2HHHJ

Crystal structure of kasugamycin bound to the 30s ribosomal subunit
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title The antibiotic kasugamycin mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation.
pubmed doi rcsb
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 2hhhJ00
2KL8A 4YY3J 4DUZJ 4GKKJ 4DV7J 3J80U 1I94J 4B3MJ 4JI1J 2VQFJ 4DR7J 4NXNJ 5BR8J 4LF9J 4LFCJ 4RJVA 2HHHJ 4DUYJ 4NXMJ 2MQ8A 4JI8J 4LFAJ 5LM7E 4X65J 3J7AN 3IMQJ 2UUBJ 3D3CJ 4DV4J 5LMUJ 5LMNJ 4GKJJ 1FJGJ 5IWAJ 4JV5J 2MEWA 4DV6J 4JI2J 5IT9U 4LF5J 4DV3J 4OX9J 4B3RJ 2MTLA 1N33J 4HHUA 4KYZA 4LFBJ 2UXCJ 5A2QU 4JI5J 4JI7J 1HR0J 3T1YJ 4KHPJ 1N36J 4LF4J 4DR1J 4DR5J 4DR4J 4DV0J 2UXBJ 4X62J 4NEZA 4JI6J 3OTOJ 4KY3A 2UUCJ 2ZM6J 3JAMU 4X66J 4LF8J 2E5LJ 2UU9J 4K0KJ 5AJ3J 3W1YC 4PWWA 5FLXU 4DV1J 2KVQE 1XMQJ 4JI3J 3T1HJ 4YHHJ 4DR3J 4LF7J 2UUAJ 4X64J 2VQEJ 1J5EJ 1N34J 4JI0J 1N32J 4AQYJ 1HNXJ 4DV2J 1HNZJ 2UXDJ 4B3SJ 4LF6J 1IBMJ 3R2CJ 1IBLJ 2F4VJ 4JYAJ 4DV5J 4NEYA 4V1Ak 1HNWJ 4B3TJ 1XNQJ 1XNRJ 3D3BJ 3R2DJ 4JI4J 1IBKJ 3J81U 1XMOJ 4DR2J 4DR6J
chains in the Genus database with same CATH superfamily
3GFXA 2U1AA 3MEEB 1KONA 3OPKA 4RUCA 3CJ2A 3DLBA 2DKOB 2XS5A 2VZ9A 2RUGA 3RBZA 3UQSA 4X66F 3EX7B 1K0VA 3BGOP 2H5JB 3IS9B 3CCES 1P9YA 2UU9F 2Q3PA 2ZH8A 1AZSA 1O5JA 1YZ7A 4FXDA 3O6QA 3QT7A 2DHGA 3F73A 2XO6A 5DDQC 4ZLLA 4F2RA 4DV0J 2KFNA 4J5OA 4F02A 3BO4A 2KT5A 4RU9A 2XLJA 3AOAA 3MEDA 3KG1A 3BYRA 4YDXA 2HQDA 2P5VA 5HQLA 2BYCA 5IXUA 3MM7B 1LOUA 1G2EA 2EEYA 3VVTA 2VPWB 4B3OA 4JV5F 1Y10A 1KLMB 4C8MA 4J9MA 2VPYB 1KC8T 2K3KA 2I9SA 2GS8A 3LP1B 1WF2A 1Q4RA 1RT4B 2YKAA 1U45A 1WHVA 1KEKA 1HHQA 2DO0A 2HW3A 3T9NA 4NE9C 4TNOA 4ID8A 2EFVA 4PR6A 3G2XA 2FVRA 1RTDA 3TQEA 1LWFB 4USIA 2UXCJ 5CH7B 1O0PA 2IFXA 2F9JA 1RBAA 3R97A 3BKUA 5H9EJ 2UXBJ 3A1YG 4XO0A 1K1QA 4TLRA 3N5FA 3H2VE 4S0MA 2CJQA 4AYBD 2F8MA 2OGUA 3NCQA 3BGRB 2KVQE 4IDKA 2R2TA 4FVCA 4R25A 1ELOA 3KG4A 2RQKA 3PNIA 5M2PA 4M1KA 1Q8LA 4QW9A 2YNHB 7FD1A 1T02A 2LEBA 4AL5A 2D3O1 2VIHA 4N41A 2ZZMA 3DOLB 3RAMA 2JLEA 1UA1A 3Q8VA 5LMUJ 2C3UA 3TEHB 4OZ2A 3GWCA 4F4YA 1LXNA 4OIXA 4TU9A 2YWFA 2MJNA 3DGPA 2EBGA 2IAJB 3BSCA 3KUGA 4F2SA 5CYQB 2RDJA 2FJVA 4TU8A 3QT8A 1UW9A 1IWAA 4KGVB 2XCAA 3ISND 3BO3A 1KBRA 2N3LA 2F3JA 3BJYA 3KNGA 3R6LB 2ZH9A 2HHHF 2O5DA 2RRAA 2M8DB 2DNOA 1HWJA 3CDUA 3PVXA 1V5VA 5T7LA 2E7WA 5CQGA 1IKYB 1P6TA 4Z2XA 4DUZF 4PWDB 2DGSA 3EVMA 2B7BB 1H38A 3W5YA 2BJ3A 2SXLA 4DR2J 2ZH5A 4DXLA 5L1KA 2ZITA 1NPPA 5IV3A 1T8EA 3HKZD 1S10A 2CRLA 4ECVA 4ZVHA 3MDFA 1YK9A 2R7UA 5L1JA 2G1DA 4A47A 3DLLQ 1JLEA 2DIUA 5HVFA 1OMSA 3VAIA 3AQOA 5I3PA 1HI8A 4M5IA 2WOMB 2RHQB 4DV6J 3DU5A 2VFSA 4O23A 2FUG9 1OQ6A 3J7ZT 2HFSA 3ZZYA 3OL7A 2P9GA 1VQ8S 3UFCX 1CJVB 4OHYA 4K0KF 2YKMB 5D3GB 1YGYA 2CNOB 1QM9A 4OI2A 2HK3A 3X1LB 4P74A 2FZGB 1FNOA 4FYDA 5FLXU 1XMQJ 2DHSA 1S0MA 3MEGB 3DM2A 2ZVIA 4CLTA 5DRKA 3PYEA 1T9VA 3JTOA 3J81Y 5IQ6A 3G6VA 3QIPA 1FKPB 1R0BG 3OW2R 2HVDA 5JMNA 2R8HA 4B3MJ 3NWRA 5C24A 4CNZA 3M8PB 1KD1T 1M5OC 4Q45A 1NKEA 2B4VA 2KXHA 2FJEB 3TVZA 2C3MA 5HSPA 2VU5A 4F04B 3TJAA 1Z2ZA 4JI3F 4WZQA 2B51A 1BC6A 1JLAB 2AJ2A 4DR5F 4DZ6A 2HNYB 1F2HA 4ZPVR 2E1RA 4EEYA 2WZ1A 4Y3CA 1NEEA 1W26A 4C11A 2AJFE 3ZTRA 5L8RC 4O3NA 3A8KA 3BS9A 2VFRA 3R5GA 3QGGA 1IR1A 2ZBCA 3JQMA 4M8LA 4WKYA 2XTJP 3ZZRA 4F3QA 4TQSA 4NLGA 5BYRA 4OV6A 5HATA 3BV8A 4PEOA 1P27B 2BACA 2DH8A 2HHQA 2V34A 2IA0A 3DHWC 4UZCA 2AYGA 3DLGA 3PJWA 4CH1A 1HFEL 3D67A 2BRLA 4MFBA 1NNDA 1RAFB 1Y5IB 4N8OA 3KHHA 4AL7A 1GX6A 4JI2F 2JEJA 4UQTA 4BC7A 4LR9A 1X4EA 2E5GA 4U9RA 2MKJA 3G71S 1NHUA 1J5OA 1LQ9A 1VS3A 4B3RF 1VBZA 2OFHX 1ZOTA 2XBPA 1YBUA 2ZBIA 1MG7A 2H48B 1LK5A 2AX0A 2FHJA 4X84A 2I38A 2CJKA 1UTAA 2BRKA 3M2VA 3FMBA 4ZP9A 1KQFB 2RUSA 4K4XA 4QPXA 4WFAQ 3QRQA 1TKTB 2RRBA 1PAEX 1T03A 1D9DA 3ILIA 4USTA 2DGXA 3CJSA 3RBDA 4KJIA 1HHSA 4DL6A 4C8YA 1HNIB 4AL6A 4ZPCA 3JQKA 4HDGA 2CZVC 1QE1B 4LFCF 4LRBA 1L3SA 4JI4J 4EBDA 2PT0A 1FFWB 2VOPA 3ENAA 5KFJA 2V63A 4JI1J 5BR8J 1VC5A 2CPJA 3RW7A 4FF2A 2XM3A 4JI8J 3H5XA 1H2TZ 3M9MB 2AWZA 3H90A 3LPEA 2I0XA 1GAOA 4IFVB 4XPCA 3BSNA 3LP2A 3KK3A 5GAHU 3BPDA 2AGPA 4NCBA 4XIUA 1TL4A 1S1XA 3CD5A 3P3DA 2ADBA 4P52A 2BX6A 1NDPA 3CC2S 3G87A 4NEZA 1LWFA 2KXNB 5SZTA 3MMJA 2U2FA 2DR5A 3R27A 3PX4A 1LNQA 3F41A 2L08A 2NR0A 4MTPA 4ECUA 4DEZA 1QSLA 2KVIA 2HWIA 2VFVA 1EKSA 4I6WA 3PM9A 1C0TB 3PFEA 4V1Ak 2KJVA 3MFIA 1FA0A 3POTB 1QY7A 2NXEA 1H73A 4ZCIA 4IYQA 4Q5VA 3A3PB 2DVIA 3O2IA 9ATCB 4CYUB 1HLWA 3HDSA 4M63A 2B5JA 1WWHA 3DOLA 3LGNA 1G4CA 2JFKA 1Q78A 1HD0A 3RR8A 2RHSB 4X4TA 3M8YA 3CCZA 4MKBA 3OTOF 4ZIVA 1X4FA 3VZIA 1TL7A 3D1OA 4I67A 1IBKF 5CYQA 4DSFA 1M0SA 3VAKA 3CMAS 1NRKA 4Y2KA 2BA9A 1JJ2R 1FERA 1DY3A 3UWTA 2RKIA 1B99A 3B82A 3J7YU 2GW8A 1F3VA 4E98A 2LCWA 3SIPB 3ZTSA 2D69A 4FYYB 4TKTA 4LF6J 1WG1A 4DN9A 4DV5J 3D3BJ 1AFIA 1IKYA 3G6XA 2IVYA 2RE1A 2BW2A 3TUJC 1WOSA 1G7CB 3HSZA 3EZUA 1D1UA 1VRTB 4DFPA 5IWAF 2XC9A 2F1FA 4J9QA 1N56A 2CAJA 4DSKA 2B9XA 3W2WB 1UEUA 1UVMA 4KKOB 2G1HA 4CM0A 4CLYA 2OEJA 4OYAA 1N52B 2IDEA 3CMQA 3RAQA 2QMWA 1DFDA 3ZXWA 2G2ZA 2GHWA 4DDFA 3KUHA 2W8LA 4LUBA 3SQOP 3EZ5A 1NK0A 3C2PA 4OHXA 3UW1A 4YS2A 2YKMA 2QZ8A 5F0WA 3HHLB 1NO8A 2LA6A 2KM8B 5DQIA 1VQOS 3VGTA 3SSRA 2KU7A 1NLKL 2WVBA 3MEGA 4GKKF 2HQFA 3R2CJ 3CEDA 5A8KA 2WRMA 2BJ1A 1MLAA 4AFFA 1U0HA 3SDEA 4IR1A 3FBBA 3A8IA 5KG4A 3ZTPA 4OX7A 3GR0A 2OTJS 4NWBA 1UPPA 2M70A 1F9EB 1SJRA 4NX9A 3HT3A 4NLXA 1GTHA 3HJFA 1WEXA 5AXNA 5HP1A 3HM9A 1U4BA 5CCLA 4JI7F 2PA8D 4ES2A 3DKDA 5H1SV 2CZ9A 2XSJA 1PG5B 3QT5A 2R2UA 4H4KC 2DGWA 1ITPA 3MPUB 2DNNA 1GQEA 4USMA 3TUIC 4K4SA 3E01B 1S79A 4ZPTR 1T94A 2H1YA 1VQ5S 2ZEJA 4ZVTB 4J37A 4UT4A 3BN4A 3JAMU 3GCXP 2L9DA 5FLXY 1R0CB 1FWPA 1U24A 5GMDA 3TI0A 2PFDA 2FLNA 5I4MA 1N5QA 2XZWA 5HL7Q 1IQZA 5HLFB 2FY8A 1VQ4S 2BE7D 3OJUA 4HT5A 2OH2A 2PMWA 2MZJA 1ZYQA 2PMHA 1IXKA 2BJ7A 3K5LA 2ILYA 2BQ3A 5KFOA 2ZD1B 2HNDA 2LQJA 1HA1A 4X62F 1X5TA 5DLFA 2RQCA 1LFWA 3EDQB 1HD1A 4FYXB 4BC9A 4QR2A 4O3RA 1S59A 3OQ2A 2V4JA 3M2RB 2XMKA 2VJVA 1RLDA 3NKYA 3SV4A 1Q16B 1T9TA 1S99A 1RCOB 2IVMA 1VQSA 3FSIA 1U8WA 3BBCA 1WG5A 3CCRS 4O3QA 3HK2A 2XLKA 1QAYA 3NGKA 4NLQA 4A8SA 3M6UA 4MJKA 1YRTA 3EXYA 5EGYA 4QYRA 4DV1J 1Q86T 3OVSA 3QSYB 2FHJD 2R2RA 4DR3J 1Q79A 1TUWA 4LFAF 1CSJA 4CLFA 3ADAC 3IAS9 2HHTA 5K8NA 2G2OA 4CO0A 4WYWA 4LBIA 3H5SA 4O0IA 3M1VA 5C5JA 1NJWA 1JB0C 4IH7A 3BR8A 4FF4A 1WKKA 2LEAA 2CPXA 3MWBA 2XEXA 2H3EB 1SPBP 1O51A 4G1PA 3HP6A 1HNIA 3OR1B 3TAPA 3R5BA 5K9FA 5GAHI 1R0AA 3HZGA 2YKPA 3VQTA 4G1IA 2V8PA 1JX4A 4LF8F 3ONQA 2OKQA 1KVKA 2EVZA 4FS2A 3BBFA 3FUYA 4ETZA 5FIIA 5J1EA 4NZ0A 3HT0A 2IY5B 3PXGa 2L3MA 2IBOA 2ZJQQ 2VDIA 2NXCA 4UUWA 5KFSA 3VHQA 1SH3A 5AXLA 2KG0A 3NGSA 3LALA 4ELVA 2N4DA 4GC6A 3TARA 4I1TA 1IM4A 4DPXA 2ASYA 2E7XA 4DCOB 1YJTA 4DSJA 1IKXA 4QIEA 1OY8A 1JLQB 1X9WA 2WVCA 1C1BA 4USWA 2VC0A 2HMIB 2XZTB 2RD5C 4PPZA 4L3KA 4LRCA 3SFUA 3SEOA 4CTAB 4ZN3A 1TP7A 3PY8A 2IJRA 1JKHB 4DR6J 2LYVA 1WORA 4UF4A 2O67A 3IWNC 4PYDA 3POTA 5D78A 1RAGB 1YDLA 4DCJB 1VOMA 4EYHB 1SC6A 1W2BR 3W66A 2LDIA 3J7YI 5A8RB 1A9NB 1PCAA 5EUHA 3RGIA 5L1IA 1WC0A 4ZA1A 1RB0A 1RWVB 4LQ9A 3DRPB 2ZKUA 2ACMA 1UEKA 1I5OB 1VISA 2V9WA 4ECRA 4I4BA 2PA3A 4QU6A 5FD1A 3PHTA 5B7WA 1EETA 3UO0A 1J2VA 1URNA 3CJ3A 3MCSA 5B0FA 3DI6B 2F4VJ 1TL1B 3D9BA 1S48A 1RACB 3ELHA 2HFNA 4Q0BB 1RDRA 1W7WA 1TQLA 2W2MP 4RPFA 3KLGB 5KT2A 3NOCA 1VDHA 1ZM2A 3QGHA 2FHKA 2MB0B 2MQPA 4HHJA 3MXHP 4WK3A 3DXSX 1RT1A 1VRTA 3DRRB 4WU3A 3UE2A 3CCWA 3D6HB 4FF1A 5CHCB 3K89A 2E9ZA 2R7VA 4LRDA 3GYGA 4M5KA 4KKOA 5GAGU 2FTRA 2D9PA 4C3KA 2EWHA 3UCZP 2UUCJ 1XWLA 5F8JA 3DXBA 1CJUA 2CQ2A 2W2OP 1YJVA 4HACB 2QYCA 4K4ZA 4DSIA 1S9EA 2FJXA 3RW6A 3EGVA 3OL6A 3UD4P 6AT1B 1IKVA 2HURA 1RAIB 4LR7A 3DLEA 3KHGA 2HBZB 5DDPC 2BJDA 3GU0A 4IH6A 3FFIA 4I56A 4BBYA 2J6UA 1S6PB 3KOAA 1DTQB 3TAQA 3C8YA 1Q82T 1VQ7S 3IXQA 5IV4A 1R8PA 2CQDA 2GIRA 4ZVEA 1PSDA 1NK6A 3ENWA 2NQPA 3F56A 4X64F 3WX8A 1M5SA 3DMJA 3GG1A 3H5YA 1VIXA 4WZMA 2HGNA 2QLXA 1M5HA 2KZZA 3K5NA 4RW8B 5BJRA 2B3TB 2JC0A 2V2ZA 2NXUA 3PJ9A 2O1PA 2DTJA 3HKWA 3UN2A 2YNFA 2CQBA 3W65A 4LF7J 3BH7B 2Q66A 2QMXA 4ZVGA 1F5BA 2MKSA 1I94F 1UL3A 2GVZB 1DAXA 1UP1A 2DPJA 2Z0GA 1UCNA 3JSMB 2AW0A 5J2QB 2DNRA 2BE2B 4DUZJ 3GYXB 2LQ8A 4CLKA 1SH2A 2A10A 7FDRA 3PEJA 1RAHB 2LXFA 4NLDA 1E6VB 1S76D 2WVEA 2HIQA 4DX7A 1S1UA 2RS2A 4C8OA 1QDUB 1RABB 2W7AA 1VIOA 2ACYA 4YB5A 5D4LA 3CCMS 2LKZA 2R42A 2HBYB 3V81A 2QYGA 3M2RA 5AXKA 3K0JA 1TV6A 2CQ0A 3T1YJ 4ZMMA 4LR8A 1OPZA 5LJ3Y 3OTEA 2B6AA 2ROEA 1SL1A 2M8HA 4CLSA 4EO8A 3OFFA 3C6UA 1SI9A 4RBUA 4WJBA 4N76A 1T7PA 1YWXA 1NZAA 3J7A1 1Q8IA 5T41A 3MMAB 4DLEA 1F3FA 2YKNB 3F0NA 4ZP6A 3UDEA 1VQYA 5J2MB 3W8PA 3KYLA 4C0BA 2VG5B 3W2VA 2CG4A 1JNRB 4NA2A 3IRXA 2UXBF 1QSYA 1R31A 1F9FA 4NCGB 3OR1A 1HMVB 2DGVA 3TA0A 2R8IA 4RZRA 4M94A 3L95X 2Y1JA 4NZ6A 3FRZA 2A1BA 3MM5A 3QAEA 1FEEA 1RGVA 4G65A 2ZH1A 3SZ2A 2XMWA 2XI2A 4Y00A 5D6GA 4ZOSA 2UV8A 1Y0HA 4A4JA 1QVGR 1UETA 4DR5J 3Q8YA 1BD6A 1JLGB 4ZCMA 1CULB 5H9FK 1X0FA 4ED4A 4OQJA 3D28A 3EICA 1K73T 2QX0A 2ZNYA 3FK4A 2HZCA 4NYOA 2C2MB 4R0JA 1CJTB 5LMUF 1U1OA 2W4PA 1SV5B 1KFDA 2RVJA 1JLQA 4DPOA 3ITHA 1KQGB 4M5HA 2DR6A 2IM1A 5HN0A 5HO4A 2ASJA 4ZPAA 1JKHA 2XNQA 4DUYJ 3G82A 3I9V9 3M8QA 1NH7A 2HWHA 1SQEA 2QMUB 4RW9B 1BQNB 5DDOC 3HFZB 2W9BB 1PYTA 3N6NA 1VRUA 2VPXB 1VLYA 1HQ2A 4B3RJ 3FCVA 3KKFA 1H7XA 4NOHA 4DZDA 2J0WA 2Y0BB 2YQ3A 4R8UB 4RLEA 3R8YA 3DOMB 2L41A 3OHBA 2PMZD 5K14B 5G0RB 1C2PA 1MW7A 5A8RA 4YR2A 5E41A 3EXCX 2BKPA 2OP5A 3PFOA 3DRPA 4LRAA 2VFTA 2IM2A 2XZDB 2E66A 2E1AA 1JXVA 2GO9A 4C98A 2UUAJ 3DRSA 5FJ4A 1RTJA 4KAIA 2BBEA 4CT9A 4ECXA 3S1TA 2VA2A 1TFYA 1YLXA 4TY8A 1EB0A 1UVIA 3I0SB 3C15A 1SL0A 2XB2D 3BGUA 1WDTA 2DISA 5HVHA 2RJZA 4CP5A 1TL1A 2W7OA 1TUGB 3AA8A 4LFCJ 2WONB 5KFQA 5GAGI 4Q0BA 4TY9A 2XS2A 3PDNA 2J6TA 1WOPA 1YITS 1J27A 1XMQF 2BJ9A 3QJLA 4DR1F 5GADU 1B7YB 1RP5A 3DGVA 1RAJA 3BPSP 4OX9J 2KJWA 3DOKB 1AW0A 1RTIB 2HGLA 1U1LA 2ATCB 5JXSA 2CPDA 3FMWA 4HHHA 1YIJS 4AE5A 2WTFA 1T05B 1NKBA 2B4OA 2RAQA 4XK8C 4P71A 3V6HA 4RBTA 1TVRA 1WHXA 2H54B 2HG4A 4LMZA 4I2PA 2MY7A 2R7TA 5HI7A 1WEZA 3VQSA 2OPPB 2YH0A 4ZK7M 4PXDA 1Y5NB 6FDRA 3MMCA 2NPFA 3D0GE 3HVTA 1CG2A 3O5TB 3SQGB 5KFZA 1PC4A 3KLFA 4KB7A 5E3QA 3LTOA 3I87A 2BM1A 2OSQA 5L38A 2MGZB 2FVQA 2OHDA 1PYOB 2DT9A 4ZP8A 2HVIA 2GIQA 2D7SA 2DCLA 3JB9k 3T5HA 2BANB 2W24A 1RT7B 1DTQA 2KT3A 1F2GA 1K9MT 4ED6A 2JEFA 3HO1A 2VG7A 4DPTA 5HROB 5E7OB 3I4HX 2QTWA 3UCUP 3N6LA 4P6QA 4DL0C 1N36J 2BJEA 2ZBRA 3FVYA 2FGOA 3OTOJ 5DJBA 3CSKA 2X3GA 1EQMA 2B8QA 2CFXA 1X60A 2HHVA 2AZ3A 2IMOA 2FC8A 2WB1D 3SCIE 2Y3YA 3V6DB 4KC5A 4NA1A 4JV2A 4N77A 1VQKS 3E2EA 2CDRB 1X5SA 2DNMA 5C25B 3KNAA 4NLSA 5CXTA 4K59A 4DQRA 3AB4B 2GVZA 4P10A 3TAMA 5E3PA 1BXNA 2IC3B 3A4TA 4FBTA 3RB4A 5RUBA 5I3UB 1RU2A 3B6BA 1D8ZA 2V4QA 3RBXA 1VQNS 1VMBA 2FB0A 3QYYA 1JXEA 4H4OA 2Y8WA 1TK0A 4ZLPA 3MGJA 1XR7A 4DSEA 2XWYA 2F63A 5IWAJ 2QN6B 2BQUA 5EN1A 4BDPA 4FBUA 1YRUA 5ETPA 2F5GA 4ZLNA 2AYMA 4IG3A 2DIVA 1S1TB 4JI4F 1RCXB 2ZE2B 3UD5A 4PZVA 4U8YA 3D0IE 4NLUA 5ETSA 4JI1F 1RUSA 3IG1B 5BR8F 3KJVB 4YB1P 3AODA 1U1QA 4BCAA 4JI8F 4FPIA 2R8GA 2E1PA 2HLUA 2E7VA 1F60B 4F4ZA 3AOBA 1IBMJ 4WKRA 4LSNA 3GONA 4WBFA 4KPYA 3MTKA 3QO9B 4GKKJ 4DV7J 5J2MA 1UWBA 4KHMA 2ZJPQ 1HWLA 5KFXA 4K4TA 3H2LA 2XY7A 4GKJF 2G2YA 4P2MA 3UNYA 4F0KA 5KFMA 3NL0A 3HSGA 3I0RB 4F0HA 1P8GA 2HGMA 1QAXA 2EC0A 2XMJA 1VQPS 4MT1A 2PO4A 4WTOB 1AYEA 4EWTA 2HS0A 3ET6A 2CYYA 2JNJA 2PDAA 2YKQA 3UDLA 2B4PA 3KDOA 2RQ4A 4JI7J 4B9VA 1LFPA 1RT5A 3D7SB 5G4DA 3HHLC 3I5CA 4IOBA 2KM8C 3HMJG 2CJBA 2GX8A 2ZDOA 2P6TA 2BEFA 2ZWOA 2Z58B 1KOOA 4ER8A 1WSVA 2DJWA 2H65B 4L75A 3W5XA 1S12A 5DQGA 4MKVA 4EMDA 3D1QA 5DG7A 1Q95G 2J0XA 3UVJB 5ETQA 3M2UB 2G0IA 4DG1B 2OELA 4Y65A 2J8SA 4OJ3A 5D4PA 4WIQA 1N5TA 2ABYA 3ZZ0A 1AFJA 3LF0A 4RW6A 1UFLA 3VGUA 2PD1A 4KGKA 2KFZA 3IC1A 2ILZA 4NMLA 2UVVA 1R8BA 1UJ6A 2A3JA 3QJPA 2Y8YA 4DX8H 1OSDA 2Q79A 4OYPA 2GJ2A 1HKAA 4WP8A 3TEGA 3QSIA 1AT1B 3B4DA 3OT9A 5BYQA 3U1NA 4RW9A 2YKOA 3IWLA 4LF6F 4W98A 4DV5F 1HIYA 2M3DA 3Q23A 3ILJA 4F7VA 2NS1B 2VASA 3CIMA 2I6WA 3CW2C 4ZHRB 2BKOA 3I5BA 1U0SA 4KQZA 5F8IA 2FGCA 1YRXA 2OTLS 4DX5A 3MCOA 4O4GA 2DEIA 4I6YA 4TLQA 2RB7A 1SBRA 3HHDA 1IBLF 1FKOA 4ED3A 3D6MB 1U7LA 3W9IA 1U1PA 2H5IB 2ZBQA 2CQGA 2YWWA 1RBLA 3SYZA 1Y11A 4ID5B 2K1RB 4EBCA 2CA9A 5CD4A 3FEXB 2HPUA 1DZ5A 3DLKB 5GADI 2DITA 1UPMB 3W64A 3P45B 3QGIA 1AXQA 1WSRA 2DR9A 1G6BA 3KK2A 2GMLA 5THWA 3K59A 4UTGA 1GMUA 2NSCA 1EAYC 3KTQA 2V2KA 3V6JA 3FNNA 3GLJA 5E0OA 4LBHA 1UVKA 1A6LA 2WONA 2BJ8A 2YNIA 4EZ9A 1CPZA 5KFRA 2C2OB 2COLA 3UDVA 5A8WB 5KFYA 3G4SS 1YI2S 2PI4A 1E6YB 2DEJA 1X5OA 3TUZC 4GVBB 3GFYA 4FP9A 2UZAA 1B3TA 4I68A 3OSNA 3ZZUA 1NAQA 2CWXA 3ZTQA 1WELA 5KFIA 3NGDA 2MZTA 1U1NA 1SL2A 4YHHF 1RTIA 4FYWB 2V8DA 3Q89A 2R3VA 2KHDA 1LWCB 2ZHBA 1UMJA 1HBUB 3S01A 5HMWA 5E3RA 2EXUA 2AGOA 3MPYA 2ZHAA 2XGPA 2ZWPA 3OSPA 3CT9A 1SJQA 1WEYA 1RKJA 3MM6A 4CLLA 3MEKA 4Q43A 4OV1A 2IMWP 1HNVA 5J2NA 2VG6B 2HHPA 3CIZA 4JV1A 2NUHA 2WSFC 2H9ZA 4QWDA 3IR5B 1FTCA 1PBUA 3TRGA 2XLIA 1AROP 5IZHA 3CTRA 4QZVB 3CWJA 1YBTA 3K7RA 3O3LA 3Q8RB 2BANA 1ZZNA 2R8JA 2BW7A 3LAMA 1FE4A 4JI5J 1SJ1A 4KHPJ 3MECA 4IOCQ 3PR5B 1LW2A 1XR5A 1REVB 2M7SA 3CJQA 4Q2MA 4F4XA 5HAOA 1GEHA 3IA0A 2NZCA 2C42A 2MHNA 4MMOA 3GSDA 1WI6A 4O3SA 1S1VA 2ZNZA 4QWAA 3GIJA 1KOHA 3DN9A 1PIEA 2JL9A 1WC1A 4X4OA 2EFQA 4LF1A 4Y28C 5KFUA 5KT5A 3QMQA 3BYPA 3IGVA 3GV5B 5C25A 4CRJA 1QSSA 2W9CA 4ITSA 2MKIA 2QL9B 3RR7A 5KG5A 4D3GA 2M5YA 2CZ4A 4RNHA 3HHNB 2ZFHA 2R2SA 2GHVC 5I3UA 3VAMA 1U49A 4DR3F 2LECA 4F50A 2MLXA 3JTNA 1MROA 4OYZA 1FWLA 1QTNB 3IWXA 3RRHA 1S1WA 3DLHA 1FWKA 4Q8EA 3PX0A 4FDFA 4HVZA 2WCXA 4L3NA 5AE1A 4QIWD 5E5NA 4ECSA 4X4QA 4URGA 3NAIA 1CC8A 2HFZA 4WE1B 2ATLA 1LW0A 5C2CA 3DFEA 5DLGA 1RU1A 1MWQA 3AHPA 5HMYA 2D9OA 3TX0A 3Q8UA 5KFAA 5KFVA 2KI2A 3IG1A 3HD1A 1FXDA 3OTDA 3MPDA 1CLFA 3BR9A 4RU2A 1SB6A 1R27B 1BHNA 2JEIA 5LSRA 2VQFF 3R7SB 2LEPA 5FDLA 1RWUA 1SJ4P 1S0OA 1PJ5A 1R6VA 3VZHA 1EJ7L 3NS7B 4Z7YA 4QIGA 1VK3A 4RWXA 3F44A 2FY1A 5LM7E 3SCKE 2L9NA 1H72C 3EE3A 3U1MA 2QLJB 2V2VA 4V19J 1N0UA 1HPZB 3RB0A 2V68A 4A8MP 1S0NA 3GG0A 1VI7A 5IFMA 3TR5A 4WF9Q 4NPOA 4HLBA 3GCWP 3I32A 3IGNA 4RL1A 1C0UB 4Q44A 1WUUA 2HS3A 1DLOB 4P9SA 5I42A 4K4UA 5DZ7A 2OUGA 1WD6A 4X4SA 3CJ8A 1RHMB 2KXFA 4ANDA 1MWZA 2DCUB 2I5JA 1N0VC 2B8PA 1TL3A 3FJ2A 2EFGA 4G1QB 1X9SA 3TWZA 2AV5A 5IOLA 3VGSA 2AX1A 4F4WA 2NREA 2KB2A 4ENOA 5KFPA 2R7SA 5ETNA 4X4UA 3R7NB 3O44A 1N88A 1DJ0A 4PWUA 2KHCA 3TQ1A 1XEZA 2W8KA 3K58A 1HW8A 3LA0A 1X4BA 2E5JA 1I94J 2CPHA 5IM0A 3UVJA 3IO1A 3M2UA 4LF9J 2W2PP 2HQIA 4LF5F 3BGFA 3PKMA 3DU6A 2DRDA 1VC6A 1VBYA 2HVHA 2EKNA 4P75A 3KJNB 1NSAA 5A2QU 2F4VF 4DR4J 3MAHA 1RXOB 4ICLB 2MHEA 1X9MA 2NXJA 5AJ3J 1HQUA 2HZAA 3D0HE 4ZHRA 5C7PA 3WHIA 4JYAF 3R1HA 1DTTB 2MYFA 5DM6Q 2O3DA 4YB6A 3KJFB 2AYEA 1QJHA 1BY9A 4GO5X 4OZ0A 1ZBTA 4B3TJ 2AT1B 1XNRJ 4PG8A 1JMTA 1XMOJ 5D8HB 2VDHA 3MR5A 2DNLA 2IM0A 1YTYA 4X4PA 4NI2B 2FQQB 1GX5A 1VHFA 1S97A 4ECQA 2K1RA 1U1KA 4KRWA 1N5SA 1FRJA 2UUCF 1GMWA 5DGBA 1YVFA 1RHUB 3RUBL 4A8KA 4QYZK 1M1HA 2AF6A 5L39A 3NMAA 3E3XA 4PXCA 2NPIA 1KDNA 2CPZA 4H4KA 4IRDA 2HHUA 1F1BB 2JZ5A 1U1MA 1IR0A 1ZM9A 4NRTA 1I3OB 1XQIA 3L09A 1YKWA 2FLPA 5D0EA 1V3ZA 2Q43A 1G3OA 3ISZA 5J2PA 3DC2A 4X4VA 2J7UA 2MZRA 4RNMA 4U96A 4DR7F 2K7KA 3C3LA 3MMBA 2DPIA 3P8BB 2QIFA 1RWMB 1HWKA 2CQHA 3J80U 4BLGA 3P5TL 3ZC4A 3OUYA 4OHWA 4R5PA 2ZH7A 5JUMA 3MPVA 2IRYA 4NXMJ 3T6BA 3Q8SB 3KLHB 1YBAA 1C1CA 1Y4ZB 3VCDA 2AEFA 5F3TA 2RF2B 3MAAB 4TVAB 3MF5A 3T1AA 2J9DE 2QEXS 4LF7F 2FVPA 1NK5A 2JSXA 5A0YB 2JEGA 2Z2YB 1WTBA 4I2QA 3HSDA 2EFPA 4B9SA 2CG8A 1FXLA 2E29A 4U8VA 5KG6A 4W4MA 4A8QA 2M52A 2I1RA 3C6TB 4LSLB 4A8XA 4EI2A 3QRPA 2XWXA 3E8OA 3KJQB 3C14B 2XYHB 4UQGA 4AQYJ 2RMLA 3SSSA 1SKWA 4B02A 1Y3KA 1XNQJ 3H20A 4CO4A 2O01C 4YR0A 2BR0A 2VUGA 4C3LA 2HSEB 4LSZB 2QJ3A 2B9EA 2N3OA 1N5YA 3R1LA 3T1YF 4DU7A 5LMNF 1ZZFA 3B78A 4RNOA 1NB2A 2XQCA 1HBNA 4N47A 4P2XA 3CCQS 3R5JB 9RUBA 4MK8A 1W2IA 1Z4UA 4IO9Q 4PCQA 5CCMA 2BE9B 4ZKAA 2OEMA 2WHOA 2J9DA 3VAHA 2OLWA 1TAUA 2BVZA 4DR1J 1FT8A 2XCPA 3U27A 2HRYA 5F9NA 4DJBA 2Z56B 3TOQA 3E51A 3A8JA 1YJ9S 3NNCA 3GTYX 3T19A 3W9JA 2VICA 2RQMA 4YFUA 4KV8A 3W9HA 5F8MA 1FRHA 4NLTA 1LWEB 2YX1A 4QWBA 2OPRA 4RX6A 1U2RA 2HFOA 2GMHA 2ADCA 4M5NA 5T14A 1RTZA 3GFHA 4DN0A 1NM2A 2VFUA 1UFWA 4KFBB 1ROFA 3TNVA 4OZ5A 1NDCA 3K17A 4JOUA 3MM9B 4M5DB 5HBMB 3FKBA 1PJ6A 1FVQA 1D0EA 1WKLA 3M32B 3AA9A 3DYAB 3TZZA 2R7RA 3H98A 2G0JA 1WC4A 2GCFA 3K5OA 1SUQB 1JJ4A 2WSEC 2ZH6A 3EM1A 3NGTA 4OZLA 3KLEB 3UDCA 3WIUA 1ZTTA 4QYZJ 4IKAA 1N6QB 2VBYA 1F0XA 3TANA 3OFGA 1H7WA 4ZN1A 1EP4A 2E5LJ 4PYAA 2KN4A 3LH2S 3HVRA 2GVDA 2E44A 3OR2B 1RWWB 2CNLB 3S6EA 2X3DA 4KO0B 4C9DA 1RTHB 4DUYF 1NSQA 1UJ4A 4PUOB 1Y5LB 3M7VA 1FXRA 2HHXA 2FJWA 1JQGA 4JI0J 3DDIA 2HFVA 1LKZA 4Y0FA 4CQ1A 3KHRA 4G1QA 3MEEA 2KYZA 4OJGA 4IO1A 2VOOA 4LVNP 1JJHA 4E8UA 1PO6A 5IT9Y 2EI5A 3Q2SC 1H98A 1BE4A 4WYLA 5M2RA 3IS9A 4IFYB 2YWEA 4EU0A 3C19A 1NXIA 1NK7A 3FSXA 3TYTA 1X4GA 5KG0A 2XYGB 4ILLA 4LQ3A 5DQHA 2UUAF 3N4WA 4ETXA 4BS2A 1AZSB 4DF4A 3Q22A 1MMLA 4TN2A 1IJEB 4YR3A 4ED5A 3NGUA 5F8NA 4KY3A 3MTJA 4MIBA 4F0MA 1ZS6A 4EO6A 1B4SA 2MKKA 3MM7A 4O0NA 4B3SF 1FRKA 3M30B 5LOQA 3RBEA 4I7FB 2KTQA 3CO0P 1KLMA 3H2UB 3MEDB 2HQCA 2N7YA 4IQXA 5K8OA 1JLBB 5A76A 1DTTA 3LP1A 2L9WA 1KTVA 3SFGA 4OX9F 3IN5A 2CUYA 3T1HJ 1RT4A 4B3OB 2RT3A 3PIPQ 4U6PA 4AT1B 1CJKB 2O66A 2B9YA 3MZIA 4EZ6A 4OX8A 4RJVA 3UI3A 5BYSA 4NA3A 3N6MA 3SI8A 4DL4A 3T9ZA 1RYRA 2PGCA 1A0OB 4K5SA 4GKJJ 3X3UA 4J9RA 2C22A 2EBEA 2VC1A 1GTEA 4RW4B 5A2QY 1FKAF 4B9NA 2AQ4A 3Q24A 1R8AA 4W90B 1IUJA 3VAJA 5CYMB 1GMWD 1RTDB 1X7VA 3BGRA 3PG9A 1JLFB 4DHVA 4A8YA 3KLIB 1REGX 2C2KB 1KRPA 2F4FA 1HARA 4IDKB 4EYIB 1HNXJ 2YNHA 5E3CA 4DF8A 2N7CA 4DFKA 1SIWB 3Q2TC 4R0EA 4YY3J 1FCAA 4RWWA 2QA4S 1N36F 4ATNA 2ROPA 4XAKA 1YSJA 4B17A 2D41A 3Q0AA 2Y0SD 4OLPA 2IAJA 1O6XA 3HCXA 1L3UA 3ZFVA 1R6YA 4ZVFA 3SXLA 2LMIA 2GAHC 2C2EA 3US5A 3MAAA 3FC9A 4J9OA 5KFFA 2K2PA 2DNYA 1FHTA 3DGPB 5GMEA 4IOAQ 1V5IB 5A0YA 2BV3A 3MUMP 4L72B 5LSOA 2Q1LA 5KOXA 5D0GA 4YUDA 2BKNA 4KPCA 2BQRA 2E9TA 5L1LA 5AE2A 5LT5A 2QFIA 2HLTA 3GSIA 1PGZA 4HL9A 4KIAA 5ADZA 2UVWA 4PWDA 1RADB 2QFJA 2LXUA 2BXJA 1NZ8A 4P73A 2APOA 1Q1KA 4GVLA 3PTWA 5F9LA 2ERRA 3BKFA 1IBLJ 1VJWA 2JFDA 1U6BA 1LV5A 3GYNA 3L3CA 1NJZA 4O3PA 2GGPB 2QL7B 4ED2A 3CVKA 2XMUA 3CJTA 3Q83A 4FXWA 1KR4A 2WOMA 2YVSA 2G0CA 2HRUA 1L3TA 4RNFA 2WVDA 1N5VA 4CI0B 2M88A 5EWEA 2IYIA 1UKUA 1FJGJ 4NL5A 1JLEB 1RI7A 4HT7A 4ZPBA 1JWWA 1T9XA 4QWCA 1KFSA 2W25A 1UVNA 4A8WA 1CJVA 2JC1A 1BUXA 1IBMF 5D3GA 4I0WA 1FVSA 2HRTA 1NCLA 3UN5A 2FLLA 2AJ0A 4PQAA 4DV7F 3KFWX 2B43A 4I64A 4QOTA 2WW8A 2Z2MA 3AJ2A 2IA6A 4YHHJ 2M2BA 3JSBA 1RQ0A 3OD2A 1C4AA 3KXDA 1NBEB 1T11A 3PRVA 1FKPA 3OV7A 3DM2B 3PHEA 2K7JA 2YXLA 4LF2A 2HYIB 1LWEA 4USHA 3O8WA 3ULHA 3W7BA 1XK8A 3M8PA 1AUSL 1U6FA 3IP0A 2VV5A 4ZJOA 5B0BA 4KR0B 4LT6A 5A6PA 2FYXA 3CD0A 1JLAA 2MZ1A 4ED0A 2GJFA 6FD1A 4NLPA 2V5HG 1WTFA 4KFBA 2KT2A 2HNYA 3IM8A 5C24B 5F0UA 4QJVA 3LWLA 2FJDB 1IBCB 4CLUA 2NYHA 3VGVA 4M5DA 3OHAA 1MWYA 3N9UC 1URRA 2BOPA 4WFNQ 3M32A 3DYAA 5L9NA 3SBMA 1WG4A 3QBCA 2QA4G 4CLPA 4UW2A 5F8LA 3KLEA 4C11B 4Q7AA 4MK7A 3PJXA 1FO1A 1QTMA 4CO2A 4PQUB 3D68A 1I6JA 3Q8QB 2DB1A 1HYSB 3IR6B 2C2NA 5KT7A 1EX8A 2G9OA 2CQIA 3I9ZA 2GQQA 4Q2LA 3NY0A 4NEYA 3CCJS 1XC9A 1BGXT 3DLGB 4IR9A 3G9CA 3K57A 4MFBB 3D4JA 3IBFB 5DS7A 4DV4F 4OI1A 3LO3A 3OL9A 2YX7A 1NPRA 2EK6A 3W8GA 3D3CJ 3PR4A 4P7TA 2IYGA 1RT3B 4PAAA 1S6QB 1PC5A 3BQ1A 2DO4A 2GNKA 4YEAA 2CIMA 2Z30B 1J5OB 3MHYA 4PG4A 3IM9A 2XHWA 2J0SD 4DFJA 3G8SA 2HBRB 3VALA 1TKTA 2HS4A 2F8EX 1PKUA 3M2VB 1TAQA 2UP1A 4U7CA 3NOGA 1NMEB 4TQRA 5HJYA 3BB5A 4UY8T 4OI4A 1ZPVA 2V67A 3V2UC 4OZJA 1QE1A 1T03B 2HNZB 3M30A 4I7FA 2R7WA 2XMTA 2W01A 2KRBA 3FQLA 5HQMA 4KT0C 5KFWA 3QFHA 2X7IA 1JLBA 2KL8A 4K4VA 3I96A 3QNWB 2VQFJ 2DXFA 1T9UA 3CGIA 4IFVA 4J90A 1TK8A 4OYIA 3K5PA 5IT4A 1SQFA 1CJKA 1S4FA 3PV8A 1PILA 1FDAA 5EHHA 1YJ7A 4ALZA 4ZS6A 4K8RA 5KFDA 4KYZA 3LP2B 3H4BA 3KK3B 4J9UE 4RW4A 1JLCB 2JRSA 1RWXB 3MR7A 5LL6d 1S1XB 2DH9A 2FHMA 3CDEA 3D54A 5CYMA 3K8WA 1RAAB 2F7VA 1D9AA 1JLFA 3OVBA 2DYAA 2WB4A 3W60A 4CO3A 1C0TA 3KLIA 2LQBA 2VBXA 5D0RA 4DQQA 3SCJE 1NK4A 2UXDJ 2GA7A 1FDBA 1SC3B 1GT8A 1BQMB 4K5RA 5ETOA 3PIOQ 4CLWA 2J9EA 3NCPA 3DDNA 1UEVA 2XGQA 4CYUA 2EFOA 4NLWA 4JI5F 4QIVA 3EGNA 4KHPF 1WHWA 3DDKA 3RB3A 1S6OA 2CPEA 2XHCA 3IMQJ 4KGZB 4URSA 3EMTA 2V0NA 3S7RA 4LF4F 1OO0B 1X0PA 4DQSA 4O3OA 1EQ0A 4LF5J 2B5JB 3NS6A 3EYZA 2NXNA 1R89A 2HEKA 3JYTB 2YNGB 1ZAWA 2HK2A 4U7UD 4ANEA 3QGPA 2Y1LB 1WF1A 1TL7B 1CEZA 1N32F 5IC4B 1LEOA 3PW0A 3G86A 2YWGA 5KTQA 2BMBA 2MQMA 2Z2LA 3DHXA 2RS8A 2KFYA 1J5EJ 2QE5A 4DV2J 1U48A 2RKIB 5IT0A 4JYAJ 2CXEA 2XG8A 1U8SA 2DD8S 1UZDA 2CADA 1JXLA 2ZUAA 3CCVS 2IVFB 1IQTA 1N48A 4DWIA 3T5LA 2UUBF 2QLBB 5EWGA 1NHVA 1SKSA 3CCLS 3W2WA 1M90T 3HZEA 2CKWA 2NYIA 2GGPA 3ENVA 1N33F 2ZVSA 1X4HA 5JVGQ 2YPZA 2MSTA 3AY0A 2MEWA 3LWMA 2B9WA 1ZTWA 2HHSA 4DOZA 2HZVA 5KG7A 4C48A 2UVUA 4DX6A 5B0GA 3JTPA 3CC4S 3AD9C 2EKYA 1GNKA 1WF0A 5CYJA 4Z37A 2XMAA 2J6SA 4FF3A 2C3YA 3HHLA 3KK1B 3ILOA 3PW7A 1VCTA 2XYPB 1VJQA 2DXEA 3JS9A 3H0PA 4WPAA 2IM3A 3NEKA 1ZETA 4ZCLA 3QT6A 3FGVA 2A0FB 4LJMA 2Z2ZA 1KLNA 2Q6CA 1HWUA 2RDDA 1FK9B 3AJDA 2QRRA 4DL5A 4TU7A 4DR7J 4F4KA 5A8KB 3NRBA 1U0HB 4JV0A 1OPIA 3SDEB 2E5IA 2C2DA 4X2BA 5KT3A 3DNCA 4HKQA 1SVDA 2FJAB 2C1EB 2J8AA 2I2YA 3TA1A 4FYVB 8AT1B 4NLYA 4J9PA 3P96A 3CJRA 4AD6A 3E01A 5HP1B 3BBBA 3RRGA 4DCPB 4UOCA 2XSJB 5K8MA 1CBKA 2OPQB 3HLUA 1X4DA 5HLFA 3HD2A 2AEMA 2VKZG 2YBVA 1IKWB 2ASDA 3HXMA 1X4AA 4LF9F 1X31C 2Z4PA 4C0OC 4K2JA 2DGOA 3EJMA 2V6AA 2DHAA 1X5PA 3OTBA 1UZHA 3A3OB 4DLGA 4PQUA 1SJFA 3L9ZA 3ZZOA 1HYSA 2ZDPA 3TW0A 2MLZA 4O4RA 2KZMA 2ZD1A 2KKHA 2RRNA 1IR2A 1NUEA 1FJCA 3ISNC 4NXNJ 1UWAA 3DRYA 2D74B 4DR4F 2LDYA 4QR0A 3W3SA 4HR2A 4OHVA 1UAWA 2PIIA 3HFVA 3L7PA 2HNDB 2MJUA 3JAMY 2FD2A 5AJ3F 5LMNJ 2MKHA 2QG9B 4NLVA 1Y00A 3VVUA 4DL3A 1PJ7A 4K7QA 1RT3A 3EVOA 3BO2A 1S6QA 2V4JB 2CQ3A 2AIRB 2BDPA 2OD6A 4B3TF 1XNRF 4JI6J 4L76A 1XMOF 3NBPB 5F8HA 5E2QA 1QAIA 2C28A 3EGZA 1FJEB 5ETTA 1YHQS 2OAUA 1LWXA 1L3VA 1FTRA 1KVJA 2K8GA 3PYDA 2HNZA 1XIQA 4USUA 3M1VB 2YH1A 1EHWA 2MQLA 1U2CA 3LUYA 1IJFB 4KH1B 4J9KA 3NP5A 1NPKA 4MIWA 1DQAA 4IH5A 4WFZA 4QBUA 2XY6A 3FBCA 1R0AB 4A8OA 2MMYA 1QAJA 1WACA 4OYMA 2CPYA 2IJNA 1PBAA 3ZTOA 2X1BA 3HPOA 3BSOA 5J1EB 3R5DA 4TXSA 1Q0NA 1WJ9A 3H5UA 3BM7A 4C2MA 1S9FA 4USJC 2DBBA 3D2WA 4O44B 3TO8A 1JLCA 3OVAA 2QLFB 3M4XA 5L9XA 5K8PA 2HMIA 4NXMF 3KWMA 3CDBA 4Y2IA 2QV6A 2K06A 4AXJA 4H4MB 4CTAA 1H74A 2MXYA 5JVHQ 3T3FA 1IKXB 4DS4A 5DETA 5DG8A 1C1BB 4MK9A 3T41A 2VJUA 5ETVA 3IR7B 1BQMA 3WIVA 4GMKA 2JOQA 4L6V3 2JDJA 3OLAA 1TKDA 4LBPA 3FEZA 2RSQA 1B70B 3PCOB 4ZVSB 2ASLA 2M0GB 4E2FB 3LQVA 3W63A 1CQNA 2ZHOA 3RYLA 2GV1A 3HULA 4AQYF 2ZM6F 1VBXA 1T3OA 1T3NA 2C3OA 3OFHA 4NZ7A 3PKYA 1FF2A 2P9CA 2AJ1A 1XNQF 2ZH3A 4YN3B 1RISA 3B4MA 4DMZA 3I5AA 3MOZA 1M5KC 4ZPWR 4EBEA 1HI0P 3NMRA 3I31A 2F9DA 3KDNA 3NNAA 3JYTA 2YNGA 4FVMA 1VQMS 3BDPA 3QJJA 3HHKA 3DI6A 1I51B 3CE8A 4OI6A 2D3OR 3VV2B 3D6FB 4IRKA 3GR1A 3SV3A 2VA3A 2E9RX 3PW4A 1WC3A 4B3SJ 2ZZNA 1OQ3A 1EETB 4QIFA 3KLGA 4Q8FA 3FCHA 1VQLS 1VK8A 2AZ1A 5GMKa 2W2NP 4M5GA 3FBEA 2CJAA 4CIOA 2VB6A 3PW2A 5DZ6A 3R9LA 3ZO7A 3JQJA 3DRRA 3M8RA 1BWEA 1TZ0A 2IRXA 2YX4A 3LGMA 5E3AA 4PG6A 4DSLA 5E33A 1G1XA 5L46A 1RT1B 4FPRA 1T9WA 3SCLE 3I4PA 4ZVQB 1RK8A 1NJXA 2CJ9A 1MNEA 4NYZA 4FN5A 4CM2A 2GMJA 2KH9A 3FEYB 3M9OB 3I55S 2K3IA 1N8RT 1CS4B 2GFFA 4HACA 2NZ4A 4ZVRB 4RO0A 1APSA 3CJ0A 2LFVA 2XNRA 3B8HA 4U67Q 1RT2B 1CJUB 3TZWA 1S72S 4KTQA 3KK1A 4LIWA 1T95A 3M6VA 3QLHB 3CCTA 3H59A 2XMVA 5JJBA 4LREA 2JVRA 3LGHA 3CXCR 4PG5A 1FNXH 1S9EB 1WNEA 3R5AA 3HHLD 4OHZA 1LK7A 4KHRA 1S6PA 1ZA2B 1IKVB 4NLRA 3CCSS 1HBOB 4WFBQ 2FJBB 2QA1A 3DLEB 1FK9A 1RA7A 5ETLA 2E5LF 5J1NA 4ZJLA 3BREA 3AXKA 2R4FA 3OL8A 3FFIB 4BHQA 4ECWA 2V9KA 4LFBF 3QIDA 3KHLA 2ZKTA 1SKUB 1U25A 2QGFB 1FNMA 1WHYA 1VBKA 1NDLA 2P8IA 4JI0F 3NWGA 2PC6A 4RW8A 1D9FA 1KQKA 1FD2A 3DMJB 8RUCA 3GQCA 4OFZA 2RDIA 1MMDA 3V4IB 2VQEF 5F41A 2OJ3A 2VKRA 1KVIA 3A13A 3CD7A 2OPQA 3H8YA 2XULA 1B64A 1HNWF 5KFCA 5ETKA 4CZCA 1IKWA 1RYSA 3BSAA 3JSMA 2YNFB 2N82B 3JXOA 5J2QA 2BE2A 2OEKA 1DQ9A 3V5RA 4OI3A 1JIHA 1RLCL 2YQ1A 3U1LA 4FS1A 2ALYB 1NDKA 1X8DA 3P4UB 3RRKA 2E1MC 1E6VA 3VTIA 4YP3A 1S4EA 3AAWB 3P49B 1NHKL 4Y34A 4U95A 1RWOB 3KG0A 1DQ8A 3OTCA 4X65J 4ED1A 3VF0B 2CDQA 2JH3A 3KUEA 3MR3A 3OXFA 3HVWA 1S1UB 2MDAA 3CJ4A 2GC8A 4F67A 4PG7A 1Q5YA 1ZAVA 2YTCA 1RT6B 3G8QA 1HR0J 2N4CA 3ZNJ1 4QCLA 5EX0A 1WKJA 1Y3JA 1XTZA 1FRIA 3V81B 2CJYB 3T1HF 5KFLA 4HH0A 1TV6B 4I69A 3N01A 1AUDA 3LAKA 5ITHA 2B6AB 3MMAA 4RKUC 4ES3A 1BWVA 2YKNA 1FE0A 3NBPA 3C6UB 4F36A 2OIHA 3U7JA 3W62A 2PEHA 2VG5A 3GFZA 5DDRC 3AB2B 2EW9A 2QT7A 4OZ3A 3GMGA 1VC0A 1IM6A 3K2YA 3RG6A 3SMZA 3U02A 2BZ2A 4NCGA 1HMVA 2F65A 3D6TB 3R6GB 4W92B 3W2VB 2H4WB 1FESA 1Q5VA 4N5SA 4HYKA 4CLZA 1FDNA 2V4RA 3MUVP 3Q8PB 3IRXB 1LXJA 3NG8A 5KAKA 3MOJB 2QA2A 1K44A 3M05A 4BWJA 2BABA 4HTJA 1DARA 1F9HA 1JLGA 2QLWA 1HNXF 2CVEA 4HEA9 1RAOA 3MM5B 1CULA 3CO9A 4OL8A 1WC6A 1CVJA 2D3ZA 3CC7S 3P6YC 1MU2B 5DG9A 2GQCA 4YY3F 1YJWS 2R7QA 3LOUA 2XY5A 2WAQD 1CJTA 2HWTA 4IUFA 4QWEA 2Y1RI 1SV5A 1NH8A 2DXDA 5EDWA 4O44A 4ZVOB 5HMXA 4ECZA 1T0TV 1HNZJ 1HQEB 3O1LA 3QATA 4MKYA 3QRRA 3I82A 4H4MA 1ZAXA 1S9GB 4QR1A 1A7GE 3PYGA 3UN3A 1P1TA 1BQNA 3BKTA 1M5VC 3HVAA 3ITHB 2GIFA 2W9BA 4C8ZA 4U7UK 4DV4J 2FVCA 2V8VA 1HW9A 3G82B 5HVGA 4R8UA 3M8QB 2W4DA 3EUNA 3DOMA 3ZZTA 1U26A 4DV3J 3GIRA 5K14A 3B54A 5G0RA 4USVA 3C66A 3FBFA 4WK1A 1VRUB 1NB7A 4OX6A 1TMJA 2C2ZB 3DLJA 4X66J 4URQU 5KG1A 1S0VA 2JX2A 3PO5A 3NLCA 2UU9J 4PRFA 2Y9HA 1QD1A 1QUPA 4J9NA 1KHWA 3RB6A 3PO4A 4K2XA 4OYWA 3I0SA 1TFWA 1FJGF 3G6YA 1O8BA 1RZMA 3DRSB 1RTJB 2POKA 1RBOB 4HDHA 2NUUG 4MH8A 2R7XA 5KFKA 2XS7A 1NSKL 2ZC4A 2EPIA 4TY8B 3PEHA 2WW4A 2R7OA 1TMMA 3C15B 4CH7A 1KQSR 4DU8A 1KN6A 4FNHA 2VBWA 1VR6A 3DOKA 3QWUA 3HHEA 1S57A 4JB8B 2ZH2A 4JV5J 1YX2A 3MR6A 2CQ1A 3CNQP 3GV8B 1T05A 1FD8A 1B0VA 1EZZB 5BXIA 3R5CA 4DBQA 4B9LA 4OYXA 4ZITA 1MN9A 3H42A 2HBQB 3RJMB 2DGTA 1FX2A 2V94A 5KFNA 1D8YA 1CS4A 1S7HA 2OPPA 4DQIA 2OSRA 3PACA 1TVRB 3SQGA 1ZM4A 3EWGA 4HI2A 1RT2A 4N56A 4I2PB 2JLFA 2GHPA 1ACMB 2EG1A 2HHWA 5AE3A 4C6AA 2MGZA 3QLHA 2EFNA 2MKCA 3MMCB 4EGLA 4F3OA 4HI1A 5ETRA 3HVTB 2HVZA 1K47A 2HFUA 2P6SA 3KLFB 5D0HA 2CPIA 4ELUA 2HQGA 1RT7A 2P9EA 3IBWA 1RKIA 2VD3A 2W4CA 4RR5A 5CABA 3GB0A 1HBOA 1WDDA 4RBVA 5HROA 3KMQA 5IC6B 3EVWA 4JBCA 5KFEA 3JSYA 1S77D 1VQ9S 3UR3C 1WOOA 1R7IA 4LF4J 2VG7B 3PRDA 2XI3A 2AJQA 3PRBA 4Y2MA 3V6DA 3NXZA 1N34F 1GK8A 1SIZA 2H51B 1TKXB 1F5CA 4IRCA 2HIYA 4QPTA 4C8NA 4UOHA 2A2CA 3V4IA 1UW4A 2Y1IA 3PZPA 4ECTA 2DNHA 4C0HA 1N32J 3RAXA 4ZP7A 3MAQA 2CQCA 3BQ0A 2IC3A 4LIRA 4N8NA 5I3QA 1IN0A 2NCKL 3FSYA 2L48A 3IRWP 2V2QA 2DY9A 4DPYA 2BOAA 4F26A 2EG2A 2HHHJ 2J9CA 3TAMB 4C3MA 5DM7Q 2FDNA 2UUTA 2UUBJ 2KYXA 3BEGB 1XJWB 1JNZB 3A3NB 4KBIA 1JK9B 5D77A 4Y2CA 4K4YA 1YZ6A 1C4CA 1R8CA 2AJ4A 4H4OB 2MQNA 4DV0F 3OJSA 1S1TA 4RW7B 1N33J 5B0CA 3GIIA 3W5ZA 2ZE2A 1XMBA 2HQ3A 3LW5C 1U1RA 4Z7CA 2R9LA 3KJVA 4B9MA 4P2FA 1UJ5A 1RT6A 1UA0A 4IG3B 3DCAA 2VPZB 1VGYA 4NASA 2MZSA 5LSLA 2FIUA 1NJYA 2ZC3A 1MN7A 3EPGA 2AU0A 3GE9A 3PX6A 3A8EA 2W2QP 3BN7A 3FDSA 3QO9A 3V6KA 4IG0B 4K0KJ 2Q6BA 3LP0B 5B0EA 3QQCD 3WZ0A 4LSNB 3I0RA 3N79A 3THPA 2VBZA 1UWBB 3N28A 5KFGA 2UXCF 1SCJB 3NS5A 3W61A 4CO1A 2KG1A 1W25A 3AXMA 4DQPA 2DGUA 4OJ1A 4QQBA 4GO7X 5GVQA 4I6AA 3JSRA 5KT6A 2MTLA 2UXDF 1R3NA 2AKWB 4K4WA 3ET6B 2LA4A 3R3TA 4DL2A 3ZNUA 2UUWA 5D4OA 1RT5B 4WXWA 1XN9A 1MU2A 4JI3J 4CT8A 2QSFA 3GJSB 3CB4A 2DR8A 2MQQA 4K50A 2A18A 4DG1A 3OLBA 4DPWA 3QFWA 4TYBA 2JWNA 1IWGA 1T9YA 2CQ4A 2GO8A 2DRBA 3IAM9 5LXYA 4ES1A 2MQOA 4PXBA 2VL1A 1HQEA 3MD3A 4ZPDA 1YJNS 1AA1B 2B56A 2DH7A 2R8KA 4UUXA 1S9GA 2WSCC 2ZH4A 4RNNA 3FRYA 4RW6B 2E5HA 2HAIA 1BQXA 4F8RA 1H2UX 3RTVA 3THVA 2J7KA 2FLOA 5CZVA 4J9VA 3CCUS 4JI2J 5B09A 1CC7A 1J5EF 5C2GA 3VWSA 4XPEA 2DGQA 5GAEU 4DV2F 2PSZA 2FHOB 1KNZA 4G6VB 5MAOA 1EKRA 1U2FA 1HHTP 4Y6IA 2RH3A 1K0TA 1NK8A 5D4NA 3M6WA 2LQ5A 4XTTA 2FVSA 5F3ZA 5KFHA 3W1YC 1GXUA 4PWWA 1Q8KA 4N7TA 5A6WA 4UY85 1F6TA 1OSCA 5K20B 2WK4A 4O4GB 4ID5A 4DR2F 1TL5A 1FKOB 3DLKA 5C42B 4FZVA 2DNQA 2ZBPA 2WBRA 3C16B 3HX9A 4YQWA 1DRZA 5CA5A 4B9TA 3CDAA 3M8ZA 4OYBA 2RNEA 1N4LA 2CVIA 2V50A 2FZCB 4OJHA 4DV6F 4NYPA 1RAEB 3KK2B 2GZOA 3OBIA 5A8WA 4X4RA 4QU7A 1E6YA 4MIAA 4GVBA 3FZBA 3MCNA 4CDIA 4C7QA 2OFGX 5HQ8A 4FNIA 3HJVA 2YNIB 2CQPA 3L7UA 4PABA 4OZNA 4J9LA 3MI7X 1OJ4A 3MM8B 2A2DA 2VODA 3CUNA 1VHIA 2M4MA 1IVZA 2QO3A 1LWCA 1M5PC 2OPSB 1GFWB 1HBUA 2V8GA 2IJFA 4F3MA 1RA6A 3WQPA 1S49A 2DK2A 4C8KA 1SKRA 4B3MF 3QZ8A 4B9UA 4H54A 3TZXA 2VG6A 5EWFA 4CCHA 1ICEB 2QC3A 4KSEB 3MM6B 1QVFR 1S6UA 1DBDA 3HSJA 1OYDA 3IFEA 1RHQB 4A48A 2V8HA 3HF5A 1HNVB 3FZ2A 5J2NB 1OYEA 1AB8A 1Q7LB 3S8SA 3GJTB 4C97A 3THTA 3K8VA 5AT1B 1RSCA 1REVA 2CJXB 1GXLA 4P72A 4KE5A 4ZVUB 2IHR1 1R8HA 4KH0B 2ZM6J 1Q81T 4P7VA 1U02A 3MECB 1TKZB 1LW2B 4NXNF 1EIYB 2MKYA 2B7CB 5ETMA 3H7HB 4YMEA 4G3IA 4DUTA 1OS5A 1YJRA 2W9AA 1NK9A 4IQMA 2V69A 4F4AA 3IBCB 3R7BB 2JLGA 4NCAA 1UVJA 1VFJA 1TKXA 1S1VB 1HBMB 1PAUB 4ILMA 4WXOA 2JJ4D 4YDDB 2VH7A 3R2DJ 2RU3A 3CJKB 1IBKJ 2J7WA 4UZBA 2VONA 1TU0B 2CNNB 2AEJA 2EK1A 2PEBA 2IDLA 5H9FJ 3TVKA 7AT1B 4JI6F 2OI2A 1H6KX 5HK4A 2W9CB 3M6XA 2F8HA 4AXIA 3LANA 2FC9A 3C46A 3GPAA 3TZYA 1V6HA 5D15A 2GJIA 1OY6A 4NMXA 2W1BA 2DNZA 1X4CA 1P1LA 3MURP 4WE1A 1MROB 2PI5A 3UPFA 3CF5Q 1FEHA 1SC1B 4RW7A 3GP9A 3AT1B 5KG3A 1S1WB 5U47A 3I6PA 2DR7A 2RU9A 3L4BC 3MR2A 3J7Z5 3M8SA 2C2RA 4PKDB 1KS2A 2PFFB 1LW0B 4NLOA 2KDOA 3SSQA 1M1KT 5LXRA 1Z1ZA 5K5MA 1P9QC 1N54B 2ZOFA 4DL7A 4MAKA 1RJJA 2H5EA 2YQ0A 3UD3P 1KSPA 3L7OA 3G6ES 2YWKA 2Z57B 5FDLB 1Z2LA 2G4BA 3TP2A 3PYFA 4IG0A 2LQ9A 3LP0A 2MQ8A 3NAHA 1HPZA 2YWHA 3MFHA 4ANCA 1F5AA 2KO1A 2MPUA 2RILA 4KGXB 5KG2A 3N0VA 3GILA 4YOEA 1DURA 1C0UA 3RU0A 1VRQC 4HHUA 4LFBJ 1DLOA 2KRRA 1NJIT 1TR0A 1PYSB 4WCEQ 3VAFA 1Q53A 1RWKB 1YG0A 2IRUA 3BZQA 5KFTA 1NKCA 4L73A 4C8LA 3N5BA 4HH1A 4DFMA 5I42B 1H2VZ 2A6MA 4MKAA 3VAGA 3KLVA 4D3HA 3OXGA 4EFAC 3PW5A 3ICLA 2VQEJ 4DPUA 1UFKA 2I5JB 2J5AA 1TL3B 1HNWJ 3NCRA 3RZAA 2AP6A 3QPIA 2UVRA 3MD1A 1RWPB 5DO2A 3H40A 2PE8A 1WC5A 1SJ3P 4ZVPB 1R43A 5GAEI 1M1GA 4CH0S 4M5MA 4M5JA 5IM0B 2MSSA 3J7AN 3MCMA 2YPYA 2LXIA 1RWNB 5B0DA 2J76E 1U47A 1FFSB 1CQMA 1ZPWX 5DGAA 2DNKA 5AXMA 3AJ1A 5J1PA 1VLOA 4P2SA 1V3SA 1S7IA 4OI0A 1VQ6S 1GH8A 2YY3A 2HAFA 4ICLA 3M8WA 4ERDA 2LLZA 4EUVA 5HANA 1D3WA 4X62J 2J0QD 3BGLA 3TUPA 1SH0A 1OY9A 2WVFA 3QZ7A 2NLWA 1RHKB 2DHHA 2XMMA 1B0TA 3AD8C 1MSWD 2OO4A 2CNKB 1NU4A 1Q7YT 1B0PA 3P5BP 1ULRA 2VHGA 1HWIA 3QAUA 1HQUB 1Y9OA 4OZ1A 2LU2A 2EC2A 1TUVA 4NRUA 4NI2A 1K1SA 2UV8G 1FJ7A 3M9NB 2X1AA 5SUHA 4CWBA 4ED7A 5KOWA 2X1GA 1GXTA 2MLYA 3Q86A 3QWPA 2DRAA 5C42A 2AGQA 4JP8A 1U6ZA 4ELTA 3C16A 1FDDA 3D66A 3OFEA 1JJCB 2AMCB 4LFAJ 1DHMA 4QW8A 2HKEA 3BDEA 5CZXA 2DHXA 3WBZA 4Y2AA 1L5UA 5IQQA 1XR6A 2G13A 3WC0A 2JHEA 3GJRB 2ZJRQ 2A6OA 2AYBA 3BF4A 5CD4H 1Y7PA 2D3UA 4PXEA 3G96A 4XDDA 4LF8J 4J7CA 5EX3A 4WU2A 4KGMA 3MM8A 3V4MA 1UVLA 2B4UA 2ZZTA 2OPSA 2I8EA 2WBMA 2MZQA 3A12A 4CNYA 4WFXA 1FRLA 3ETMA 2DNGA 3T6JA 5J2PB 3GIMA 5HJXA 3ENQA 1RHRB 4RUBA 2P2CB 5KT4A 4L74A 3UNGC 2JVOA 3WC2A 4ZDNA 1H0HB 3MPWA 3MMBB 2ZUGA 1ZM3A 3KLHA 4M95A 5IS2A 4DI6A 3CPWR 2RF2A 2LVWA 4LVOP 1H3DA 2AHOB 3ILLA 2ROGA 1MMNA 3OUYB 4R5PB 4PPDA 2X1FA 2IPOB 4RUHA 8ATCB 5LJ5Y 1GMVA 2IBKA 3NGRA 2FPHX 1YJUA 1C1CB 3FQKA 4A46A 3AH6A 1TTHB 3I56S 2XSFA 3HI9A 3C6TA 3VR1A 4LSLA 1TK5A 4X4NA 3HFKA 4I2QB 2XO7A 1RHJB 3AQPA 1KKHA 4GRSA 5M2UA 3C14A 5T7LB 3J80Y 1FRXA 1HI1A 1QLNA 5MLCV 2QL5B 3LPYA 4C4WA 4X65F 4ZCKA 1TKZA 4FKYA 4A8FA 1FX4A 1OIAA 1Q8BA 3G8TA 4EK2A 3J81U 1QUVA 2HVEA 4OMFG 4B08A 1HBMA 3UCGA 3AD7C 2GAGC 4DS5A 1HR0F 2BM0A 4USKA 4ECYA 2ALZA 3CJKA 4HTIA 3GZ7A 3OXLA 1N5YB 2RIJA 2X51A 4OYOA 5KFBA 2DNPA 5HMZA 1XBWA 3TVYA 5H9EK 3T5JA 4TYAA 1HBNB 3BQ2A 3GIKA 3H4DA 2H4YB 4GC7A 1L3KA 3ZZPA 1NSPA 1KTQA 1BLUA 1FI4A 4XDCA 2IIHA 1BMQB 3TA2A 5B0AA 5CAAA 4F25A 3ETOA 1VYAA 4DV1F 4E0DA 1WI8A 3EZOA 1KP6A 4AUKA 4J91A 2F40A 1I1GA 4ZLJA 1B7FA 4UOFA 2Z8QA 3WDOA 4ILRA 3TJ8A 2OMOA 3NNHA 2M9KA 3EPIA 4FKXA 2LU1A 4WFYA 3K5MA 3QIPB 1S5ZA 2D1CA 4JUZA 4KV8B 1ZH5A 3FCWA 5F8GA 3D5MA 2LP4A 2CWKA 3CDWA 4LRFA 1TELA 4YB7A 3MUTP 4CO5A 2W7PA 3CMES 2PN6A 2OPRB 3WX4A 3MM9A 4ZIWA 4WP3A 5HBMA 4FXVA 4MYTA 2OD4A 2GQ2A 4RUAA 3T5KA 1OWXA 3TJ9A 2CPFA 2QSWA 3AOCA 1V9OA 4OLOA 1SC4B 1K8AT 3H25A 1KHVA 1SUQA 1KWMA 4ZJQA 1ZA1B 4WP9A 2ZOMA 3ZZZA 5IT9U 1D09B 4WWSA 1N6QA 1SQGA 1HNZF 1FRMA 3GV7B 3J81j 3D1HA 1U09A 3CD6S 3KMSA 1RE1B 3AFGA 1YQHA 3OR2A 4J9SA 2FZKB 3GJQB 4ED8A 3EGWB 4KO0A 4V19X 1RTHA 2OMLA 4PUOA 1XERA 1HL6A 4WTYA 2VF3A 3EDRB 2C3PA 4WIIA 3TX8A 1SXLA 1EP4B 2NSBA 2BUNA 4BWMA 2GVDB 2DY1A 1FFGB 2ZOGA 4X64J 2AD9A 1EARA 3UR0A 2MY8A 1N34J 4DR6F 5B08A 1V3RA 4MYUA 4UOGA 2B0GA 4DV3F 3BH6B 4IFYA 3DRXA 4M5LA 2E1CA 3CULA 3CJ5A
chains in the Genus database with same CATH topology
2KL8A 4YY3J 4DUZJ 4GKKJ 4DV7J 3J80U 1I94J 4B3MJ 4JI1J 2VQFJ 4DR7J 4NXNJ 5BR8J 4LF9J 4LFCJ 4RJVA 2HHHJ 4DUYJ 4NXMJ 2MQ8A 4JI8J 4LFAJ 5LM7E 4X65J 3J7AN 3IMQJ 2UUBJ 3D3CJ 4DV4J 5LMUJ 5LMNJ 4GKJJ 1FJGJ 5IWAJ 4JV5J 2MEWA 4DV6J 4JI2J 5IT9U 4LF5J 4DV3J 4OX9J 4B3RJ 2MTLA 1N33J 4HHUA 4KYZA 4LFBJ 2UXCJ 5A2QU 4JI5J 4JI7J 1HR0J 3T1YJ 4KHPJ 1N36J 4LF4J 4DR1J 4DR5J 4DR4J 4DV0J 2UXBJ 4X62J 4NEZA 4JI6J 3OTOJ 4KY3A 2UUCJ 2ZM6J 3JAMU 4X66J 4LF8J 2E5LJ 2UU9J 4K0KJ 5AJ3J 3W1YC 4PWWA 5FLXU 4DV1J 2KVQE 1XMQJ 4JI3J 3T1HJ 4YHHJ 4DR3J 4LF7J 2UUAJ 4X64J 2VQEJ 1J5EJ 1N34J 4JI0J 1N32J 4AQYJ 1HNXJ 4DV2J 1HNZJ 2UXDJ 4B3SJ 4LF6J 1IBMJ 3R2CJ 1IBLJ 2F4VJ 4JYAJ 4DV5J 4NEYA 4V1Ak 1HNWJ 4B3TJ 1XNQJ 1XNRJ 3D3BJ 3R2DJ 4JI4J 1IBKJ 3J81U 1XMOJ 4DR2J 4DR6J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KL8 A;  4YY3 J;  4DUZ J;  4GKK J;  4DV7 J;  3J80 U;  1I94 J;  4B3M J;  4JI1 J;  2VQF J;  4DR7 J;  4NXN J;  5BR8 J;  4LF9 J;  4LFC J;  4RJV A;  2HHH J;  4DUY J;  4NXM J;  2MQ8 A;  4JI8 J;  4LFA J;  5LM7 E;  4X65 J;  3J7A N;  3IMQ J;  2UUB J;  3D3C J;  4DV4 J;  5LMU J;  5LMN J;  4GKJ J;  1FJG J;  5IWA J;  4JV5 J;  2MEW A;  4DV6 J;  4JI2 J;  5IT9 U;  4LF5 J;  4DV3 J;  4OX9 J;  4B3R J;  2MTL A;  1N33 J;  4HHU A;  4KYZ A;  4LFB J;  2UXC J;  5A2Q U;  4JI5 J;  4JI7 J;  1HR0 J;  3T1Y J;  4KHP J;  1N36 J;  4LF4 J;  4DR1 J;  4DR5 J;  4DR4 J;  4DV0 J;  2UXB J;  4X62 J;  4NEZ A;  4JI6 J;  3OTO J;  4KY3 A;  2UUC J;  2ZM6 J;  3JAM U;  4X66 J;  4LF8 J;  2E5L J;  2UU9 J;  4K0K J;  5AJ3 J;  3W1Y C;  4PWW A;  5FLX U;  4DV1 J;  2KVQ E;  1XMQ J;  4JI3 J;  3T1H J;  4YHH J;  4DR3 J;  4LF7 J;  2UUA J;  4X64 J;  2VQE J;  1J5E J;  1N34 J;  4JI0 J;  1N32 J;  4AQY J;  1HNX J;  4DV2 J;  1HNZ J;  2UXD J;  4B3S J;  4LF6 J;  1IBM J;  3R2C J;  1IBL J;  2F4V J;  4JYA J;  4DV5 J;  4NEY A;  4V1A k;  1HNW J;  4B3T J;  1XNQ J;  1XNR J;  3D3B J;  3R2D J;  4JI4 J;  1IBK J;  3J81 U;  1XMO J;  4DR2 J;  4DR6 J; 
#chains in the Genus database with same CATH topology
 3GFX A;  2U1A A;  3MEE B;  1KON A;  3OPK A;  4RUC A;  3CJ2 A;  3DLB A;  2DKO B;  2XS5 A;  2VZ9 A;  2RUG A;  3RBZ A;  3UQS A;  4X66 F;  3EX7 B;  1K0V A;  3BGO P;  2H5J B;  3IS9 B;  3CCE S;  1P9Y A;  2UU9 F;  2Q3P A;  2ZH8 A;  1AZS A;  1O5J A;  1YZ7 A;  4FXD A;  3O6Q A;  3QT7 A;  2DHG A;  3F73 A;  2XO6 A;  5DDQ C;  4ZLL A;  4F2R A;  4DV0 J;  2KFN A;  4J5O A;  4F02 A;  3BO4 A;  2KT5 A;  4RU9 A;  2XLJ A;  3AOA A;  3MED A;  3KG1 A;  3BYR A;  4YDX A;  2HQD A;  2P5V A;  5HQL A;  2BYC A;  5IXU A;  3MM7 B;  1LOU A;  1G2E A;  2EEY A;  3VVT A;  2VPW B;  4B3O A;  4JV5 F;  1Y10 A;  1KLM B;  4C8M A;  4J9M A;  2VPY B;  1KC8 T;  2K3K A;  2I9S A;  2GS8 A;  3LP1 B;  1WF2 A;  1Q4R A;  1RT4 B;  2YKA A;  1U45 A;  1WHV A;  1KEK A;  1HHQ A;  2DO0 A;  2HW3 A;  3T9N A;  4NE9 C;  4TNO A;  4ID8 A;  2EFV A;  4PR6 A;  3G2X A;  2FVR A;  1RTD A;  3TQE A;  1LWF B;  4USI A;  2UXC J;  5CH7 B;  1O0P A;  2IFX A;  2F9J A;  1RBA A;  3R97 A;  3BKU A;  5H9E J;  2UXB J;  3A1Y G;  4XO0 A;  1K1Q A;  4TLR A;  3N5F A;  3H2V E;  4S0M A;  2CJQ A;  4AYB D;  2F8M A;  2OGU A;  3NCQ A;  3BGR B;  2KVQ E;  4IDK A;  2R2T A;  4FVC A;  4R25 A;  1ELO A;  3KG4 A;  2RQK A;  3PNI A;  5M2P A;  4M1K A;  1Q8L A;  4QW9 A;  2YNH B;  7FD1 A;  1T02 A;  2LEB A;  4AL5 A;  2D3O 1;  2VIH A;  4N41 A;  2ZZM A;  3DOL B;  3RAM A;  2JLE A;  1UA1 A;  3Q8V A;  5LMU J;  2C3U A;  3TEH B;  4OZ2 A;  3GWC A;  4F4Y A;  1LXN A;  4OIX A;  4TU9 A;  2YWF A;  2MJN A;  3DGP A;  2EBG A;  2IAJ B;  3BSC A;  3KUG A;  4F2S A;  5CYQ B;  2RDJ A;  2FJV A;  4TU8 A;  3QT8 A;  1UW9 A;  1IWA A;  4KGV B;  2XCA A;  3ISN D;  3BO3 A;  1KBR A;  2N3L A;  2F3J A;  3BJY A;  3KNG A;  3R6L B;  2ZH9 A;  2HHH F;  2O5D A;  2RRA A;  2M8D B;  2DNO A;  1HWJ A;  3CDU A;  3PVX A;  1V5V A;  5T7L A;  2E7W A;  5CQG A;  1IKY B;  1P6T A;  4Z2X A;  4DUZ F;  4PWD B;  2DGS A;  3EVM A;  2B7B B;  1H38 A;  3W5Y A;  2BJ3 A;  2SXL A;  4DR2 J;  2ZH5 A;  4DXL A;  5L1K A;  2ZIT A;  1NPP A;  5IV3 A;  1T8E A;  3HKZ D;  1S10 A;  2CRL A;  4ECV A;  4ZVH A;  3MDF A;  1YK9 A;  2R7U A;  5L1J A;  2G1D A;  4A47 A;  3DLL Q;  1JLE A;  2DIU A;  5HVF A;  1OMS A;  3VAI A;  3AQO A;  5I3P A;  1HI8 A;  4M5I A;  2WOM B;  2RHQ B;  4DV6 J;  3DU5 A;  2VFS A;  4O23 A;  2FUG 9;  1OQ6 A;  3J7Z T;  2HFS A;  3ZZY A;  3OL7 A;  2P9G A;  1VQ8 S;  3UFC X;  1CJV B;  4OHY A;  4K0K F;  2YKM B;  5D3G B;  1YGY A;  2CNO B;  1QM9 A;  4OI2 A;  2HK3 A;  3X1L B;  4P74 A;  2FZG B;  1FNO A;  4FYD A;  5FLX U;  1XMQ J;  2DHS A;  1S0M A;  3MEG B;  3DM2 A;  2ZVI A;  4CLT A;  5DRK A;  3PYE A;  1T9V A;  3JTO A;  3J81 Y;  5IQ6 A;  3G6V A;  3QIP A;  1FKP B;  1R0B G;  3OW2 R;  2HVD A;  5JMN A;  2R8H A;  4B3M J;  3NWR A;  5C24 A;  4CNZ A;  3M8P B;  1KD1 T;  1M5O C;  4Q45 A;  1NKE A;  2B4V A;  2KXH A;  2FJE B;  3TVZ A;  2C3M A;  5HSP A;  2VU5 A;  4F04 B;  3TJA A;  1Z2Z A;  4JI3 F;  4WZQ A;  2B51 A;  1BC6 A;  1JLA B;  2AJ2 A;  4DR5 F;  4DZ6 A;  2HNY B;  1F2H A;  4ZPV R;  2E1R A;  4EEY A;  2WZ1 A;  4Y3C A;  1NEE A;  1W26 A;  4C11 A;  2AJF E;  3ZTR A;  5L8R C;  4O3N A;  3A8K A;  3BS9 A;  2VFR A;  3R5G A;  3QGG A;  1IR1 A;  2ZBC A;  3JQM A;  4M8L A;  4WKY A;  2XTJ P;  3ZZR A;  4F3Q A;  4TQS A;  4NLG A;  5BYR A;  4OV6 A;  5HAT A;  3BV8 A;  4PEO A;  1P27 B;  2BAC A;  2DH8 A;  2HHQ A;  2V34 A;  2IA0 A;  3DHW C;  4UZC A;  2AYG A;  3DLG A;  3PJW A;  4CH1 A;  1HFE L;  3D67 A;  2BRL A;  4MFB A;  1NND A;  1RAF B;  1Y5I B;  4N8O A;  3KHH A;  4AL7 A;  1GX6 A;  4JI2 F;  2JEJ A;  4UQT A;  4BC7 A;  4LR9 A;  1X4E A;  2E5G A;  4U9R A;  2MKJ A;  3G71 S;  1NHU A;  1J5O A;  1LQ9 A;  1VS3 A;  4B3R F;  1VBZ A;  2OFH X;  1ZOT A;  2XBP A;  1YBU A;  2ZBI A;  1MG7 A;  2H48 B;  1LK5 A;  2AX0 A;  2FHJ A;  4X84 A;  2I38 A;  2CJK A;  1UTA A;  2BRK A;  3M2V A;  3FMB A;  4ZP9 A;  1KQF B;  2RUS A;  4K4X A;  4QPX A;  4WFA Q;  3QRQ A;  1TKT B;  2RRB A;  1PAE X;  1T03 A;  1D9D A;  3ILI A;  4UST A;  2DGX A;  3CJS A;  3RBD A;  4KJI A;  1HHS A;  4DL6 A;  4C8Y A;  1HNI B;  4AL6 A;  4ZPC A;  3JQK A;  4HDG A;  2CZV C;  1QE1 B;  4LFC F;  4LRB A;  1L3S A;  4JI4 J;  4EBD A;  2PT0 A;  1FFW B;  2VOP A;  3ENA A;  5KFJ A;  2V63 A;  4JI1 J;  5BR8 J;  1VC5 A;  2CPJ A;  3RW7 A;  4FF2 A;  2XM3 A;  4JI8 J;  3H5X A;  1H2T Z;  3M9M B;  2AWZ A;  3H90 A;  3LPE A;  2I0X A;  1GAO A;  4IFV B;  4XPC A;  3BSN A;  3LP2 A;  3KK3 A;  5GAH U;  3BPD A;  2AGP A;  4NCB A;  4XIU A;  1TL4 A;  1S1X A;  3CD5 A;  3P3D A;  2ADB A;  4P52 A;  2BX6 A;  1NDP A;  3CC2 S;  3G87 A;  4NEZ A;  1LWF A;  2KXN B;  5SZT A;  3MMJ A;  2U2F A;  2DR5 A;  3R27 A;  3PX4 A;  1LNQ A;  3F41 A;  2L08 A;  2NR0 A;  4MTP A;  4ECU A;  4DEZ A;  1QSL A;  2KVI A;  2HWI A;  2VFV A;  1EKS A;  4I6W A;  3PM9 A;  1C0T B;  3PFE A;  4V1A k;  2KJV A;  3MFI A;  1FA0 A;  3POT B;  1QY7 A;  2NXE A;  1H73 A;  4ZCI A;  4IYQ A;  4Q5V A;  3A3P B;  2DVI A;  3O2I A;  9ATC B;  4CYU B;  1HLW A;  3HDS A;  4M63 A;  2B5J A;  1WWH A;  3DOL A;  3LGN A;  1G4C A;  2JFK A;  1Q78 A;  1HD0 A;  3RR8 A;  2RHS B;  4X4T A;  3M8Y A;  3CCZ A;  4MKB A;  3OTO F;  4ZIV A;  1X4F A;  3VZI A;  1TL7 A;  3D1O A;  4I67 A;  1IBK F;  5CYQ A;  4DSF A;  1M0S A;  3VAK A;  3CMA S;  1NRK A;  4Y2K A;  2BA9 A;  1JJ2 R;  1FER A;  1DY3 A;  3UWT A;  2RKI A;  1B99 A;  3B82 A;  3J7Y U;  2GW8 A;  1F3V A;  4E98 A;  2LCW A;  3SIP B;  3ZTS A;  2D69 A;  4FYY B;  4TKT A;  4LF6 J;  1WG1 A;  4DN9 A;  4DV5 J;  3D3B J;  1AFI A;  1IKY A;  3G6X A;  2IVY A;  2RE1 A;  2BW2 A;  3TUJ C;  1WOS A;  1G7C B;  3HSZ A;  3EZU A;  1D1U A;  1VRT B;  4DFP A;  5IWA F;  2XC9 A;  2F1F A;  4J9Q A;  1N56 A;  2CAJ A;  4DSK A;  2B9X A;  3W2W B;  1UEU A;  1UVM A;  4KKO B;  2G1H A;  4CM0 A;  4CLY A;  2OEJ A;  4OYA A;  1N52 B;  2IDE A;  3CMQ A;  3RAQ A;  2QMW A;  1DFD A;  3ZXW A;  2G2Z A;  2GHW A;  4DDF A;  3KUH A;  2W8L A;  4LUB A;  3SQO P;  3EZ5 A;  1NK0 A;  3C2P A;  4OHX A;  3UW1 A;  4YS2 A;  2YKM A;  2QZ8 A;  5F0W A;  3HHL B;  1NO8 A;  2LA6 A;  2KM8 B;  5DQI A;  1VQO S;  3VGT A;  3SSR A;  2KU7 A;  1NLK L;  2WVB A;  3MEG A;  4GKK F;  2HQF A;  3R2C J;  3CED A;  5A8K A;  2WRM A;  2BJ1 A;  1MLA A;  4AFF A;  1U0H A;  3SDE A;  4IR1 A;  3FBB A;  3A8I A;  5KG4 A;  3ZTP A;  4OX7 A;  3GR0 A;  2OTJ S;  4NWB A;  1UPP A;  2M70 A;  1F9E B;  1SJR A;  4NX9 A;  3HT3 A;  4NLX A;  1GTH A;  3HJF A;  1WEX A;  5AXN A;  5HP1 A;  3HM9 A;  1U4B A;  5CCL A;  4JI7 F;  2PA8 D;  4ES2 A;  3DKD A;  5H1S V;  2CZ9 A;  2XSJ A;  1PG5 B;  3QT5 A;  2R2U A;  4H4K C;  2DGW A;  1ITP A;  3MPU B;  2DNN A;  1GQE A;  4USM A;  3TUI C;  4K4S A;  3E01 B;  1S79 A;  4ZPT R;  1T94 A;  2H1Y A;  1VQ5 S;  2ZEJ A;  4ZVT B;  4J37 A;  4UT4 A;  3BN4 A;  3JAM U;  3GCX P;  2L9D A;  5FLX Y;  1R0C B;  1FWP A;  1U24 A;  5GMD A;  3TI0 A;  2PFD A;  2FLN A;  5I4M A;  1N5Q A;  2XZW A;  5HL7 Q;  1IQZ A;  5HLF B;  2FY8 A;  1VQ4 S;  2BE7 D;  3OJU A;  4HT5 A;  2OH2 A;  2PMW A;  2MZJ A;  1ZYQ A;  2PMH A;  1IXK A;  2BJ7 A;  3K5L A;  2ILY A;  2BQ3 A;  5KFO A;  2ZD1 B;  2HND A;  2LQJ A;  1HA1 A;  4X62 F;  1X5T A;  5DLF A;  2RQC A;  1LFW A;  3EDQ B;  1HD1 A;  4FYX B;  4BC9 A;  4QR2 A;  4O3R A;  1S59 A;  3OQ2 A;  2V4J A;  3M2R B;  2XMK A;  2VJV A;  1RLD A;  3NKY A;  3SV4 A;  1Q16 B;  1T9T A;  1S99 A;  1RCO B;  2IVM A;  1VQS A;  3FSI A;  1U8W A;  3BBC A;  1WG5 A;  3CCR S;  4O3Q A;  3HK2 A;  2XLK A;  1QAY A;  3NGK A;  4NLQ A;  4A8S A;  3M6U A;  4MJK A;  1YRT A;  3EXY A;  5EGY A;  4QYR A;  4DV1 J;  1Q86 T;  3OVS A;  3QSY B;  2FHJ D;  2R2R A;  4DR3 J;  1Q79 A;  1TUW A;  4LFA F;  1CSJ A;  4CLF A;  3ADA C;  3IAS 9;  2HHT A;  5K8N A;  2G2O A;  4CO0 A;  4WYW A;  4LBI A;  3H5S A;  4O0I A;  3M1V A;  5C5J A;  1NJW A;  1JB0 C;  4IH7 A;  3BR8 A;  4FF4 A;  1WKK A;  2LEA A;  2CPX A;  3MWB A;  2XEX A;  2H3E B;  1SPB P;  1O51 A;  4G1P A;  3HP6 A;  1HNI A;  3OR1 B;  3TAP A;  3R5B A;  5K9F A;  5GAH I;  1R0A A;  3HZG A;  2YKP A;  3VQT A;  4G1I A;  2V8P A;  1JX4 A;  4LF8 F;  3ONQ A;  2OKQ A;  1KVK A;  2EVZ A;  4FS2 A;  3BBF A;  3FUY A;  4ETZ A;  5FII A;  5J1E A;  4NZ0 A;  3HT0 A;  2IY5 B;  3PXG a;  2L3M A;  2IBO A;  2ZJQ Q;  2VDI A;  2NXC A;  4UUW A;  5KFS A;  3VHQ A;  1SH3 A;  5AXL A;  2KG0 A;  3NGS A;  3LAL A;  4ELV A;  2N4D A;  4GC6 A;  3TAR A;  4I1T A;  1IM4 A;  4DPX A;  2ASY A;  2E7X A;  4DCO B;  1YJT A;  4DSJ A;  1IKX A;  4QIE A;  1OY8 A;  1JLQ B;  1X9W A;  2WVC A;  1C1B A;  4USW A;  2VC0 A;  2HMI B;  2XZT B;  2RD5 C;  4PPZ A;  4L3K A;  4LRC A;  3SFU A;  3SEO A;  4CTA B;  4ZN3 A;  1TP7 A;  3PY8 A;  2IJR A;  1JKH B;  4DR6 J;  2LYV A;  1WOR A;  4UF4 A;  2O67 A;  3IWN C;  4PYD A;  3POT A;  5D78 A;  1RAG B;  1YDL A;  4DCJ B;  1VOM A;  4EYH B;  1SC6 A;  1W2B R;  3W66 A;  2LDI A;  3J7Y I;  5A8R B;  1A9N B;  1PCA A;  5EUH A;  3RGI A;  5L1I A;  1WC0 A;  4ZA1 A;  1RB0 A;  1RWV B;  4LQ9 A;  3DRP B;  2ZKU A;  2ACM A;  1UEK A;  1I5O B;  1VIS A;  2V9W A;  4ECR A;  4I4B A;  2PA3 A;  4QU6 A;  5FD1 A;  3PHT A;  5B7W A;  1EET A;  3UO0 A;  1J2V A;  1URN A;  3CJ3 A;  3MCS A;  5B0F A;  3DI6 B;  2F4V J;  1TL1 B;  3D9B A;  1S48 A;  1RAC B;  3ELH A;  2HFN A;  4Q0B B;  1RDR A;  1W7W A;  1TQL A;  2W2M P;  4RPF A;  3KLG B;  5KT2 A;  3NOC A;  1VDH A;  1ZM2 A;  3QGH A;  2FHK A;  2MB0 B;  2MQP A;  4HHJ A;  3MXH P;  4WK3 A;  3DXS X;  1RT1 A;  1VRT A;  3DRR B;  4WU3 A;  3UE2 A;  3CCW A;  3D6H B;  4FF1 A;  5CHC B;  3K89 A;  2E9Z A;  2R7V A;  4LRD A;  3GYG A;  4M5K A;  4KKO A;  5GAG U;  2FTR A;  2D9P A;  4C3K A;  2EWH A;  3UCZ P;  2UUC J;  1XWL A;  5F8J A;  3DXB A;  1CJU A;  2CQ2 A;  2W2O P;  1YJV A;  4HAC B;  2QYC A;  4K4Z A;  4DSI A;  1S9E A;  2FJX A;  3RW6 A;  3EGV A;  3OL6 A;  3UD4 P;  6AT1 B;  1IKV A;  2HUR A;  1RAI B;  4LR7 A;  3DLE A;  3KHG A;  2HBZ B;  5DDP C;  2BJD A;  3GU0 A;  4IH6 A;  3FFI A;  4I56 A;  4BBY A;  2J6U A;  1S6P B;  3KOA A;  1DTQ B;  3TAQ A;  3C8Y A;  1Q82 T;  1VQ7 S;  3IXQ A;  5IV4 A;  1R8P A;  2CQD A;  2GIR A;  4ZVE A;  1PSD A;  1NK6 A;  3ENW A;  2NQP A;  3F56 A;  4X64 F;  3WX8 A;  1M5S A;  3DMJ A;  3GG1 A;  3H5Y A;  1VIX A;  4WZM A;  2HGN A;  2QLX A;  1M5H A;  2KZZ A;  3K5N A;  4RW8 B;  5BJR A;  2B3T B;  2JC0 A;  2V2Z A;  2NXU A;  3PJ9 A;  2O1P A;  2DTJ A;  3HKW A;  3UN2 A;  2YNF A;  2CQB A;  3W65 A;  4LF7 J;  3BH7 B;  2Q66 A;  2QMX A;  4ZVG A;  1F5B A;  2MKS A;  1I94 F;  1UL3 A;  2GVZ B;  1DAX A;  1UP1 A;  2DPJ A;  2Z0G A;  1UCN A;  3JSM B;  2AW0 A;  5J2Q B;  2DNR A;  2BE2 B;  4DUZ J;  3GYX B;  2LQ8 A;  4CLK A;  1SH2 A;  2A10 A;  7FDR A;  3PEJ A;  1RAH B;  2LXF A;  4NLD A;  1E6V B;  1S76 D;  2WVE A;  2HIQ A;  4DX7 A;  1S1U A;  2RS2 A;  4C8O A;  1QDU B;  1RAB B;  2W7A A;  1VIO A;  2ACY A;  4YB5 A;  5D4L A;  3CCM S;  2LKZ A;  2R42 A;  2HBY B;  3V81 A;  2QYG A;  3M2R A;  5AXK A;  3K0J A;  1TV6 A;  2CQ0 A;  3T1Y J;  4ZMM A;  4LR8 A;  1OPZ A;  5LJ3 Y;  3OTE A;  2B6A A;  2ROE A;  1SL1 A;  2M8H A;  4CLS A;  4EO8 A;  3OFF A;  3C6U A;  1SI9 A;  4RBU A;  4WJB A;  4N76 A;  1T7P A;  1YWX A;  1NZA A;  3J7A 1;  1Q8I A;  5T41 A;  3MMA B;  4DLE A;  1F3F A;  2YKN B;  3F0N A;  4ZP6 A;  3UDE A;  1VQY A;  5J2M B;  3W8P A;  3KYL A;  4C0B A;  2VG5 B;  3W2V A;  2CG4 A;  1JNR B;  4NA2 A;  3IRX A;  2UXB F;  1QSY A;  1R31 A;  1F9F A;  4NCG B;  3OR1 A;  1HMV B;  2DGV A;  3TA0 A;  2R8I A;  4RZR A;  4M94 A;  3L95 X;  2Y1J A;  4NZ6 A;  3FRZ A;  2A1B A;  3MM5 A;  3QAE A;  1FEE A;  1RGV A;  4G65 A;  2ZH1 A;  3SZ2 A;  2XMW A;  2XI2 A;  4Y00 A;  5D6G A;  4ZOS A;  2UV8 A;  1Y0H A;  4A4J A;  1QVG R;  1UET A;  4DR5 J;  3Q8Y A;  1BD6 A;  1JLG B;  4ZCM A;  1CUL B;  5H9F K;  1X0F A;  4ED4 A;  4OQJ A;  3D28 A;  3EIC A;  1K73 T;  2QX0 A;  2ZNY A;  3FK4 A;  2HZC A;  4NYO A;  2C2M B;  4R0J A;  1CJT B;  5LMU F;  1U1O A;  2W4P A;  1SV5 B;  1KFD A;  2RVJ A;  1JLQ A;  4DPO A;  3ITH A;  1KQG B;  4M5H A;  2DR6 A;  2IM1 A;  5HN0 A;  5HO4 A;  2ASJ A;  4ZPA A;  1JKH A;  2XNQ A;  4DUY J;  3G82 A;  3I9V 9;  3M8Q A;  1NH7 A;  2HWH A;  1SQE A;  2QMU B;  4RW9 B;  1BQN B;  5DDO C;  3HFZ B;  2W9B B;  1PYT A;  3N6N A;  1VRU A;  2VPX B;  1VLY A;  1HQ2 A;  4B3R J;  3FCV A;  3KKF A;  1H7X A;  4NOH A;  4DZD A;  2J0W A;  2Y0B B;  2YQ3 A;  4R8U B;  4RLE A;  3R8Y A;  3DOM B;  2L41 A;  3OHB A;  2PMZ D;  5K14 B;  5G0R B;  1C2P A;  1MW7 A;  5A8R A;  4YR2 A;  5E41 A;  3EXC X;  2BKP A;  2OP5 A;  3PFO A;  3DRP A;  4LRA A;  2VFT A;  2IM2 A;  2XZD B;  2E66 A;  2E1A A;  1JXV A;  2GO9 A;  4C98 A;  2UUA J;  3DRS A;  5FJ4 A;  1RTJ A;  4KAI A;  2BBE A;  4CT9 A;  4ECX A;  3S1T A;  2VA2 A;  1TFY A;  1YLX A;  4TY8 A;  1EB0 A;  1UVI A;  3I0S B;  3C15 A;  1SL0 A;  2XB2 D;  3BGU A;  1WDT A;  2DIS A;  5HVH A;  2RJZ A;  4CP5 A;  1TL1 A;  2W7O A;  1TUG B;  3AA8 A;  4LFC J;  2WON B;  5KFQ A;  5GAG I;  4Q0B A;  4TY9 A;  2XS2 A;  3PDN A;  2J6T A;  1WOP A;  1YIT S;  1J27 A;  1XMQ F;  2BJ9 A;  3QJL A;  4DR1 F;  5GAD U;  1B7Y B;  1RP5 A;  3DGV A;  1RAJ A;  3BPS P;  4OX9 J;  2KJW A;  3DOK B;  1AW0 A;  1RTI B;  2HGL A;  1U1L A;  2ATC B;  5JXS A;  2CPD A;  3FMW A;  4HHH A;  1YIJ S;  4AE5 A;  2WTF A;  1T05 B;  1NKB A;  2B4O A;  2RAQ A;  4XK8 C;  4P71 A;  3V6H A;  4RBT A;  1TVR A;  1WHX A;  2H54 B;  2HG4 A;  4LMZ A;  4I2P A;  2MY7 A;  2R7T A;  5HI7 A;  1WEZ A;  3VQS A;  2OPP B;  2YH0 A;  4ZK7 M;  4PXD A;  1Y5N B;  6FDR A;  3MMC A;  2NPF A;  3D0G E;  3HVT A;  1CG2 A;  3O5T B;  3SQG B;  5KFZ A;  1PC4 A;  3KLF A;  4KB7 A;  5E3Q A;  3LTO A;  3I87 A;  2BM1 A;  2OSQ A;  5L38 A;  2MGZ B;  2FVQ A;  2OHD A;  1PYO B;  2DT9 A;  4ZP8 A;  2HVI A;  2GIQ A;  2D7S A;  2DCL A;  3JB9 k;  3T5H A;  2BAN B;  2W24 A;  1RT7 B;  1DTQ A;  2KT3 A;  1F2G A;  1K9M T;  4ED6 A;  2JEF A;  3HO1 A;  2VG7 A;  4DPT A;  5HRO B;  5E7O B;  3I4H X;  2QTW A;  3UCU P;  3N6L A;  4P6Q A;  4DL0 C;  1N36 J;  2BJE A;  2ZBR A;  3FVY A;  2FGO A;  3OTO J;  5DJB A;  3CSK A;  2X3G A;  1EQM A;  2B8Q A;  2CFX A;  1X60 A;  2HHV A;  2AZ3 A;  2IMO A;  2FC8 A;  2WB1 D;  3SCI E;  2Y3Y A;  3V6D B;  4KC5 A;  4NA1 A;  4JV2 A;  4N77 A;  1VQK S;  3E2E A;  2CDR B;  1X5S A;  2DNM A;  5C25 B;  3KNA A;  4NLS A;  5CXT A;  4K59 A;  4DQR A;  3AB4 B;  2GVZ A;  4P10 A;  3TAM A;  5E3P A;  1BXN A;  2IC3 B;  3A4T A;  4FBT A;  3RB4 A;  5RUB A;  5I3U B;  1RU2 A;  3B6B A;  1D8Z A;  2V4Q A;  3RBX A;  1VQN S;  1VMB A;  2FB0 A;  3QYY A;  1JXE A;  4H4O A;  2Y8W A;  1TK0 A;  4ZLP A;  3MGJ A;  1XR7 A;  4DSE A;  2XWY A;  2F63 A;  5IWA J;  2QN6 B;  2BQU A;  5EN1 A;  4BDP A;  4FBU A;  1YRU A;  5ETP A;  2F5G A;  4ZLN A;  2AYM A;  4IG3 A;  2DIV A;  1S1T B;  4JI4 F;  1RCX B;  2ZE2 B;  3UD5 A;  4PZV A;  4U8Y A;  3D0I E;  4NLU A;  5ETS A;  4JI1 F;  1RUS A;  3IG1 B;  5BR8 F;  3KJV B;  4YB1 P;  3AOD A;  1U1Q A;  4BCA A;  4JI8 F;  4FPI A;  2R8G A;  2E1P A;  2HLU A;  2E7V A;  1F60 B;  4F4Z A;  3AOB A;  1IBM J;  4WKR A;  4LSN A;  3GON A;  4WBF A;  4KPY A;  3MTK A;  3QO9 B;  4GKK J;  4DV7 J;  5J2M A;  1UWB A;  4KHM A;  2ZJP Q;  1HWL A;  5KFX A;  4K4T A;  3H2L A;  2XY7 A;  4GKJ F;  2G2Y A;  4P2M A;  3UNY A;  4F0K A;  5KFM A;  3NL0 A;  3HSG A;  3I0R B;  4F0H A;  1P8G A;  2HGM A;  1QAX A;  2EC0 A;  2XMJ A;  1VQP S;  4MT1 A;  2PO4 A;  4WTO B;  1AYE A;  4EWT A;  2HS0 A;  3ET6 A;  2CYY A;  2JNJ A;  2PDA A;  2YKQ A;  3UDL A;  2B4P A;  3KDO A;  2RQ4 A;  4JI7 J;  4B9V A;  1LFP A;  1RT5 A;  3D7S B;  5G4D A;  3HHL C;  3I5C A;  4IOB A;  2KM8 C;  3HMJ G;  2CJB A;  2GX8 A;  2ZDO A;  2P6T A;  2BEF A;  2ZWO A;  2Z58 B;  1KOO A;  4ER8 A;  1WSV A;  2DJW A;  2H65 B;  4L75 A;  3W5X A;  1S12 A;  5DQG A;  4MKV A;  4EMD A;  3D1Q A;  5DG7 A;  1Q95 G;  2J0X A;  3UVJ B;  5ETQ A;  3M2U B;  2G0I A;  4DG1 B;  2OEL A;  4Y65 A;  2J8S A;  4OJ3 A;  5D4P A;  4WIQ A;  1N5T A;  2ABY A;  3ZZ0 A;  1AFJ A;  3LF0 A;  4RW6 A;  1UFL A;  3VGU A;  2PD1 A;  4KGK A;  2KFZ A;  3IC1 A;  2ILZ A;  4NML A;  2UVV A;  1R8B A;  1UJ6 A;  2A3J A;  3QJP A;  2Y8Y A;  4DX8 H;  1OSD A;  2Q79 A;  4OYP A;  2GJ2 A;  1HKA A;  4WP8 A;  3TEG A;  3QSI A;  1AT1 B;  3B4D A;  3OT9 A;  5BYQ A;  3U1N A;  4RW9 A;  2YKO A;  3IWL A;  4LF6 F;  4W98 A;  4DV5 F;  1HIY A;  2M3D A;  3Q23 A;  3ILJ A;  4F7V A;  2NS1 B;  2VAS A;  3CIM A;  2I6W A;  3CW2 C;  4ZHR B;  2BKO A;  3I5B A;  1U0S A;  4KQZ A;  5F8I A;  2FGC A;  1YRX A;  2OTL S;  4DX5 A;  3MCO A;  4O4G A;  2DEI A;  4I6Y A;  4TLQ A;  2RB7 A;  1SBR A;  3HHD A;  1IBL F;  1FKO A;  4ED3 A;  3D6M B;  1U7L A;  3W9I A;  1U1P A;  2H5I B;  2ZBQ A;  2CQG A;  2YWW A;  1RBL A;  3SYZ A;  1Y11 A;  4ID5 B;  2K1R B;  4EBC A;  2CA9 A;  5CD4 A;  3FEX B;  2HPU A;  1DZ5 A;  3DLK B;  5GAD I;  2DIT A;  1UPM B;  3W64 A;  3P45 B;  3QGI A;  1AXQ A;  1WSR A;  2DR9 A;  1G6B A;  3KK2 A;  2GML A;  5THW A;  3K59 A;  4UTG A;  1GMU A;  2NSC A;  1EAY C;  3KTQ A;  2V2K A;  3V6J A;  3FNN A;  3GLJ A;  5E0O A;  4LBH A;  1UVK A;  1A6L A;  2WON A;  2BJ8 A;  2YNI A;  4EZ9 A;  1CPZ A;  5KFR A;  2C2O B;  2COL A;  3UDV A;  5A8W B;  5KFY A;  3G4S S;  1YI2 S;  2PI4 A;  1E6Y B;  2DEJ A;  1X5O A;  3TUZ C;  4GVB B;  3GFY A;  4FP9 A;  2UZA A;  1B3T A;  4I68 A;  3OSN A;  3ZZU A;  1NAQ A;  2CWX A;  3ZTQ A;  1WEL A;  5KFI A;  3NGD A;  2MZT A;  1U1N A;  1SL2 A;  4YHH F;  1RTI A;  4FYW B;  2V8D A;  3Q89 A;  2R3V A;  2KHD A;  1LWC B;  2ZHB A;  1UMJ A;  1HBU B;  3S01 A;  5HMW A;  5E3R A;  2EXU A;  2AGO A;  3MPY A;  2ZHA A;  2XGP A;  2ZWP A;  3OSP A;  3CT9 A;  1SJQ A;  1WEY A;  1RKJ A;  3MM6 A;  4CLL A;  3MEK A;  4Q43 A;  4OV1 A;  2IMW P;  1HNV A;  5J2N A;  2VG6 B;  2HHP A;  3CIZ A;  4JV1 A;  2NUH A;  2WSF C;  2H9Z A;  4QWD A;  3IR5 B;  1FTC A;  1PBU A;  3TRG A;  2XLI A;  1ARO P;  5IZH A;  3CTR A;  4QZV B;  3CWJ A;  1YBT A;  3K7R A;  3O3L A;  3Q8R B;  2BAN A;  1ZZN A;  2R8J A;  2BW7 A;  3LAM A;  1FE4 A;  4JI5 J;  1SJ1 A;  4KHP J;  3MEC A;  4IOC Q;  3PR5 B;  1LW2 A;  1XR5 A;  1REV B;  2M7S A;  3CJQ A;  4Q2M A;  4F4X A;  5HAO A;  1GEH A;  3IA0 A;  2NZC A;  2C42 A;  2MHN A;  4MMO A;  3GSD A;  1WI6 A;  4O3S A;  1S1V A;  2ZNZ A;  4QWA A;  3GIJ A;  1KOH A;  3DN9 A;  1PIE A;  2JL9 A;  1WC1 A;  4X4O A;  2EFQ A;  4LF1 A;  4Y28 C;  5KFU A;  5KT5 A;  3QMQ A;  3BYP A;  3IGV A;  3GV5 B;  5C25 A;  4CRJ A;  1QSS A;  2W9C A;  4ITS A;  2MKI A;  2QL9 B;  3RR7 A;  5KG5 A;  4D3G A;  2M5Y A;  2CZ4 A;  4RNH A;  3HHN B;  2ZFH A;  2R2S A;  2GHV C;  5I3U A;  3VAM A;  1U49 A;  4DR3 F;  2LEC A;  4F50 A;  2MLX A;  3JTN A;  1MRO A;  4OYZ A;  1FWL A;  1QTN B;  3IWX A;  3RRH A;  1S1W A;  3DLH A;  1FWK A;  4Q8E A;  3PX0 A;  4FDF A;  4HVZ A;  2WCX A;  4L3N A;  5AE1 A;  4QIW D;  5E5N A;  4ECS A;  4X4Q A;  4URG A;  3NAI A;  1CC8 A;  2HFZ A;  4WE1 B;  2ATL A;  1LW0 A;  5C2C A;  3DFE A;  5DLG A;  1RU1 A;  1MWQ A;  3AHP A;  5HMY A;  2D9O A;  3TX0 A;  3Q8U A;  5KFA A;  5KFV A;  2KI2 A;  3IG1 A;  3HD1 A;  1FXD A;  3OTD A;  3MPD A;  1CLF A;  3BR9 A;  4RU2 A;  1SB6 A;  1R27 B;  1BHN A;  2JEI A;  5LSR A;  2VQF F;  3R7S B;  2LEP A;  5FDL A;  1RWU A;  1SJ4 P;  1S0O A;  1PJ5 A;  1R6V A;  3VZH A;  1EJ7 L;  3NS7 B;  4Z7Y A;  4QIG A;  1VK3 A;  4RWX A;  3F44 A;  2FY1 A;  5LM7 E;  3SCK E;  2L9N A;  1H72 C;  3EE3 A;  3U1M A;  2QLJ B;  2V2V A;  4V19 J;  1N0U A;  1HPZ B;  3RB0 A;  2V68 A;  4A8M P;  1S0N A;  3GG0 A;  1VI7 A;  5IFM A;  3TR5 A;  4WF9 Q;  4NPO A;  4HLB A;  3GCW P;  3I32 A;  3IGN A;  4RL1 A;  1C0U B;  4Q44 A;  1WUU A;  2HS3 A;  1DLO B;  4P9S A;  5I42 A;  4K4U A;  5DZ7 A;  2OUG A;  1WD6 A;  4X4S A;  3CJ8 A;  1RHM B;  2KXF A;  4AND A;  1MWZ A;  2DCU B;  2I5J A;  1N0V C;  2B8P A;  1TL3 A;  3FJ2 A;  2EFG A;  4G1Q B;  1X9S A;  3TWZ A;  2AV5 A;  5IOL A;  3VGS A;  2AX1 A;  4F4W A;  2NRE A;  2KB2 A;  4ENO A;  5KFP A;  2R7S A;  5ETN A;  4X4U A;  3R7N B;  3O44 A;  1N88 A;  1DJ0 A;  4PWU A;  2KHC A;  3TQ1 A;  1XEZ A;  2W8K A;  3K58 A;  1HW8 A;  3LA0 A;  1X4B A;  2E5J A;  1I94 J;  2CPH A;  5IM0 A;  3UVJ A;  3IO1 A;  3M2U A;  4LF9 J;  2W2P P;  2HQI A;  4LF5 F;  3BGF A;  3PKM A;  3DU6 A;  2DRD A;  1VC6 A;  1VBY A;  2HVH A;  2EKN A;  4P75 A;  3KJN B;  1NSA A;  5A2Q U;  2F4V F;  4DR4 J;  3MAH A;  1RXO B;  4ICL B;  2MHE A;  1X9M A;  2NXJ A;  5AJ3 J;  1HQU A;  2HZA A;  3D0H E;  4ZHR A;  5C7P A;  3WHI A;  4JYA F;  3R1H A;  1DTT B;  2MYF A;  5DM6 Q;  2O3D A;  4YB6 A;  3KJF B;  2AYE A;  1QJH A;  1BY9 A;  4GO5 X;  4OZ0 A;  1ZBT A;  4B3T J;  2AT1 B;  1XNR J;  4PG8 A;  1JMT A;  1XMO J;  5D8H B;  2VDH A;  3MR5 A;  2DNL A;  2IM0 A;  1YTY A;  4X4P A;  4NI2 B;  2FQQ B;  1GX5 A;  1VHF A;  1S97 A;  4ECQ A;  2K1R A;  1U1K A;  4KRW A;  1N5S A;  1FRJ A;  2UUC F;  1GMW A;  5DGB A;  1YVF A;  1RHU B;  3RUB L;  4A8K A;  4QYZ K;  1M1H A;  2AF6 A;  5L39 A;  3NMA A;  3E3X A;  4PXC A;  2NPI A;  1KDN A;  2CPZ A;  4H4K A;  4IRD A;  2HHU A;  1F1B B;  2JZ5 A;  1U1M A;  1IR0 A;  1ZM9 A;  4NRT A;  1I3O B;  1XQI A;  3L09 A;  1YKW A;  2FLP A;  5D0E A;  1V3Z A;  2Q43 A;  1G3O A;  3ISZ A;  5J2P A;  3DC2 A;  4X4V A;  2J7U A;  2MZR A;  4RNM A;  4U96 A;  4DR7 F;  2K7K A;  3C3L A;  3MMB A;  2DPI A;  3P8B B;  2QIF A;  1RWM B;  1HWK A;  2CQH A;  3J80 U;  4BLG A;  3P5T L;  3ZC4 A;  3OUY A;  4OHW A;  4R5P A;  2ZH7 A;  5JUM A;  3MPV A;  2IRY A;  4NXM J;  3T6B A;  3Q8S B;  3KLH B;  1YBA A;  1C1C A;  1Y4Z B;  3VCD A;  2AEF A;  5F3T A;  2RF2 B;  3MAA B;  4TVA B;  3MF5 A;  3T1A A;  2J9D E;  2QEX S;  4LF7 F;  2FVP A;  1NK5 A;  2JSX A;  5A0Y B;  2JEG A;  2Z2Y B;  1WTB A;  4I2Q A;  3HSD A;  2EFP A;  4B9S A;  2CG8 A;  1FXL A;  2E29 A;  4U8V A;  5KG6 A;  4W4M A;  4A8Q A;  2M52 A;  2I1R A;  3C6T B;  4LSL B;  4A8X A;  4EI2 A;  3QRP A;  2XWX A;  3E8O A;  3KJQ B;  3C14 B;  2XYH B;  4UQG A;  4AQY J;  2RML A;  3SSS A;  1SKW A;  4B02 A;  1Y3K A;  1XNQ J;  3H20 A;  4CO4 A;  2O01 C;  4YR0 A;  2BR0 A;  2VUG A;  4C3L A;  2HSE B;  4LSZ B;  2QJ3 A;  2B9E A;  2N3O A;  1N5Y A;  3R1L A;  3T1Y F;  4DU7 A;  5LMN F;  1ZZF A;  3B78 A;  4RNO A;  1NB2 A;  2XQC A;  1HBN A;  4N47 A;  4P2X A;  3CCQ S;  3R5J B;  9RUB A;  4MK8 A;  1W2I A;  1Z4U A;  4IO9 Q;  4PCQ A;  5CCM A;  2BE9 B;  4ZKA A;  2OEM A;  2WHO A;  2J9D A;  3VAH A;  2OLW A;  1TAU A;  2BVZ A;  4DR1 J;  1FT8 A;  2XCP A;  3U27 A;  2HRY A;  5F9N A;  4DJB A;  2Z56 B;  3TOQ A;  3E51 A;  3A8J A;  1YJ9 S;  3NNC A;  3GTY X;  3T19 A;  3W9J A;  2VIC A;  2RQM A;  4YFU A;  4KV8 A;  3W9H A;  5F8M A;  1FRH A;  4NLT A;  1LWE B;  2YX1 A;  4QWB A;  2OPR A;  4RX6 A;  1U2R A;  2HFO A;  2GMH A;  2ADC A;  4M5N A;  5T14 A;  1RTZ A;  3GFH A;  4DN0 A;  1NM2 A;  2VFU A;  1UFW A;  4KFB B;  1ROF A;  3TNV A;  4OZ5 A;  1NDC A;  3K17 A;  4JOU A;  3MM9 B;  4M5D B;  5HBM B;  3FKB A;  1PJ6 A;  1FVQ A;  1D0E A;  1WKL A;  3M32 B;  3AA9 A;  3DYA B;  3TZZ A;  2R7R A;  3H98 A;  2G0J A;  1WC4 A;  2GCF A;  3K5O A;  1SUQ B;  1JJ4 A;  2WSE C;  2ZH6 A;  3EM1 A;  3NGT A;  4OZL A;  3KLE B;  3UDC A;  3WIU A;  1ZTT A;  4QYZ J;  4IKA A;  1N6Q B;  2VBY A;  1F0X A;  3TAN A;  3OFG A;  1H7W A;  4ZN1 A;  1EP4 A;  2E5L J;  4PYA A;  2KN4 A;  3LH2 S;  3HVR A;  2GVD A;  2E44 A;  3OR2 B;  1RWW B;  2CNL B;  3S6E A;  2X3D A;  4KO0 B;  4C9D A;  1RTH B;  4DUY F;  1NSQ A;  1UJ4 A;  4PUO B;  1Y5L B;  3M7V A;  1FXR A;  2HHX A;  2FJW A;  1JQG A;  4JI0 J;  3DDI A;  2HFV A;  1LKZ A;  4Y0F A;  4CQ1 A;  3KHR A;  4G1Q A;  3MEE A;  2KYZ A;  4OJG A;  4IO1 A;  2VOO A;  4LVN P;  1JJH A;  4E8U A;  1PO6 A;  5IT9 Y;  2EI5 A;  3Q2S C;  1H98 A;  1BE4 A;  4WYL A;  5M2R A;  3IS9 A;  4IFY B;  2YWE A;  4EU0 A;  3C19 A;  1NXI A;  1NK7 A;  3FSX A;  3TYT A;  1X4G A;  5KG0 A;  2XYG B;  4ILL A;  4LQ3 A;  5DQH A;  2UUA F;  3N4W A;  4ETX A;  4BS2 A;  1AZS B;  4DF4 A;  3Q22 A;  1MML A;  4TN2 A;  1IJE B;  4YR3 A;  4ED5 A;  3NGU A;  5F8N A;  4KY3 A;  3MTJ A;  4MIB A;  4F0M A;  1ZS6 A;  4EO6 A;  1B4S A;  2MKK A;  3MM7 A;  4O0N A;  4B3S F;  1FRK A;  3M30 B;  5LOQ A;  3RBE A;  4I7F B;  2KTQ A;  3CO0 P;  1KLM A;  3H2U B;  3MED B;  2HQC A;  2N7Y A;  4IQX A;  5K8O A;  1JLB B;  5A76 A;  1DTT A;  3LP1 A;  2L9W A;  1KTV A;  3SFG A;  4OX9 F;  3IN5 A;  2CUY A;  3T1H J;  1RT4 A;  4B3O B;  2RT3 A;  3PIP Q;  4U6P A;  4AT1 B;  1CJK B;  2O66 A;  2B9Y A;  3MZI A;  4EZ6 A;  4OX8 A;  4RJV A;  3UI3 A;  5BYS A;  4NA3 A;  3N6M A;  3SI8 A;  4DL4 A;  3T9Z A;  1RYR A;  2PGC A;  1A0O B;  4K5S A;  4GKJ J;  3X3U A;  4J9R A;  2C22 A;  2EBE A;  2VC1 A;  1GTE A;  4RW4 B;  5A2Q Y;  1FKA F;  4B9N A;  2AQ4 A;  3Q24 A;  1R8A A;  4W90 B;  1IUJ A;  3VAJ A;  5CYM B;  1GMW D;  1RTD B;  1X7V A;  3BGR A;  3PG9 A;  1JLF B;  4DHV A;  4A8Y A;  3KLI B;  1REG X;  2C2K B;  1KRP A;  2F4F A;  1HAR A;  4IDK B;  4EYI B;  1HNX J;  2YNH A;  5E3C A;  4DF8 A;  2N7C A;  4DFK A;  1SIW B;  3Q2T C;  4R0E A;  4YY3 J;  1FCA A;  4RWW A;  2QA4 S;  1N36 F;  4ATN A;  2ROP A;  4XAK A;  1YSJ A;  4B17 A;  2D41 A;  3Q0A A;  2Y0S D;  4OLP A;  2IAJ A;  1O6X A;  3HCX A;  1L3U A;  3ZFV A;  1R6Y A;  4ZVF A;  3SXL A;  2LMI A;  2GAH C;  2C2E A;  3US5 A;  3MAA A;  3FC9 A;  4J9O A;  5KFF A;  2K2P A;  2DNY A;  1FHT A;  3DGP B;  5GME A;  4IOA Q;  1V5I B;  5A0Y A;  2BV3 A;  3MUM P;  4L72 B;  5LSO A;  2Q1L A;  5KOX A;  5D0G A;  4YUD A;  2BKN A;  4KPC A;  2BQR A;  2E9T A;  5L1L A;  5AE2 A;  5LT5 A;  2QFI A;  2HLT A;  3GSI A;  1PGZ A;  4HL9 A;  4KIA A;  5ADZ A;  2UVW A;  4PWD A;  1RAD B;  2QFJ A;  2LXU A;  2BXJ A;  1NZ8 A;  4P73 A;  2APO A;  1Q1K A;  4GVL A;  3PTW A;  5F9L A;  2ERR A;  3BKF A;  1IBL J;  1VJW A;  2JFD A;  1U6B A;  1LV5 A;  3GYN A;  3L3C A;  1NJZ A;  4O3P A;  2GGP B;  2QL7 B;  4ED2 A;  3CVK A;  2XMU A;  3CJT A;  3Q83 A;  4FXW A;  1KR4 A;  2WOM A;  2YVS A;  2G0C A;  2HRU A;  1L3T A;  4RNF A;  2WVD A;  1N5V A;  4CI0 B;  2M88 A;  5EWE A;  2IYI A;  1UKU A;  1FJG J;  4NL5 A;  1JLE B;  1RI7 A;  4HT7 A;  4ZPB A;  1JWW A;  1T9X A;  4QWC A;  1KFS A;  2W25 A;  1UVN A;  4A8W A;  1CJV A;  2JC1 A;  1BUX A;  1IBM F;  5D3G A;  4I0W A;  1FVS A;  2HRT A;  1NCL A;  3UN5 A;  2FLL A;  2AJ0 A;  4PQA A;  4DV7 F;  3KFW X;  2B43 A;  4I64 A;  4QOT A;  2WW8 A;  2Z2M A;  3AJ2 A;  2IA6 A;  4YHH J;  2M2B A;  3JSB A;  1RQ0 A;  3OD2 A;  1C4A A;  3KXD A;  1NBE B;  1T11 A;  3PRV A;  1FKP A;  3OV7 A;  3DM2 B;  3PHE A;  2K7J A;  2YXL A;  4LF2 A;  2HYI B;  1LWE A;  4USH A;  3O8W A;  3ULH A;  3W7B A;  1XK8 A;  3M8P A;  1AUS L;  1U6F A;  3IP0 A;  2VV5 A;  4ZJO A;  5B0B A;  4KR0 B;  4LT6 A;  5A6P A;  2FYX A;  3CD0 A;  1JLA A;  2MZ1 A;  4ED0 A;  2GJF A;  6FD1 A;  4NLP A;  2V5H G;  1WTF A;  4KFB A;  2KT2 A;  2HNY A;  3IM8 A;  5C24 B;  5F0U A;  4QJV A;  3LWL A;  2FJD B;  1IBC B;  4CLU A;  2NYH A;  3VGV A;  4M5D A;  3OHA A;  1MWY A;  3N9U C;  1URR A;  2BOP A;  4WFN Q;  3M32 A;  3DYA A;  5L9N A;  3SBM A;  1WG4 A;  3QBC A;  2QA4 G;  4CLP A;  4UW2 A;  5F8L A;  3KLE A;  4C11 B;  4Q7A A;  4MK7 A;  3PJX A;  1FO1 A;  1QTM A;  4CO2 A;  4PQU B;  3D68 A;  1I6J A;  3Q8Q B;  2DB1 A;  1HYS B;  3IR6 B;  2C2N A;  5KT7 A;  1EX8 A;  2G9O A;  2CQI A;  3I9Z A;  2GQQ A;  4Q2L A;  3NY0 A;  4NEY A;  3CCJ S;  1XC9 A;  1BGX T;  3DLG B;  4IR9 A;  3G9C A;  3K57 A;  4MFB B;  3D4J A;  3IBF B;  5DS7 A;  4DV4 F;  4OI1 A;  3LO3 A;  3OL9 A;  2YX7 A;  1NPR A;  2EK6 A;  3W8G A;  3D3C J;  3PR4 A;  4P7T A;  2IYG A;  1RT3 B;  4PAA A;  1S6Q B;  1PC5 A;  3BQ1 A;  2DO4 A;  2GNK A;  4YEA A;  2CIM A;  2Z30 B;  1J5O B;  3MHY A;  4PG4 A;  3IM9 A;  2XHW A;  2J0S D;  4DFJ A;  3G8S A;  2HBR B;  3VAL A;  1TKT A;  2HS4 A;  2F8E X;  1PKU A;  3M2V B;  1TAQ A;  2UP1 A;  4U7C A;  3NOG A;  1NME B;  4TQR A;  5HJY A;  3BB5 A;  4UY8 T;  4OI4 A;  1ZPV A;  2V67 A;  3V2U C;  4OZJ A;  1QE1 A;  1T03 B;  2HNZ B;  3M30 A;  4I7F A;  2R7W A;  2XMT A;  2W01 A;  2KRB A;  3FQL A;  5HQM A;  4KT0 C;  5KFW A;  3QFH A;  2X7I A;  1JLB A;  2KL8 A;  4K4V A;  3I96 A;  3QNW B;  2VQF J;  2DXF A;  1T9U A;  3CGI A;  4IFV A;  4J90 A;  1TK8 A;  4OYI A;  3K5P A;  5IT4 A;  1SQF A;  1CJK A;  1S4F A;  3PV8 A;  1PIL A;  1FDA A;  5EHH A;  1YJ7 A;  4ALZ A;  4ZS6 A;  4K8R A;  5KFD A;  4KYZ A;  3LP2 B;  3H4B A;  3KK3 B;  4J9U E;  4RW4 A;  1JLC B;  2JRS A;  1RWX B;  3MR7 A;  5LL6 d;  1S1X B;  2DH9 A;  2FHM A;  3CDE A;  3D54 A;  5CYM A;  3K8W A;  1RAA B;  2F7V A;  1D9A A;  1JLF A;  3OVB A;  2DYA A;  2WB4 A;  3W60 A;  4CO3 A;  1C0T A;  3KLI A;  2LQB A;  2VBX A;  5D0R A;  4DQQ A;  3SCJ E;  1NK4 A;  2UXD J;  2GA7 A;  1FDB A;  1SC3 B;  1GT8 A;  1BQM B;  4K5R A;  5ETO A;  3PIO Q;  4CLW A;  2J9E A;  3NCP A;  3DDN A;  1UEV A;  2XGQ A;  4CYU A;  2EFO A;  4NLW A;  4JI5 F;  4QIV A;  3EGN A;  4KHP F;  1WHW A;  3DDK A;  3RB3 A;  1S6O A;  2CPE A;  2XHC A;  3IMQ J;  4KGZ B;  4URS A;  3EMT A;  2V0N A;  3S7R A;  4LF4 F;  1OO0 B;  1X0P A;  4DQS A;  4O3O A;  1EQ0 A;  4LF5 J;  2B5J B;  3NS6 A;  3EYZ A;  2NXN A;  1R89 A;  2HEK A;  3JYT B;  2YNG B;  1ZAW A;  2HK2 A;  4U7U D;  4ANE A;  3QGP A;  2Y1L B;  1WF1 A;  1TL7 B;  1CEZ A;  1N32 F;  5IC4 B;  1LEO A;  3PW0 A;  3G86 A;  2YWG A;  5KTQ A;  2BMB A;  2MQM A;  2Z2L A;  3DHX A;  2RS8 A;  2KFY A;  1J5E J;  2QE5 A;  4DV2 J;  1U48 A;  2RKI B;  5IT0 A;  4JYA J;  2CXE A;  2XG8 A;  1U8S A;  2DD8 S;  1UZD A;  2CAD A;  1JXL A;  2ZUA A;  3CCV S;  2IVF B;  1IQT A;  1N48 A;  4DWI A;  3T5L A;  2UUB F;  2QLB B;  5EWG A;  1NHV A;  1SKS A;  3CCL S;  3W2W A;  1M90 T;  3HZE A;  2CKW A;  2NYI A;  2GGP A;  3ENV A;  1N33 F;  2ZVS A;  1X4H A;  5JVG Q;  2YPZ A;  2MST A;  3AY0 A;  2MEW A;  3LWM A;  2B9W A;  1ZTW A;  2HHS A;  4DOZ A;  2HZV A;  5KG7 A;  4C48 A;  2UVU A;  4DX6 A;  5B0G A;  3JTP A;  3CC4 S;  3AD9 C;  2EKY A;  1GNK A;  1WF0 A;  5CYJ A;  4Z37 A;  2XMA A;  2J6S A;  4FF3 A;  2C3Y A;  3HHL A;  3KK1 B;  3ILO A;  3PW7 A;  1VCT A;  2XYP B;  1VJQ A;  2DXE A;  3JS9 A;  3H0P A;  4WPA A;  2IM3 A;  3NEK A;  1ZET A;  4ZCL A;  3QT6 A;  3FGV A;  2A0F B;  4LJM A;  2Z2Z A;  1KLN A;  2Q6C A;  1HWU A;  2RDD A;  1FK9 B;  3AJD A;  2QRR A;  4DL5 A;  4TU7 A;  4DR7 J;  4F4K A;  5A8K B;  3NRB A;  1U0H B;  4JV0 A;  1OPI A;  3SDE B;  2E5I A;  2C2D A;  4X2B A;  5KT3 A;  3DNC A;  4HKQ A;  1SVD A;  2FJA B;  2C1E B;  2J8A A;  2I2Y A;  3TA1 A;  4FYV B;  8AT1 B;  4NLY A;  4J9P A;  3P96 A;  3CJR A;  4AD6 A;  3E01 A;  5HP1 B;  3BBB A;  3RRG A;  4DCP B;  4UOC A;  2XSJ B;  5K8M A;  1CBK A;  2OPQ B;  3HLU A;  1X4D A;  5HLF A;  3HD2 A;  2AEM A;  2VKZ G;  2YBV A;  1IKW B;  2ASD A;  3HXM A;  1X4A A;  4LF9 F;  1X31 C;  2Z4P A;  4C0O C;  4K2J A;  2DGO A;  3EJM A;  2V6A A;  2DHA A;  1X5P A;  3OTB A;  1UZH A;  3A3O B;  4DLG A;  4PQU A;  1SJF A;  3L9Z A;  3ZZO A;  1HYS A;  2ZDP A;  3TW0 A;  2MLZ A;  4O4R A;  2KZM A;  2ZD1 A;  2KKH A;  2RRN A;  1IR2 A;  1NUE A;  1FJC A;  3ISN C;  4NXN J;  1UWA A;  3DRY A;  2D74 B;  4DR4 F;  2LDY A;  4QR0 A;  3W3S A;  4HR2 A;  4OHV A;  1UAW A;  2PII A;  3HFV A;  3L7P A;  2HND B;  2MJU A;  3JAM Y;  2FD2 A;  5AJ3 F;  5LMN J;  2MKH A;  2QG9 B;  4NLV A;  1Y00 A;  3VVU A;  4DL3 A;  1PJ7 A;  4K7Q A;  1RT3 A;  3EVO A;  3BO2 A;  1S6Q A;  2V4J B;  2CQ3 A;  2AIR B;  2BDP A;  2OD6 A;  4B3T F;  1XNR F;  4JI6 J;  4L76 A;  1XMO F;  3NBP B;  5F8H A;  5E2Q A;  1QAI A;  2C28 A;  3EGZ A;  1FJE B;  5ETT A;  1YHQ S;  2OAU A;  1LWX A;  1L3V A;  1FTR A;  1KVJ A;  2K8G A;  3PYD A;  2HNZ A;  1XIQ A;  4USU A;  3M1V B;  2YH1 A;  1EHW A;  2MQL A;  1U2C A;  3LUY A;  1IJF B;  4KH1 B;  4J9K A;  3NP5 A;  1NPK A;  4MIW A;  1DQA A;  4IH5 A;  4WFZ A;  4QBU A;  2XY6 A;  3FBC A;  1R0A B;  4A8O A;  2MMY A;  1QAJ A;  1WAC A;  4OYM A;  2CPY A;  2IJN A;  1PBA A;  3ZTO A;  2X1B A;  3HPO A;  3BSO A;  5J1E B;  3R5D A;  4TXS A;  1Q0N A;  1WJ9 A;  3H5U A;  3BM7 A;  4C2M A;  1S9F A;  4USJ C;  2DBB A;  3D2W A;  4O44 B;  3TO8 A;  1JLC A;  3OVA A;  2QLF B;  3M4X A;  5L9X A;  5K8P A;  2HMI A;  4NXM F;  3KWM A;  3CDB A;  4Y2I A;  2QV6 A;  2K06 A;  4AXJ A;  4H4M B;  4CTA A;  1H74 A;  2MXY A;  5JVH Q;  3T3F A;  1IKX B;  4DS4 A;  5DET A;  5DG8 A;  1C1B B;  4MK9 A;  3T41 A;  2VJU A;  5ETV A;  3IR7 B;  1BQM A;  3WIV A;  4GMK A;  2JOQ A;  4L6V 3;  2JDJ A;  3OLA A;  1TKD A;  4LBP A;  3FEZ A;  2RSQ A;  1B70 B;  3PCO B;  4ZVS B;  2ASL A;  2M0G B;  4E2F B;  3LQV A;  3W63 A;  1CQN A;  2ZHO A;  3RYL A;  2GV1 A;  3HUL A;  4AQY F;  2ZM6 F;  1VBX A;  1T3O A;  1T3N A;  2C3O A;  3OFH A;  4NZ7 A;  3PKY A;  1FF2 A;  2P9C A;  2AJ1 A;  1XNQ F;  2ZH3 A;  4YN3 B;  1RIS A;  3B4M A;  4DMZ A;  3I5A A;  3MOZ A;  1M5K C;  4ZPW R;  4EBE A;  1HI0 P;  3NMR A;  3I31 A;  2F9D A;  3KDN A;  3NNA A;  3JYT A;  2YNG A;  4FVM A;  1VQM S;  3BDP A;  3QJJ A;  3HHK A;  3DI6 A;  1I51 B;  3CE8 A;  4OI6 A;  2D3O R;  3VV2 B;  3D6F B;  4IRK A;  3GR1 A;  3SV3 A;  2VA3 A;  2E9R X;  3PW4 A;  1WC3 A;  4B3S J;  2ZZN A;  1OQ3 A;  1EET B;  4QIF A;  3KLG A;  4Q8F A;  3FCH A;  1VQL S;  1VK8 A;  2AZ1 A;  5GMK a;  2W2N P;  4M5G A;  3FBE A;  2CJA A;  4CIO A;  2VB6 A;  3PW2 A;  5DZ6 A;  3R9L A;  3ZO7 A;  3JQJ A;  3DRR A;  3M8R A;  1BWE A;  1TZ0 A;  2IRX A;  2YX4 A;  3LGM A;  5E3A A;  4PG6 A;  4DSL A;  5E33 A;  1G1X A;  5L46 A;  1RT1 B;  4FPR A;  1T9W A;  3SCL E;  3I4P A;  4ZVQ B;  1RK8 A;  1NJX A;  2CJ9 A;  1MNE A;  4NYZ A;  4FN5 A;  4CM2 A;  2GMJ A;  2KH9 A;  3FEY B;  3M9O B;  3I55 S;  2K3I A;  1N8R T;  1CS4 B;  2GFF A;  4HAC A;  2NZ4 A;  4ZVR B;  4RO0 A;  1APS A;  3CJ0 A;  2LFV A;  2XNR A;  3B8H A;  4U67 Q;  1RT2 B;  1CJU B;  3TZW A;  1S72 S;  4KTQ A;  3KK1 A;  4LIW A;  1T95 A;  3M6V A;  3QLH B;  3CCT A;  3H59 A;  2XMV A;  5JJB A;  4LRE A;  2JVR A;  3LGH A;  3CXC R;  4PG5 A;  1FNX H;  1S9E B;  1WNE A;  3R5A A;  3HHL D;  4OHZ A;  1LK7 A;  4KHR A;  1S6P A;  1ZA2 B;  1IKV B;  4NLR A;  3CCS S;  1HBO B;  4WFB Q;  2FJB B;  2QA1 A;  3DLE B;  1FK9 A;  1RA7 A;  5ETL A;  2E5L F;  5J1N A;  4ZJL A;  3BRE A;  3AXK A;  2R4F A;  3OL8 A;  3FFI B;  4BHQ A;  4ECW A;  2V9K A;  4LFB F;  3QID A;  3KHL A;  2ZKT A;  1SKU B;  1U25 A;  2QGF B;  1FNM A;  1WHY A;  1VBK A;  1NDL A;  2P8I A;  4JI0 F;  3NWG A;  2PC6 A;  4RW8 A;  1D9F A;  1KQK A;  1FD2 A;  3DMJ B;  8RUC A;  3GQC A;  4OFZ A;  2RDI A;  1MMD A;  3V4I B;  2VQE F;  5F41 A;  2OJ3 A;  2VKR A;  1KVI A;  3A13 A;  3CD7 A;  2OPQ A;  3H8Y A;  2XUL A;  1B64 A;  1HNW F;  5KFC A;  5ETK A;  4CZC A;  1IKW A;  1RYS A;  3BSA A;  3JSM A;  2YNF B;  2N82 B;  3JXO A;  5J2Q A;  2BE2 A;  2OEK A;  1DQ9 A;  3V5R A;  4OI3 A;  1JIH A;  1RLC L;  2YQ1 A;  3U1L A;  4FS1 A;  2ALY B;  1NDK A;  1X8D A;  3P4U B;  3RRK A;  2E1M C;  1E6V A;  3VTI A;  4YP3 A;  1S4E A;  3AAW B;  3P49 B;  1NHK L;  4Y34 A;  4U95 A;  1RWO B;  3KG0 A;  1DQ8 A;  3OTC A;  4X65 J;  4ED1 A;  3VF0 B;  2CDQ A;  2JH3 A;  3KUE A;  3MR3 A;  3OXF A;  3HVW A;  1S1U B;  2MDA A;  3CJ4 A;  2GC8 A;  4F67 A;  4PG7 A;  1Q5Y A;  1ZAV A;  2YTC A;  1RT6 B;  3G8Q A;  1HR0 J;  2N4C A;  3ZNJ 1;  4QCL A;  5EX0 A;  1WKJ A;  1Y3J A;  1XTZ A;  1FRI A;  3V81 B;  2CJY B;  3T1H F;  5KFL A;  4HH0 A;  1TV6 B;  4I69 A;  3N01 A;  1AUD A;  3LAK A;  5ITH A;  2B6A B;  3MMA A;  4RKU C;  4ES3 A;  1BWV A;  2YKN A;  1FE0 A;  3NBP A;  3C6U B;  4F36 A;  2OIH A;  3U7J A;  3W62 A;  2PEH A;  2VG5 A;  3GFZ A;  5DDR C;  3AB2 B;  2EW9 A;  2QT7 A;  4OZ3 A;  3GMG A;  1VC0 A;  1IM6 A;  3K2Y A;  3RG6 A;  3SMZ A;  3U02 A;  2BZ2 A;  4NCG A;  1HMV A;  2F65 A;  3D6T B;  3R6G B;  4W92 B;  3W2V B;  2H4W B;  1FES A;  1Q5V A;  4N5S A;  4HYK A;  4CLZ A;  1FDN A;  2V4R A;  3MUV P;  3Q8P B;  3IRX B;  1LXJ A;  3NG8 A;  5KAK A;  3MOJ B;  2QA2 A;  1K44 A;  3M05 A;  4BWJ A;  2BAB A;  4HTJ A;  1DAR A;  1F9H A;  1JLG A;  2QLW A;  1HNX F;  2CVE A;  4HEA 9;  1RAO A;  3MM5 B;  1CUL A;  3CO9 A;  4OL8 A;  1WC6 A;  1CVJ A;  2D3Z A;  3CC7 S;  3P6Y C;  1MU2 B;  5DG9 A;  2GQC A;  4YY3 F;  1YJW S;  2R7Q A;  3LOU A;  2XY5 A;  2WAQ D;  1CJT A;  2HWT A;  4IUF A;  4QWE A;  2Y1R I;  1SV5 A;  1NH8 A;  2DXD A;  5EDW A;  4O44 A;  4ZVO B;  5HMX A;  4ECZ A;  1T0T V;  1HNZ J;  1HQE B;  3O1L A;  3QAT A;  4MKY A;  3QRR A;  3I82 A;  4H4M A;  1ZAX A;  1S9G B;  4QR1 A;  1A7G E;  3PYG A;  3UN3 A;  1P1T A;  1BQN A;  3BKT A;  1M5V C;  3HVA A;  3ITH B;  2GIF A;  2W9B A;  4C8Z A;  4U7U K;  4DV4 J;  2FVC A;  2V8V A;  1HW9 A;  3G82 B;  5HVG A;  4R8U A;  3M8Q B;  2W4D A;  3EUN A;  3DOM A;  3ZZT A;  1U26 A;  4DV3 J;  3GIR A;  5K14 A;  3B54 A;  5G0R A;  4USV A;  3C66 A;  3FBF A;  4WK1 A;  1VRU B;  1NB7 A;  4OX6 A;  1TMJ A;  2C2Z B;  3DLJ A;  4X66 J;  4URQ U;  5KG1 A;  1S0V A;  2JX2 A;  3PO5 A;  3NLC A;  2UU9 J;  4PRF A;  2Y9H A;  1QD1 A;  1QUP A;  4J9N A;  1KHW A;  3RB6 A;  3PO4 A;  4K2X A;  4OYW A;  3I0S A;  1TFW A;  1FJG F;  3G6Y A;  1O8B A;  1RZM A;  3DRS B;  1RTJ B;  2POK A;  1RBO B;  4HDH A;  2NUU G;  4MH8 A;  2R7X A;  5KFK A;  2XS7 A;  1NSK L;  2ZC4 A;  2EPI A;  4TY8 B;  3PEH A;  2WW4 A;  2R7O A;  1TMM A;  3C15 B;  4CH7 A;  1KQS R;  4DU8 A;  1KN6 A;  4FNH A;  2VBW A;  1VR6 A;  3DOK A;  3QWU A;  3HHE A;  1S57 A;  4JB8 B;  2ZH2 A;  4JV5 J;  1YX2 A;  3MR6 A;  2CQ1 A;  3CNQ P;  3GV8 B;  1T05 A;  1FD8 A;  1B0V A;  1EZZ B;  5BXI A;  3R5C A;  4DBQ A;  4B9L A;  4OYX A;  4ZIT A;  1MN9 A;  3H42 A;  2HBQ B;  3RJM B;  2DGT A;  1FX2 A;  2V94 A;  5KFN A;  1D8Y A;  1CS4 A;  1S7H A;  2OPP A;  4DQI A;  2OSR A;  3PAC A;  1TVR B;  3SQG A;  1ZM4 A;  3EWG A;  4HI2 A;  1RT2 A;  4N56 A;  4I2P B;  2JLF A;  2GHP A;  1ACM B;  2EG1 A;  2HHW A;  5AE3 A;  4C6A A;  2MGZ A;  3QLH A;  2EFN A;  2MKC A;  3MMC B;  4EGL A;  4F3O A;  4HI1 A;  5ETR A;  3HVT B;  2HVZ A;  1K47 A;  2HFU A;  2P6S A;  3KLF B;  5D0H A;  2CPI A;  4ELU A;  2HQG A;  1RT7 A;  2P9E A;  3IBW A;  1RKI A;  2VD3 A;  2W4C A;  4RR5 A;  5CAB A;  3GB0 A;  1HBO A;  1WDD A;  4RBV A;  5HRO A;  3KMQ A;  5IC6 B;  3EVW A;  4JBC A;  5KFE A;  3JSY A;  1S77 D;  1VQ9 S;  3UR3 C;  1WOO A;  1R7I A;  4LF4 J;  2VG7 B;  3PRD A;  2XI3 A;  2AJQ A;  3PRB A;  4Y2M A;  3V6D A;  3NXZ A;  1N34 F;  1GK8 A;  1SIZ A;  2H51 B;  1TKX B;  1F5C A;  4IRC A;  2HIY A;  4QPT A;  4C8N A;  4UOH A;  2A2C A;  3V4I A;  1UW4 A;  2Y1I A;  3PZP A;  4ECT A;  2DNH A;  4C0H A;  1N32 J;  3RAX A;  4ZP7 A;  3MAQ A;  2CQC A;  3BQ0 A;  2IC3 A;  4LIR A;  4N8N A;  5I3Q A;  1IN0 A;  2NCK L;  3FSY A;  2L48 A;  3IRW P;  2V2Q A;  2DY9 A;  4DPY A;  2BOA A;  4F26 A;  2EG2 A;  2HHH J;  2J9C A;  3TAM B;  4C3M A;  5DM7 Q;  2FDN A;  2UUT A;  2UUB J;  2KYX A;  3BEG B;  1XJW B;  1JNZ B;  3A3N B;  4KBI A;  1JK9 B;  5D77 A;  4Y2C A;  4K4Y A;  1YZ6 A;  1C4C A;  1R8C A;  2AJ4 A;  4H4O B;  2MQN A;  4DV0 F;  3OJS A;  1S1T A;  4RW7 B;  1N33 J;  5B0C A;  3GII A;  3W5Z A;  2ZE2 A;  1XMB A;  2HQ3 A;  3LW5 C;  1U1R A;  4Z7C A;  2R9L A;  3KJV A;  4B9M A;  4P2F A;  1UJ5 A;  1RT6 A;  1UA0 A;  4IG3 B;  3DCA A;  2VPZ B;  1VGY A;  4NAS A;  2MZS A;  5LSL A;  2FIU A;  1NJY A;  2ZC3 A;  1MN7 A;  3EPG A;  2AU0 A;  3GE9 A;  3PX6 A;  3A8E A;  2W2Q P;  3BN7 A;  3FDS A;  3QO9 A;  3V6K A;  4IG0 B;  4K0K J;  2Q6B A;  3LP0 B;  5B0E A;  3QQC D;  3WZ0 A;  4LSN B;  3I0R A;  3N79 A;  3THP A;  2VBZ A;  1UWB B;  3N28 A;  5KFG A;  2UXC F;  1SCJ B;  3NS5 A;  3W61 A;  4CO1 A;  2KG1 A;  1W25 A;  3AXM A;  4DQP A;  2DGU A;  4OJ1 A;  4QQB A;  4GO7 X;  5GVQ A;  4I6A A;  3JSR A;  5KT6 A;  2MTL A;  2UXD F;  1R3N A;  2AKW B;  4K4W A;  3ET6 B;  2LA4 A;  3R3T A;  4DL2 A;  3ZNU A;  2UUW A;  5D4O A;  1RT5 B;  4WXW A;  1XN9 A;  1MU2 A;  4JI3 J;  4CT8 A;  2QSF A;  3GJS B;  3CB4 A;  2DR8 A;  2MQQ A;  4K50 A;  2A18 A;  4DG1 A;  3OLB A;  4DPW A;  3QFW A;  4TYB A;  2JWN A;  1IWG A;  1T9Y A;  2CQ4 A;  2GO8 A;  2DRB A;  3IAM 9;  5LXY A;  4ES1 A;  2MQO A;  4PXB A;  2VL1 A;  1HQE A;  3MD3 A;  4ZPD A;  1YJN S;  1AA1 B;  2B56 A;  2DH7 A;  2R8K A;  4UUX A;  1S9G A;  2WSC C;  2ZH4 A;  4RNN A;  3FRY A;  4RW6 B;  2E5H A;  2HAI A;  1BQX A;  4F8R A;  1H2U X;  3RTV A;  3THV A;  2J7K A;  2FLO A;  5CZV A;  4J9V A;  3CCU S;  4JI2 J;  5B09 A;  1CC7 A;  1J5E F;  5C2G A;  3VWS A;  4XPE A;  2DGQ A;  5GAE U;  4DV2 F;  2PSZ A;  2FHO B;  1KNZ A;  4G6V B;  5MAO A;  1EKR A;  1U2F A;  1HHT P;  4Y6I A;  2RH3 A;  1K0T A;  1NK8 A;  5D4N A;  3M6W A;  2LQ5 A;  4XTT A;  2FVS A;  5F3Z A;  5KFH A;  3W1Y C;  1GXU A;  4PWW A;  1Q8K A;  4N7T A;  5A6W A;  4UY8 5;  1F6T A;  1OSC A;  5K20 B;  2WK4 A;  4O4G B;  4ID5 A;  4DR2 F;  1TL5 A;  1FKO B;  3DLK A;  5C42 B;  4FZV A;  2DNQ A;  2ZBP A;  2WBR A;  3C16 B;  3HX9 A;  4YQW A;  1DRZ A;  5CA5 A;  4B9T A;  3CDA A;  3M8Z A;  4OYB A;  2RNE A;  1N4L A;  2CVI A;  2V50 A;  2FZC B;  4OJH A;  4DV6 F;  4NYP A;  1RAE B;  3KK2 B;  2GZO A;  3OBI A;  5A8W A;  4X4R A;  4QU7 A;  1E6Y A;  4MIA A;  4GVB A;  3FZB A;  3MCN A;  4CDI A;  4C7Q A;  2OFG X;  5HQ8 A;  4FNI A;  3HJV A;  2YNI B;  2CQP A;  3L7U A;  4PAB A;  4OZN A;  4J9L A;  3MI7 X;  1OJ4 A;  3MM8 B;  2A2D A;  2VOD A;  3CUN A;  1VHI A;  2M4M A;  1IVZ A;  2QO3 A;  1LWC A;  1M5P C;  2OPS B;  1GFW B;  1HBU A;  2V8G A;  2IJF A;  4F3M A;  1RA6 A;  3WQP A;  1S49 A;  2DK2 A;  4C8K A;  1SKR A;  4B3M F;  3QZ8 A;  4B9U A;  4H54 A;  3TZX A;  2VG6 A;  5EWF A;  4CCH A;  1ICE B;  2QC3 A;  4KSE B;  3MM6 B;  1QVF R;  1S6U A;  1DBD A;  3HSJ A;  1OYD A;  3IFE A;  1RHQ B;  4A48 A;  2V8H A;  3HF5 A;  1HNV B;  3FZ2 A;  5J2N B;  1OYE A;  1AB8 A;  1Q7L B;  3S8S A;  3GJT B;  4C97 A;  3THT A;  3K8V A;  5AT1 B;  1RSC A;  1REV A;  2CJX B;  1GXL A;  4P72 A;  4KE5 A;  4ZVU B;  2IHR 1;  1R8H A;  4KH0 B;  2ZM6 J;  1Q81 T;  4P7V A;  1U02 A;  3MEC B;  1TKZ B;  1LW2 B;  4NXN F;  1EIY B;  2MKY A;  2B7C B;  5ETM A;  3H7H B;  4YME A;  4G3I A;  4DUT A;  1OS5 A;  1YJR A;  2W9A A;  1NK9 A;  4IQM A;  2V69 A;  4F4A A;  3IBC B;  3R7B B;  2JLG A;  4NCA A;  1UVJ A;  1VFJ A;  1TKX A;  1S1V B;  1HBM B;  1PAU B;  4ILM A;  4WXO A;  2JJ4 D;  4YDD B;  2VH7 A;  3R2D J;  2RU3 A;  3CJK B;  1IBK J;  2J7W A;  4UZB A;  2VON A;  1TU0 B;  2CNN B;  2AEJ A;  2EK1 A;  2PEB A;  2IDL A;  5H9F J;  3TVK A;  7AT1 B;  4JI6 F;  2OI2 A;  1H6K X;  5HK4 A;  2W9C B;  3M6X A;  2F8H A;  4AXI A;  3LAN A;  2FC9 A;  3C46 A;  3GPA A;  3TZY A;  1V6H A;  5D15 A;  2GJI A;  1OY6 A;  4NMX A;  2W1B A;  2DNZ A;  1X4C A;  1P1L A;  3MUR P;  4WE1 A;  1MRO B;  2PI5 A;  3UPF A;  3CF5 Q;  1FEH A;  1SC1 B;  4RW7 A;  3GP9 A;  3AT1 B;  5KG3 A;  1S1W B;  5U47 A;  3I6P A;  2DR7 A;  2RU9 A;  3L4B C;  3MR2 A;  3J7Z 5;  3M8S A;  2C2R A;  4PKD B;  1KS2 A;  2PFF B;  1LW0 B;  4NLO A;  2KDO A;  3SSQ A;  1M1K T;  5LXR A;  1Z1Z A;  5K5M A;  1P9Q C;  1N54 B;  2ZOF A;  4DL7 A;  4MAK A;  1RJJ A;  2H5E A;  2YQ0 A;  3UD3 P;  1KSP A;  3L7O A;  3G6E S;  2YWK A;  2Z57 B;  5FDL B;  1Z2L A;  2G4B A;  3TP2 A;  3PYF A;  4IG0 A;  2LQ9 A;  3LP0 A;  2MQ8 A;  3NAH A;  1HPZ A;  2YWH A;  3MFH A;  4ANC A;  1F5A A;  2KO1 A;  2MPU A;  2RIL A;  4KGX B;  5KG2 A;  3N0V A;  3GIL A;  4YOE A;  1DUR A;  1C0U A;  3RU0 A;  1VRQ C;  4HHU A;  4LFB J;  1DLO A;  2KRR A;  1NJI T;  1TR0 A;  1PYS B;  4WCE Q;  3VAF A;  1Q53 A;  1RWK B;  1YG0 A;  2IRU A;  3BZQ A;  5KFT A;  1NKC A;  4L73 A;  4C8L A;  3N5B A;  4HH1 A;  4DFM A;  5I42 B;  1H2V Z;  2A6M A;  4MKA A;  3VAG A;  3KLV A;  4D3H A;  3OXG A;  4EFA C;  3PW5 A;  3ICL A;  2VQE J;  4DPU A;  1UFK A;  2I5J B;  2J5A A;  1TL3 B;  1HNW J;  3NCR A;  3RZA A;  2AP6 A;  3QPI A;  2UVR A;  3MD1 A;  1RWP B;  5DO2 A;  3H40 A;  2PE8 A;  1WC5 A;  1SJ3 P;  4ZVP B;  1R43 A;  5GAE I;  1M1G A;  4CH0 S;  4M5M A;  4M5J A;  5IM0 B;  2MSS A;  3J7A N;  3MCM A;  2YPY A;  2LXI A;  1RWN B;  5B0D A;  2J76 E;  1U47 A;  1FFS B;  1CQM A;  1ZPW X;  5DGA A;  2DNK A;  5AXM A;  3AJ1 A;  5J1P A;  1VLO A;  4P2S A;  1V3S A;  1S7I A;  4OI0 A;  1VQ6 S;  1GH8 A;  2YY3 A;  2HAF A;  4ICL A;  3M8W A;  4ERD A;  2LLZ A;  4EUV A;  5HAN A;  1D3W A;  4X62 J;  2J0Q D;  3BGL A;  3TUP A;  1SH0 A;  1OY9 A;  2WVF A;  3QZ7 A;  2NLW A;  1RHK B;  2DHH A;  2XMM A;  1B0T A;  3AD8 C;  1MSW D;  2OO4 A;  2CNK B;  1NU4 A;  1Q7Y T;  1B0P A;  3P5B P;  1ULR A;  2VHG A;  1HWI A;  3QAU A;  1HQU B;  1Y9O A;  4OZ1 A;  2LU2 A;  2EC2 A;  1TUV A;  4NRU A;  4NI2 A;  1K1S A;  2UV8 G;  1FJ7 A;  3M9N B;  2X1A A;  5SUH A;  4CWB A;  4ED7 A;  5KOW A;  2X1G A;  1GXT A;  2MLY A;  3Q86 A;  3QWP A;  2DRA A;  5C42 A;  2AGQ A;  4JP8 A;  1U6Z A;  4ELT A;  3C16 A;  1FDD A;  3D66 A;  3OFE A;  1JJC B;  2AMC B;  4LFA J;  1DHM A;  4QW8 A;  2HKE A;  3BDE A;  5CZX A;  2DHX A;  3WBZ A;  4Y2A A;  1L5U A;  5IQQ A;  1XR6 A;  2G13 A;  3WC0 A;  2JHE A;  3GJR B;  2ZJR Q;  2A6O A;  2AYB A;  3BF4 A;  5CD4 H;  1Y7P A;  2D3U A;  4PXE A;  3G96 A;  4XDD A;  4LF8 J;  4J7C A;  5EX3 A;  4WU2 A;  4KGM A;  3MM8 A;  3V4M A;  1UVL A;  2B4U A;  2ZZT A;  2OPS A;  2I8E A;  2WBM A;  2MZQ A;  3A12 A;  4CNY A;  4WFX A;  1FRL A;  3ETM A;  2DNG A;  3T6J A;  5J2P B;  3GIM A;  5HJX A;  3ENQ A;  1RHR B;  4RUB A;  2P2C B;  5KT4 A;  4L74 A;  3UNG C;  2JVO A;  3WC2 A;  4ZDN A;  1H0H B;  3MPW A;  3MMB B;  2ZUG A;  1ZM3 A;  3KLH A;  4M95 A;  5IS2 A;  4DI6 A;  3CPW R;  2RF2 A;  2LVW A;  4LVO P;  1H3D A;  2AHO B;  3ILL A;  2ROG A;  1MMN A;  3OUY B;  4R5P B;  4PPD A;  2X1F A;  2IPO B;  4RUH A;  8ATC B;  5LJ5 Y;  1GMV A;  2IBK A;  3NGR A;  2FPH X;  1YJU A;  1C1C B;  3FQK A;  4A46 A;  3AH6 A;  1TTH B;  3I56 S;  2XSF A;  3HI9 A;  3C6T A;  3VR1 A;  4LSL A;  1TK5 A;  4X4N A;  3HFK A;  4I2Q B;  2XO7 A;  1RHJ B;  3AQP A;  1KKH A;  4GRS A;  5M2U A;  3C14 A;  5T7L B;  3J80 Y;  1FRX A;  1HI1 A;  1QLN A;  5MLC V;  2QL5 B;  3LPY A;  4C4W A;  4X65 F;  4ZCK A;  1TKZ A;  4FKY A;  4A8F A;  1FX4 A;  1OIA A;  1Q8B A;  3G8T A;  4EK2 A;  3J81 U;  1QUV A;  2HVE A;  4OMF G;  4B08 A;  1HBM A;  3UCG A;  3AD7 C;  2GAG C;  4DS5 A;  1HR0 F;  2BM0 A;  4USK A;  4ECY A;  2ALZ A;  3CJK A;  4HTI A;  3GZ7 A;  3OXL A;  1N5Y B;  2RIJ A;  2X51 A;  4OYO A;  5KFB A;  2DNP A;  5HMZ A;  1XBW A;  3TVY A;  5H9E K;  3T5J A;  4TYA A;  1HBN B;  3BQ2 A;  3GIK A;  3H4D A;  2H4Y B;  4GC7 A;  1L3K A;  3ZZP A;  1NSP A;  1KTQ A;  1BLU A;  1FI4 A;  4XDC A;  2IIH A;  1BMQ B;  3TA2 A;  5B0A A;  5CAA A;  4F25 A;  3ETO A;  1VYA A;  4DV1 F;  4E0D A;  1WI8 A;  3EZO A;  1KP6 A;  4AUK A;  4J91 A;  2F40 A;  1I1G A;  4ZLJ A;  1B7F A;  4UOF A;  2Z8Q A;  3WDO A;  4ILR A;  3TJ8 A;  2OMO A;  3NNH A;  2M9K A;  3EPI A;  4FKX A;  2LU1 A;  4WFY A;  3K5M A;  3QIP B;  1S5Z A;  2D1C A;  4JUZ A;  4KV8 B;  1ZH5 A;  3FCW A;  5F8G A;  3D5M A;  2LP4 A;  2CWK A;  3CDW A;  4LRF A;  1TEL A;  4YB7 A;  3MUT P;  4CO5 A;  2W7P A;  3CME S;  2PN6 A;  2OPR B;  3WX4 A;  3MM9 A;  4ZIW A;  4WP3 A;  5HBM A;  4FXV A;  4MYT A;  2OD4 A;  2GQ2 A;  4RUA A;  3T5K A;  1OWX A;  3TJ9 A;  2CPF A;  2QSW A;  3AOC A;  1V9O A;  4OLO A;  1SC4 B;  1K8A T;  3H25 A;  1KHV A;  1SUQ A;  1KWM A;  4ZJQ A;  1ZA1 B;  4WP9 A;  2ZOM A;  3ZZZ A;  5IT9 U;  1D09 B;  4WWS A;  1N6Q A;  1SQG A;  1HNZ F;  1FRM A;  3GV7 B;  3J81 j;  3D1H A;  1U09 A;  3CD6 S;  3KMS A;  1RE1 B;  3AFG A;  1YQH A;  3OR2 A;  4J9S A;  2FZK B;  3GJQ B;  4ED8 A;  3EGW B;  4KO0 A;  4V19 X;  1RTH A;  2OML A;  4PUO A;  1XER A;  1HL6 A;  4WTY A;  2VF3 A;  3EDR B;  2C3P A;  4WII A;  3TX8 A;  1SXL A;  1EP4 B;  2NSB A;  2BUN A;  4BWM A;  2GVD B;  2DY1 A;  1FFG B;  2ZOG A;  4X64 J;  2AD9 A;  1EAR A;  3UR0 A;  2MY8 A;  1N34 J;  4DR6 F;  5B08 A;  1V3R A;  4MYU A;  4UOG A;  2B0G A;  4DV3 F;  3BH6 B;  4IFY A;  3DRX A;  4M5L A;  2E1C A;  3CUL A;  3CJ5 A; 
#chains in the Genus database with same CATH homology
 2KL8 A;  4YY3 J;  4DUZ J;  4GKK J;  4DV7 J;  3J80 U;  1I94 J;  4B3M J;  4JI1 J;  2VQF J;  4DR7 J;  4NXN J;  5BR8 J;  4LF9 J;  4LFC J;  4RJV A;  2HHH J;  4DUY J;  4NXM J;  2MQ8 A;  4JI8 J;  4LFA J;  5LM7 E;  4X65 J;  3J7A N;  3IMQ J;  2UUB J;  3D3C J;  4DV4 J;  5LMU J;  5LMN J;  4GKJ J;  1FJG J;  5IWA J;  4JV5 J;  2MEW A;  4DV6 J;  4JI2 J;  5IT9 U;  4LF5 J;  4DV3 J;  4OX9 J;  4B3R J;  2MTL A;  1N33 J;  4HHU A;  4KYZ A;  4LFB J;  2UXC J;  5A2Q U;  4JI5 J;  4JI7 J;  1HR0 J;  3T1Y J;  4KHP J;  1N36 J;  4LF4 J;  4DR1 J;  4DR5 J;  4DR4 J;  4DV0 J;  2UXB J;  4X62 J;  4NEZ A;  4JI6 J;  3OTO J;  4KY3 A;  2UUC J;  2ZM6 J;  3JAM U;  4X66 J;  4LF8 J;  2E5L J;  2UU9 J;  4K0K J;  5AJ3 J;  3W1Y C;  4PWW A;  5FLX U;  4DV1 J;  2KVQ E;  1XMQ J;  4JI3 J;  3T1H J;  4YHH J;  4DR3 J;  4LF7 J;  2UUA J;  4X64 J;  2VQE J;  1J5E J;  1N34 J;  4JI0 J;  1N32 J;  4AQY J;  1HNX J;  4DV2 J;  1HNZ J;  2UXD J;  4B3S J;  4LF6 J;  1IBM J;  3R2C J;  1IBL J;  2F4V J;  4JYA J;  4DV5 J;  4NEY A;  4V1A k;  1HNW J;  4B3T J;  1XNQ J;  1XNR J;  3D3B J;  3R2D J;  4JI4 J;  1IBK J;  3J81 U;  1XMO J;  4DR2 J;  4DR6 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...