2HHHJ

Crystal structure of kasugamycin bound to the 30s ribosomal subunit
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The antibiotic kasugamycin mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 2hhhJ00
4DV4J 2UU9J 4NXNJ 1HNZJ 1N33J 4JI8J 3D3CJ 4KHPJ 4LFCJ 3W1YC 5IT9U 1N36J 4K0KJ 3JAMU 4JI3J 4B3RJ 2MTLA 4KY3A 4DV2J 1FJGJ 4JI5J 4LFBJ 2E5LJ 2KVQE 4JV5J 2HHHJ 4DR1J 4DV6J 4DV7J 4LF4J 4DUYJ 4X66J 4DV1J 3J81U 5LMUJ 2UUAJ 4B3TJ 5LM7E 3T1YJ 4LF6J 4NEZA 3IMQJ 4LF8J 4DV0J 3J80U 4PWWA 4DV5J 4DUZJ 4YHHJ 5IWAJ 4HHUA 4JI2J 4DR7J 4DV3J 4RJVA 4JI1J 5BR8J 2UXBJ 1HR0J 5A2QU 4X65J 4NEYA 3R2CJ 4DR3J 1N34J 4B3MJ 2VQEJ 3R2DJ 2UXCJ 4JI7J 1XMQJ 4DR5J 2VQFJ 1IBMJ 4GKJJ 2KL8A 4KYZA 4X62J 4DR2J 2MQ8A 3OTOJ 1N32J 4JYAJ 1XNRJ 1HNWJ 4GKKJ 5AJ3J 4DR6J 4AQYJ 1IBLJ 1HNXJ 3T1HJ 4JI0J 4NXMJ 4LFAJ 4LF7J 4B3SJ 2MEWA 4JI6J 5FLXU 4V1Ak 4OX9J 4YY3J 5LMNJ 1IBKJ 1I94J 1XMOJ 2UUBJ 2ZM6J 4JI4J 4LF9J 4LF5J 3D3BJ 4DR4J 1XNQJ 2UUCJ 2F4VJ 4X64J 3J7AN 1J5EJ 2UXDJ
chains in the Genus database with same CATH superfamily
3DDIA 1RT6B 5CYMA 2R7XA 2CVIA 1HNZJ 1JLFB 3Q8UA 2PO4A 5CYJA 3LP0B 3OTDA 2VDIA 3RBZA 3LALA 1QM9A 2HW3A 4NLWA 4UUXA 1LW0B 2Z4PA 1MWQA 5E3QA 1TUVA 4OI0A 1MMDA 1G2EA 2HZVA 1NNDA 1YBUA 4CLLA 2BOAA 5E3AA 3UR3C 2SXLA 4OZLA 4IDKB 2IDLA 4QWCA 3KLFB 3JSMA 3THVA 2VKRA 3JSYA 3PFOA 4HYKA 2RUSA 2LU1A 3OFEA 1X9SA 2MQMA 3D28A 2K7JA 4GRSA 1NRKA 4EK2A 2MKKA 2V68A 5J2QB 2XSJB 3CO9A 3GIMA 4J9MA 2WHOA 3VV2B 4DBQA 1JB0C 3AJDA 3MM9B 4ZITA 2DEJA 2UUWA 4AE5A 3HT3A 4ID5A 4CTAB 2XS2A 2W4DA 2MDAA 4NXNF 1JLEA 5LM7E 2BQUA 2NPIA 1U45A 1SQFA 3BH7B 3R5CA 4RNNA 2VZ9A 2MLYA 2CPEA 1WF0A 1D0EA 3MGJA 3NWRA 3SCKE 4RBVA 4DU8A 3I9ZA 2WTFA 4ECTA 5B7WA 1U47A 5LXRA 1TFWA 1UVMA 3UDVA 2AEMA 3PHTA 1U8WA 4N77A 1QSSA 3FKBA 2G2YA 2WB1D 2UV8A 2I8EA 4HHUA 4C3KA 3CVKA 4CZCA 4RZRA 3FBBA 3HFZB 2DR5A 4WFBQ 1XMQF 1ZETA 5FJ4A 1TKDA 1SJ1A 3BBFA 1C1BA 5D77A 3RBDA 1AZSB 2DBBA 3KMQA 2FJXA 5B0GA 1UFKA 1FD8A 3PDNA 4O3NA 4PYAA 3W9JA 4H4OB 1AUSL 4Y00A 2LQJA 1U49A 1ZOTA 4ED2A 5I4MA 4FYYB 3LP0A 5B0CA 3BKUA 5E3PA 2QV6A 2YNFA 3HHLA 1RGVA 3MPWA 1M5HA 1XMQJ 1HNIB 2HBYB 4F2RA 1N32F 2W2QP 4YOEA 1QUPA 3KK3B 3EGWB 1ZM4A 1IN0A 3HJVA 3GP9A 3QO9A 4K5RA 3RAMA 4ES1A 5BYSA 2W9BB 3AHPA 8ATCB 1RUSA 2LFVA 2VC1A 3M2RA 5BJRA 3CJRA 1R6VA 2PSZA 3SDEB 5KG7A 3ITHA 1S97A 2BMBA 1VQPS 1YJUA 4NPOA 4KV8B 5DDRC 1C1CB 1ZAXA 2OPQA 5A8KB 1S72S 1EIYB 1GXLA 3D54A 2AJ0A 3FJ2A 3VQSA 5M2PA 3K2YA 3T6BA 3T1HJ 1HNXJ 2VOPA 3KNGA 4JI0J 5FDLA 3R3TA 1RE1B 1UVNA 4J9KA 3B82A 3EPGA 4FVCA 2OP5A 3DI6B 2F4FA 4YB6A 4TNOA 4CO1A 3NBPA 4DV6F 1KP6A 2FD2A 3D6FB 4OJ3A 1W2IA 5IOLA 4CO2A 2QEXS 1M5SA 1IBMF 1EKRA 4FDFA 4ED6A 1XWLA 2AF6A 3M9OB 5IQ6A 3CD5A 1CC8A 2V69A 3TWZA 4F36A 1QY7A 3EGVA 1XR7A 1RHQB 1FVSA 1G6BA 1NEEA 2JFKA 1BQMB 2R2RA 4DSLA 2Z2LA 1CPZA 1GMWA 3E01B 2U2FA 1VISA 3I5CA 4O44B 2XLJA 4BCAA 2QJ3A 3WIVA 4ELVA 1H3DA 1N48A 3J7YI 1S79A 4YB1P 3MUMP 4EBCA 4YDDB 1LV5A 4LUBA 5MAOA 2VD3A 5CQGA 1HPZA 2HQFA 3BGLA 3VHQA 5IV3A 5L1IA 4IQMA 4DF4A 3DKDA 1K0TA 3OD2A 3TANA 2GGPA 3HHLD 5KFUA 3M8RA 3MECB 4PKDB 1U1PA 2O1PA 3D3CJ 3ELHA 1TKTA 2R9LA 1MN7A 2IPOB 5HMYA 2WCXA 4RW7A 4F4AA 2ZBQA 1H7XA 4LT6A 4BWMA 3HVWA 4A48A 4C7QA 2MGZB 3LPEA 4DOZA 5DM6Q 2XO7A 3VGVA 2B56A 5L39A 3AFGA 2QL7B 4IH6A 5M2UA 1VQLS 4JV1A 2LA4A 3D6HB 2ZBPA 2CDRB 2G1HA 2CJAA 3DGVA 4IFYA 5CHCB 1YIJS 1RTDA 2V9WA 3MUVP 1F9HA 3GE9A 3FSXA 5IXUA 5DDPC 1A6LA 3LQVA 2EC0A 2WW4A 4F4WA 3D4JA 3O3LA 4MIAA 2ILYA 4K4UA 2YKAA 2EG1A 3VGTA 1U1RA 1CULA 3ISNC 1RU1A 5A8WA 4CT8A 2RE1A 1EKSA 3SSSA 1RTDB 4B3SF 1OQ6A 3IBCB 4LVOP 2CPZA 5KT6A 1U1NA 4R5PA 3LOUA 2IFXA 5A8RB 2CVEA 4UF4A 5T7LA 4F02A 3H7HB 3IWLA 3LANA 2DPIA 1HMVA 2UXDF 1R27B 3B6BA 3CDWA 3RAQA 4KFBA 1KFDA 4X4NA 1WDTA 2IBOA 1FT8A 3R7NB 3NCPA 2LQ8A 3MEGB 4R0JA 4EO6A 3L7UA 4ID8A 5HO4A 3K17A 2JZ5A 3NEKA 1QVFR 1CJTB 2HWIA 3BR8A 2GO8A 4PWDA 4L6V3 4MK8A 2B4UA 3H2UB 3I9V9 3GV7B 2O67A 2FZKB 1KKHA 2HRUA 4QWBA 3WHIA 5KT3A 2V94A 2NREA 1DY3A 2HZAA 1WD6A 3L95X 3TZYA 2QL5B 4C4WA 4RUCA 3HX9A 3R8YA 4JI1J 2RU3A 4LSNB 2ZDOA 4H4KA 1RKIA 2R7QA 3QRPA 1LNQA 2A2CA 2CG4A 2F8EX 4M5MA 5JMNA 3OLBA 1MROA 4PG5A 3M05A 1EETB 2FGOA 5I3UB 5AE1A 1YJRA 2LYVA 1C0TA 1S77D 1QJHA 4PXCA 4RW9A 1H2VZ 1NHUA 2C2NA 2YKPA 2AQ4A 1SH0A 4CP5A 1Y00A 2B9XA 1U1QA 1QAJA 2V4JB 3W2VB 3OUYA 1WF2A 4NLQA 2YBVA 3DHXA 3R2DJ 1UL3A 2ZVIA 2ALZA 1AZSA 2AWZA 4JI4F 3KKFA 1BWVA 1T7PA 3GYXB 3OR2B 4F4ZA 5HP1B 2VA2A 2MZQA 2QMWA 1H2UX 3A8IA 3IM8A 4IG3B 1O0PA 1NMEB 2YWGA 1K0VA 2NXNA 4F26A 5HMZA 1X31C 3IXQA 1T05A 3GWCA 2MQ8A 3GJTB 3EJMA 4EWTA 4DZ6A 3R2CJ 5KTQA 3HKWA 4CLKA 2RUGA 1NK0A 4RU2A 2GMHA 4N56A 1TMMA 5F41A 4C0OC 1ZAWA 1ZS6A 3QPIA 5CAAA 1SKWA 1ZH5A 5KFAA 4OLOA 2IAJA 3HVAA 3UE2A 2QO3A 2AMCB 3LAKA 1UA0A 1YRUA 5ETOA 3QWUA 4F8RA 1DRZA 1LXNA 4JI6J 4UY85 4HKQA 1PCAA 1EP4B 3OXGA 2VFRA 1HNZF 1FDNA 5D78A 1M90T 4NASA 2E5LF 3CE8A 2AD9A 3PW4A 2BJ3A 1DAXA 2YWEA 2YNFB 4UQGA 1VC6A 2QIFA 4NA1A 4USMA 3SFUA 1X4BA 1CJVA 3MM6A 2C22A 1JIHA 4OLPA 1U24A 2DK2A 3G8SA 5KT5A 1RAIB 1K8AT 2D3UA 1RBAA 4HHHA 2H65B 4YS2A 2XS5A 2YKMA 4P74A 1KEKA 2FJAB 4XPEA 1TK5A 1VOMA 5K9FA 4DPUA 2R8KA 3CEDA 1OY6A 4QR2A 2OTJS 4HVZA 3NL0A 1XBWA 2ASYA 3DMJB 3FEZA 3GZ7A 2ACMA 4DFPA 4DL6A 4QYZK 1RHRB 4O3QA 3M32A 3I0SB 3DLHA 2V8VA 1OYDA 2FHMA 1O5JA 1MWYA 2WSFC 4P10A 3W1YC 1TL3B 2X1FA 4JI0F 2PI4A 4PABA 5CABA 2BR0A 2FVQA 3BN4A 2EBEA 2R7OA 3VVTA 3WIUA 3MD3A 3DFEA 3IN5A 3R5DA 2OJ3A 4DR4F 3QLHA 4AXJA 4DHVA 3CJ2A 5DLGA 2ZJRQ 5I3QA 2XZWA 4K59A 2G0IA 2DNLA 1HQUA 3DU6A 4BC9A 2O66A 2CQ4A 2RKIA 3M8YA 1V9OA 5ETPA 5KFIA 4X84A 3P96A 4ZVTB 4OZ0A 1SUQA 3ZTRA 5C25A 2JOQA 4DU7A 1D9AA 3M8QA 1XERA 4Y34A 1B70B 3MZIA 3MMAB 2N3OA 1NSAA 1T03B 1C1CA 3NAHA 2E5LJ 5AT1B 1DARA 2Q43A 4ZCLA 4ECXA 2RDDA 1NO8A 2VG6B 2WOMB 1J5OB 4FN5A 1X4AA 4CT9A 4RWWA 4N76A 1RABB 3NCRA 4L72B 1JLCB 2MZJA 3FUYA 3VQTA 3ZXWA 3DLJA 3BV8A 2R8GA 2OPRB 2XHWA 3LGHA 2XSFA 3DRRB 2HHHF 2UUAJ 2DCLA 1RA6A 5CYQA 3CXCR 3GQCA 4H4KC 4JP8A 5GMKa 2ZKTA 4CCHA 2HKEA 4O4RA 5GADU 4FS1A 3LPYA 4J5OA 3HULA 4AYBD 3BPDA 4DV5J 2CFXA 5HQLA 3RG6A 2LU2A 4FYVB 1R31A 1YRXA 2AJ4A 2AZ1A 3DHWC 4KC5A 3PW0A 1CS4B 1SIWB 2UV8G 4X4VA 4I2PA 4QJVA 4NLSA 3UVJA 5HMWA 4G1IA 2BJ1A 4NA3A 5F3TA 1PAUB 4U7CA 3CCTA 4DS5A 4A8MP 2IA6A 5HMXA 4IOAQ 2A18A 4N8NA 4TKTA 3T19A 5M2RA 2EFOA 4Y2KA 1H72C 1R0BG 2V2VA 4IH7A 1PO6A 3VVUA 3WC2A 3ZZ0A 5LSLA 2V4QA 1IBCB 3CD0A 4RW6B 2OPPB 1N34J 2QLWA 3TAPA 2QL9B 2VFSA 3DOLA 5C7PA 5F8LA 3W7BA 4R5PB 2WB4A 2PEHA 1YQHA 2CJBA 3RR8A 4UZCA 2L41A 3KK2A 4AFFA 4QR0A 4CO3A 5C42B 5L1JA 1NJYA 2HLTA 2DVIA 4DQIA 1DTTB 3C6UB 4CO4A 1VIXA 4ICLB 1D1UA 2OMLA 4R8UA 3QLHB 2KRBA 2QZ8A 2VBYA 1RBOB 4M5DB 5GADI 4NLGA 1A9NB 2PI5A 4BDPA 2B51A 2HHTA 5H9EK 3LP2B 4I1TA 4TY8A 2I6WA 3UN2A 3ZTSA 4KHRA 1KRPA 1WG4A 2RVJA 1DTTA 3JTOA 3DOMB 2JC1A 1M5PC 4NXMF 2WVEA 5DGBA 4K50A 5FLXY 4A46A 1S7IA 4Z37A 1SB6A 1WHXA 1PJ7A 3RU0A 3BBBA 4GKKF 2FYXA 2HVEA 3RB0A 2HPUA 4KH0B 4DLEA 2DITA 4CLZA 3HCXA 4X4TA 1SJFA 5I42A 4RW6A 3TAQA 2MKYA 5K14B 1YBAA 3QT5A 3U27A 1IBKJ 2F65A 3OW2R 1P6TA 1Y3KA 3BQ2A 1I94J 3K0JA 1HYSB 4I7FB 2GW8A 3MTJA 2IC3B 1VQ4S 1NJIT 4J9QA 2ZM6J 2ROPA 2OTLS 3U02A 1C2PA 4F67A 1RT5B 3EXYA 3GIJA 3AQPA 3M30A 2G2ZA 4RU9A 1PBUA 1VRQC 2H5EA 3R27A 4Q7AA 2R7VA 1R0AB 3THTA 3IRXA 2XB2D 2X1GA 2RILA 1NJWA 4DDFA 2W8LA 4I2QA 3CCRS 1IQTA 4V19X 4DV4J 1P9YA 3ZNUA 3FCVA 3KHGA 1U0SA 4UOGA 4G1PA 1WTBA 3OL9A 2CAJA 4ZMMA 3FFIB 5B0BA 5IT9U 4B02A 1LFWA 4EYIB 2Z2MA 4F4YA 2ZWOA 4QIVA 2LXIA 3J81j 4CRJA 1UFWA 3E3XA 1D9FA 3QIPB 4NLPA 1NKBA 3VAJA 1A0OB 3O1LA 4KH1B 1SIZA 2V9KA 4DQRA 1NB2A 5D0HA 1N4LA 4O3OA 3P8BB 4ANDA 1NSPA 1TL3A 3GONA 5K5MA 1EB0A 2RRAA 2ZH1A 5IV4A 4RUBA 3CDAA 4CWBA 3O2IA 4WYLA 1FKPB 1HIYA 5J2NA 2B8QA 2GC8A 1PILA 2P9CA 4HDHA 2F40A 5CZVA 3UI3A 1CJKB 2VICA 4RW9B 4USHA 1KONA 2DH7A 2OPSB 3A8JA 1I6JA 3TZXA 2GQCA 4ZIVA 2R2SA 2EEYA 4ZVQB 1S9GB 2M9KA 5A6WA 3ULHA 4CNZA 3PV8A 2Y8WA 1PG5B 1RWWB 2B6AA 1GFWB 2YH0A 4ZDNA 4LF6J 1XN9A 2W2MP 3AA8A 3E8OA 3NGTA 1FTCA 2PDAA 1JNRB 1Y7PA 1YGYA 4I56A 3W8GA 4UT4A 3CMES 1XNQF 2EKNA 2HFUA 1U4BA 1SQGA 2BVZA 3QRQA 2W2NP 4K2XA 2XMAA 1JLGB 4I64A 3NS7B 3HZGA 1Q86T 4Q44A 2FUG9 1QAXA 4ZOSA 4OYPA 4ECWA 4DL2A 2UUBF 1RHKB 1IVZA 4ED8A 2GJFA 2IAJB 2RMLA 4Q2MA 5F8IA 2HK3A 2XWXA 3VTIA 3GPAA 4FXWA 4OI6A 1RCXB 2GHPA 2BXJA 3TZWA 4EMDA 3NKYA 1YJVA 2CKWA 4HTJA 3MR5A 2R7WA 1I51B 1KD1T 4FKYA 3DDNA 2FPHX 2UUCF 2J76E 3B4MA 1VQ9S 1HBNA 1VQOS 2UUAF 2EI5A 3CJKB 2LDYA 1VK8A 2RSQA 3FVYA 1FERA 4IKAA 4DF8A 3S8SA 4JV5F 2YWFA 2BJEA 3CSKA 1IBKF 5LMNF 4DUTA 1CVJA 3HXMA 2V2KA 4NZ6A 3QJJA 4EZ6A 1FX4A 2MHEA 2MZSA 5B09A 2PA8D 2FVRA 4U7UD 3DRPA 3OR2A 3J81Y 5D4LA 3TEHB 2XMMA 3PHEA 4NA2A 4YR0A 3KK1B 2FVSA 5C5JA 2WVFA 3HHLC 2COLA 4KO0B 3EICA 3SDEA 3AQOA 1F5CA 5CXTA 4M5NA 2HMIB 4FPIA 1QD1A 3NXZA 3MFHA 3OTBA 3QWPA 1SL1A 3N6NA 3TUPA 4LJMA 1VK3A 3MM6B 4WZQA 3HSGA 1CSJA 2GO9A 1KHVA 1ZM9A 5LMNJ 2RF2B 3F0NA 4HHJA 1DZ5A 2R2TA 3NNCA 1MLAA 2IRYA 5HL7Q 1WC3A 4G3IA 1FXRA 2MKHA 2QLFB 4YEAA 4A47A 4ECYA 5L1KA 2AKWB 4TQRA 3PX4A 1YTYA 1CJUA 1REVB 1JK9B 1SKUB 4IFVA 1JLFA 2DY9A 1CG2A 4Y6IA 2PD1A 2KB2A 1E6VB 3TVYA 4CI0B 2X3GA 1VJWA 2QMXA 4DN0A 2F8MA 1O51A 3CJ0A 4H4MB 3GG1A 3MUTP 4HI1A 2C2KB 4UW2A 1MSWD 2CXEA 1Q7YT 3ISND 1YJTA 4DV1F 1R43A 3CJ3A 3G82B 5JXSA 2QA4G 1RAFB 2CIMA 3OVAA 2GVZB 1OSCA 3AOBA 4N8OA 2IM2A 2KFZA 2HBRB 5H9FJ 4C0HA 1KR4A 1MMLA 3RBEA 2N7YA 3CJKA 3CW2C 4PEOA 1HNVB 3QFHA 1V3RA 3MMCB 2R8JA 4JI5F 1T9YA 4BHQA 4KSEB 4QPXA 2MTLA 4TN2A 3FFIA 4F3QA 1F0XA 3R5JB 4OZ5A 4PG8A 5B0DA 1ZTTA 1YI2S 1FESA 2JNJA 2AYBA 1X60A 2C3YA 2YTCA 4OYXA 3ZTQA 1R6YA 2XMKA 4EYHB 2M4MA 2KVQE 1S9EA 1RXOB 2LKZA 2HQGA 1MG7A 2QC3A 3FK4A 5LMUF 4KBIA 1Q5YA 4LSLA 3HVRA 4LQ3A 1XK8A 3MEEB 2FJDB 3CCUS 2XHCA 3BO2A 3KDOA 2IVFB 1BXNA 3IGVA 2CYYA 2FLNA 3N0VA 1S1VA 4WFZA 3POTB 4NLUA 3KK2B 3CJQA 2RQCA 2CG8A 3SQGB 2JEIA 3ENVA 1PJ6A 4NRUA 1LK5A 1FRKA 2V34A 3PG9A 3OHAA 4FXDA 1JXEA 4J9PA 4X62F 4LBHA 3BQ0A 1N0VC 1WHYA 1MN9A 1R8PA 2WRMA 4YQWA 1UWBB 2E5JA 1ULRA 4ZHRB 2NXCA 2JLGA 3KWMA 3M8SA 2D9PA 3MF5A 3G6YA 4N41A 2K1RA 4WE1B 2CA9A 1E6YB 4JI2F 1RT5A 1DLOB 1MW7A 1WC1A 2CNNB 5E0OA 5DG8A 1F6TA 2OSQA 3I82A 5L9NA 2NZCA 2K7KA 5IT9Y 2F1FA 1X4CA 4B9TA 4NZ7A 3CCES 3ZZZA 4OX9F 1FWLA 2ZEJA 1JNZB 3DXSX 3IR6B 2DR9A 1G1XA 1KN6A 4FS2A 2FVPA 2QYCA 1S1XB 1YZ7A 5K14A 3GILA 4JOUA 5H9EJ 1HNXF 3AH6A 2V50A 1RDRA 2PA3A 2WVDA 1FDAA 1S1VB 4IH5A 3IS9B 5DQIA 3AD8C 2ATCB 2RRNA 2W9CA 3UFCX 4EFAC 3VF0B 3H25A 2IA0A 3CCZA 3SIPB 4GKJJ 2E1RA 2OPQB 1GNKA 3RB3A 2ZDPA 4URSA 3OLAA 2XSJA 2PMWA 2Q66A 4DR2J 4WFXA 3W61A 4ED4A 4O0NA 2RS8A 2B43A 1L3SA 1IWGA 1N32J 4I2QB 4DR5F 1BLUA 3N5FA 2UVVA 1HNWJ 5KFJA 1EARA 1Q8LA 3GV8B 4URGA 3M2RB 2VASA 2B0GA 5E41A 2VF3A 4DV0F 4ELUA 2J0XA 5G4DA 5CZXA 3TR5A 2LXFA 1KDNA 3M6UA 3MPUB 2CQ0A 1VC0A 3HD1A 3N6LA 4YDXA 1ZA2B 2L48A 2MEWA 2JL9A 3C6TA 4KIAA 4OX9J 2Y1IA 2IYGA 5FIIA 3I56S 3BSCA 4G1QB 3TA1A 5J1PA 4OI2A 2L9WA 1GXTA 2IVMA 1CC7A 1S6QA 3MOJB 3MAHA 2I0XA 4JI7F 3ADAC 2AT1B 3C6TB 1RT6A 1X7VA 1EP4A 1FRJA 1RYSA 2LXUA 4E8UA 3CCWA 4ZHRA 3ILLA 4DSFA 3NGSA 4IRKA 3MCNA 1IKVA 3LP1B 2F4VJ 4I7FA 4ID5B 4K8RA 3DU5A 1O6XA 2XGQA 1N56A 2UU9J 1R7IA 2MYFA 1BUXA 2HVIA 1IKWA 2RHQB 2ROGA 4TXSA 1Y5NB 3G6ES 4I69A 2V8HA 4FF2A 1VLOA 1FF2A 3V81B 2KFNA 1R3NA 1U1MA 2MSSA 3MR3A 1RAAB 4PG6A 2BM0A 5KFXA 1JLBB 3CJ8A 3QBCA 3OR1A 3FDSA 3S6EA 1WC4A 5A6PA 2CADA 2V63A 3G9CA 4OYAA 3ZZYA 2B4PA 5DRKA 4CLUA 3DLEA 1FE4A 2APOA 5B0FA 4X4QA 3FBFA 2CQBA 4ZP9A 2MXYA 1FKAF 3BSOA 2VOOA 3SCJE 1W26A 4OHWA 1VLYA 4YR2A 1IJFB 4LF4J 2ZNZA 3TP2A 4B9MA 2HHVA 4N47A 3CCLS 4XDDA 2IMWP 2R8HA 1FKOA 4L75A 1YZ6A 1VIOA 3JYTB 1VBYA 2E9TA 5B0AA 5EX0A 4TYBA 1SCJB 3R5GA 4HH1A 3G8QA 2MMYA 4MT1A 4XDCA 1HWJA 4F7VA 1JMTA 1IR2A 1VBZA 3DGPB 4DUZJ 1RBLA 1B0TA 1N33F 2XYHB 4IFVB 1WWHA 2VHGA 4DV3J 4EGLA 3PR4A 3QZ7A 2DR8A 1VHIA 1WOSA 5G0RA 1WEZA 1S99A 1MU2A 5K20B 1R8HA 5JVGQ 4J9LA 3EVMA 1T03A 2W01A 4KKOB 3C2PA 4F0HA 4F04B 4X65J 2OD4A 1F2HA 2C1EB 3PJ9A 4MMOA 3LWLA 2ZJQQ 1S7HA 2ZHBA 4ICLA 1PGZA 2JH3A 4QCLA 4PPDA 4C11B 5BYRA 3GSIA 1RWKB 2AX0A 3NGUA 3TA0A 4IG3A 4A8KA 3OJUA 5KG4A 2XY5A 7FDRA 2CQ3A 2IYIA 1XEZA 3D1QA 2DGVA 3NGKA 5LXYA 2VQFJ 2OPPA 2XMWA 3BBCA 3TX8A 1T94A 4NLOA 2LECA 4ZVPB 3TVKA 3IM9A 1HBNB 4KYZA 1G3OA 3KTQA 1PKUA 2MHNA 3QQCD 3TI0A 2IHR1 3MCSA 3BB5A 4NI2B 4HACA 5KFHA 3PRDA 1RT3A 5AXKA 1VQKS 4ZPTR 3R5AA 1R8BA 4DR6J 2D69A 2VQEF 5EUHA 7AT1B 4MIWA 2D1CA 2W1BA 1WORA 1T9VA 2KKHA 2QE5A 5KFYA 5F8MA 2BQ3A 2AGPA 1NK9A 3AB4B 3GJSB 4LF7J 2R7SA 4U7UK 1NK5A 1NJZA 3J7ZT 1OWXA 1X0PA 4MK9A 4ZPAA 4RW8B 2K2PA 3MMBB 4M5HA 4ZLJA 3PJXA 3MAQA 5F0WA 1SH2A 2DHAA 1RWVB 3UR0A 4PWDB 4ETZA 1VR6A 2JJ4D 1UWAA 1JXVA 2CWXA 2I5JA 2YKMB 2KT2A 4P2XA 3PX0A 2J7UA 4ZVFA 1VQMS 4OL8A 1OPIA 3GFZA 3ISZA 3K5OA 5DJBA 4I0WA 3TUJC 1WKLA 4DG1A 2A6OA 4DV5F 2VPWB 3A8EA 2M52A 1WEXA 1QSLA 1XNQJ 1FI4A 2ZZMA 4ED1A 5HBMA 1U0HA 3PX6A 1YJWS 2IJNA 2IC3A 4KHPF 3VZHA 2M2BA 2J8SA 1V3SA 1OY8A 2NSCA 2E44A 4DPYA 5KAKA 1S4FA 1AW0A 5HROB 2ZJPQ 2R4FA 4JI1F 4MFBB 3HLUA 3UNYA 1NAQA 3M9MB 4LFCJ 2QA1A 2ZH6A 1U1OA 5KFMA 3BGFA 4IQXA 1A7GE 1S59A 2KVIA 2QT7A 2XZDB 1YX2A 1S76D 4O0IA 3WZ0A 4UUWA 4C0BA 5K8MA 4HTIA 4B3RJ 3VGSA 5DG7A 3Q83A 5KG6A 4YMEA 4C97A 1DQ9A 4IG0B 4RW4A 4F25A 3DCAA 4QU7A 3H90A 2UVUA 3BEGB 1X9MA 2WBMA 3EM1A 4F3OA 1RTJB 4LQ9A 4QIWD 2D3O1 5K8OA 2Z58B 4CQ1A 4AL7A 4LVNP 3U1NA 3AD7C 3ENWA 3QAEA 6AT1B 3C15B 3CDBA 4ANEA 3QZ8A 2WK4A 4LRDA 4IO9Q 1FJGF 4U95A 2M0GB 2ERRA 1U6ZA 7FD1A 1NUEA 3EVWA 3J81U 1N5TA 4PXEA 2GMLA 2ZFHA 3I32A 3H40A 2FLPA 4B3TJ 2HURA 1F2GA 2HLUA 2VPZB 4K4VA 2HNDA 2V0NA 2QG9B 2BYCA 1YSJA 2XCPA 3V6HA 1Q53A 4WJBA 2EVZA 4J9RA 4C3LA 4LSNA 1FFGB 4FBUA 1S9GA 1LOUA 3ZFVA 1C1BB 2HRYA 3LA0A 2H4YB 2B6AB 2X3DA 3EUNA 3FC9A 1JJ2R 2DYAA 1SI9A 5DGAA 1HI0P 2QA4S 1TAQA 1WHVA 4W90B 3FEXB 2CQDA 4M5IA 3BZQA 3EZUA 5KFOA 1X9WA 1HBUA 1TELA 2XTJP 3O44A 2RDIA 4PWUA 2X1BA 2ZH4A 1NH7A 3U7JA 2XI2A 5D0RA 2HHQA 1C0UA 1S1UA 3IAM9 6FD1A 3LUYA 3UCGA 3W9IA 3Q8VA 3K57A 2DXDA 1S1TA 2W7OA 2RS2A 4GVBB 2N4CA 3GFHA 4P52A 5HP1A 2C2DA 4PQAA 1TQLA 4R8UB 2H9ZA 1FNXH 4MYTA 3F41A 3GB0A 3ITHB 3BQ1A 5THWA 3UDLA 1SH3A 3SI8A 1NSKL 3OTOF 5DDQC 3MFIA 4CM0A 2AGQA 4U96A 2XMJA 3F73A 3H5XA 5AE2A 4C8YA 3BPSP 3IC1A 3CIMA 1LWEA 4KB7A 2OFHX 3ONQA 1RSCA 3KFWX 2CPDA 2G9OA 3FQLA 4P2SA 1UFLA 1RHMB 1WI6A 4DL4A 4I4BA 4KHMA 4PQUA 1G7CB 3KDNA 4JV2A 2N7CA 3K5NA 4EBDA 4XO0A 3T5LA 2JVOA 3DMJA 1FDBA 3D7SB 3M4XA 3R7BB 3ET6B 1Q8IA 3NLCA 4LRAA 5SUHA 2AU0A 3DLBA 1P8GA 4LFAJ 1FEEA 4HACB 2KRRA 5U47A 1HL6A 2C2EA 1KWMA 1S0VA 3ZZRA 2GAGC 2HFOA 3W2WB 1CJUB 2ZBCA 3G6XA 1GX5A 4OV1A 1NZAA 2DXEA 1XMOJ 3M1VB 2FY8A 2W7AA 1U48A 2VA3A 1OMSA 3NS5A 2GVDA 1VHFA 4A8WA 3FSIA 4NCGA 3RR7A 1ACMB 3JAMY 4ECZA 1Z1ZA 2OAUA 2CZ9A 2HS0A 4B3RF 5IT0A 1WACA 2UZAA 4LF5J 2B5JB 4MAKA 2CPXA 4I6YA 4OYZA 4ITSA 2KZMA 3GR0A 3K8VA 3AJ1A 4O23A 5GAGI 5L9XA 3V4IB 4HL9A 4DN9A 3Q8YA 2POKA 1EX8A 3CO0P 4OJGA 2FHKA 1I94F 3DRSA 4PG4A 3QIPA 1YLXA 4QQBA 2IY5B 2QSFA 2RKIB 3UW1A 1HQUB 2GX8A 5FDLB 3TA2A 1SJ3P 3OXFA 5C25B 3VAIA 3H2LA 3PEHA 1HNIA 3T9ZA 1ZYQA 1N36J 3GJQB 2OFGX 4JI3J 4K0KJ 1FEHA 1F5BA 1ZZNA 2FQQB 1LWCB 1NJXA 1SQEA 2VG6A 2WOMA 2GGPB 3HZEA 3PYFA 1IKWB 4URQU 1J5OA 1WJ9A 1SL2A 1HWKA 1L3VA 1XNRF 1EZZB 1PYOB 4DV2J 2HQDA 4USVA 3FQKA 4OIXA 1BQNA 1U2FA 3NGDA 3ZZTA 4F50A 3W63A 2A1BA 3CMQA 4W4MA 4DS4A 1V6HA 1Q16B 4NLXA 2V4RA 4JV5J 5C24A 4FF4A 4HT5A 3E01A 4CNYA 3W3SA 1DTQB 3Q8PB 2V2ZA 1WTFA 1E6VA 1GEHA 4OX6A 3IRWP 1RLDA 2Q6CA 4DQSA 4DFKA 3CC7S 4NOHA 3ZO7A 4C98A 3JSRA 2UU9F 3DLGB 3NS6A 1CS4A 4F3MA 2L3MA 5EDWA 1VC5A 4M94A 1XTZA 2LVWA 2OEJA 3NBPB 1KS2A 1Y10A 4RW8A 4A8YA 2WONA 1S10A 4OZ1A 1GXUA 2P9GA 4DR2F 1Q4RA 3DRRA 5E3CA 1K9MT 3TAMB 1LQ9A 1U26A 4PQUB 2K8GA 3UD4P 3MD1A 3QGGA 3HVTB 4JI3F 1N36F 4KFBB 2V2QA 3TYTA 4NCAA 3CT9A 3IP0A 4IYQA 4KV8A 3IFEA 4WWSA 4KTQA 2VUGA 4B9NA 1QE1A 1BC6A 5KFSA 2J9DA 2M3DA 2RQKA 1S12A 3OL6A 3Q24A 1HR0J 4EZ9A 3MPYA 3G71S 1LEOA 4Q2LA 2IDEA 1CULB 2BM1A 1JLAB 2RHSB 1AA1B 3HD2A 4Q0BB 3WBZA 2HHXA 4WIIA 5A8RA 4DR6F 3CC4S 1VS3A 4CDIA 1Y5IB 1YBTA 4OI1A 4MIBA 3UD3P 3G6VA 4FYWB 2P8IA 1S1XA 4CYUB 1I3OB 1Q0NA 2CPYA 1RISA 2EW9A 2FIUA 2RIJA 2XYPB 2KL8A 4MK7A 2A2DA 4DPWA 3BYPA 1ZPVA 2FC8A 2IJFA 3W5XA 2KXHA 1VQYA 1UP1A 3D5MA 1MWZA 3PR5B 3AJ2A 2NUHA 1XNRJ 2HRTA 3PYEA 2HGMA 2RAQA 5J1EB 2YX4A 3NOGA 5J1NA 3G8TA 3LWMA 4EBEA 4LFAF 4ZS6A 4ZLPA 3T1YF 5HLFA 4RLEA 3HK2A 2HHSA 4OJHA 1N52B 1F5AA 4FZVA 3TQEA 1TUGB 4LSLB 4OHXA 5JVHQ 3BGUA 3AA9A 4OHYA 4JYAJ 5DZ6A 1IQZA 3DDKA 5GAHU 4X65F 1RT3B 3UDCA 4ED3A 5KFNA 5K8NA 3KLHA 4MKYA 2GV1A 5DETA 3N5BA 3VAKA 1BQMA 1OO0B 2ABYA 2VDHA 4ZP7A 3RW7A 2MZTA 3SQGA 1L3KA 3QNWB 5CA5A 1PC5A 3CTRA 2DY1A 4S0MA 3CB4A 2ZD1B 2HQIA 4MH8A 5D0EA 1NK7A 3FEYB 4HDGA 2YNGB 5A0YB 1WOOA 3D66A 3C15A 1RHUB 2VFUA 2YNIB 3M2VA 2N4DA 4QPTA 4ZLLA 3L3CA 2OPSA 2ZM6F 4DR3F 2ZBIA 4USJC 3SBMA 2PFFB 3W62A 1RT2B 3KUEA 4ES2A 1L3TA 3QT7A 1HI1A 3U1MA 1HBUB 4FP9A 4WK3A 5BYQA 3RRGA 4OHZA 3CF5Q 2E9ZA 3MM7B 1HMVB 2B9WA 3T5JA 2C2MB 3MMCA 4D3GA 2FHJA 1T11A 1WNEA 3L4BC 2DO0A 3E51A 5A2QY 3HHKA 3QATA 1RZMA 5CCMA 3TARA 2HWHA 4ZPCA 3W5ZA 3BR9A 2NYIA 4YB7A 1NPPA 2IRXA 3ICLA 4R0EA 3OT9A 4FNIA 3PKYA 2XG8A 5HROA 4NLDA 4JV0A 1NBEB 3QMQA 3MM8A 2CJ9A 4KY3A 4DCPB 5D8HB 4RR5A 1VQ7S 3KLGA 3EX7B 3BM7A 1TV6A 1TK0A 5A0YA 1D3WA 4H54A 3JYTA 5I3UA 2B8PA 3QSIA 3SSQA 4YY3F 3PACA 4DV6J 5IC4B 1EQMA 1JJHA 1X5TA 2HMIA 1Y3JA 2DNYA 2K3KA 4Q43A 2DIVA 4ZCIA 1B0PA 1RHJB 5HLFB 2D9OA 4Z7CA 2GFFA 3GCXP 5KFPA 1JLGA 4UTGA 2IVYA 4WU3A 2QLXA 3M9NB 2C3PA 4ECQA 3T1YJ 3UWTA 3W9HA 3UVJB 1LFPA 2D7SA 2DH9A 2QFIA 2RH3A 4ANCA 4K4WA 1NDPA 2DNZA 3MEEA 1TKXB 3HHDA 5BXIA 2JX2A 4LMZA 2ASLA 3SXLA 4LF8J 3AB2B 3RTVA 3CCSS 4Y2CA 4CH0S 3A4TA 4YHHJ 2CQPA 2FJVA 2ZZNA 5ETSA 3THPA 4XPCA 3JB9k 1HBOA 4PXDA 3UQSA 1RYRA 2AJFE 1S1WB 1BWEA 1SC4B 5AXMA 3M8PA 3QFWA 2WZ1A 4CH7A 2F3JA 1SUQB 1RWOB 2KT5A 4RJVA 1FWPA 5HVFA 5EX3A 3RUBL 4J91A 1GMWD 3KLEB 1HWLA 2FHJD 2OELA 2DNPA 1NPKA 1KTQA 2VG7B 4M5JA 5G0RB 5FD1A 3MOZA 3GYGA 2J9EA 1Y4ZB 2W9BA 2VU5A 4P9SA 4TLQA 2KU7A 2R8IA 1NK6A 2CJQA 3AY0A 2F5GA 1S4EA 3M32B 4KGMA 2GAHC 3L7PA 4KAIA 4M63A 3M2UB 4DXLA 2HHPA 5JJBA 2WBRA 3AODA 3MWBA 1HA1A 2KM8C 2NUUG 2YXLA 3GJRB 5KFFA 2GJIA 1UA1A 1Q5VA 4KR0B 4ECUA 5L46A 4ELTA 2WONB 1CQNA 2OHDA 5DDOC 2JRSA 1RT7B 2ZHAA 1LWFB 1TL7B 2EC2A 5HJXA 2J5AA 2MLZA 2YY3A 4JI6F 2A10A 4DCOB 2E1CA 3NMAA 4F4XA 1RA7A 2H51B 2CJKA 3KK3A 4GKKJ 3KUGA 1Z2ZA 4RPFA 3CJ4A 2FC9A 5C24B 4Q8FA 1HNWF 3H0PA 1YG0A 4USTA 3W60A 1YRTA 1S9FA 2IIHA 4K4YA 1U6BA 2E5HA 1WG5A 4CLFA 4KGVB 5KFTA 1M1HA 4V1Ak 1RTIB 1X4DA 4QIGA 3PO5A 2JLEA 1N88A 2DGQA 3LGMA 3CDEA 2Z56B 1QAYA 1T9UA 1MMNA 4UOHA 3C14A 2WSEC 4ZVRB 3C19A 3MAAA 1JLQA 1F3VA 4EO8A 1VYAA 4QW9A 1JWWA 3HP6A 4Y2AA 2OH2A 4OHVA 3AXMA 1T3OA 2EWHA 1W7WA 1NZ8A 2C28A 3SQOP 1N34F 4USWA 2BJ9A 3SMZA 1VQNS 3LP2A 1RTHB 1S6OA 4TY8B 4OZ2A 1J5EJ 1AFIA 2YNGA 2DHSA 4OX8A 3C8YA 4J7CA 4BBYA 3TO8A 2K3IA 3PIOQ 2UP1A 4UZBA 1IUJA 2W7PA 3P5TL 4AT1B 1U25A 2W2OP 3IRXB 2IM1A 4PRFA 1TTHB 4WFAQ 4C11A 4RNFA 2XZTB 4ZN1A 1NPRA 1BQXA 1S6PA 3D68A 1PC4A 2DT9A 2X7IA 3Q23A 1UWBA 3HO1A 3X1LB 3TJ8A 4WFYA 8RUCA 3KG1A 1RCOB 3QJPA 2RB7A 3PKMA 4ILMA 2HZCA 2PFDA 2DR7A 1HYSA 2E1MC 2VG5B 4E2FB 2HK2A 2ILZA 4OI4A 1SJRA 5F9NA 1VGYA 4WF9Q 4JB8B 3PYDA 1YWXA 2J0WA 3POTA 4HT7A 1PYTA 4IDKA 4ZP6A 3JSMB 3NP5A 4DR1J 2D74B 2HHHJ 4ZVOB 3ILIA 2JFDA 1IKYB 4GVLA 1PJ5A 2I38A 3G2XA 3MEGA 4DV1J 1U1LA 1UZHA 3H59A 5KFRA 3BJYA 5L8RC 4DR1F 1M5OC 2VKZG 4NLTA 1T8EA 4ECSA 1S9EB 2DGWA 2NXEA 3GR1A 3MCMA 5GMEA 9RUBA 2AHOB 2KO1A 3DOKB 1FDDA 1XMBA 3DI6A 3ZTPA 4P7VA 5KOWA 3Q8QB 3FRYA 1GH8A 5LSOA 4DL7A 3TUZC 3CPWR 1H74A 2XWYA 2BABA 1S6PB 4NZ0A 2NXUA 5KG0A 5KFGA 4GC7A 2LDIA 2AEFA 5C2GA 1NDLA 3BYRA 1TVRA 3X3UA 5KFEA 3RB4A 3N4WA 4DSKA 4GVBA 4C8LA 2NLWA 3DOMA 1HBMA 2DB1A 4DQQA 2FLLA 1RP5A 2DTJA 1RTJA 3DOLB 3GFXA 4QU6A 3F56A 2HNZA 4HR2A 3A13A 2UXBJ 4WP3A 1NLKL 2HS4A 2WW8A 1QLNA 4I6AA 2W4CA 1TAUA 1RLCL 3IS9A 3VALA 1FA0A 3OL8A 1N8RT 4NEYA 1M1KT 1ROFA 2NR0A 2F4VF 3EXCX 3C6UA 1SJQA 1E6YA 2HEKA 3C66A 3W65A 4DI6A 4RUAA 2ZH8A 4YR3A 5JUMA 3G87A 3KLIA 2KI2A 3MECA 5B0EA 4AUKA 4M1KA 4X4PA 4ZIWA 1Y9OA 3NAIA 5KFDA 4YB5A 1Y0HA 2XEXA 3DLKB 2MJUA 1NU4A 4YUDA 2HNYB 4BWJA 3HT0A 4JI2J 5EHHA 2WAQD 3NRBA 3W2VA 3OUYB 4M95A 2FB0A 2F8HA 5HI7A 2YNHA 3DYAB 3JQKA 3P5BP 2JSXA 5D3GB 1IKXA 1NHKL 1RT4B 2BANA 2E66A 4C3MA 3VR1A 2BOPA 4ERDA 3CCJS 4DX8H 2KN4A 3J7Z5 3OPKA 4HH0A 1FX2A 2YKNA 4LF6F 2XO6A 4FF3A 3QAUA 1FD2A 3WX4A 1VMBA 4ZLNA 4AQYJ 3PIPQ 2HVHA 3HKZD 2R7TA 1WC6A 1LWFA 1TL7A 4EUVA 2G0JA 3KHHA 2AGOA 1VRTA 1CJVB 3DRPB 3HI9A 2J8AA 2YWHA 4KQZA 2DGTA 3IBFB 2PMZD 3KMSA 2XCAA 5AXNA 3OR1B 3Q89A 4QBUA 3PY8A 4MJKA 4FXVA 2BE7D 2XYGB 4WBFA 5KG5A 2VJVA 2UUBJ 2JLFA 1DBDA 4Y3CA 4JI4J 2F63A 2LQ5A 1TV6B 4DZDA 1N5QA 5KT4A 1S0OA 2GCFA 3Q8RB 3GMGA 2BRLA 3OBIA 1UAWA 4OMFG 1LWEB 2GQQA 2J0SD 4WU2A 1OS5A 4OYMA 3U1LA 2HFVA 2B7CB 3BSAA 1QUVA 2FZCB 5HVGA 4O4GA 1SXLA 1C4AA 2B3TB 4IOCQ 2DGSA 2F9DA 5ETNA 3C46A 3PVXA 2P5VA 1DJ0A 3F44A 3MI7X 1UEVA 3EVOA 3MEKA 2H1YA 1ZZFA 2ZKUA 1ZPWX 2UXBF 1EQ0A 1OJ4A 1TUWA 2DCUB 2XLKA 3TW0A 2FDNA 4RBUA 4YN3B 4A8XA 2EK6A 2VFVA 4X66F 4P75A 4KHPJ 4O3RA 3FMWA 4M5LA 3R6LB 1SC6A 3KOAA 1YKWA 4O3SA 3W5YA 4NRTA 1DQAA 3GIRA 2E7WA 2CZ4A 3ENQA 3VCDA 5T14A 2YKQA 1GTHA 2VODA 1TKTB 2OKQA 4C8KA 5HATA 2VJUA 5LL6d 4TU9A 4NX9A 3ZNJ1 2AYMA 4K4XA 2VBWA 1T3NA 2H3EB 3PRBA 4IRCA 3DLGA 2NYHA 1RT7A 3LH2S 1NSQA 1SJ4P 4KPYA 4CH1A 1X4GA 5ETRA 5F8NA 4DUYJ 3OFGA 4OFZA 5B08A 3N28A 2ZZTA 2G4BA 3BDEA 3R97A 1GQEA 3MPVA 2MJNA 4C48A 3HSZA 1H2TZ 2ZUAA 2V8PA 4ES3A 3I55S 5GMDA 2DISA 3M2UA 2CPFA 3DM2B 4WP9A 1VQ8S 4L3KA 1RAJA 2VL1A 2W9AA 3CCQS 1NM2A 1U6FA 3CD6S 4ZP8A 2NPFA 2MKIA 4ENOA 3DNCA 3S01A 1N54B 5T7LB 1S48A 3C14B 1C4CA 3N6MA 3T5KA 3KLEA 2XNRA 3GSDA 1K1QA 5H9FK 3EDQB 1WSVA 3EE3A 3K5PA 5EWFA 2G0CA 4DL3A 1FFWB 2UUTA 3L09A 1JLAA 1O8BA 2ADCA 2LLZA 4H4MA 3RRKA 3UCZP 4BS2A 1KSPA 2KG1A 2Z2YB 2E29A 2IRUA 2Z8QA 3T41A 2W2PP 2J0QD 1HW8A 5ETVA 2QGFB 4TQSA 4A8SA 1SKSA 3PYGA 2GHVC 4TU7A 1S0NA 2VONA 2CJYB 4RW7B 4NLYA 1UMJA 2ZC4A 1RWPB 4J37A 2YH1A 1RJJA 1S5ZA 3T6JA 2UXCJ 1IR0A 1HD0A 3R7SB 2XGPA 1C0TB 4LBPA 5HQMA 5F8GA 2DIUA 3BGRB 1IXKA 4OYWA 1FHTA 1IBMJ 1KVIA 2HBZB 4C9DA 4D3HA 2XY7A 3WQPA 4DPOA 3KNAA 1KVJA 2KHDA 2LEAA 1HFEL 4Y28C 1L5UA 2DHHA 2DH8A 1HKAA 3OTOJ 3B4DA 2BQRA 2XI3A 1DFDA 5LT5A 3T3FA 1YJNS 2EKYA 4L3NA 2R7UA 4G65A 2ZOMA 5AJ3J 3DRYA 4ALZA 1L3UA 3LW5C 1LXJA 5F3ZA 1AROP 2LA6A 2KJWA 2P6SA 4ZN3A 2YX1A 3DYAA 1ZTWA 1VI7A 2BJ7A 2PC6A 3I31A 2LP4A 2M70A 3QGHA 4FYXB 2KHCA 3ENAA 5AE3A 2ZE2B 3EMTA 4JUZA 3K5LA 4B17A 4E98A 4B3SJ 1N5VA 2JEGA 2BEFA 3NMRA 1HNVA 4F2SA 4GKJF 2FHOB 3A3OB 2I1RA 4L76A 2XQCA 4J9UE 3LF0A 2M88A 4ED0A 2E7VA 4RBTA 3S1TA 4ZK7M 4B9VA 1RAHB 4OX7A 3TEGA 4DV3F 1ELOA 4ECVA 5GVQA 2JWNA 1AYEA 3DRXA 2CQ1A 3KXDA 5D6GA 2XLIA 1TKZA 3CC2S 4DFMA 4KJIA 1JXLA 3JTPA 2EBGA 2MQQA 1FJEB 2FTRA 1ZAVA 4BC7A 2UUCJ 4B08A 4Y2MA 2MSTA 4X64J 2MLXA 3D0GE 4JI8F 1QE1B 1X5SA 4RNMA 4U9RA 3OL7A 3V4MA 2MGZA 2OUGA 2YKNB 2BRKA 2PN6A 5CCLA 2IMOA 2ZBRA 4DX5A 2B5JA 5GAEU 4ZVEA 4C8OA 5AXLA 1IKVB 3SCLE 1KNZA 2O3DA 1B0VA 2IBKA 1TL1B 3PZPA 1KLMB 3LO3A 4X4SA 3H4DA 3AOAA 1H98A 4QZVB 5SZTA 2QRRA 2HQ3A 1CLFA 1LW0A 2HIYA 4DSJA 1R0CB 1QDUB 2Z2ZA 2AZ3A 1AUDA 2XS7A 2DXFA 1X4HA 4P6QA 4LFBJ 3B78A 4OZNA 2YNHB 1RQ0A 2ZH5A 1Q78A 2EFPA 2BANB 3MM8B 1WKJA 4IOBA 5EWEA 2CRLA 5IT4A 3EZ5A 2V67A 3BF4A 1WF1A 2ZNYA 3DLEB 1QVGR 2J6TA 4ZVHA 2BDPA 4ZVUB 1KQGB 4AQYF 2XULA 3TVZA 4N5SA 3SSRA 2NS1B 3SCIE 1UVKA 2M7SA 2E7XA 4ZPBA 5LJ5Y 3V6DB 5A8WB 1T95A 1V3ZA 1HQEA 3BGOP 1VBKA 1X0FA 4KT0C 2CDQA 5IM0A 1JLBA 5BR8F 1KOOA 2CNKB 1PSDA 2BKOA 4RL1A 2EXUA 5F0UA 3CUNA 1EAYC 2Y1LB 1XJWB 3M6XA 4PAAA 4AXIA 3K59A 4LSZB 1W2BR 4K5SA 4PUOA 2YWWA 2VG7A 1KTVA 3J7YU 3C16A 4KGZB 4DR7F 4FPRA 4LRFA 3AD9C 5HQ8A 5HSPA 1YK9A 3UPFA 2DRBA 1RT1A 4HEA9 3SYZA 2PEBA 2DO4A 2W9CB 4DSEA 4WZMA 4ZJQA 4DR3J 3V81A 2CPJA 3TQ1A 2E5IA 3CCVS 4PPZA 3OQ2A 1XQIA 2CQIA 2BW2A 2CJXB 3BDPA 2C3OA 3NOCA 1GTEA 3PCOB 3MCOA 2IM3A 4DR5J 2Y9HA 1LWXA 2L9DA 2H48B 3K89A 3SV3A 4H4OA 2HFSA 5ETLA 3D6TB 2QSWA 4HI2A 3ZZPA 1UVLA 1Q79A 1QTMA 5HANA 3KLIB 2K06A 3NWGA 2DR6A 4WP8A 4X62J 2E1PA 2Z0GA 3N79A 3LGNA 1AFJA 2DNGA 4I68A 4TYAA 1JLCA 1FKPA 3CNQP 2CQCA 3FCHA 5J2NB 5J2MB 4O3PA 4B3MF 3HJFA 3MXHP 2OLWA 4C6AA 1KFSA 2J7WA 2VPYB 3HF5A 5AJ3F 1RT1B 4NXMJ 4AL5A 1B99A 5EWGA 2RT3A 4JYAF 3ILOA 4NLVA 3I0RB 1JLEB 1LWCA 2PE8A 2Q6BA 5CYQB 1UCNA 2CWKA 4MKBA 4M5KA 1NK8A 2E1AA 2GIQA 2V5HG 3TAMA 3V6DA 2MPUA 2C2OB 1WG1A 1OPZA 5D15A 2YPZA 2BX6A 3US5A 2NQPA 1HQEB 1ZA1B 2HVZA 1UZDA 2GZOA 4LF9J 1BHNA 1N6QB 2UXCF 3D2WA 2AJQA 1MU2B 3MM7A 3D3BJ 1PBAA 4DX6A 2CQGA 2PMHA 1WKKA 1LKZA 2HBQB 2MKSA 2WVCA 4ZA1A 2H5JB 1JLQB 2N3LA 4C8NA 3MAAB 3IO1A 3UN3A 5A76A 1GT8A 1RWMB 4NCGB 2IJRA 3CIZA 4ZVGA 3D0HE 4V19J 1HLWA 3G86A 3NCQA 2YNIA 3M2VB 5MLCV 4P2FA 2O01C 2V8DA 3EGNA 4QOTA 4ZPVR 4U67Q 2JC0A 3BO3A 1NH8A 1N5YB 1J5EF 2XMTA 3OFFA 2EK1A 4CLWA 1YDLA 3R1HA 4DCJB 3H5YA 3A12A 1BQNB 2O5DA 2YWKA 3HFVA 2DGXA 4X2BA 1FCAA 1RTIA 1WUUA 2XMUA 2YQ3A 4DWIA 2GQ2A 2RF2A 4OYOA 1D9DA 1DTQA 3ZC4A 4PZVA 1IKYA 1RB0A 1OQ3A 1QTNB 2BW7A 2F7VA 4A4JA 1D8ZA 1TL1A 4A8FA 3D67A 4DL0C 2QYGA 4W98A 4WCEQ 2DHXA 3J7A1 3OHBA 3OXLA 2L9NA 3H5UA 2FJBB 4DPXA 4F0MA 4DV7J 4LF2A 4O44A 2VG5A 1SV5B 2GHWA 3RW6A 1KQKA 4C8ZA 3GIIA 3KK1A 3A3NB 3FCWA 3JSBA 5KFBA 4B9LA 2J6UA 1CJTA 3E2EA 1X4FA 1F1BB 3V2UC 1PAEX 2CQ2A 2PT0A 3QT8A 5L38A 4NEZA 2I2YA 5HVHA 4K4SA 3P45B 2H54B 3HM9A 1S1WA 4DV2F 3SEOA 3IWNC 2Q79A 3EDRB 4QIFA 2GVZA 3R6GB 2ZH3A 2OD6A 2E9RX 1HI8A 4J9VA 1GX6A 2DJWA 1AT1B 1C0UB 1S1UB 2GIFA 1J2VA 1RTZA 1XIQA 2Z30B 2QFJA 2BJ8A 4OZJA 3OSPA 2DKOB 3ILJA 4MKVA 2YX7A 1BMQB 2DNRA 2WVBA 3ETOA 1TKZB 3VZIA 4J9OA 3DN9A 3M6WA 3MEDA 5E7OB 4J9NA 4QYZJ 4UOCA 3FBEA 2BJDA 4RNHA 2OEKA 4Z2XA 2M5YA 1UPPA 2AJ2A 5HBMB 3C3LA 2W8KA 1HBOB 2EFVA 4TVAB 3MM5B 3EPIA 3QGIA 1V5VA 4X64F 3OFHA 4ZCMA 3I87A 3HSJA 2VFTA 1TL5A 1HR0F 1M5VC 4B3MJ 4PG7A 3IGNA 3PEJA 1R8CA 3MTKA 5GAEI 3DXBA 1EETA 3FZBA 1MROB 4Z7YA 4FYDA 3PXGa 3WC0A 5ETMA 1WDDA 1J27A 5I3PA 4C8MA 2BE2B 3G4SS 4N7TA 1G4CA 2QLJB 2R3VA 3H8YA 4PXBA 3RJMB 2XM3A 5F8JA 2KTQA 2OGUA 4DQPA 2ZOGA 3UNGC 2MKCA 4I67A 3PRVA 2BKNA 4WIQA 3OSNA 4LF7F 5C2CA 4LR8A 2V6AA 3C16B 4B9UA 3BGRA 3UN5A 3O8WA 5EN1A 1OSDA 2EPIA 3FBCA 1IBLJ 1HARA 1BY9A 2RDJA 5ADZA 1AXQA 2D3ZA 2MKJA 4OYBA 5KFVA 1T05B 4LFCF 3LAMA 5CD4H 2HG4A 3GU0A 4CLPA 1CQMA 2FGCA 2KXFA 4WXOA 4GC6A 3MPDA 3RBXA 4ILRA 4KO0A 5D0GA 2C3MA 1UW4A 1DURA 2B9EA 2JHEA 3MR2A 3G96A 1KVKA 3VAMA 3TX0A 1B64A 1RT2A 2ZE2A 2P9EA 3PJWA 4MKAA 4WXWA 3TOQA 1N5SA 3M8PB 4UOFA 1UEKA 1IM6A 2GMJA 5LSRA 3UDEA 4XAKA 2EFGA 1B4SA 3D9BA 3MM9A 3DC2A 3I96A 2K1RB 3IG1A 3PM9A 4WE1A 2GVDB 3HMJG 1HBMB 3Q0AA 3M7VA 2R7RA 3N9UC 5L1LA 3J7AN 4E0DA 1T9XA 1WEYA 4WKYA 1Q1KA 1WOPA 5E33A 2QLBB 5H1SV 2N82B 4EEYA 4NXNJ 5J2MA 1N33J 2HNDB 2HVDA 3FMBA 1R0AA 3RRHA 4ED5A 3A1YG 4KGXB 1F9FA 3BKTA 2LEBA 3IA0A 1VQSA 2KT3A 4KRWA 3JAMU 2RJZA 2C3UA 3A3PB 2DNMA 5ETTA 3TNVA 4ZJLA 5D4NA 1EHWA 2ADBA 1S6UA 4RNOA 3RYLA 1UJ4A 1URNA 3DLKA 2HGLA 1N5YA 3MR7A 3TJAA 4P73A 4OV6A 2DNHA 3QGPA 1FWKA 1RAOA 1HHSA 1R8AA 3GLJA 4JI5J 1FJCA 1Q81T 5HJYA 1UJ6A 3KJVB 4B3TF 1T9WA 2AYEA 3CD7A 1FE0A 2XY6A 1UVJA 1S57A 1RWNB 4PR6A 3MHYA 1WI8A 2KXNB 3GTYX 2ZH9A 1BE4A 1P27B 3TRGA 4LIWA 4DX7A 5KFLA 2Z57B 4B3OA 4UQTA 4TU8A 4LRCA 4B3OB 1QSYA 1TVRB 2GIRA 4ZKAA 2B7BB 3VAFA 3G82A 4A8OA 1VRUB 1WC0A 4KGKA 3IR7B 3Q22A 4DV0J 2CNOB 2ROEA 2OPRA 4L73A 4PWWA 5CH7B 4LF5F 3KG4A 5IZHA 2FJEB 4KKOA 3TUIC 4ATNA 2X51A 1GK8A 1PYSB 2B4VA 3FGVA 4OI3A 4MTPA 4CLSA 2ATLA 1S1TB 4U8VA 2VC0A 4U6PA 5KFKA 1FNMA 2MQNA 1H6KX 3IAS9 2KFYA 1KQSR 5J2PA 2JDJA 5IM0B 1RAEB 3LP1A 4USUA 2VIHA 3HVTA 3HHLB 2HFZA 5K8PA 3PW2A 2AW0A 3H98A 2AIRB 2RD5C 2AEJA 2B9YA 3I0RA 4XK8C 1FK9B 1DLOA 1QAIA 5ITHA 1MNEA 2VPXB 5F8HA 1VQ5S 2M8DB 2YQ1A 3I6PA 1WHWA 2Q3PA 2X1AA 1SKRA 2VV5A 2AV5A 3M1VA 4OQJA 2RU9A 1N0UA 4M5GA 4CLYA 3GIKA 4NLRA 4JI7J 3D1OA 2H5IB 4X4RA 2NCKL 2JVRA 2G1DA 5D4OA 1U2CA 2OMOA 3KUHA 3OTCA 1NK4A 1GAOA 2HFNA 2B4OA 2GA7A 2G13A 4USKA 4U8YA 3R1LA 3VGUA 4OJ1A 3ET6A 3KG0A 1HHQA 2J9DE 1K47A 4CLTA 2NZ4A 1Z4UA 3PTWA 1EJ7L 4R25A 1NDKA 2VBZA 3DRSB 2Y8YA 3TZZA 2VH7A 4K7QA 2KM8B 2P6TA 3I5BA 2MZ1A 1JKHA 1M0SA 1PIEA 2BUNA 1X5OA 5RUBA 2W4PA 5HK4A 3WX8A 2GNKA 5KFQA 1RAGB 3T9NA 2HAIA 2PGCA 1S0MA 1UPMB 5DQGA 4BLGA 1TU0B 1OY9A 3A8KA 4NE9C 3GCWP 3JQJA 4DMZA 1VRUA 1JKHB 1U0HB 3CWJA 5HN0A 2AX1A 2HHWA 4X4UA 5C42A 3KLHB 1RTHA 1R89A 2HWTA 2E5GA 2XC9A 3VAGA 4RKUC 2YQ0A 2MQPA 5CD4A 1HPZB 1KBRA 3M6VA 4MFBA 5DQHA 4QWDA 2LQBA 3K7RA 4LF9F 4DR4J 3EGZA 2RQ4A 1H7WA 3I0SA 5KT2A 4P71A 2I5JB 3QRRA 3PNIA 2XNQA 2V8GA 1FRLA 3JTNA 3QIDA 1IR1A 4MYUA 1FO1A 2J9CA 5J1EA 4J9SA 1YHQS 3CULA 3SZ2A 1KOHA 2MZRA 3M8ZA 4WKRA 3DOKA 3RGIA 1TR0A 4DV4F 1V5IB 2BACA 2NXJA 3ETMA 4CO5A 3CMAS 1VDHA 4JI8J 1FRIA 3BSNA 1FVQA 5F9LA 1IWAA 1NHVA 2BA9A 3BO4A 2ZH7A 2D3OR 3IBWA 1LW2A 3EZOA 3NG8A 5I42B 4LF1A 3KJQB 4F0KA 2HYIB 3L7OA 1JJCB 5ETQA 1XR5A 4QW8A 3V6JA 1TK8A 2ACYA 2HAFA 5D3GA 2J7KA 1FJGJ 1K44A 2F9JA 2FJWA 2WSCC 1K73T 1KQFB 4DL5A 1UJ5A 2ZUGA 3TJ9A 1Q8KA 5DM7Q 2AYGA 2FY1A 4TLRA 4WTOB 2W25A 4ECRA 4WYWA 2JEJA 1SBRA 2GS8A 1FRHA 1ITPA 3S7RA 3MR6A 4X66J 1NDCA 2C2ZB 1SL0A 2AJ1A 3M8QB 2ZH2A 4DV7F 1H73A 5LMUJ 4J90A 5J2QA 2QX0A 3N01A 3MMAA 2KJVA 3GV5B 1Y5LB 4LR9A 4WPAA 2HSEB 4P72A 3QSYB 1RWXB 4DSIA 2QMUB 1BD6A 2KYZA 4CO0A 4CM2A 5IS2A 1KC8T 3Q86A 4YFUA 1OIAA 4CTAA 3DLLQ 4LRBA 2XMVA 3K8WA 3KJFB 4FKXA 1M5KC 1Z2LA 2ZHOA 3MMJA 1S6QB 3W64A 1FJ7A 1HD1A 3D1HA 2LEPA 3JXOA 1JQGA 5DS7A 5IWAJ 2P2CB 2J6SA 1Q82T 1UW9A 5KFCA 3OTEA 1XR6A 2DPJA 3AXKA 1KLNA 2Y0BB 4L74A 1HWUA 2V4JA 3M30B 3R9LA 3ZZUA 1XMOF 3DGPA 3UCUP 4FVMA 1GMVA 1SPBP 2U1AA 3HFKA 1SVDA 2CQHA 3KJVA 3K58A 2CPIA 1VBXA 2VBXA 1GMUA 2ZVSA 3NY0A 4I2PB 1F60B 2XBPA 3HSDA 4ZVSB 4LIRA 4NYPA 3VWSA 1FTRA 3W2WA 2MQOA 3P3DA 2Y1JA 2YPYA 2HNYA 3BREA 1DQ8A 4B9SA 1WC5A 3P4UB 5DLFA 3CDUA 1Q7LB 3O6QA 4RWXA 1FKOB 2FLOA 3NNAA 1B7FA 1F9EB 1UETA 3CJSA 2KH9A 4IRDA 1TMJA 3IR5B 3MDFA 1Y11A 1I5OB 4NYZA 4PCQA 1VCTA 4EI2A 2DRAA 2PIIA 1KLMA 3CJTA 4YP3A 3QT6A 4Y65A 3R5BA 1X8DA 3NGRA 4GO7X 1XC9A 3AOCA 4DUZF 1URRA 4NMLA 3QYYA 4LFBF 3BN7A 3O5TB 5GAGU 2OI2A 4NL5A 3KHRA 1FFSB 1T9TA 2HIQA 4XTTA 2A3JA 5DZ7A 2CZVC 3V4IA 1IJEB 2Y1RI 1B3TA 4PUOB 1FXLA 4ETXA 4FF1A 4DPTA 3T1HF 1YVFA 3CCMS 4M5DA 1RACB 4KPCA 5KG3A 1CJKA 3HHNB 1OYEA 2ZWPA 1H38A 1FRMA 1M1GA 1B7YB 1RI7A 4LBIA 4USIA 2R2UA 2C42A 2CNLB 3WDOA 3UD5A 5KG2A 3PW7A 3H42A 5FLXU 2IM0A 4DUYF 1N6QA 5E5NA 2QTWA 5KFWA 4IUFA 2M8HA 4ZPWR 2MY7A 3VAHA 5DO2A 3H20A 3KHLA 4KE5A 2OEMA 2L08A 2UVWA 1TKXA 5GAHI 4IR1A 4OZ3A 3IWXA 4NWBA 2CUYA 2QA2A 4ZCKA 4O4GB 1TL4A 2KZZA 1D09B 2C2RA 4HLBA 6FDRA 2A0FB 2ZITA 1CBKA 1U09A 1X5PA 2AP6A 3MMBA 5CYMB 4ZJOA 4EU0A 1LK7A 1TP7A 2KDOA 4G6VB 5HAOA 4K4ZA 1JX4A 1AB8A 2ZC3A 1SC3B 2KYXA 5KFZA 1SC1B 3FSYA 3L9ZA 1RKJA 1NKCA 1RU2A 3RAXA 3PFEA 1W25A 2DRDA 3Q2SC 1VJQA 5J2PB 3KLVA 3OVBA 4UY8T 1YJ9S 2LCWA 4CIOA 1RWUA 2DNOA 3W66A 2ZOFA 5KOXA 3HPOA 2DGUA 2ASJA 2LMIA 3IG1B 1FK9A 3H2VE 1WELA 2FZGB 2DHGA 4LF4F 3KLGB 3H4BA 3RB6A 3PO4A 1UVIA 3SFGA 1REGX 4RUHA 4YHHF 1NB7A 4W92B 1U2RA 3Q8SB 4GO5X 2LQ9A 2BE9B 2EG2A 1H0HB 3RZAA 3PW5A 2YVSA 1FNOA 4XIUA 1YJ7A 4DEZA 2D41A 2RQMA 2G2OA 4OYIA 4NI2A 1DHMA 4NMXA 2EFQA 3FZ2A 4QIEA 3LTOA 5IC6B 1RK8A 2HQCA 3ZZOA 4WTYA 2DNNA 3NNHA 4K4TA 3FNNA 4GMKA 3HDSA 4IG0A 4RW4B 1CEZA 2BZ2A 2VB6A 2NSBA 1Q95G 3P49B 1TZ0A 5D4PA 5A8KA 2ASDA 4P2MA 4ZPDA 2HHUA 4Q5VA 1ZM3A 3T5HA 2EFNA 2R42A 4QR1A 2DGOA 3IMQJ 3QO9B 2H4WB 4P7TA 3CJ5A 2Y0SD 3GFYA 2DNKA 5KT7A 5E2QA 9ATCB 2CPHA 1P1TA 1F3FA 3J80Y 3J80U 3JS9A 1UTAA 3V5RA 4DJBA 3V6KA 1KHWA 2OSRA 4TY9A 4QWAA 1NXIA 5KG1A 2DNQA 1WSRA 5LJ3Y 3MURP 1UKUA 3DM2A 1T02A 3EYZA 4AL6A 4M8LA 4RX6A 2VQFF 1U02A 4DR7J 4DFJA 2UXDJ 2W24A 3JQMA 4IFYB 3D0IE 1REVA 2MY8A 5IWAF 3KYLA 3AAWB 5DG9A 4DG1B 5E3RA 5IFMA 1ICEB 5BR8J 3BS9A 5A2QU 1FRXA 2FVCA 4AD6A 1JJ4A 4ED7A 2DEIA 4DLGA 2HGNA 3OJSA 2HS3A 1HHTP 2BE2A 3CGIA 3QJLA 3HHEA 1S49A 3MEDB 1IBLF 3UO0A 1NKEA 4ER8A 1X4EA 1LW2B 3T1AA 2BKPA 2VQEJ 2JEFA 3FRZA 4JBCA 3GYNA 3BH6B 2YKOA 4IR9A 5LOQA 2RRBA 4FNHA 3MM5A 4F4KA 4A8QA 1HQ2A 2DD8S 1FXDA 1T0TV 3M8WA 3OV7A 3D6MB 4Q0BA 3B54A 2Q1LA 2MB0B 1UEUA 8AT1B 1Q8BA 4ILLA 4I6WA 2RNEA 3BKFA 3GG0A 3K5MA 3H5SA 2BV3A 1VFJA 4IO1A 4CYUA 1D8YA 1BGXT 3EWGA 1HWIA 2I9SA 1ZM2A 4QYRA 2BBEA 2HNZB 1I1GA 1SV5A 4LR7A 3ZTOA 4Q45A 4K0KF 2OO4A 1U8SA 3SV4A 2ZD1A 5IQQA 1ZBTA 4X4OA 1IM4A 4YY3J 4K2JA 2A6MA 3I4PA 4NYOA 4Y0FA 2UVRA 4WFNQ 3KLFA 1HW9A 1U7LA 4Y2IA 1P9QC 4Q8EA 2MQLA 5EGYA 4WK1A 1TFYA 1VRTB 3W8PA 3I5AA 4LREA 2QN6B 4RO0A 2OIHA 1APSA 1K1SA 1VQ6S 1YITS 2KG0A 4G1QA 5ETKA 5T41A 3OVSA 1U1KA 1P1LA 2Y3YA 4LF8F 4FBTA 1RADB 4PYDA 3AT1B 2GJ2A 4NCBA 2ALYB 3Q2TC 1IKXB 1NCLA 1RT4A 4C2MA 3KJNB 3I4HX 4QWEA 3P6YC 3B8HA
chains in the Genus database with same CATH topology
4DV4J 2UU9J 4NXNJ 1HNZJ 1N33J 4JI8J 3D3CJ 4KHPJ 4LFCJ 3W1YC 5IT9U 1N36J 4K0KJ 3JAMU 4JI3J 4B3RJ 2MTLA 4KY3A 4DV2J 1FJGJ 4JI5J 4LFBJ 2E5LJ 2KVQE 4JV5J 2HHHJ 4DR1J 4DV6J 4DV7J 4LF4J 4DUYJ 4X66J 4DV1J 3J81U 5LMUJ 2UUAJ 4B3TJ 5LM7E 3T1YJ 4LF6J 4NEZA 3IMQJ 4LF8J 4DV0J 3J80U 4PWWA 4DV5J 4DUZJ 4YHHJ 5IWAJ 4HHUA 4JI2J 4DR7J 4DV3J 4RJVA 4JI1J 5BR8J 2UXBJ 1HR0J 5A2QU 4X65J 4NEYA 3R2CJ 4DR3J 1N34J 4B3MJ 2VQEJ 3R2DJ 2UXCJ 4JI7J 1XMQJ 4DR5J 2VQFJ 1IBMJ 4GKJJ 2KL8A 4KYZA 4X62J 4DR2J 2MQ8A 3OTOJ 1N32J 4JYAJ 1XNRJ 1HNWJ 4GKKJ 5AJ3J 4DR6J 4AQYJ 1IBLJ 1HNXJ 3T1HJ 4JI0J 4NXMJ 4LFAJ 4LF7J 4B3SJ 2MEWA 4JI6J 5FLXU 4V1Ak 4OX9J 4YY3J 5LMNJ 1IBKJ 1I94J 1XMOJ 2UUBJ 2ZM6J 4JI4J 4LF9J 4LF5J 3D3BJ 4DR4J 1XNQJ 2UUCJ 2F4VJ 4X64J 3J7AN 1J5EJ 2UXDJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV4 J;  2UU9 J;  4NXN J;  1HNZ J;  1N33 J;  4JI8 J;  3D3C J;  4KHP J;  4LFC J;  3W1Y C;  5IT9 U;  1N36 J;  4K0K J;  3JAM U;  4JI3 J;  4B3R J;  2MTL A;  4KY3 A;  4DV2 J;  1FJG J;  4JI5 J;  4LFB J;  2E5L J;  2KVQ E;  4JV5 J;  2HHH J;  4DR1 J;  4DV6 J;  4DV7 J;  4LF4 J;  4DUY J;  4X66 J;  4DV1 J;  3J81 U;  5LMU J;  2UUA J;  4B3T J;  5LM7 E;  3T1Y J;  4LF6 J;  4NEZ A;  3IMQ J;  4LF8 J;  4DV0 J;  3J80 U;  4PWW A;  4DV5 J;  4DUZ J;  4YHH J;  5IWA J;  4HHU A;  4JI2 J;  4DR7 J;  4DV3 J;  4RJV A;  4JI1 J;  5BR8 J;  2UXB J;  1HR0 J;  5A2Q U;  4X65 J;  4NEY A;  3R2C J;  4DR3 J;  1N34 J;  4B3M J;  2VQE J;  3R2D J;  2UXC J;  4JI7 J;  1XMQ J;  4DR5 J;  2VQF J;  1IBM J;  4GKJ J;  2KL8 A;  4KYZ A;  4X62 J;  4DR2 J;  2MQ8 A;  3OTO J;  1N32 J;  4JYA J;  1XNR J;  1HNW J;  4GKK J;  5AJ3 J;  4DR6 J;  4AQY J;  1IBL J;  1HNX J;  3T1H J;  4JI0 J;  4NXM J;  4LFA J;  4LF7 J;  4B3S J;  2MEW A;  4JI6 J;  5FLX U;  4V1A k;  4OX9 J;  4YY3 J;  5LMN J;  1IBK J;  1I94 J;  1XMO J;  2UUB J;  2ZM6 J;  4JI4 J;  4LF9 J;  4LF5 J;  3D3B J;  4DR4 J;  1XNQ J;  2UUC J;  2F4V J;  4X64 J;  3J7A N;  1J5E J;  2UXD J; 
#chains in the Genus database with same CATH topology
 3DDI A;  1RT6 B;  5CYM A;  2R7X A;  2CVI A;  1HNZ J;  1JLF B;  3Q8U A;  2PO4 A;  5CYJ A;  3LP0 B;  3OTD A;  2VDI A;  3RBZ A;  3LAL A;  1QM9 A;  2HW3 A;  4NLW A;  4UUX A;  1LW0 B;  2Z4P A;  1MWQ A;  5E3Q A;  1TUV A;  4OI0 A;  1MMD A;  1G2E A;  2HZV A;  1NND A;  1YBU A;  4CLL A;  2BOA A;  5E3A A;  3UR3 C;  2SXL A;  4OZL A;  4IDK B;  2IDL A;  4QWC A;  3KLF B;  3JSM A;  3THV A;  2VKR A;  3JSY A;  3PFO A;  4HYK A;  2RUS A;  2LU1 A;  3OFE A;  1X9S A;  2MQM A;  3D28 A;  2K7J A;  4GRS A;  1NRK A;  4EK2 A;  2MKK A;  2V68 A;  5J2Q B;  2XSJ B;  3CO9 A;  3GIM A;  4J9M A;  2WHO A;  3VV2 B;  4DBQ A;  1JB0 C;  3AJD A;  3MM9 B;  4ZIT A;  2DEJ A;  2UUW A;  4AE5 A;  3HT3 A;  4ID5 A;  4CTA B;  2XS2 A;  2W4D A;  2MDA A;  4NXN F;  1JLE A;  5LM7 E;  2BQU A;  2NPI A;  1U45 A;  1SQF A;  3BH7 B;  3R5C A;  4RNN A;  2VZ9 A;  2MLY A;  2CPE A;  1WF0 A;  1D0E A;  3MGJ A;  3NWR A;  3SCK E;  4RBV A;  4DU8 A;  3I9Z A;  2WTF A;  4ECT A;  5B7W A;  1U47 A;  5LXR A;  1TFW A;  1UVM A;  3UDV A;  2AEM A;  3PHT A;  1U8W A;  4N77 A;  1QSS A;  3FKB A;  2G2Y A;  2WB1 D;  2UV8 A;  2I8E A;  4HHU A;  4C3K A;  3CVK A;  4CZC A;  4RZR A;  3FBB A;  3HFZ B;  2DR5 A;  4WFB Q;  1XMQ F;  1ZET A;  5FJ4 A;  1TKD A;  1SJ1 A;  3BBF A;  1C1B A;  5D77 A;  3RBD A;  1AZS B;  2DBB A;  3KMQ A;  2FJX A;  5B0G A;  1UFK A;  1FD8 A;  3PDN A;  4O3N A;  4PYA A;  3W9J A;  4H4O B;  1AUS L;  4Y00 A;  2LQJ A;  1U49 A;  1ZOT A;  4ED2 A;  5I4M A;  4FYY B;  3LP0 A;  5B0C A;  3BKU A;  5E3P A;  2QV6 A;  2YNF A;  3HHL A;  1RGV A;  3MPW A;  1M5H A;  1XMQ J;  1HNI B;  2HBY B;  4F2R A;  1N32 F;  2W2Q P;  4YOE A;  1QUP A;  3KK3 B;  3EGW B;  1ZM4 A;  1IN0 A;  3HJV A;  3GP9 A;  3QO9 A;  4K5R A;  3RAM A;  4ES1 A;  5BYS A;  2W9B B;  3AHP A;  8ATC B;  1RUS A;  2LFV A;  2VC1 A;  3M2R A;  5BJR A;  3CJR A;  1R6V A;  2PSZ A;  3SDE B;  5KG7 A;  3ITH A;  1S97 A;  2BMB A;  1VQP S;  1YJU A;  4NPO A;  4KV8 B;  5DDR C;  1C1C B;  1ZAX A;  2OPQ A;  5A8K B;  1S72 S;  1EIY B;  1GXL A;  3D54 A;  2AJ0 A;  3FJ2 A;  3VQS A;  5M2P A;  3K2Y A;  3T6B A;  3T1H J;  1HNX J;  2VOP A;  3KNG A;  4JI0 J;  5FDL A;  3R3T A;  1RE1 B;  1UVN A;  4J9K A;  3B82 A;  3EPG A;  4FVC A;  2OP5 A;  3DI6 B;  2F4F A;  4YB6 A;  4TNO A;  4CO1 A;  3NBP A;  4DV6 F;  1KP6 A;  2FD2 A;  3D6F B;  4OJ3 A;  1W2I A;  5IOL A;  4CO2 A;  2QEX S;  1M5S A;  1IBM F;  1EKR A;  4FDF A;  4ED6 A;  1XWL A;  2AF6 A;  3M9O B;  5IQ6 A;  3CD5 A;  1CC8 A;  2V69 A;  3TWZ A;  4F36 A;  1QY7 A;  3EGV A;  1XR7 A;  1RHQ B;  1FVS A;  1G6B A;  1NEE A;  2JFK A;  1BQM B;  2R2R A;  4DSL A;  2Z2L A;  1CPZ A;  1GMW A;  3E01 B;  2U2F A;  1VIS A;  3I5C A;  4O44 B;  2XLJ A;  4BCA A;  2QJ3 A;  3WIV A;  4ELV A;  1H3D A;  1N48 A;  3J7Y I;  1S79 A;  4YB1 P;  3MUM P;  4EBC A;  4YDD B;  1LV5 A;  4LUB A;  5MAO A;  2VD3 A;  5CQG A;  1HPZ A;  2HQF A;  3BGL A;  3VHQ A;  5IV3 A;  5L1I A;  4IQM A;  4DF4 A;  3DKD A;  1K0T A;  3OD2 A;  3TAN A;  2GGP A;  3HHL D;  5KFU A;  3M8R A;  3MEC B;  4PKD B;  1U1P A;  2O1P A;  3D3C J;  3ELH A;  1TKT A;  2R9L A;  1MN7 A;  2IPO B;  5HMY A;  2WCX A;  4RW7 A;  4F4A A;  2ZBQ A;  1H7X A;  4LT6 A;  4BWM A;  3HVW A;  4A48 A;  4C7Q A;  2MGZ B;  3LPE A;  4DOZ A;  5DM6 Q;  2XO7 A;  3VGV A;  2B56 A;  5L39 A;  3AFG A;  2QL7 B;  4IH6 A;  5M2U A;  1VQL S;  4JV1 A;  2LA4 A;  3D6H B;  2ZBP A;  2CDR B;  2G1H A;  2CJA A;  3DGV A;  4IFY A;  5CHC B;  1YIJ S;  1RTD A;  2V9W A;  3MUV P;  1F9H A;  3GE9 A;  3FSX A;  5IXU A;  5DDP C;  1A6L A;  3LQV A;  2EC0 A;  2WW4 A;  4F4W A;  3D4J A;  3O3L A;  4MIA A;  2ILY A;  4K4U A;  2YKA A;  2EG1 A;  3VGT A;  1U1R A;  1CUL A;  3ISN C;  1RU1 A;  5A8W A;  4CT8 A;  2RE1 A;  1EKS A;  3SSS A;  1RTD B;  4B3S F;  1OQ6 A;  3IBC B;  4LVO P;  2CPZ A;  5KT6 A;  1U1N A;  4R5P A;  3LOU A;  2IFX A;  5A8R B;  2CVE A;  4UF4 A;  5T7L A;  4F02 A;  3H7H B;  3IWL A;  3LAN A;  2DPI A;  1HMV A;  2UXD F;  1R27 B;  3B6B A;  3CDW A;  3RAQ A;  4KFB A;  1KFD A;  4X4N A;  1WDT A;  2IBO A;  1FT8 A;  3R7N B;  3NCP A;  2LQ8 A;  3MEG B;  4R0J A;  4EO6 A;  3L7U A;  4ID8 A;  5HO4 A;  3K17 A;  2JZ5 A;  3NEK A;  1QVF R;  1CJT B;  2HWI A;  3BR8 A;  2GO8 A;  4PWD A;  4L6V 3;  4MK8 A;  2B4U A;  3H2U B;  3I9V 9;  3GV7 B;  2O67 A;  2FZK B;  1KKH A;  2HRU A;  4QWB A;  3WHI A;  5KT3 A;  2V94 A;  2NRE A;  1DY3 A;  2HZA A;  1WD6 A;  3L95 X;  3TZY A;  2QL5 B;  4C4W A;  4RUC A;  3HX9 A;  3R8Y A;  4JI1 J;  2RU3 A;  4LSN B;  2ZDO A;  4H4K A;  1RKI A;  2R7Q A;  3QRP A;  1LNQ A;  2A2C A;  2CG4 A;  2F8E X;  4M5M A;  5JMN A;  3OLB A;  1MRO A;  4PG5 A;  3M05 A;  1EET B;  2FGO A;  5I3U B;  5AE1 A;  1YJR A;  2LYV A;  1C0T A;  1S77 D;  1QJH A;  4PXC A;  4RW9 A;  1H2V Z;  1NHU A;  2C2N A;  2YKP A;  2AQ4 A;  1SH0 A;  4CP5 A;  1Y00 A;  2B9X A;  1U1Q A;  1QAJ A;  2V4J B;  3W2V B;  3OUY A;  1WF2 A;  4NLQ A;  2YBV A;  3DHX A;  3R2D J;  1UL3 A;  2ZVI A;  2ALZ A;  1AZS A;  2AWZ A;  4JI4 F;  3KKF A;  1BWV A;  1T7P A;  3GYX B;  3OR2 B;  4F4Z A;  5HP1 B;  2VA2 A;  2MZQ A;  2QMW A;  1H2U X;  3A8I A;  3IM8 A;  4IG3 B;  1O0P A;  1NME B;  2YWG A;  1K0V A;  2NXN A;  4F26 A;  5HMZ A;  1X31 C;  3IXQ A;  1T05 A;  3GWC A;  2MQ8 A;  3GJT B;  3EJM A;  4EWT A;  4DZ6 A;  3R2C J;  5KTQ A;  3HKW A;  4CLK A;  2RUG A;  1NK0 A;  4RU2 A;  2GMH A;  4N56 A;  1TMM A;  5F41 A;  4C0O C;  1ZAW A;  1ZS6 A;  3QPI A;  5CAA A;  1SKW A;  1ZH5 A;  5KFA A;  4OLO A;  2IAJ A;  3HVA A;  3UE2 A;  2QO3 A;  2AMC B;  3LAK A;  1UA0 A;  1YRU A;  5ETO A;  3QWU A;  4F8R A;  1DRZ A;  1LXN A;  4JI6 J;  4UY8 5;  4HKQ A;  1PCA A;  1EP4 B;  3OXG A;  2VFR A;  1HNZ F;  1FDN A;  5D78 A;  1M90 T;  4NAS A;  2E5L F;  3CE8 A;  2AD9 A;  3PW4 A;  2BJ3 A;  1DAX A;  2YWE A;  2YNF B;  4UQG A;  1VC6 A;  2QIF A;  4NA1 A;  4USM A;  3SFU A;  1X4B A;  1CJV A;  3MM6 A;  2C22 A;  1JIH A;  4OLP A;  1U24 A;  2DK2 A;  3G8S A;  5KT5 A;  1RAI B;  1K8A T;  2D3U A;  1RBA A;  4HHH A;  2H65 B;  4YS2 A;  2XS5 A;  2YKM A;  4P74 A;  1KEK A;  2FJA B;  4XPE A;  1TK5 A;  1VOM A;  5K9F A;  4DPU A;  2R8K A;  3CED A;  1OY6 A;  4QR2 A;  2OTJ S;  4HVZ A;  3NL0 A;  1XBW A;  2ASY A;  3DMJ B;  3FEZ A;  3GZ7 A;  2ACM A;  4DFP A;  4DL6 A;  4QYZ K;  1RHR B;  4O3Q A;  3M32 A;  3I0S B;  3DLH A;  2V8V A;  1OYD A;  2FHM A;  1O5J A;  1MWY A;  2WSF C;  4P10 A;  3W1Y C;  1TL3 B;  2X1F A;  4JI0 F;  2PI4 A;  4PAB A;  5CAB A;  2BR0 A;  2FVQ A;  3BN4 A;  2EBE A;  2R7O A;  3VVT A;  3WIU A;  3MD3 A;  3DFE A;  3IN5 A;  3R5D A;  2OJ3 A;  4DR4 F;  3QLH A;  4AXJ A;  4DHV A;  3CJ2 A;  5DLG A;  2ZJR Q;  5I3Q A;  2XZW A;  4K59 A;  2G0I A;  2DNL A;  1HQU A;  3DU6 A;  4BC9 A;  2O66 A;  2CQ4 A;  2RKI A;  3M8Y A;  1V9O A;  5ETP A;  5KFI A;  4X84 A;  3P96 A;  4ZVT B;  4OZ0 A;  1SUQ A;  3ZTR A;  5C25 A;  2JOQ A;  4DU7 A;  1D9A A;  3M8Q A;  1XER A;  4Y34 A;  1B70 B;  3MZI A;  3MMA B;  2N3O A;  1NSA A;  1T03 B;  1C1C A;  3NAH A;  2E5L J;  5AT1 B;  1DAR A;  2Q43 A;  4ZCL A;  4ECX A;  2RDD A;  1NO8 A;  2VG6 B;  2WOM B;  1J5O B;  4FN5 A;  1X4A A;  4CT9 A;  4RWW A;  4N76 A;  1RAB B;  3NCR A;  4L72 B;  1JLC B;  2MZJ A;  3FUY A;  3VQT A;  3ZXW A;  3DLJ A;  3BV8 A;  2R8G A;  2OPR B;  2XHW A;  3LGH A;  2XSF A;  3DRR B;  2HHH F;  2UUA J;  2DCL A;  1RA6 A;  5CYQ A;  3CXC R;  3GQC A;  4H4K C;  4JP8 A;  5GMK a;  2ZKT A;  4CCH A;  2HKE A;  4O4R A;  5GAD U;  4FS1 A;  3LPY A;  4J5O A;  3HUL A;  4AYB D;  3BPD A;  4DV5 J;  2CFX A;  5HQL A;  3RG6 A;  2LU2 A;  4FYV B;  1R31 A;  1YRX A;  2AJ4 A;  2AZ1 A;  3DHW C;  4KC5 A;  3PW0 A;  1CS4 B;  1SIW B;  2UV8 G;  4X4V A;  4I2P A;  4QJV A;  4NLS A;  3UVJ A;  5HMW A;  4G1I A;  2BJ1 A;  4NA3 A;  5F3T A;  1PAU B;  4U7C A;  3CCT A;  4DS5 A;  4A8M P;  2IA6 A;  5HMX A;  4IOA Q;  2A18 A;  4N8N A;  4TKT A;  3T19 A;  5M2R A;  2EFO A;  4Y2K A;  1H72 C;  1R0B G;  2V2V A;  4IH7 A;  1PO6 A;  3VVU A;  3WC2 A;  3ZZ0 A;  5LSL A;  2V4Q A;  1IBC B;  3CD0 A;  4RW6 B;  2OPP B;  1N34 J;  2QLW A;  3TAP A;  2QL9 B;  2VFS A;  3DOL A;  5C7P A;  5F8L A;  3W7B A;  4R5P B;  2WB4 A;  2PEH A;  1YQH A;  2CJB A;  3RR8 A;  4UZC A;  2L41 A;  3KK2 A;  4AFF A;  4QR0 A;  4CO3 A;  5C42 B;  5L1J A;  1NJY A;  2HLT A;  2DVI A;  4DQI A;  1DTT B;  3C6U B;  4CO4 A;  1VIX A;  4ICL B;  1D1U A;  2OML A;  4R8U A;  3QLH B;  2KRB A;  2QZ8 A;  2VBY A;  1RBO B;  4M5D B;  5GAD I;  4NLG A;  1A9N B;  2PI5 A;  4BDP A;  2B51 A;  2HHT A;  5H9E K;  3LP2 B;  4I1T A;  4TY8 A;  2I6W A;  3UN2 A;  3ZTS A;  4KHR A;  1KRP A;  1WG4 A;  2RVJ A;  1DTT A;  3JTO A;  3DOM B;  2JC1 A;  1M5P C;  4NXM F;  2WVE A;  5DGB A;  4K50 A;  5FLX Y;  4A46 A;  1S7I A;  4Z37 A;  1SB6 A;  1WHX A;  1PJ7 A;  3RU0 A;  3BBB A;  4GKK F;  2FYX A;  2HVE A;  3RB0 A;  2HPU A;  4KH0 B;  4DLE A;  2DIT A;  4CLZ A;  3HCX A;  4X4T A;  1SJF A;  5I42 A;  4RW6 A;  3TAQ A;  2MKY A;  5K14 B;  1YBA A;  3QT5 A;  3U27 A;  1IBK J;  2F65 A;  3OW2 R;  1P6T A;  1Y3K A;  3BQ2 A;  1I94 J;  3K0J A;  1HYS B;  4I7F B;  2GW8 A;  3MTJ A;  2IC3 B;  1VQ4 S;  1NJI T;  4J9Q A;  2ZM6 J;  2ROP A;  2OTL S;  3U02 A;  1C2P A;  4F67 A;  1RT5 B;  3EXY A;  3GIJ A;  3AQP A;  3M30 A;  2G2Z A;  4RU9 A;  1PBU A;  1VRQ C;  2H5E A;  3R27 A;  4Q7A A;  2R7V A;  1R0A B;  3THT A;  3IRX A;  2XB2 D;  2X1G A;  2RIL A;  1NJW A;  4DDF A;  2W8L A;  4I2Q A;  3CCR S;  1IQT A;  4V19 X;  4DV4 J;  1P9Y A;  3ZNU A;  3FCV A;  3KHG A;  1U0S A;  4UOG A;  4G1P A;  1WTB A;  3OL9 A;  2CAJ A;  4ZMM A;  3FFI B;  5B0B A;  5IT9 U;  4B02 A;  1LFW A;  4EYI B;  2Z2M A;  4F4Y A;  2ZWO A;  4QIV A;  2LXI A;  3J81 j;  4CRJ A;  1UFW A;  3E3X A;  1D9F A;  3QIP B;  4NLP A;  1NKB A;  3VAJ A;  1A0O B;  3O1L A;  4KH1 B;  1SIZ A;  2V9K A;  4DQR A;  1NB2 A;  5D0H A;  1N4L A;  4O3O A;  3P8B B;  4AND A;  1NSP A;  1TL3 A;  3GON A;  5K5M A;  1EB0 A;  2RRA A;  2ZH1 A;  5IV4 A;  4RUB A;  3CDA A;  4CWB A;  3O2I A;  4WYL A;  1FKP B;  1HIY A;  5J2N A;  2B8Q A;  2GC8 A;  1PIL A;  2P9C A;  4HDH A;  2F40 A;  5CZV A;  3UI3 A;  1CJK B;  2VIC A;  4RW9 B;  4USH A;  1KON A;  2DH7 A;  2OPS B;  3A8J A;  1I6J A;  3TZX A;  2GQC A;  4ZIV A;  2R2S A;  2EEY A;  4ZVQ B;  1S9G B;  2M9K A;  5A6W A;  3ULH A;  4CNZ A;  3PV8 A;  2Y8W A;  1PG5 B;  1RWW B;  2B6A A;  1GFW B;  2YH0 A;  4ZDN A;  4LF6 J;  1XN9 A;  2W2M P;  3AA8 A;  3E8O A;  3NGT A;  1FTC A;  2PDA A;  1JNR B;  1Y7P A;  1YGY A;  4I56 A;  3W8G A;  4UT4 A;  3CME S;  1XNQ F;  2EKN A;  2HFU A;  1U4B A;  1SQG A;  2BVZ A;  3QRQ A;  2W2N P;  4K2X A;  2XMA A;  1JLG B;  4I64 A;  3NS7 B;  3HZG A;  1Q86 T;  4Q44 A;  2FUG 9;  1QAX A;  4ZOS A;  4OYP A;  4ECW A;  4DL2 A;  2UUB F;  1RHK B;  1IVZ A;  4ED8 A;  2GJF A;  2IAJ B;  2RML A;  4Q2M A;  5F8I A;  2HK3 A;  2XWX A;  3VTI A;  3GPA A;  4FXW A;  4OI6 A;  1RCX B;  2GHP A;  2BXJ A;  3TZW A;  4EMD A;  3NKY A;  1YJV A;  2CKW A;  4HTJ A;  3MR5 A;  2R7W A;  1I51 B;  1KD1 T;  4FKY A;  3DDN A;  2FPH X;  2UUC F;  2J76 E;  3B4M A;  1VQ9 S;  1HBN A;  1VQO S;  2UUA F;  2EI5 A;  3CJK B;  2LDY A;  1VK8 A;  2RSQ A;  3FVY A;  1FER A;  4IKA A;  4DF8 A;  3S8S A;  4JV5 F;  2YWF A;  2BJE A;  3CSK A;  1IBK F;  5LMN F;  4DUT A;  1CVJ A;  3HXM A;  2V2K A;  4NZ6 A;  3QJJ A;  4EZ6 A;  1FX4 A;  2MHE A;  2MZS A;  5B09 A;  2PA8 D;  2FVR A;  4U7U D;  3DRP A;  3OR2 A;  3J81 Y;  5D4L A;  3TEH B;  2XMM A;  3PHE A;  4NA2 A;  4YR0 A;  3KK1 B;  2FVS A;  5C5J A;  2WVF A;  3HHL C;  2COL A;  4KO0 B;  3EIC A;  3SDE A;  3AQO A;  1F5C A;  5CXT A;  4M5N A;  2HMI B;  4FPI A;  1QD1 A;  3NXZ A;  3MFH A;  3OTB A;  3QWP A;  1SL1 A;  3N6N A;  3TUP A;  4LJM A;  1VK3 A;  3MM6 B;  4WZQ A;  3HSG A;  1CSJ A;  2GO9 A;  1KHV A;  1ZM9 A;  5LMN J;  2RF2 B;  3F0N A;  4HHJ A;  1DZ5 A;  2R2T A;  3NNC A;  1MLA A;  2IRY A;  5HL7 Q;  1WC3 A;  4G3I A;  1FXR A;  2MKH A;  2QLF B;  4YEA A;  4A47 A;  4ECY A;  5L1K A;  2AKW B;  4TQR A;  3PX4 A;  1YTY A;  1CJU A;  1REV B;  1JK9 B;  1SKU B;  4IFV A;  1JLF A;  2DY9 A;  1CG2 A;  4Y6I A;  2PD1 A;  2KB2 A;  1E6V B;  3TVY A;  4CI0 B;  2X3G A;  1VJW A;  2QMX A;  4DN0 A;  2F8M A;  1O51 A;  3CJ0 A;  4H4M B;  3GG1 A;  3MUT P;  4HI1 A;  2C2K B;  4UW2 A;  1MSW D;  2CXE A;  1Q7Y T;  3ISN D;  1YJT A;  4DV1 F;  1R43 A;  3CJ3 A;  3G82 B;  5JXS A;  2QA4 G;  1RAF B;  2CIM A;  3OVA A;  2GVZ B;  1OSC A;  3AOB A;  4N8O A;  2IM2 A;  2KFZ A;  2HBR B;  5H9F J;  4C0H A;  1KR4 A;  1MML A;  3RBE A;  2N7Y A;  3CJK A;  3CW2 C;  4PEO A;  1HNV B;  3QFH A;  1V3R A;  3MMC B;  2R8J A;  4JI5 F;  1T9Y A;  4BHQ A;  4KSE B;  4QPX A;  2MTL A;  4TN2 A;  3FFI A;  4F3Q A;  1F0X A;  3R5J B;  4OZ5 A;  4PG8 A;  5B0D A;  1ZTT A;  1YI2 S;  1FES A;  2JNJ A;  2AYB A;  1X60 A;  2C3Y A;  2YTC A;  4OYX A;  3ZTQ A;  1R6Y A;  2XMK A;  4EYH B;  2M4M A;  2KVQ E;  1S9E A;  1RXO B;  2LKZ A;  2HQG A;  1MG7 A;  2QC3 A;  3FK4 A;  5LMU F;  4KBI A;  1Q5Y A;  4LSL A;  3HVR A;  4LQ3 A;  1XK8 A;  3MEE B;  2FJD B;  3CCU S;  2XHC A;  3BO2 A;  3KDO A;  2IVF B;  1BXN A;  3IGV A;  2CYY A;  2FLN A;  3N0V A;  1S1V A;  4WFZ A;  3POT B;  4NLU A;  3KK2 B;  3CJQ A;  2RQC A;  2CG8 A;  3SQG B;  2JEI A;  3ENV A;  1PJ6 A;  4NRU A;  1LK5 A;  1FRK A;  2V34 A;  3PG9 A;  3OHA A;  4FXD A;  1JXE A;  4J9P A;  4X62 F;  4LBH A;  3BQ0 A;  1N0V C;  1WHY A;  1MN9 A;  1R8P A;  2WRM A;  4YQW A;  1UWB B;  2E5J A;  1ULR A;  4ZHR B;  2NXC A;  2JLG A;  3KWM A;  3M8S A;  2D9P A;  3MF5 A;  3G6Y A;  4N41 A;  2K1R A;  4WE1 B;  2CA9 A;  1E6Y B;  4JI2 F;  1RT5 A;  1DLO B;  1MW7 A;  1WC1 A;  2CNN B;  5E0O A;  5DG8 A;  1F6T A;  2OSQ A;  3I82 A;  5L9N A;  2NZC A;  2K7K A;  5IT9 Y;  2F1F A;  1X4C A;  4B9T A;  4NZ7 A;  3CCE S;  3ZZZ A;  4OX9 F;  1FWL A;  2ZEJ A;  1JNZ B;  3DXS X;  3IR6 B;  2DR9 A;  1G1X A;  1KN6 A;  4FS2 A;  2FVP A;  2QYC A;  1S1X B;  1YZ7 A;  5K14 A;  3GIL A;  4JOU A;  5H9E J;  1HNX F;  3AH6 A;  2V50 A;  1RDR A;  2PA3 A;  2WVD A;  1FDA A;  1S1V B;  4IH5 A;  3IS9 B;  5DQI A;  3AD8 C;  2ATC B;  2RRN A;  2W9C A;  3UFC X;  4EFA C;  3VF0 B;  3H25 A;  2IA0 A;  3CCZ A;  3SIP B;  4GKJ J;  2E1R A;  2OPQ B;  1GNK A;  3RB3 A;  2ZDP A;  4URS A;  3OLA A;  2XSJ A;  2PMW A;  2Q66 A;  4DR2 J;  4WFX A;  3W61 A;  4ED4 A;  4O0N A;  2RS8 A;  2B43 A;  1L3S A;  1IWG A;  1N32 J;  4I2Q B;  4DR5 F;  1BLU A;  3N5F A;  2UVV A;  1HNW J;  5KFJ A;  1EAR A;  1Q8L A;  3GV8 B;  4URG A;  3M2R B;  2VAS A;  2B0G A;  5E41 A;  2VF3 A;  4DV0 F;  4ELU A;  2J0X A;  5G4D A;  5CZX A;  3TR5 A;  2LXF A;  1KDN A;  3M6U A;  3MPU B;  2CQ0 A;  1VC0 A;  3HD1 A;  3N6L A;  4YDX A;  1ZA2 B;  2L48 A;  2MEW A;  2JL9 A;  3C6T A;  4KIA A;  4OX9 J;  2Y1I A;  2IYG A;  5FII A;  3I56 S;  3BSC A;  4G1Q B;  3TA1 A;  5J1P A;  4OI2 A;  2L9W A;  1GXT A;  2IVM A;  1CC7 A;  1S6Q A;  3MOJ B;  3MAH A;  2I0X A;  4JI7 F;  3ADA C;  2AT1 B;  3C6T B;  1RT6 A;  1X7V A;  1EP4 A;  1FRJ A;  1RYS A;  2LXU A;  4E8U A;  3CCW A;  4ZHR A;  3ILL A;  4DSF A;  3NGS A;  4IRK A;  3MCN A;  1IKV A;  3LP1 B;  2F4V J;  4I7F A;  4ID5 B;  4K8R A;  3DU5 A;  1O6X A;  2XGQ A;  1N56 A;  2UU9 J;  1R7I A;  2MYF A;  1BUX A;  2HVI A;  1IKW A;  2RHQ B;  2ROG A;  4TXS A;  1Y5N B;  3G6E S;  4I69 A;  2V8H A;  4FF2 A;  1VLO A;  1FF2 A;  3V81 B;  2KFN A;  1R3N A;  1U1M A;  2MSS A;  3MR3 A;  1RAA B;  4PG6 A;  2BM0 A;  5KFX A;  1JLB B;  3CJ8 A;  3QBC A;  3OR1 A;  3FDS A;  3S6E A;  1WC4 A;  5A6P A;  2CAD A;  2V63 A;  3G9C A;  4OYA A;  3ZZY A;  2B4P A;  5DRK A;  4CLU A;  3DLE A;  1FE4 A;  2APO A;  5B0F A;  4X4Q A;  3FBF A;  2CQB A;  4ZP9 A;  2MXY A;  1FKA F;  3BSO A;  2VOO A;  3SCJ E;  1W26 A;  4OHW A;  1VLY A;  4YR2 A;  1IJF B;  4LF4 J;  2ZNZ A;  3TP2 A;  4B9M A;  2HHV A;  4N47 A;  3CCL S;  4XDD A;  2IMW P;  2R8H A;  1FKO A;  4L75 A;  1YZ6 A;  1VIO A;  3JYT B;  1VBY A;  2E9T A;  5B0A A;  5EX0 A;  4TYB A;  1SCJ B;  3R5G A;  4HH1 A;  3G8Q A;  2MMY A;  4MT1 A;  4XDC A;  1HWJ A;  4F7V A;  1JMT A;  1IR2 A;  1VBZ A;  3DGP B;  4DUZ J;  1RBL A;  1B0T A;  1N33 F;  2XYH B;  4IFV B;  1WWH A;  2VHG A;  4DV3 J;  4EGL A;  3PR4 A;  3QZ7 A;  2DR8 A;  1VHI A;  1WOS A;  5G0R A;  1WEZ A;  1S99 A;  1MU2 A;  5K20 B;  1R8H A;  5JVG Q;  4J9L A;  3EVM A;  1T03 A;  2W01 A;  4KKO B;  3C2P A;  4F0H A;  4F04 B;  4X65 J;  2OD4 A;  1F2H A;  2C1E B;  3PJ9 A;  4MMO A;  3LWL A;  2ZJQ Q;  1S7H A;  2ZHB A;  4ICL A;  1PGZ A;  2JH3 A;  4QCL A;  4PPD A;  4C11 B;  5BYR A;  3GSI A;  1RWK B;  2AX0 A;  3NGU A;  3TA0 A;  4IG3 A;  4A8K A;  3OJU A;  5KG4 A;  2XY5 A;  7FDR A;  2CQ3 A;  2IYI A;  1XEZ A;  3D1Q A;  2DGV A;  3NGK A;  5LXY A;  2VQF J;  2OPP A;  2XMW A;  3BBC A;  3TX8 A;  1T94 A;  4NLO A;  2LEC A;  4ZVP B;  3TVK A;  3IM9 A;  1HBN B;  4KYZ A;  1G3O A;  3KTQ A;  1PKU A;  2MHN A;  3QQC D;  3TI0 A;  2IHR 1;  3MCS A;  3BB5 A;  4NI2 B;  4HAC A;  5KFH A;  3PRD A;  1RT3 A;  5AXK A;  1VQK S;  4ZPT R;  3R5A A;  1R8B A;  4DR6 J;  2D69 A;  2VQE F;  5EUH A;  7AT1 B;  4MIW A;  2D1C A;  2W1B A;  1WOR A;  1T9V A;  2KKH A;  2QE5 A;  5KFY A;  5F8M A;  2BQ3 A;  2AGP A;  1NK9 A;  3AB4 B;  3GJS B;  4LF7 J;  2R7S A;  4U7U K;  1NK5 A;  1NJZ A;  3J7Z T;  1OWX A;  1X0P A;  4MK9 A;  4ZPA A;  4RW8 B;  2K2P A;  3MMB B;  4M5H A;  4ZLJ A;  3PJX A;  3MAQ A;  5F0W A;  1SH2 A;  2DHA A;  1RWV B;  3UR0 A;  4PWD B;  4ETZ A;  1VR6 A;  2JJ4 D;  1UWA A;  1JXV A;  2CWX A;  2I5J A;  2YKM B;  2KT2 A;  4P2X A;  3PX0 A;  2J7U A;  4ZVF A;  1VQM S;  4OL8 A;  1OPI A;  3GFZ A;  3ISZ A;  3K5O A;  5DJB A;  4I0W A;  3TUJ C;  1WKL A;  4DG1 A;  2A6O A;  4DV5 F;  2VPW B;  3A8E A;  2M52 A;  1WEX A;  1QSL A;  1XNQ J;  1FI4 A;  2ZZM A;  4ED1 A;  5HBM A;  1U0H A;  3PX6 A;  1YJW S;  2IJN A;  2IC3 A;  4KHP F;  3VZH A;  2M2B A;  2J8S A;  1V3S A;  1OY8 A;  2NSC A;  2E44 A;  4DPY A;  5KAK A;  1S4F A;  1AW0 A;  5HRO B;  2ZJP Q;  2R4F A;  4JI1 F;  4MFB B;  3HLU A;  3UNY A;  1NAQ A;  3M9M B;  4LFC J;  2QA1 A;  2ZH6 A;  1U1O A;  5KFM A;  3BGF A;  4IQX A;  1A7G E;  1S59 A;  2KVI A;  2QT7 A;  2XZD B;  1YX2 A;  1S76 D;  4O0I A;  3WZ0 A;  4UUW A;  4C0B A;  5K8M A;  4HTI A;  4B3R J;  3VGS A;  5DG7 A;  3Q83 A;  5KG6 A;  4YME A;  4C97 A;  1DQ9 A;  4IG0 B;  4RW4 A;  4F25 A;  3DCA A;  4QU7 A;  3H90 A;  2UVU A;  3BEG B;  1X9M A;  2WBM A;  3EM1 A;  4F3O A;  1RTJ B;  4LQ9 A;  4QIW D;  2D3O 1;  5K8O A;  2Z58 B;  4CQ1 A;  4AL7 A;  4LVN P;  3U1N A;  3AD7 C;  3ENW A;  3QAE A;  6AT1 B;  3C15 B;  3CDB A;  4ANE A;  3QZ8 A;  2WK4 A;  4LRD A;  4IO9 Q;  1FJG F;  4U95 A;  2M0G B;  2ERR A;  1U6Z A;  7FD1 A;  1NUE A;  3EVW A;  3J81 U;  1N5T A;  4PXE A;  2GML A;  2ZFH A;  3I32 A;  3H40 A;  2FLP A;  4B3T J;  2HUR A;  1F2G A;  2HLU A;  2VPZ B;  4K4V A;  2HND A;  2V0N A;  2QG9 B;  2BYC A;  1YSJ A;  2XCP A;  3V6H A;  1Q53 A;  4WJB A;  2EVZ A;  4J9R A;  4C3L A;  4LSN A;  1FFG B;  4FBU A;  1S9G A;  1LOU A;  3ZFV A;  1C1B B;  2HRY A;  3LA0 A;  2H4Y B;  2B6A B;  2X3D A;  3EUN A;  3FC9 A;  1JJ2 R;  2DYA A;  1SI9 A;  5DGA A;  1HI0 P;  2QA4 S;  1TAQ A;  1WHV A;  4W90 B;  3FEX B;  2CQD A;  4M5I A;  3BZQ A;  3EZU A;  5KFO A;  1X9W A;  1HBU A;  1TEL A;  2XTJ P;  3O44 A;  2RDI A;  4PWU A;  2X1B A;  2ZH4 A;  1NH7 A;  3U7J A;  2XI2 A;  5D0R A;  2HHQ A;  1C0U A;  1S1U A;  3IAM 9;  6FD1 A;  3LUY A;  3UCG A;  3W9I A;  3Q8V A;  3K57 A;  2DXD A;  1S1T A;  2W7O A;  2RS2 A;  4GVB B;  2N4C A;  3GFH A;  4P52 A;  5HP1 A;  2C2D A;  4PQA A;  1TQL A;  4R8U B;  2H9Z A;  1FNX H;  4MYT A;  3F41 A;  3GB0 A;  3ITH B;  3BQ1 A;  5THW A;  3UDL A;  1SH3 A;  3SI8 A;  1NSK L;  3OTO F;  5DDQ C;  3MFI A;  4CM0 A;  2AGQ A;  4U96 A;  2XMJ A;  3F73 A;  3H5X A;  5AE2 A;  4C8Y A;  3BPS P;  3IC1 A;  3CIM A;  1LWE A;  4KB7 A;  2OFH X;  3ONQ A;  1RSC A;  3KFW X;  2CPD A;  2G9O A;  3FQL A;  4P2S A;  1UFL A;  1RHM B;  1WI6 A;  4DL4 A;  4I4B A;  4KHM A;  4PQU A;  1G7C B;  3KDN A;  4JV2 A;  2N7C A;  3K5N A;  4EBD A;  4XO0 A;  3T5L A;  2JVO A;  3DMJ A;  1FDB A;  3D7S B;  3M4X A;  3R7B B;  3ET6 B;  1Q8I A;  3NLC A;  4LRA A;  5SUH A;  2AU0 A;  3DLB A;  1P8G A;  4LFA J;  1FEE A;  4HAC B;  2KRR A;  5U47 A;  1HL6 A;  2C2E A;  1KWM A;  1S0V A;  3ZZR A;  2GAG C;  2HFO A;  3W2W B;  1CJU B;  2ZBC A;  3G6X A;  1GX5 A;  4OV1 A;  1NZA A;  2DXE A;  1XMO J;  3M1V B;  2FY8 A;  2W7A A;  1U48 A;  2VA3 A;  1OMS A;  3NS5 A;  2GVD A;  1VHF A;  4A8W A;  3FSI A;  4NCG A;  3RR7 A;  1ACM B;  3JAM Y;  4ECZ A;  1Z1Z A;  2OAU A;  2CZ9 A;  2HS0 A;  4B3R F;  5IT0 A;  1WAC A;  2UZA A;  4LF5 J;  2B5J B;  4MAK A;  2CPX A;  4I6Y A;  4OYZ A;  4ITS A;  2KZM A;  3GR0 A;  3K8V A;  3AJ1 A;  4O23 A;  5GAG I;  5L9X A;  3V4I B;  4HL9 A;  4DN9 A;  3Q8Y A;  2POK A;  1EX8 A;  3CO0 P;  4OJG A;  2FHK A;  1I94 F;  3DRS A;  4PG4 A;  3QIP A;  1YLX A;  4QQB A;  2IY5 B;  2QSF A;  2RKI B;  3UW1 A;  1HQU B;  2GX8 A;  5FDL B;  3TA2 A;  1SJ3 P;  3OXF A;  5C25 B;  3VAI A;  3H2L A;  3PEH A;  1HNI A;  3T9Z A;  1ZYQ A;  1N36 J;  3GJQ B;  2OFG X;  4JI3 J;  4K0K J;  1FEH A;  1F5B A;  1ZZN A;  2FQQ B;  1LWC B;  1NJX A;  1SQE A;  2VG6 A;  2WOM A;  2GGP B;  3HZE A;  3PYF A;  1IKW B;  4URQ U;  1J5O A;  1WJ9 A;  1SL2 A;  1HWK A;  1L3V A;  1XNR F;  1EZZ B;  1PYO B;  4DV2 J;  2HQD A;  4USV A;  3FQK A;  4OIX A;  1BQN A;  1U2F A;  3NGD A;  3ZZT A;  4F50 A;  3W63 A;  2A1B A;  3CMQ A;  4W4M A;  4DS4 A;  1V6H A;  1Q16 B;  4NLX A;  2V4R A;  4JV5 J;  5C24 A;  4FF4 A;  4HT5 A;  3E01 A;  4CNY A;  3W3S A;  1DTQ B;  3Q8P B;  2V2Z A;  1WTF A;  1E6V A;  1GEH A;  4OX6 A;  3IRW P;  1RLD A;  2Q6C A;  4DQS A;  4DFK A;  3CC7 S;  4NOH A;  3ZO7 A;  4C98 A;  3JSR A;  2UU9 F;  3DLG B;  3NS6 A;  1CS4 A;  4F3M A;  2L3M A;  5EDW A;  1VC5 A;  4M94 A;  1XTZ A;  2LVW A;  2OEJ A;  3NBP B;  1KS2 A;  1Y10 A;  4RW8 A;  4A8Y A;  2WON A;  1S10 A;  4OZ1 A;  1GXU A;  2P9G A;  4DR2 F;  1Q4R A;  3DRR A;  5E3C A;  1K9M T;  3TAM B;  1LQ9 A;  1U26 A;  4PQU B;  2K8G A;  3UD4 P;  3MD1 A;  3QGG A;  3HVT B;  4JI3 F;  1N36 F;  4KFB B;  2V2Q A;  3TYT A;  4NCA A;  3CT9 A;  3IP0 A;  4IYQ A;  4KV8 A;  3IFE A;  4WWS A;  4KTQ A;  2VUG A;  4B9N A;  1QE1 A;  1BC6 A;  5KFS A;  2J9D A;  2M3D A;  2RQK A;  1S12 A;  3OL6 A;  3Q24 A;  1HR0 J;  4EZ9 A;  3MPY A;  3G71 S;  1LEO A;  4Q2L A;  2IDE A;  1CUL B;  2BM1 A;  1JLA B;  2RHS B;  1AA1 B;  3HD2 A;  4Q0B B;  3WBZ A;  2HHX A;  4WII A;  5A8R A;  4DR6 F;  3CC4 S;  1VS3 A;  4CDI A;  1Y5I B;  1YBT A;  4OI1 A;  4MIB A;  3UD3 P;  3G6V A;  4FYW B;  2P8I A;  1S1X A;  4CYU B;  1I3O B;  1Q0N A;  2CPY A;  1RIS A;  2EW9 A;  2FIU A;  2RIJ A;  2XYP B;  2KL8 A;  4MK7 A;  2A2D A;  4DPW A;  3BYP A;  1ZPV A;  2FC8 A;  2IJF A;  3W5X A;  2KXH A;  1VQY A;  1UP1 A;  3D5M A;  1MWZ A;  3PR5 B;  3AJ2 A;  2NUH A;  1XNR J;  2HRT A;  3PYE A;  2HGM A;  2RAQ A;  5J1E B;  2YX4 A;  3NOG A;  5J1N A;  3G8T A;  3LWM A;  4EBE A;  4LFA F;  4ZS6 A;  4ZLP A;  3T1Y F;  5HLF A;  4RLE A;  3HK2 A;  2HHS A;  4OJH A;  1N52 B;  1F5A A;  4FZV A;  3TQE A;  1TUG B;  4LSL B;  4OHX A;  5JVH Q;  3BGU A;  3AA9 A;  4OHY A;  4JYA J;  5DZ6 A;  1IQZ A;  3DDK A;  5GAH U;  4X65 F;  1RT3 B;  3UDC A;  4ED3 A;  5KFN A;  5K8N A;  3KLH A;  4MKY A;  2GV1 A;  5DET A;  3N5B A;  3VAK A;  1BQM A;  1OO0 B;  2ABY A;  2VDH A;  4ZP7 A;  3RW7 A;  2MZT A;  3SQG A;  1L3K A;  3QNW B;  5CA5 A;  1PC5 A;  3CTR A;  2DY1 A;  4S0M A;  3CB4 A;  2ZD1 B;  2HQI A;  4MH8 A;  5D0E A;  1NK7 A;  3FEY B;  4HDG A;  2YNG B;  5A0Y B;  1WOO A;  3D66 A;  3C15 A;  1RHU B;  2VFU A;  2YNI B;  3M2V A;  2N4D A;  4QPT A;  4ZLL A;  3L3C A;  2OPS A;  2ZM6 F;  4DR3 F;  2ZBI A;  4USJ C;  3SBM A;  2PFF B;  3W62 A;  1RT2 B;  3KUE A;  4ES2 A;  1L3T A;  3QT7 A;  1HI1 A;  3U1M A;  1HBU B;  4FP9 A;  4WK3 A;  5BYQ A;  3RRG A;  4OHZ A;  3CF5 Q;  2E9Z A;  3MM7 B;  1HMV B;  2B9W A;  3T5J A;  2C2M B;  3MMC A;  4D3G A;  2FHJ A;  1T11 A;  1WNE A;  3L4B C;  2DO0 A;  3E51 A;  5A2Q Y;  3HHK A;  3QAT A;  1RZM A;  5CCM A;  3TAR A;  2HWH A;  4ZPC A;  3W5Z A;  3BR9 A;  2NYI A;  4YB7 A;  1NPP A;  2IRX A;  3ICL A;  4R0E A;  3OT9 A;  4FNI A;  3PKY A;  2XG8 A;  5HRO A;  4NLD A;  4JV0 A;  1NBE B;  3QMQ A;  3MM8 A;  2CJ9 A;  4KY3 A;  4DCP B;  5D8H B;  4RR5 A;  1VQ7 S;  3KLG A;  3EX7 B;  3BM7 A;  1TV6 A;  1TK0 A;  5A0Y A;  1D3W A;  4H54 A;  3JYT A;  5I3U A;  2B8P A;  3QSI A;  3SSQ A;  4YY3 F;  3PAC A;  4DV6 J;  5IC4 B;  1EQM A;  1JJH A;  1X5T A;  2HMI A;  1Y3J A;  2DNY A;  2K3K A;  4Q43 A;  2DIV A;  4ZCI A;  1B0P A;  1RHJ B;  5HLF B;  2D9O A;  4Z7C A;  2GFF A;  3GCX P;  5KFP A;  1JLG A;  4UTG A;  2IVY A;  4WU3 A;  2QLX A;  3M9N B;  2C3P A;  4ECQ A;  3T1Y J;  3UWT A;  3W9H A;  3UVJ B;  1LFP A;  2D7S A;  2DH9 A;  2QFI A;  2RH3 A;  4ANC A;  4K4W A;  1NDP A;  2DNZ A;  3MEE A;  1TKX B;  3HHD A;  5BXI A;  2JX2 A;  4LMZ A;  2ASL A;  3SXL A;  4LF8 J;  3AB2 B;  3RTV A;  3CCS S;  4Y2C A;  4CH0 S;  3A4T A;  4YHH J;  2CQP A;  2FJV A;  2ZZN A;  5ETS A;  3THP A;  4XPC A;  3JB9 k;  1HBO A;  4PXD A;  3UQS A;  1RYR A;  2AJF E;  1S1W B;  1BWE A;  1SC4 B;  5AXM A;  3M8P A;  3QFW A;  2WZ1 A;  4CH7 A;  2F3J A;  1SUQ B;  1RWO B;  2KT5 A;  4RJV A;  1FWP A;  5HVF A;  5EX3 A;  3RUB L;  4J91 A;  1GMW D;  3KLE B;  1HWL A;  2FHJ D;  2OEL A;  2DNP A;  1NPK A;  1KTQ A;  2VG7 B;  4M5J A;  5G0R B;  5FD1 A;  3MOZ A;  3GYG A;  2J9E A;  1Y4Z B;  2W9B A;  2VU5 A;  4P9S A;  4TLQ A;  2KU7 A;  2R8I A;  1NK6 A;  2CJQ A;  3AY0 A;  2F5G A;  1S4E A;  3M32 B;  4KGM A;  2GAH C;  3L7P A;  4KAI A;  4M63 A;  3M2U B;  4DXL A;  2HHP A;  5JJB A;  2WBR A;  3AOD A;  3MWB A;  1HA1 A;  2KM8 C;  2NUU G;  2YXL A;  3GJR B;  5KFF A;  2GJI A;  1UA1 A;  1Q5V A;  4KR0 B;  4ECU A;  5L46 A;  4ELT A;  2WON B;  1CQN A;  2OHD A;  5DDO C;  2JRS A;  1RT7 B;  2ZHA A;  1LWF B;  1TL7 B;  2EC2 A;  5HJX A;  2J5A A;  2MLZ A;  2YY3 A;  4JI6 F;  2A10 A;  4DCO B;  2E1C A;  3NMA A;  4F4X A;  1RA7 A;  2H51 B;  2CJK A;  3KK3 A;  4GKK J;  3KUG A;  1Z2Z A;  4RPF A;  3CJ4 A;  2FC9 A;  5C24 B;  4Q8F A;  1HNW F;  3H0P A;  1YG0 A;  4UST A;  3W60 A;  1YRT A;  1S9F A;  2IIH A;  4K4Y A;  1U6B A;  2E5H A;  1WG5 A;  4CLF A;  4KGV B;  5KFT A;  1M1H A;  4V1A k;  1RTI B;  1X4D A;  4QIG A;  3PO5 A;  2JLE A;  1N88 A;  2DGQ A;  3LGM A;  3CDE A;  2Z56 B;  1QAY A;  1T9U A;  1MMN A;  4UOH A;  3C14 A;  2WSE C;  4ZVR B;  3C19 A;  3MAA A;  1JLQ A;  1F3V A;  4EO8 A;  1VYA A;  4QW9 A;  1JWW A;  3HP6 A;  4Y2A A;  2OH2 A;  4OHV A;  3AXM A;  1T3O A;  2EWH A;  1W7W A;  1NZ8 A;  2C28 A;  3SQO P;  1N34 F;  4USW A;  2BJ9 A;  3SMZ A;  1VQN S;  3LP2 A;  1RTH B;  1S6O A;  4TY8 B;  4OZ2 A;  1J5E J;  1AFI A;  2YNG A;  2DHS A;  4OX8 A;  3C8Y A;  4J7C A;  4BBY A;  3TO8 A;  2K3I A;  3PIO Q;  2UP1 A;  4UZB A;  1IUJ A;  2W7P A;  3P5T L;  4AT1 B;  1U25 A;  2W2O P;  3IRX B;  2IM1 A;  4PRF A;  1TTH B;  4WFA Q;  4C11 A;  4RNF A;  2XZT B;  4ZN1 A;  1NPR A;  1BQX A;  1S6P A;  3D68 A;  1PC4 A;  2DT9 A;  2X7I A;  3Q23 A;  1UWB A;  3HO1 A;  3X1L B;  3TJ8 A;  4WFY A;  8RUC A;  3KG1 A;  1RCO B;  3QJP A;  2RB7 A;  3PKM A;  4ILM A;  2HZC A;  2PFD A;  2DR7 A;  1HYS A;  2E1M C;  2VG5 B;  4E2F B;  2HK2 A;  2ILZ A;  4OI4 A;  1SJR A;  5F9N A;  1VGY A;  4WF9 Q;  4JB8 B;  3PYD A;  1YWX A;  2J0W A;  3POT A;  4HT7 A;  1PYT A;  4IDK A;  4ZP6 A;  3JSM B;  3NP5 A;  4DR1 J;  2D74 B;  2HHH J;  4ZVO B;  3ILI A;  2JFD A;  1IKY B;  4GVL A;  1PJ5 A;  2I38 A;  3G2X A;  3MEG A;  4DV1 J;  1U1L A;  1UZH A;  3H59 A;  5KFR A;  3BJY A;  5L8R C;  4DR1 F;  1M5O C;  2VKZ G;  4NLT A;  1T8E A;  4ECS A;  1S9E B;  2DGW A;  2NXE A;  3GR1 A;  3MCM A;  5GME A;  9RUB A;  2AHO B;  2KO1 A;  3DOK B;  1FDD A;  1XMB A;  3DI6 A;  3ZTP A;  4P7V A;  5KOW A;  3Q8Q B;  3FRY A;  1GH8 A;  5LSO A;  4DL7 A;  3TUZ C;  3CPW R;  1H74 A;  2XWY A;  2BAB A;  1S6P B;  4NZ0 A;  2NXU A;  5KG0 A;  5KFG A;  4GC7 A;  2LDI A;  2AEF A;  5C2G A;  1NDL A;  3BYR A;  1TVR A;  3X3U A;  5KFE A;  3RB4 A;  3N4W A;  4DSK A;  4GVB A;  4C8L A;  2NLW A;  3DOM A;  1HBM A;  2DB1 A;  4DQQ A;  2FLL A;  1RP5 A;  2DTJ A;  1RTJ A;  3DOL B;  3GFX A;  4QU6 A;  3F56 A;  2HNZ A;  4HR2 A;  3A13 A;  2UXB J;  4WP3 A;  1NLK L;  2HS4 A;  2WW8 A;  1QLN A;  4I6A A;  2W4C A;  1TAU A;  1RLC L;  3IS9 A;  3VAL A;  1FA0 A;  3OL8 A;  1N8R T;  4NEY A;  1M1K T;  1ROF A;  2NR0 A;  2F4V F;  3EXC X;  3C6U A;  1SJQ A;  1E6Y A;  2HEK A;  3C66 A;  3W65 A;  4DI6 A;  4RUA A;  2ZH8 A;  4YR3 A;  5JUM A;  3G87 A;  3KLI A;  2KI2 A;  3MEC A;  5B0E A;  4AUK A;  4M1K A;  4X4P A;  4ZIW A;  1Y9O A;  3NAI A;  5KFD A;  4YB5 A;  1Y0H A;  2XEX A;  3DLK B;  2MJU A;  1NU4 A;  4YUD A;  2HNY B;  4BWJ A;  3HT0 A;  4JI2 J;  5EHH A;  2WAQ D;  3NRB A;  3W2V A;  3OUY B;  4M95 A;  2FB0 A;  2F8H A;  5HI7 A;  2YNH A;  3DYA B;  3JQK A;  3P5B P;  2JSX A;  5D3G B;  1IKX A;  1NHK L;  1RT4 B;  2BAN A;  2E66 A;  4C3M A;  3VR1 A;  2BOP A;  4ERD A;  3CCJ S;  4DX8 H;  2KN4 A;  3J7Z 5;  3OPK A;  4HH0 A;  1FX2 A;  2YKN A;  4LF6 F;  2XO6 A;  4FF3 A;  3QAU A;  1FD2 A;  3WX4 A;  1VMB A;  4ZLN A;  4AQY J;  3PIP Q;  2HVH A;  3HKZ D;  2R7T A;  1WC6 A;  1LWF A;  1TL7 A;  4EUV A;  2G0J A;  3KHH A;  2AGO A;  1VRT A;  1CJV B;  3DRP B;  3HI9 A;  2J8A A;  2YWH A;  4KQZ A;  2DGT A;  3IBF B;  2PMZ D;  3KMS A;  2XCA A;  5AXN A;  3OR1 B;  3Q89 A;  4QBU A;  3PY8 A;  4MJK A;  4FXV A;  2BE7 D;  2XYG B;  4WBF A;  5KG5 A;  2VJV A;  2UUB J;  2JLF A;  1DBD A;  4Y3C A;  4JI4 J;  2F63 A;  2LQ5 A;  1TV6 B;  4DZD A;  1N5Q A;  5KT4 A;  1S0O A;  2GCF A;  3Q8R B;  3GMG A;  2BRL A;  3OBI A;  1UAW A;  4OMF G;  1LWE B;  2GQQ A;  2J0S D;  4WU2 A;  1OS5 A;  4OYM A;  3U1L A;  2HFV A;  2B7C B;  3BSA A;  1QUV A;  2FZC B;  5HVG A;  4O4G A;  1SXL A;  1C4A A;  2B3T B;  4IOC Q;  2DGS A;  2F9D A;  5ETN A;  3C46 A;  3PVX A;  2P5V A;  1DJ0 A;  3F44 A;  3MI7 X;  1UEV A;  3EVO A;  3MEK A;  2H1Y A;  1ZZF A;  2ZKU A;  1ZPW X;  2UXB F;  1EQ0 A;  1OJ4 A;  1TUW A;  2DCU B;  2XLK A;  3TW0 A;  2FDN A;  4RBU A;  4YN3 B;  4A8X A;  2EK6 A;  2VFV A;  4X66 F;  4P75 A;  4KHP J;  4O3R A;  3FMW A;  4M5L A;  3R6L B;  1SC6 A;  3KOA A;  1YKW A;  4O3S A;  3W5Y A;  4NRT A;  1DQA A;  3GIR A;  2E7W A;  2CZ4 A;  3ENQ A;  3VCD A;  5T14 A;  2YKQ A;  1GTH A;  2VOD A;  1TKT B;  2OKQ A;  4C8K A;  5HAT A;  2VJU A;  5LL6 d;  4TU9 A;  4NX9 A;  3ZNJ 1;  2AYM A;  4K4X A;  2VBW A;  1T3N A;  2H3E B;  3PRB A;  4IRC A;  3DLG A;  2NYH A;  1RT7 A;  3LH2 S;  1NSQ A;  1SJ4 P;  4KPY A;  4CH1 A;  1X4G A;  5ETR A;  5F8N A;  4DUY J;  3OFG A;  4OFZ A;  5B08 A;  3N28 A;  2ZZT A;  2G4B A;  3BDE A;  3R97 A;  1GQE A;  3MPV A;  2MJN A;  4C48 A;  3HSZ A;  1H2T Z;  2ZUA A;  2V8P A;  4ES3 A;  3I55 S;  5GMD A;  2DIS A;  3M2U A;  2CPF A;  3DM2 B;  4WP9 A;  1VQ8 S;  4L3K A;  1RAJ A;  2VL1 A;  2W9A A;  3CCQ S;  1NM2 A;  1U6F A;  3CD6 S;  4ZP8 A;  2NPF A;  2MKI A;  4ENO A;  3DNC A;  3S01 A;  1N54 B;  5T7L B;  1S48 A;  3C14 B;  1C4C A;  3N6M A;  3T5K A;  3KLE A;  2XNR A;  3GSD A;  1K1Q A;  5H9F K;  3EDQ B;  1WSV A;  3EE3 A;  3K5P A;  5EWF A;  2G0C A;  4DL3 A;  1FFW B;  2UUT A;  3L09 A;  1JLA A;  1O8B A;  2ADC A;  2LLZ A;  4H4M A;  3RRK A;  3UCZ P;  4BS2 A;  1KSP A;  2KG1 A;  2Z2Y B;  2E29 A;  2IRU A;  2Z8Q A;  3T41 A;  2W2P P;  2J0Q D;  1HW8 A;  5ETV A;  2QGF B;  4TQS A;  4A8S A;  1SKS A;  3PYG A;  2GHV C;  4TU7 A;  1S0N A;  2VON A;  2CJY B;  4RW7 B;  4NLY A;  1UMJ A;  2ZC4 A;  1RWP B;  4J37 A;  2YH1 A;  1RJJ A;  1S5Z A;  3T6J A;  2UXC J;  1IR0 A;  1HD0 A;  3R7S B;  2XGP A;  1C0T B;  4LBP A;  5HQM A;  5F8G A;  2DIU A;  3BGR B;  1IXK A;  4OYW A;  1FHT A;  1IBM J;  1KVI A;  2HBZ B;  4C9D A;  4D3H A;  2XY7 A;  3WQP A;  4DPO A;  3KNA A;  1KVJ A;  2KHD A;  2LEA A;  1HFE L;  4Y28 C;  1L5U A;  2DHH A;  2DH8 A;  1HKA A;  3OTO J;  3B4D A;  2BQR A;  2XI3 A;  1DFD A;  5LT5 A;  3T3F A;  1YJN S;  2EKY A;  4L3N A;  2R7U A;  4G65 A;  2ZOM A;  5AJ3 J;  3DRY A;  4ALZ A;  1L3U A;  3LW5 C;  1LXJ A;  5F3Z A;  1ARO P;  2LA6 A;  2KJW A;  2P6S A;  4ZN3 A;  2YX1 A;  3DYA A;  1ZTW A;  1VI7 A;  2BJ7 A;  2PC6 A;  3I31 A;  2LP4 A;  2M70 A;  3QGH A;  4FYX B;  2KHC A;  3ENA A;  5AE3 A;  2ZE2 B;  3EMT A;  4JUZ A;  3K5L A;  4B17 A;  4E98 A;  4B3S J;  1N5V A;  2JEG A;  2BEF A;  3NMR A;  1HNV A;  4F2S A;  4GKJ F;  2FHO B;  3A3O B;  2I1R A;  4L76 A;  2XQC A;  4J9U E;  3LF0 A;  2M88 A;  4ED0 A;  2E7V A;  4RBT A;  3S1T A;  4ZK7 M;  4B9V A;  1RAH B;  4OX7 A;  3TEG A;  4DV3 F;  1ELO A;  4ECV A;  5GVQ A;  2JWN A;  1AYE A;  3DRX A;  2CQ1 A;  3KXD A;  5D6G A;  2XLI A;  1TKZ A;  3CC2 S;  4DFM A;  4KJI A;  1JXL A;  3JTP A;  2EBG A;  2MQQ A;  1FJE B;  2FTR A;  1ZAV A;  4BC7 A;  2UUC J;  4B08 A;  4Y2M A;  2MST A;  4X64 J;  2MLX A;  3D0G E;  4JI8 F;  1QE1 B;  1X5S A;  4RNM A;  4U9R A;  3OL7 A;  3V4M A;  2MGZ A;  2OUG A;  2YKN B;  2BRK A;  2PN6 A;  5CCL A;  2IMO A;  2ZBR A;  4DX5 A;  2B5J A;  5GAE U;  4ZVE A;  4C8O A;  5AXL A;  1IKV B;  3SCL E;  1KNZ A;  2O3D A;  1B0V A;  2IBK A;  1TL1 B;  3PZP A;  1KLM B;  3LO3 A;  4X4S A;  3H4D A;  3AOA A;  1H98 A;  4QZV B;  5SZT A;  2QRR A;  2HQ3 A;  1CLF A;  1LW0 A;  2HIY A;  4DSJ A;  1R0C B;  1QDU B;  2Z2Z A;  2AZ3 A;  1AUD A;  2XS7 A;  2DXF A;  1X4H A;  4P6Q A;  4LFB J;  3B78 A;  4OZN A;  2YNH B;  1RQ0 A;  2ZH5 A;  1Q78 A;  2EFP A;  2BAN B;  3MM8 B;  1WKJ A;  4IOB A;  5EWE A;  2CRL A;  5IT4 A;  3EZ5 A;  2V67 A;  3BF4 A;  1WF1 A;  2ZNY A;  3DLE B;  1QVG R;  2J6T A;  4ZVH A;  2BDP A;  4ZVU B;  1KQG B;  4AQY F;  2XUL A;  3TVZ A;  4N5S A;  3SSR A;  2NS1 B;  3SCI E;  1UVK A;  2M7S A;  2E7X A;  4ZPB A;  5LJ5 Y;  3V6D B;  5A8W B;  1T95 A;  1V3Z A;  1HQE A;  3BGO P;  1VBK A;  1X0F A;  4KT0 C;  2CDQ A;  5IM0 A;  1JLB A;  5BR8 F;  1KOO A;  2CNK B;  1PSD A;  2BKO A;  4RL1 A;  2EXU A;  5F0U A;  3CUN A;  1EAY C;  2Y1L B;  1XJW B;  3M6X A;  4PAA A;  4AXI A;  3K59 A;  4LSZ B;  1W2B R;  4K5S A;  4PUO A;  2YWW A;  2VG7 A;  1KTV A;  3J7Y U;  3C16 A;  4KGZ B;  4DR7 F;  4FPR A;  4LRF A;  3AD9 C;  5HQ8 A;  5HSP A;  1YK9 A;  3UPF A;  2DRB A;  1RT1 A;  4HEA 9;  3SYZ A;  2PEB A;  2DO4 A;  2W9C B;  4DSE A;  4WZM A;  4ZJQ A;  4DR3 J;  3V81 A;  2CPJ A;  3TQ1 A;  2E5I A;  3CCV S;  4PPZ A;  3OQ2 A;  1XQI A;  2CQI A;  2BW2 A;  2CJX B;  3BDP A;  2C3O A;  3NOC A;  1GTE A;  3PCO B;  3MCO A;  2IM3 A;  4DR5 J;  2Y9H A;  1LWX A;  2L9D A;  2H48 B;  3K89 A;  3SV3 A;  4H4O A;  2HFS A;  5ETL A;  3D6T B;  2QSW A;  4HI2 A;  3ZZP A;  1UVL A;  1Q79 A;  1QTM A;  5HAN A;  3KLI B;  2K06 A;  3NWG A;  2DR6 A;  4WP8 A;  4X62 J;  2E1P A;  2Z0G A;  3N79 A;  3LGN A;  1AFJ A;  2DNG A;  4I68 A;  4TYA A;  1JLC A;  1FKP A;  3CNQ P;  2CQC A;  3FCH A;  5J2N B;  5J2M B;  4O3P A;  4B3M F;  3HJF A;  3MXH P;  2OLW A;  4C6A A;  1KFS A;  2J7W A;  2VPY B;  3HF5 A;  5AJ3 F;  1RT1 B;  4NXM J;  4AL5 A;  1B99 A;  5EWG A;  2RT3 A;  4JYA F;  3ILO A;  4NLV A;  3I0R B;  1JLE B;  1LWC A;  2PE8 A;  2Q6B A;  5CYQ B;  1UCN A;  2CWK A;  4MKB A;  4M5K A;  1NK8 A;  2E1A A;  2GIQ A;  2V5H G;  3TAM A;  3V6D A;  2MPU A;  2C2O B;  1WG1 A;  1OPZ A;  5D15 A;  2YPZ A;  2BX6 A;  3US5 A;  2NQP A;  1HQE B;  1ZA1 B;  2HVZ A;  1UZD A;  2GZO A;  4LF9 J;  1BHN A;  1N6Q B;  2UXC F;  3D2W A;  2AJQ A;  1MU2 B;  3MM7 A;  3D3B J;  1PBA A;  4DX6 A;  2CQG A;  2PMH A;  1WKK A;  1LKZ A;  2HBQ B;  2MKS A;  2WVC A;  4ZA1 A;  2H5J B;  1JLQ B;  2N3L A;  4C8N A;  3MAA B;  3IO1 A;  3UN3 A;  5A76 A;  1GT8 A;  1RWM B;  4NCG B;  2IJR A;  3CIZ A;  4ZVG A;  3D0H E;  4V19 J;  1HLW A;  3G86 A;  3NCQ A;  2YNI A;  3M2V B;  5MLC V;  4P2F A;  2O01 C;  2V8D A;  3EGN A;  4QOT A;  4ZPV R;  4U67 Q;  2JC0 A;  3BO3 A;  1NH8 A;  1N5Y B;  1J5E F;  2XMT A;  3OFF A;  2EK1 A;  4CLW A;  1YDL A;  3R1H A;  4DCJ B;  3H5Y A;  3A12 A;  1BQN B;  2O5D A;  2YWK A;  3HFV A;  2DGX A;  4X2B A;  1FCA A;  1RTI A;  1WUU A;  2XMU A;  2YQ3 A;  4DWI A;  2GQ2 A;  2RF2 A;  4OYO A;  1D9D A;  1DTQ A;  3ZC4 A;  4PZV A;  1IKY A;  1RB0 A;  1OQ3 A;  1QTN B;  2BW7 A;  2F7V A;  4A4J A;  1D8Z A;  1TL1 A;  4A8F A;  3D67 A;  4DL0 C;  2QYG A;  4W98 A;  4WCE Q;  2DHX A;  3J7A 1;  3OHB A;  3OXL A;  2L9N A;  3H5U A;  2FJB B;  4DPX A;  4F0M A;  4DV7 J;  4LF2 A;  4O44 A;  2VG5 A;  1SV5 B;  2GHW A;  3RW6 A;  1KQK A;  4C8Z A;  3GII A;  3KK1 A;  3A3N B;  3FCW A;  3JSB A;  5KFB A;  4B9L A;  2J6U A;  1CJT A;  3E2E A;  1X4F A;  1F1B B;  3V2U C;  1PAE X;  2CQ2 A;  2PT0 A;  3QT8 A;  5L38 A;  4NEZ A;  2I2Y A;  5HVH A;  4K4S A;  3P45 B;  2H54 B;  3HM9 A;  1S1W A;  4DV2 F;  3SEO A;  3IWN C;  2Q79 A;  3EDR B;  4QIF A;  2GVZ A;  3R6G B;  2ZH3 A;  2OD6 A;  2E9R X;  1HI8 A;  4J9V A;  1GX6 A;  2DJW A;  1AT1 B;  1C0U B;  1S1U B;  2GIF A;  1J2V A;  1RTZ A;  1XIQ A;  2Z30 B;  2QFJ A;  2BJ8 A;  4OZJ A;  3OSP A;  2DKO B;  3ILJ A;  4MKV A;  2YX7 A;  1BMQ B;  2DNR A;  2WVB A;  3ETO A;  1TKZ B;  3VZI A;  4J9O A;  3DN9 A;  3M6W A;  3MED A;  5E7O B;  4J9N A;  4QYZ J;  4UOC A;  3FBE A;  2BJD A;  4RNH A;  2OEK A;  4Z2X A;  2M5Y A;  1UPP A;  2AJ2 A;  5HBM B;  3C3L A;  2W8K A;  1HBO B;  2EFV A;  4TVA B;  3MM5 B;  3EPI A;  3QGI A;  1V5V A;  4X64 F;  3OFH A;  4ZCM A;  3I87 A;  3HSJ A;  2VFT A;  1TL5 A;  1HR0 F;  1M5V C;  4B3M J;  4PG7 A;  3IGN A;  3PEJ A;  1R8C A;  3MTK A;  5GAE I;  3DXB A;  1EET A;  3FZB A;  1MRO B;  4Z7Y A;  4FYD A;  3PXG a;  3WC0 A;  5ETM A;  1WDD A;  1J27 A;  5I3P A;  4C8M A;  2BE2 B;  3G4S S;  4N7T A;  1G4C A;  2QLJ B;  2R3V A;  3H8Y A;  4PXB A;  3RJM B;  2XM3 A;  5F8J A;  2KTQ A;  2OGU A;  4DQP A;  2ZOG A;  3UNG C;  2MKC A;  4I67 A;  3PRV A;  2BKN A;  4WIQ A;  3OSN A;  4LF7 F;  5C2C A;  4LR8 A;  2V6A A;  3C16 B;  4B9U A;  3BGR A;  3UN5 A;  3O8W A;  5EN1 A;  1OSD A;  2EPI A;  3FBC A;  1IBL J;  1HAR A;  1BY9 A;  2RDJ A;  5ADZ A;  1AXQ A;  2D3Z A;  2MKJ A;  4OYB A;  5KFV A;  1T05 B;  4LFC F;  3LAM A;  5CD4 H;  2HG4 A;  3GU0 A;  4CLP A;  1CQM A;  2FGC A;  2KXF A;  4WXO A;  4GC6 A;  3MPD A;  3RBX A;  4ILR A;  4KO0 A;  5D0G A;  2C3M A;  1UW4 A;  1DUR A;  2B9E A;  2JHE A;  3MR2 A;  3G96 A;  1KVK A;  3VAM A;  3TX0 A;  1B64 A;  1RT2 A;  2ZE2 A;  2P9E A;  3PJW A;  4MKA A;  4WXW A;  3TOQ A;  1N5S A;  3M8P B;  4UOF A;  1UEK A;  1IM6 A;  2GMJ A;  5LSR A;  3UDE A;  4XAK A;  2EFG A;  1B4S A;  3D9B A;  3MM9 A;  3DC2 A;  3I96 A;  2K1R B;  3IG1 A;  3PM9 A;  4WE1 A;  2GVD B;  3HMJ G;  1HBM B;  3Q0A A;  3M7V A;  2R7R A;  3N9U C;  5L1L A;  3J7A N;  4E0D A;  1T9X A;  1WEY A;  4WKY A;  1Q1K A;  1WOP A;  5E33 A;  2QLB B;  5H1S V;  2N82 B;  4EEY A;  4NXN J;  5J2M A;  1N33 J;  2HND B;  2HVD A;  3FMB A;  1R0A A;  3RRH A;  4ED5 A;  3A1Y G;  4KGX B;  1F9F A;  3BKT A;  2LEB A;  3IA0 A;  1VQS A;  2KT3 A;  4KRW A;  3JAM U;  2RJZ A;  2C3U A;  3A3P B;  2DNM A;  5ETT A;  3TNV A;  4ZJL A;  5D4N A;  1EHW A;  2ADB A;  1S6U A;  4RNO A;  3RYL A;  1UJ4 A;  1URN A;  3DLK A;  2HGL A;  1N5Y A;  3MR7 A;  3TJA A;  4P73 A;  4OV6 A;  2DNH A;  3QGP A;  1FWK A;  1RAO A;  1HHS A;  1R8A A;  3GLJ A;  4JI5 J;  1FJC A;  1Q81 T;  5HJY A;  1UJ6 A;  3KJV B;  4B3T F;  1T9W A;  2AYE A;  3CD7 A;  1FE0 A;  2XY6 A;  1UVJ A;  1S57 A;  1RWN B;  4PR6 A;  3MHY A;  1WI8 A;  2KXN B;  3GTY X;  2ZH9 A;  1BE4 A;  1P27 B;  3TRG A;  4LIW A;  4DX7 A;  5KFL A;  2Z57 B;  4B3O A;  4UQT A;  4TU8 A;  4LRC A;  4B3O B;  1QSY A;  1TVR B;  2GIR A;  4ZKA A;  2B7B B;  3VAF A;  3G82 A;  4A8O A;  1VRU B;  1WC0 A;  4KGK A;  3IR7 B;  3Q22 A;  4DV0 J;  2CNO B;  2ROE A;  2OPR A;  4L73 A;  4PWW A;  5CH7 B;  4LF5 F;  3KG4 A;  5IZH A;  2FJE B;  4KKO A;  3TUI C;  4ATN A;  2X51 A;  1GK8 A;  1PYS B;  2B4V A;  3FGV A;  4OI3 A;  4MTP A;  4CLS A;  2ATL A;  1S1T B;  4U8V A;  2VC0 A;  4U6P A;  5KFK A;  1FNM A;  2MQN A;  1H6K X;  3IAS 9;  2KFY A;  1KQS R;  5J2P A;  2JDJ A;  5IM0 B;  1RAE B;  3LP1 A;  4USU A;  2VIH A;  3HVT A;  3HHL B;  2HFZ A;  5K8P A;  3PW2 A;  2AW0 A;  3H98 A;  2AIR B;  2RD5 C;  2AEJ A;  2B9Y A;  3I0R A;  4XK8 C;  1FK9 B;  1DLO A;  1QAI A;  5ITH A;  1MNE A;  2VPX B;  5F8H A;  1VQ5 S;  2M8D B;  2YQ1 A;  3I6P A;  1WHW A;  2Q3P A;  2X1A A;  1SKR A;  2VV5 A;  2AV5 A;  3M1V A;  4OQJ A;  2RU9 A;  1N0U A;  4M5G A;  4CLY A;  3GIK A;  4NLR A;  4JI7 J;  3D1O A;  2H5I B;  4X4R A;  2NCK L;  2JVR A;  2G1D A;  5D4O A;  1U2C A;  2OMO A;  3KUH A;  3OTC A;  1NK4 A;  1GAO A;  2HFN A;  2B4O A;  2GA7 A;  2G13 A;  4USK A;  4U8Y A;  3R1L A;  3VGU A;  4OJ1 A;  3ET6 A;  3KG0 A;  1HHQ A;  2J9D E;  1K47 A;  4CLT A;  2NZ4 A;  1Z4U A;  3PTW A;  1EJ7 L;  4R25 A;  1NDK A;  2VBZ A;  3DRS B;  2Y8Y A;  3TZZ A;  2VH7 A;  4K7Q A;  2KM8 B;  2P6T A;  3I5B A;  2MZ1 A;  1JKH A;  1M0S A;  1PIE A;  2BUN A;  1X5O A;  5RUB A;  2W4P A;  5HK4 A;  3WX8 A;  2GNK A;  5KFQ A;  1RAG B;  3T9N A;  2HAI A;  2PGC A;  1S0M A;  1UPM B;  5DQG A;  4BLG A;  1TU0 B;  1OY9 A;  3A8K A;  4NE9 C;  3GCW P;  3JQJ A;  4DMZ A;  1VRU A;  1JKH B;  1U0H B;  3CWJ A;  5HN0 A;  2AX1 A;  2HHW A;  4X4U A;  5C42 A;  3KLH B;  1RTH A;  1R89 A;  2HWT A;  2E5G A;  2XC9 A;  3VAG A;  4RKU C;  2YQ0 A;  2MQP A;  5CD4 A;  1HPZ B;  1KBR A;  3M6V A;  4MFB A;  5DQH A;  4QWD A;  2LQB A;  3K7R A;  4LF9 F;  4DR4 J;  3EGZ A;  2RQ4 A;  1H7W A;  3I0S A;  5KT2 A;  4P71 A;  2I5J B;  3QRR A;  3PNI A;  2XNQ A;  2V8G A;  1FRL A;  3JTN A;  3QID A;  1IR1 A;  4MYU A;  1FO1 A;  2J9C A;  5J1E A;  4J9S A;  1YHQ S;  3CUL A;  3SZ2 A;  1KOH A;  2MZR A;  3M8Z A;  4WKR A;  3DOK A;  3RGI A;  1TR0 A;  4DV4 F;  1V5I B;  2BAC A;  2NXJ A;  3ETM A;  4CO5 A;  3CMA S;  1VDH A;  4JI8 J;  1FRI A;  3BSN A;  1FVQ A;  5F9L A;  1IWA A;  1NHV A;  2BA9 A;  3BO4 A;  2ZH7 A;  2D3O R;  3IBW A;  1LW2 A;  3EZO A;  3NG8 A;  5I42 B;  4LF1 A;  3KJQ B;  4F0K A;  2HYI B;  3L7O A;  1JJC B;  5ETQ A;  1XR5 A;  4QW8 A;  3V6J A;  1TK8 A;  2ACY A;  2HAF A;  5D3G A;  2J7K A;  1FJG J;  1K44 A;  2F9J A;  2FJW A;  2WSC C;  1K73 T;  1KQF B;  4DL5 A;  1UJ5 A;  2ZUG A;  3TJ9 A;  1Q8K A;  5DM7 Q;  2AYG A;  2FY1 A;  4TLR A;  4WTO B;  2W25 A;  4ECR A;  4WYW A;  2JEJ A;  1SBR A;  2GS8 A;  1FRH A;  1ITP A;  3S7R A;  3MR6 A;  4X66 J;  1NDC A;  2C2Z B;  1SL0 A;  2AJ1 A;  3M8Q B;  2ZH2 A;  4DV7 F;  1H73 A;  5LMU J;  4J90 A;  5J2Q A;  2QX0 A;  3N01 A;  3MMA A;  2KJV A;  3GV5 B;  1Y5L B;  4LR9 A;  4WPA A;  2HSE B;  4P72 A;  3QSY B;  1RWX B;  4DSI A;  2QMU B;  1BD6 A;  2KYZ A;  4CO0 A;  4CM2 A;  5IS2 A;  1KC8 T;  3Q86 A;  4YFU A;  1OIA A;  4CTA A;  3DLL Q;  4LRB A;  2XMV A;  3K8W A;  3KJF B;  4FKX A;  1M5K C;  1Z2L A;  2ZHO A;  3MMJ A;  1S6Q B;  3W64 A;  1FJ7 A;  1HD1 A;  3D1H A;  2LEP A;  3JXO A;  1JQG A;  5DS7 A;  5IWA J;  2P2C B;  2J6S A;  1Q82 T;  1UW9 A;  5KFC A;  3OTE A;  1XR6 A;  2DPJ A;  3AXK A;  1KLN A;  2Y0B B;  4L74 A;  1HWU A;  2V4J A;  3M30 B;  3R9L A;  3ZZU A;  1XMO F;  3DGP A;  3UCU P;  4FVM A;  1GMV A;  1SPB P;  2U1A A;  3HFK A;  1SVD A;  2CQH A;  3KJV A;  3K58 A;  2CPI A;  1VBX A;  2VBX A;  1GMU A;  2ZVS A;  3NY0 A;  4I2P B;  1F60 B;  2XBP A;  3HSD A;  4ZVS B;  4LIR A;  4NYP A;  3VWS A;  1FTR A;  3W2W A;  2MQO A;  3P3D A;  2Y1J A;  2YPY A;  2HNY A;  3BRE A;  1DQ8 A;  4B9S A;  1WC5 A;  3P4U B;  5DLF A;  3CDU A;  1Q7L B;  3O6Q A;  4RWX A;  1FKO B;  2FLO A;  3NNA A;  1B7F A;  1F9E B;  1UET A;  3CJS A;  2KH9 A;  4IRD A;  1TMJ A;  3IR5 B;  3MDF A;  1Y11 A;  1I5O B;  4NYZ A;  4PCQ A;  1VCT A;  4EI2 A;  2DRA A;  2PII A;  1KLM A;  3CJT A;  4YP3 A;  3QT6 A;  4Y65 A;  3R5B A;  1X8D A;  3NGR A;  4GO7 X;  1XC9 A;  3AOC A;  4DUZ F;  1URR A;  4NML A;  3QYY A;  4LFB F;  3BN7 A;  3O5T B;  5GAG U;  2OI2 A;  4NL5 A;  3KHR A;  1FFS B;  1T9T A;  2HIQ A;  4XTT A;  2A3J A;  5DZ7 A;  2CZV C;  3V4I A;  1IJE B;  2Y1R I;  1B3T A;  4PUO B;  1FXL A;  4ETX A;  4FF1 A;  4DPT A;  3T1H F;  1YVF A;  3CCM S;  4M5D A;  1RAC B;  4KPC A;  5KG3 A;  1CJK A;  3HHN B;  1OYE A;  2ZWP A;  1H38 A;  1FRM A;  1M1G A;  1B7Y B;  1RI7 A;  4LBI A;  4USI A;  2R2U A;  2C42 A;  2CNL B;  3WDO A;  3UD5 A;  5KG2 A;  3PW7 A;  3H42 A;  5FLX U;  2IM0 A;  4DUY F;  1N6Q A;  5E5N A;  2QTW A;  5KFW A;  4IUF A;  2M8H A;  4ZPW R;  2MY7 A;  3VAH A;  5DO2 A;  3H20 A;  3KHL A;  4KE5 A;  2OEM A;  2L08 A;  2UVW A;  1TKX A;  5GAH I;  4IR1 A;  4OZ3 A;  3IWX A;  4NWB A;  2CUY A;  2QA2 A;  4ZCK A;  4O4G B;  1TL4 A;  2KZZ A;  1D09 B;  2C2R A;  4HLB A;  6FDR A;  2A0F B;  2ZIT A;  1CBK A;  1U09 A;  1X5P A;  2AP6 A;  3MMB A;  5CYM B;  4ZJO A;  4EU0 A;  1LK7 A;  1TP7 A;  2KDO A;  4G6V B;  5HAO A;  4K4Z A;  1JX4 A;  1AB8 A;  2ZC3 A;  1SC3 B;  2KYX A;  5KFZ A;  1SC1 B;  3FSY A;  3L9Z A;  1RKJ A;  1NKC A;  1RU2 A;  3RAX A;  3PFE A;  1W25 A;  2DRD A;  3Q2S C;  1VJQ A;  5J2P B;  3KLV A;  3OVB A;  4UY8 T;  1YJ9 S;  2LCW A;  4CIO A;  1RWU A;  2DNO A;  3W66 A;  2ZOF A;  5KOX A;  3HPO A;  2DGU A;  2ASJ A;  2LMI A;  3IG1 B;  1FK9 A;  3H2V E;  1WEL A;  2FZG B;  2DHG A;  4LF4 F;  3KLG B;  3H4B A;  3RB6 A;  3PO4 A;  1UVI A;  3SFG A;  1REG X;  4RUH A;  4YHH F;  1NB7 A;  4W92 B;  1U2R A;  3Q8S B;  4GO5 X;  2LQ9 A;  2BE9 B;  2EG2 A;  1H0H B;  3RZA A;  3PW5 A;  2YVS A;  1FNO A;  4XIU A;  1YJ7 A;  4DEZ A;  2D41 A;  2RQM A;  2G2O A;  4OYI A;  4NI2 A;  1DHM A;  4NMX A;  2EFQ A;  3FZ2 A;  4QIE A;  3LTO A;  5IC6 B;  1RK8 A;  2HQC A;  3ZZO A;  4WTY A;  2DNN A;  3NNH A;  4K4T A;  3FNN A;  4GMK A;  3HDS A;  4IG0 A;  4RW4 B;  1CEZ A;  2BZ2 A;  2VB6 A;  2NSB A;  1Q95 G;  3P49 B;  1TZ0 A;  5D4P A;  5A8K A;  2ASD A;  4P2M A;  4ZPD A;  2HHU A;  4Q5V A;  1ZM3 A;  3T5H A;  2EFN A;  2R42 A;  4QR1 A;  2DGO A;  3IMQ J;  3QO9 B;  2H4W B;  4P7T A;  3CJ5 A;  2Y0S D;  3GFY A;  2DNK A;  5KT7 A;  5E2Q A;  9ATC B;  2CPH A;  1P1T A;  1F3F A;  3J80 Y;  3J80 U;  3JS9 A;  1UTA A;  3V5R A;  4DJB A;  3V6K A;  1KHW A;  2OSR A;  4TY9 A;  4QWA A;  1NXI A;  5KG1 A;  2DNQ A;  1WSR A;  5LJ3 Y;  3MUR P;  1UKU A;  3DM2 A;  1T02 A;  3EYZ A;  4AL6 A;  4M8L A;  4RX6 A;  2VQF F;  1U02 A;  4DR7 J;  4DFJ A;  2UXD J;  2W24 A;  3JQM A;  4IFY B;  3D0I E;  1REV A;  2MY8 A;  5IWA F;  3KYL A;  3AAW B;  5DG9 A;  4DG1 B;  5E3R A;  5IFM A;  1ICE B;  5BR8 J;  3BS9 A;  5A2Q U;  1FRX A;  2FVC A;  4AD6 A;  1JJ4 A;  4ED7 A;  2DEI A;  4DLG A;  2HGN A;  3OJS A;  2HS3 A;  1HHT P;  2BE2 A;  3CGI A;  3QJL A;  3HHE A;  1S49 A;  3MED B;  1IBL F;  3UO0 A;  1NKE A;  4ER8 A;  1X4E A;  1LW2 B;  3T1A A;  2BKP A;  2VQE J;  2JEF A;  3FRZ A;  4JBC A;  3GYN A;  3BH6 B;  2YKO A;  4IR9 A;  5LOQ A;  2RRB A;  4FNH A;  3MM5 A;  4F4K A;  4A8Q A;  1HQ2 A;  2DD8 S;  1FXD A;  1T0T V;  3M8W A;  3OV7 A;  3D6M B;  4Q0B A;  3B54 A;  2Q1L A;  2MB0 B;  1UEU A;  8AT1 B;  1Q8B A;  4ILL A;  4I6W A;  2RNE A;  3BKF A;  3GG0 A;  3K5M A;  3H5S A;  2BV3 A;  1VFJ A;  4IO1 A;  4CYU A;  1D8Y A;  1BGX T;  3EWG A;  1HWI A;  2I9S A;  1ZM2 A;  4QYR A;  2BBE A;  2HNZ B;  1I1G A;  1SV5 A;  4LR7 A;  3ZTO A;  4Q45 A;  4K0K F;  2OO4 A;  1U8S A;  3SV4 A;  2ZD1 A;  5IQQ A;  1ZBT A;  4X4O A;  1IM4 A;  4YY3 J;  4K2J A;  2A6M A;  3I4P A;  4NYO A;  4Y0F A;  2UVR A;  4WFN Q;  3KLF A;  1HW9 A;  1U7L A;  4Y2I A;  1P9Q C;  4Q8E A;  2MQL A;  5EGY A;  4WK1 A;  1TFY A;  1VRT B;  3W8P A;  3I5A A;  4LRE A;  2QN6 B;  4RO0 A;  2OIH A;  1APS A;  1K1S A;  1VQ6 S;  1YIT S;  2KG0 A;  4G1Q A;  5ETK A;  5T41 A;  3OVS A;  1U1K A;  1P1L A;  2Y3Y A;  4LF8 F;  4FBT A;  1RAD B;  4PYD A;  3AT1 B;  2GJ2 A;  4NCB A;  2ALY B;  3Q2T C;  1IKX B;  1NCL A;  1RT4 A;  4C2M A;  3KJN B;  3I4H X;  4QWE A;  3P6Y C;  3B8H A; 
#chains in the Genus database with same CATH homology
 4DV4 J;  2UU9 J;  4NXN J;  1HNZ J;  1N33 J;  4JI8 J;  3D3C J;  4KHP J;  4LFC J;  3W1Y C;  5IT9 U;  1N36 J;  4K0K J;  3JAM U;  4JI3 J;  4B3R J;  2MTL A;  4KY3 A;  4DV2 J;  1FJG J;  4JI5 J;  4LFB J;  2E5L J;  2KVQ E;  4JV5 J;  2HHH J;  4DR1 J;  4DV6 J;  4DV7 J;  4LF4 J;  4DUY J;  4X66 J;  4DV1 J;  3J81 U;  5LMU J;  2UUA J;  4B3T J;  5LM7 E;  3T1Y J;  4LF6 J;  4NEZ A;  3IMQ J;  4LF8 J;  4DV0 J;  3J80 U;  4PWW A;  4DV5 J;  4DUZ J;  4YHH J;  5IWA J;  4HHU A;  4JI2 J;  4DR7 J;  4DV3 J;  4RJV A;  4JI1 J;  5BR8 J;  2UXB J;  1HR0 J;  5A2Q U;  4X65 J;  4NEY A;  3R2C J;  4DR3 J;  1N34 J;  4B3M J;  2VQE J;  3R2D J;  2UXC J;  4JI7 J;  1XMQ J;  4DR5 J;  2VQF J;  1IBM J;  4GKJ J;  2KL8 A;  4KYZ A;  4X62 J;  4DR2 J;  2MQ8 A;  3OTO J;  1N32 J;  4JYA J;  1XNR J;  1HNW J;  4GKK J;  5AJ3 J;  4DR6 J;  4AQY J;  1IBL J;  1HNX J;  3T1H J;  4JI0 J;  4NXM J;  4LFA J;  4LF7 J;  4B3S J;  2MEW A;  4JI6 J;  5FLX U;  4V1A k;  4OX9 J;  4YY3 J;  5LMN J;  1IBK J;  1I94 J;  1XMO J;  2UUB J;  2ZM6 J;  4JI4 J;  4LF9 J;  4LF5 J;  3D3B J;  4DR4 J;  1XNQ J;  2UUC J;  2F4V J;  4X64 J;  3J7A N;  1J5E J;  2UXD J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...