2HHHJ

Crystal structure of kasugamycin bound to the 30s ribosomal subunit
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
b'KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title The antibiotic kasugamycin mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation.
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 2hhhJ00
5LMNJ 4DR2J 4B3RJ 4DR3J 4OX9J 4GKJJ 3R2DJ 1N32J 1J5EJ 5AJ3J 4B3MJ 3J80U 4JV5J 2UXDJ 2UXCJ 1HNXJ 4DV2J 4JI7J 4JI2J 4PWWA 1XMQJ 4DV1J 1N36J 4V1Ak 1IBMJ 4B3TJ 1N34J 3IMQJ 1XNRJ 2UUBJ 4DV3J 4DR6J 4LF6J 3D3BJ 3D3CJ 4DV4J 1I94J 3JAMU 4DR4J 4NEYA 4DR7J 4K0KJ 5IWAJ 2E5LJ 4HHUA 5FLXU 4KHPJ 4AQYJ 5A2QU 4DUYJ 2F4VJ 1N33J 4NXNJ 4X64J 2VQFJ 4JI0J 2HHHJ 1HR0J 4JI5J 5BR8J 4DUZJ 4LFCJ 1XMOJ 2UXBJ 4LF7J 2ZM6J 4X65J 2MQ8A 2VQEJ 2KL8A 3R2CJ 2UU9J 4JI1J 1XNQJ 4DR1J 3W1YC 3OTOJ 3J7AN 1HNZJ 2MTLA 1FJGJ 3J81U 4DV6J 4JI3J 5IT9U 4LF9J 1IBLJ 4DV0J 4LFAJ 4RJVA 4DV7J 4JI4J 3T1YJ 4DV5J 4LF4J 2UUCJ 4LFBJ 4NEZA 1HNWJ 4B3SJ 4JI6J 2MEWA 4JI8J 2UUAJ 1IBKJ 4X62J 4NXMJ 5LMUJ 4X66J 4JYAJ 4KY3A 3T1HJ 5LM7E 4LF8J 4GKKJ 4YHHJ 2KVQE 4YY3J 4LF5J 4DR5J 4KYZA
chains in the Genus database with same CATH superfamily
2A6OA 3UN2A 2VOOA 1RT3A 3IAM9 1TKDA 2JWNA 3DOKB 1HMVB 1SVDA 4P72A 1YKWA 4OJHA 5KG7A 2CDRB 1N36J 3N6NA 4AL5A 1S4EA 3HZEA 3OFGA 2DR9A 3KLVA 2MB0B 1C1CA 3IS9B 3TA2A 4HHUA 3BSAA 3M2RB 3PX6A 3WBZA 2LKZA 3UW1A 1TL5A 3D1OA 2OEMA 4QIGA 1S0NA 4LVOP 1WF1A 2ZBIA 1IKYA 2XGPA 4RL1A 1RT5A 2UZAA 1U1PA 3TAQA 3AOBA 3JSMB 1U1QA 3SQOP 1QAXA 2W01A 4NEZA 3RYLA 2ZWPA 4OZ5A 4FS2A 4Y2CA 3TX8A 3B78A 3D5MA 2AYBA 3BO3A 3PHEA 4DG1A 2IAJB 2HK3A 4ED1A 1BWEA 3U7JA 4OYPA 4JOUA 4URGA 3MI7X 1X4HA 2YNFB 1AROP 5F8JA 1F1BB 3EGWB 2MQNA 2WVFA 1RHUB 2V9WA 2IM3A 1UZHA 5F3TA 1JLFB 3I87A 3BR8A 5LOQA 2IVYA 4ITSA 3OTEA 3RU0A 3H42A 5KFLA 4DR3F 2QL5B 1VFJA 4NLGA 2KT5A 1FKOB 4DSFA 5L9XA 3I0SB 5GADU 4B3TF 4P7TA 2UUBF 2DY9A 1KC8T 3OLAA 3IM9A 4B3OB 3EVWA 3UO0A 3KNAA 5D3GA 1FEEA 4ED2A 1FWLA 2DH8A 3UNYA 2D69A 2Z56B 4URQU 1ZPVA 4WYLA 4P6QA 2CZ9A 1CJKB 3DLEB 3CC4S 2HBYB 1DBDA 2PFDA 1IBCB 1DZ5A 2ZE2A 3QT7A 1TMMA 3I82A 1RWKB 2PSZA 4KR0B 2RS8A 4DV6F 2VDIA 1ZM2A 4UOHA 1Q53A 4ZPCA 1RLDA 5HMZA 2JVRA 3U02A 4H4KA 5K14B 5IT4A 1ZOTA 1Y7PA 3K17A 1JLAA 1XTZA 2CPEA 4RW4B 1D0EA 1JXEA 3GJSB 3DFEA 2CNKB 5HQMA 2KB2A 4PXEA 3L3CA 3PX0A 3CJ8A 3VQTA 4X4NA 5C25A 4ECXA 3ENVA 3V81B 3Q2SC 1EHWA 3B8HA 2LDIA 1EETB 1S6OA 2U1AA 4KIAA 3M8QA 4LF7J 1RBAA 1VQKS 2HIQA 2ZJQQ 4OL8A 1RKIA 4K5RA 4F7VA 1VQMS 1NSPA 1Q5YA 4C8MA 2WOMB 1O8BA 1HBNA 1TQLA 1N6QB 2OIHA 1KTQA 2R2UA 3R7SB 3K59A 3BH6B 3QZ7A 4QJVA 4DEZA 5FJ4A 1GXUA 4ZVPB 1MG7A 2OLWA 4PQUA 4FBTA 3D28A 2EC0A 4IG0B 3U1LA 5A8KA 1IWGA 2P5VA 1QD1A 3GU0A 3PRBA 2I5JA 4UT4A 4PXBA 4Q5VA 4USWA 3M30B 3L7OA 1YBUA 4LUBA 2EK1A 2W2QP 4A8OA 4DN9A 1IKWA 4MMOA 5H9FK 4B3MF 1T3OA 4X4VA 3PXGa 3LGNA 5K20B 4PRFA 1ZZFA 1F0XA 4EK2A 4HACA 2XBPA 1P1TA 1MSWD 4DR6F 3QWPA 4C6AA 4Q0BA 4NCGA 5ETSA 1HNZJ 1X4FA 2OSQA 1K44A 4DX8H 3OR2A 1UZDA 4AD6A 3IAS9 2CYYA 1Q8LA 2BJ7A 3SCJE 4OLPA 4NLRA 4I6AA 3GYNA 4C9DA 1WI8A 1SJQA 4U8YA 4F0KA 2HNDB 3J81j 5IV3A 4EFAC 3D1HA 1S6PB 3NY0A 4PABA 4DV7F 3A3NB 3KLFA 3G6ES 1T9YA 4Y28C 1RT6A 2XY6A 4H4KC 4YQWA 2DGVA 1SUQB 1BE4A 3SCLE 1IVZA 4G1PA 1HHQA 1IR0A 3OLBA 1S97A 4G1QB 4OZ1A 3H25A 2UXCF 3AY0A 1YGYA 1ZAXA 5IQQA 1XC9A 4M5DB 1D8ZA 4F2RA 3NL0A 4YB6A 2AWZA 5KFVA 5I3UB 1IM4A 1SQEA 2CZVC 4U7UD 4M5IA 2JEJA 1NB7A 4DL4A 5C5JA 3CXCR 2DXDA 3BQ0A 2YX1A 5K8PA 1WJ9A 2WZ1A 2KI2A 4K8RA 4CQ1A 4MFBA 4LF1A 1H0HB 2JLGA 4ILLA 2V94A 1XNQF 1M5KC 3BGOP 2NZCA 3BKFA 4C3MA 1EQMA 4LRDA 4LSLB 2DEJA 4X84A 5KT6A 4KYZA 1RAIB 3G86A 3OPKA 3QQCD 5K8NA 5CD4A 2XY7A 2FC8A 4C0HA 5I3QA 5D4OA 2DNRA 4M8LA 4OHVA 3QT6A 1XK8A 2DH7A 4LF6J 1FWKA 3L7UA 3WC0A 3TQ1A 4MK7A 2D3OR 4PZVA 5G4DA 1X4BA 3BBBA 2XZDB 3SDEB 2P9CA 4OX8A 1AZSA 2DR7A 3WX4A 3C46A 3FRZA 1BUXA 1W25A 4QWEA 2G1DA 2R7QA 5HVFA 3I5CA 3HKWA 1O51A 4AQYF 4CT9A 3AD8C 3J80Y 1UVKA 2HFOA 3J7YI 4J9KA 3DOKA 5F8GA 5KG6A 1HMVA 3ZZRA 1VLYA 3HSJA 3TVZA 1SL2A 4WTOB 3N4WA 2GMJA 2Q79A 3OTOF 1FFSB 3DOMB 4KH1B 4CH1A 2VJUA 4EEYA 2F7VA 2DNLA 3AB4B 3IS9A 2W2PP 1FRXA 1NRKA 3M2RA 2QA4G 1LWXA 4DR2J 4B3RJ 1DQ8A 5A0YB 1OQ3A 2W8LA 3FMBA 3SBMA 4RNMA 1ROFA 3MCSA 3KJQB 2ZBCA 1RTDB 2ALYB 3A1YG 4Y2IA 3IR6B 1HWKA 1T94A 1HWIA 2V2KA 2WVBA 1TMJA 1VQOS 3JSMA 4F3QA 1ZM4A 3IN5A 1P8GA 2FB0A 1WKLA 2VQFJ 3M6VA 4AFFA 2WSFC 1G1XA 3R3TA 2MKSA 1EX8A 3GFZA 1X60A 2DD8S 2RDJA 5GMDA 2PT0A 4XPEA 5E3QA 4GC6A 1JLGB 5DRKA 3M9NB 2IAJA 3WIUA 2I2YA 2A18A 3W65A 2YNFA 2GGPB 3T6JA 1Q95G 1UVLA 1VQ7S 1YZ6A 5KG4A 1JLFA 4KO0A 3CJSA 4RW9B 2G2OA 3QAEA 1HLWA 1SXLA 3M8PB 4OI3A 2B8PA 5B0BA 2ERRA 4Y2AA 3EGVA 2FLLA 3GIKA 4EBEA 2VA3A 1FKOA 3HHNB 2VFTA 1WC0A 3I0SA 1S10A 4ED4A 1KONA 3ZZYA 3R7NB 2BANB 5L38A 4DDFA 3FCHA 4ECWA 4B3OA 1CG2A 2W8KA 1CJUB 2EFVA 1CJKA 3DLEA 4KV8B 5IWAF 1QTNB 2Y1LB 2CPFA 4J5OA 2LQBA 1U2CA 5KT5A 2K2PA 4NA1A 2FHMA 3KHLA 4I64A 1WG5A 2CQ2A 1P9QC 1Q81T 3QFWA 2IBOA 2CQ3A 1HHSA 2IPOB 3A4TA 1T02A 4TY9A 2LXUA 4OV1A 1FDNA 3UR0A 2AMCB 2E1AA 3MR6A 4L73A 4CH7A 3QRQA 4PQAA 2ADBA 5K14A 2QA4S 3DOLB 2K8GA 2M8HA 3TZWA 5KFCA 1B99A 3IRWP 4RW4A 2W2OP 2OUGA 3BO4A 1RZMA 3FBEA 1U0HA 1Y5NB 3BV8A 1PJ5A 2V4JB 2MZRA 5A2QY 2NUHA 3Q22A 3BH7B 2QFIA 5CCLA 3R5DA 4N41A 5IXUA 3V81A 3FC9A 3Q8UA 2DHAA 5ETLA 3CCJS 1OJ4A 5LMNJ 1EETA 1C0UB 2B51A 3MGJA 3HSDA 3ISND 2J5AA 4ZN3A 1BQMB 4M94A 2QLBB 4GKKF 3OT9A 3NS7B 2OPRB 4DL6A 3CDWA 2HVDA 2WOMA 4KB7A 4CZCA 4KGKA 5E0OA 3N01A 1HFEL 4O44B 1B64A 1N4LA 3QSYB 5KG1A 1N6QA 3JTPA 4ED3A 4IRDA 5F3ZA 2DY1A 2PFFB 2WBRA 4K4WA 3X1LB 3N9UC 4RUBA 3D6HB 1L5UA 4PKDB 4IG0A 3RR8A 2YKPA 2N3LA 1IM6A 2MZSA 4RNHA 1FJCA 3VR1A 1IR2A 2GA7A 4IDKB 4RX6A 3GJRB 1XBWA 3M30A 1UW9A 2ZITA 1U1RA 4DQRA 3LAMA 4NMXA 2FVQA 3TVYA 4JB8B 4YHHJ 3SV3A 2FVPA 5DDQC 4J90A 4J9NA 3KXDA 4NYOA 4DR5J 4JV1A 2DVIA 2BJ9A 4PPDA 4X4PA 1IKVB 4JI6F 1TAUA 2GZOA 4UOCA 2H1YA 3GCXP 4OZLA 1YJUA 5KFAA 3M9OB 3LWMA 2DNPA 3OJSA 2FJEB 4YN3B 2DNHA 1WWHA 5IWAJ 4F02A 3D67A 1YJRA 4NWBA 5J2PB 4QPXA 2VH7A 3TANA 5GAGU 2HNDA 1T9VA 1VC0A 1FVSA 3C16B 2QYGA 3HFKA 5DM6Q 3NKYA 1S6PA 1E6YA 4OJGA 5E3PA 1FJGJ 3NGKA 3OSNA 4F04B 3RBZA 3TUPA 3CDUA 3RZAA 1LWEB 1FEHA 3VVTA 2KRBA 1SUQA 3FKBA 2B0GA 3G71S 4USJC 3BGLA 3ITHB 1V5IB 3VGVA 4QU6A 2ZJPQ 2GNKA 4JP8A 4X4RA 5HMXA 1U1OA 2VG6A 2VPWB 4M5MA 4P2MA 2D74B 4G1QA 3D9BA 2QA2A 1B0VA 2KFYA 1XNRJ 2E66A 3OXFA 3OFFA 3W3SA 1X7VA 4NLPA 3AHPA 1S0VA 3PFOA 2D3ZA 3PYGA 2MZJA 3HHEA 2GMLA 2YWGA 3C15B 4M5DA 5I3UA 2NXNA 3JXOA 1OMSA 1NKCA 4IH6A 2O01C 3OTCA 3PYFA 1IJFB 3JAMU 3G8SA 4FF1A 4A8QA 4NXNJ 3PVXA 1M1HA 1R8PA 2YKNB 4J9PA 2RIJA 3GZ7A 4DL0C 2HFVA 2XMWA 1RSCA 1RWWB 1BC6A 3KK3A 3TJ9A 2PDAA 4LSLA 5A6PA 4C0BA 3RAXA 1J2VA 4R0JA 2RD5C 2ZH6A 4EZ6A 2J7KA 1SH2A 1GK8A 3MECB 5KG0A 2CVIA 2P9GA 2AGQA 2BJDA 5KG3A 2N3OA 5LJ5Y 4HEA9 2ZH1A 2F3JA 1X31C 2Z58B 4AUKA 1RU2A 4NX9A 1HQEB 5L1KA 4I1TA 3SDEA 3E2EA 2CWKA 4C3LA 1R0CB 4B3SF 1Y5IB 4UQTA 3MCNA 4L3KA 3U1NA 4ZHRB 4LF8F 2LYVA 4QIFA 4LMZA 2DGTA 2P2CB 3HD1A 1UEUA 4LQ3A 2HVIA 2B4VA 1Y00A 2FVCA 4W92B 2QTWA 4F26A 1VCTA 3DGVA 3N5BA 3GE9A 4USKA 3DLJA 2NPFA 3DOMA 4QW8A 5DDPC 4ZPTR 4EI2A 5HAOA 2YNHB 2QMXA 4FYDA 3Q8YA 3HT3A 2DXFA 1JNZB 2XMAA 5CYQB 2HFZA 4ID5B 5A0YA 4UOFA 2X1AA 1RTDA 1EKSA 5J2QB 4IYQA 1DQAA 2UUAJ 1IBKJ 2CQHA 3UE2A 5BYSA 2J6UA 3DDNA 2M2BA 2VU5A 5C2GA 4CT8A 3P5BP 5D0HA 1UW4A 1ZZNA 1AXQA 2LXIA 2I38A 2CNNB 3BZQA 4OX9F 1SC6A 1BGXT 2D3UA 4HI2A 1T11A 5KFHA 2XMKA 5L1IA 3V4IB 5IT9Y 2XWYA 4KT0C 1VGYA 4MIWA 3MUVP 1KN6A 3GR1A 3OJUA 1D9DA 4ER8A 4YR3A 1AUDA 1JLGA 3MMJA 4X4SA 1TFYA 1NJYA 3MPVA 4FKYA 3QIPB 5EDWA 3R5JB 4XDDA 2VKZG 2GGPA 3EYZA 1M90T 2FUG9 4ZA1A 2E1RA 4X4TA 3AB2B 3DI6B 4J9OA 2QC3A 4X65J 3J7ZT 5JUMA 3DDKA 4QCLA 4RW9A 3KUEA 2QO3A 4DQIA 3M8PA 1TKTB 4OI6A 4K59A 2CPXA 1TK0A 1W2BR 4ZLNA 4LIRA 2PE8A 4NL5A 4UZCA 3EX7B 1JXLA 4WYWA 1XEZA 2KFZA 4G6VB 2DGSA 1GEHA 3OFEA 5JXSA 4DFKA 2BANA 2DR6A 1NHVA 2DISA 3I0RB 5HLFB 2GMHA 3AD7C 2CPZA 3MF5A 2W7OA 1CJUA 4KV8A 3ZTOA 2EEYA 4NLTA 1JB0C 1Y3KA 5CQGA 3BM7A 3QJPA 2YKAA 4JI8F 3TJAA 3M05A 3T5JA 1U24A 4HT7A 2BJ1A 2HWTA 1SJFA 4QYRA 4AT1B 3CO0P 3UDEA 4R5PB 3J7Z5 2VASA 1RWPB 3DOLA 2RRNA 1M1GA 1WEYA 3GR0A 3MCOA 1ZM3A 4F2SA 1RAAB 3EE3A 2ZBPA 2LA6A 3W2WB 2HRYA 3HVAA 1U8SA 3CJ0A 2GAHC 5F0UA 2V4JA 2P9EA 1OY8A 3HI9A 4QYZK 2ACYA 1T9WA 1NHKL 3Q83A 1C0UA 3DHWC 5D77A 1QAIA 1JLBB 8ATCB 4W90B 3HVWA 2GHPA 4ECUA 1BQMA 4HH0A 2V6AA 3PEHA 3IRXB 3NRBA 2OPRA 3OV7A 2NPIA 4WWSA 1RHKB 4WK3A 1FFWB 1WTBA 4O44A 2VV5A 1TZ0A 3TR5A 3BSCA 1CLFA 4OX9J 2EKYA 4DBQA 3F0NA 2J0QD 4ELUA 3HKZD 1TELA 2VPYB 1XR5A 5KFOA 3IMQJ 3QGPA 2Y9HA 4J9LA 3DDIA 5HQ8A 3THTA 2OMOA 3BPDA 1I94J 2V50A 3BN4A 5RUBA 2OHDA 3THVA 2VA2A 1LOUA 1TL3B 4Q8EA 1JLCB 4LSZB 1NUEA 4E0DA 2CQPA 4IDKA 1TKXB 4P7VA 4J37A 1TL4A 1IJEB 2HFUA 4E8UA 4OV6A 1UEKA 4FYVB 2BE7D 4DUYF 2XYHB 1IKVA 2Q6BA 2YKOA 1Q7YT 2R3VA 2MEWA 4A48A 2E5HA 4X62J 7FDRA 3V6KA 4NXMJ 4OFZA 2XB2D 2J0WA 4ZOSA 5KFXA 3G2XA 2BM0A 1W7WA 4U9RA 1WHWA 4RU9A 3KFWX 5J2PA 3H2VE 4ANCA 1WG1A 3RB4A 3UCUP 2UVWA 3RAQA 2XCAA 3C16A 2C2KB 1L3SA 1PC4A 2F9JA 2IA6A 2DHGA 3NG8A 2R8IA 3HDSA 4RBVA 2IHR1 1LWEA 1BMQB 2YBVA 1D8YA 1KEKA 3ITHA 2U2FA 2G4BA 1LWFA 1T8EA 1VQ5S 4GRSA 1WG4A 4O0NA 3HX9A 4DSJA 3SQGB 3KLEA 2Y8WA 1D9FA 3ETOA 3ELHA 1SKRA 4H4OB 4N7TA 1HBUB 1GMUA 2BOAA 4LF9J 1PILA 3C15A 4FPRA 4C97A 1C1BB 1G2EA 2W4PA 3KHGA 3FRYA 1VRTB 3H2LA 1HNWJ 3ZTSA 4A8MP 2E29A 3TYTA 1TKZB 4TU8A 2M7SA 1QY7A 3M7VA 4C8OA 2BRKA 2Y0SD 4RW7B 4ICLB 1FXDA 2RRBA 3MUMP 2IA0A 3H59A 2YKNA 2G0CA 4TU7A 2DPIA 3MPWA 2AU0A 1YG0A 1YJWS 1G4CA 3LUYA 3NGTA 1SC3B 1T7PA 3I5BA 4USIA 3FEYB 5KFJA 3IWXA 1UFLA 4P10A 1YDLA 2WW4A 3MECA 4ECZA 1U02A 2XZWA 1FRHA 1NDPA 1NK6A 3UR3C 3FFIB 1CSJA 5GAEU 3CT9A 1C0TB 4LRCA 4TYAA 5AXNA 1HQEA 2J76E 4DZ6A 4LFAJ 4ID8A 3T9ZA 3DLLQ 4LFCF 4N77A 3SZ2A 5K8MA 2IM0A 5F8HA 2ASLA 4ZHRA 4RUAA 3UVJB 2BRLA 3SMZA 3CEDA 3Q8RB 2DTJA 5G0RB 3L95X 4K4VA 3TUJC 5KFEA 4DPUA 2HQGA 2CZ4A 2R9LA 3R2DJ 3CCES 2DNGA 5GAHU 2VJVA 2B56A 4DPXA 2PA3A 2EPIA 2CNOB 2YQ1A 3HJFA 1NCLA 2IC3B 3HK2A 1S7IA 2YNHA 3MEDB 1FXRA 5B0AA 3BO2A 2P8IA 2D7SA 2IYIA 1Z1ZA 3TW0A 5CYQA 3US5A 4ID5A 3DNCA 2FVSA 1WOSA 2GIFA 1N33J 2XQCA 5AXKA 3HHKA 1VHIA 2JC0A 3IBFB 5T41A 4DQQA 2GO8A 1NMEB 3DLKB 1GXTA 1YLXA 3UD4P 4WFNQ 1VQPS 2UXBF 3V4IA 2B7BB 2ZH8A 2MJUA 3FZBA 1HNVB 3LALA 4DI6A 4EWTA 2COLA 3PCOB 1S0OA 1F5BA 2ZH9A 1OYDA 3QIPA 1HWUA 1U45A 2AYGA 1T95A 3PEJA 1TFWA 1UJ4A 3M32B 5HMWA 3DI6A 1JX4A 2XNQA 3DXBA 3SCKE 1SI9A 1S77D 2OPPB 1G6BA 1TKTA 1JJ4A 4JBCA 3EDQB 4ZP7A 1R6VA 4ZVEA 4ILMA 4WE1B 1NM2A 5D6GA 2G2ZA 1WC6A 2F8MA 1YHQS 1TUGB 4ZVGA 1ZAWA 1S1XB 5HLFA 3I0RA 4ZVOB 2P6TA 4ATNA 2MQ8A 2VQEJ 3W64A 4TYBA 2KT2A 1F6TA 4CH0S 3CD7A 4ERDA 3PW0A 4ZVRB 5KT2A 1L3VA 1IBLJ 1ZA1B 3GIRA 3P49B 5ITHA 2N4CA 2AZ1A 3BSOA 2XY5A 4I2PA 3LGHA 1RGVA 1KP6A 4HHJA 4F4AA 2AEJA 2F9DA 2LLZA 4O3SA 4R5PA 3B82A 5IOLA 4OZ3A 4DXLA 4LF5J 3B54A 4UUWA 4DV5F 1SIWB 1GMWA 1SL0A 4A4JA 1K0VA 3K7RA 3W2WA 2CA9A 1PKUA 1KFSA 2JLFA 3LP1B 4ECRA 2MXYA 1FERA 1JWWA 1NH7A 2ZVSA 4YY3F 1RT1B 4HVZA 1HWJA 2MKKA 3NWGA 5DS7A 4KHPJ 5C24B 3QGHA 4X4QA 1JLBA 2HURA 2HHPA 1U8WA 5K5MA 1VC6A 2K1RB 3TZXA 3T9NA 1C4AA 2NLWA 4U95A 2F4VF 3N79A 3CC2S 1F9EB 5L8RC 2RQCA 1V3ZA 5IC4B 3PJ9A 2MZTA 4RW6A 2OGUA 3BGFA 4CIOA 2FJVA 3JTNA 4HI1A 3AA8A 2LDYA 4PPZA 5B0GA 3R1HA 5EWGA 1HWLA 1UA1A 2J0XA 3DYAB 1FXLA 1S1UB 4M5JA 3ENWA 2BACA 2ZNYA 1TL3A 1JLCA 2XYPB 2UUCF 2WTFA 3R1LA 4D3HA 4WIQA 1TKXA 5LMUF 1S48A 3IBWA 2UUWA 1NJIT 2VC0A 1A7GE 3NGRA 2W2MP 2CQDA 2B4UA 4DR7J 3HM9A 4WIIA 2DNKA 2FYXA 4Z2XA 2RJZA 4DUZJ 3EZ5A 3A12A 1XMQF 3W60A 1IBMF 2RQ4A 1N0UA 4M5GA 3Q8QB 2XNRA 2GC8A 1RQ0A 4N5SA 2VHGA 3PYEA 2QX0A 4X64F 2KYXA 4KHRA 1I51B 2EK6A 3TA0A 1D3WA 1YX2A 3HP6A 3K8WA 2XI2A 2I1RA 1VYAA 3I4PA 2HMIB 1CEZA 3R9LA 1JXVA 4XAKA 1B7YB 5KT7A 2Z2MA 2CG4A 5HO4A 2KU7A 3MR3A 3A8KA 2IRXA 3QAUA 3P4UB 4DCJB 3V6JA 1VBKA 3AOCA 4MKAA 1RDRA 1H2UX 4OI0A 2JOQA 5F8LA 6AT1B 3SQGA 3F41A 2OFHX 3DRSB 1RP5A 4ZJOA 4C11B 2QLWA 3K5NA 1N5YB 2NSCA 4H4OA 1BD6A 1A6LA 1HBUA 2MLYA 3G8TA 1PYSB 3PIOQ 1NB2A 1UVNA 4FF3A 3ZZTA 1C1BA 3FVYA 5DZ6A 2FHJA 2BKNA 4DL5A 1JIHA 4PR6A 4C8KA 3CE8A 1B3TA 1VRTA 1N54B 1TKZA 1YWXA 3D6FB 3NNHA 3BBCA 4J9UE 3KOAA 3FBFA 4YB1P 3K5OA 4RW7A 4ICLA 3HCXA 2H9ZA 2HHWA 1WTFA 4OJ3A 4C98A 4Y2MA 3NGUA 5E41A 2MQLA 3HFVA 3VV2B 2M5YA 3MMBB 4LFBJ 2LEAA 2C2RA 1B0TA 1CPZA 2CNLB 2CJKA 4ZPWR 3OVBA 2WSEC 1FNOA 2VFRA 4OI2A 1VISA 1HQUB 2B43A 2R7SA 3FFIA 4I69A 1GXLA 3N0VA 4X2BA 1SC1B 4LR8A 3CCRS 1QUVA 2VUGA 5H1SV 4DWIA 4ED0A 1NK0A 1C0TA 5GAEI 1RAEB 1QAJA 1YRUA 3MPYA 5AE2A 1V3RA 3PDNA 1FKAF 3TOQA 4DX6A 2UXDF 4DV2F 2KJVA 1WC3A 3UVJA 2VICA 1UKUA 4EMDA 3KLIB 2HS0A 2CQ0A 5G0RA 4TLQA 5EUHA 1UEVA 2RDIA 2OH2A 4Q43A 4K0KF 3RAMA 2MY8A 1IUJA 1VMBA 1YBAA 3S8SA 2G1HA 2FLPA 3G6XA 5GAHI 1WUUA 2YWKA 1PYTA 1RWNB 4G65A 2IC3A 3MEDA 1B7FA 2YPZA 5KFPA 2ZJRQ 2F5GA 2W4DA 4PEOA 2HVHA 4UZBA 3BGRB 3G6VA 3LH2S 1J5EJ 3O3LA 3QNWB 2DGWA 5F8NA 2ZUGA 1RCXB 3NBPB 1IKXB 1LNQA 4PWWA 3KDNA 3CDEA 3VF0B 1PG5B 3DLKA 2G0JA 2YNIB 2R7RA 4RNOA 2WVEA 4LVNP 1EP4B 2CFXA 1UJ6A 2B6AB 5IC6B 3CJ4A 4DOZA 2B5JB 3MOZA 1PJ6A 4TY8B 1LK7A 2JEGA 1TL1B 1QSYA 1HNVA 2DHXA 5FIIA 3A3OB 4ZVHA 2ZH5A 3RRHA 2R4FA 2ZOGA 4USVA 3BREA 4C4WA 4NI2B 4JI5F 4DV0J 3GJTB 1XMBA 2FQQB 2ACMA 5LSRA 2XMUA 3M32A 3WX8A 1KBRA 5HVGA 2XTJP 3DRRB 4U67Q 4WFXA 2D1CA 2A1BA 2OPPA 2XSJB 2LEPA 3GIJA 1MLAA 4RLEA 4XPCA 1K1SA 4WE1A 3MD3A 5LJ3Y 1J27A 2NUUG 1GT8A 4IOCQ 4KGVB 2RF2B 1X5SA 2HQ3A 1N5TA 4OHZA 3IWNC 3ZFVA 1KQSR 1ZH5A 5AJ3J 5AE3A 3M2UB 1S1XA 4DPWA 2DK2A 4X66F 3QPIA 4PXDA 2IRYA 1QSSA 2GHWA 2F8EX 3PG9A 4KAIA 1RTZA 3W5YA 1R8CA 5GVQA 2XHCA 2Z2ZA 3EMTA 3CW2C 4MAKA 4B9NA 3CVKA 3UFCX 1HNIB 2EFQA 3Q23A 2XC9A 2BKOA 3LW5C 3OXLA 1PC5A 5HJXA 2OPQB 4ZVQB 1K9MT 5FLXY 5LT5A 3SIPB 5D78A 2MY7A 2KN4A 1HPZB 2EI5A 2W4CA 3AQOA 5D0EA 3LP1A 3JSBA 2PMHA 4MJKA 1SBRA 1IQTA 3ILIA 2XMMA 3J81Y 1RT1A 1X4EA 5F8MA 5E3AA 4OHYA 2J9DA 2YWFA 3S6EA 1SJ1A 5C24A 2DGUA 2LQ5A 2Z2YB 2JRSA 3CGIA 3HVTB 4CM0A 3UI3A 4IKAA 2KHDA 2N7YA 3GONA 2K1RA 2Y1IA 1RAOA 5I42A 4I7FB 4Q7AA 2AJ4A 3HHLB 1EARA 6FDRA 5E33A 2BM1A 2RUSA 4WKRA 1ZTWA 2E5LJ 4KQZA 1SJ4P 3NXZA 1TAQA 1QE1B 4K4UA 3OFHA 4N56A 1JK9B 1GTEA 1S99A 2C3YA 1EIYB 4AL6A 1N34F 1Y9OA 4BWJA 1S0MA 3LA0A 2QYCA 3DYAA 3G96A 1S1UA 2RNEA 4V19J 4USHA 2DR8A 2XS2A 1YTYA 3I96A 3W5XA 5GMKa 3GTYX 2BJEA 3W9JA 1MN9A 2Y0BB 2L9NA 4Q2LA 3H4BA 3AXKA 2GQ2A 4FN5A 2DO4A 3GB0A 3D0IE 4TU9A 2HBZB 4K4ZA 1HI1A 2LECA 4UY8T 2AV5A 2OD6A 2G13A 1F60B 2VBZA 3RW6A 3O1LA 1HIYA 1KFDA 4ZVFA 4JI7J 4RWWA 3T1HF 3RGIA 1JJ2R 4DV1F 4V1Ak 2J6TA 2QSFA 1OPIA 3M8RA 2CKWA 3E01A 2EC2A 4DF8A 3MAAB 3EDRB 2D41A 2MMYA 2QGFB 4JI0J 4W98A 2QZ8A 2HMIA 2KH9A 3D6MB 3I55S 5L9NA 2G0IA 1OQ6A 1WELA 3OTDA 3VAKA 3H5SA 4F8RA 2FJXA 3NLCA 3J7YU 1FA0A 5DQGA 1Q0NA 3OHAA 1WACA 3BB5A 4UY85 4FP9A 4P9SA 4C11A 2QSWA 1N5YA 1FHTA 4MK9A 1EKRA 5A6WA 1Y4ZB 1TR0A 3RRGA 1IN0A 4IUFA 2J6SA 2G9OA 1SPBP 5B09A 2V8DA 2FC9A 3NAHA 3ENQA 4LF4F 4GKJJ 2MHEA 1PAEX 4ED8A 4FDFA 2HNZB 1WEZA 3VHQA 4ZIVA 4OX7A 4CO0A 4PXCA 1Y11A 2N82B 2J9DE 4G3IA 2FZGB 1Q8IA 2DR5A 1EB0A 2HGNA 3Q0AA 1WF0A 4KH0B 2PIIA 1YI2S 1RTIB 2HHHJ 3MMBA 2YH1A 5DLFA 2JNJA 5HBMB 1WHXA 1V5VA 4MT1A 4K2XA 1K73T 2V68A 4BC9A 5CYMB 4FVCA 1HQUA 1VQ9S 2M9KA 4CLWA 2EG1A 2FPHX 1XQIA 1NDKA 1U1MA 2DHSA 2AF6A 1R8AA 3FCWA 2CPJA 4N8NA 2PMWA 1RWVB 2CUYA 1NH8A 4RR5A 2QEXS 2QA1A 4IRKA 3KLIA 4YOEA 1JLQB 1HNXJ 4O3OA 3VALA 4DV1J 5CYJA 1NPRA 4Y2KA 2IMOA 4ZLJA 1HW8A 2LP4A 5JVGQ 4PYAA 3M1VB 3W9HA 2CQ4A 4CLZA 1YRTA 1IR1A 5D15A 4F25A 4WU3A 3JS9A 4NLUA 3KMQA 3GPAA 2QT7A 1QSLA 5KFIA 2GO9A 5F9NA 4NZ0A 1X5OA 3MZIA 3BGRA 3EGNA 3N6MA 3OL6A 2RUGA 2PEHA 1R3NA 3FUYA 3FCVA 3NBPA 1IKXA 1JLEB 4JI1F 4DR1F 2CJYB 2YNIA 4F3MA 4CNYA 5FDLB 2YX4A 2ZHOA 1AA1B 1RAFB 4RUHA 1TV6B 2XMVA 1RT4B 1VLOA 3MTJA 5J2NB 2PD1A 4NMLA 1EP4A 1EZZB 1U48A 2GFFA 2B6AA 5GMEA 2B5JA 1RWOB 1TL1A 2AIRB 3GWCA 3IFEA 2R7XA 8RUCA 5KFWA 4LF2A 4NA2A 2B9WA 3K0JA 2VPXB 5KFZA 3PW5A 1N32F 4O3NA 1F5AA 4I67A 2RQKA 2AGPA 2W9AA 1UFKA 3KDOA 4DCOB 1H73A 4I4BA 2XSJA 5THWA 5D0GA 4KRWA 1VQNS 4DR4F 2B7CB 4WFYA 4C48A 3GFXA 3H8YA 3MR7A 2RF2A 2NQPA 4KBIA 5BR8F 3EM1A 3SI8A 1JQGA 1PCAA 2BKPA 4DSEA 3M2UA 1FX2A 2VFSA 1O5JA 4IG3B 3W5ZA 3TUZC 2BW2A 2GHVC 2AX0A 1D1UA 4F4XA 1YJ7A 2VBYA 3H5YA 5EX3A 3CO9A 3TI0A 3KTQA 4IRCA 3QRPA 4J9VA 4P2FA 1T9UA 2JDJA 4DR3J 4FNIA 1HNIA 2MDAA 5HN0A 1REGX 2JSXA 1LQ9A 4BC7A 1OY6A 1RTHB 3CCTA 1F9HA 1DTTB 4DSLA 4B3TJ 3H98A 3VAJA 1KD1T 2UUBJ 2OPQA 2D9OA 3BSNA 2LFVA 1WI6A 1NJZA 1NBEB 2R42A 5HP1B 3DLBA 1HPZA 2FJBB 2VBXA 4K5SA 3A8JA 3PY8A 4FYYB 2VG5A 5ETPA 2IBKA 4UW2A 2HZCA 1VIOA 1RA6A 4TQSA 1PIEA 1H2TZ 4DV4F 4DV6J 2XWXA 3CD6S 2FGOA 2ZUAA 1FDDA 2ZDOA 3HVTA 2GIRA 2FHKA 4QOTA 1XJWB 3QO9B 2XS7A 4JV0A 1SH3A 4DS4A 2UU9F 1TU0B 9RUBA 3BQ2A 1S9GB 4CLYA 1SQGA 3HHLA 4YP3A 2QG9B 1NPPA 4S0MA 4DCPB 1A9NB 3PW2A 1ZETA 1RHJB 5KG5A 2V67A 2ZWOA 3C6UB 3NS5A 3LPYA 2C3PA 4KC5A 4OYIA 4ECYA 3EZUA 1QE1A 1HARA 3D4JA 4C0OC 5KT4A 4FS1A 3PR4A 5KAKA 1XERA 2W7PA 3M8WA 4MYTA 3TJ8A 1S12A 4LQ9A 3UDVA 3BYPA 4B9VA 2AHOB 2F4FA 2E5JA 1HKAA 2DCUB 1X4CA 3CMES 5KFFA 1NSKL 2XLKA 2E1PA 2KZMA 2W1BA 2NCKL 2DT9A 2E9TA 4DV3F 4ILRA 2OO4A 3JSYA 1GMVA 4DQSA 2NXJA 1HR0F 4NA3A 1REVB 1MWQA 4M1KA 4V19X 3MMCB 3IG1B 2E9RX 2VZ9A 5SZTA 4TKTA 1NJWA 5HROB 1U25A 2VG7B 4HLBA 4E2FB 3MAAA 4O4GB 1C1CB 3PR5B 2LMIA 4WZQA 1U4BA 4JI4F 4O3RA 2NXUA 5EGYA 1WSRA 3A8IA 2B9EA 4L76A 4OYBA 4OZ2A 4AXJA 1R43A 4B3MJ 3P6YC 1UETA 4B9TA 4C2MA 3BS9A 2GCFA 4DR6J 3UD3P 4WKYA 2PMZD 4OJ1A 3AJDA 1C4CA 4P74A 3ICLA 2H54B 1L3KA 2L9WA 1O6XA 3T5HA 1CQNA 2V34A 2J7WA 4HHHA 3KJVB 2DRDA 3OUYB 1H2VZ 2DEIA 1EAYC 3KG1A 1X5PA 1FJEB 3J7AN 2MJNA 4DL7A 4GVLA 1RWXB 3QIDA 2FJWA 5ETMA 1QVGR 1DAXA 1HI0P 5B08A 1X9SA 2V2QA 4DV7J 2IJNA 2HNZA 3KNGA 5KFRA 4NRTA 3QBCA 2GJIA 3H4DA 5DG9A 1XIQA 3W8PA 2R7OA 3D0GE 3HHLC 2DNMA 1Q1KA 3N6LA 1X4DA 3MHYA 1NO8A 1KWMA 1YK9A 1RTIA 2KT3A 2WK4A 2CVEA 2GVDB 4ANDA 2DHHA 2UXCJ 5HBMA 3S1TA 1N52B 4ECVA 3L4BC 3KHRA 3H20A 2WAQD 2RU9A 2GJ2A 3DGPB 2XMJA 4WXWA 5CYMA 1PBAA 4M95A 2QFJA 4JV5F 1RACB 3H0PA 1WDDA 2XO6A 3TEGA 4UOGA 1FRMA 1Q7LB 2VKRA 3P45B 2IDLA 1MROB 3B6BA 1I3OB 1S76D 3W2VB 4H54A 1RADB 2PGCA 4QBUA 1XNQJ 1RU1A 3ONQA 2G2YA 2OEJA 5J1PA 1RHQB 3NNCA 1SJRA 2V63A 1C2PA 2HFNA 2QLJB 1JLAB 2ZM6F 1T0TV 2EXUA 1JLQA 3CJ2A 3MXHP 2ATLA 5KFDA 3M9MB 3KUGA 3PFEA 1AW0A 3GG0A 2IDEA 1WKKA 1UCNA 3FSIA 1NAQA 3PRDA 3FDSA 1TUWA 4PG8A 2VB6A 4F0MA 2IMWP 3MPDA 3M1VA 5K8OA 5HK4A 4RW8B 3T5KA 3MM9B 3G82B 1SB6A 4C8LA 3GV5B 3Q2TC 4P73A 3DLHA 4BDPA 3ZXWA 3QJLA 2R8HA 1JKHB 3ETMA 1U6ZA 3RB6A 3EPGA 2BZ2A 2KM8B 5FD1A 3EXYA 4PG4A 4AQYJ 5B0EA 4RU2A 2HQIA 3A8EA 1JLEA 4OHXA 1XMOF 2ZKTA 3NCQA 1MWYA 3UQSA 2MKCA 2H3EB 4GO5X 1YJNS 5FDLA 3OTOJ 4WCEQ 1U47A 3V5RA 2J8SA 4M5KA 3A3PB 1TV6A 1RT4A 5J2NA 5D4LA 4ZPDA 3BYRA 2LVWA 3EUNA 1RBLA 5C2CA 2D9PA 2GV1A 2DJWA 2HW3A 2DO0A 2AEMA 2GW8A 2MQPA 1NU4A 3FMWA 5C42B 5ETTA 3IM8A 1UVMA 4FXVA 3U27A 1TUVA 4DUTA 3GQCA 2NYHA 3WHIA 2JX2A 1WOOA 5T7LB 3ET6B 4ZLPA 2ROEA 3MM8B 1RISA 2AP6A 4F4KA 3TAPA 2XEXA 4JI2F 4F36A 1VOMA 1FO1A 3VAIA 4O3PA 1VBXA 1GX6A 2KXHA 4ZCKA 4CO3A 4G1IA 4DZDA 3CJKB 3LWLA 4J9MA 2OD4A 1PGZA 4HR2A 5AT1B 2ZFHA 1UWAA 5H9EK 8AT1B 1N36F 4WBFA 3W9IA 3HO1A 1M5OC 1CQMA 1KOHA 2R7UA 2OMLA 1K1QA 3CCUS 5LSOA 3KLFB 2RB7A 5J1NA 4XK8C 3CTRA 1U1KA 2O66A 2XLIA 2R8GA 1RTHA 2M8DB 4CTAB 2BW7A 1RWUA 1DTTA 2B9XA 5HI7A 3CIMA 1BY9A 3NCPA 3QSIA 2YVSA 2IM2A 3OL7A 2NXEA 5HP1A 4DSIA 1UPPA 4OMFG 2YPYA 4FYXB 4TXSA 5EWEA 4QU7A 1V3SA 3PJWA 4CLKA 3K2YA 4X4UA 2CRLA 3TA1A 1FRJA 1UWBB 2XGQA 1R27B 1P1LA 3I4HX 1P9YA 3KLHB 2D3O1 5CCMA 2AQ4A 3EPIA 4WP9A 3QO9A 1R31A 4CNZA 3BJYA 2X1BA 1XMOJ 2NZ4A 3RG6A 2V69A 3DLGB 2ZOFA 3C6UA 4TN2A 2JEFA 1NK4A 2JEIA 1VC5A 3P5TL 3MM6B 2GIQA 3ISZA 3HT0A 2KYZA 3KLGB 1R7IA 3MAHA 3GJQB 2C2DA 4DLEA 1NZ8A 2Z4PA 3JYTB 4GKKJ 1HD0A 5CZXA 2O1PA 2Z0GA 1QTMA 5B7WA 2MZQA 2BYCA 5A8RB 1GQEA 2HAFA 2E7VA 1FESA 2AJ1A 1CJTB 1KTVA 2RS2A 3VGUA 4I56A 5CABA 4JI2J 5BJRA 5LL6d 4I2QB 1U2RA 4JUZA 2ZOMA 3VVUA 2X1FA 1YIJS 1REVA 2A0FB 3DHXA 3CCWA 1FNMA 1T05B 4CO5A 2Z30B 1X8DA 2RAQA 3TQEA 3MMCA 3IG1A 2XO7A 4DPOA 2H65B 2DXEA 5HROA 2VG7A 4CI0B 3FQKA 4O4GA 1F3FA 3ZNUA 3KG4A 5U47A 1N0VC 3KUHA 1HA1A 4F4ZA 4TVAB 4P52A 4YR2A 2YWHA 5KG2A 4ZJQA 4RKUC 1RB0A 1S79A 4LF7F 3TAMB 1WDTA 4CLSA 4JI6J 1MMLA 3R5AA 3DN9A 4CWBA 4K4YA 3M4XA 1RHMB 4AE5A 4RNFA 3DRXA 2R7TA 2A2DA 1E6VB 1JJCB 3KJVA 3OUYA 4YDXA 5B0DA 1O0PA 2C3UA 2ZVIA 3UNGC 3MD1A 2BVZA 2R7WA 3IWLA 1M1KT 1FI4A 2M52A 3AA9A 4YDDB 3TZYA 1X9WA 1WOPA 3OXGA 2AJ0A 4FKXA 5ETNA 4MKBA 1TL7B 2CADA 3CIZA 3PKYA 1VQ8S 2KVIA 5KFTA 3Q24A 2FVRA 1ITPA 5KTQA 1FRLA 1ZBTA 1TVRB 4KO0B 1Z2ZA 1HYSB 3CCMS 4I6WA 1KVJA 4ZITA 2K06A 2YWWA 3VGSA 1KQFB 1YJ9S 1NJXA 2V0NA 2GVDA 1RJJA 1H3DA 2QL9B 1N56A 1X5TA 2L48A 4IO1A 3SEOA 1HNZF 1WD6A 3PRVA 2L41A 2KRRA 4OIXA 3DGPA 2OTLS 1RAJA 1HBMB 3N5FA 2ZBQA 2H51B 3UCGA 2ZH3A 3AODA 2NREA 3DC2A 3KKFA 5DZ7A 2ADCA 3CCLS 1MROA 2QLXA 1RXOB 3W2VA 4WPAA 4CCHA 2YH0A 4J91A 4B17A 5T14A 1FNXH 3HSZA 1SV5B 2HZVA 2POKA 1BWVA 2BQ3A 2QV6A 4USUA 3DU6A 1RTJB 3ADAC 4A8XA 1U0HB 4FZVA 2H48B 1FCAA 5DGAA 4NLYA 4DU8A 3R6LB 2ZH2A 5JVHQ 2Z57B 1CULB 2FZCB 3Q8VA 4LIWA 4RW8A 2R2SA 3MM9A 3G82A 3SV4A 4KGMA 2E9ZA 2ZD1B 3G87A 5IT0A 2XZTB 2XSFA 1LXNA 4B3SJ 1M0SA 2R2RA 3RW7A 2XMTA 1HQ2A 1JKHA 3G9CA 2HWHA 4LF8J 4KKOB 4HDHA 4KFBB 4ZVSB 1XR6A 4A8FA 1MW7A 1RT7B 3M6UA 3OBIA 5AXLA 4O23A 2PI5A 3DXSX 2B4PA 1KSPA 1UL3A 4WTYA 2L3MA 2P6SA 3QLHB 3PM9A 4GVBB 5DDOC 4NZ6A 3FJ2A 2WCXA 1S59A 2WRMA 3CCVS 2Y1RI 1LW2B 2HHSA 1GFWB 2KHCA 4Y65A 3O5TB 3PIPQ 4NLOA 3H40A 3WC2A 4MIBA 4U7UK 1S1TB 3PHTA 1LFWA 1PAUB 5C42A 5EWFA 4LF6F 4BBYA 2RRAA 3W1YC 4LRFA 1B0PA 3UDCA 2ZC3A 4QIVA 1N48A 3LOUA 4B08A 1TK5A 5T7LA 2J9CA 3ET6A 1ULRA 2RILA 5E2QA 1I5OB 3MM8A 1U2FA 2RH3A 3DKDA 3VQSA 1FE4A 1UPMB 4LR9A 4ZP9A 3L9ZA 1MWZA 3CJKA 3IBCB 2B9YA 2BUNA 1VQLS 3CF5Q 4ZPBA 4QZVB 4LRBA 2C3OA 2IJFA 3WIVA 4BLGA 1DLOB 2HZAA 3ILJA 1E6YB 4AXIA 5IM0B 3T19A 1RK8A 3UCZP 2ZBRA 2QMUB 3DRPB 1Y10A 4DR2F 4B3RF 2N4DA 4DF4A 1NK7A 1WF2A 3W7BA 4LR7A 4CTAA 2AD9A 4X4OA 1HD1A 3I56S 3R2CJ 2VG6B 1KLMB 2Y8YA 2MLXA 3I9V9 2V2VA 2YWEA 3G8QA 2BA9A 4EZ9A 2CJAA 2DIVA 4RPFA 2VOPA 4R8UB 5JMNA 4XIUA 2VQFF 3GCWP 2DGQA 3TZZA 4YMEA 3HZGA 3JB9k 3MM7B 2HHUA 2CJ9A 2CQBA 2C22A 4JI8J 3AQPA 4CRJA 3CUNA 1UWBA 1NHUA 3PACA 1S6QB 1XWLA 3L7PA 3KLHA 4IQMA 3TUIC 2KM8C 1ZS6A 3KK3B 3DLGA 3JQKA 3N28A 4EYHB 1KKHA 3LP2B 4CO2A 1KVIA 1H98A 2F1FA 2V2ZA 5L1JA 2WB1D 4H4MB 5D4PA 1U09A 1UAWA 3ZNJ1 3C14B 3NWRA 3D54A 5FLXU 3FK4A 3MM6A 1TP7A 2OI2A 2H5EA 1T03B 3EWGA 3KLGA 3V6DB 3R97A 3GFYA 2ASJA 3ZZPA 3MR2A 2LQ8A 3JYTA 3AD9C 1VJWA 3J81U 1FE0A 5A8RA 2CPIA 3MFHA 2WW8A 1BQNB 5DG8A 3GV8B 1CJTA 2A3JA 2ASYA 2GAGC 3K8VA 4YB5A 3CCZA 3K5LA 1N5QA 4I2QA 1ACMB 3AJ1A 2HHQA 1H72C 1OS5A 2BJ3A 3QMQA 1Q8BA 2XHWA 3UN5A 1T05A 2V8HA 4QIEA 4ZP6A 2X7IA 5LXRA 2UUTA 3FEXB 2AX1A 4ZK7M 3T6BA 3ULHA 3D0HE 1VQ4S 4EUVA 1LXJA 1VQYA 2HRTA 3W61A 2ROPA 3MMAB 5LMNF 3AH6A 2QJ3A 4HTJA 1VR6A 4DUYJ 5AXMA 2KZZA 7FD1A 2FJDB 1IQZA 3TAMA 4B9MA 2V8VA 3ZTQA 3F44A 2HKEA 3TP2A 3MTKA 4Y3CA 2VC1A 4N76A 1SKSA 1KDNA 2KTQA 2W9BB 5IFMA 3K57A 2MYFA 2DGOA 1RAGB 1E6VA 3X3UA 3WZ0A 2AW0A 3RUBL 1WNEA 1U1LA 1KRPA 4Z7YA 1OIAA 2VDHA 4IOAQ 2JFKA 1FDAA 1TL7A 4PCQA 1FKPB 4M63A 2Z8QA 1D09B 1UA0A 2HSEB 1RT2B 2W9CB 1TVRA 4WP8A 4O0IA 3PV8A 1HYSA 3LAKA 2IFXA 3KMSA 5J2QA 4C7QA 4YHHF 2IVMA 4DR5F 1P6TA 2NXCA 5DETA 2HIYA 4NEYA 2A10A 2JLEA 1NKEA 1FVQA 2F63A 3KG0A 3TO8A 5GADI 1P27B 5BYRA 2NYIA 2EBGA 2Y1JA 3KK2B 4CO4A 5KFMA 4LSNB 3KHHA 4J9RA 3M2VB 3CPWR 1HBOB 1KNZA 4P2SA 2CQGA 1HBMA 2DRAA 1OSDA 5L39A 5H9EJ 1J5OB 2YNGB 3H90A 1JNRB 2YKMB 2DNZA 3HHDA 4PG6A 3MWBA 2HBQB 1LW0B 3BDEA 3VZHA 2HYIB 4NYZA 4ZCIA 1MN7A 2CJQA 1FJGF 4XO0A 2LQJA 2E1MC 4PYDA 2Z2LA 1G7CB 3TEHB 4P71A 1SV5A 4QW9A 2WSCC 4J7CA 3POTB 5F0WA 1B4SA 4L75A 1RTJA 4ZPVR 2ZZTA 4K2JA 3VCDA 2DCLA 6FD1A 4J9SA 2WHOA 4L74A 2OSRA 2AEFA 2AT1B 1QJHA 4P75A 1CULA 1XNRF 3NMRA 4OQJA 3NEKA 4RBTA 2V5HG 4WFZA 3OQ2A 4Z37A 2ZD1A 1KVKA 4ZCMA 4IFYB 4LFCJ 5F41A 3D6TB 3FBBA 4OZ0A 5ETVA 2HNYB 3Q89A 4KKOA 1KQGB 4KFBA 4NXNF 4NLVA 1RT7A 2IJRA 2H5IB 2MQOA 3T5LA 2K7KA 2EFOA 3QLHA 1DHMA 4GVBA 4IR1A 4CO1A 4C8ZA 3FEZA 5M2PA 3JQJA 3CJRA 5KFNA 3HHLD 2LU2A 5EX0A 1LW2A 5LXYA 2OEKA 1IWAA 3SFGA 2V4RA 3D66A 4P2XA 2OJ3A 1S1TA 1R89A 1SL1A 3R6GB 3M8SA 4DN0A 1QDUB 2PI4A 3R27A 3S01A 1NXIA 1R8HA 5D4NA 2FY8A 4UQGA 1Z2LA 3IRXA 2NS1B 2JFDA 1VIXA 4IOBA 4KGZB 4NPOA 2IY5B 4CLTA 3OVAA 4ZDNA 1CJVB 2M4MA 1YSJA 1FK9B 5AE1A 3H5UA 3VTIA 2XYGB 2UVRA 5J2MB 2UXBJ 3V6HA 2RMLA 1T3NA 5KFUA 3C6TB 4EO6A 2I0XA 1NNDA 2OTJS 1FTCA 4CLFA 2DB1A 4K7QA 4XDCA 2XI3A 1RI7A 3D1QA 4KPYA 3PO5A 1FRKA 4UTGA 5M2RA 2RHQB 1DLOA 4I68A 5IM0A 2PC6A 4IFVB 1G3OA 1GTHA 3EXCX 3CC7S 3DRPA 3CDBA 4YUDA 3F56A 1S49A 1H38A 5E7OB 1NPKA 3NGSA 1LWFB 2EFGA 2UUAF 1IBKF 3BDPA 3ZTPA 3KLEB 3MEGB 1KLMA 3D7SB 9ATCB 2OFGX 1UVJA 4OI1A 4R8UA 2EFPA 2Q6CA 3MM7A 4URSA 2H5JB 1R6YA 1FX4A 4CDIA 2DNOA 4ANEA 2H4YB 1VK8A 4ES2A 1QM9A 4NOHA 4UUXA 1S6QA 3I31A 4DHVA 3Q8PB 4WP3A 1NZAA 4ES3A 3IGVA 4WK1A 3L09A 5CZVA 3MDFA 4XTTA 4DV5J 4X65F 3LP2A 5BYQA 3QRRA 3ILOA 1RCOB 4FF2A 2AKWB 3Q86A 4H4MA 3BQ1A 2UV8G 3LF0A 4ED7A 3VAGA 3VAMA 3C14A 3HULA 4YY3J 3UWTA 3WDOA 2Q1LA 2J0SD 1T03A 2Q66A 5D0RA 3V6DA 1Q79A 1YRXA 2LCWA 2KDOA 1HHTP 2V4QA 2RU3A 3PW4A 2CG8A 1UP1A 4CLPA 4ALZA 1Q86T 4ZMMA 2MKIA 4NLXA 3O2IA 1MU2B 1VQSA 4O4RA 1BQNA 2F4VJ 4WJBA 1YVFA 2SXLA 4ED6A 4QWAA 1BLUA 3BPSP 4CLUA 2KJWA 2BBEA 3PKMA 3PYDA 2VD3A 3I5AA 1KHWA 2AYEA 2XULA 4QPTA 1ZTTA 4F67A 3IP0A 2UVVA 2FTRA 3BGUA 5I3PA 2GQQA 2RT3A 2MKYA 3K5PA 2KFNA 1SC4B 4USTA 2FGCA 2UUCJ 2RKIB 4F4YA 4Y00A 1CC7A 4ETZA 2E7WA 2W25A 5LMUJ 1DJ0A 1M5VC 4EBCA 1X9MA 3MMAA 3R8YA 1Y5LB 5KFKA 2CJBA 1S1WB 4MH8A 2X51A 3MPUB 4OYAA 1XMQJ 1IBMJ 2W9BA 1WKJA 3W63A 2PN6A 3GIIA 3M8ZA 3ZO7A 4Q8FA 4KJIA 5HSPA 3HMJG 2FIUA 4X64J 5K9FA 1TTHB 5HJYA 1JJHA 2BABA 4CP5A 1W26A 4DLGA 3EICA 2DRBA 3HLUA 1DQ9A 3RB0A 3T1AA 1T9XA 2MPUA 1WEXA 3CWJA 3ZZOA 4E98A 1I94F 3CJQA 3G4SS 1FKPA 4WFBQ 2GVZB 4NRUA 5CD4H 2APOA 4KGXB 1RT2A 4AYBD 1I1GA 2W9CA 2ZHBA 1CVJA 4GMKA 4NASA 3FNNA 3DMJB 3PO4A 5H9FJ 1V9OA 3LTOA 2A6MA 1LFPA 2FLNA 5LM7E 2R8JA 1BHNA 3H7HB 1AB8A 3NCRA 1M5SA 1F9FA 3GG1A 3UD5A 1VRUB 3J80U 4DPTA 5ETKA 2HK2A 4X62F 3KK2A 4NXMF 3EVMA 4DL2A 5C7PA 4LSNA 3M6XA 3AT1B 3M2VA 1HBOA 1S1VB 3QGIA 2HVZA 3D3BJ 2ZHAA 1J5OA 4KSEB 2YNGA 4R0EA 1NK8A 2YKMA 4ZCLA 1MNEA 3MUTP 2ZNZA 4U6PA 2HHXA 3GP9A 1LW0A 4I2PB 2CQIA 1AFJA 2HAIA 4UF4A 5DQIA 4PAAA 4RUCA 2CPYA 3POTA 2OKQA 4ED5A 1XR7A 3SSSA 4Q45A 4GO7X 5BXIA 1OSCA 2MLZA 4C3KA 2QMWA 3GV7B 2RDDA 1S9EB 4IH5A 1SKUB 2M0GB 2E1CA 3TRGA 1DFDA 2BJ8A 4LF9F 1S72S 2EW9A 2MHNA 2DBBA 3CSKA 2KVQE 4KTQA 3UN3A 2YQ0A 3ZZ0A 3JQMA 5JJBA 4IFYA 3HXMA 1HNWF 1NEEA 2NSBA 2UXDJ 4K4XA 4DV2J 4OX6A 3V4MA 2B4OA 1NK9A 5MLCV 4MYUA 2HNYA 3QT8A 3FSYA 1FTRA 4QWCA 5DG7A 3VAHA 3ZC4A 4LBHA 4K0KJ 2MSSA 4NYPA 3KJNB 4RW6B 3LO3A 1SKWA 3CULA 4RO0A 4BCAA 1WC4A 2E5IA 2J8AA 4N8OA 3I6PA 2E44A 2X3DA 1ZA2B 3CNQP 5IV4A 2BDPA 1FDBA 1YZ7A 3O44A 2VBWA 4F50A 3MM5B 4RZRA 2ZKUA 2W7AA 4MKYA 3T1YF 1VBYA 5HQLA 3S7RA 5DGBA 1X4AA 2HQCA 2VONA 3OTBA 4ZLLA 4U96A 3F73A 4LFAF 1FF2A 2ZH4A 4QR1A 5KFSA 4QWBA 1CJVA 2OP5A 1FK9A 2MKHA 3R5GA 3NMAA 2QRRA 5J2MA 3C6TA 1HI8A 2PA8D 2C1EB 1PBUA 2C2EA 3CB4A 4M5NA 5B0FA 5CH7B 2YKQA 2M3DA 2L08A 4OHWA 2ILYA 2ZZNA 3MEEB 5KFYA 1W2IA 2DH9A 2PO4A 5A2QU 5DO2A 2B8QA 5GAGI 4KPCA 4JI5J 3B4DA 4IFVA 4IR9A 2F40A 4HTIA 2J9EA 2MSTA 2HLTA 5ETOA 1SCJB 3HPOA 4CLLA 1N33F 3SSQA 1U26A 4I0WA 2W2NP 4JV2A 1WC1A 3PZPA 4HT5A 1SQFA 2C2OB 3MEGA 2HEKA 4ECTA 2FJAB 3ENAA 4QR2A 3PTWA 4X66J 4N47A 1X4GA 2I6WA 3VGTA 3KK1B 2VF3A 5DJBA 4TNOA 2OAUA 3C3LA 3C19A 4L3NA 5HVHA 2ILZA 1WC5A 2ALZA 1H6KX 2HHTA 5KFQA 4ECSA 3OVSA 4YEAA 2ZH7A 1APSA 3AAWB 4TLRA 1ICEB 3HF5A 3SYZA 1GNKA 3THPA 2WVCA 2M88A 4HKQA 3NOGA 3PJXA 5E5NA 2ROGA 1QVFR 1DRZA 1XN9A 3E3XA 1SIZA 2KL8A 2KG1A 2LEBA 3RJMB 3DRSA 1KLNA 2BV3A 5ADZA 3R5BA 2BEFA 3GLJA 4LJMA 3T1YJ 5L1LA 4KHMA 1JMTA 4YS2A 4ZKAA 3IO1A 2VQEF 3LPEA 2CIMA 4KE5A 3P8BB 3MFIA 1NDLA 2HG4A 4KY3A 4WF9Q 1ZYQA 1IBLF 2C28A 1YBTA 1MU2A 5B0CA 1FT8A 4AL7A 2N7CA 4J9QA 3J7A1 3AFGA 3PW7A 1NDCA 3C2PA 3D2WA 1RA7A 2K7JA 1N34J 2XM3A 4LF5F 2O3DA 1WORA 4A8SA 4PUOB 3BR9A 2HRUA 4FBUA 1YJTA 2MZ1A 5E3CA 3QFHA 2XCPA 3KYLA 2X1GA 2ZDPA 3T41A 2RKIA 1Q4RA 3VAFA 3CD5A 5J1EB 4ELVA 1Q5VA 4KHPF 3NOCA 2HQDA 1HW9A 1AFIA 3EZOA 1S1WA 2YY3A 3DM2B 2M70A 2BMBA 2JVOA 2C42A 1PSDA 2Y3YA 1KS2A 5CHCB 1YQHA 5DLGA 3T1HJ 1N5SA 3V2UC 4ZVTB 2HBRB 5IS2A 1FFGB 2WBMA 1BXNA 3VZIA 4FNHA 2XG8A 2QL7B 3EVOA 2Q3PA 3DCAA 4Q2MA 4I6YA 2BOPA 3CJ3A 3CCSS 1VS3A 2PEBA 3LGMA 3TNVA 3CJTA 1RABB 2MQMA 2XS5A 3AJ2A 2GVZA 1UVIA 2BE2B 4WXOA 1RLCL 4LREA 1TK8A 2BXJA 4M5HA 3M6WA 2JC1A 3DMJA 4L6V3 2IVFB 3GSIA 4USMA 2V8PA 1DY3A 5IQ6A 3BN7A 2I8EA 4F4WA 2HFSA 4C8NA 2UVUA 1Z4UA 4DR7F 3O6QA 3CMQA 3AXMA 3E8OA 2DYAA 5A8WB 2RHSB 1PYOB 1L3UA 1DARA 3UPFA 4DUZF 4Y0FA 1WHVA 1VRUA 1RHRB 4MKVA 1S7HA 4LF4J 3EGZA 1OO0B 1S1VA 1VI7A 1I6JA 1OYEA 3CJ5A 2XLJA 4TY8A 1DTQB 2LQ9A 3TX0A 3CD0A 3SXLA 2EWHA 5CXTA 3W8GA 4RBUA 1URNA 1RE1B 4NI2A 1X0FA 2KXNB 4K50A 1X0PA 1VHFA 3EJMA 2ATCB 2WONB 1NSAA 3DRRA 1VRQC 3RBXA 2CXEA 4B9LA 4PWDB 1CS4B 2DPJA 2GJFA 2FD2A 5KOWA 3BF4A 1RWMB 3OR1B 7AT1B 4DU7A 2FDNA 5DDRC 4CYUB 1LK5A 2AJ2A 1S9EA 1QLNA 1D9AA 1Y0HA 3W62A 4QQBA 3OL8A 1N8RT 3JAMY 5L46A 1UMJA 5IT9U 1RYRA 3NNAA 1BQXA 2CAJA 4NLWA 2FZKB 3HJVA 5I42B 2CQCA 5KFBA 2EBEA 5E3RA 3FQLA 4JYAF 1M5HA 3MCMA 3GFHA 4FVMA 1Q8KA 3O8WA 2HHVA 4NLSA 4IH7A 1Q16B 2YTCA 3D68A 2OELA 3HSGA 1T9TA 4O3QA 3QYYA 4Z7CA 1Q82T 4LFBF 1QUPA 4EO8A 4NLDA 4NZ7A 2B3TB 4YR0A 1IXKA 3I9ZA 2MGZB 1AT1B 4OYMA 1RKJA 4CM2A 3PX4A 2K3IA 3JSRA 3GYGA 3DRYA 2FY1A 3MM5A 1L3TA 1VBZA 3A13A 4LT6A 2Q43A 4B9SA 1R0AB 1OPZA 2VIHA 3C8YA 4PG7A 4JI1J 4I7FA 1H7XA 3JTOA 4DR1J 1MMDA 1WHYA 4ZP8A 4DJBA 2OPSB 4IO9Q 1NLKL 3P3DA 1N88A 2IIHA 2BQRA 5LSLA 2DGXA 2BX6A 3E01B 2LU1A 3MEEA 1LWCB 2YQ3A 4LRAA 4NE9C 3RRKA 2UV8A 4ETXA 4OYZA 4PG5A 3HVRA 3M8YA 1K8AT 4HH1A 1N32J 1LKZA 5KOXA 5CA5A 1MMNA 5A76A 4MK8A 2CWXA 3P96A 2GQCA 5F8IA 1PO6A 1EJ7L 3GILA 2WB4A 4ZIWA 1V6HA 3BKUA 3LP0B 4U7CA 4DR4J 2QLFB 1J5EF 3PNIA 4DX7A 4RNNA 3IR5B 5BR8J 2F65A 4A8KA 1RT3B 3VWSA 2CDQA 3KWMA 5ETQA 4EYIB 3KK1A 2HGMA 3DU5A 4EU0A 4B02A 1YJVA 4ZPAA 2DNYA 3QWUA 1GH8A 3QATA 2R2TA 3BKTA 2X3GA 3MEKA 2KO1A 2V9KA 2A2CA 2VFVA 2FLOA 1NKBA 4MTPA 1IKYB 4R25A 2AGOA 2HPUA 4JYAJ 1LEOA 4DL3A 2LXFA 2IRUA 1RT5B 5DM7Q 1VK3A 3IXQA 4DV0F 2GX8A 3TARA 5CAAA 3WQPA 5HL7Q 2BR0A 2EFNA 1A0OB 3NS6A 3UDLA 2AZ3A 5HANA 3ISNC 3K58A 1F5CA 3KJFB 3CDAA 4DPYA 1K0TA 2VFUA 1UFWA 1YITS 4IQXA 4FPIA 4DV4J 2EG2A 4YFUA 4BS2A 3IC1A 3GSDA 2HS4A 5AJ3F 4DG1B 1VQ6S 5IZHA 1RBOB 3FGVA 4RWXA 4OZNA 2DITA 2J7UA 1KR4A 4WZMA 2JH3A 2UU9J 1RYSA 5EHHA 4BHQA 2MTLA 1OY9A 4FF4A 2HS3A 4HYKA 5HMYA 2QN6B 4F3OA 4U8VA 4K4TA 3ZTRA 4F0HA 1H74A 3QGGA 3HD2A 5KT3A 2UP1A 1NSQA 4PWUA 1F2HA 2H4WB 3B4MA 4PUOA 5D3GB 1AUSL 1GX5A 1U7LA 4QYZJ 2GS8A 2FHOB 2E7XA 4DFJA 3SSRA 4EBDA 3SFUA 2HWIA 4C8YA 2HGLA 2ZE2B 5J1EA 4OLOA 3U1MA 2DIUA 2O67A 4DFMA 4DV3J 3D3CJ 2C2NA 2ASDA 2CPHA 3K5MA 2NR0A 4HDGA 1F3VA 2HLUA 4L72B 2KKHA 3DM2A 1HR0J 2RVJA 3I32A 3LQVA 1CBKA 4EGLA 1U6BA 1N5VA 3G6YA 1HL6A 5ETRA 1R0BG 2KXFA 2YXLA 1OWXA 3OL9A 4OI4A 2E5LF 2E5GA 3QZ8A 3NP5A 2C3MA 3MURP 3MAQA 5C25B 4RJVA 1CC8A 1GAOA 1SH0A 2R8KA 4JI4J 2AJFE 1S57A 1GMWD 3OSPA 3CCQS 4Y34A 2JL9A 3FZ2A 2EVZA 3M8QB 1WSVA 5HATA 2MQQA 1U0SA 2VODA 2BE2A 4WFAQ 4ENOA 4YB7A 5MAOA 2AYMA 1F2GA 2HVEA 4D3GA 1HBNB 1URRA 2QE5A 3HFZB 2AJQA 4LBIA 3OD2A 4ZVUB 2MKJA 1U1NA 3RBEA 2VPZB 3H2UB 1FJ7A 2DNQA 5A8WA 2BE9B 2ABYA 1U49A 1H7WA 4PQUB 2CPDA 1ZAVA 3RB3A 4ELTA 1NK5A 3IA0A 1B70B 5A8KB 4WU2A 4ZS6A 4JI7F 3Q8SB 3MR5A 1DTQA 2I5JB 2EKNA 2LA4A 4DX5A 3R7BB 2CQ1A 1AYEA 3K89A 4DMZA 4JI3F 3LANA 3ZZZA 1DURA 1UJ5A 4JI0F 2JZ5A 1S6UA 1S4FA 4NLQA 1IKWB 5M2UA 3QJJA 1K47A 1LV5A 3FBCA 1VDHA 2WONA 2I9SA 4DSKA 3OHBA 1ZM9A 2RE1A 4PWDA 1CS4A 4HACB 2IYGA 3OW2R 4Q0BB 4NCGB 3OR1A 3OR2B 3NGDA 2WVDA 3E51A 4MIAA 2DNNA 2K3KA 4CYUA 5F9LA 3RR7A 1KOOA 1S5ZA 4A8YA 3BBFA 2CJXB 4DQPA 2VG5B 4FXDA 4A47A 4JV5J 3T3FA 4HL9A 4QIWD 2R7VA 4IG3A 2IM1A 1KQKA 1KHVA 1ZPWX 4BWMA 2DKOB 2ZZMA 3C66A 4GKJF 4FXWA 4W4MA 5D8HB 3FSXA 1RAHB 3SCIE 1RT6B 1SJ3P 4OYWA 1FRIA 4OZJA 3IGNA 2BQUA 2ZM6J 5DQHA 3BEGB 4FYWB 3ILLA 4M5LA 1U6FA 4ES1A 3RTVA 4DS5A 5EN1A 3QT5A 2HHHF 5KFGA 1RUSA 1UTAA 2VL1A 1S9FA 1EQ0A 2MGZA 2JHEA 2W24A 3RBDA 3ZZUA 4Q44A 4TQRA 4A8WA 4NCAA 1PJ7A 3GYXB 2RSQA 1QAYA 2O5DA 4LBPA 1Q78A 4QR0A 3W66A 4A46A 1R8BA 4OYOA 2FHJD 2C2MB 2HQFA 4MFBB 2ZEJA 1R0AA 4ZN1A 3NAIA 5I4MA 1S9GA 4B9UA 2KG0A 3CMAS 3TVKA 1Y3JA 4GC7A 3GMGA 4QWDA 2C2ZB 3GIMA 4DFPA 4ECQA 2OPSA 1ELOA 1FD8A 1HNXF 1FD2A 3TWZA 4Y6IA 4ZJLA 3R5CA 2ZC4A 1LWCA 3MOJB 1FWPA 4JI3J 2RQMA 1M5PC 2JJ4D 2YX7A 3H5XA 1AZSB 5SUHA 3AOAA 4K4SA 1VJQA 2V8GA 3IR7B 4NCBA 2F8HA 2L9DA 3LP0A 4OYXA 2QIFA
chains in the Genus database with same CATH topology
5LMNJ 4DR2J 4B3RJ 4DR3J 4OX9J 4GKJJ 3R2DJ 1N32J 1J5EJ 5AJ3J 4B3MJ 3J80U 4JV5J 2UXDJ 2UXCJ 1HNXJ 4DV2J 4JI7J 4JI2J 4PWWA 1XMQJ 4DV1J 1N36J 4V1Ak 1IBMJ 4B3TJ 1N34J 3IMQJ 1XNRJ 2UUBJ 4DV3J 4DR6J 4LF6J 3D3BJ 3D3CJ 4DV4J 1I94J 3JAMU 4DR4J 4NEYA 4DR7J 4K0KJ 5IWAJ 2E5LJ 4HHUA 5FLXU 4KHPJ 4AQYJ 5A2QU 4DUYJ 2F4VJ 1N33J 4NXNJ 4X64J 2VQFJ 4JI0J 2HHHJ 1HR0J 4JI5J 5BR8J 4DUZJ 4LFCJ 1XMOJ 2UXBJ 4LF7J 2ZM6J 4X65J 2MQ8A 2VQEJ 2KL8A 3R2CJ 2UU9J 4JI1J 1XNQJ 4DR1J 3W1YC 3OTOJ 3J7AN 1HNZJ 2MTLA 1FJGJ 3J81U 4DV6J 4JI3J 5IT9U 4LF9J 1IBLJ 4DV0J 4LFAJ 4RJVA 4DV7J 4JI4J 3T1YJ 4DV5J 4LF4J 2UUCJ 4LFBJ 4NEZA 1HNWJ 4B3SJ 4JI6J 2MEWA 4JI8J 2UUAJ 1IBKJ 4X62J 4NXMJ 5LMUJ 4X66J 4JYAJ 4KY3A 3T1HJ 5LM7E 4LF8J 4GKKJ 4YHHJ 2KVQE 4YY3J 4LF5J 4DR5J 4KYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMN J;  4DR2 J;  4B3R J;  4DR3 J;  4OX9 J;  4GKJ J;  3R2D J;  1N32 J;  1J5E J;  5AJ3 J;  4B3M J;  3J80 U;  4JV5 J;  2UXD J;  2UXC J;  1HNX J;  4DV2 J;  4JI7 J;  4JI2 J;  4PWW A;  1XMQ J;  4DV1 J;  1N36 J;  4V1A k;  1IBM J;  4B3T J;  1N34 J;  3IMQ J;  1XNR J;  2UUB J;  4DV3 J;  4DR6 J;  4LF6 J;  3D3B J;  3D3C J;  4DV4 J;  1I94 J;  3JAM U;  4DR4 J;  4NEY A;  4DR7 J;  4K0K J;  5IWA J;  2E5L J;  4HHU A;  5FLX U;  4KHP J;  4AQY J;  5A2Q U;  4DUY J;  2F4V J;  1N33 J;  4NXN J;  4X64 J;  2VQF J;  4JI0 J;  2HHH J;  1HR0 J;  4JI5 J;  5BR8 J;  4DUZ J;  4LFC J;  1XMO J;  2UXB J;  4LF7 J;  2ZM6 J;  4X65 J;  2MQ8 A;  2VQE J;  2KL8 A;  3R2C J;  2UU9 J;  4JI1 J;  1XNQ J;  4DR1 J;  3W1Y C;  3OTO J;  3J7A N;  1HNZ J;  2MTL A;  1FJG J;  3J81 U;  4DV6 J;  4JI3 J;  5IT9 U;  4LF9 J;  1IBL J;  4DV0 J;  4LFA J;  4RJV A;  4DV7 J;  4JI4 J;  3T1Y J;  4DV5 J;  4LF4 J;  2UUC J;  4LFB J;  4NEZ A;  1HNW J;  4B3S J;  4JI6 J;  2MEW A;  4JI8 J;  2UUA J;  1IBK J;  4X62 J;  4NXM J;  5LMU J;  4X66 J;  4JYA J;  4KY3 A;  3T1H J;  5LM7 E;  4LF8 J;  4GKK J;  4YHH J;  2KVQ E;  4YY3 J;  4LF5 J;  4DR5 J;  4KYZ A; 
#chains in the Genus database with same CATH topology
 2A6O A;  3UN2 A;  2VOO A;  1RT3 A;  3IAM 9;  1TKD A;  2JWN A;  3DOK B;  1HMV B;  1SVD A;  4P72 A;  1YKW A;  4OJH A;  5KG7 A;  2CDR B;  1N36 J;  3N6N A;  4AL5 A;  1S4E A;  3HZE A;  3OFG A;  2DR9 A;  3KLV A;  2MB0 B;  1C1C A;  3IS9 B;  3TA2 A;  4HHU A;  3BSA A;  3M2R B;  3PX6 A;  3WBZ A;  2LKZ A;  3UW1 A;  1TL5 A;  3D1O A;  2OEM A;  4QIG A;  1S0N A;  4LVO P;  1WF1 A;  2ZBI A;  1IKY A;  2XGP A;  4RL1 A;  1RT5 A;  2UZA A;  1U1P A;  3TAQ A;  3AOB A;  3JSM B;  1U1Q A;  3SQO P;  1QAX A;  2W01 A;  4NEZ A;  3RYL A;  2ZWP A;  4OZ5 A;  4FS2 A;  4Y2C A;  3TX8 A;  3B78 A;  3D5M A;  2AYB A;  3BO3 A;  3PHE A;  4DG1 A;  2IAJ B;  2HK3 A;  4ED1 A;  1BWE A;  3U7J A;  4OYP A;  4JOU A;  4URG A;  3MI7 X;  1X4H A;  2YNF B;  1ARO P;  5F8J A;  1F1B B;  3EGW B;  2MQN A;  2WVF A;  1RHU B;  2V9W A;  2IM3 A;  1UZH A;  5F3T A;  1JLF B;  3I87 A;  3BR8 A;  5LOQ A;  2IVY A;  4ITS A;  3OTE A;  3RU0 A;  3H42 A;  5KFL A;  4DR3 F;  2QL5 B;  1VFJ A;  4NLG A;  2KT5 A;  1FKO B;  4DSF A;  5L9X A;  3I0S B;  5GAD U;  4B3T F;  4P7T A;  2UUB F;  2DY9 A;  1KC8 T;  3OLA A;  3IM9 A;  4B3O B;  3EVW A;  3UO0 A;  3KNA A;  5D3G A;  1FEE A;  4ED2 A;  1FWL A;  2DH8 A;  3UNY A;  2D69 A;  2Z56 B;  4URQ U;  1ZPV A;  4WYL A;  4P6Q A;  2CZ9 A;  1CJK B;  3DLE B;  3CC4 S;  2HBY B;  1DBD A;  2PFD A;  1IBC B;  1DZ5 A;  2ZE2 A;  3QT7 A;  1TMM A;  3I82 A;  1RWK B;  2PSZ A;  4KR0 B;  2RS8 A;  4DV6 F;  2VDI A;  1ZM2 A;  4UOH A;  1Q53 A;  4ZPC A;  1RLD A;  5HMZ A;  2JVR A;  3U02 A;  4H4K A;  5K14 B;  5IT4 A;  1ZOT A;  1Y7P A;  3K17 A;  1JLA A;  1XTZ A;  2CPE A;  4RW4 B;  1D0E A;  1JXE A;  3GJS B;  3DFE A;  2CNK B;  5HQM A;  2KB2 A;  4PXE A;  3L3C A;  3PX0 A;  3CJ8 A;  3VQT A;  4X4N A;  5C25 A;  4ECX A;  3ENV A;  3V81 B;  3Q2S C;  1EHW A;  3B8H A;  2LDI A;  1EET B;  1S6O A;  2U1A A;  4KIA A;  3M8Q A;  4LF7 J;  1RBA A;  1VQK S;  2HIQ A;  2ZJQ Q;  4OL8 A;  1RKI A;  4K5R A;  4F7V A;  1VQM S;  1NSP A;  1Q5Y A;  4C8M A;  2WOM B;  1O8B A;  1HBN A;  1TQL A;  1N6Q B;  2OIH A;  1KTQ A;  2R2U A;  3R7S B;  3K59 A;  3BH6 B;  3QZ7 A;  4QJV A;  4DEZ A;  5FJ4 A;  1GXU A;  4ZVP B;  1MG7 A;  2OLW A;  4PQU A;  4FBT A;  3D28 A;  2EC0 A;  4IG0 B;  3U1L A;  5A8K A;  1IWG A;  2P5V A;  1QD1 A;  3GU0 A;  3PRB A;  2I5J A;  4UT4 A;  4PXB A;  4Q5V A;  4USW A;  3M30 B;  3L7O A;  1YBU A;  4LUB A;  2EK1 A;  2W2Q P;  4A8O A;  4DN9 A;  1IKW A;  4MMO A;  5H9F K;  4B3M F;  1T3O A;  4X4V A;  3PXG a;  3LGN A;  5K20 B;  4PRF A;  1ZZF A;  1F0X A;  4EK2 A;  4HAC A;  2XBP A;  1P1T A;  1MSW D;  4DR6 F;  3QWP A;  4C6A A;  4Q0B A;  4NCG A;  5ETS A;  1HNZ J;  1X4F A;  2OSQ A;  1K44 A;  4DX8 H;  3OR2 A;  1UZD A;  4AD6 A;  3IAS 9;  2CYY A;  1Q8L A;  2BJ7 A;  3SCJ E;  4OLP A;  4NLR A;  4I6A A;  3GYN A;  4C9D A;  1WI8 A;  1SJQ A;  4U8Y A;  4F0K A;  2HND B;  3J81 j;  5IV3 A;  4EFA C;  3D1H A;  1S6P B;  3NY0 A;  4PAB A;  4DV7 F;  3A3N B;  3KLF A;  3G6E S;  1T9Y A;  4Y28 C;  1RT6 A;  2XY6 A;  4H4K C;  4YQW A;  2DGV A;  1SUQ B;  1BE4 A;  3SCL E;  1IVZ A;  4G1P A;  1HHQ A;  1IR0 A;  3OLB A;  1S97 A;  4G1Q B;  4OZ1 A;  3H25 A;  2UXC F;  3AY0 A;  1YGY A;  1ZAX A;  5IQQ A;  1XC9 A;  4M5D B;  1D8Z A;  4F2R A;  3NL0 A;  4YB6 A;  2AWZ A;  5KFV A;  5I3U B;  1IM4 A;  1SQE A;  2CZV C;  4U7U D;  4M5I A;  2JEJ A;  1NB7 A;  4DL4 A;  5C5J A;  3CXC R;  2DXD A;  3BQ0 A;  2YX1 A;  5K8P A;  1WJ9 A;  2WZ1 A;  2KI2 A;  4K8R A;  4CQ1 A;  4MFB A;  4LF1 A;  1H0H B;  2JLG A;  4ILL A;  2V94 A;  1XNQ F;  1M5K C;  3BGO P;  2NZC A;  3BKF A;  4C3M A;  1EQM A;  4LRD A;  4LSL B;  2DEJ A;  4X84 A;  5KT6 A;  4KYZ A;  1RAI B;  3G86 A;  3OPK A;  3QQC D;  5K8N A;  5CD4 A;  2XY7 A;  2FC8 A;  4C0H A;  5I3Q A;  5D4O A;  2DNR A;  4M8L A;  4OHV A;  3QT6 A;  1XK8 A;  2DH7 A;  4LF6 J;  1FWK A;  3L7U A;  3WC0 A;  3TQ1 A;  4MK7 A;  2D3O R;  4PZV A;  5G4D A;  1X4B A;  3BBB A;  2XZD B;  3SDE B;  2P9C A;  4OX8 A;  1AZS A;  2DR7 A;  3WX4 A;  3C46 A;  3FRZ A;  1BUX A;  1W25 A;  4QWE A;  2G1D A;  2R7Q A;  5HVF A;  3I5C A;  3HKW A;  1O51 A;  4AQY F;  4CT9 A;  3AD8 C;  3J80 Y;  1UVK A;  2HFO A;  3J7Y I;  4J9K A;  3DOK A;  5F8G A;  5KG6 A;  1HMV A;  3ZZR A;  1VLY A;  3HSJ A;  3TVZ A;  1SL2 A;  4WTO B;  3N4W A;  2GMJ A;  2Q79 A;  3OTO F;  1FFS B;  3DOM B;  4KH1 B;  4CH1 A;  2VJU A;  4EEY A;  2F7V A;  2DNL A;  3AB4 B;  3IS9 A;  2W2P P;  1FRX A;  1NRK A;  3M2R A;  2QA4 G;  1LWX A;  4DR2 J;  4B3R J;  1DQ8 A;  5A0Y B;  1OQ3 A;  2W8L A;  3FMB A;  3SBM A;  4RNM A;  1ROF A;  3MCS A;  3KJQ B;  2ZBC A;  1RTD B;  2ALY B;  3A1Y G;  4Y2I A;  3IR6 B;  1HWK A;  1T94 A;  1HWI A;  2V2K A;  2WVB A;  1TMJ A;  1VQO S;  3JSM A;  4F3Q A;  1ZM4 A;  3IN5 A;  1P8G A;  2FB0 A;  1WKL A;  2VQF J;  3M6V A;  4AFF A;  2WSF C;  1G1X A;  3R3T A;  2MKS A;  1EX8 A;  3GFZ A;  1X60 A;  2DD8 S;  2RDJ A;  5GMD A;  2PT0 A;  4XPE A;  5E3Q A;  4GC6 A;  1JLG B;  5DRK A;  3M9N B;  2IAJ A;  3WIU A;  2I2Y A;  2A18 A;  3W65 A;  2YNF A;  2GGP B;  3T6J A;  1Q95 G;  1UVL A;  1VQ7 S;  1YZ6 A;  5KG4 A;  1JLF A;  4KO0 A;  3CJS A;  4RW9 B;  2G2O A;  3QAE A;  1HLW A;  1SXL A;  3M8P B;  4OI3 A;  2B8P A;  5B0B A;  2ERR A;  4Y2A A;  3EGV A;  2FLL A;  3GIK A;  4EBE A;  2VA3 A;  1FKO A;  3HHN B;  2VFT A;  1WC0 A;  3I0S A;  1S10 A;  4ED4 A;  1KON A;  3ZZY A;  3R7N B;  2BAN B;  5L38 A;  4DDF A;  3FCH A;  4ECW A;  4B3O A;  1CG2 A;  2W8K A;  1CJU B;  2EFV A;  1CJK A;  3DLE A;  4KV8 B;  5IWA F;  1QTN B;  2Y1L B;  2CPF A;  4J5O A;  2LQB A;  1U2C A;  5KT5 A;  2K2P A;  4NA1 A;  2FHM A;  3KHL A;  4I64 A;  1WG5 A;  2CQ2 A;  1P9Q C;  1Q81 T;  3QFW A;  2IBO A;  2CQ3 A;  1HHS A;  2IPO B;  3A4T A;  1T02 A;  4TY9 A;  2LXU A;  4OV1 A;  1FDN A;  3UR0 A;  2AMC B;  2E1A A;  3MR6 A;  4L73 A;  4CH7 A;  3QRQ A;  4PQA A;  2ADB A;  5K14 A;  2QA4 S;  3DOL B;  2K8G A;  2M8H A;  3TZW A;  5KFC A;  1B99 A;  3IRW P;  4RW4 A;  2W2O P;  2OUG A;  3BO4 A;  1RZM A;  3FBE A;  1U0H A;  1Y5N B;  3BV8 A;  1PJ5 A;  2V4J B;  2MZR A;  5A2Q Y;  2NUH A;  3Q22 A;  3BH7 B;  2QFI A;  5CCL A;  3R5D A;  4N41 A;  5IXU A;  3V81 A;  3FC9 A;  3Q8U A;  2DHA A;  5ETL A;  3CCJ S;  1OJ4 A;  5LMN J;  1EET A;  1C0U B;  2B51 A;  3MGJ A;  3HSD A;  3ISN D;  2J5A A;  4ZN3 A;  1BQM B;  4M94 A;  2QLB B;  4GKK F;  3OT9 A;  3NS7 B;  2OPR B;  4DL6 A;  3CDW A;  2HVD A;  2WOM A;  4KB7 A;  4CZC A;  4KGK A;  5E0O A;  3N01 A;  1HFE L;  4O44 B;  1B64 A;  1N4L A;  3QSY B;  5KG1 A;  1N6Q A;  3JTP A;  4ED3 A;  4IRD A;  5F3Z A;  2DY1 A;  2PFF B;  2WBR A;  4K4W A;  3X1L B;  3N9U C;  4RUB A;  3D6H B;  1L5U A;  4PKD B;  4IG0 A;  3RR8 A;  2YKP A;  2N3L A;  1IM6 A;  2MZS A;  4RNH A;  1FJC A;  3VR1 A;  1IR2 A;  2GA7 A;  4IDK B;  4RX6 A;  3GJR B;  1XBW A;  3M30 A;  1UW9 A;  2ZIT A;  1U1R A;  4DQR A;  3LAM A;  4NMX A;  2FVQ A;  3TVY A;  4JB8 B;  4YHH J;  3SV3 A;  2FVP A;  5DDQ C;  4J90 A;  4J9N A;  3KXD A;  4NYO A;  4DR5 J;  4JV1 A;  2DVI A;  2BJ9 A;  4PPD A;  4X4P A;  1IKV B;  4JI6 F;  1TAU A;  2GZO A;  4UOC A;  2H1Y A;  3GCX P;  4OZL A;  1YJU A;  5KFA A;  3M9O B;  3LWM A;  2DNP A;  3OJS A;  2FJE B;  4YN3 B;  2DNH A;  1WWH A;  5IWA J;  4F02 A;  3D67 A;  1YJR A;  4NWB A;  5J2P B;  4QPX A;  2VH7 A;  3TAN A;  5GAG U;  2HND A;  1T9V A;  1VC0 A;  1FVS A;  3C16 B;  2QYG A;  3HFK A;  5DM6 Q;  3NKY A;  1S6P A;  1E6Y A;  4OJG A;  5E3P A;  1FJG J;  3NGK A;  3OSN A;  4F04 B;  3RBZ A;  3TUP A;  3CDU A;  3RZA A;  1LWE B;  1FEH A;  3VVT A;  2KRB A;  1SUQ A;  3FKB A;  2B0G A;  3G71 S;  4USJ C;  3BGL A;  3ITH B;  1V5I B;  3VGV A;  4QU6 A;  2ZJP Q;  2GNK A;  4JP8 A;  4X4R A;  5HMX A;  1U1O A;  2VG6 A;  2VPW B;  4M5M A;  4P2M A;  2D74 B;  4G1Q A;  3D9B A;  2QA2 A;  1B0V A;  2KFY A;  1XNR J;  2E66 A;  3OXF A;  3OFF A;  3W3S A;  1X7V A;  4NLP A;  3AHP A;  1S0V A;  3PFO A;  2D3Z A;  3PYG A;  2MZJ A;  3HHE A;  2GML A;  2YWG A;  3C15 B;  4M5D A;  5I3U A;  2NXN A;  3JXO A;  1OMS A;  1NKC A;  4IH6 A;  2O01 C;  3OTC A;  3PYF A;  1IJF B;  3JAM U;  3G8S A;  4FF1 A;  4A8Q A;  4NXN J;  3PVX A;  1M1H A;  1R8P A;  2YKN B;  4J9P A;  2RIJ A;  3GZ7 A;  4DL0 C;  2HFV A;  2XMW A;  1RSC A;  1RWW B;  1BC6 A;  3KK3 A;  3TJ9 A;  2PDA A;  4LSL A;  5A6P A;  4C0B A;  3RAX A;  1J2V A;  4R0J A;  2RD5 C;  2ZH6 A;  4EZ6 A;  2J7K A;  1SH2 A;  1GK8 A;  3MEC B;  5KG0 A;  2CVI A;  2P9G A;  2AGQ A;  2BJD A;  5KG3 A;  2N3O A;  5LJ5 Y;  4HEA 9;  2ZH1 A;  2F3J A;  1X31 C;  2Z58 B;  4AUK A;  1RU2 A;  4NX9 A;  1HQE B;  5L1K A;  4I1T A;  3SDE A;  3E2E A;  2CWK A;  4C3L A;  1R0C B;  4B3S F;  1Y5I B;  4UQT A;  3MCN A;  4L3K A;  3U1N A;  4ZHR B;  4LF8 F;  2LYV A;  4QIF A;  4LMZ A;  2DGT A;  2P2C B;  3HD1 A;  1UEU A;  4LQ3 A;  2HVI A;  2B4V A;  1Y00 A;  2FVC A;  4W92 B;  2QTW A;  4F26 A;  1VCT A;  3DGV A;  3N5B A;  3GE9 A;  4USK A;  3DLJ A;  2NPF A;  3DOM A;  4QW8 A;  5DDP C;  4ZPT R;  4EI2 A;  5HAO A;  2YNH B;  2QMX A;  4FYD A;  3Q8Y A;  3HT3 A;  2DXF A;  1JNZ B;  2XMA A;  5CYQ B;  2HFZ A;  4ID5 B;  5A0Y A;  4UOF A;  2X1A A;  1RTD A;  1EKS A;  5J2Q B;  4IYQ A;  1DQA A;  2UUA J;  1IBK J;  2CQH A;  3UE2 A;  5BYS A;  2J6U A;  3DDN A;  2M2B A;  2VU5 A;  5C2G A;  4CT8 A;  3P5B P;  5D0H A;  1UW4 A;  1ZZN A;  1AXQ A;  2LXI A;  2I38 A;  2CNN B;  3BZQ A;  4OX9 F;  1SC6 A;  1BGX T;  2D3U A;  4HI2 A;  1T11 A;  5KFH A;  2XMK A;  5L1I A;  3V4I B;  5IT9 Y;  2XWY A;  4KT0 C;  1VGY A;  4MIW A;  3MUV P;  1KN6 A;  3GR1 A;  3OJU A;  1D9D A;  4ER8 A;  4YR3 A;  1AUD A;  1JLG A;  3MMJ A;  4X4S A;  1TFY A;  1NJY A;  3MPV A;  4FKY A;  3QIP B;  5EDW A;  3R5J B;  4XDD A;  2VKZ G;  2GGP A;  3EYZ A;  1M90 T;  2FUG 9;  4ZA1 A;  2E1R A;  4X4T A;  3AB2 B;  3DI6 B;  4J9O A;  2QC3 A;  4X65 J;  3J7Z T;  5JUM A;  3DDK A;  4QCL A;  4RW9 A;  3KUE A;  2QO3 A;  4DQI A;  3M8P A;  1TKT B;  4OI6 A;  4K59 A;  2CPX A;  1TK0 A;  1W2B R;  4ZLN A;  4LIR A;  2PE8 A;  4NL5 A;  4UZC A;  3EX7 B;  1JXL A;  4WYW A;  1XEZ A;  2KFZ A;  4G6V B;  2DGS A;  1GEH A;  3OFE A;  5JXS A;  4DFK A;  2BAN A;  2DR6 A;  1NHV A;  2DIS A;  3I0R B;  5HLF B;  2GMH A;  3AD7 C;  2CPZ A;  3MF5 A;  2W7O A;  1CJU A;  4KV8 A;  3ZTO A;  2EEY A;  4NLT A;  1JB0 C;  1Y3K A;  5CQG A;  3BM7 A;  3QJP A;  2YKA A;  4JI8 F;  3TJA A;  3M05 A;  3T5J A;  1U24 A;  4HT7 A;  2BJ1 A;  2HWT A;  1SJF A;  4QYR A;  4AT1 B;  3CO0 P;  3UDE A;  4R5P B;  3J7Z 5;  2VAS A;  1RWP B;  3DOL A;  2RRN A;  1M1G A;  1WEY A;  3GR0 A;  3MCO A;  1ZM3 A;  4F2S A;  1RAA B;  3EE3 A;  2ZBP A;  2LA6 A;  3W2W B;  2HRY A;  3HVA A;  1U8S A;  3CJ0 A;  2GAH C;  5F0U A;  2V4J A;  2P9E A;  1OY8 A;  3HI9 A;  4QYZ K;  2ACY A;  1T9W A;  1NHK L;  3Q83 A;  1C0U A;  3DHW C;  5D77 A;  1QAI A;  1JLB B;  8ATC B;  4W90 B;  3HVW A;  2GHP A;  4ECU A;  1BQM A;  4HH0 A;  2V6A A;  3PEH A;  3IRX B;  3NRB A;  2OPR A;  3OV7 A;  2NPI A;  4WWS A;  1RHK B;  4WK3 A;  1FFW B;  1WTB A;  4O44 A;  2VV5 A;  1TZ0 A;  3TR5 A;  3BSC A;  1CLF A;  4OX9 J;  2EKY A;  4DBQ A;  3F0N A;  2J0Q D;  4ELU A;  3HKZ D;  1TEL A;  2VPY B;  1XR5 A;  5KFO A;  3IMQ J;  3QGP A;  2Y9H A;  4J9L A;  3DDI A;  5HQ8 A;  3THT A;  2OMO A;  3BPD A;  1I94 J;  2V50 A;  3BN4 A;  5RUB A;  2OHD A;  3THV A;  2VA2 A;  1LOU A;  1TL3 B;  4Q8E A;  1JLC B;  4LSZ B;  1NUE A;  4E0D A;  2CQP A;  4IDK A;  1TKX B;  4P7V A;  4J37 A;  1TL4 A;  1IJE B;  2HFU A;  4E8U A;  4OV6 A;  1UEK A;  4FYV B;  2BE7 D;  4DUY F;  2XYH B;  1IKV A;  2Q6B A;  2YKO A;  1Q7Y T;  2R3V A;  2MEW A;  4A48 A;  2E5H A;  4X62 J;  7FDR A;  3V6K A;  4NXM J;  4OFZ A;  2XB2 D;  2J0W A;  4ZOS A;  5KFX A;  3G2X A;  2BM0 A;  1W7W A;  4U9R A;  1WHW A;  4RU9 A;  3KFW X;  5J2P A;  3H2V E;  4ANC A;  1WG1 A;  3RB4 A;  3UCU P;  2UVW A;  3RAQ A;  2XCA A;  3C16 A;  2C2K B;  1L3S A;  1PC4 A;  2F9J A;  2IA6 A;  2DHG A;  3NG8 A;  2R8I A;  3HDS A;  4RBV A;  2IHR 1;  1LWE A;  1BMQ B;  2YBV A;  1D8Y A;  1KEK A;  3ITH A;  2U2F A;  2G4B A;  1LWF A;  1T8E A;  1VQ5 S;  4GRS A;  1WG4 A;  4O0N A;  3HX9 A;  4DSJ A;  3SQG B;  3KLE A;  2Y8W A;  1D9F A;  3ETO A;  3ELH A;  1SKR A;  4H4O B;  4N7T A;  1HBU B;  1GMU A;  2BOA A;  4LF9 J;  1PIL A;  3C15 A;  4FPR A;  4C97 A;  1C1B B;  1G2E A;  2W4P A;  3KHG A;  3FRY A;  1VRT B;  3H2L A;  1HNW J;  3ZTS A;  4A8M P;  2E29 A;  3TYT A;  1TKZ B;  4TU8 A;  2M7S A;  1QY7 A;  3M7V A;  4C8O A;  2BRK A;  2Y0S D;  4RW7 B;  4ICL B;  1FXD A;  2RRB A;  3MUM P;  2IA0 A;  3H59 A;  2YKN A;  2G0C A;  4TU7 A;  2DPI A;  3MPW A;  2AU0 A;  1YG0 A;  1YJW S;  1G4C A;  3LUY A;  3NGT A;  1SC3 B;  1T7P A;  3I5B A;  4USI A;  3FEY B;  5KFJ A;  3IWX A;  1UFL A;  4P10 A;  1YDL A;  2WW4 A;  3MEC A;  4ECZ A;  1U02 A;  2XZW A;  1FRH A;  1NDP A;  1NK6 A;  3UR3 C;  3FFI B;  1CSJ A;  5GAE U;  3CT9 A;  1C0T B;  4LRC A;  4TYA A;  5AXN A;  1HQE A;  2J76 E;  4DZ6 A;  4LFA J;  4ID8 A;  3T9Z A;  3DLL Q;  4LFC F;  4N77 A;  3SZ2 A;  5K8M A;  2IM0 A;  5F8H A;  2ASL A;  4ZHR A;  4RUA A;  3UVJ B;  2BRL A;  3SMZ A;  3CED A;  3Q8R B;  2DTJ A;  5G0R B;  3L95 X;  4K4V A;  3TUJ C;  5KFE A;  4DPU A;  2HQG A;  2CZ4 A;  2R9L A;  3R2D J;  3CCE S;  2DNG A;  5GAH U;  2VJV A;  2B56 A;  4DPX A;  2PA3 A;  2EPI A;  2CNO B;  2YQ1 A;  3HJF A;  1NCL A;  2IC3 B;  3HK2 A;  1S7I A;  2YNH A;  3MED B;  1FXR A;  5B0A A;  3BO2 A;  2P8I A;  2D7S A;  2IYI A;  1Z1Z A;  3TW0 A;  5CYQ A;  3US5 A;  4ID5 A;  3DNC A;  2FVS A;  1WOS A;  2GIF A;  1N33 J;  2XQC A;  5AXK A;  3HHK A;  1VHI A;  2JC0 A;  3IBF B;  5T41 A;  4DQQ A;  2GO8 A;  1NME B;  3DLK B;  1GXT A;  1YLX A;  3UD4 P;  4WFN Q;  1VQP S;  2UXB F;  3V4I A;  2B7B B;  2ZH8 A;  2MJU A;  3FZB A;  1HNV B;  3LAL A;  4DI6 A;  4EWT A;  2COL A;  3PCO B;  1S0O A;  1F5B A;  2ZH9 A;  1OYD A;  3QIP A;  1HWU A;  1U45 A;  2AYG A;  1T95 A;  3PEJ A;  1TFW A;  1UJ4 A;  3M32 B;  5HMW A;  3DI6 A;  1JX4 A;  2XNQ A;  3DXB A;  3SCK E;  1SI9 A;  1S77 D;  2OPP B;  1G6B A;  1TKT A;  1JJ4 A;  4JBC A;  3EDQ B;  4ZP7 A;  1R6V A;  4ZVE A;  4ILM A;  4WE1 B;  1NM2 A;  5D6G A;  2G2Z A;  1WC6 A;  2F8M A;  1YHQ S;  1TUG B;  4ZVG A;  1ZAW A;  1S1X B;  5HLF A;  3I0R A;  4ZVO B;  2P6T A;  4ATN A;  2MQ8 A;  2VQE J;  3W64 A;  4TYB A;  2KT2 A;  1F6T A;  4CH0 S;  3CD7 A;  4ERD A;  3PW0 A;  4ZVR B;  5KT2 A;  1L3V A;  1IBL J;  1ZA1 B;  3GIR A;  3P49 B;  5ITH A;  2N4C A;  2AZ1 A;  3BSO A;  2XY5 A;  4I2P A;  3LGH A;  1RGV A;  1KP6 A;  4HHJ A;  4F4A A;  2AEJ A;  2F9D A;  2LLZ A;  4O3S A;  4R5P A;  3B82 A;  5IOL A;  4OZ3 A;  4DXL A;  4LF5 J;  3B54 A;  4UUW A;  4DV5 F;  1SIW B;  1GMW A;  1SL0 A;  4A4J A;  1K0V A;  3K7R A;  3W2W A;  2CA9 A;  1PKU A;  1KFS A;  2JLF A;  3LP1 B;  4ECR A;  2MXY A;  1FER A;  1JWW A;  1NH7 A;  2ZVS A;  4YY3 F;  1RT1 B;  4HVZ A;  1HWJ A;  2MKK A;  3NWG A;  5DS7 A;  4KHP J;  5C24 B;  3QGH A;  4X4Q A;  1JLB A;  2HUR A;  2HHP A;  1U8W A;  5K5M A;  1VC6 A;  2K1R B;  3TZX A;  3T9N A;  1C4A A;  2NLW A;  4U95 A;  2F4V F;  3N79 A;  3CC2 S;  1F9E B;  5L8R C;  2RQC A;  1V3Z A;  5IC4 B;  3PJ9 A;  2MZT A;  4RW6 A;  2OGU A;  3BGF A;  4CIO A;  2FJV A;  3JTN A;  4HI1 A;  3AA8 A;  2LDY A;  4PPZ A;  5B0G A;  3R1H A;  5EWG A;  1HWL A;  1UA1 A;  2J0X A;  3DYA B;  1FXL A;  1S1U B;  4M5J A;  3ENW A;  2BAC A;  2ZNY A;  1TL3 A;  1JLC A;  2XYP B;  2UUC F;  2WTF A;  3R1L A;  4D3H A;  4WIQ A;  1TKX A;  5LMU F;  1S48 A;  3IBW A;  2UUW A;  1NJI T;  2VC0 A;  1A7G E;  3NGR A;  2W2M P;  2CQD A;  2B4U A;  4DR7 J;  3HM9 A;  4WII A;  2DNK A;  2FYX A;  4Z2X A;  2RJZ A;  4DUZ J;  3EZ5 A;  3A12 A;  1XMQ F;  3W60 A;  1IBM F;  2RQ4 A;  1N0U A;  4M5G A;  3Q8Q B;  2XNR A;  2GC8 A;  1RQ0 A;  4N5S A;  2VHG A;  3PYE A;  2QX0 A;  4X64 F;  2KYX A;  4KHR A;  1I51 B;  2EK6 A;  3TA0 A;  1D3W A;  1YX2 A;  3HP6 A;  3K8W A;  2XI2 A;  2I1R A;  1VYA A;  3I4P A;  2HMI B;  1CEZ A;  3R9L A;  1JXV A;  4XAK A;  1B7Y B;  5KT7 A;  2Z2M A;  2CG4 A;  5HO4 A;  2KU7 A;  3MR3 A;  3A8K A;  2IRX A;  3QAU A;  3P4U B;  4DCJ B;  3V6J A;  1VBK A;  3AOC A;  4MKA A;  1RDR A;  1H2U X;  4OI0 A;  2JOQ A;  5F8L A;  6AT1 B;  3SQG A;  3F41 A;  2OFH X;  3DRS B;  1RP5 A;  4ZJO A;  4C11 B;  2QLW A;  3K5N A;  1N5Y B;  2NSC A;  4H4O A;  1BD6 A;  1A6L A;  1HBU A;  2MLY A;  3G8T A;  1PYS B;  3PIO Q;  1NB2 A;  1UVN A;  4FF3 A;  3ZZT A;  1C1B A;  3FVY A;  5DZ6 A;  2FHJ A;  2BKN A;  4DL5 A;  1JIH A;  4PR6 A;  4C8K A;  3CE8 A;  1B3T A;  1VRT A;  1N54 B;  1TKZ A;  1YWX A;  3D6F B;  3NNH A;  3BBC A;  4J9U E;  3KOA A;  3FBF A;  4YB1 P;  3K5O A;  4RW7 A;  4ICL A;  3HCX A;  2H9Z A;  2HHW A;  1WTF A;  4OJ3 A;  4C98 A;  4Y2M A;  3NGU A;  5E41 A;  2MQL A;  3HFV A;  3VV2 B;  2M5Y A;  3MMB B;  4LFB J;  2LEA A;  2C2R A;  1B0T A;  1CPZ A;  2CNL B;  2CJK A;  4ZPW R;  3OVB A;  2WSE C;  1FNO A;  2VFR A;  4OI2 A;  1VIS A;  1HQU B;  2B43 A;  2R7S A;  3FFI A;  4I69 A;  1GXL A;  3N0V A;  4X2B A;  1SC1 B;  4LR8 A;  3CCR S;  1QUV A;  2VUG A;  5H1S V;  4DWI A;  4ED0 A;  1NK0 A;  1C0T A;  5GAE I;  1RAE B;  1QAJ A;  1YRU A;  3MPY A;  5AE2 A;  1V3R A;  3PDN A;  1FKA F;  3TOQ A;  4DX6 A;  2UXD F;  4DV2 F;  2KJV A;  1WC3 A;  3UVJ A;  2VIC A;  1UKU A;  4EMD A;  3KLI B;  2HS0 A;  2CQ0 A;  5G0R A;  4TLQ A;  5EUH A;  1UEV A;  2RDI A;  2OH2 A;  4Q43 A;  4K0K F;  3RAM A;  2MY8 A;  1IUJ A;  1VMB A;  1YBA A;  3S8S A;  2G1H A;  2FLP A;  3G6X A;  5GAH I;  1WUU A;  2YWK A;  1PYT A;  1RWN B;  4G65 A;  2IC3 A;  3MED A;  1B7F A;  2YPZ A;  5KFP A;  2ZJR Q;  2F5G A;  2W4D A;  4PEO A;  2HVH A;  4UZB A;  3BGR B;  3G6V A;  3LH2 S;  1J5E J;  3O3L A;  3QNW B;  2DGW A;  5F8N A;  2ZUG A;  1RCX B;  3NBP B;  1IKX B;  1LNQ A;  4PWW A;  3KDN A;  3CDE A;  3VF0 B;  1PG5 B;  3DLK A;  2G0J A;  2YNI B;  2R7R A;  4RNO A;  2WVE A;  4LVN P;  1EP4 B;  2CFX A;  1UJ6 A;  2B6A B;  5IC6 B;  3CJ4 A;  4DOZ A;  2B5J B;  3MOZ A;  1PJ6 A;  4TY8 B;  1LK7 A;  2JEG A;  1TL1 B;  1QSY A;  1HNV A;  2DHX A;  5FII A;  3A3O B;  4ZVH A;  2ZH5 A;  3RRH A;  2R4F A;  2ZOG A;  4USV A;  3BRE A;  4C4W A;  4NI2 B;  4JI5 F;  4DV0 J;  3GJT B;  1XMB A;  2FQQ B;  2ACM A;  5LSR A;  2XMU A;  3M32 A;  3WX8 A;  1KBR A;  5HVG A;  2XTJ P;  3DRR B;  4U67 Q;  4WFX A;  2D1C A;  2A1B A;  2OPP A;  2XSJ B;  2LEP A;  3GIJ A;  1MLA A;  4RLE A;  4XPC A;  1K1S A;  4WE1 A;  3MD3 A;  5LJ3 Y;  1J27 A;  2NUU G;  1GT8 A;  4IOC Q;  4KGV B;  2RF2 B;  1X5S A;  2HQ3 A;  1N5T A;  4OHZ A;  3IWN C;  3ZFV A;  1KQS R;  1ZH5 A;  5AJ3 J;  5AE3 A;  3M2U B;  1S1X A;  4DPW A;  2DK2 A;  4X66 F;  3QPI A;  4PXD A;  2IRY A;  1QSS A;  2GHW A;  2F8E X;  3PG9 A;  4KAI A;  1RTZ A;  3W5Y A;  1R8C A;  5GVQ A;  2XHC A;  2Z2Z A;  3EMT A;  3CW2 C;  4MAK A;  4B9N A;  3CVK A;  3UFC X;  1HNI B;  2EFQ A;  3Q23 A;  2XC9 A;  2BKO A;  3LW5 C;  3OXL A;  1PC5 A;  5HJX A;  2OPQ B;  4ZVQ B;  1K9M T;  5FLX Y;  5LT5 A;  3SIP B;  5D78 A;  2MY7 A;  2KN4 A;  1HPZ B;  2EI5 A;  2W4C A;  3AQO A;  5D0E A;  3LP1 A;  3JSB A;  2PMH A;  4MJK A;  1SBR A;  1IQT A;  3ILI A;  2XMM A;  3J81 Y;  1RT1 A;  1X4E A;  5F8M A;  5E3A A;  4OHY A;  2J9D A;  2YWF A;  3S6E A;  1SJ1 A;  5C24 A;  2DGU A;  2LQ5 A;  2Z2Y B;  2JRS A;  3CGI A;  3HVT B;  4CM0 A;  3UI3 A;  4IKA A;  2KHD A;  2N7Y A;  3GON A;  2K1R A;  2Y1I A;  1RAO A;  5I42 A;  4I7F B;  4Q7A A;  2AJ4 A;  3HHL B;  1EAR A;  6FDR A;  5E33 A;  2BM1 A;  2RUS A;  4WKR A;  1ZTW A;  2E5L J;  4KQZ A;  1SJ4 P;  3NXZ A;  1TAQ A;  1QE1 B;  4K4U A;  3OFH A;  4N56 A;  1JK9 B;  1GTE A;  1S99 A;  2C3Y A;  1EIY B;  4AL6 A;  1N34 F;  1Y9O A;  4BWJ A;  1S0M A;  3LA0 A;  2QYC A;  3DYA A;  3G96 A;  1S1U A;  2RNE A;  4V19 J;  4USH A;  2DR8 A;  2XS2 A;  1YTY A;  3I96 A;  3W5X A;  5GMK a;  3GTY X;  2BJE A;  3W9J A;  1MN9 A;  2Y0B B;  2L9N A;  4Q2L A;  3H4B A;  3AXK A;  2GQ2 A;  4FN5 A;  2DO4 A;  3GB0 A;  3D0I E;  4TU9 A;  2HBZ B;  4K4Z A;  1HI1 A;  2LEC A;  4UY8 T;  2AV5 A;  2OD6 A;  2G13 A;  1F60 B;  2VBZ A;  3RW6 A;  3O1L A;  1HIY A;  1KFD A;  4ZVF A;  4JI7 J;  4RWW A;  3T1H F;  3RGI A;  1JJ2 R;  4DV1 F;  4V1A k;  2J6T A;  2QSF A;  1OPI A;  3M8R A;  2CKW A;  3E01 A;  2EC2 A;  4DF8 A;  3MAA B;  3EDR B;  2D41 A;  2MMY A;  2QGF B;  4JI0 J;  4W98 A;  2QZ8 A;  2HMI A;  2KH9 A;  3D6M B;  3I55 S;  5L9N A;  2G0I A;  1OQ6 A;  1WEL A;  3OTD A;  3VAK A;  3H5S A;  4F8R A;  2FJX A;  3NLC A;  3J7Y U;  1FA0 A;  5DQG A;  1Q0N A;  3OHA A;  1WAC A;  3BB5 A;  4UY8 5;  4FP9 A;  4P9S A;  4C11 A;  2QSW A;  1N5Y A;  1FHT A;  4MK9 A;  1EKR A;  5A6W A;  1Y4Z B;  1TR0 A;  3RRG A;  1IN0 A;  4IUF A;  2J6S A;  2G9O A;  1SPB P;  5B09 A;  2V8D A;  2FC9 A;  3NAH A;  3ENQ A;  4LF4 F;  4GKJ J;  2MHE A;  1PAE X;  4ED8 A;  4FDF A;  2HNZ B;  1WEZ A;  3VHQ A;  4ZIV A;  4OX7 A;  4CO0 A;  4PXC A;  1Y11 A;  2N82 B;  2J9D E;  4G3I A;  2FZG B;  1Q8I A;  2DR5 A;  1EB0 A;  2HGN A;  3Q0A A;  1WF0 A;  4KH0 B;  2PII A;  1YI2 S;  1RTI B;  2HHH J;  3MMB A;  2YH1 A;  5DLF A;  2JNJ A;  5HBM B;  1WHX A;  1V5V A;  4MT1 A;  4K2X A;  1K73 T;  2V68 A;  4BC9 A;  5CYM B;  4FVC A;  1HQU A;  1VQ9 S;  2M9K A;  4CLW A;  2EG1 A;  2FPH X;  1XQI A;  1NDK A;  1U1M A;  2DHS A;  2AF6 A;  1R8A A;  3FCW A;  2CPJ A;  4N8N A;  2PMW A;  1RWV B;  2CUY A;  1NH8 A;  4RR5 A;  2QEX S;  2QA1 A;  4IRK A;  3KLI A;  4YOE A;  1JLQ B;  1HNX J;  4O3O A;  3VAL A;  4DV1 J;  5CYJ A;  1NPR A;  4Y2K A;  2IMO A;  4ZLJ A;  1HW8 A;  2LP4 A;  5JVG Q;  4PYA A;  3M1V B;  3W9H A;  2CQ4 A;  4CLZ A;  1YRT A;  1IR1 A;  5D15 A;  4F25 A;  4WU3 A;  3JS9 A;  4NLU A;  3KMQ A;  3GPA A;  2QT7 A;  1QSL A;  5KFI A;  2GO9 A;  5F9N A;  4NZ0 A;  1X5O A;  3MZI A;  3BGR A;  3EGN A;  3N6M A;  3OL6 A;  2RUG A;  2PEH A;  1R3N A;  3FUY A;  3FCV A;  3NBP A;  1IKX A;  1JLE B;  4JI1 F;  4DR1 F;  2CJY B;  2YNI A;  4F3M A;  4CNY A;  5FDL B;  2YX4 A;  2ZHO A;  1AA1 B;  1RAF B;  4RUH A;  1TV6 B;  2XMV A;  1RT4 B;  1VLO A;  3MTJ A;  5J2N B;  2PD1 A;  4NML A;  1EP4 A;  1EZZ B;  1U48 A;  2GFF A;  2B6A A;  5GME A;  2B5J A;  1RWO B;  1TL1 A;  2AIR B;  3GWC A;  3IFE A;  2R7X A;  8RUC A;  5KFW A;  4LF2 A;  4NA2 A;  2B9W A;  3K0J A;  2VPX B;  5KFZ A;  3PW5 A;  1N32 F;  4O3N A;  1F5A A;  4I67 A;  2RQK A;  2AGP A;  2W9A A;  1UFK A;  3KDO A;  4DCO B;  1H73 A;  4I4B A;  2XSJ A;  5THW A;  5D0G A;  4KRW A;  1VQN S;  4DR4 F;  2B7C B;  4WFY A;  4C48 A;  3GFX A;  3H8Y A;  3MR7 A;  2RF2 A;  2NQP A;  4KBI A;  5BR8 F;  3EM1 A;  3SI8 A;  1JQG A;  1PCA A;  2BKP A;  4DSE A;  3M2U A;  1FX2 A;  2VFS A;  1O5J A;  4IG3 B;  3W5Z A;  3TUZ C;  2BW2 A;  2GHV C;  2AX0 A;  1D1U A;  4F4X A;  1YJ7 A;  2VBY A;  3H5Y A;  5EX3 A;  3CO9 A;  3TI0 A;  3KTQ A;  4IRC A;  3QRP A;  4J9V A;  4P2F A;  1T9U A;  2JDJ A;  4DR3 J;  4FNI A;  1HNI A;  2MDA A;  5HN0 A;  1REG X;  2JSX A;  1LQ9 A;  4BC7 A;  1OY6 A;  1RTH B;  3CCT A;  1F9H A;  1DTT B;  4DSL A;  4B3T J;  3H98 A;  3VAJ A;  1KD1 T;  2UUB J;  2OPQ A;  2D9O A;  3BSN A;  2LFV A;  1WI6 A;  1NJZ A;  1NBE B;  2R42 A;  5HP1 B;  3DLB A;  1HPZ A;  2FJB B;  2VBX A;  4K5S A;  3A8J A;  3PY8 A;  4FYY B;  2VG5 A;  5ETP A;  2IBK A;  4UW2 A;  2HZC A;  1VIO A;  1RA6 A;  4TQS A;  1PIE A;  1H2T Z;  4DV4 F;  4DV6 J;  2XWX A;  3CD6 S;  2FGO A;  2ZUA A;  1FDD A;  2ZDO A;  3HVT A;  2GIR A;  2FHK A;  4QOT A;  1XJW B;  3QO9 B;  2XS7 A;  4JV0 A;  1SH3 A;  4DS4 A;  2UU9 F;  1TU0 B;  9RUB A;  3BQ2 A;  1S9G B;  4CLY A;  1SQG A;  3HHL A;  4YP3 A;  2QG9 B;  1NPP A;  4S0M A;  4DCP B;  1A9N B;  3PW2 A;  1ZET A;  1RHJ B;  5KG5 A;  2V67 A;  2ZWO A;  3C6U B;  3NS5 A;  3LPY A;  2C3P A;  4KC5 A;  4OYI A;  4ECY A;  3EZU A;  1QE1 A;  1HAR A;  3D4J A;  4C0O C;  5KT4 A;  4FS1 A;  3PR4 A;  5KAK A;  1XER A;  2W7P A;  3M8W A;  4MYT A;  3TJ8 A;  1S12 A;  4LQ9 A;  3UDV A;  3BYP A;  4B9V A;  2AHO B;  2F4F A;  2E5J A;  1HKA A;  2DCU B;  1X4C A;  3CME S;  5KFF A;  1NSK L;  2XLK A;  2E1P A;  2KZM A;  2W1B A;  2NCK L;  2DT9 A;  2E9T A;  4DV3 F;  4ILR A;  2OO4 A;  3JSY A;  1GMV A;  4DQS A;  2NXJ A;  1HR0 F;  4NA3 A;  1REV B;  1MWQ A;  4M1K A;  4V19 X;  3MMC B;  3IG1 B;  2E9R X;  2VZ9 A;  5SZT A;  4TKT A;  1NJW A;  5HRO B;  1U25 A;  2VG7 B;  4HLB A;  4E2F B;  3MAA A;  4O4G B;  1C1C B;  3PR5 B;  2LMI A;  4WZQ A;  1U4B A;  4JI4 F;  4O3R A;  2NXU A;  5EGY A;  1WSR A;  3A8I A;  2B9E A;  4L76 A;  4OYB A;  4OZ2 A;  4AXJ A;  1R43 A;  4B3M J;  3P6Y C;  1UET A;  4B9T A;  4C2M A;  3BS9 A;  2GCF A;  4DR6 J;  3UD3 P;  4WKY A;  2PMZ D;  4OJ1 A;  3AJD A;  1C4C A;  4P74 A;  3ICL A;  2H54 B;  1L3K A;  2L9W A;  1O6X A;  3T5H A;  1CQN A;  2V34 A;  2J7W A;  4HHH A;  3KJV B;  2DRD A;  3OUY B;  1H2V Z;  2DEI A;  1EAY C;  3KG1 A;  1X5P A;  1FJE B;  3J7A N;  2MJN A;  4DL7 A;  4GVL A;  1RWX B;  3QID A;  2FJW A;  5ETM A;  1QVG R;  1DAX A;  1HI0 P;  5B08 A;  1X9S A;  2V2Q A;  4DV7 J;  2IJN A;  2HNZ A;  3KNG A;  5KFR A;  4NRT A;  3QBC A;  2GJI A;  3H4D A;  5DG9 A;  1XIQ A;  3W8P A;  2R7O A;  3D0G E;  3HHL C;  2DNM A;  1Q1K A;  3N6L A;  1X4D A;  3MHY A;  1NO8 A;  1KWM A;  1YK9 A;  1RTI A;  2KT3 A;  2WK4 A;  2CVE A;  2GVD B;  4AND A;  2DHH A;  2UXC J;  5HBM A;  3S1T A;  1N52 B;  4ECV A;  3L4B C;  3KHR A;  3H20 A;  2WAQ D;  2RU9 A;  2GJ2 A;  3DGP B;  2XMJ A;  4WXW A;  5CYM A;  1PBA A;  4M95 A;  2QFJ A;  4JV5 F;  1RAC B;  3H0P A;  1WDD A;  2XO6 A;  3TEG A;  4UOG A;  1FRM A;  1Q7L B;  2VKR A;  3P45 B;  2IDL A;  1MRO B;  3B6B A;  1I3O B;  1S76 D;  3W2V B;  4H54 A;  1RAD B;  2PGC A;  4QBU A;  1XNQ J;  1RU1 A;  3ONQ A;  2G2Y A;  2OEJ A;  5J1P A;  1RHQ B;  3NNC A;  1SJR A;  2V63 A;  1C2P A;  2HFN A;  2QLJ B;  1JLA B;  2ZM6 F;  1T0T V;  2EXU A;  1JLQ A;  3CJ2 A;  3MXH P;  2ATL A;  5KFD A;  3M9M B;  3KUG A;  3PFE A;  1AW0 A;  3GG0 A;  2IDE A;  1WKK A;  1UCN A;  3FSI A;  1NAQ A;  3PRD A;  3FDS A;  1TUW A;  4PG8 A;  2VB6 A;  4F0M A;  2IMW P;  3MPD A;  3M1V A;  5K8O A;  5HK4 A;  4RW8 B;  3T5K A;  3MM9 B;  3G82 B;  1SB6 A;  4C8L A;  3GV5 B;  3Q2T C;  4P73 A;  3DLH A;  4BDP A;  3ZXW A;  3QJL A;  2R8H A;  1JKH B;  3ETM A;  1U6Z A;  3RB6 A;  3EPG A;  2BZ2 A;  2KM8 B;  5FD1 A;  3EXY A;  4PG4 A;  4AQY J;  5B0E A;  4RU2 A;  2HQI A;  3A8E A;  1JLE A;  4OHX A;  1XMO F;  2ZKT A;  3NCQ A;  1MWY A;  3UQS A;  2MKC A;  2H3E B;  4GO5 X;  1YJN S;  5FDL A;  3OTO J;  4WCE Q;  1U47 A;  3V5R A;  2J8S A;  4M5K A;  3A3P B;  1TV6 A;  1RT4 A;  5J2N A;  5D4L A;  4ZPD A;  3BYR A;  2LVW A;  3EUN A;  1RBL A;  5C2C A;  2D9P A;  2GV1 A;  2DJW A;  2HW3 A;  2DO0 A;  2AEM A;  2GW8 A;  2MQP A;  1NU4 A;  3FMW A;  5C42 B;  5ETT A;  3IM8 A;  1UVM A;  4FXV A;  3U27 A;  1TUV A;  4DUT A;  3GQC A;  2NYH A;  3WHI A;  2JX2 A;  1WOO A;  5T7L B;  3ET6 B;  4ZLP A;  2ROE A;  3MM8 B;  1RIS A;  2AP6 A;  4F4K A;  3TAP A;  2XEX A;  4JI2 F;  4F36 A;  1VOM A;  1FO1 A;  3VAI A;  4O3P A;  1VBX A;  1GX6 A;  2KXH A;  4ZCK A;  4CO3 A;  4G1I A;  4DZD A;  3CJK B;  3LWL A;  4J9M A;  2OD4 A;  1PGZ A;  4HR2 A;  5AT1 B;  2ZFH A;  1UWA A;  5H9E K;  8AT1 B;  1N36 F;  4WBF A;  3W9I A;  3HO1 A;  1M5O C;  1CQM A;  1KOH A;  2R7U A;  2OML A;  1K1Q A;  3CCU S;  5LSO A;  3KLF B;  2RB7 A;  5J1N A;  4XK8 C;  3CTR A;  1U1K A;  2O66 A;  2XLI A;  2R8G A;  1RTH A;  2M8D B;  4CTA B;  2BW7 A;  1RWU A;  1DTT A;  2B9X A;  5HI7 A;  3CIM A;  1BY9 A;  3NCP A;  3QSI A;  2YVS A;  2IM2 A;  3OL7 A;  2NXE A;  5HP1 A;  4DSI A;  1UPP A;  4OMF G;  2YPY A;  4FYX B;  4TXS A;  5EWE A;  4QU7 A;  1V3S A;  3PJW A;  4CLK A;  3K2Y A;  4X4U A;  2CRL A;  3TA1 A;  1FRJ A;  1UWB B;  2XGQ A;  1R27 B;  1P1L A;  3I4H X;  1P9Y A;  3KLH B;  2D3O 1;  5CCM A;  2AQ4 A;  3EPI A;  4WP9 A;  3QO9 A;  1R31 A;  4CNZ A;  3BJY A;  2X1B A;  1XMO J;  2NZ4 A;  3RG6 A;  2V69 A;  3DLG B;  2ZOF A;  3C6U A;  4TN2 A;  2JEF A;  1NK4 A;  2JEI A;  1VC5 A;  3P5T L;  3MM6 B;  2GIQ A;  3ISZ A;  3HT0 A;  2KYZ A;  3KLG B;  1R7I A;  3MAH A;  3GJQ B;  2C2D A;  4DLE A;  1NZ8 A;  2Z4P A;  3JYT B;  4GKK J;  1HD0 A;  5CZX A;  2O1P A;  2Z0G A;  1QTM A;  5B7W A;  2MZQ A;  2BYC A;  5A8R B;  1GQE A;  2HAF A;  2E7V A;  1FES A;  2AJ1 A;  1CJT B;  1KTV A;  2RS2 A;  3VGU A;  4I56 A;  5CAB A;  4JI2 J;  5BJR A;  5LL6 d;  4I2Q B;  1U2R A;  4JUZ A;  2ZOM A;  3VVU A;  2X1F A;  1YIJ S;  1REV A;  2A0F B;  3DHX A;  3CCW A;  1FNM A;  1T05 B;  4CO5 A;  2Z30 B;  1X8D A;  2RAQ A;  3TQE A;  3MMC A;  3IG1 A;  2XO7 A;  4DPO A;  2H65 B;  2DXE A;  5HRO A;  2VG7 A;  4CI0 B;  3FQK A;  4O4G A;  1F3F A;  3ZNU A;  3KG4 A;  5U47 A;  1N0V C;  3KUH A;  1HA1 A;  4F4Z A;  4TVA B;  4P52 A;  4YR2 A;  2YWH A;  5KG2 A;  4ZJQ A;  4RKU C;  1RB0 A;  1S79 A;  4LF7 F;  3TAM B;  1WDT A;  4CLS A;  4JI6 J;  1MML A;  3R5A A;  3DN9 A;  4CWB A;  4K4Y A;  3M4X A;  1RHM B;  4AE5 A;  4RNF A;  3DRX A;  2R7T A;  2A2D A;  1E6V B;  1JJC B;  3KJV A;  3OUY A;  4YDX A;  5B0D A;  1O0P A;  2C3U A;  2ZVI A;  3UNG C;  3MD1 A;  2BVZ A;  2R7W A;  3IWL A;  1M1K T;  1FI4 A;  2M52 A;  3AA9 A;  4YDD B;  3TZY A;  1X9W A;  1WOP A;  3OXG A;  2AJ0 A;  4FKX A;  5ETN A;  4MKB A;  1TL7 B;  2CAD A;  3CIZ A;  3PKY A;  1VQ8 S;  2KVI A;  5KFT A;  3Q24 A;  2FVR A;  1ITP A;  5KTQ A;  1FRL A;  1ZBT A;  1TVR B;  4KO0 B;  1Z2Z A;  1HYS B;  3CCM S;  4I6W A;  1KVJ A;  4ZIT A;  2K06 A;  2YWW A;  3VGS A;  1KQF B;  1YJ9 S;  1NJX A;  2V0N A;  2GVD A;  1RJJ A;  1H3D A;  2QL9 B;  1N56 A;  1X5T A;  2L48 A;  4IO1 A;  3SEO A;  1HNZ F;  1WD6 A;  3PRV A;  2L41 A;  2KRR A;  4OIX A;  3DGP A;  2OTL S;  1RAJ A;  1HBM B;  3N5F A;  2ZBQ A;  2H51 B;  3UCG A;  2ZH3 A;  3AOD A;  2NRE A;  3DC2 A;  3KKF A;  5DZ7 A;  2ADC A;  3CCL S;  1MRO A;  2QLX A;  1RXO B;  3W2V A;  4WPA A;  4CCH A;  2YH0 A;  4J91 A;  4B17 A;  5T14 A;  1FNX H;  3HSZ A;  1SV5 B;  2HZV A;  2POK A;  1BWV A;  2BQ3 A;  2QV6 A;  4USU A;  3DU6 A;  1RTJ B;  3ADA C;  4A8X A;  1U0H B;  4FZV A;  2H48 B;  1FCA A;  5DGA A;  4NLY A;  4DU8 A;  3R6L B;  2ZH2 A;  5JVH Q;  2Z57 B;  1CUL B;  2FZC B;  3Q8V A;  4LIW A;  4RW8 A;  2R2S A;  3MM9 A;  3G82 A;  3SV4 A;  4KGM A;  2E9Z A;  2ZD1 B;  3G87 A;  5IT0 A;  2XZT B;  2XSF A;  1LXN A;  4B3S J;  1M0S A;  2R2R A;  3RW7 A;  2XMT A;  1HQ2 A;  1JKH A;  3G9C A;  2HWH A;  4LF8 J;  4KKO B;  4HDH A;  4KFB B;  4ZVS B;  1XR6 A;  4A8F A;  1MW7 A;  1RT7 B;  3M6U A;  3OBI A;  5AXL A;  4O23 A;  2PI5 A;  3DXS X;  2B4P A;  1KSP A;  1UL3 A;  4WTY A;  2L3M A;  2P6S A;  3QLH B;  3PM9 A;  4GVB B;  5DDO C;  4NZ6 A;  3FJ2 A;  2WCX A;  1S59 A;  2WRM A;  3CCV S;  2Y1R I;  1LW2 B;  2HHS A;  1GFW B;  2KHC A;  4Y65 A;  3O5T B;  3PIP Q;  4NLO A;  3H40 A;  3WC2 A;  4MIB A;  4U7U K;  1S1T B;  3PHT A;  1LFW A;  1PAU B;  5C42 A;  5EWF A;  4LF6 F;  4BBY A;  2RRA A;  3W1Y C;  4LRF A;  1B0P A;  3UDC A;  2ZC3 A;  4QIV A;  1N48 A;  3LOU A;  4B08 A;  1TK5 A;  5T7L A;  2J9C A;  3ET6 A;  1ULR A;  2RIL A;  5E2Q A;  1I5O B;  3MM8 A;  1U2F A;  2RH3 A;  3DKD A;  3VQS A;  1FE4 A;  1UPM B;  4LR9 A;  4ZP9 A;  3L9Z A;  1MWZ A;  3CJK A;  3IBC B;  2B9Y A;  2BUN A;  1VQL S;  3CF5 Q;  4ZPB A;  4QZV B;  4LRB A;  2C3O A;  2IJF A;  3WIV A;  4BLG A;  1DLO B;  2HZA A;  3ILJ A;  1E6Y B;  4AXI A;  5IM0 B;  3T19 A;  1RK8 A;  3UCZ P;  2ZBR A;  2QMU B;  3DRP B;  1Y10 A;  4DR2 F;  4B3R F;  2N4D A;  4DF4 A;  1NK7 A;  1WF2 A;  3W7B A;  4LR7 A;  4CTA A;  2AD9 A;  4X4O A;  1HD1 A;  3I56 S;  3R2C J;  2VG6 B;  1KLM B;  2Y8Y A;  2MLX A;  3I9V 9;  2V2V A;  2YWE A;  3G8Q A;  2BA9 A;  4EZ9 A;  2CJA A;  2DIV A;  4RPF A;  2VOP A;  4R8U B;  5JMN A;  4XIU A;  2VQF F;  3GCW P;  2DGQ A;  3TZZ A;  4YME A;  3HZG A;  3JB9 k;  3MM7 B;  2HHU A;  2CJ9 A;  2CQB A;  2C22 A;  4JI8 J;  3AQP A;  4CRJ A;  3CUN A;  1UWB A;  1NHU A;  3PAC A;  1S6Q B;  1XWL A;  3L7P A;  3KLH A;  4IQM A;  3TUI C;  2KM8 C;  1ZS6 A;  3KK3 B;  3DLG A;  3JQK A;  3N28 A;  4EYH B;  1KKH A;  3LP2 B;  4CO2 A;  1KVI A;  1H98 A;  2F1F A;  2V2Z A;  5L1J A;  2WB1 D;  4H4M B;  5D4P A;  1U09 A;  1UAW A;  3ZNJ 1;  3C14 B;  3NWR A;  3D54 A;  5FLX U;  3FK4 A;  3MM6 A;  1TP7 A;  2OI2 A;  2H5E A;  1T03 B;  3EWG A;  3KLG A;  3V6D B;  3R97 A;  3GFY A;  2ASJ A;  3ZZP A;  3MR2 A;  2LQ8 A;  3JYT A;  3AD9 C;  1VJW A;  3J81 U;  1FE0 A;  5A8R A;  2CPI A;  3MFH A;  2WW8 A;  1BQN B;  5DG8 A;  3GV8 B;  1CJT A;  2A3J A;  2ASY A;  2GAG C;  3K8V A;  4YB5 A;  3CCZ A;  3K5L A;  1N5Q A;  4I2Q A;  1ACM B;  3AJ1 A;  2HHQ A;  1H72 C;  1OS5 A;  2BJ3 A;  3QMQ A;  1Q8B A;  2XHW A;  3UN5 A;  1T05 A;  2V8H A;  4QIE A;  4ZP6 A;  2X7I A;  5LXR A;  2UUT A;  3FEX B;  2AX1 A;  4ZK7 M;  3T6B A;  3ULH A;  3D0H E;  1VQ4 S;  4EUV A;  1LXJ A;  1VQY A;  2HRT A;  3W61 A;  2ROP A;  3MMA B;  5LMN F;  3AH6 A;  2QJ3 A;  4HTJ A;  1VR6 A;  4DUY J;  5AXM A;  2KZZ A;  7FD1 A;  2FJD B;  1IQZ A;  3TAM A;  4B9M A;  2V8V A;  3ZTQ A;  3F44 A;  2HKE A;  3TP2 A;  3MTK A;  4Y3C A;  2VC1 A;  4N76 A;  1SKS A;  1KDN A;  2KTQ A;  2W9B B;  5IFM A;  3K57 A;  2MYF A;  2DGO A;  1RAG B;  1E6V A;  3X3U A;  3WZ0 A;  2AW0 A;  3RUB L;  1WNE A;  1U1L A;  1KRP A;  4Z7Y A;  1OIA A;  2VDH A;  4IOA Q;  2JFK A;  1FDA A;  1TL7 A;  4PCQ A;  1FKP B;  4M63 A;  2Z8Q A;  1D09 B;  1UA0 A;  2HSE B;  1RT2 B;  2W9C B;  1TVR A;  4WP8 A;  4O0I A;  3PV8 A;  1HYS A;  3LAK A;  2IFX A;  3KMS A;  5J2Q A;  4C7Q A;  4YHH F;  2IVM A;  4DR5 F;  1P6T A;  2NXC A;  5DET A;  2HIY A;  4NEY A;  2A10 A;  2JLE A;  1NKE A;  1FVQ A;  2F63 A;  3KG0 A;  3TO8 A;  5GAD I;  1P27 B;  5BYR A;  2NYI A;  2EBG A;  2Y1J A;  3KK2 B;  4CO4 A;  5KFM A;  4LSN B;  3KHH A;  4J9R A;  3M2V B;  3CPW R;  1HBO B;  1KNZ A;  4P2S A;  2CQG A;  1HBM A;  2DRA A;  1OSD A;  5L39 A;  5H9E J;  1J5O B;  2YNG B;  3H90 A;  1JNR B;  2YKM B;  2DNZ A;  3HHD A;  4PG6 A;  3MWB A;  2HBQ B;  1LW0 B;  3BDE A;  3VZH A;  2HYI B;  4NYZ A;  4ZCI A;  1MN7 A;  2CJQ A;  1FJG F;  4XO0 A;  2LQJ A;  2E1M C;  4PYD A;  2Z2L A;  1G7C B;  3TEH B;  4P71 A;  1SV5 A;  4QW9 A;  2WSC C;  4J7C A;  3POT B;  5F0W A;  1B4S A;  4L75 A;  1RTJ A;  4ZPV R;  2ZZT A;  4K2J A;  3VCD A;  2DCL A;  6FD1 A;  4J9S A;  2WHO A;  4L74 A;  2OSR A;  2AEF A;  2AT1 B;  1QJH A;  4P75 A;  1CUL A;  1XNR F;  3NMR A;  4OQJ A;  3NEK A;  4RBT A;  2V5H G;  4WFZ A;  3OQ2 A;  4Z37 A;  2ZD1 A;  1KVK A;  4ZCM A;  4IFY B;  4LFC J;  5F41 A;  3D6T B;  3FBB A;  4OZ0 A;  5ETV A;  2HNY B;  3Q89 A;  4KKO A;  1KQG B;  4KFB A;  4NXN F;  4NLV A;  1RT7 A;  2IJR A;  2H5I B;  2MQO A;  3T5L A;  2K7K A;  2EFO A;  3QLH A;  1DHM A;  4GVB A;  4IR1 A;  4CO1 A;  4C8Z A;  3FEZ A;  5M2P A;  3JQJ A;  3CJR A;  5KFN A;  3HHL D;  2LU2 A;  5EX0 A;  1LW2 A;  5LXY A;  2OEK A;  1IWA A;  3SFG A;  2V4R A;  3D66 A;  4P2X A;  2OJ3 A;  1S1T A;  1R89 A;  1SL1 A;  3R6G B;  3M8S A;  4DN0 A;  1QDU B;  2PI4 A;  3R27 A;  3S01 A;  1NXI A;  1R8H A;  5D4N A;  2FY8 A;  4UQG A;  1Z2L A;  3IRX A;  2NS1 B;  2JFD A;  1VIX A;  4IOB A;  4KGZ B;  4NPO A;  2IY5 B;  4CLT A;  3OVA A;  4ZDN A;  1CJV B;  2M4M A;  1YSJ A;  1FK9 B;  5AE1 A;  3H5U A;  3VTI A;  2XYG B;  2UVR A;  5J2M B;  2UXB J;  3V6H A;  2RML A;  1T3N A;  5KFU A;  3C6T B;  4EO6 A;  2I0X A;  1NND A;  2OTJ S;  1FTC A;  4CLF A;  2DB1 A;  4K7Q A;  4XDC A;  2XI3 A;  1RI7 A;  3D1Q A;  4KPY A;  3PO5 A;  1FRK A;  4UTG A;  5M2R A;  2RHQ B;  1DLO A;  4I68 A;  5IM0 A;  2PC6 A;  4IFV B;  1G3O A;  1GTH A;  3EXC X;  3CC7 S;  3DRP A;  3CDB A;  4YUD A;  3F56 A;  1S49 A;  1H38 A;  5E7O B;  1NPK A;  3NGS A;  1LWF B;  2EFG A;  2UUA F;  1IBK F;  3BDP A;  3ZTP A;  3KLE B;  3MEG B;  1KLM A;  3D7S B;  9ATC B;  2OFG X;  1UVJ A;  4OI1 A;  4R8U A;  2EFP A;  2Q6C A;  3MM7 A;  4URS A;  2H5J B;  1R6Y A;  1FX4 A;  4CDI A;  2DNO A;  4ANE A;  2H4Y B;  1VK8 A;  4ES2 A;  1QM9 A;  4NOH A;  4UUX A;  1S6Q A;  3I31 A;  4DHV A;  3Q8P B;  4WP3 A;  1NZA A;  4ES3 A;  3IGV A;  4WK1 A;  3L09 A;  5CZV A;  3MDF A;  4XTT A;  4DV5 J;  4X65 F;  3LP2 A;  5BYQ A;  3QRR A;  3ILO A;  1RCO B;  4FF2 A;  2AKW B;  3Q86 A;  4H4M A;  3BQ1 A;  2UV8 G;  3LF0 A;  4ED7 A;  3VAG A;  3VAM A;  3C14 A;  3HUL A;  4YY3 J;  3UWT A;  3WDO A;  2Q1L A;  2J0S D;  1T03 A;  2Q66 A;  5D0R A;  3V6D A;  1Q79 A;  1YRX A;  2LCW A;  2KDO A;  1HHT P;  2V4Q A;  2RU3 A;  3PW4 A;  2CG8 A;  1UP1 A;  4CLP A;  4ALZ A;  1Q86 T;  4ZMM A;  2MKI A;  4NLX A;  3O2I A;  1MU2 B;  1VQS A;  4O4R A;  1BQN A;  2F4V J;  4WJB A;  1YVF A;  2SXL A;  4ED6 A;  4QWA A;  1BLU A;  3BPS P;  4CLU A;  2KJW A;  2BBE A;  3PKM A;  3PYD A;  2VD3 A;  3I5A A;  1KHW A;  2AYE A;  2XUL A;  4QPT A;  1ZTT A;  4F67 A;  3IP0 A;  2UVV A;  2FTR A;  3BGU A;  5I3P A;  2GQQ A;  2RT3 A;  2MKY A;  3K5P A;  2KFN A;  1SC4 B;  4UST A;  2FGC A;  2UUC J;  2RKI B;  4F4Y A;  4Y00 A;  1CC7 A;  4ETZ A;  2E7W A;  2W25 A;  5LMU J;  1DJ0 A;  1M5V C;  4EBC A;  1X9M A;  3MMA A;  3R8Y A;  1Y5L B;  5KFK A;  2CJB A;  1S1W B;  4MH8 A;  2X51 A;  3MPU B;  4OYA A;  1XMQ J;  1IBM J;  2W9B A;  1WKJ A;  3W63 A;  2PN6 A;  3GII A;  3M8Z A;  3ZO7 A;  4Q8F A;  4KJI A;  5HSP A;  3HMJ G;  2FIU A;  4X64 J;  5K9F A;  1TTH B;  5HJY A;  1JJH A;  2BAB A;  4CP5 A;  1W26 A;  4DLG A;  3EIC A;  2DRB A;  3HLU A;  1DQ9 A;  3RB0 A;  3T1A A;  1T9X A;  2MPU A;  1WEX A;  3CWJ A;  3ZZO A;  4E98 A;  1I94 F;  3CJQ A;  3G4S S;  1FKP A;  4WFB Q;  2GVZ B;  4NRU A;  5CD4 H;  2APO A;  4KGX B;  1RT2 A;  4AYB D;  1I1G A;  2W9C A;  2ZHB A;  1CVJ A;  4GMK A;  4NAS A;  3FNN A;  3DMJ B;  3PO4 A;  5H9F J;  1V9O A;  3LTO A;  2A6M A;  1LFP A;  2FLN A;  5LM7 E;  2R8J A;  1BHN A;  3H7H B;  1AB8 A;  3NCR A;  1M5S A;  1F9F A;  3GG1 A;  3UD5 A;  1VRU B;  3J80 U;  4DPT A;  5ETK A;  2HK2 A;  4X62 F;  3KK2 A;  4NXM F;  3EVM A;  4DL2 A;  5C7P A;  4LSN A;  3M6X A;  3AT1 B;  3M2V A;  1HBO A;  1S1V B;  3QGI A;  2HVZ A;  3D3B J;  2ZHA A;  1J5O A;  4KSE B;  2YNG A;  4R0E A;  1NK8 A;  2YKM A;  4ZCL A;  1MNE A;  3MUT P;  2ZNZ A;  4U6P A;  2HHX A;  3GP9 A;  1LW0 A;  4I2P B;  2CQI A;  1AFJ A;  2HAI A;  4UF4 A;  5DQI A;  4PAA A;  4RUC A;  2CPY A;  3POT A;  2OKQ A;  4ED5 A;  1XR7 A;  3SSS A;  4Q45 A;  4GO7 X;  5BXI A;  1OSC A;  2MLZ A;  4C3K A;  2QMW A;  3GV7 B;  2RDD A;  1S9E B;  4IH5 A;  1SKU B;  2M0G B;  2E1C A;  3TRG A;  1DFD A;  2BJ8 A;  4LF9 F;  1S72 S;  2EW9 A;  2MHN A;  2DBB A;  3CSK A;  2KVQ E;  4KTQ A;  3UN3 A;  2YQ0 A;  3ZZ0 A;  3JQM A;  5JJB A;  4IFY A;  3HXM A;  1HNW F;  1NEE A;  2NSB A;  2UXD J;  4K4X A;  4DV2 J;  4OX6 A;  3V4M A;  2B4O A;  1NK9 A;  5MLC V;  4MYU A;  2HNY A;  3QT8 A;  3FSY A;  1FTR A;  4QWC A;  5DG7 A;  3VAH A;  3ZC4 A;  4LBH A;  4K0K J;  2MSS A;  4NYP A;  3KJN B;  4RW6 B;  3LO3 A;  1SKW A;  3CUL A;  4RO0 A;  4BCA A;  1WC4 A;  2E5I A;  2J8A A;  4N8O A;  3I6P A;  2E44 A;  2X3D A;  1ZA2 B;  3CNQ P;  5IV4 A;  2BDP A;  1FDB A;  1YZ7 A;  3O44 A;  2VBW A;  4F50 A;  3MM5 B;  4RZR A;  2ZKU A;  2W7A A;  4MKY A;  3T1Y F;  1VBY A;  5HQL A;  3S7R A;  5DGB A;  1X4A A;  2HQC A;  2VON A;  3OTB A;  4ZLL A;  4U96 A;  3F73 A;  4LFA F;  1FF2 A;  2ZH4 A;  4QR1 A;  5KFS A;  4QWB A;  1CJV A;  2OP5 A;  1FK9 A;  2MKH A;  3R5G A;  3NMA A;  2QRR A;  5J2M A;  3C6T A;  1HI8 A;  2PA8 D;  2C1E B;  1PBU A;  2C2E A;  3CB4 A;  4M5N A;  5B0F A;  5CH7 B;  2YKQ A;  2M3D A;  2L08 A;  4OHW A;  2ILY A;  2ZZN A;  3MEE B;  5KFY A;  1W2I A;  2DH9 A;  2PO4 A;  5A2Q U;  5DO2 A;  2B8Q A;  5GAG I;  4KPC A;  4JI5 J;  3B4D A;  4IFV A;  4IR9 A;  2F40 A;  4HTI A;  2J9E A;  2MST A;  2HLT A;  5ETO A;  1SCJ B;  3HPO A;  4CLL A;  1N33 F;  3SSQ A;  1U26 A;  4I0W A;  2W2N P;  4JV2 A;  1WC1 A;  3PZP A;  4HT5 A;  1SQF A;  2C2O B;  3MEG A;  2HEK A;  4ECT A;  2FJA B;  3ENA A;  4QR2 A;  3PTW A;  4X66 J;  4N47 A;  1X4G A;  2I6W A;  3VGT A;  3KK1 B;  2VF3 A;  5DJB A;  4TNO A;  2OAU A;  3C3L A;  3C19 A;  4L3N A;  5HVH A;  2ILZ A;  1WC5 A;  2ALZ A;  1H6K X;  2HHT A;  5KFQ A;  4ECS A;  3OVS A;  4YEA A;  2ZH7 A;  1APS A;  3AAW B;  4TLR A;  1ICE B;  3HF5 A;  3SYZ A;  1GNK A;  3THP A;  2WVC A;  2M88 A;  4HKQ A;  3NOG A;  3PJX A;  5E5N A;  2ROG A;  1QVF R;  1DRZ A;  1XN9 A;  3E3X A;  1SIZ A;  2KL8 A;  2KG1 A;  2LEB A;  3RJM B;  3DRS A;  1KLN A;  2BV3 A;  5ADZ A;  3R5B A;  2BEF A;  3GLJ A;  4LJM A;  3T1Y J;  5L1L A;  4KHM A;  1JMT A;  4YS2 A;  4ZKA A;  3IO1 A;  2VQE F;  3LPE A;  2CIM A;  4KE5 A;  3P8B B;  3MFI A;  1NDL A;  2HG4 A;  4KY3 A;  4WF9 Q;  1ZYQ A;  1IBL F;  2C28 A;  1YBT A;  1MU2 A;  5B0C A;  1FT8 A;  4AL7 A;  2N7C A;  4J9Q A;  3J7A 1;  3AFG A;  3PW7 A;  1NDC A;  3C2P A;  3D2W A;  1RA7 A;  2K7J A;  1N34 J;  2XM3 A;  4LF5 F;  2O3D A;  1WOR A;  4A8S A;  4PUO B;  3BR9 A;  2HRU A;  4FBU A;  1YJT A;  2MZ1 A;  5E3C A;  3QFH A;  2XCP A;  3KYL A;  2X1G A;  2ZDP A;  3T41 A;  2RKI A;  1Q4R A;  3VAF A;  3CD5 A;  5J1E B;  4ELV A;  1Q5V A;  4KHP F;  3NOC A;  2HQD A;  1HW9 A;  1AFI A;  3EZO A;  1S1W A;  2YY3 A;  3DM2 B;  2M70 A;  2BMB A;  2JVO A;  2C42 A;  1PSD A;  2Y3Y A;  1KS2 A;  5CHC B;  1YQH A;  5DLG A;  3T1H J;  1N5S A;  3V2U C;  4ZVT B;  2HBR B;  5IS2 A;  1FFG B;  2WBM A;  1BXN A;  3VZI A;  4FNH A;  2XG8 A;  2QL7 B;  3EVO A;  2Q3P A;  3DCA A;  4Q2M A;  4I6Y A;  2BOP A;  3CJ3 A;  3CCS S;  1VS3 A;  2PEB A;  3LGM A;  3TNV A;  3CJT A;  1RAB B;  2MQM A;  2XS5 A;  3AJ2 A;  2GVZ A;  1UVI A;  2BE2 B;  4WXO A;  1RLC L;  4LRE A;  1TK8 A;  2BXJ A;  4M5H A;  3M6W A;  2JC1 A;  3DMJ A;  4L6V 3;  2IVF B;  3GSI A;  4USM A;  2V8P A;  1DY3 A;  5IQ6 A;  3BN7 A;  2I8E A;  4F4W A;  2HFS A;  4C8N A;  2UVU A;  1Z4U A;  4DR7 F;  3O6Q A;  3CMQ A;  3AXM A;  3E8O A;  2DYA A;  5A8W B;  2RHS B;  1PYO B;  1L3U A;  1DAR A;  3UPF A;  4DUZ F;  4Y0F A;  1WHV A;  1VRU A;  1RHR B;  4MKV A;  1S7H A;  4LF4 J;  3EGZ A;  1OO0 B;  1S1V A;  1VI7 A;  1I6J A;  1OYE A;  3CJ5 A;  2XLJ A;  4TY8 A;  1DTQ B;  2LQ9 A;  3TX0 A;  3CD0 A;  3SXL A;  2EWH A;  5CXT A;  3W8G A;  4RBU A;  1URN A;  1RE1 B;  4NI2 A;  1X0F A;  2KXN B;  4K50 A;  1X0P A;  1VHF A;  3EJM A;  2ATC B;  2WON B;  1NSA A;  3DRR A;  1VRQ C;  3RBX A;  2CXE A;  4B9L A;  4PWD B;  1CS4 B;  2DPJ A;  2GJF A;  2FD2 A;  5KOW A;  3BF4 A;  1RWM B;  3OR1 B;  7AT1 B;  4DU7 A;  2FDN A;  5DDR C;  4CYU B;  1LK5 A;  2AJ2 A;  1S9E A;  1QLN A;  1D9A A;  1Y0H A;  3W62 A;  4QQB A;  3OL8 A;  1N8R T;  3JAM Y;  5L46 A;  1UMJ A;  5IT9 U;  1RYR A;  3NNA A;  1BQX A;  2CAJ A;  4NLW A;  2FZK B;  3HJV A;  5I42 B;  2CQC A;  5KFB A;  2EBE A;  5E3R A;  3FQL A;  4JYA F;  1M5H A;  3MCM A;  3GFH A;  4FVM A;  1Q8K A;  3O8W A;  2HHV A;  4NLS A;  4IH7 A;  1Q16 B;  2YTC A;  3D68 A;  2OEL A;  3HSG A;  1T9T A;  4O3Q A;  3QYY A;  4Z7C A;  1Q82 T;  4LFB F;  1QUP A;  4EO8 A;  4NLD A;  4NZ7 A;  2B3T B;  4YR0 A;  1IXK A;  3I9Z A;  2MGZ B;  1AT1 B;  4OYM A;  1RKJ A;  4CM2 A;  3PX4 A;  2K3I A;  3JSR A;  3GYG A;  3DRY A;  2FY1 A;  3MM5 A;  1L3T A;  1VBZ A;  3A13 A;  4LT6 A;  2Q43 A;  4B9S A;  1R0A B;  1OPZ A;  2VIH A;  3C8Y A;  4PG7 A;  4JI1 J;  4I7F A;  1H7X A;  3JTO A;  4DR1 J;  1MMD A;  1WHY A;  4ZP8 A;  4DJB A;  2OPS B;  4IO9 Q;  1NLK L;  3P3D A;  1N88 A;  2IIH A;  2BQR A;  5LSL A;  2DGX A;  2BX6 A;  3E01 B;  2LU1 A;  3MEE A;  1LWC B;  2YQ3 A;  4LRA A;  4NE9 C;  3RRK A;  2UV8 A;  4ETX A;  4OYZ A;  4PG5 A;  3HVR A;  3M8Y A;  1K8A T;  4HH1 A;  1N32 J;  1LKZ A;  5KOX A;  5CA5 A;  1MMN A;  5A76 A;  4MK8 A;  2CWX A;  3P96 A;  2GQC A;  5F8I A;  1PO6 A;  1EJ7 L;  3GIL A;  2WB4 A;  4ZIW A;  1V6H A;  3BKU A;  3LP0 B;  4U7C A;  4DR4 J;  2QLF B;  1J5E F;  3PNI A;  4DX7 A;  4RNN A;  3IR5 B;  5BR8 J;  2F65 A;  4A8K A;  1RT3 B;  3VWS A;  2CDQ A;  3KWM A;  5ETQ A;  4EYI B;  3KK1 A;  2HGM A;  3DU5 A;  4EU0 A;  4B02 A;  1YJV A;  4ZPA A;  2DNY A;  3QWU A;  1GH8 A;  3QAT A;  2R2T A;  3BKT A;  2X3G A;  3MEK A;  2KO1 A;  2V9K A;  2A2C A;  2VFV A;  2FLO A;  1NKB A;  4MTP A;  1IKY B;  4R25 A;  2AGO A;  2HPU A;  4JYA J;  1LEO A;  4DL3 A;  2LXF A;  2IRU A;  1RT5 B;  5DM7 Q;  1VK3 A;  3IXQ A;  4DV0 F;  2GX8 A;  3TAR A;  5CAA A;  3WQP A;  5HL7 Q;  2BR0 A;  2EFN A;  1A0O B;  3NS6 A;  3UDL A;  2AZ3 A;  5HAN A;  3ISN C;  3K58 A;  1F5C A;  3KJF B;  3CDA A;  4DPY A;  1K0T A;  2VFU A;  1UFW A;  1YIT S;  4IQX A;  4FPI A;  4DV4 J;  2EG2 A;  4YFU A;  4BS2 A;  3IC1 A;  3GSD A;  2HS4 A;  5AJ3 F;  4DG1 B;  1VQ6 S;  5IZH A;  1RBO B;  3FGV A;  4RWX A;  4OZN A;  2DIT A;  2J7U A;  1KR4 A;  4WZM A;  2JH3 A;  2UU9 J;  1RYS A;  5EHH A;  4BHQ A;  2MTL A;  1OY9 A;  4FF4 A;  2HS3 A;  4HYK A;  5HMY A;  2QN6 B;  4F3O A;  4U8V A;  4K4T A;  3ZTR A;  4F0H A;  1H74 A;  3QGG A;  3HD2 A;  5KT3 A;  2UP1 A;  1NSQ A;  4PWU A;  1F2H A;  2H4W B;  3B4M A;  4PUO A;  5D3G B;  1AUS L;  1GX5 A;  1U7L A;  4QYZ J;  2GS8 A;  2FHO B;  2E7X A;  4DFJ A;  3SSR A;  4EBD A;  3SFU A;  2HWI A;  4C8Y A;  2HGL A;  2ZE2 B;  5J1E A;  4OLO A;  3U1M A;  2DIU A;  2O67 A;  4DFM A;  4DV3 J;  3D3C J;  2C2N A;  2ASD A;  2CPH A;  3K5M A;  2NR0 A;  4HDG A;  1F3V A;  2HLU A;  4L72 B;  2KKH A;  3DM2 A;  1HR0 J;  2RVJ A;  3I32 A;  3LQV A;  1CBK A;  4EGL A;  1U6B A;  1N5V A;  3G6Y A;  1HL6 A;  5ETR A;  1R0B G;  2KXF A;  2YXL A;  1OWX A;  3OL9 A;  4OI4 A;  2E5L F;  2E5G A;  3QZ8 A;  3NP5 A;  2C3M A;  3MUR P;  3MAQ A;  5C25 B;  4RJV A;  1CC8 A;  1GAO A;  1SH0 A;  2R8K A;  4JI4 J;  2AJF E;  1S57 A;  1GMW D;  3OSP A;  3CCQ S;  4Y34 A;  2JL9 A;  3FZ2 A;  2EVZ A;  3M8Q B;  1WSV A;  5HAT A;  2MQQ A;  1U0S A;  2VOD A;  2BE2 A;  4WFA Q;  4ENO A;  4YB7 A;  5MAO A;  2AYM A;  1F2G A;  2HVE A;  4D3G A;  1HBN B;  1URR A;  2QE5 A;  3HFZ B;  2AJQ A;  4LBI A;  3OD2 A;  4ZVU B;  2MKJ A;  1U1N A;  3RBE A;  2VPZ B;  3H2U B;  1FJ7 A;  2DNQ A;  5A8W A;  2BE9 B;  2ABY A;  1U49 A;  1H7W A;  4PQU B;  2CPD A;  1ZAV A;  3RB3 A;  4ELT A;  1NK5 A;  3IA0 A;  1B70 B;  5A8K B;  4WU2 A;  4ZS6 A;  4JI7 F;  3Q8S B;  3MR5 A;  1DTQ A;  2I5J B;  2EKN A;  2LA4 A;  4DX5 A;  3R7B B;  2CQ1 A;  1AYE A;  3K89 A;  4DMZ A;  4JI3 F;  3LAN A;  3ZZZ A;  1DUR A;  1UJ5 A;  4JI0 F;  2JZ5 A;  1S6U A;  1S4F A;  4NLQ A;  1IKW B;  5M2U A;  3QJJ A;  1K47 A;  1LV5 A;  3FBC A;  1VDH A;  2WON A;  2I9S A;  4DSK A;  3OHB A;  1ZM9 A;  2RE1 A;  4PWD A;  1CS4 A;  4HAC B;  2IYG A;  3OW2 R;  4Q0B B;  4NCG B;  3OR1 A;  3OR2 B;  3NGD A;  2WVD A;  3E51 A;  4MIA A;  2DNN A;  2K3K A;  4CYU A;  5F9L A;  3RR7 A;  1KOO A;  1S5Z A;  4A8Y A;  3BBF A;  2CJX B;  4DQP A;  2VG5 B;  4FXD A;  4A47 A;  4JV5 J;  3T3F A;  4HL9 A;  4QIW D;  2R7V A;  4IG3 A;  2IM1 A;  1KQK A;  1KHV A;  1ZPW X;  4BWM A;  2DKO B;  2ZZM A;  3C66 A;  4GKJ F;  4FXW A;  4W4M A;  5D8H B;  3FSX A;  1RAH B;  3SCI E;  1RT6 B;  1SJ3 P;  4OYW A;  1FRI A;  4OZJ A;  3IGN A;  2BQU A;  2ZM6 J;  5DQH A;  3BEG B;  4FYW B;  3ILL A;  4M5L A;  1U6F A;  4ES1 A;  3RTV A;  4DS5 A;  5EN1 A;  3QT5 A;  2HHH F;  5KFG A;  1RUS A;  1UTA A;  2VL1 A;  1S9F A;  1EQ0 A;  2MGZ A;  2JHE A;  2W24 A;  3RBD A;  3ZZU A;  4Q44 A;  4TQR A;  4A8W A;  4NCA A;  1PJ7 A;  3GYX B;  2RSQ A;  1QAY A;  2O5D A;  4LBP A;  1Q78 A;  4QR0 A;  3W66 A;  4A46 A;  1R8B A;  4OYO A;  2FHJ D;  2C2M B;  2HQF A;  4MFB B;  2ZEJ A;  1R0A A;  4ZN1 A;  3NAI A;  5I4M A;  1S9G A;  4B9U A;  2KG0 A;  3CMA S;  3TVK A;  1Y3J A;  4GC7 A;  3GMG A;  4QWD A;  2C2Z B;  3GIM A;  4DFP A;  4ECQ A;  2OPS A;  1ELO A;  1FD8 A;  1HNX F;  1FD2 A;  3TWZ A;  4Y6I A;  4ZJL A;  3R5C A;  2ZC4 A;  1LWC A;  3MOJ B;  1FWP A;  4JI3 J;  2RQM A;  1M5P C;  2JJ4 D;  2YX7 A;  3H5X A;  1AZS B;  5SUH A;  3AOA A;  4K4S A;  1VJQ A;  2V8G A;  3IR7 B;  4NCB A;  2F8H A;  2L9D A;  3LP0 A;  4OYX A;  2QIF A; 
#chains in the Genus database with same CATH homology
 5LMN J;  4DR2 J;  4B3R J;  4DR3 J;  4OX9 J;  4GKJ J;  3R2D J;  1N32 J;  1J5E J;  5AJ3 J;  4B3M J;  3J80 U;  4JV5 J;  2UXD J;  2UXC J;  1HNX J;  4DV2 J;  4JI7 J;  4JI2 J;  4PWW A;  1XMQ J;  4DV1 J;  1N36 J;  4V1A k;  1IBM J;  4B3T J;  1N34 J;  3IMQ J;  1XNR J;  2UUB J;  4DV3 J;  4DR6 J;  4LF6 J;  3D3B J;  3D3C J;  4DV4 J;  1I94 J;  3JAM U;  4DR4 J;  4NEY A;  4DR7 J;  4K0K J;  5IWA J;  2E5L J;  4HHU A;  5FLX U;  4KHP J;  4AQY J;  5A2Q U;  4DUY J;  2F4V J;  1N33 J;  4NXN J;  4X64 J;  2VQF J;  4JI0 J;  2HHH J;  1HR0 J;  4JI5 J;  5BR8 J;  4DUZ J;  4LFC J;  1XMO J;  2UXB J;  4LF7 J;  2ZM6 J;  4X65 J;  2MQ8 A;  2VQE J;  2KL8 A;  3R2C J;  2UU9 J;  4JI1 J;  1XNQ J;  4DR1 J;  3W1Y C;  3OTO J;  3J7A N;  1HNZ J;  2MTL A;  1FJG J;  3J81 U;  4DV6 J;  4JI3 J;  5IT9 U;  4LF9 J;  1IBL J;  4DV0 J;  4LFA J;  4RJV A;  4DV7 J;  4JI4 J;  3T1Y J;  4DV5 J;  4LF4 J;  2UUC J;  4LFB J;  4NEZ A;  1HNW J;  4B3S J;  4JI6 J;  2MEW A;  4JI8 J;  2UUA J;  1IBK J;  4X62 J;  4NXM J;  5LMU J;  4X66 J;  4JYA J;  4KY3 A;  3T1H J;  5LM7 E;  4LF8 J;  4GKK J;  4YHH J;  2KVQ E;  4YY3 J;  4LF5 J;  4DR5 J;  4KYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...