2HHHJ

Crystal structure of kasugamycin bound to the 30s ribosomal subunit
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The antibiotic kasugamycin mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 2hhhJ00
3D3CJ 4X62J 4DR2J 2UUCJ 2UUAJ 5LMNJ 4JI7J 4JI3J 4DR6J 1HNXJ 3OTOJ 4LF5J 4JI5J 4OX9J 2UXBJ 4V1Ak 3J80U 4K0KJ 4LF9J 5AJ3J 4DV4J 1HNZJ 2UUBJ 4LF6J 4JI1J 4RJVA 4DV3J 2VQEJ 4GKJJ 1I94J 4X64J 4GKKJ 4KYZA 1FJGJ 4KHPJ 5FLXU 2E5LJ 5A2QU 4NXNJ 4X66J 4NEYA 2MTLA 2KL8A 1HR0J 4JI2J 3W1YC 5IWAJ 4DV2J 4YHHJ 4DV5J 1IBLJ 5BR8J 3R2CJ 4LF8J 4KY3A 4DV1J 4LF7J 2MQ8A 3T1HJ 2HHHJ 2UXDJ 4B3TJ 4DR7J 4JI4J 2KVQE 1IBMJ 1HNWJ 1XMQJ 4LFAJ 4B3SJ 4JI8J 4DV0J 1N36J 4JYAJ 4JV5J 4DR3J 1XNQJ 3JAMU 4X65J 3J7AN 4YY3J 4JI0J 1N33J 2VQFJ 4DV7J 4DR4J 4NXMJ 4DR5J 4DV6J 1XNRJ 2MEWA 5IT9U 2F4VJ 4NEZA 1XMOJ 2UU9J 2UXCJ 3J81U 4DR1J 1J5EJ 1N32J 1N34J 3IMQJ 4B3MJ 4PWWA 4JI6J 4LFBJ 4DUZJ 4LF4J 3R2DJ 1IBKJ 2ZM6J 5LMUJ 3D3BJ 4HHUA 5LM7E 4LFCJ 3T1YJ 4B3RJ 4DUYJ 4AQYJ
chains in the Genus database with same CATH superfamily
4DR2J 2I9SA 2H1YA 2QEXS 5LMNJ 4K4XA 2DY9A 1RAHB 4IRDA 1JLAB 1FWLA 4WXOA 4GO5X 5U47A 4JI4F 3G86A 1SL2A 1U1LA 2CJKA 3GSIA 4F4YA 4K4UA 1Q95G 3IAS9 3CD0A 3TZZA 4LRCA 1O51A 2QT7A 3K5NA 1HNZJ 1VBZA 2ZVIA 2Y1JA 4ZHRB 1S7IA 1N33F 1FCAA 1IWAA 2B7CB 4RJVA 2AYBA 1QY7A 1X4BA 3G71S 4DX5A 1U49A 4I1TA 4DCOB 2D3O1 1TMJA 1V3RA 4MK8A 1ZOTA 5B0CA 4J90A 4RW9A 3W61A 3BGUA 4O3RA 3G8QA 4UOCA 4DUTA 1P9QC 3J81Y 4K4TA 2HHSA 3FCWA 2E44A 4YB1P 2DR8A 1HBNB 3IBFB 3D1HA 1IR0A 2ACYA 1UFLA 4ECSA 2YBVA 1C1CA 1UZDA 3DRSB 5D4OA 2P6TA 2C42A 1U8WA 3THPA 4EUVA 2AEMA 5I3PA 4RW9B 4ZLJA 3FCVA 2B4VA 4MIAA 2IA0A 4FPRA 2IRUA 4BBYA 4DV2J 3R9LA 3VAKA 4C3LA 5A6PA 2E1CA 4F4KA 2HFUA 3DOMA 4DN9A 1NBEB 2DK2A 1S97A 3FMWA 2GAGC 3EWGA 2X7IA 3IC1A 1F9EB 4V19J 2KT2A 2YX4A 2JRSA 2YNIA 5ETSA 1RZMA 3SQGA 3A13A 1CQNA 2RB7A 1U45A 1RT3A 3ISNC 5DQHA 2M4MA 4B17A 2DNNA 1TK5A 3PEJA 4ZPBA 4F25A 2I5JA 4WYWA 4AL6A 2IBKA 1FDDA 2G1HA 2V4JA 4M95A 1X0PA 2LP4A 3W8PA 2EWHA 4C11A 2HZAA 4ED3A 4A8YA 3HVRA 1X9MA 2A0FB 3HD1A 4F3OA 4OI4A 3JSMA 2AT1B 2MHEA 2WBRA 2ZUGA 2ZUAA 4NI2A 1RTJA 4F67A 4DOZA 1S1VB 3CCLS 1RT7B 1G4CA 3O2IA 5BYRA 1HWIA 1S1XB 4OYAA 3V6KA 4XDDA 4MKYA 4NXMJ 4OI0A 3I82A 4YB5A 2G4BA 4FF3A 2KXNB 1WKKA 3RW6A 1HNXF 4MFBB 1RT7A 3PFEA 1UA1A 5HAOA 4ZVPB 4I56A 5HROB 4DUYF 3MD1A 3CJKA 1VDHA 4WK3A 5L1IA 4LQ9A 4DR1J 4C97A 4MIWA 1CJTA 2Z2LA 2GGPA 3NS6A 4P6QA 3UDVA 5C2CA 5J2NA 4JV2A 5ETOA 2AGOA 4DR7F 5IC4B 3FVYA 3DHWC 4IDKA 4ZLPA 1MMLA 3ZNJ1 3EGWB 3QO9A 2BE7D 2CNKB 2CQGA 3MEEB 3TI0A 1KN6A 1E6YB 2B4PA 5K20B 5KFHA 1B70B 1A7GE 3TUJC 4DLEA 3B54A 4NLVA 4ER8A 1HQ2A 1PGZA 2M0GB 4A8QA 1N88A 2CPJA 3MEEA 4DU7A 2WVDA 2I8EA 3PRDA 1UVNA 2IHR1 5LMUJ 3PHTA 3T5JA 2BOPA 4ECVA 3EDRB 4NLOA 3DRPA 3FCHA 3VCDA 4N41A 2YQ1A 1NZAA 4WTOB 1QE1B 1KLMB 1TKXB 2BJ9A 4LF4F 1X5OA 2EI5A 2GVDB 4DQQA 1QSSA 4CLLA 2HVHA 3UVJB 4CTAB 5LSLA 1KTVA 1FFWB 4ZN3A 3ZO7A 4LMZA 2OO4A 2DGSA 5HMXA 3NBPA 5IOLA 3HVTB 2BRKA 2JHEA 4DV7F 4DR1F 3FBEA 1N5YA 4RO0A 3D1QA 1R8AA 3BN7A 3FJ2A 4CYUA 5GAEI 5LSRA 4FPIA 1PG5B 2HWTA 1F5AA 4CLTA 3X3UA 3BH7B 1FDBA 3QRQA 4DV0F 2R2UA 3HHEA 1IBMF 2J0SD 2CPEA 2OD6A 4R25A 5T7LB 3PKMA 4MT1A 1OYEA 5AJ3J 3PYFA 1ZTWA 2HMIA 1NXIA 4ZMMA 4KJIA 3LANA 2CQ3A 1VBXA 2NXNA 3LA0A 4X84A 4XK8C 4YUDA 5K14A 1KNZA 4DL5A 1HNIB 2ZKTA 1RTIB 4FN5A 3AD9C 3ILIA 4DPTA 3F0NA 1VJWA 4I69A 1TKZA 4IKAA 4OFZA 3CJQA 1C2PA 1RU1A 1T94A 2GFFA 2B0GA 2V2QA 2YWHA 4MKAA 4Q45A 2E5LF 2Y1LB 4WFXA 2BANA 5SUHA 2GJIA 4EK2A 3EZOA 4U67Q 2XBPA 1TELA 3CSKA 2EC2A 1F9FA 2P2CB 4G1QB 4OHVA 2PFDA 5B0GA 2XLIA 4HVZA 3RZAA 3PZPA 1V3SA 1XERA 4KIAA 3M9MB 4Y3CA 4DXLA 2N7YA 1N32F 3JSYA 1PC5A 3NS5A 5F9NA 3Q89A 1K1QA 4DV5J 2YPYA 3JSBA 4TY8B 4NLQA 5A8RA 1NDKA 1FD8A 4U95A 3OJSA 2E5JA 3VGSA 4YS2A 2CDQA 4X66F 2KH9A 5KFMA 5IQQA 1FWKA 3T1HJ 1IBKF 1RI7A 4B3TJ 1HBMA 3CCES 4NZ7A 4N76A 5I4MA 1X4DA 1IBMJ 3IP0A 3W60A 2MQPA 3OT9A 2ZH1A 3HSZA 2ADCA 1HNWJ 2JH3A 1Q16B 2MY7A 2VG5A 4FYWB 4HYKA 2VU5A 4J5OA 1N0UA 4FYDA 3I31A 1WG1A 1X7VA 2JJ4D 4P7TA 3CC4S 4C7QA 2B9WA 1B99A 1LXNA 1SJ3P 5G4DA 2JFKA 3W5ZA 3LP0A 4LF6F 1S6PA 2KDOA 4KB7A 4R8UB 2VPZB 1M1HA 1X0FA 3OTEA 1YTYA 4U96A 3U1LA 4M5KA 3BN4A 4O3NA 2W8LA 2B56A 2HKEA 3PIOQ 2LEBA 4QIGA 5KFEA 3DKDA 2OELA 2QYGA 4NLTA 4NPOA 2N7CA 1HQEA 5A0YA 5HVHA 2FDNA 2W7OA 4ETZA 3PX6A 3CMES 2CNNB 3I0SB 5CH7B 1HIYA 3E01B 2CWXA 2XMWA 1OYDA 4ERDA 1RWWB 2AJ1A 4QWEA 1X60A 1U0HB 4C8MA 3H25A 2W2PP 4EWTA 1M5VC 3G9CA 3AFGA 3CIZA 3KLEB 4B3TF 3I6PA 1VQSA 2A6MA 4DFPA 2YKPA 5DLFA 1ITPA 1YX2A 4B3MJ 3LPEA 4C8LA 3LGNA 3NCPA 1TFYA 2Y3YA 1NKCA 2BXJA 2PFFB 3GYGA 3I5CA 1X31C 4WP9A 3N9UC 3LWMA 1L3SA 3IM8A 5F3ZA 1NSQA 5DGBA 3BYRA 3BV8A 3TP2A 4I2QA 1TMMA 1HWUA 2OFHX 3SQGB 5J1EA 1U8SA 4IOAQ 1AFJA 5IC6B 2HZVA 3IO1A 2U2FA 1RWXB 2DNOA 3OL6A 3CF5Q 1FFSB 2M8DB 4ICLB 4DX8H 3U7JA 3EE3A 4TU7A 2DEJA 1Q8IA 1AUDA 4Q8FA 2WOMB 1WUUA 4ZLNA 1NCLA 1WORA 4QWDA 3KHHA 2WBMA 2NYHA 1XR7A 5EUHA 3Q8VA 1C0TA 4DFKA 2DHXA 3LPYA 1NRKA 2F9JA 3G6YA 2UUWA 2EFNA 5B08A 5THWA 2RUSA 2RAQA 3C6TA 3W2WA 2F5GA 4UF4A 2MZ1A 5L1LA 5KFBA 1RT1B 4RBTA 1SUQA 5JVGQ 1FKAF 2VJUA 1U1PA 1YQHA 3FBBA 4WKRA 1DFDA 2CADA 4J9NA 1Q86T 2DVIA 3VVTA 4DCPB 1S1WB 2IY5B 4GC6A 4NA1A 3WDOA 1M5PC 1NNDA 3BH6B 3FDSA 3LO3A 1LEOA 4L3NA 4LIRA 3J7ZT 3QT7A 1RACB 3ULHA 3IN5A 3BS9A 1I94J 2WVCA 2XB2D 3CJSA 3UE2A 4YB7A 4HHHA 1RB0A 4DSJA 2CQ2A 4NXMF 3OJUA 1EB0A 1S1WA 4CCHA 2YNGA 3TJ8A 6AT1B 1UJ5A 3JQMA 3VR1A 1JXLA 4ZVFA 2E1MC 2F1FA 4U7UK 1Y7PA 3M8RA 5KFUA 2PT0A 4NLUA 1QLNA 5KFYA 3D0HE 3G6VA 3PG9A 3ZZOA 2KZMA 2QA4G 4KE5A 1VS3A 2L9NA 3Q8YA 4F36A 3BGLA 4IUFA 1FXDA 2XSFA 4USUA 3W2VB 3CD6S 4AD6A 3ENAA 2ROGA 3HHLC 1UVKA 2G0CA 4ZPTR 1M0SA 2AJ4A 2HNDB 3C6UA 3W63A 1VOMA 5HSPA 3KK2A 2V4JB 2ZH8A 3AB4B 2LEPA 1O0PA 3UNYA 4DX6A 5KG6A 3T41A 4Q5VA 2HHHJ 1VQNS 2Z2MA 5LJ5Y 2OGUA 2NZ4A 2X3GA 2VIHA 2DCLA 4HI2A 4RU2A 2PI5A 2J0WA 4F0MA 2JLFA 1YI2S 3WC2A 3GFHA 2LQ5A 3Q8RB 3KUEA 4QU6A 2P8IA 2HHVA 4OZ2A 3ILOA 3TAMA 4ECQA 4OJ1A 2XS5A 3HHLB 4Y2AA 2FVPA 2FY1A 3NGKA 1RT2B 4H4MB 1AXQA 1JLBA 1N5TA 1S6QB 2VBYA 3TJAA 2CAJA 2CQ0A 1VC6A 1KHWA 1Y4ZB 4C0OC 3C8YA 2DGTA 1IKWA 3FUYA 3O8WA 3QGHA 3ENQA 2YH0A 5LOQA 1NU4A 2C3OA 1KHVA 1T05B 3AB2B 2ZOFA 1Q8LA 4B9SA 4USHA 2ZJPQ 4DR6F 5I42B 3MMAA 2QFJA 1TL7B 2BMBA 4KO0A 3VQSA 2IM1A 4ILLA 4PEOA 4NCGA 3D6FB 2MY8A 3IS9A 4WZQA 1U09A 5KFKA 1OSCA 2G2ZA 4ITSA 3Q0AA 2F3JA 3UDEA 3TA2A 3TA1A 4RWWA 1OY9A 2QYCA 4I2PB 3Q8SB 3HVWA 2A18A 2GMLA 2BR0A 5KTQA 1NHVA 4TY8A 5A8RB 1W26A 2R4FA 1WHVA 1SXLA 4DV1F 1D0EA 5A8KA 4O44A 1F1BB 2OI2A 2QTWA 5JMNA 2ZM6J 5B09A 4CO4A 3BF4A 2KG1A 2R7TA 4Y0FA 2ZH9A 2FLPA 5IT9Y 2XWXA 3ETMA 3C14B 3MD3A 1BQMB 4FVCA 3VGTA 3BBCA 2HQDA 3CJ4A 4CYUB 3V4IB 3W3SA 2QL9B 4ED4A 4U9RA 1V5IB 2I0XA 2VASA 2MKHA 2WZ1A 2VPWB 3BM7A 2HFNA 4K5SA 4WTYA 5HMYA 1KR4A 1T03B 1EQMA 4W4MA 4HKQA 2D9OA 2R8KA 1JNRB 4R8UA 1DZ5A 2ASLA 4NYPA 2KFZA 1FKOA 2CJAA 2DRBA 4OZ1A 3PKYA 2EPIA 3KLHB 1HNWF 2UXBJ 1KS2A 1A6LA 1DLOA 1QUPA 2F40A 2XULA 4MTPA 4ELVA 1IUJA 3GG0A 2CZ9A 1U2FA 3TAQA 1TK0A 1Y10A 2VQEJ 1H7XA 3DGVA 1LWFA 1H7WA 1NK7A 2VA3A 5D3GB 4KO0B 1UW9A 3BR8A 3DMJB 3ONQA 2OEJA 3S6EA 4ANCA 1SH3A 4ZIVA 3EGZA 1QD1A 2QG9B 1CJTB 1FI4A 5J2NB 1CULB 2PN6A 5K14B 1BY9A 1DTTB 3RAQA 1U4BA 3CUNA 2B5JA 5KFZA 4PG7A 1REGX 5KFVA 2AX0A 2AGQA 4Q0BB 4OYMA 2GHWA 4ZCLA 4FXWA 4Y2MA 1NK8A 1FERA 5F41A 4ZCMA 4UQTA 3CCUS 2FC8A 2CG4A 1CULA 1Q4RA 4F04B 1WNEA 3OQ2A 5IT0A 4FXDA 4I6AA 2F8EX 3RYLA 3TWZA 2AHOB 1NKEA 1H2TZ 3HXMA 1FJCA 5T14A 3ZTQA 2U1AA 4O23A 2A2DA 5KFCA 3MM7B 4URGA 2NS1B 1YJNS 2UVVA 5C25B 3JB9k 4USIA 4DR7J 3BSOA 2M52A 2H65B 3TX8A 2CPHA 3MTJA 4HI1A 4J9UE 4LF1A 4X4OA 2HK3A 2IPOB 4DN0A 2ZWOA 2V8PA 2CFXA 3M30A 1EARA 2DNHA 2WVBA 1GQEA 2GNKA 2BJ7A 3N6NA 4F2RA 2HNZB 1RE1B 2QMUB 5DDOC 3DYAB 2CZVC 4WE1A 4WBFA 3U1MA 3M9NB 3CCQS 1W7WA 3HFZB 2VBZA 2DCUB 1PCAA 3BJYA 3HZGA 2YX7A 4EEYA 4B3SF 2LDIA 4JOUA 4OZLA 4LF5F 4J7CA 4BDPA 4DR3F 3NLCA 1VRUB 2QL5B 2Z30B 5AE1A 4PUOA 2HHXA 4AQYF 3AA8A 2RS8A 3R5BA 1EZZB 1LW0B 1RK8A 1YHQS 3KLEA 4HL9A 4ALZA 1YBTA 2MZSA 1SH0A 3AD8C 2XC9A 3KG1A 4NLYA 4FS1A 4IH7A 4AL5A 3EUNA 2LECA 3PACA 1O5JA 3L7UA 1Q78A 4P52A 1DTQB 4ED5A 1OJ4A 2A6OA 3EICA 4QOTA 3H8YA 2M88A 1X4GA 4ZK7M 5B0EA 1K9MT 3H98A 1RXOB 3K58A 4CLUA 1GAOA 3HDSA 4JI6J 1RYRA 3NKYA 2ASYA 3BZQA 4IRKA 1DTQA 1ROFA 1UEKA 4RLEA 4ZPVR 4C48A 2ZZNA 5E2QA 4ZJQA 2IM3A 1K73T 1GEHA 4YR0A 4USVA 2BBEA 3M8ZA 4F26A 5IWAF 3OUYB 3D3BJ 4DEZA 3R97A 7AT1B 1B7FA 2I5JB 2O5DA 2YNHB 5A6WA 5LM7E 1JWWA 3MWBA 2GVZB 2KU7A 3T6BA 4PQUA 2V8HA 2CPIA 3M2UA 5IXUA 3IXQA 3GP9A 3MR3A 2VKRA 2ZNZA 3IAM9 2LQ8A 3M2RB 2EBEA 3VZIA 2W4DA 2MQMA 4F0KA 4ED8A 4XTTA 4EZ9A 2MGZA 2MKCA 4GVBB 4AQYJ 1S0NA 3B6BA 1CJUA 1F3VA 3CT9A 1FNXH 1G6BA 3P49B 1G1XA 1T0TV 4ZKAA 3MM9B 4YB6A 1AROP 3GJTB 2C3PA 1S77D 3CULA 1WKJA 1ZH5A 2C2NA 5C2GA 1TUVA 4ECYA 1WF2A 2H48B 4WIIA 4JI5J 1JLCA 1T95A 2RVJA 1F5BA 4I6WA 5KFIA 2HHQA 4ZJLA 1RHQB 2H3EB 3A4TA 1DQ9A 2I2YA 2DEIA 1LW2B 2HBRB 2LU1A 2PO4A 1NHUA 4K2XA 1R6YA 4RW7A 2L08A 3W62A 4JI0F 4A46A 1KQGB 4ANDA 5KOWA 2ALYB 2DGQA 4NRTA 4X4TA 3RR8A 4NLRA 1SUQB 4PG8A 4JP8A 3OXGA 3I0SA 3ISZA 4DSIA 4UOFA 2JLGA 4DR4F 5LXYA 3UPFA 3C15B 1WD6A 2RDDA 1VQ5S 2RE1A 1P27B 3EVOA 4NZ0A 3WX8A 1NKBA 1PILA 3KOAA 2PGCA 1WOSA 2OPSB 3NXZA 4OQJA 4NXNJ 3J7A1 4I0WA 4NEYA 1TKTB 3CJ3A 3UDCA 2MKKA 3MR6A 2FJBB 4FF2A 1XNQF 4O44B 4TVAB 1RT4A 4KQZA 1HBNA 4RZRA 3MCSA 4IOCQ 1WC3A 1C1CB 3DRSA 2ZZTA 3AJ1A 4LSNA 1YJWS 1S9EA 2AJ2A 3TVYA 4Y65A 2BUNA 5K8MA 3MGJA 2MQ8A 1MROA 2NREA 2RHSB 2HRTA 1VRTB 1HBUA 2XO7A 2VUGA 4ZVTB 3QJJA 3GJSB 1PYTA 4NA2A 4J9LA 4LR9A 1PYOB 4XAKA 1WDTA 2GAHC 2GX8A 3I5BA 4NI2B 5KFQA 3MMCB 3OVAA 4V19X 1YZ7A 3M2UB 2R8HA 1TP7A 3IRWP 1HBUB 1RISA 3M2RA 2FUG9 2Z57B 2VFRA 3JAMY 2OPPA 3WIUA 3I9ZA 3QSIA 1W25A 1FKOB 1NSAA 2HG4A 2DH7A 1Q82T 2FTRA 2R7RA 2OIHA 1OWXA 1DBDA 4USMA 3LGHA 3A12A 3QLHB 1JLAA 3PJ9A 1FTCA 1RWKB 4DR5J 3NMAA 1L3VA 2OAUA 1O6XA 4JI8F 3TANA 3HHLA 1SJQA 1UFKA 1FD2A 2GIQA 4N8OA 3HFKA 1DRZA 1RT2A 4L75A 2M9KA 4OYWA 2W9AA 2BVZA 2J9CA 4IG3A 1HI0P 2W01A 3IM9A 2V2KA 4IDKB 3RU0A 2NCKL 3GV7B 4XIUA 1TK8A 1S7HA 3EPGA 2C3UA 1FVSA 1FDNA 3PIPQ 2R7VA 4I64A 2GIFA 4PCQA 3L3CA 3C46A 4B3RF 5KAKA 3PJXA 2AP6A 2AMCB 4X4SA 4I7FB 1JLGB 1HMVA 1MWZA 3I4PA 1RLCL 4YQWA 3BSCA 2ASDA 2HBQB 2OPSA 4YOEA 4PR6A 3W66A 2XMVA 1U47A 1KD1T 3CC7S 2NXUA 4RW6A 3IGVA 4DUZJ 1RWNB 1KKHA 5H1SV 2WAQD 5HQLA 2M2BA 3BPDA 3UWTA 4JB8B 4NYZA 3BDPA 3MM7A 1U02A 2LFVA 4ZITA 3QJLA 3TUPA 1VLYA 2QGFB 3TQ1A 2CVEA 2XZTB 2RDJA 2LXFA 4FYYB 1M5KC 3IR5B 2YWKA 1JB0C 1RHUB 3GB0A 1HW9A 3QWPA 1KOOA 5MAOA 5B0FA 2OPRB 3DLKB 2LEAA 2B9XA 2F8HA 3EVWA 4J37A 3SEOA 5IFMA 1YRXA 2R7QA 2B9EA 2XI2A 3KKFA 2MJUA 1RA6A 6FD1A 2DGVA 1LFPA 2OKQA 2PSZA 5GADI 2AYMA 2W9CB 1RTDA 3M32A 1MWYA 1TTHB 3N5FA 1PJ7A 4L73A 1Y3KA 4JI3J 4JV0A 1CJVB 3AHPA 1HKAA 1LQ9A 2F63A 1NK9A 4GRSA 5HBMA 2DPJA 1S4FA 1HL6A 2A10A 2HGLA 5E0OA 3PXGa 4OX9J 2GMJA 1S48A 2BA9A 1T9UA 4YR2A 2VQFF 4LVNP 4DSKA 1PJ5A 2YWEA 5HATA 3OVBA 4NLWA 4DV4J 3UN5A 2Y1IA 3BPSP 5ETRA 3MMJA 5DGAA 4Q2MA 1H38A 3LOUA 2B8QA 2O67A 5JVHQ 3MPYA 4H4OB 1MMDA 2PA3A 3RG6A 3DDIA 5I3UB 3KLHA 1SL0A 1UTAA 3ZNUA 3ZZRA 1WC5A 2CJQA 2V4RA 2UXDF 1X4HA 1U0HA 5HROA 2YWWA 3W5YA 3MDFA 4CNZA 4HDGA 4A8SA 3PVXA 2HMIB 2YH1A 3C19A 4HTJA 1PSDA 1WOPA 3GYXB 2E7XA 1ZA2B 3QT5A 4IFVA 1WTBA 4UQGA 3K5OA 3LTOA 5D15A 4LREA 2HRUA 3D0GE 4EBEA 2BW2A 2XWYA 1YITS 1HR0J 4F8RA 4JI2J 5KG5A 3RB0A 4QR2A 4ZVRB 1ULRA 4I2QB 4OMFG 4KHPF 5BR8J 3CMAS 2ZJQQ 1C4AA 3DI6A 5J1NA 4Q0BA 1T3NA 4XDCA 1KQFB 3NGTA 3CCVS 5A8KB 1RWPB 3KG4A 2KHDA 4CLZA 1AB8A 1M1KT 1MU2B 2V9KA 2G1DA 2OJ3A 3M1VB 4DU8A 1R0AB 2CG8A 2M70A 2V0NA 4IQXA 3WBZA 3MMBA 3WQPA 4PKDB 2AV5A 1M5HA 4QU7A 5HANA 5CZVA 1TZ0A 3DLGA 1CSJA 2B6AA 1BQMA 5B0BA 1NPPA 3R8YA 4LF2A 3J81j 3HULA 4JV5J 2NYIA 2VHGA 3IG1A 1VK8A 2V69A 1IM4A 2RRAA 1GTHA 2VPYB 3QIPA 5GAHI 3M32B 4URSA 3OSNA 2XMUA 3C16A 1SKWA 1WI8A 1P6TA 4KHRA 4KHMA 3CCWA 2MKSA 2Q43A 2POKA 2EC0A 5IT9U 3PEHA 1S0VA 5A8WB 4DL2A 3U27A 3RTVA 1U2CA 3RBEA 1WACA 1LWXA 1YRUA 2F65A 2RRBA 5D4NA 3OD2A 3UR0A 4Q44A 1RBAA 1BHNA 3PYDA 1U6FA 2Z4PA 3M8PA 4KV8B 2VOOA 4WZMA 1U2RA 2B7BB 2QSWA 1BWEA 3DDNA 1JXEA 3OR1B 1NHKL 2YWGA 2FJVA 2KFNA 4P2XA 3BGFA 3KHGA 2DB1A 3DLJA 1AYEA 1RAAB 3LW5C 1SVDA 3TEGA 2HNYA 4FF1A 4CLKA 3BKUA 4OL8A 3SCLE 1PYSB 3DOKA 1RT4B 3LP2A 4TKTA 4QIEA 5AT1B 1HLWA 4FBUA 2C22A 2WONB 4X4RA 1WC0A 2AZ3A 3PW5A 1HYSA 1RKJA 2LXIA 1S1TB 1ZZFA 1VR6A 3NNHA 1MN9A 1S9FA 4DPXA 2V34A 3A8KA 3RB6A 1HPZB 4PWDA 2MLZA 2C3YA 1UKUA 4CDIA 4NXNF 2ILYA 4C2MA 2IDEA 4ECRA 1HHQA 1IQZA 4KC5A 2HQGA 2LVWA 3OVSA 4IQMA 3KJNB 2ZBRA 4LSZB 3CJ0A 3DDKA 4CO0A 1CC7A 1M5SA 1RHJB 2M3DA 3HSGA 2ATCB 2M7SA 3EMTA 3K5MA 4ECUA 1JNZB 3QMQA 4RUCA 4DV6F 1ACMB 1ZPVA 1I51B 4PXEA 1K1SA 1VGYA 2DITA 4WJBA 2IJNA 5F9LA 3KJVA 1HQUB 2O1PA 3EXCX 1RTJB 3SSSA 4QWBA 3MUVP 2F9DA 5CXTA 2IAJA 1OQ6A 4M5MA 3KDNA 4CT9A 2IRXA 1Q5YA 2C2OB 4M1KA 4HT5A 4DL3A 4DZDA 2D69A 2H54B 2V9WA 2W4CA 1VJQA 1VISA 4O4GA 3KJVB 3CC2S 3NMRA 1RTHB 3NGSA 4P2SA 1VC0A 3I56S 3PV8A 3M6WA 1S4EA 1S1UB 1T9XA 3TNVA 4R5PB 2ASJA 4LF9J 4RUHA 4PWUA 4QIWD 2VD3A 3PRBA 3RRGA 2Y0BB 1ZYQA 4F2SA 1CVJA 4B3OB 9RUBA 5JXSA 4DV3J 1RT1A 1TL4A 3P45B 5J2QB 1V3ZA 3FKBA 1RAOA 1TVRB 4I4BA 2DIUA 2ZVSA 1IR2A 1QVFR 4GKKJ 2QIFA 3SXLA 3HM9A 3EPIA 4RW7B 3KXDA 1FJGJ 4OI2A 1P1LA 2A3JA 4OZ0A 1YSJA 2J0QD 1EP4A 4X2BA 2V68A 3DRXA 1FK9B 2AU0A 4BS2A 2MSTA 1CJKB 3A8EA 1RGVA 2GQCA 3CXCR 4ZVHA 5ETKA 3S1TA 4AFFA 2YNIB 2QA2A 3OTDA 2XZDB 5C42A 1BQNB 2K06A 2NUUG 1LWEA 4WWSA 5IZHA 3DRYA 2RQCA 2VH7A 1UEVA 2P9CA 1RAIB 1QDUB 1WG5A 1WHXA 2KI2A 3NWGA 2XHCA 1C1BA 1Y5NB 1UWAA 2EK6A 2XYPB 3Q83A 5C42B 1OSDA 5J2MB 4JI4J 4CP5A 4M5DB 3HF5A 1VQPS 3DFEA 4KFBB 4DUZF 3RBDA 2HNDA 2ZC4A 3C6UB 3KK2B 1Q79A 4NRUA 4PQAA 3OR2A 5LJ3Y 5L9XA 2OFGX 5J2MA 2KYZA 4GVLA 2XYHB 4G6VB 4PZVA 5IM0A 4YDXA 4DV3F 1XNQJ 1QAYA 1ZAWA 4ZN1A 4HT7A 4RKUC 1RQ0A 2UUBF 4MFBA 2DNGA 1ZM4A 1GFWB 3U02A 4LRFA 1UL3A 2XGQA 4TLQA 2XGPA 2ZHBA 1AZSA 4RW4B 2CPDA 1T3OA 2SXLA 2YPZA 5HVFA 3K0JA 3W5XA 3VTIA 3BYPA 2BQ3A 2H4YB 4LBHA 2FZCB 3MI7X 4NCGB 2VFUA 2L41A 1S1VA 4KGZB 2KJVA 3HHLD 5GAEU 3JYTA 3F73A 2WVEA 2E1AA 3VAHA 3PX4A 4UY8T 2KHCA 2OHDA 1TL3B 1LK5A 2BX6A 3BKFA 4HDHA 4ENOA 4EBCA 4JI3F 4JI7F 4DWIA 3CW2C 3DLEA 4A8MP 2VOPA 2KT3A 4RNFA 3K5LA 4TYBA 3ZZUA 4P2MA 3FZ2A 1ZZNA 3HJFA 2IMWP 5DDPC 3NGRA 1JX4A 2NPFA 3FSYA 2CNLB 1R8CA 3QIDA 4OHYA 3M8YA 2F4FA 4J9VA 4MYTA 3OFEA 4PPDA 3NCQA 2X1GA 2K2PA 2L9WA 3IS9B 4PXDA 4AT1B 1U1KA 4LFCF 3O1LA 3V6HA 4LF8F 2FZKB 3OV7A 3O6QA 1KSPA 2DIVA 3K59A 3AQPA 4A8WA 1JLGA 1HMVB 2OEKA 1IJFB 2N82B 4N56A 3LAMA 2IJFA 4USTA 3V6JA 1LXJA 5HO4A 3MURP 2GO9A 3EZ5A 2FLLA 2Y8WA 3LALA 1S49A 2B3TB 3MR7A 3V5RA 4KAIA 1F3FA 1SJ1A 3I87A 3MTKA 4OLPA 3MPWA 2CQIA 2BYCA 2CPXA 3V2UC 1I6JA 4B3RJ 4IH5A 2L9DA 4MKVA 2HFSA 4PG6A 3NOGA 3TZXA 1B64A 3KFWX 2D7SA 2VF3A 2FGCA 4M5HA 1NB2A 3C14A 3V4IA 4JI7J 1A0OB 2WB1D 1X4FA 3AJ2A 4ED1A 1YJUA 5DRKA 2XO6A 1WF1A 3D1OA 5B0AA 2J5AA 1VBYA 2D74B 1FX2A 1NJZA 5F8JA 1IKVA 3A3OB 4K8RA 3KMSA 3BKTA 2DGWA 4TU9A 3QFHA 1J27A 3M2VB 4F3QA 3GIKA 5H9FJ 1T05A 5LMNF 4JI1J 4RL1A 2HAIA 4U8VA 4IO9Q 4ED2A 2BANB 4X64J 4U7CA 4Z7YA 2NPIA 1VK3A 5CCLA 3N4WA 4IG0A 3MOZA 3THVA 5AXNA 2DJWA 2VKZG 4TYAA 1FKPA 1YDLA 2OMOA 5BYQA 3SFUA 3PO5A 1URRA 4KGKA 4ECTA 3HK2A 3CD7A 3H7HB 1VHFA 2VFSA 2FVCA 3Q2SC 1H2UX 2IVFB 4XO0A 4DQRA 2PMWA 2V50A 1TKZB 3KLGB 1PBAA 3ILLA 2QLFB 2ZJRQ 2CPZA 1V5VA 2D3OR 2CQBA 1JLQB 4QIVA 1WHYA 1RBOB 2B5JB 3W9HA 4YHHJ 1R0AA 5BYSA 1VQ4S 4LFAF 1IM6A 4QZVB 2FJDB 1TAUA 3KWMA 3DLLQ 2B8PA 4EYHB 1VCTA 3SYZA 2OPQA 2UXDJ 3H5XA 2H5EA 4NL5A 3HT3A 1OPZA 1ZETA 2DYAA 2GQ2A 1JQGA 2RRNA 2BV3A 5CAAA 2VB6A 4K4YA 3J80Y 4NLDA 2XMTA 4DV2F 2HFVA 2NLWA 3M4XA 3O5TB 3PYEA 3IR7B 4RU9A 2DNQA 3EYZA 4IR1A 7FD1A 4Z37A 1TKXA 3UO0A 1YK9A 3M1VA 2AJQA 3DGPA 1OY6A 3UVJA 4CTAA 2CPYA 4JI1F 4NCBA 3A3PB 2HVEA 5GADU 1QSLA 4JI2F 4X64F 3SSRA 1CLFA 4DQIA 1RAEB 1WF0A 4GKJF 1MSWD 4TY9A 2GC8A 4DV7J 1BGXT 2KKHA 5KG2A 1QVGR 4WKYA 2PC6A 5GVQA 3KUGA 1ZA1B 4DG1A 4KH1B 2DXDA 3UD4P 2W2OP 2FVSA 4DV6J 3D7SB 3IA0A 2HSEB 3QIPB 2VZ9A 4WXWA 3PW7A 1X9WA 3DYAA 2H9ZA 4YFUA 4ECXA 1HI8A 5J2QA 2VJVA 3B78A 3QFWA 4MKBA 2N3LA 2AZ1A 3F44A 2J8AA 4F4ZA 1EJ7L 4MYUA 2K3IA 1NH8A 2LQ9A 2DT9A 1HWKA 3BGRA 1RUSA 4E8UA 4YR3A 1SJFA 4EMDA 2WSFC 2FHJA 3BBFA 1GMWA 2B9YA 2EBGA 1Y3JA 5GMEA 1U6ZA 3HPOA 2MPUA 2HLTA 4M5LA 2DD8S 2DHHA 2AYEA 5K8NA 3TARA 3C2PA 1S76D 2WCXA 4HH1A 3H5YA 1HYSB 4K50A 1I1GA 5D77A 2D3ZA 2JC1A 3AXMA 5E3PA 5KFJA 1DTTA 4B9NA 4BWJA 3MUTP 2QA4S 5GAGU 2MKYA 3KK1B 3FSIA 1KRPA 5J1PA 3BEGB 1FRXA 1FJGF 1OS5A 1VQLS 3J7YU 5GMKa 1JLFB 3DM2A 5L1KA 5HLFB 2CQ1A 2D9PA 4GMKA 1S10A 2CXEA 4DV5F 2EFOA 3FK4A 4ZS6A 4LQ3A 2BZ2A 2IMOA 3CCSS 1JK9B 4IFYA 2FHKA 1VQMS 1GMWD 4ZOSA 3H90A 1SIWB 2XY7A 5HP1A 4C8YA 1D09B 1D8YA 2OEMA 2QV6A 3ZTOA 1S0MA 5HMWA 4ZJOA 1NLKL 3ZZTA 2YNFB 1NJXA 1HR0F 2XMKA 3LWLA 1KFSA 2ZDOA 3JXOA 2HWHA 3D3CJ 4Y2IA 4UY85 1SC4B 4DBQA 2W2NP 1S6QA 2QMWA 3D68A 4DPOA 9ATCB 2OMLA 2ZC3A 1N6QB 4F4AA 1RHKB 2EKYA 1YJTA 4H4KA 4ZHRA 1U1MA 5EN1A 3MFHA 5B7WA 3EXYA 4PXCA 1Q8KA 4IYQA 4RR5A 3OL9A 1P8GA 2XMJA 1QSYA 3GTYX 3DC2A 3N28A 4P9SA 2JDJA 5I42A 1SL1A 2QO3A 2GHVC 4OV6A 1OO0B 4Q2LA 1NAQA 3AD7C 3SV3A 1U1NA 2XMAA 2R8IA 2DRAA 5CYQA 1KQSR 1OY8A 4AUKA 4CM2A 1HA1A 2FIUA 5K9FA 1EKSA 4HHJA 1RJJA 2BKOA 2LQJA 3IR6B 3P5TL 4K2JA 1HNVA 1UWBA 4HTIA 1IWGA 4CH1A 1SV5B 2X1BA 1XMQF 2ZBQA 1HWLA 1S9GB 1TKDA 4U7UD 2CUYA 4DPUA 1H72C 4ZVGA 4CQ1A 1LNQA 3GONA 3KK3A 1DHMA 5GAGI 1KOHA 2ILZA 4CM0A 5E41A 3FZBA 2AJFE 2VBXA 1SCJB 4Y00A 1NUEA 2MZQA 1Z2LA 1IBLJ 2PMZD 1FRJA 2FQQB 5D4PA 1Y5IB 4ZDNA 3VHQA 1HW8A 3GIRA 3KLIA 2MZTA 4C0BA 2AKWB 2CPFA 3OXLA 4URQU 5HN0A 1T7PA 1HARA 2HYIB 2EFQA 1CG2A 2Z2YB 3DRPB 4O4RA 3EGNA 3OR2B 2GO8A 1WKLA 1R31A 1IBCB 3NG8A 5L9NA 2E5GA 5FD1A 3R1LA 1N48A 1NMEB 3NRBA 3KLIB 3W7BA 3CPWR 3HVAA 3CB4A 3IBCB 3UW1A 3LGMA 4CLWA 4OLOA 4QPTA 5E5NA 4H4MA 3NBPB 2ZZMA 3T19A 1N5YB 3VAFA 1KLNA 2HFOA 2XSJB 2CJ9A 2LA6A 2FVRA 3FRYA 3D6MB 4GVBA 4WPAA 3J7AN 3SDEA 1N33J 4DF8A 1TL3A 3HFVA 5IM0B 5IV4A 3H2VE 1FHTA 2IVMA 1N52B 5CA5A 2C1EB 4KPCA 1SPBP 3KHLA 2CJYB 3CJTA 1HI1A 3N6LA 4FVMA 2Y0SD 3AQOA 4KT0C 1R7IA 3SCIE 4B08A 2GA7A 4EI2A 2AEJA 1FJ7A 4RW4A 2QRRA 4OYIA 4HH0A 2PDAA 3DMJA 1TQLA 2C2ZB 2WRMA 1JJHA 3JSRA 5AXLA 3OLAA 4ED0A 3VALA 3G6XA 1T9YA 2AEFA 3QGGA 4NASA 3RBXA 1FRHA 2MQOA 5HK4A 1WTFA 5DO2A 1TL7A 3F41A 3VF0B 4ES2A 2QLJB 3QBCA 2R42A 2DO0A 1M1GA 2DISA 2BJ8A 2FJXA 4W92B 5D78A 1RP5A 2E5IA 3TO8A 3P8BB 2KRBA 4S0MA 4ZP7A 4ZPCA 2H5IB 3QZ7A 1SC1B 2EFGA 3VVUA 2GQQA 3MEGB 2ACMA 2RH3A 2UVUA 3GCWP 1FEEA 2FB0A 2XEXA 1U1OA 2E1PA 1P9YA 2HURA 2W24A 3PRVA 3L7PA 4Q7AA 4Y28C 1JJ4A 4CLSA 1M90T 3AODA 3FEYB 3NWRA 3OFGA 4G1PA 1RYSA 4QYZK 2LXUA 3MEGA 3CJ5A 5CD4A 2E9RX 1FRMA 3K2YA 1B0VA 5KT3A 4C8KA 1F9HA 3S8SA 1XNRF 1XWLA 3D54A 3H5SA 4RNMA 2HHUA 2HNZA 3TQEA 1EHWA 4ZPAA 4YY3F 4X62J 2UUCJ 3I32A 1XR5A 2JZ5A 3QNWB 1QE1A 1JLEA 4OJHA 1KC8T 4MK9A 2JOQA 3AOBA 3FQKA 1TR0A 1YJRA 4AXJA 1CS4A 2LYVA 2D1CA 4AL7A 3WIVA 1KVJA 3CDWA 2MQQA 2F4VF 1EAYC 1KTQA 3HVTA 1VRUA 2DHAA 5D3GA 1VMBA 1QJHA 4USKA 5A0YB 1UPMB 4DLGA 4ED6A 3UFCX 3C66A 5ADZA 2OP5A 5KT2A 2J6UA 4LF6J 3HHKA 1J5OA 3M8PB 1EIYB 2WSCC 4GKJJ 3BSAA 2J7UA 2R2RA 5E3QA 2CYYA 1GT8A 2QLBB 2ZKUA 5L8RC 1O8BA 3CJKB 3POTA 3RAMA 1ZM2A 3SQOP 5F8IA 3TZYA 4C4WA 2ZWPA 1CQMA 4H4OA 3FMBA 1S79A 4OI3A 2IM0A 3VGVA 2DRDA 1T9WA 3ETOA 3G8TA 3Q23A 2R9LA 2BQRA 2KL8A 4NWBA 4I2PA 1BUXA 4DL4A 2YWFA 1FKPB 3BR9A 4B9UA 1Q53A 4WYLA 4A48A 1H73A 4NZ6A 1U7LA 1NEEA 4DX7A 2ATLA 2R7SA 2Y9HA 1JMTA 4YN3B 1EKRA 1A9NB 2IA6A 1Y9OA 2HBZB 3MMBB 1ZTTA 4DV1J 1D9FA 2DNZA 3B4MA 2OLWA 1RHRB 3D67A 3DXSX 4L76A 3TA0A 3TZWA 3EM1A 3G87A 3ILJA 3LH2S 4KGVB 2EFVA 2GVZA 5M2PA 3VAJA 2X1FA 3M30B 1JLQA 4NLPA 1YBUA 1FE4A 3WX4A 1JJ2R 3W65A 2B4UA 3GE9A 1NJWA 3ZZYA 2XY5A 3HZEA 4K5RA 4MAKA 1LWCB 3C16B 1S6PB 5ETLA 4KPYA 5C25A 2BE2B 2E29A 3NGUA 2XQCA 4DV0J 4X4VA 1NK5A 2J6TA 3GZ7A 4C8OA 4PXBA 5AJ3F 1KWMA 4K4WA 2VBWA 3R6LB 3GFYA 4A8FA 4D3GA 2YKNA 4PYAA 4WIQA 3LUYA 5D0HA 2CA9A 1KVKA 4DQSA 1FESA 2IBOA 3CWJA 5JJBA 2HS4A 1RTZA 4C0HA 3IGNA 3LP0B 1MWQA 1E6VB 1X4EA 1IKVB 3CGIA 1DLOB 3EDQB 4CO1A 2WK4A 1DAXA 2EG2A 3CVKA 3M2VA 2CJXB 3GG1A 2CQPA 1UZHA 3PR4A 1RDRA 2JEJA 2J9EA 3DN9A 2LDYA 4TQSA 3O3LA 4CI0B 3AJDA 3LP2B 1FRLA 3U1NA 3D2WA 1N32J 1TV6B 2HIQA 2RUGA 3CNQP 1G2EA 1SJ4P 2GHPA 1EETB 1REVA 3HJVA 1EX8A 1RWMB 5LMUF 3K5PA 1RA7A 3A8JA 3UN2A 4IFVB 3H0PA 3PX0A 4OI1A 2AD9A 1S72S 1HPZA 2HIYA 1IKYB 2KN4A 1LWEB 4R0EA 3I55S 1PIEA 2H4WB 3NGDA 2JEFA 1Q7LB 3I4HX 4KKOB 2ROPA 4OZ5A 4LF4J 2J0XA 2AW0A 5KFXA 4DZ6A 5KT6A 1GH8A 2W25A 2BKNA 4CLYA 1R0CB 3JQJA 3W9JA 4ZLLA 4WFZA 5EHHA 1WOOA 4Q43A 5IQ6A 4LR8A 5FDLA 4N5SA 3ITHB 2W4PA 4M63A 4OHXA 1SBRA 3NY0A 1HQUA 3NS7B 3MMCA 3UN3A 2EEYA 1XIQA 2Z56B 1G3OA 2HS0A 3PHEA 3H40A 3FSXA 4DFJA 3D6TB 4FYXB 3C6TB 4RW8A 4UZCA 4O4GB 1S99A 3MPUB 2RQ4A 4PQUB 1BE4A 1H0HB 3D4JA 3IRXB 2MHNA 3T9ZA 2EFPA 2ZFHA 3H4BA 4F02A 1LW2A 4ANEA 1GXLA 4X4NA 3OTOJ 4N77A 3QAUA 1C0TB 3GJRB 4UUXA 2XTJP 3JYTB 1N56A 4OI6A 2HEKA 2D3UA 2GS8A 1FX4A 1B0TA 1GXTA 1VQYA 1YVFA 1D3WA 2MLYA 4TNOA 1QTMA 3T6JA 2HWIA 2QC3A 3RUBL 4BLGA 2FZGB 4FNHA 4HACA 5D0EA 2J7KA 4PUOB 3AOCA 3DOLB 4HLBA 1HQEB 5H9FK 2DNKA 2FC9A 3KYLA 4OJGA 4P72A 3M9OB 4QWCA 3GILA 4B3OA 2G2OA 2QMXA 3MM5A 4HACB 3MHYA 3D0IE 2BJ1A 4LFBF 2NQPA 5FJ4A 1IN0A 2DGUA 3LP1B 3SSQA 4X66J 5L46A 5EDWA 4IRCA 1RT6B 1ZBTA 1CEZA 2DNMA 3DHXA 2KG0A 4KGMA 4RNNA 5ETVA 3W1YC 3M8WA 2BKPA 4N47A 3L7OA 1T9TA 2YKAA 4WU3A 1VQ7S 2HPUA 1FDAA 3HX9A 4KY3A 5AXMA 3W9IA 1NJIT 2PIIA 3BBBA 2GJ2A 1G7CB 2BOAA 2UV8G 3QQCD 3TEHB 6FDRA 1VQ6S 1MG7A 3I0RA 3HLUA 2JX2A 1L3KA 1KFDA 3IWNC 2HHTA 2KB2A 3FEXB 3GWCA 4PWDB 2W9BA 2VFTA 1SC6A 2VG6B 4BCAA 5ETQA 3SCKE 1NPKA 3OTBA 3K57A 4QW8A 1XMQJ 3TR5A 1SJRA 1MROB 3RRHA 2H51B 2I1RA 5L39A 1VC5A 4LVOP 3CCJS 1GNKA 4LSLA 1MMNA 2AYGA 4DSFA 2YNFA 2MMYA 2GZOA 4J9PA 4QJVA 1S6OA 3GCXP 4C8NA 4C6AA 3K7RA 1C4CA 1Q8BA 5D6GA 4DFMA 1NDPA 2MB0B 1AA1B 2O66A 2H5JB 3ZXWA 4ZCKA 5I3QA 3TAMB 1Y0HA 3UD5A 4P73A 5DLGA 2ZH2A 1XNRJ 2CDRB 2L3MA 4ELUA 2GW8A 4JI5F 1XEZA 3ZZPA 5E7OB 1OQ3A 3DCAA 4LBPA 4D3HA 1ZS6A 2IJRA 2W1BA 4P10A 4XPCA 5L38A 2UXCJ 3CO0P 4F3MA 2ZE2A 5F0UA 3MEDA 5FIIA 5CQGA 4F0HA 3DLBA 1HD1A 2MJNA 2LLZA 4FKXA 2HGMA 3R5AA 4LRDA 1LK7A 2XCAA 3BSNA 3HI9A 1ZM3A 4K4SA 3HHDA 2DHSA 3QT8A 1ZPWX 2B4OA 2ZE2B 1WHWA 1EP4B 1SQGA 3A1YG 1LFWA 1LKZA 3G82B 4AXIA 2C2DA 4ILMA 5E3CA 5J2PB 1FA0A 2HK2A 1D1UA 2HHHF 1NJYA 1TKTA 4O3QA 2BJ3A 2VICA 4DJBA 2DR7A 5GMDA 1FRKA 3QYYA 3J7YI 1HFEL 2RF2A 5HQMA 4QR1A 3WHIA 1IBKJ 3FNNA 1P1TA 4EZ6A 1B4SA 2OUGA 5KG3A 4LSNB 3R7SB 3DOMB 1CBKA 2DY1A 1MNEA 2BM0A 2QE5A 4P7VA 4ZVUB 2GV1A 3BQ1A 1OPIA 4JI6F 3MECA 3THTA 1L5UA 3T1YJ 1LWCA 3W2WB 4DR4J 2YKMA 4NX9A 1F60B 4DMZA 2ZBCA 1AFIA 2R8GA 4MK7A 2BW7A 4CO2A 4DHVA 3K89A 2DGXA 2GJFA 3OBIA 5D0RA 4ZIWA 1XMOF 5C7PA 2YKNB 5HJXA 3L9ZA 5DZ7A 2VONA 4M5NA 2NXEA 2K8GA 2BQUA 2OH2A 2R7UA 4DR6J 1GXUA 1C0UB 2AJ0A 2D41A 3GLJA 2YKQA 2LU2A 3MFIA 1HWJA 3I5AA 2I38A 4QBUA 1TFWA 2FLOA 2UV8A 3MOJB 3W8GA 1N34F 2CQCA 3QLHA 5A8WA 3JTNA 2E9ZA 4ES1A 4DR5F 3SBMA 2VG7B 1JKHB 1LW0A 1IKWB 4WFYA 4RX6A 3KLFB 4JYAF 1GMVA 4L74A 2FLNA 2HVDA 2BE9B 2R3VA 1HHTP 1QAXA 3M6VA 1AT1B 1UMJA 5ETMA 4Q8EA 1JXVA 1KBRA 2WW8A 2UZAA 4YP3A 3R1HA 2VG7A 4Y6IA 2ZH7A 3CTRA 5F8NA 2ALZA 1ZAVA 1N54B 1JIHA 1R27B 1VQ8S 1NM2A 3MUMP 4KH0B 4B3MF 1LWFB 5KG0A 2MDAA 2HS3A 2E1RA 3NEKA 4PPZA 2DR6A 2ZM6F 1BXNA 3T1YF 4O0NA 2MTLA 1N36F 1XQIA 2ROEA 3H2UB 4B9LA 1Y00A 1UETA 3RB4A 2FPHX 1XBWA 2VC0A 2IYGA 2OPQB 4B02A 1D8ZA 3CCZA 2G0IA 5D8HB 3MZIA 2HQIA 3M6UA 1IXKA 2DHGA 2JLEA 3OUYA 3LF0A 5L1JA 2MSSA 1VFJA 1H74A 5FDLB 4EBDA 3QGPA 1WEXA 3FQLA 1U6BA 2W7AA 4OV1A 4RNHA 3QAEA 4LT6A 4ICLA 5HP1B 4QCLA 3PO4A 3HKWA 3OW2R 2XLKA 3GMGA 4KTQA 3DI6B 1F6TA 1ELOA 3MCOA 3GFZA 5DZ6A 4EYIB 4QW9A 1VHIA 2DBBA 1LOUA 2MQNA 2MLXA 1F2HA 1FE0A 1R8HA 3ISND 4WE1B 2RILA 2MGZB 1CJUB 1QAIA 2KT5A 2UXBF 2GMHA 4JYAJ 2HQCA 1RBLA 3KNGA 1N6QA 4NLSA 4N8NA 5KT4A 3JAMU 2W9CA 2F7VA 2HQFA 1UA0A 1YGYA 2MYFA 1L3TA 1I5OB 2QLWA 4QYRA 1JLEB 3JS9A 2BE2A 4ZVQB 1RAGB 2HHPA 2JFDA 1XK8A 4A8OA 5IV3A 3GIMA 4DPWA 2MEWA 3BGRB 1N5QA 1XR6A 1UVJA 4IH6A 4NEZA 2V63A 3R7BB 3RRKA 4TU8A 5EWEA 5T7LA 3UNGC 2UUTA 2RJZA 4WCEQ 3BO2A 3SCJE 2UU9J 4J9KA 3TVKA 1S0OA 2JNJA 1H98A 3A3NB 3AA9A 1FXRA 2RT3A 3HCXA 4KSEB 1WJ9A 4X4PA 3J81U 2YQ3A 4X62F 1HNVB 1UWBB 3G8SA 2HZCA 3BQ0A 1RCXB 4USWA 3CEDA 3KK1A 1L3UA 2OTLS 2J9DE 3Q8QB 1VBKA 3G6ES 4B9VA 3RJMB 2XI3A 3CO9A 2RNEA 2DXFA 3DNCA 3F56A 2RQMA 2DTJA 3GJQB 4W98A 2IYIA 3SMZA 2Y8YA 3IMQJ 4M8LA 3OTCA 5DQGA 3X1LB 4WFBQ 3HP6A 2J6SA 3OSPA 1U26A 2E66A 3L4BC 4EO8A 1F2GA 3NAHA 3MR5A 2HLUA 4DS5A 3TAPA 4WF9Q 1FWPA 3RW7A 2DGOA 3ZTPA 3IWXA 3MPDA 1Q7YT 1PAUB 5A76A 1UFWA 3DOKB 1N8RT 5BR8F 1U24A 1NSPA 2M5YA 4IR9A 2HVZA 2WSEC 4R0JA 3A8IA 1PJ6A 4FF4A 1RT5B 1WSRA 3RBZA 4L3KA 1YKWA 4CNYA 4DCJB 3VGUA 1SIZA 3TW0A 3Q8UA 4J9SA 2VA2A 1R0BG 3PTWA 4G65A 2E7VA 3TUIC 3D6HB 3QPIA 4A4JA 4CWBA 3GV5B 2UU9F 4C98A 2RKIB 4FYVB 4QPXA 5H9EK 3DGPB 3ZZ0A 2DR9A 1WC6A 3T5HA 4JV5F 2KM8B 1R8PA 3ENWA 1FNOA 3EX7B 3QJPA 2L48A 3KTQA 1RKIA 1HNXJ 2JC0A 3TX0A 2AGPA 3DOLA 4V1Ak 1TVRA 3M7VA 2RSQA 3ZTSA 3J80U 2V4QA 2UVWA 2XNRA 4K0KJ 4DG1B 4YDDB 1VQKS 1N5SA 1T8EA 2PE8A 3C15A 1K44A 2Z58B 2HVIA 2Q6CA 2EKNA 5KFPA 4J9QA 3O44A 2MZRA 4UOGA 1NZ8A 4OX6A 1YIJS 2PEHA 2N3OA 2KFYA 4NLGA 1XJWB 2YVSA 2RQKA 4NMLA 2Z0GA 4KGXB 1WDDA 4I7FA 4BC9A 5A2QU 1FFGB 4ZP8A 3PNIA 2ZH6A 3GYNA 1RU2A 3BREA 3VV2B 5DM6Q 2ADBA 1UJ4A 2CQHA 5KT7A 5KFDA 2HNYB 1ICEB 2DKOB 1U1RA 1WC1A 5CHCB 5ITHA 2AF6A 4EO6A 3MM5B 3FFIA 3UCGA 1VRTA 2IIHA 3D66A 2KRRA 4FBTA 2ZDPA 5SZTA 3NL0A 2R7OA 5KFGA 2IDLA 1S9GA 2FYXA 1N4LA 2V8GA 1K0VA 2CNOB 2R8JA 3KHRA 1S1TA 4KBIA 3QT6A 2RMLA 5HI7A 2FHJD 1OMSA 2QLXA 4ILRA 4C11B 1Z2ZA 2ZITA 3GU0A 2GVDA 2ZD1B 4RUAA 4AE5A 2KM8C 3G4SS 2HGNA 4LRBA 1XMBA 2RIJA 4O3SA 4K0KF 3RGIA 3PW2A 5DETA 5A2QY 4TQRA 4B3SJ 2WOMA 1WEZA 4OYXA 4ELTA 4E0DA 2OSRA 1UVMA 2G9OA 2CKWA 3R3TA 3AOAA 3TVZA 2W9BB 4DR3J 3SI8A 3VZHA 4NCAA 4ID8A 5HBMB 2V2ZA 2DNYA 4LJMA 4O3OA 3GQCA 4JI0J 1PC4A 4ID5A 2X1AA 3KJFB 2RU3A 5DG7A 1QUVA 5CD4H 5KOXA 1Z4UA 3V6DA 2RD5C 3RAXA 3NCRA 5DS7A 4ZPWR 3TYTA 3TJ9A 4FS2A 3KLFA 2HW3A 1RTHA 3B4DA 4UW2A 1HNIA 1N0VC 2Z8QA 4Y2KA 1XMOJ 3H59A 4LF9F 5CYMB 1VQOS 5ETNA 3P3DA 3T9NA 2V67A 3WZ0A 3V6DB 1SI9A 2QZ8A 4OX9F 3BDEA 4ZVEA 2ZH5A 2BRLA 4ETXA 2Q66A 3P96A 1YJ9S 2XMMA 1J5EJ 3CDEA 5LXRA 2BJEA 3MCMA 2BABA 1N34J 2EW9A 3CD5A 2FJEB 3HMJG 2LQBA 4DL6A 3MCNA 2P9GA 1K0TA 3HT0A 1RWVB 3R5GA 4QR0A 2FJWA 3HSJA 1GK8A 3CIMA 4PWWA 2K3KA 3QRPA 1AW0A 2NR0A 4CLFA 5HJYA 5CCMA 1Q81T 1R8BA 2ZBPA 4USJC 4J9OA 2J7WA 2Q1LA 4IOBA 4OJ3A 4TXSA 4EFAC 3G82A 3RR7A 4OX8A 3FBCA 1KLMA 3R2DJ 1KDNA 2BEFA 4QIFA 2ZOGA 1YRTA 3MAAA 4Y34A 4FNIA 1IBLF 1MW7A 2MZJA 3M8QB 3T5KA 2UXCF 3DRRB 1UEUA 3DU5A 3S01A 2VV5A 1UJ6A 3GPAA 2C2KB 2K7JA 3N0VA 4MJKA 2NXCA 2VG5B 4BWMA 1C1BB 2V5HG 3P5BP 1NSKL 1WG4A 3KUHA 3K17A 4CH0S 1Q0NA 7FDRA 2VG6A 1C0UA 3KLVA 3P6YC 3IG1B 2WTFA 4HR2A 3FBFA 5RUBA 4CZCA 5CABA 1H2VZ 2AQ4A 4C3KA 3NOCA 2UUAJ 2O01C 4DI6A 2UVRA 3MF5A 2JEGA 5F0WA 4ED7A 4U6PA 1B0PA 4P2FA 3JSMB 3GIJA 2CQ4A 1J5EF 1BLUA 1RTDB 2FD2A 2C2MB 1SKSA 4B9TA 4LF5J 2NUHA 1QM9A 2CQDA 2QSFA 2KZZA 3PFOA 1MLAA 1FVQA 2I6WA 3ET6B 5F8HA 2J8SA 2XS7A 2K7KA 2PEBA 1S5ZA 4GC7A 3OLBA 4KV8A 2CVIA 3AXKA 3CDAA 1J2VA 3AY0A 2ZHOA 4IG3B 4A8XA 1NPRA 4Y2CA 1TV6A 5G0RA 4TLRA 1BD6A 3OPKA 3ET6A 4UOHA 2A2CA 2V8VA 5FLXU 1REVB 2E5LJ 3T5LA 4PRFA 3M8SA 5KG1A 1IJEB 2PI4A 1R43A 4YEAA 1R3NA 5K8PA 2V94A 1RTIA 2ZHAA 2JEIA 5E33A 3I96A 4K4VA 2WONA 1V9OA 1Z1ZA 3JTOA 4FDFA 4X4UA 1S6UA 3MM6A 3HKZD 1PAEX 2QJ3A 2KYXA 3R2CJ 4O0IA 4OX7A 4AYBD 1NH7A 2G0JA 3KLGA 4LF8J 3EVMA 1KQKA 4LF7J 2DNPA 4IFYB 3E3XA 4PAAA 1V6HA 3HSDA 2GCFA 3KG0A 3OXFA 2RF2B 2B6AB 3SIPB 1S12A 4QYZJ 5EWFA 2YXLA 1NO8A 3MAHA 1F5CA 3W64A 1BMQB 4RNOA 4RBUA 3OL7A 2R7WA 4J9MA 3SZ2A 4IO1A 3ENVA 5HL7Q 4JI8J 1ZAXA 3BGOP 1DQAA 3PYGA 1N36J 2PA8D 3DU6A 3TUZC 3GFXA 4ATNA 1S57A 1QTNB 4CO3A 4DV4F 3UCUP 3CDUA 2ERRA 1JJCB 3CCMS 1E6VA 2ZEJA 1JLCB 2AWZA 5KFAA 5IT4A 3E51A 2UUCF 5DDRC 2P6SA 3PDNA 3R6GB 3KNAA 2EK1A 1FT8A 2YKOA 4WK1A 2P9EA 1FXLA 4OYPA 2ZH3A 4H54A 4P74A 2KO1A 2QL7B 1FO1A 4L6V3 1NDLA 2ZOMA 4RPFA 3BB5A 5HQ8A 1X5PA 5HVGA 2W2MP 3AH6A 2PD1A 1X4CA 3H5UA 4CIOA 5I3UA 4OYBA 2V6AA 3H2LA 4LUBA 3MEKA 3Q8PB 4LF7F 1VI7A 3LP1A 1CJKA 2QN6B 1FRIA 2Z2ZA 5E3AA 5KFSA 5AE3A 5BXIA 1RT6A 3POTB 4O3PA 1TL1A 2EVZA 4CRJA 5EGYA 4QWAA 3CJ2A 1WEYA 2WHOA 2JSXA 3C3LA 4K7QA 4G3IA 4NMXA 3OR1A 4MIBA 3ZC4A 4G1QA 4H4KC 1KONA 1XC9A 1RT5A 2XM3A 3D9BA 5C24B 4YHHF 4F4XA 5M2RA 4UT4A 3H20A 3US5A 8ATCB 2KXHA 4OZNA 3CCRS 5IS2A 2WW4A 1WELA 2C28A 4KFBA 1MU2A 2QFIA 1AUSL 5ETTA 1HNZF 4LFCJ 1IVZA 3L09A 4M94A 2F8MA 1HBOA 1RWOB 1CC8A 1R6VA 2VFVA 4LSLB 1OIAA 2OSQA 3SFGA 4NA3A 1WWHA 2XSJA 2OPPB 3V4MA 4DUYJ 3AAWB 3H42A 3ZZZA 1U1QA 5EX3A 2XG8A 2XCPA 3SDEB 4DF4A 4ZPDA 4A8KA 1S1UA 4R5PA 1RAJA 2XNQA 2BM1A 1NK4A 4NOHA 5DG8A 1K8AT 5F8MA 2XLJA 3H4DA 1UVIA 3UD3P 4DPYA 1N5VA 5KFWA 4DL0C 5CYQB 2RKIA 3B82A 2W8KA 3N79A 2IAJB 1NDCA 2DNLA 3CJ8A 2HRYA 2YQ0A 5MLCV 1K47A 3Q2TC 1Q1KA 1YZ6A 5F8GA 1BWVA 2Q6BA 2YNGB 4U8YA 3MAQA 2UUBJ 3VQTA 3T3FA 1RCOB 1SH2A 3DLHA 3EGVA 4B9MA 1VIXA 2JL9A 4E2FB 4X65F 4KYZA 1QAJA 1TAQA 4FZVA 1U0SA 2APOA 4FXVA 4OHZA 3KK3B 4KHPJ 1T11A 1R89A 4CT8A 5KFRA 3QO9B 2C2RA 4BC7A 1RHMB 1UPPA 4M5IA 5CZXA 4JUZA 1EETA 1S9EB 2KXFA 5KFNA 3QATA 4F50A 4PG5A 1IKXB 3OFFA 4XPEA 5KFOA 4QQBA 1SB6A 1SV5A 1UCNA 2BJDA 1FK9A 3EZUA 4L72B 4NLXA 4YMEA 2J9DA 5KG4A 2DO4A 3R7NB 3G96A 3M8QA 3FRZA 1FEHA 3ADAC 5D0GA 1EQ0A 3N5BA 3LQVA 3VAMA 2OPRA 3DLKA 4CLPA 2KTQA 2JWNA 1Y5LB 2RU9A 2KVQE 2IVYA 3PCOB 4JBCA 3W2VA 4KR0B 5AE2A 1NK6A 3DXBA 3MR2A 4WFNQ 4ECZA 2BDPA 5K5MA 3QWUA 4ID5B 4LFAJ 4ZCIA 3V81A 1YJ7A 4WP8A 1SKUB 3PW4A 4F4WA 1X5SA 4DS4A 5HMZA 4HEA9 3E2EA 1GTEA 3QSYB 1W2BR 4FP9A 3PM9A 4X65J 5KFFA 1BC6A 1U48A 2EG1A 2XYGB 4WFAQ 4ZVSB 4C8ZA 2CZ4A 1H6KX 2VQFJ 3KMQA 3CE8A 4FKYA 5LL6d 2E7WA 2YTCA 3CCTA 2MXYA 2G2YA 3R5CA 1LV5A 2VODA 4GKKF 2VQEF 3ZFVA 3R5JB 4DDFA 1X8DA 3BQ2A 3QRRA 3OTOF 2OTJS 2FGOA 2UUAF 3M05A 3RB3A 4Z2XA 1S1XA 8RUCA 2A1BA 2IM2A 4OYZA 2RDIA 3B8HA 4G1IA 3UCZP 1FJEB 4GO7X 1GMUA 2NXJA 3R5DA 2PMHA 4TN2A 3KDOA 4NE9C 4RW6B 5CYMA 4RBVA 1TUWA 1KEKA 3PY8A 1KVIA 2AIRB 3WC0A 2KVIA 1X9SA 5B0DA 4CH7A 4LFBJ 1D9AA 1VIOA 4A47A 5DM7Q 1M5OC 4JV1A 3R27A 1NK0A 2K1RB 5BJRA 2HFZA 2KJWA 1TU0B 4J91A 3MECB 1DARA 5F8LA 2R2TA 1IKXA 2CRLA 3FGVA 1X5TA 1U25A 3FC9A 3FFIB 5EWGA 4C9DA 1SKRA 1BQNA 4W90B 1DJ0A 1DURA 1HBMB 4ZA1A 2UP1A 1Q5VA 2LCWA 4N7TA 4F7VA 2X3DA 2YY3A 3I0RB 4I68A 4OZ3A 1KP6A 3D5MA 1RSCA 1SQEA 2YX1A 3DLGB 4KRWA 1GX5A 2JVOA 3MM8B 5DG9A 3GV8B 3D28A 3MAAB 2AX1A 3MPVA 1IR1A 2B43A 3JQKA 3NP5A 1CS4B 3DRRA 3OHBA 4DSLA 1UVLA 5CYJA 2XS2A 3NNAA 5KG7A 1S59A 2GIRA 4ECWA 5LT5A 5K8OA 2YKMB 1HHSA 1T03A 2RHQB 3GR1A 4WU2A 5ETPA 1JKHA 3NAIA 2N4DA 4DSEA 4RWXA 4Z7CA 2WB4A 3GSDA 2HBYB 1J5OB 1JLBB 2VDHA 4DQPA 1UW4A 1AZSB 5G0RB 5LSOA 5GAHU 3BO4A 5DQIA 5H9EJ 1RABB 4ZVOB 2MKIA 1W2IA 4BHQA 2COLA 3CDBA 3VAGA 2IC3B 3ICLA 2XZWA 3S7RA 1XTZA 2VPXB 3MMAB 1YLXA 4EU0A 3OL8A 2MQLA 2LA4A 3J7Z5 3IWLA 3SV4A 3MEDB 4I6YA 1HD0A 3DLEB 2DH8A 4PG4A 2LMIA 2E5HA 3UQSA 3HHNB 2GGPB 2XHWA 2HQ3A 3NNCA 1TUGB 2CJBA 3UDLA 3G2XA 2IC3A 2VL1A 3ELHA 8AT1B 1NB7A 5EX0A 4X4QA 2N4CA 2X51A 5C5JA 2FVQA 3K8VA 4P71A 5J2PA 3Q86A 5IWAJ 1APSA 1RLDA 2LKZA 4OIXA 5J1EB 2IRYA 1E6YA 1FNMA 5JUMA 3Q22A 2K1RA 1Y11A 1UP1A 2W2QP 3IFEA 4OYOA 4RUBA 3CJRA 4CO5A 3MM6B 1BQXA 3HD2A 2YNHA 2ZH4A 1TL5A 2RS2A 4PABA 1VRQC 1MN7A 1VLOA 4DL7A 1VQ9S 2DPIA 1HBOB 1SQFA 2OD4A 1IQTA 4OZJA 5FLXY 3AT1B 2FJAB 1CPZA 1ZM9A 3M6XA 5KFTA 4LRAA 2NZCA 3QZ8A 1I94F 2M8HA 3MM8A 2NSCA 4UUWA 2R7XA 4NYOA 2CWKA 3IRXA 4UTGA 2WVFA 2ABYA 2JVRA 3N6MA 3QGIA 3Q24A 3MM9A 1X4AA 1YG0A 2NSBA 5E3RA 2C2EA 2QA1A 1H3DA 3GR0A 4YY3J 4LBIA 4K4ZA 1D9DA 4M5GA 1FTRA 4LIWA 2FHMA 4OHWA 5F3TA 5AXKA 5T41A 3VAIA 1WI6A 1CJVA 1T9VA 2J76E 5DDQC 4C3MA 4M5JA 4E98A 1URNA 1DY3A 3I9V9 2Q79A 2IFXA 2O3DA 1WC4A 2V2VA 3JTPA 2VDIA 3CMQA 1PO6A 2F4VJ 1PBUA 4K59A 4ES3A 3PR5B 2E9TA 2R2SA 4DR2F 1F0XA 3UI3A 2DXEA 3K8WA 3P4UB 5D4LA 4MH8A 1VYAA 4ZP6A 2B51A 5KFLA 3UR3C 3ZTRA 4I67A 2HHWA 4PYDA 3MXHP 5KT5A 2FY8A 1IKYA 4EGLA 1RWUA 4IG0B 1B3TA 2CIMA 3TRGA 3E01A 4MMOA 4UZBA 3PW0A 3T1HF 1JLFA 3DM2B 3KJQB 1YBAA 5HLFA 2XY6A 1PKUA 3FEZA 1RAFB 2FHOB 1T02A 2W7PA 4P75A 2DNRA 2P5VA 4ZP9A 3E8OA 2EXUA 3ITHA 1TL1B 3LAKA 1SC3B 2BACA 5DJBA 3BO3A 2DR5A 3OFHA 2HAFA 2ZBIA 4WP3A 1RT3B 1DQ8A 1XN9A 2Q3PA 2VC1A 2ZD1A 2ZNYA 3N01A 4HHUA 4LR7A 4M5DA 3T1AA 1WSVA 1B7YB 3EJMA 4KKOA 4RW8B 3VWSA 4J9RA 3OHAA 1FF2A 1YWXA 2C3MA 5C24A 2Y1RI 1GX6A 1RADB 3IBWA 3V81B 2V8DA 3HO1A 3GIIA 3L95X 3PJWA 2DH9A 2MKJA 2QX0A 2G13A 1UAWA 3TOQA 1I3OB 5M2UA 1YJVA
chains in the Genus database with same CATH topology
3D3CJ 4X62J 4DR2J 2UUCJ 2UUAJ 5LMNJ 4JI7J 4JI3J 4DR6J 1HNXJ 3OTOJ 4LF5J 4JI5J 4OX9J 2UXBJ 4V1Ak 3J80U 4K0KJ 4LF9J 5AJ3J 4DV4J 1HNZJ 2UUBJ 4LF6J 4JI1J 4RJVA 4DV3J 2VQEJ 4GKJJ 1I94J 4X64J 4GKKJ 4KYZA 1FJGJ 4KHPJ 5FLXU 2E5LJ 5A2QU 4NXNJ 4X66J 4NEYA 2MTLA 2KL8A 1HR0J 4JI2J 3W1YC 5IWAJ 4DV2J 4YHHJ 4DV5J 1IBLJ 5BR8J 3R2CJ 4LF8J 4KY3A 4DV1J 4LF7J 2MQ8A 3T1HJ 2HHHJ 2UXDJ 4B3TJ 4DR7J 4JI4J 2KVQE 1IBMJ 1HNWJ 1XMQJ 4LFAJ 4B3SJ 4JI8J 4DV0J 1N36J 4JYAJ 4JV5J 4DR3J 1XNQJ 3JAMU 4X65J 3J7AN 4YY3J 4JI0J 1N33J 2VQFJ 4DV7J 4DR4J 4NXMJ 4DR5J 4DV6J 1XNRJ 2MEWA 5IT9U 2F4VJ 4NEZA 1XMOJ 2UU9J 2UXCJ 3J81U 4DR1J 1J5EJ 1N32J 1N34J 3IMQJ 4B3MJ 4PWWA 4JI6J 4LFBJ 4DUZJ 4LF4J 3R2DJ 1IBKJ 2ZM6J 5LMUJ 3D3BJ 4HHUA 5LM7E 4LFCJ 3T1YJ 4B3RJ 4DUYJ 4AQYJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D3C J;  4X62 J;  4DR2 J;  2UUC J;  2UUA J;  5LMN J;  4JI7 J;  4JI3 J;  4DR6 J;  1HNX J;  3OTO J;  4LF5 J;  4JI5 J;  4OX9 J;  2UXB J;  4V1A k;  3J80 U;  4K0K J;  4LF9 J;  5AJ3 J;  4DV4 J;  1HNZ J;  2UUB J;  4LF6 J;  4JI1 J;  4RJV A;  4DV3 J;  2VQE J;  4GKJ J;  1I94 J;  4X64 J;  4GKK J;  4KYZ A;  1FJG J;  4KHP J;  5FLX U;  2E5L J;  5A2Q U;  4NXN J;  4X66 J;  4NEY A;  2MTL A;  2KL8 A;  1HR0 J;  4JI2 J;  3W1Y C;  5IWA J;  4DV2 J;  4YHH J;  4DV5 J;  1IBL J;  5BR8 J;  3R2C J;  4LF8 J;  4KY3 A;  4DV1 J;  4LF7 J;  2MQ8 A;  3T1H J;  2HHH J;  2UXD J;  4B3T J;  4DR7 J;  4JI4 J;  2KVQ E;  1IBM J;  1HNW J;  1XMQ J;  4LFA J;  4B3S J;  4JI8 J;  4DV0 J;  1N36 J;  4JYA J;  4JV5 J;  4DR3 J;  1XNQ J;  3JAM U;  4X65 J;  3J7A N;  4YY3 J;  4JI0 J;  1N33 J;  2VQF J;  4DV7 J;  4DR4 J;  4NXM J;  4DR5 J;  4DV6 J;  1XNR J;  2MEW A;  5IT9 U;  2F4V J;  4NEZ A;  1XMO J;  2UU9 J;  2UXC J;  3J81 U;  4DR1 J;  1J5E J;  1N32 J;  1N34 J;  3IMQ J;  4B3M J;  4PWW A;  4JI6 J;  4LFB J;  4DUZ J;  4LF4 J;  3R2D J;  1IBK J;  2ZM6 J;  5LMU J;  3D3B J;  4HHU A;  5LM7 E;  4LFC J;  3T1Y J;  4B3R J;  4DUY J;  4AQY J; 
#chains in the Genus database with same CATH topology
 4DR2 J;  2I9S A;  2H1Y A;  2QEX S;  5LMN J;  4K4X A;  2DY9 A;  1RAH B;  4IRD A;  1JLA B;  1FWL A;  4WXO A;  4GO5 X;  5U47 A;  4JI4 F;  3G86 A;  1SL2 A;  1U1L A;  2CJK A;  3GSI A;  4F4Y A;  4K4U A;  1Q95 G;  3IAS 9;  3CD0 A;  3TZZ A;  4LRC A;  1O51 A;  2QT7 A;  3K5N A;  1HNZ J;  1VBZ A;  2ZVI A;  2Y1J A;  4ZHR B;  1S7I A;  1N33 F;  1FCA A;  1IWA A;  2B7C B;  4RJV A;  2AYB A;  1QY7 A;  1X4B A;  3G71 S;  4DX5 A;  1U49 A;  4I1T A;  4DCO B;  2D3O 1;  1TMJ A;  1V3R A;  4MK8 A;  1ZOT A;  5B0C A;  4J90 A;  4RW9 A;  3W61 A;  3BGU A;  4O3R A;  3G8Q A;  4UOC A;  4DUT A;  1P9Q C;  3J81 Y;  4K4T A;  2HHS A;  3FCW A;  2E44 A;  4YB1 P;  2DR8 A;  1HBN B;  3IBF B;  3D1H A;  1IR0 A;  2ACY A;  1UFL A;  4ECS A;  2YBV A;  1C1C A;  1UZD A;  3DRS B;  5D4O A;  2P6T A;  2C42 A;  1U8W A;  3THP A;  4EUV A;  2AEM A;  5I3P A;  4RW9 B;  4ZLJ A;  3FCV A;  2B4V A;  4MIA A;  2IA0 A;  4FPR A;  2IRU A;  4BBY A;  4DV2 J;  3R9L A;  3VAK A;  4C3L A;  5A6P A;  2E1C A;  4F4K A;  2HFU A;  3DOM A;  4DN9 A;  1NBE B;  2DK2 A;  1S97 A;  3FMW A;  2GAG C;  3EWG A;  2X7I A;  3IC1 A;  1F9E B;  4V19 J;  2KT2 A;  2YX4 A;  2JRS A;  2YNI A;  5ETS A;  1RZM A;  3SQG A;  3A13 A;  1CQN A;  2RB7 A;  1U45 A;  1RT3 A;  3ISN C;  5DQH A;  2M4M A;  4B17 A;  2DNN A;  1TK5 A;  3PEJ A;  4ZPB A;  4F25 A;  2I5J A;  4WYW A;  4AL6 A;  2IBK A;  1FDD A;  2G1H A;  2V4J A;  4M95 A;  1X0P A;  2LP4 A;  3W8P A;  2EWH A;  4C11 A;  2HZA A;  4ED3 A;  4A8Y A;  3HVR A;  1X9M A;  2A0F B;  3HD1 A;  4F3O A;  4OI4 A;  3JSM A;  2AT1 B;  2MHE A;  2WBR A;  2ZUG A;  2ZUA A;  4NI2 A;  1RTJ A;  4F67 A;  4DOZ A;  1S1V B;  3CCL S;  1RT7 B;  1G4C A;  3O2I A;  5BYR A;  1HWI A;  1S1X B;  4OYA A;  3V6K A;  4XDD A;  4MKY A;  4NXM J;  4OI0 A;  3I82 A;  4YB5 A;  2G4B A;  4FF3 A;  2KXN B;  1WKK A;  3RW6 A;  1HNX F;  4MFB B;  1RT7 A;  3PFE A;  1UA1 A;  5HAO A;  4ZVP B;  4I56 A;  5HRO B;  4DUY F;  3MD1 A;  3CJK A;  1VDH A;  4WK3 A;  5L1I A;  4LQ9 A;  4DR1 J;  4C97 A;  4MIW A;  1CJT A;  2Z2L A;  2GGP A;  3NS6 A;  4P6Q A;  3UDV A;  5C2C A;  5J2N A;  4JV2 A;  5ETO A;  2AGO A;  4DR7 F;  5IC4 B;  3FVY A;  3DHW C;  4IDK A;  4ZLP A;  1MML A;  3ZNJ 1;  3EGW B;  3QO9 A;  2BE7 D;  2CNK B;  2CQG A;  3MEE B;  3TI0 A;  1KN6 A;  1E6Y B;  2B4P A;  5K20 B;  5KFH A;  1B70 B;  1A7G E;  3TUJ C;  4DLE A;  3B54 A;  4NLV A;  4ER8 A;  1HQ2 A;  1PGZ A;  2M0G B;  4A8Q A;  1N88 A;  2CPJ A;  3MEE A;  4DU7 A;  2WVD A;  2I8E A;  3PRD A;  1UVN A;  2IHR 1;  5LMU J;  3PHT A;  3T5J A;  2BOP A;  4ECV A;  3EDR B;  4NLO A;  3DRP A;  3FCH A;  3VCD A;  4N41 A;  2YQ1 A;  1NZA A;  4WTO B;  1QE1 B;  1KLM B;  1TKX B;  2BJ9 A;  4LF4 F;  1X5O A;  2EI5 A;  2GVD B;  4DQQ A;  1QSS A;  4CLL A;  2HVH A;  3UVJ B;  4CTA B;  5LSL A;  1KTV A;  1FFW B;  4ZN3 A;  3ZO7 A;  4LMZ A;  2OO4 A;  2DGS A;  5HMX A;  3NBP A;  5IOL A;  3HVT B;  2BRK A;  2JHE A;  4DV7 F;  4DR1 F;  3FBE A;  1N5Y A;  4RO0 A;  3D1Q A;  1R8A A;  3BN7 A;  3FJ2 A;  4CYU A;  5GAE I;  5LSR A;  4FPI A;  1PG5 B;  2HWT A;  1F5A A;  4CLT A;  3X3U A;  3BH7 B;  1FDB A;  3QRQ A;  4DV0 F;  2R2U A;  3HHE A;  1IBM F;  2J0S D;  2CPE A;  2OD6 A;  4R25 A;  5T7L B;  3PKM A;  4MT1 A;  1OYE A;  5AJ3 J;  3PYF A;  1ZTW A;  2HMI A;  1NXI A;  4ZMM A;  4KJI A;  3LAN A;  2CQ3 A;  1VBX A;  2NXN A;  3LA0 A;  4X84 A;  4XK8 C;  4YUD A;  5K14 A;  1KNZ A;  4DL5 A;  1HNI B;  2ZKT A;  1RTI B;  4FN5 A;  3AD9 C;  3ILI A;  4DPT A;  3F0N A;  1VJW A;  4I69 A;  1TKZ A;  4IKA A;  4OFZ A;  3CJQ A;  1C2P A;  1RU1 A;  1T94 A;  2GFF A;  2B0G A;  2V2Q A;  2YWH A;  4MKA A;  4Q45 A;  2E5L F;  2Y1L B;  4WFX A;  2BAN A;  5SUH A;  2GJI A;  4EK2 A;  3EZO A;  4U67 Q;  2XBP A;  1TEL A;  3CSK A;  2EC2 A;  1F9F A;  2P2C B;  4G1Q B;  4OHV A;  2PFD A;  5B0G A;  2XLI A;  4HVZ A;  3RZA A;  3PZP A;  1V3S A;  1XER A;  4KIA A;  3M9M B;  4Y3C A;  4DXL A;  2N7Y A;  1N32 F;  3JSY A;  1PC5 A;  3NS5 A;  5F9N A;  3Q89 A;  1K1Q A;  4DV5 J;  2YPY A;  3JSB A;  4TY8 B;  4NLQ A;  5A8R A;  1NDK A;  1FD8 A;  4U95 A;  3OJS A;  2E5J A;  3VGS A;  4YS2 A;  2CDQ A;  4X66 F;  2KH9 A;  5KFM A;  5IQQ A;  1FWK A;  3T1H J;  1IBK F;  1RI7 A;  4B3T J;  1HBM A;  3CCE S;  4NZ7 A;  4N76 A;  5I4M A;  1X4D A;  1IBM J;  3IP0 A;  3W60 A;  2MQP A;  3OT9 A;  2ZH1 A;  3HSZ A;  2ADC A;  1HNW J;  2JH3 A;  1Q16 B;  2MY7 A;  2VG5 A;  4FYW B;  4HYK A;  2VU5 A;  4J5O A;  1N0U A;  4FYD A;  3I31 A;  1WG1 A;  1X7V A;  2JJ4 D;  4P7T A;  3CC4 S;  4C7Q A;  2B9W A;  1B99 A;  1LXN A;  1SJ3 P;  5G4D A;  2JFK A;  3W5Z A;  3LP0 A;  4LF6 F;  1S6P A;  2KDO A;  4KB7 A;  4R8U B;  2VPZ B;  1M1H A;  1X0F A;  3OTE A;  1YTY A;  4U96 A;  3U1L A;  4M5K A;  3BN4 A;  4O3N A;  2W8L A;  2B56 A;  2HKE A;  3PIO Q;  2LEB A;  4QIG A;  5KFE A;  3DKD A;  2OEL A;  2QYG A;  4NLT A;  4NPO A;  2N7C A;  1HQE A;  5A0Y A;  5HVH A;  2FDN A;  2W7O A;  4ETZ A;  3PX6 A;  3CME S;  2CNN B;  3I0S B;  5CH7 B;  1HIY A;  3E01 B;  2CWX A;  2XMW A;  1OYD A;  4ERD A;  1RWW B;  2AJ1 A;  4QWE A;  1X60 A;  1U0H B;  4C8M A;  3H25 A;  2W2P P;  4EWT A;  1M5V C;  3G9C A;  3AFG A;  3CIZ A;  3KLE B;  4B3T F;  3I6P A;  1VQS A;  2A6M A;  4DFP A;  2YKP A;  5DLF A;  1ITP A;  1YX2 A;  4B3M J;  3LPE A;  4C8L A;  3LGN A;  3NCP A;  1TFY A;  2Y3Y A;  1NKC A;  2BXJ A;  2PFF B;  3GYG A;  3I5C A;  1X31 C;  4WP9 A;  3N9U C;  3LWM A;  1L3S A;  3IM8 A;  5F3Z A;  1NSQ A;  5DGB A;  3BYR A;  3BV8 A;  3TP2 A;  4I2Q A;  1TMM A;  1HWU A;  2OFH X;  3SQG B;  5J1E A;  1U8S A;  4IOA Q;  1AFJ A;  5IC6 B;  2HZV A;  3IO1 A;  2U2F A;  1RWX B;  2DNO A;  3OL6 A;  3CF5 Q;  1FFS B;  2M8D B;  4ICL B;  4DX8 H;  3U7J A;  3EE3 A;  4TU7 A;  2DEJ A;  1Q8I A;  1AUD A;  4Q8F A;  2WOM B;  1WUU A;  4ZLN A;  1NCL A;  1WOR A;  4QWD A;  3KHH A;  2WBM A;  2NYH A;  1XR7 A;  5EUH A;  3Q8V A;  1C0T A;  4DFK A;  2DHX A;  3LPY A;  1NRK A;  2F9J A;  3G6Y A;  2UUW A;  2EFN A;  5B08 A;  5THW A;  2RUS A;  2RAQ A;  3C6T A;  3W2W A;  2F5G A;  4UF4 A;  2MZ1 A;  5L1L A;  5KFB A;  1RT1 B;  4RBT A;  1SUQ A;  5JVG Q;  1FKA F;  2VJU A;  1U1P A;  1YQH A;  3FBB A;  4WKR A;  1DFD A;  2CAD A;  4J9N A;  1Q86 T;  2DVI A;  3VVT A;  4DCP B;  1S1W B;  2IY5 B;  4GC6 A;  4NA1 A;  3WDO A;  1M5P C;  1NND A;  3BH6 B;  3FDS A;  3LO3 A;  1LEO A;  4L3N A;  4LIR A;  3J7Z T;  3QT7 A;  1RAC B;  3ULH A;  3IN5 A;  3BS9 A;  1I94 J;  2WVC A;  2XB2 D;  3CJS A;  3UE2 A;  4YB7 A;  4HHH A;  1RB0 A;  4DSJ A;  2CQ2 A;  4NXM F;  3OJU A;  1EB0 A;  1S1W A;  4CCH A;  2YNG A;  3TJ8 A;  6AT1 B;  1UJ5 A;  3JQM A;  3VR1 A;  1JXL A;  4ZVF A;  2E1M C;  2F1F A;  4U7U K;  1Y7P A;  3M8R A;  5KFU A;  2PT0 A;  4NLU A;  1QLN A;  5KFY A;  3D0H E;  3G6V A;  3PG9 A;  3ZZO A;  2KZM A;  2QA4 G;  4KE5 A;  1VS3 A;  2L9N A;  3Q8Y A;  4F36 A;  3BGL A;  4IUF A;  1FXD A;  2XSF A;  4USU A;  3W2V B;  3CD6 S;  4AD6 A;  3ENA A;  2ROG A;  3HHL C;  1UVK A;  2G0C A;  4ZPT R;  1M0S A;  2AJ4 A;  2HND B;  3C6U A;  3W63 A;  1VOM A;  5HSP A;  3KK2 A;  2V4J B;  2ZH8 A;  3AB4 B;  2LEP A;  1O0P A;  3UNY A;  4DX6 A;  5KG6 A;  3T41 A;  4Q5V A;  2HHH J;  1VQN S;  2Z2M A;  5LJ5 Y;  2OGU A;  2NZ4 A;  2X3G A;  2VIH A;  2DCL A;  4HI2 A;  4RU2 A;  2PI5 A;  2J0W A;  4F0M A;  2JLF A;  1YI2 S;  3WC2 A;  3GFH A;  2LQ5 A;  3Q8R B;  3KUE A;  4QU6 A;  2P8I A;  2HHV A;  4OZ2 A;  3ILO A;  3TAM A;  4ECQ A;  4OJ1 A;  2XS5 A;  3HHL B;  4Y2A A;  2FVP A;  2FY1 A;  3NGK A;  1RT2 B;  4H4M B;  1AXQ A;  1JLB A;  1N5T A;  1S6Q B;  2VBY A;  3TJA A;  2CAJ A;  2CQ0 A;  1VC6 A;  1KHW A;  1Y4Z B;  4C0O C;  3C8Y A;  2DGT A;  1IKW A;  3FUY A;  3O8W A;  3QGH A;  3ENQ A;  2YH0 A;  5LOQ A;  1NU4 A;  2C3O A;  1KHV A;  1T05 B;  3AB2 B;  2ZOF A;  1Q8L A;  4B9S A;  4USH A;  2ZJP Q;  4DR6 F;  5I42 B;  3MMA A;  2QFJ A;  1TL7 B;  2BMB A;  4KO0 A;  3VQS A;  2IM1 A;  4ILL A;  4PEO A;  4NCG A;  3D6F B;  2MY8 A;  3IS9 A;  4WZQ A;  1U09 A;  5KFK A;  1OSC A;  2G2Z A;  4ITS A;  3Q0A A;  2F3J A;  3UDE A;  3TA2 A;  3TA1 A;  4RWW A;  1OY9 A;  2QYC A;  4I2P B;  3Q8S B;  3HVW A;  2A18 A;  2GML A;  2BR0 A;  5KTQ A;  1NHV A;  4TY8 A;  5A8R B;  1W26 A;  2R4F A;  1WHV A;  1SXL A;  4DV1 F;  1D0E A;  5A8K A;  4O44 A;  1F1B B;  2OI2 A;  2QTW A;  5JMN A;  2ZM6 J;  5B09 A;  4CO4 A;  3BF4 A;  2KG1 A;  2R7T A;  4Y0F A;  2ZH9 A;  2FLP A;  5IT9 Y;  2XWX A;  3ETM A;  3C14 B;  3MD3 A;  1BQM B;  4FVC A;  3VGT A;  3BBC A;  2HQD A;  3CJ4 A;  4CYU B;  3V4I B;  3W3S A;  2QL9 B;  4ED4 A;  4U9R A;  1V5I B;  2I0X A;  2VAS A;  2MKH A;  2WZ1 A;  2VPW B;  3BM7 A;  2HFN A;  4K5S A;  4WTY A;  5HMY A;  1KR4 A;  1T03 B;  1EQM A;  4W4M A;  4HKQ A;  2D9O A;  2R8K A;  1JNR B;  4R8U A;  1DZ5 A;  2ASL A;  4NYP A;  2KFZ A;  1FKO A;  2CJA A;  2DRB A;  4OZ1 A;  3PKY A;  2EPI A;  3KLH B;  1HNW F;  2UXB J;  1KS2 A;  1A6L A;  1DLO A;  1QUP A;  2F40 A;  2XUL A;  4MTP A;  4ELV A;  1IUJ A;  3GG0 A;  2CZ9 A;  1U2F A;  3TAQ A;  1TK0 A;  1Y10 A;  2VQE J;  1H7X A;  3DGV A;  1LWF A;  1H7W A;  1NK7 A;  2VA3 A;  5D3G B;  4KO0 B;  1UW9 A;  3BR8 A;  3DMJ B;  3ONQ A;  2OEJ A;  3S6E A;  4ANC A;  1SH3 A;  4ZIV A;  3EGZ A;  1QD1 A;  2QG9 B;  1CJT B;  1FI4 A;  5J2N B;  1CUL B;  2PN6 A;  5K14 B;  1BY9 A;  1DTT B;  3RAQ A;  1U4B A;  3CUN A;  2B5J A;  5KFZ A;  4PG7 A;  1REG X;  5KFV A;  2AX0 A;  2AGQ A;  4Q0B B;  4OYM A;  2GHW A;  4ZCL A;  4FXW A;  4Y2M A;  1NK8 A;  1FER A;  5F41 A;  4ZCM A;  4UQT A;  3CCU S;  2FC8 A;  2CG4 A;  1CUL A;  1Q4R A;  4F04 B;  1WNE A;  3OQ2 A;  5IT0 A;  4FXD A;  4I6A A;  2F8E X;  3RYL A;  3TWZ A;  2AHO B;  1NKE A;  1H2T Z;  3HXM A;  1FJC A;  5T14 A;  3ZTQ A;  2U1A A;  4O23 A;  2A2D A;  5KFC A;  3MM7 B;  4URG A;  2NS1 B;  1YJN S;  2UVV A;  5C25 B;  3JB9 k;  4USI A;  4DR7 J;  3BSO A;  2M52 A;  2H65 B;  3TX8 A;  2CPH A;  3MTJ A;  4HI1 A;  4J9U E;  4LF1 A;  4X4O A;  2HK3 A;  2IPO B;  4DN0 A;  2ZWO A;  2V8P A;  2CFX A;  3M30 A;  1EAR A;  2DNH A;  2WVB A;  1GQE A;  2GNK A;  2BJ7 A;  3N6N A;  4F2R A;  2HNZ B;  1RE1 B;  2QMU B;  5DDO C;  3DYA B;  2CZV C;  4WE1 A;  4WBF A;  3U1M A;  3M9N B;  3CCQ S;  1W7W A;  3HFZ B;  2VBZ A;  2DCU B;  1PCA A;  3BJY A;  3HZG A;  2YX7 A;  4EEY A;  4B3S F;  2LDI A;  4JOU A;  4OZL A;  4LF5 F;  4J7C A;  4BDP A;  4DR3 F;  3NLC A;  1VRU B;  2QL5 B;  2Z30 B;  5AE1 A;  4PUO A;  2HHX A;  4AQY F;  3AA8 A;  2RS8 A;  3R5B A;  1EZZ B;  1LW0 B;  1RK8 A;  1YHQ S;  3KLE A;  4HL9 A;  4ALZ A;  1YBT A;  2MZS A;  1SH0 A;  3AD8 C;  2XC9 A;  3KG1 A;  4NLY A;  4FS1 A;  4IH7 A;  4AL5 A;  3EUN A;  2LEC A;  3PAC A;  1O5J A;  3L7U A;  1Q78 A;  4P52 A;  1DTQ B;  4ED5 A;  1OJ4 A;  2A6O A;  3EIC A;  4QOT A;  3H8Y A;  2M88 A;  1X4G A;  4ZK7 M;  5B0E A;  1K9M T;  3H98 A;  1RXO B;  3K58 A;  4CLU A;  1GAO A;  3HDS A;  4JI6 J;  1RYR A;  3NKY A;  2ASY A;  3BZQ A;  4IRK A;  1DTQ A;  1ROF A;  1UEK A;  4RLE A;  4ZPV R;  4C48 A;  2ZZN A;  5E2Q A;  4ZJQ A;  2IM3 A;  1K73 T;  1GEH A;  4YR0 A;  4USV A;  2BBE A;  3M8Z A;  4F26 A;  5IWA F;  3OUY B;  3D3B J;  4DEZ A;  3R97 A;  7AT1 B;  1B7F A;  2I5J B;  2O5D A;  2YNH B;  5A6W A;  5LM7 E;  1JWW A;  3MWB A;  2GVZ B;  2KU7 A;  3T6B A;  4PQU A;  2V8H A;  2CPI A;  3M2U A;  5IXU A;  3IXQ A;  3GP9 A;  3MR3 A;  2VKR A;  2ZNZ A;  3IAM 9;  2LQ8 A;  3M2R B;  2EBE A;  3VZI A;  2W4D A;  2MQM A;  4F0K A;  4ED8 A;  4XTT A;  4EZ9 A;  2MGZ A;  2MKC A;  4GVB B;  4AQY J;  1S0N A;  3B6B A;  1CJU A;  1F3V A;  3CT9 A;  1FNX H;  1G6B A;  3P49 B;  1G1X A;  1T0T V;  4ZKA A;  3MM9 B;  4YB6 A;  1ARO P;  3GJT B;  2C3P A;  1S77 D;  3CUL A;  1WKJ A;  1ZH5 A;  2C2N A;  5C2G A;  1TUV A;  4ECY A;  1WF2 A;  2H48 B;  4WII A;  4JI5 J;  1JLC A;  1T95 A;  2RVJ A;  1F5B A;  4I6W A;  5KFI A;  2HHQ A;  4ZJL A;  1RHQ B;  2H3E B;  3A4T A;  1DQ9 A;  2I2Y A;  2DEI A;  1LW2 B;  2HBR B;  2LU1 A;  2PO4 A;  1NHU A;  4K2X A;  1R6Y A;  4RW7 A;  2L08 A;  3W62 A;  4JI0 F;  4A46 A;  1KQG B;  4AND A;  5KOW A;  2ALY B;  2DGQ A;  4NRT A;  4X4T A;  3RR8 A;  4NLR A;  1SUQ B;  4PG8 A;  4JP8 A;  3OXG A;  3I0S A;  3ISZ A;  4DSI A;  4UOF A;  2JLG A;  4DR4 F;  5LXY A;  3UPF A;  3C15 B;  1WD6 A;  2RDD A;  1VQ5 S;  2RE1 A;  1P27 B;  3EVO A;  4NZ0 A;  3WX8 A;  1NKB A;  1PIL A;  3KOA A;  2PGC A;  1WOS A;  2OPS B;  3NXZ A;  4OQJ A;  4NXN J;  3J7A 1;  4I0W A;  4NEY A;  1TKT B;  3CJ3 A;  3UDC A;  2MKK A;  3MR6 A;  2FJB B;  4FF2 A;  1XNQ F;  4O44 B;  4TVA B;  1RT4 A;  4KQZ A;  1HBN A;  4RZR A;  3MCS A;  4IOC Q;  1WC3 A;  1C1C B;  3DRS A;  2ZZT A;  3AJ1 A;  4LSN A;  1YJW S;  1S9E A;  2AJ2 A;  3TVY A;  4Y65 A;  2BUN A;  5K8M A;  3MGJ A;  2MQ8 A;  1MRO A;  2NRE A;  2RHS B;  2HRT A;  1VRT B;  1HBU A;  2XO7 A;  2VUG A;  4ZVT B;  3QJJ A;  3GJS B;  1PYT A;  4NA2 A;  4J9L A;  4LR9 A;  1PYO B;  4XAK A;  1WDT A;  2GAH C;  2GX8 A;  3I5B A;  4NI2 B;  5KFQ A;  3MMC B;  3OVA A;  4V19 X;  1YZ7 A;  3M2U B;  2R8H A;  1TP7 A;  3IRW P;  1HBU B;  1RIS A;  3M2R A;  2FUG 9;  2Z57 B;  2VFR A;  3JAM Y;  2OPP A;  3WIU A;  3I9Z A;  3QSI A;  1W25 A;  1FKO B;  1NSA A;  2HG4 A;  2DH7 A;  1Q82 T;  2FTR A;  2R7R A;  2OIH A;  1OWX A;  1DBD A;  4USM A;  3LGH A;  3A12 A;  3QLH B;  1JLA A;  3PJ9 A;  1FTC A;  1RWK B;  4DR5 J;  3NMA A;  1L3V A;  2OAU A;  1O6X A;  4JI8 F;  3TAN A;  3HHL A;  1SJQ A;  1UFK A;  1FD2 A;  2GIQ A;  4N8O A;  3HFK A;  1DRZ A;  1RT2 A;  4L75 A;  2M9K A;  4OYW A;  2W9A A;  2BVZ A;  2J9C A;  4IG3 A;  1HI0 P;  2W01 A;  3IM9 A;  2V2K A;  4IDK B;  3RU0 A;  2NCK L;  3GV7 B;  4XIU A;  1TK8 A;  1S7H A;  3EPG A;  2C3U A;  1FVS A;  1FDN A;  3PIP Q;  2R7V A;  4I64 A;  2GIF A;  4PCQ A;  3L3C A;  3C46 A;  4B3R F;  5KAK A;  3PJX A;  2AP6 A;  2AMC B;  4X4S A;  4I7F B;  1JLG B;  1HMV A;  1MWZ A;  3I4P A;  1RLC L;  4YQW A;  3BSC A;  2ASD A;  2HBQ B;  2OPS A;  4YOE A;  4PR6 A;  3W66 A;  2XMV A;  1U47 A;  1KD1 T;  3CC7 S;  2NXU A;  4RW6 A;  3IGV A;  4DUZ J;  1RWN B;  1KKH A;  5H1S V;  2WAQ D;  5HQL A;  2M2B A;  3BPD A;  3UWT A;  4JB8 B;  4NYZ A;  3BDP A;  3MM7 A;  1U02 A;  2LFV A;  4ZIT A;  3QJL A;  3TUP A;  1VLY A;  2QGF B;  3TQ1 A;  2CVE A;  2XZT B;  2RDJ A;  2LXF A;  4FYY B;  1M5K C;  3IR5 B;  2YWK A;  1JB0 C;  1RHU B;  3GB0 A;  1HW9 A;  3QWP A;  1KOO A;  5MAO A;  5B0F A;  2OPR B;  3DLK B;  2LEA A;  2B9X A;  2F8H A;  3EVW A;  4J37 A;  3SEO A;  5IFM A;  1YRX A;  2R7Q A;  2B9E A;  2XI2 A;  3KKF A;  2MJU A;  1RA6 A;  6FD1 A;  2DGV A;  1LFP A;  2OKQ A;  2PSZ A;  5GAD I;  2AYM A;  2W9C B;  1RTD A;  3M32 A;  1MWY A;  1TTH B;  3N5F A;  1PJ7 A;  4L73 A;  1Y3K A;  4JI3 J;  4JV0 A;  1CJV B;  3AHP A;  1HKA A;  1LQ9 A;  2F63 A;  1NK9 A;  4GRS A;  5HBM A;  2DPJ A;  1S4F A;  1HL6 A;  2A10 A;  2HGL A;  5E0O A;  3PXG a;  4OX9 J;  2GMJ A;  1S48 A;  2BA9 A;  1T9U A;  4YR2 A;  2VQF F;  4LVN P;  4DSK A;  1PJ5 A;  2YWE A;  5HAT A;  3OVB A;  4NLW A;  4DV4 J;  3UN5 A;  2Y1I A;  3BPS P;  5ETR A;  3MMJ A;  5DGA A;  4Q2M A;  1H38 A;  3LOU A;  2B8Q A;  2O67 A;  5JVH Q;  3MPY A;  4H4O B;  1MMD A;  2PA3 A;  3RG6 A;  3DDI A;  5I3U B;  3KLH A;  1SL0 A;  1UTA A;  3ZNU A;  3ZZR A;  1WC5 A;  2CJQ A;  2V4R A;  2UXD F;  1X4H A;  1U0H A;  5HRO A;  2YWW A;  3W5Y A;  3MDF A;  4CNZ A;  4HDG A;  4A8S A;  3PVX A;  2HMI B;  2YH1 A;  3C19 A;  4HTJ A;  1PSD A;  1WOP A;  3GYX B;  2E7X A;  1ZA2 B;  3QT5 A;  4IFV A;  1WTB A;  4UQG A;  3K5O A;  3LTO A;  5D15 A;  4LRE A;  2HRU A;  3D0G E;  4EBE A;  2BW2 A;  2XWY A;  1YIT S;  1HR0 J;  4F8R A;  4JI2 J;  5KG5 A;  3RB0 A;  4QR2 A;  4ZVR B;  1ULR A;  4I2Q B;  4OMF G;  4KHP F;  5BR8 J;  3CMA S;  2ZJQ Q;  1C4A A;  3DI6 A;  5J1N A;  4Q0B A;  1T3N A;  4XDC A;  1KQF B;  3NGT A;  3CCV S;  5A8K B;  1RWP B;  3KG4 A;  2KHD A;  4CLZ A;  1AB8 A;  1M1K T;  1MU2 B;  2V9K A;  2G1D A;  2OJ3 A;  3M1V B;  4DU8 A;  1R0A B;  2CG8 A;  2M70 A;  2V0N A;  4IQX A;  3WBZ A;  3MMB A;  3WQP A;  4PKD B;  2AV5 A;  1M5H A;  4QU7 A;  5HAN A;  5CZV A;  1TZ0 A;  3DLG A;  1CSJ A;  2B6A A;  1BQM A;  5B0B A;  1NPP A;  3R8Y A;  4LF2 A;  3J81 j;  3HUL A;  4JV5 J;  2NYI A;  2VHG A;  3IG1 A;  1VK8 A;  2V69 A;  1IM4 A;  2RRA A;  1GTH A;  2VPY B;  3QIP A;  5GAH I;  3M32 B;  4URS A;  3OSN A;  2XMU A;  3C16 A;  1SKW A;  1WI8 A;  1P6T A;  4KHR A;  4KHM A;  3CCW A;  2MKS A;  2Q43 A;  2POK A;  2EC0 A;  5IT9 U;  3PEH A;  1S0V A;  5A8W B;  4DL2 A;  3U27 A;  3RTV A;  1U2C A;  3RBE A;  1WAC A;  1LWX A;  1YRU A;  2F65 A;  2RRB A;  5D4N A;  3OD2 A;  3UR0 A;  4Q44 A;  1RBA A;  1BHN A;  3PYD A;  1U6F A;  2Z4P A;  3M8P A;  4KV8 B;  2VOO A;  4WZM A;  1U2R A;  2B7B B;  2QSW A;  1BWE A;  3DDN A;  1JXE A;  3OR1 B;  1NHK L;  2YWG A;  2FJV A;  2KFN A;  4P2X A;  3BGF A;  3KHG A;  2DB1 A;  3DLJ A;  1AYE A;  1RAA B;  3LW5 C;  1SVD A;  3TEG A;  2HNY A;  4FF1 A;  4CLK A;  3BKU A;  4OL8 A;  3SCL E;  1PYS B;  3DOK A;  1RT4 B;  3LP2 A;  4TKT A;  4QIE A;  5AT1 B;  1HLW A;  4FBU A;  2C22 A;  2WON B;  4X4R A;  1WC0 A;  2AZ3 A;  3PW5 A;  1HYS A;  1RKJ A;  2LXI A;  1S1T B;  1ZZF A;  1VR6 A;  3NNH A;  1MN9 A;  1S9F A;  4DPX A;  2V34 A;  3A8K A;  3RB6 A;  1HPZ B;  4PWD A;  2MLZ A;  2C3Y A;  1UKU A;  4CDI A;  4NXN F;  2ILY A;  4C2M A;  2IDE A;  4ECR A;  1HHQ A;  1IQZ A;  4KC5 A;  2HQG A;  2LVW A;  3OVS A;  4IQM A;  3KJN B;  2ZBR A;  4LSZ B;  3CJ0 A;  3DDK A;  4CO0 A;  1CC7 A;  1M5S A;  1RHJ B;  2M3D A;  3HSG A;  2ATC B;  2M7S A;  3EMT A;  3K5M A;  4ECU A;  1JNZ B;  3QMQ A;  4RUC A;  4DV6 F;  1ACM B;  1ZPV A;  1I51 B;  4PXE A;  1K1S A;  1VGY A;  2DIT A;  4WJB A;  2IJN A;  5F9L A;  3KJV A;  1HQU B;  2O1P A;  3EXC X;  1RTJ B;  3SSS A;  4QWB A;  3MUV P;  2F9D A;  5CXT A;  2IAJ A;  1OQ6 A;  4M5M A;  3KDN A;  4CT9 A;  2IRX A;  1Q5Y A;  2C2O B;  4M1K A;  4HT5 A;  4DL3 A;  4DZD A;  2D69 A;  2H54 B;  2V9W A;  2W4C A;  1VJQ A;  1VIS A;  4O4G A;  3KJV B;  3CC2 S;  3NMR A;  1RTH B;  3NGS A;  4P2S A;  1VC0 A;  3I56 S;  3PV8 A;  3M6W A;  1S4E A;  1S1U B;  1T9X A;  3TNV A;  4R5P B;  2ASJ A;  4LF9 J;  4RUH A;  4PWU A;  4QIW D;  2VD3 A;  3PRB A;  3RRG A;  2Y0B B;  1ZYQ A;  4F2S A;  1CVJ A;  4B3O B;  9RUB A;  5JXS A;  4DV3 J;  1RT1 A;  1TL4 A;  3P45 B;  5J2Q B;  1V3Z A;  3FKB A;  1RAO A;  1TVR B;  4I4B A;  2DIU A;  2ZVS A;  1IR2 A;  1QVF R;  4GKK J;  2QIF A;  3SXL A;  3HM9 A;  3EPI A;  4RW7 B;  3KXD A;  1FJG J;  4OI2 A;  1P1L A;  2A3J A;  4OZ0 A;  1YSJ A;  2J0Q D;  1EP4 A;  4X2B A;  2V68 A;  3DRX A;  1FK9 B;  2AU0 A;  4BS2 A;  2MST A;  1CJK B;  3A8E A;  1RGV A;  2GQC A;  3CXC R;  4ZVH A;  5ETK A;  3S1T A;  4AFF A;  2YNI B;  2QA2 A;  3OTD A;  2XZD B;  5C42 A;  1BQN B;  2K06 A;  2NUU G;  1LWE A;  4WWS A;  5IZH A;  3DRY A;  2RQC A;  2VH7 A;  1UEV A;  2P9C A;  1RAI B;  1QDU B;  1WG5 A;  1WHX A;  2KI2 A;  3NWG A;  2XHC A;  1C1B A;  1Y5N B;  1UWA A;  2EK6 A;  2XYP B;  3Q83 A;  5C42 B;  1OSD A;  5J2M B;  4JI4 J;  4CP5 A;  4M5D B;  3HF5 A;  1VQP S;  3DFE A;  4KFB B;  4DUZ F;  3RBD A;  2HND A;  2ZC4 A;  3C6U B;  3KK2 B;  1Q79 A;  4NRU A;  4PQA A;  3OR2 A;  5LJ3 Y;  5L9X A;  2OFG X;  5J2M A;  2KYZ A;  4GVL A;  2XYH B;  4G6V B;  4PZV A;  5IM0 A;  4YDX A;  4DV3 F;  1XNQ J;  1QAY A;  1ZAW A;  4ZN1 A;  4HT7 A;  4RKU C;  1RQ0 A;  2UUB F;  4MFB A;  2DNG A;  1ZM4 A;  1GFW B;  3U02 A;  4LRF A;  1UL3 A;  2XGQ A;  4TLQ A;  2XGP A;  2ZHB A;  1AZS A;  4RW4 B;  2CPD A;  1T3O A;  2SXL A;  2YPZ A;  5HVF A;  3K0J A;  3W5X A;  3VTI A;  3BYP A;  2BQ3 A;  2H4Y B;  4LBH A;  2FZC B;  3MI7 X;  4NCG B;  2VFU A;  2L41 A;  1S1V A;  4KGZ B;  2KJV A;  3HHL D;  5GAE U;  3JYT A;  3F73 A;  2WVE A;  2E1A A;  3VAH A;  3PX4 A;  4UY8 T;  2KHC A;  2OHD A;  1TL3 B;  1LK5 A;  2BX6 A;  3BKF A;  4HDH A;  4ENO A;  4EBC A;  4JI3 F;  4JI7 F;  4DWI A;  3CW2 C;  3DLE A;  4A8M P;  2VOP A;  2KT3 A;  4RNF A;  3K5L A;  4TYB A;  3ZZU A;  4P2M A;  3FZ2 A;  1ZZN A;  3HJF A;  2IMW P;  5DDP C;  3NGR A;  1JX4 A;  2NPF A;  3FSY A;  2CNL B;  1R8C A;  3QID A;  4OHY A;  3M8Y A;  2F4F A;  4J9V A;  4MYT A;  3OFE A;  4PPD A;  3NCQ A;  2X1G A;  2K2P A;  2L9W A;  3IS9 B;  4PXD A;  4AT1 B;  1U1K A;  4LFC F;  3O1L A;  3V6H A;  4LF8 F;  2FZK B;  3OV7 A;  3O6Q A;  1KSP A;  2DIV A;  3K59 A;  3AQP A;  4A8W A;  1JLG A;  1HMV B;  2OEK A;  1IJF B;  2N82 B;  4N56 A;  3LAM A;  2IJF A;  4UST A;  3V6J A;  1LXJ A;  5HO4 A;  3MUR P;  2GO9 A;  3EZ5 A;  2FLL A;  2Y8W A;  3LAL A;  1S49 A;  2B3T B;  3MR7 A;  3V5R A;  4KAI A;  1F3F A;  1SJ1 A;  3I87 A;  3MTK A;  4OLP A;  3MPW A;  2CQI A;  2BYC A;  2CPX A;  3V2U C;  1I6J A;  4B3R J;  4IH5 A;  2L9D A;  4MKV A;  2HFS A;  4PG6 A;  3NOG A;  3TZX A;  1B64 A;  3KFW X;  2D7S A;  2VF3 A;  2FGC A;  4M5H A;  1NB2 A;  3C14 A;  3V4I A;  4JI7 J;  1A0O B;  2WB1 D;  1X4F A;  3AJ2 A;  4ED1 A;  1YJU A;  5DRK A;  2XO6 A;  1WF1 A;  3D1O A;  5B0A A;  2J5A A;  1VBY A;  2D74 B;  1FX2 A;  1NJZ A;  5F8J A;  1IKV A;  3A3O B;  4K8R A;  3KMS A;  3BKT A;  2DGW A;  4TU9 A;  3QFH A;  1J27 A;  3M2V B;  4F3Q A;  3GIK A;  5H9F J;  1T05 A;  5LMN F;  4JI1 J;  4RL1 A;  2HAI A;  4U8V A;  4IO9 Q;  4ED2 A;  2BAN B;  4X64 J;  4U7C A;  4Z7Y A;  2NPI A;  1VK3 A;  5CCL A;  3N4W A;  4IG0 A;  3MOZ A;  3THV A;  5AXN A;  2DJW A;  2VKZ G;  4TYA A;  1FKP A;  1YDL A;  2OMO A;  5BYQ A;  3SFU A;  3PO5 A;  1URR A;  4KGK A;  4ECT A;  3HK2 A;  3CD7 A;  3H7H B;  1VHF A;  2VFS A;  2FVC A;  3Q2S C;  1H2U X;  2IVF B;  4XO0 A;  4DQR A;  2PMW A;  2V50 A;  1TKZ B;  3KLG B;  1PBA A;  3ILL A;  2QLF B;  2ZJR Q;  2CPZ A;  1V5V A;  2D3O R;  2CQB A;  1JLQ B;  4QIV A;  1WHY A;  1RBO B;  2B5J B;  3W9H A;  4YHH J;  1R0A A;  5BYS A;  1VQ4 S;  4LFA F;  1IM6 A;  4QZV B;  2FJD B;  1TAU A;  3KWM A;  3DLL Q;  2B8P A;  4EYH B;  1VCT A;  3SYZ A;  2OPQ A;  2UXD J;  3H5X A;  2H5E A;  4NL5 A;  3HT3 A;  1OPZ A;  1ZET A;  2DYA A;  2GQ2 A;  1JQG A;  2RRN A;  2BV3 A;  5CAA A;  2VB6 A;  4K4Y A;  3J80 Y;  4NLD A;  2XMT A;  4DV2 F;  2HFV A;  2NLW A;  3M4X A;  3O5T B;  3PYE A;  3IR7 B;  4RU9 A;  2DNQ A;  3EYZ A;  4IR1 A;  7FD1 A;  4Z37 A;  1TKX A;  3UO0 A;  1YK9 A;  3M1V A;  2AJQ A;  3DGP A;  1OY6 A;  3UVJ A;  4CTA A;  2CPY A;  4JI1 F;  4NCB A;  3A3P B;  2HVE A;  5GAD U;  1QSL A;  4JI2 F;  4X64 F;  3SSR A;  1CLF A;  4DQI A;  1RAE B;  1WF0 A;  4GKJ F;  1MSW D;  4TY9 A;  2GC8 A;  4DV7 J;  1BGX T;  2KKH A;  5KG2 A;  1QVG R;  4WKY A;  2PC6 A;  5GVQ A;  3KUG A;  1ZA1 B;  4DG1 A;  4KH1 B;  2DXD A;  3UD4 P;  2W2O P;  2FVS A;  4DV6 J;  3D7S B;  3IA0 A;  2HSE B;  3QIP B;  2VZ9 A;  4WXW A;  3PW7 A;  1X9W A;  3DYA A;  2H9Z A;  4YFU A;  4ECX A;  1HI8 A;  5J2Q A;  2VJV A;  3B78 A;  3QFW A;  4MKB A;  2N3L A;  2AZ1 A;  3F44 A;  2J8A A;  4F4Z A;  1EJ7 L;  4MYU A;  2K3I A;  1NH8 A;  2LQ9 A;  2DT9 A;  1HWK A;  3BGR A;  1RUS A;  4E8U A;  4YR3 A;  1SJF A;  4EMD A;  2WSF C;  2FHJ A;  3BBF A;  1GMW A;  2B9Y A;  2EBG A;  1Y3J A;  5GME A;  1U6Z A;  3HPO A;  2MPU A;  2HLT A;  4M5L A;  2DD8 S;  2DHH A;  2AYE A;  5K8N A;  3TAR A;  3C2P A;  1S76 D;  2WCX A;  4HH1 A;  3H5Y A;  1HYS B;  4K50 A;  1I1G A;  5D77 A;  2D3Z A;  2JC1 A;  3AXM A;  5E3P A;  5KFJ A;  1DTT A;  4B9N A;  4BWJ A;  3MUT P;  2QA4 S;  5GAG U;  2MKY A;  3KK1 B;  3FSI A;  1KRP A;  5J1P A;  3BEG B;  1FRX A;  1FJG F;  1OS5 A;  1VQL S;  3J7Y U;  5GMK a;  1JLF B;  3DM2 A;  5L1K A;  5HLF B;  2CQ1 A;  2D9P A;  4GMK A;  1S10 A;  2CXE A;  4DV5 F;  2EFO A;  3FK4 A;  4ZS6 A;  4LQ3 A;  2BZ2 A;  2IMO A;  3CCS S;  1JK9 B;  4IFY A;  2FHK A;  1VQM S;  1GMW D;  4ZOS A;  3H90 A;  1SIW B;  2XY7 A;  5HP1 A;  4C8Y A;  1D09 B;  1D8Y A;  2OEM A;  2QV6 A;  3ZTO A;  1S0M A;  5HMW A;  4ZJO A;  1NLK L;  3ZZT A;  2YNF B;  1NJX A;  1HR0 F;  2XMK A;  3LWL A;  1KFS A;  2ZDO A;  3JXO A;  2HWH A;  3D3C J;  4Y2I A;  4UY8 5;  1SC4 B;  4DBQ A;  2W2N P;  1S6Q A;  2QMW A;  3D68 A;  4DPO A;  9ATC B;  2OML A;  2ZC3 A;  1N6Q B;  4F4A A;  1RHK B;  2EKY A;  1YJT A;  4H4K A;  4ZHR A;  1U1M A;  5EN1 A;  3MFH A;  5B7W A;  3EXY A;  4PXC A;  1Q8K A;  4IYQ A;  4RR5 A;  3OL9 A;  1P8G A;  2XMJ A;  1QSY A;  3GTY X;  3DC2 A;  3N28 A;  4P9S A;  2JDJ A;  5I42 A;  1SL1 A;  2QO3 A;  2GHV C;  4OV6 A;  1OO0 B;  4Q2L A;  1NAQ A;  3AD7 C;  3SV3 A;  1U1N A;  2XMA A;  2R8I A;  2DRA A;  5CYQ A;  1KQS R;  1OY8 A;  4AUK A;  4CM2 A;  1HA1 A;  2FIU A;  5K9F A;  1EKS A;  4HHJ A;  1RJJ A;  2BKO A;  2LQJ A;  3IR6 B;  3P5T L;  4K2J A;  1HNV A;  1UWB A;  4HTI A;  1IWG A;  4CH1 A;  1SV5 B;  2X1B A;  1XMQ F;  2ZBQ A;  1HWL A;  1S9G B;  1TKD A;  4U7U D;  2CUY A;  4DPU A;  1H72 C;  4ZVG A;  4CQ1 A;  1LNQ A;  3GON A;  3KK3 A;  1DHM A;  5GAG I;  1KOH A;  2ILZ A;  4CM0 A;  5E41 A;  3FZB A;  2AJF E;  2VBX A;  1SCJ B;  4Y00 A;  1NUE A;  2MZQ A;  1Z2L A;  1IBL J;  2PMZ D;  1FRJ A;  2FQQ B;  5D4P A;  1Y5I B;  4ZDN A;  3VHQ A;  1HW8 A;  3GIR A;  3KLI A;  2MZT A;  4C0B A;  2AKW B;  2CPF A;  3OXL A;  4URQ U;  5HN0 A;  1T7P A;  1HAR A;  2HYI B;  2EFQ A;  1CG2 A;  2Z2Y B;  3DRP B;  4O4R A;  3EGN A;  3OR2 B;  2GO8 A;  1WKL A;  1R31 A;  1IBC B;  3NG8 A;  5L9N A;  2E5G A;  5FD1 A;  3R1L A;  1N48 A;  1NME B;  3NRB A;  3KLI B;  3W7B A;  3CPW R;  3HVA A;  3CB4 A;  3IBC B;  3UW1 A;  3LGM A;  4CLW A;  4OLO A;  4QPT A;  5E5N A;  4H4M A;  3NBP B;  2ZZM A;  3T19 A;  1N5Y B;  3VAF A;  1KLN A;  2HFO A;  2XSJ B;  2CJ9 A;  2LA6 A;  2FVR A;  3FRY A;  3D6M B;  4GVB A;  4WPA A;  3J7A N;  3SDE A;  1N33 J;  4DF8 A;  1TL3 A;  3HFV A;  5IM0 B;  5IV4 A;  3H2V E;  1FHT A;  2IVM A;  1N52 B;  5CA5 A;  2C1E B;  4KPC A;  1SPB P;  3KHL A;  2CJY B;  3CJT A;  1HI1 A;  3N6L A;  4FVM A;  2Y0S D;  3AQO A;  4KT0 C;  1R7I A;  3SCI E;  4B08 A;  2GA7 A;  4EI2 A;  2AEJ A;  1FJ7 A;  4RW4 A;  2QRR A;  4OYI A;  4HH0 A;  2PDA A;  3DMJ A;  1TQL A;  2C2Z B;  2WRM A;  1JJH A;  3JSR A;  5AXL A;  3OLA A;  4ED0 A;  3VAL A;  3G6X A;  1T9Y A;  2AEF A;  3QGG A;  4NAS A;  3RBX A;  1FRH A;  2MQO A;  5HK4 A;  1WTF A;  5DO2 A;  1TL7 A;  3F41 A;  3VF0 B;  4ES2 A;  2QLJ B;  3QBC A;  2R42 A;  2DO0 A;  1M1G A;  2DIS A;  2BJ8 A;  2FJX A;  4W92 B;  5D78 A;  1RP5 A;  2E5I A;  3TO8 A;  3P8B B;  2KRB A;  4S0M A;  4ZP7 A;  4ZPC A;  2H5I B;  3QZ7 A;  1SC1 B;  2EFG A;  3VVU A;  2GQQ A;  3MEG B;  2ACM A;  2RH3 A;  2UVU A;  3GCW P;  1FEE A;  2FB0 A;  2XEX A;  1U1O A;  2E1P A;  1P9Y A;  2HUR A;  2W24 A;  3PRV A;  3L7P A;  4Q7A A;  4Y28 C;  1JJ4 A;  4CLS A;  1M90 T;  3AOD A;  3FEY B;  3NWR A;  3OFG A;  4G1P A;  1RYS A;  4QYZ K;  2LXU A;  3MEG A;  3CJ5 A;  5CD4 A;  2E9R X;  1FRM A;  3K2Y A;  1B0V A;  5KT3 A;  4C8K A;  1F9H A;  3S8S A;  1XNR F;  1XWL A;  3D54 A;  3H5S A;  4RNM A;  2HHU A;  2HNZ A;  3TQE A;  1EHW A;  4ZPA A;  4YY3 F;  4X62 J;  2UUC J;  3I32 A;  1XR5 A;  2JZ5 A;  3QNW B;  1QE1 A;  1JLE A;  4OJH A;  1KC8 T;  4MK9 A;  2JOQ A;  3AOB A;  3FQK A;  1TR0 A;  1YJR A;  4AXJ A;  1CS4 A;  2LYV A;  2D1C A;  4AL7 A;  3WIV A;  1KVJ A;  3CDW A;  2MQQ A;  2F4V F;  1EAY C;  1KTQ A;  3HVT A;  1VRU A;  2DHA A;  5D3G A;  1VMB A;  1QJH A;  4USK A;  5A0Y B;  1UPM B;  4DLG A;  4ED6 A;  3UFC X;  3C66 A;  5ADZ A;  2OP5 A;  5KT2 A;  2J6U A;  4LF6 J;  3HHK A;  1J5O A;  3M8P B;  1EIY B;  2WSC C;  4GKJ J;  3BSA A;  2J7U A;  2R2R A;  5E3Q A;  2CYY A;  1GT8 A;  2QLB B;  2ZKU A;  5L8R C;  1O8B A;  3CJK B;  3POT A;  3RAM A;  1ZM2 A;  3SQO P;  5F8I A;  3TZY A;  4C4W A;  2ZWP A;  1CQM A;  4H4O A;  3FMB A;  1S79 A;  4OI3 A;  2IM0 A;  3VGV A;  2DRD A;  1T9W A;  3ETO A;  3G8T A;  3Q23 A;  2R9L A;  2BQR A;  2KL8 A;  4NWB A;  4I2P A;  1BUX A;  4DL4 A;  2YWF A;  1FKP B;  3BR9 A;  4B9U A;  1Q53 A;  4WYL A;  4A48 A;  1H73 A;  4NZ6 A;  1U7L A;  1NEE A;  4DX7 A;  2ATL A;  2R7S A;  2Y9H A;  1JMT A;  4YN3 B;  1EKR A;  1A9N B;  2IA6 A;  1Y9O A;  2HBZ B;  3MMB B;  1ZTT A;  4DV1 J;  1D9F A;  2DNZ A;  3B4M A;  2OLW A;  1RHR B;  3D67 A;  3DXS X;  4L76 A;  3TA0 A;  3TZW A;  3EM1 A;  3G87 A;  3ILJ A;  3LH2 S;  4KGV B;  2EFV A;  2GVZ A;  5M2P A;  3VAJ A;  2X1F A;  3M30 B;  1JLQ A;  4NLP A;  1YBU A;  1FE4 A;  3WX4 A;  1JJ2 R;  3W65 A;  2B4U A;  3GE9 A;  1NJW A;  3ZZY A;  2XY5 A;  3HZE A;  4K5R A;  4MAK A;  1LWC B;  3C16 B;  1S6P B;  5ETL A;  4KPY A;  5C25 A;  2BE2 B;  2E29 A;  3NGU A;  2XQC A;  4DV0 J;  4X4V A;  1NK5 A;  2J6T A;  3GZ7 A;  4C8O A;  4PXB A;  5AJ3 F;  1KWM A;  4K4W A;  2VBW A;  3R6L B;  3GFY A;  4A8F A;  4D3G A;  2YKN A;  4PYA A;  4WIQ A;  3LUY A;  5D0H A;  2CA9 A;  1KVK A;  4DQS A;  1FES A;  2IBO A;  3CWJ A;  5JJB A;  2HS4 A;  1RTZ A;  4C0H A;  3IGN A;  3LP0 B;  1MWQ A;  1E6V B;  1X4E A;  1IKV B;  3CGI A;  1DLO B;  3EDQ B;  4CO1 A;  2WK4 A;  1DAX A;  2EG2 A;  3CVK A;  3M2V A;  2CJX B;  3GG1 A;  2CQP A;  1UZH A;  3PR4 A;  1RDR A;  2JEJ A;  2J9E A;  3DN9 A;  2LDY A;  4TQS A;  3O3L A;  4CI0 B;  3AJD A;  3LP2 B;  1FRL A;  3U1N A;  3D2W A;  1N32 J;  1TV6 B;  2HIQ A;  2RUG A;  3CNQ P;  1G2E A;  1SJ4 P;  2GHP A;  1EET B;  1REV A;  3HJV A;  1EX8 A;  1RWM B;  5LMU F;  3K5P A;  1RA7 A;  3A8J A;  3UN2 A;  4IFV B;  3H0P A;  3PX0 A;  4OI1 A;  2AD9 A;  1S72 S;  1HPZ A;  2HIY A;  1IKY B;  2KN4 A;  1LWE B;  4R0E A;  3I55 S;  1PIE A;  2H4W B;  3NGD A;  2JEF A;  1Q7L B;  3I4H X;  4KKO B;  2ROP A;  4OZ5 A;  4LF4 J;  2J0X A;  2AW0 A;  5KFX A;  4DZ6 A;  5KT6 A;  1GH8 A;  2W25 A;  2BKN A;  4CLY A;  1R0C B;  3JQJ A;  3W9J A;  4ZLL A;  4WFZ A;  5EHH A;  1WOO A;  4Q43 A;  5IQ6 A;  4LR8 A;  5FDL A;  4N5S A;  3ITH B;  2W4P A;  4M63 A;  4OHX A;  1SBR A;  3NY0 A;  1HQU A;  3NS7 B;  3MMC A;  3UN3 A;  2EEY A;  1XIQ A;  2Z56 B;  1G3O A;  2HS0 A;  3PHE A;  3H40 A;  3FSX A;  4DFJ A;  3D6T B;  4FYX B;  3C6T B;  4RW8 A;  4UZC A;  4O4G B;  1S99 A;  3MPU B;  2RQ4 A;  4PQU B;  1BE4 A;  1H0H B;  3D4J A;  3IRX B;  2MHN A;  3T9Z A;  2EFP A;  2ZFH A;  3H4B A;  4F02 A;  1LW2 A;  4ANE A;  1GXL A;  4X4N A;  3OTO J;  4N77 A;  3QAU A;  1C0T B;  3GJR B;  4UUX A;  2XTJ P;  3JYT B;  1N56 A;  4OI6 A;  2HEK A;  2D3U A;  2GS8 A;  1FX4 A;  1B0T A;  1GXT A;  1VQY A;  1YVF A;  1D3W A;  2MLY A;  4TNO A;  1QTM A;  3T6J A;  2HWI A;  2QC3 A;  3RUB L;  4BLG A;  2FZG B;  4FNH A;  4HAC A;  5D0E A;  2J7K A;  4PUO B;  3AOC A;  3DOL B;  4HLB A;  1HQE B;  5H9F K;  2DNK A;  2FC9 A;  3KYL A;  4OJG A;  4P72 A;  3M9O B;  4QWC A;  3GIL A;  4B3O A;  2G2O A;  2QMX A;  3MM5 A;  4HAC B;  3MHY A;  3D0I E;  2BJ1 A;  4LFB F;  2NQP A;  5FJ4 A;  1IN0 A;  2DGU A;  3LP1 B;  3SSQ A;  4X66 J;  5L46 A;  5EDW A;  4IRC A;  1RT6 B;  1ZBT A;  1CEZ A;  2DNM A;  3DHX A;  2KG0 A;  4KGM A;  4RNN A;  5ETV A;  3W1Y C;  3M8W A;  2BKP A;  4N47 A;  3L7O A;  1T9T A;  2YKA A;  4WU3 A;  1VQ7 S;  2HPU A;  1FDA A;  3HX9 A;  4KY3 A;  5AXM A;  3W9I A;  1NJI T;  2PII A;  3BBB A;  2GJ2 A;  1G7C B;  2BOA A;  2UV8 G;  3QQC D;  3TEH B;  6FDR A;  1VQ6 S;  1MG7 A;  3I0R A;  3HLU A;  2JX2 A;  1L3K A;  1KFD A;  3IWN C;  2HHT A;  2KB2 A;  3FEX B;  3GWC A;  4PWD B;  2W9B A;  2VFT A;  1SC6 A;  2VG6 B;  4BCA A;  5ETQ A;  3SCK E;  1NPK A;  3OTB A;  3K57 A;  4QW8 A;  1XMQ J;  3TR5 A;  1SJR A;  1MRO B;  3RRH A;  2H51 B;  2I1R A;  5L39 A;  1VC5 A;  4LVO P;  3CCJ S;  1GNK A;  4LSL A;  1MMN A;  2AYG A;  4DSF A;  2YNF A;  2MMY A;  2GZO A;  4J9P A;  4QJV A;  1S6O A;  3GCX P;  4C8N A;  4C6A A;  3K7R A;  1C4C A;  1Q8B A;  5D6G A;  4DFM A;  1NDP A;  2MB0 B;  1AA1 B;  2O66 A;  2H5J B;  3ZXW A;  4ZCK A;  5I3Q A;  3TAM B;  1Y0H A;  3UD5 A;  4P73 A;  5DLG A;  2ZH2 A;  1XNR J;  2CDR B;  2L3M A;  4ELU A;  2GW8 A;  4JI5 F;  1XEZ A;  3ZZP A;  5E7O B;  1OQ3 A;  3DCA A;  4LBP A;  4D3H A;  1ZS6 A;  2IJR A;  2W1B A;  4P10 A;  4XPC A;  5L38 A;  2UXC J;  3CO0 P;  4F3M A;  2ZE2 A;  5F0U A;  3MED A;  5FII A;  5CQG A;  4F0H A;  3DLB A;  1HD1 A;  2MJN A;  2LLZ A;  4FKX A;  2HGM A;  3R5A A;  4LRD A;  1LK7 A;  2XCA A;  3BSN A;  3HI9 A;  1ZM3 A;  4K4S A;  3HHD A;  2DHS A;  3QT8 A;  1ZPW X;  2B4O A;  2ZE2 B;  1WHW A;  1EP4 B;  1SQG A;  3A1Y G;  1LFW A;  1LKZ A;  3G82 B;  4AXI A;  2C2D A;  4ILM A;  5E3C A;  5J2P B;  1FA0 A;  2HK2 A;  1D1U A;  2HHH F;  1NJY A;  1TKT A;  4O3Q A;  2BJ3 A;  2VIC A;  4DJB A;  2DR7 A;  5GMD A;  1FRK A;  3QYY A;  3J7Y I;  1HFE L;  2RF2 A;  5HQM A;  4QR1 A;  3WHI A;  1IBK J;  3FNN A;  1P1T A;  4EZ6 A;  1B4S A;  2OUG A;  5KG3 A;  4LSN B;  3R7S B;  3DOM B;  1CBK A;  2DY1 A;  1MNE A;  2BM0 A;  2QE5 A;  4P7V A;  4ZVU B;  2GV1 A;  3BQ1 A;  1OPI A;  4JI6 F;  3MEC A;  3THT A;  1L5U A;  3T1Y J;  1LWC A;  3W2W B;  4DR4 J;  2YKM A;  4NX9 A;  1F60 B;  4DMZ A;  2ZBC A;  1AFI A;  2R8G A;  4MK7 A;  2BW7 A;  4CO2 A;  4DHV A;  3K89 A;  2DGX A;  2GJF A;  3OBI A;  5D0R A;  4ZIW A;  1XMO F;  5C7P A;  2YKN B;  5HJX A;  3L9Z A;  5DZ7 A;  2VON A;  4M5N A;  2NXE A;  2K8G A;  2BQU A;  2OH2 A;  2R7U A;  4DR6 J;  1GXU A;  1C0U B;  2AJ0 A;  2D41 A;  3GLJ A;  2YKQ A;  2LU2 A;  3MFI A;  1HWJ A;  3I5A A;  2I38 A;  4QBU A;  1TFW A;  2FLO A;  2UV8 A;  3MOJ B;  3W8G A;  1N34 F;  2CQC A;  3QLH A;  5A8W A;  3JTN A;  2E9Z A;  4ES1 A;  4DR5 F;  3SBM A;  2VG7 B;  1JKH B;  1LW0 A;  1IKW B;  4WFY A;  4RX6 A;  3KLF B;  4JYA F;  1GMV A;  4L74 A;  2FLN A;  2HVD A;  2BE9 B;  2R3V A;  1HHT P;  1QAX A;  3M6V A;  1AT1 B;  1UMJ A;  5ETM A;  4Q8E A;  1JXV A;  1KBR A;  2WW8 A;  2UZA A;  4YP3 A;  3R1H A;  2VG7 A;  4Y6I A;  2ZH7 A;  3CTR A;  5F8N A;  2ALZ A;  1ZAV A;  1N54 B;  1JIH A;  1R27 B;  1VQ8 S;  1NM2 A;  3MUM P;  4KH0 B;  4B3M F;  1LWF B;  5KG0 A;  2MDA A;  2HS3 A;  2E1R A;  3NEK A;  4PPZ A;  2DR6 A;  2ZM6 F;  1BXN A;  3T1Y F;  4O0N A;  2MTL A;  1N36 F;  1XQI A;  2ROE A;  3H2U B;  4B9L A;  1Y00 A;  1UET A;  3RB4 A;  2FPH X;  1XBW A;  2VC0 A;  2IYG A;  2OPQ B;  4B02 A;  1D8Z A;  3CCZ A;  2G0I A;  5D8H B;  3MZI A;  2HQI A;  3M6U A;  1IXK A;  2DHG A;  2JLE A;  3OUY A;  3LF0 A;  5L1J A;  2MSS A;  1VFJ A;  1H74 A;  5FDL B;  4EBD A;  3QGP A;  1WEX A;  3FQL A;  1U6B A;  2W7A A;  4OV1 A;  4RNH A;  3QAE A;  4LT6 A;  4ICL A;  5HP1 B;  4QCL A;  3PO4 A;  3HKW A;  3OW2 R;  2XLK A;  3GMG A;  4KTQ A;  3DI6 B;  1F6T A;  1ELO A;  3MCO A;  3GFZ A;  5DZ6 A;  4EYI B;  4QW9 A;  1VHI A;  2DBB A;  1LOU A;  2MQN A;  2MLX A;  1F2H A;  1FE0 A;  1R8H A;  3ISN D;  4WE1 B;  2RIL A;  2MGZ B;  1CJU B;  1QAI A;  2KT5 A;  2UXB F;  2GMH A;  4JYA J;  2HQC A;  1RBL A;  3KNG A;  1N6Q A;  4NLS A;  4N8N A;  5KT4 A;  3JAM U;  2W9C A;  2F7V A;  2HQF A;  1UA0 A;  1YGY A;  2MYF A;  1L3T A;  1I5O B;  2QLW A;  4QYR A;  1JLE B;  3JS9 A;  2BE2 A;  4ZVQ B;  1RAG B;  2HHP A;  2JFD A;  1XK8 A;  4A8O A;  5IV3 A;  3GIM A;  4DPW A;  2MEW A;  3BGR B;  1N5Q A;  1XR6 A;  1UVJ A;  4IH6 A;  4NEZ A;  2V63 A;  3R7B B;  3RRK A;  4TU8 A;  5EWE A;  5T7L A;  3UNG C;  2UUT A;  2RJZ A;  4WCE Q;  3BO2 A;  3SCJ E;  2UU9 J;  4J9K A;  3TVK A;  1S0O A;  2JNJ A;  1H98 A;  3A3N B;  3AA9 A;  1FXR A;  2RT3 A;  3HCX A;  4KSE B;  1WJ9 A;  4X4P A;  3J81 U;  2YQ3 A;  4X62 F;  1HNV B;  1UWB B;  3G8S A;  2HZC A;  3BQ0 A;  1RCX B;  4USW A;  3CED A;  3KK1 A;  1L3U A;  2OTL S;  2J9D E;  3Q8Q B;  1VBK A;  3G6E S;  4B9V A;  3RJM B;  2XI3 A;  3CO9 A;  2RNE A;  2DXF A;  3DNC A;  3F56 A;  2RQM A;  2DTJ A;  3GJQ B;  4W98 A;  2IYI A;  3SMZ A;  2Y8Y A;  3IMQ J;  4M8L A;  3OTC A;  5DQG A;  3X1L B;  4WFB Q;  3HP6 A;  2J6S A;  3OSP A;  1U26 A;  2E66 A;  3L4B C;  4EO8 A;  1F2G A;  3NAH A;  3MR5 A;  2HLU A;  4DS5 A;  3TAP A;  4WF9 Q;  1FWP A;  3RW7 A;  2DGO A;  3ZTP A;  3IWX A;  3MPD A;  1Q7Y T;  1PAU B;  5A76 A;  1UFW A;  3DOK B;  1N8R T;  5BR8 F;  1U24 A;  1NSP A;  2M5Y A;  4IR9 A;  2HVZ A;  2WSE C;  4R0J A;  3A8I A;  1PJ6 A;  4FF4 A;  1RT5 B;  1WSR A;  3RBZ A;  4L3K A;  1YKW A;  4CNY A;  4DCJ B;  3VGU A;  1SIZ A;  3TW0 A;  3Q8U A;  4J9S A;  2VA2 A;  1R0B G;  3PTW A;  4G65 A;  2E7V A;  3TUI C;  3D6H B;  3QPI A;  4A4J A;  4CWB A;  3GV5 B;  2UU9 F;  4C98 A;  2RKI B;  4FYV B;  4QPX A;  5H9E K;  3DGP B;  3ZZ0 A;  2DR9 A;  1WC6 A;  3T5H A;  4JV5 F;  2KM8 B;  1R8P A;  3ENW A;  1FNO A;  3EX7 B;  3QJP A;  2L48 A;  3KTQ A;  1RKI A;  1HNX J;  2JC0 A;  3TX0 A;  2AGP A;  3DOL A;  4V1A k;  1TVR A;  3M7V A;  2RSQ A;  3ZTS A;  3J80 U;  2V4Q A;  2UVW A;  2XNR A;  4K0K J;  4DG1 B;  4YDD B;  1VQK S;  1N5S A;  1T8E A;  2PE8 A;  3C15 A;  1K44 A;  2Z58 B;  2HVI A;  2Q6C A;  2EKN A;  5KFP A;  4J9Q A;  3O44 A;  2MZR A;  4UOG A;  1NZ8 A;  4OX6 A;  1YIJ S;  2PEH A;  2N3O A;  2KFY A;  4NLG A;  1XJW B;  2YVS A;  2RQK A;  4NML A;  2Z0G A;  4KGX B;  1WDD A;  4I7F A;  4BC9 A;  5A2Q U;  1FFG B;  4ZP8 A;  3PNI A;  2ZH6 A;  3GYN A;  1RU2 A;  3BRE A;  3VV2 B;  5DM6 Q;  2ADB A;  1UJ4 A;  2CQH A;  5KT7 A;  5KFD A;  2HNY B;  1ICE B;  2DKO B;  1U1R A;  1WC1 A;  5CHC B;  5ITH A;  2AF6 A;  4EO6 A;  3MM5 B;  3FFI A;  3UCG A;  1VRT A;  2IIH A;  3D66 A;  2KRR A;  4FBT A;  2ZDP A;  5SZT A;  3NL0 A;  2R7O A;  5KFG A;  2IDL A;  1S9G A;  2FYX A;  1N4L A;  2V8G A;  1K0V A;  2CNO B;  2R8J A;  3KHR A;  1S1T A;  4KBI A;  3QT6 A;  2RML A;  5HI7 A;  2FHJ D;  1OMS A;  2QLX A;  4ILR A;  4C11 B;  1Z2Z A;  2ZIT A;  3GU0 A;  2GVD A;  2ZD1 B;  4RUA A;  4AE5 A;  2KM8 C;  3G4S S;  2HGN A;  4LRB A;  1XMB A;  2RIJ A;  4O3S A;  4K0K F;  3RGI A;  3PW2 A;  5DET A;  5A2Q Y;  4TQR A;  4B3S J;  2WOM A;  1WEZ A;  4OYX A;  4ELT A;  4E0D A;  2OSR A;  1UVM A;  2G9O A;  2CKW A;  3R3T A;  3AOA A;  3TVZ A;  2W9B B;  4DR3 J;  3SI8 A;  3VZH A;  4NCA A;  4ID8 A;  5HBM B;  2V2Z A;  2DNY A;  4LJM A;  4O3O A;  3GQC A;  4JI0 J;  1PC4 A;  4ID5 A;  2X1A A;  3KJF B;  2RU3 A;  5DG7 A;  1QUV A;  5CD4 H;  5KOX A;  1Z4U A;  3V6D A;  2RD5 C;  3RAX A;  3NCR A;  5DS7 A;  4ZPW R;  3TYT A;  3TJ9 A;  4FS2 A;  3KLF A;  2HW3 A;  1RTH A;  3B4D A;  4UW2 A;  1HNI A;  1N0V C;  2Z8Q A;  4Y2K A;  1XMO J;  3H59 A;  4LF9 F;  5CYM B;  1VQO S;  5ETN A;  3P3D A;  3T9N A;  2V67 A;  3WZ0 A;  3V6D B;  1SI9 A;  2QZ8 A;  4OX9 F;  3BDE A;  4ZVE A;  2ZH5 A;  2BRL A;  4ETX A;  2Q66 A;  3P96 A;  1YJ9 S;  2XMM A;  1J5E J;  3CDE A;  5LXR A;  2BJE A;  3MCM A;  2BAB A;  1N34 J;  2EW9 A;  3CD5 A;  2FJE B;  3HMJ G;  2LQB A;  4DL6 A;  3MCN A;  2P9G A;  1K0T A;  3HT0 A;  1RWV B;  3R5G A;  4QR0 A;  2FJW A;  3HSJ A;  1GK8 A;  3CIM A;  4PWW A;  2K3K A;  3QRP A;  1AW0 A;  2NR0 A;  4CLF A;  5HJY A;  5CCM A;  1Q81 T;  1R8B A;  2ZBP A;  4USJ C;  4J9O A;  2J7W A;  2Q1L A;  4IOB A;  4OJ3 A;  4TXS A;  4EFA C;  3G82 A;  3RR7 A;  4OX8 A;  3FBC A;  1KLM A;  3R2D J;  1KDN A;  2BEF A;  4QIF A;  2ZOG A;  1YRT A;  3MAA A;  4Y34 A;  4FNI A;  1IBL F;  1MW7 A;  2MZJ A;  3M8Q B;  3T5K A;  2UXC F;  3DRR B;  1UEU A;  3DU5 A;  3S01 A;  2VV5 A;  1UJ6 A;  3GPA A;  2C2K B;  2K7J A;  3N0V A;  4MJK A;  2NXC A;  2VG5 B;  4BWM A;  1C1B B;  2V5H G;  3P5B P;  1NSK L;  1WG4 A;  3KUH A;  3K17 A;  4CH0 S;  1Q0N A;  7FDR A;  2VG6 A;  1C0U A;  3KLV A;  3P6Y C;  3IG1 B;  2WTF A;  4HR2 A;  3FBF A;  5RUB A;  4CZC A;  5CAB A;  1H2V Z;  2AQ4 A;  4C3K A;  3NOC A;  2UUA J;  2O01 C;  4DI6 A;  2UVR A;  3MF5 A;  2JEG A;  5F0W A;  4ED7 A;  4U6P A;  1B0P A;  4P2F A;  3JSM B;  3GIJ A;  2CQ4 A;  1J5E F;  1BLU A;  1RTD B;  2FD2 A;  2C2M B;  1SKS A;  4B9T A;  4LF5 J;  2NUH A;  1QM9 A;  2CQD A;  2QSF A;  2KZZ A;  3PFO A;  1MLA A;  1FVQ A;  2I6W A;  3ET6 B;  5F8H A;  2J8S A;  2XS7 A;  2K7K A;  2PEB A;  1S5Z A;  4GC7 A;  3OLB A;  4KV8 A;  2CVI A;  3AXK A;  3CDA A;  1J2V A;  3AY0 A;  2ZHO A;  4IG3 B;  4A8X A;  1NPR A;  4Y2C A;  1TV6 A;  5G0R A;  4TLR A;  1BD6 A;  3OPK A;  3ET6 A;  4UOH A;  2A2C A;  2V8V A;  5FLX U;  1REV B;  2E5L J;  3T5L A;  4PRF A;  3M8S A;  5KG1 A;  1IJE B;  2PI4 A;  1R43 A;  4YEA A;  1R3N A;  5K8P A;  2V94 A;  1RTI A;  2ZHA A;  2JEI A;  5E33 A;  3I96 A;  4K4V A;  2WON A;  1V9O A;  1Z1Z A;  3JTO A;  4FDF A;  4X4U A;  1S6U A;  3MM6 A;  3HKZ D;  1PAE X;  2QJ3 A;  2KYX A;  3R2C J;  4O0I A;  4OX7 A;  4AYB D;  1NH7 A;  2G0J A;  3KLG A;  4LF8 J;  3EVM A;  1KQK A;  4LF7 J;  2DNP A;  4IFY B;  3E3X A;  4PAA A;  1V6H A;  3HSD A;  2GCF A;  3KG0 A;  3OXF A;  2RF2 B;  2B6A B;  3SIP B;  1S12 A;  4QYZ J;  5EWF A;  2YXL A;  1NO8 A;  3MAH A;  1F5C A;  3W64 A;  1BMQ B;  4RNO A;  4RBU A;  3OL7 A;  2R7W A;  4J9M A;  3SZ2 A;  4IO1 A;  3ENV A;  5HL7 Q;  4JI8 J;  1ZAX A;  3BGO P;  1DQA A;  3PYG A;  1N36 J;  2PA8 D;  3DU6 A;  3TUZ C;  3GFX A;  4ATN A;  1S57 A;  1QTN B;  4CO3 A;  4DV4 F;  3UCU P;  3CDU A;  2ERR A;  1JJC B;  3CCM S;  1E6V A;  2ZEJ A;  1JLC B;  2AWZ A;  5KFA A;  5IT4 A;  3E51 A;  2UUC F;  5DDR C;  2P6S A;  3PDN A;  3R6G B;  3KNA A;  2EK1 A;  1FT8 A;  2YKO A;  4WK1 A;  2P9E A;  1FXL A;  4OYP A;  2ZH3 A;  4H54 A;  4P74 A;  2KO1 A;  2QL7 B;  1FO1 A;  4L6V 3;  1NDL A;  2ZOM A;  4RPF A;  3BB5 A;  5HQ8 A;  1X5P A;  5HVG A;  2W2M P;  3AH6 A;  2PD1 A;  1X4C A;  3H5U A;  4CIO A;  5I3U A;  4OYB A;  2V6A A;  3H2L A;  4LUB A;  3MEK A;  3Q8P B;  4LF7 F;  1VI7 A;  3LP1 A;  1CJK A;  2QN6 B;  1FRI A;  2Z2Z A;  5E3A A;  5KFS A;  5AE3 A;  5BXI A;  1RT6 A;  3POT B;  4O3P A;  1TL1 A;  2EVZ A;  4CRJ A;  5EGY A;  4QWA A;  3CJ2 A;  1WEY A;  2WHO A;  2JSX A;  3C3L A;  4K7Q A;  4G3I A;  4NMX A;  3OR1 A;  4MIB A;  3ZC4 A;  4G1Q A;  4H4K C;  1KON A;  1XC9 A;  1RT5 A;  2XM3 A;  3D9B A;  5C24 B;  4YHH F;  4F4X A;  5M2R A;  4UT4 A;  3H20 A;  3US5 A;  8ATC B;  2KXH A;  4OZN A;  3CCR S;  5IS2 A;  2WW4 A;  1WEL A;  2C28 A;  4KFB A;  1MU2 A;  2QFI A;  1AUS L;  5ETT A;  1HNZ F;  4LFC J;  1IVZ A;  3L09 A;  4M94 A;  2F8M A;  1HBO A;  1RWO B;  1CC8 A;  1R6V A;  2VFV A;  4LSL B;  1OIA A;  2OSQ A;  3SFG A;  4NA3 A;  1WWH A;  2XSJ A;  2OPP B;  3V4M A;  4DUY J;  3AAW B;  3H42 A;  3ZZZ A;  1U1Q A;  5EX3 A;  2XG8 A;  2XCP A;  3SDE B;  4DF4 A;  4ZPD A;  4A8K A;  1S1U A;  4R5P A;  1RAJ A;  2XNQ A;  2BM1 A;  1NK4 A;  4NOH A;  5DG8 A;  1K8A T;  5F8M A;  2XLJ A;  3H4D A;  1UVI A;  3UD3 P;  4DPY A;  1N5V A;  5KFW A;  4DL0 C;  5CYQ B;  2RKI A;  3B82 A;  2W8K A;  3N79 A;  2IAJ B;  1NDC A;  2DNL A;  3CJ8 A;  2HRY A;  2YQ0 A;  5MLC V;  1K47 A;  3Q2T C;  1Q1K A;  1YZ6 A;  5F8G A;  1BWV A;  2Q6B A;  2YNG B;  4U8Y A;  3MAQ A;  2UUB J;  3VQT A;  3T3F A;  1RCO B;  1SH2 A;  3DLH A;  3EGV A;  4B9M A;  1VIX A;  2JL9 A;  4E2F B;  4X65 F;  4KYZ A;  1QAJ A;  1TAQ A;  4FZV A;  1U0S A;  2APO A;  4FXV A;  4OHZ A;  3KK3 B;  4KHP J;  1T11 A;  1R89 A;  4CT8 A;  5KFR A;  3QO9 B;  2C2R A;  4BC7 A;  1RHM B;  1UPP A;  4M5I A;  5CZX A;  4JUZ A;  1EET A;  1S9E B;  2KXF A;  5KFN A;  3QAT A;  4F50 A;  4PG5 A;  1IKX B;  3OFF A;  4XPE A;  5KFO A;  4QQB A;  1SB6 A;  1SV5 A;  1UCN A;  2BJD A;  1FK9 A;  3EZU A;  4L72 B;  4NLX A;  4YME A;  2J9D A;  5KG4 A;  2DO4 A;  3R7N B;  3G96 A;  3M8Q A;  3FRZ A;  1FEH A;  3ADA C;  5D0G A;  1EQ0 A;  3N5B A;  3LQV A;  3VAM A;  2OPR A;  3DLK A;  4CLP A;  2KTQ A;  2JWN A;  1Y5L B;  2RU9 A;  2KVQ E;  2IVY A;  3PCO B;  4JBC A;  3W2V A;  4KR0 B;  5AE2 A;  1NK6 A;  3DXB A;  3MR2 A;  4WFN Q;  4ECZ A;  2BDP A;  5K5M A;  3QWU A;  4ID5 B;  4LFA J;  4ZCI A;  3V81 A;  1YJ7 A;  4WP8 A;  1SKU B;  3PW4 A;  4F4W A;  1X5S A;  4DS4 A;  5HMZ A;  4HEA 9;  3E2E A;  1GTE A;  3QSY B;  1W2B R;  4FP9 A;  3PM9 A;  4X65 J;  5KFF A;  1BC6 A;  1U48 A;  2EG1 A;  2XYG B;  4WFA Q;  4ZVS B;  4C8Z A;  2CZ4 A;  1H6K X;  2VQF J;  3KMQ A;  3CE8 A;  4FKY A;  5LL6 d;  2E7W A;  2YTC A;  3CCT A;  2MXY A;  2G2Y A;  3R5C A;  1LV5 A;  2VOD A;  4GKK F;  2VQE F;  3ZFV A;  3R5J B;  4DDF A;  1X8D A;  3BQ2 A;  3QRR A;  3OTO F;  2OTJ S;  2FGO A;  2UUA F;  3M05 A;  3RB3 A;  4Z2X A;  1S1X A;  8RUC A;  2A1B A;  2IM2 A;  4OYZ A;  2RDI A;  3B8H A;  4G1I A;  3UCZ P;  1FJE B;  4GO7 X;  1GMU A;  2NXJ A;  3R5D A;  2PMH A;  4TN2 A;  3KDO A;  4NE9 C;  4RW6 B;  5CYM A;  4RBV A;  1TUW A;  1KEK A;  3PY8 A;  1KVI A;  2AIR B;  3WC0 A;  2KVI A;  1X9S A;  5B0D A;  4CH7 A;  4LFB J;  1D9A A;  1VIO A;  4A47 A;  5DM7 Q;  1M5O C;  4JV1 A;  3R27 A;  1NK0 A;  2K1R B;  5BJR A;  2HFZ A;  2KJW A;  1TU0 B;  4J91 A;  3MEC B;  1DAR A;  5F8L A;  2R2T A;  1IKX A;  2CRL A;  3FGV A;  1X5T A;  1U25 A;  3FC9 A;  3FFI B;  5EWG A;  4C9D A;  1SKR A;  1BQN A;  4W90 B;  1DJ0 A;  1DUR A;  1HBM B;  4ZA1 A;  2UP1 A;  1Q5V A;  2LCW A;  4N7T A;  4F7V A;  2X3D A;  2YY3 A;  3I0R B;  4I68 A;  4OZ3 A;  1KP6 A;  3D5M A;  1RSC A;  1SQE A;  2YX1 A;  3DLG B;  4KRW A;  1GX5 A;  2JVO A;  3MM8 B;  5DG9 A;  3GV8 B;  3D28 A;  3MAA B;  2AX1 A;  3MPV A;  1IR1 A;  2B43 A;  3JQK A;  3NP5 A;  1CS4 B;  3DRR A;  3OHB A;  4DSL A;  1UVL A;  5CYJ A;  2XS2 A;  3NNA A;  5KG7 A;  1S59 A;  2GIR A;  4ECW A;  5LT5 A;  5K8O A;  2YKM B;  1HHS A;  1T03 A;  2RHQ B;  3GR1 A;  4WU2 A;  5ETP A;  1JKH A;  3NAI A;  2N4D A;  4DSE A;  4RWX A;  4Z7C A;  2WB4 A;  3GSD A;  2HBY B;  1J5O B;  1JLB B;  2VDH A;  4DQP A;  1UW4 A;  1AZS B;  5G0R B;  5LSO A;  5GAH U;  3BO4 A;  5DQI A;  5H9E J;  1RAB B;  4ZVO B;  2MKI A;  1W2I A;  4BHQ A;  2COL A;  3CDB A;  3VAG A;  2IC3 B;  3ICL A;  2XZW A;  3S7R A;  1XTZ A;  2VPX B;  3MMA B;  1YLX A;  4EU0 A;  3OL8 A;  2MQL A;  2LA4 A;  3J7Z 5;  3IWL A;  3SV4 A;  3MED B;  4I6Y A;  1HD0 A;  3DLE B;  2DH8 A;  4PG4 A;  2LMI A;  2E5H A;  3UQS A;  3HHN B;  2GGP B;  2XHW A;  2HQ3 A;  3NNC A;  1TUG B;  2CJB A;  3UDL A;  3G2X A;  2IC3 A;  2VL1 A;  3ELH A;  8AT1 B;  1NB7 A;  5EX0 A;  4X4Q A;  2N4C A;  2X51 A;  5C5J A;  2FVQ A;  3K8V A;  4P71 A;  5J2P A;  3Q86 A;  5IWA J;  1APS A;  1RLD A;  2LKZ A;  4OIX A;  5J1E B;  2IRY A;  1E6Y A;  1FNM A;  5JUM A;  3Q22 A;  2K1R A;  1Y11 A;  1UP1 A;  2W2Q P;  3IFE A;  4OYO A;  4RUB A;  3CJR A;  4CO5 A;  3MM6 B;  1BQX A;  3HD2 A;  2YNH A;  2ZH4 A;  1TL5 A;  2RS2 A;  4PAB A;  1VRQ C;  1MN7 A;  1VLO A;  4DL7 A;  1VQ9 S;  2DPI A;  1HBO B;  1SQF A;  2OD4 A;  1IQT A;  4OZJ A;  5FLX Y;  3AT1 B;  2FJA B;  1CPZ A;  1ZM9 A;  3M6X A;  5KFT A;  4LRA A;  2NZC A;  3QZ8 A;  1I94 F;  2M8H A;  3MM8 A;  2NSC A;  4UUW A;  2R7X A;  4NYO A;  2CWK A;  3IRX A;  4UTG A;  2WVF A;  2ABY A;  2JVR A;  3N6M A;  3QGI A;  3Q24 A;  3MM9 A;  1X4A A;  1YG0 A;  2NSB A;  5E3R A;  2C2E A;  2QA1 A;  1H3D A;  3GR0 A;  4YY3 J;  4LBI A;  4K4Z A;  1D9D A;  4M5G A;  1FTR A;  4LIW A;  2FHM A;  4OHW A;  5F3T A;  5AXK A;  5T41 A;  3VAI A;  1WI6 A;  1CJV A;  1T9V A;  2J76 E;  5DDQ C;  4C3M A;  4M5J A;  4E98 A;  1URN A;  1DY3 A;  3I9V 9;  2Q79 A;  2IFX A;  2O3D A;  1WC4 A;  2V2V A;  3JTP A;  2VDI A;  3CMQ A;  1PO6 A;  2F4V J;  1PBU A;  4K59 A;  4ES3 A;  3PR5 B;  2E9T A;  2R2S A;  4DR2 F;  1F0X A;  3UI3 A;  2DXE A;  3K8W A;  3P4U B;  5D4L A;  4MH8 A;  1VYA A;  4ZP6 A;  2B51 A;  5KFL A;  3UR3 C;  3ZTR A;  4I67 A;  2HHW A;  4PYD A;  3MXH P;  5KT5 A;  2FY8 A;  1IKY A;  4EGL A;  1RWU A;  4IG0 B;  1B3T A;  2CIM A;  3TRG A;  3E01 A;  4MMO A;  4UZB A;  3PW0 A;  3T1H F;  1JLF A;  3DM2 B;  3KJQ B;  1YBA A;  5HLF A;  2XY6 A;  1PKU A;  3FEZ A;  1RAF B;  2FHO B;  1T02 A;  2W7P A;  4P75 A;  2DNR A;  2P5V A;  4ZP9 A;  3E8O A;  2EXU A;  3ITH A;  1TL1 B;  3LAK A;  1SC3 B;  2BAC A;  5DJB A;  3BO3 A;  2DR5 A;  3OFH A;  2HAF A;  2ZBI A;  4WP3 A;  1RT3 B;  1DQ8 A;  1XN9 A;  2Q3P A;  2VC1 A;  2ZD1 A;  2ZNY A;  3N01 A;  4HHU A;  4LR7 A;  4M5D A;  3T1A A;  1WSV A;  1B7Y B;  3EJM A;  4KKO A;  4RW8 B;  3VWS A;  4J9R A;  3OHA A;  1FF2 A;  1YWX A;  2C3M A;  5C24 A;  2Y1R I;  1GX6 A;  1RAD B;  3IBW A;  3V81 B;  2V8D A;  3HO1 A;  3GII A;  3L95 X;  3PJW A;  2DH9 A;  2MKJ A;  2QX0 A;  2G13 A;  1UAW A;  3TOQ A;  1I3O B;  5M2U A;  1YJV A; 
#chains in the Genus database with same CATH homology
 3D3C J;  4X62 J;  4DR2 J;  2UUC J;  2UUA J;  5LMN J;  4JI7 J;  4JI3 J;  4DR6 J;  1HNX J;  3OTO J;  4LF5 J;  4JI5 J;  4OX9 J;  2UXB J;  4V1A k;  3J80 U;  4K0K J;  4LF9 J;  5AJ3 J;  4DV4 J;  1HNZ J;  2UUB J;  4LF6 J;  4JI1 J;  4RJV A;  4DV3 J;  2VQE J;  4GKJ J;  1I94 J;  4X64 J;  4GKK J;  4KYZ A;  1FJG J;  4KHP J;  5FLX U;  2E5L J;  5A2Q U;  4NXN J;  4X66 J;  4NEY A;  2MTL A;  2KL8 A;  1HR0 J;  4JI2 J;  3W1Y C;  5IWA J;  4DV2 J;  4YHH J;  4DV5 J;  1IBL J;  5BR8 J;  3R2C J;  4LF8 J;  4KY3 A;  4DV1 J;  4LF7 J;  2MQ8 A;  3T1H J;  2HHH J;  2UXD J;  4B3T J;  4DR7 J;  4JI4 J;  2KVQ E;  1IBM J;  1HNW J;  1XMQ J;  4LFA J;  4B3S J;  4JI8 J;  4DV0 J;  1N36 J;  4JYA J;  4JV5 J;  4DR3 J;  1XNQ J;  3JAM U;  4X65 J;  3J7A N;  4YY3 J;  4JI0 J;  1N33 J;  2VQF J;  4DV7 J;  4DR4 J;  4NXM J;  4DR5 J;  4DV6 J;  1XNR J;  2MEW A;  5IT9 U;  2F4V J;  4NEZ A;  1XMO J;  2UU9 J;  2UXC J;  3J81 U;  4DR1 J;  1J5E J;  1N32 J;  1N34 J;  3IMQ J;  4B3M J;  4PWW A;  4JI6 J;  4LFB J;  4DUZ J;  4LF4 J;  3R2D J;  1IBK J;  2ZM6 J;  5LMU J;  3D3B J;  4HHU A;  5LM7 E;  4LFC J;  3T1Y J;  4B3R J;  4DUY J;  4AQY J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...