2HHHJ

Crystal structure of kasugamycin bound to the 30s ribosomal subunit
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title The antibiotic kasugamycin mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation.
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 2hhhJ00
3R2CJ 4DR3J 4DV5J 5LM7E 1N36J 5A2QU 4JI8J 5FLXU 3R2DJ 3J81U 4LF5J 4X66J 4DV7J 4LF9J 3D3BJ 4AQYJ 4KYZA 5LMUJ 3JAMU 1N32J 4B3TJ 1HNZJ 4V1Ak 3D3CJ 4DR2J 5IT9U 4GKJJ 4JI4J 1IBMJ 4JV5J 4LFBJ 3J80U 4GKKJ 4LF7J 4X65J 4DUYJ 2UU9J 4LF4J 4JI7J 2MTLA 4DV2J 2HHHJ 1N33J 2VQFJ 4DV6J 1HNWJ 2UUAJ 3IMQJ 2E5LJ 1IBKJ 1J5EJ 4JYAJ 2ZM6J 4B3RJ 4PWWA 4JI2J 4JI0J 4DR1J 4DUZJ 4B3MJ 2UUCJ 4NXNJ 4K0KJ 4DV4J 4KY3A 4RJVA 4YHHJ 2VQEJ 3T1YJ 2MQ8A 4LFAJ 2UXCJ 4JI5J 4X64J 5AJ3J 1HNXJ 4DV1J 2MEWA 3T1HJ 2KL8A 4DR6J 4KHPJ 4DV0J 4NEZA 5IWAJ 1IBLJ 4NXMJ 1XMQJ 3OTOJ 1N34J 4DR7J 2UXBJ 3J7AN 2F4VJ 4DV3J 4LF6J 4DR4J 1I94J 2UUBJ 1HR0J 1XMOJ 4NEYA 4JI1J 4JI6J 4X62J 2UXDJ 4LF8J 1XNQJ 5LMNJ 2KVQE 4HHUA 4LFCJ 4OX9J 4JI3J 1XNRJ 4YY3J 3W1YC 1FJGJ 5BR8J 4B3SJ 4DR5J
chains in the Genus database with same CATH superfamily
1ZM9A 1JLAB 4CYUA 5IT0A 3R2DJ 1RAJA 4R8UB 2B43A 3QFWA 3H25A 2VOPA 2CQBA 1SKWA 2WBMA 1A7GE 3R5AA 1P8GA 3CE8A 5KFPA 5KFNA 4I2QB 2AU0A 4C8MA 3M9OB 2M5YA 3DI6A 2R7WA 2CRLA 4IG0B 1EQ0A 3CCMS 2QMWA 1HBOA 3LGMA 3R5DA 3J7ZT 3CMQA 4ENOA 5B0EA 1YJ7A 4HDHA 2M4MA 1QSYA 1S9GB 3P6YC 4OI6A 3G8QA 5FD1A 5AJ3F 5F0UA 2IIHA 4ZVHA 4DX5A 2Y9HA 3I9ZA 3N4WA 3IC1A 1NBEB 5L38A 4ITSA 3K57A 2DKOB 3L9ZA 4KO0B 2XSFA 4AXJA 4K4YA 3CC2S 2HSEB 2XWXA 4WZMA 1RT6B 1UVIA 1AZSB 2DY9A 4AUKA 2FY1A 1CBKA 5FLXU 2JHEA 3DRRB 4XPCA 4LF5J 5E3AA 2B4PA 5H9EJ 1J5OA 1U45A 2J0WA 1YI2S 2DHXA 1PCAA 2XMAA 3O3LA 4LSNB 2BKNA 5F8LA 3C19A 3IG1A 3JXOA 5HBMA 3KUHA 4O3QA 5EUHA 2DGSA 4CLZA 5KT3A 2FB0A 2KM8B 1NK9A 1OWXA 1U49A 4W92B 4UT4A 4J37A 5GMEA 5LL6d 4KBIA 3GCWP 1TL3B 1CULA 4OL8A 1TKZB 1LWEB 4DFPA 1VK8A 2F4FA 2KT3A 2MSSA 4DL4A 4A4JA 2F3JA 1VBYA 2BUNA 3RJMB 4DI6A 1LWXA 2RE1A 1JLFA 4TQRA 1RI7A 1MMNA 1RHRB 4NCBA 2HZAA 4KGZB 1NJYA 4LF6F 1RE1B 4FBTA 5DQHA 4UZCA 2L3MA 5DDQC 5EGYA 4X4TA 4ID5B 3CCRS 1U25A 2DJWA 4M1KA 1YDLA 3UDLA 2OHDA 2V9KA 1L3TA 3CD0A 3MDFA 3PR4A 4NRTA 3FNNA 4YUDA 2AJ4A 3IRXB 3K5OA 4X66F 1T02A 4CWBA 2HGMA 4UY85 3UO0A 1MWYA 2CJYB 4CTAA 1F60B 4LF7J 4RNOA 1IQTA 3BN7A 4ZLJA 4C3LA 2CG8A 2F7VA 3MD1A 2RRNA 2GZOA 2D69A 2HQFA 1NB7A 1NO8A 4OYBA 2P9CA 5ETQA 3C15B 3V6KA 4IRCA 1YZ6A 4H4KC 3T6JA 4X62F 1NK4A 2OEJA 2MY7A 3GP9A 1NZ8A 1XR5A 2GJIA 1N88A 1VCTA 5E5NA 3M1VA 2WHOA 1DARA 3P5BP 2V68A 1NUEA 1GT8A 3OXLA 4TXSA 1MROA 2DEIA 1S7IA 2JZ5A 2GHWA 5M2PA 1OPZA 2IA0A 1W25A 3NKYA 5I42A 2MKJA 1N52B 4TY8B 2CQHA 4GKKF 3MM8B 2F9DA 2LXUA 2Z2LA 1UEVA 3F0NA 4TU9A 3NS6A 3DI6B 2BE9B 3ILLA 1WSVA 3BYRA 1MLAA 4ZVGA 3NLCA 4OI2A 1JXEA 2W2NP 4DLGA 2V34A 1HBOB 2K7JA 2MKCA 5HVFA 3ZTSA 4PCQA 3NCQA 3ITHA 4CP5A 4OX7A 5KOXA 4Y0FA 1WG5A 2QLFB 2ZM6J 1MG7A 3DDNA 3PDNA 4RNFA 2ZD1A 4K59A 4ZJLA 4L6V3 4ED7A 1NK5A 3HHDA 3UCGA 4ZMMA 3L09A 3GIRA 4KHRA 3C3LA 2R4FA 2HG4A 2CQ0A 1KBRA 3EE3A 1T05B 1M5KC 3OR1B 4EFAC 1UKUA 5K8NA 1KQFB 3A3NB 1E6YA 3VF0B 5F8JA 3DLLQ 2GMLA 4KGVB 3OXFA 1ZBTA 5KFUA 5AE1A 1KHWA 2I0XA 3TWZA 1RBAA 1EAYC 4LBHA 4DV7J 5DS7A 1YBUA 1D3WA 2IRYA 4DR3F 4FS1A 5HBMB 4B02A 2B9XA 4OYWA 2F1FA 5I4MA 3DDKA 4CO1A 1U4BA 1T95A 1WSRA 5H1SV 3EPGA 4Y3CA 4JV5J 4QCLA 1XIQA 4O3NA 1GMWD 3U02A 3OVBA 1CULB 2IAJA 1AW0A 2JX2A 2VA3A 4NCAA 1H7WA 2YVSA 1J5EF 2CDQA 2OUGA 2HMIA 1D8YA 1TVRA 3SSRA 2YKQA 3HHLA 4XPEA 4K7QA 3A3OB 2KO1A 4UTGA 2LEPA 1YBAA 2YQ3A 5KFRA 5A8KA 1BQMA 1U2CA 1OSDA 3W8GA 3DU5A 3WBZA 2YKMB 4NLYA 1ZOTA 3OVSA 3LF0A 1VBKA 3PCOB 2YPZA 4M5DB 3PEJA 2C2MB 1RDRA 2FJXA 2F8MA 3KKFA 3TUIC 2VPYB 2XULA 4KYZA 4IH7A 1WG4A 2W2OP 4GRSA 2YKOA 4OHWA 4JV1A 5J2NA 1V6HA 4WFXA 1SL2A 4MK7A 1NKBA 3NCRA 5IM0B 2V2VA 2HS3A 1RHUB 1WC5A 4JI7F 3T1AA 2KG1A 1LWCA 4FF1A 2CPHA 2E1AA 2ZH6A 5L9XA 5DETA 1H2VZ 3M1VB 3DHWC 3V6JA 2DH8A 4LRCA 2C2OB 3S7RA 1MSWD 1TL7A 4OYPA 1FKAF 3W9JA 4QWCA 4ETZA 2XNQA 2RQKA 4DX8H 2V4QA 3J7YI 5D0HA 3Q2TC 1ZH5A 5I42B 3W9HA 3RB0A 4J9NA 1RKJA 1VQ5S 5ETKA 4ES3A 4NE9C 3I32A 2K3KA 4NZ6A 4EYIB 1NDPA 1WELA 2IM0A 4N47A 4CQ1A 1S77D 1RABB 1SL0A 1HNVA 3ZZPA 4EBCA 2V69A 2AIRB 3ITHB 3TOQA 5I3PA 4N41A 1NXIA 2RKIB 1RKIA 1JNZB 3GSIA 1IBMJ 2MJUA 3KJFB 1ZPVA 2LDIA 1SJQA 3IR5B 1RWXB 4NLUA 4YOEA 4KHMA 1HWIA 2L08A 1OS5A 1M5VC 3ZTPA 2MZRA 1E6YB 4RJVA 1VLOA 2HK2A 2MHEA 3J7YU 3OD2A 2DR5A 3Q8PB 4LJMA 4ZPBA 3EGWB 3BSOA 2XI3A 1FTCA 2V6AA 3MEDA 4C8OA 1TKXA 5IC6B 2GNKA 2CPIA 2CQ2A 5A76A 4H4MA 5KFAA 1KOHA 4JI3J 3SI8A 1U1KA 1KNZA 5BR8J 4J9PA 4YQWA 5M2UA 3N6NA 1TL5A 4DU8A 4ZP7A 4ZPAA 3OTBA 4Q7AA 2HBRB 2IAJB 4K4TA 2RF2A 1URRA 3RGIA 3TAPA 1SBRA 3CJSA 3GTYX 5HO4A 3KTQA 4KAIA 2I5JA 2HMIB 1ZAXA 4WP9A 1YJNS 1TVRB 4DV2J 3HHLB 2B8QA 3RRGA 2HFOA 1LXJA 3N5FA 2IJFA 3CMAS 4DUTA 3CEDA 3SV3A 1BQMB 2K06A 3BDPA 2W9BA 4PXBA 1NKEA 2KM8C 2PMHA 3HZGA 2YKAA 4HTIA 3QT6A 2OSQA 1IKVA 3M8WA 2AQ4A 2VDIA 1REVB 3FUYA 4OZLA 3SSSA 2QT7A 1CVJA 3D0HE 2Z4PA 2UUWA 5KG4A 3THTA 3R8YA 3DLKB 2J6SA 4F26A 2POKA 1BE4A 2IVFB 3BH6B 2HHTA 2VG5A 2OTLS 1LWCB 2HYIB 2DPIA 5HL7Q 5G0RA 4RUHA 1PAUB 4DUYF 3T5JA 3Q8RB 1PJ6A 8AT1B 2GO9A 1RTDA 3M8RA 4UUWA 3CCVS 1RT4A 2GIQA 1TL7B 2QLXA 2YQ1A 3BBFA 1K9MT 2F4VF 4ER8A 4OHVA 2M8DB 2CIMA 2YTCA 2XNRA 5FLXY 4XDCA 3OL7A 3HZEA 2QMXA 1ZTWA 3DOMB 4DWIA 1RAEB 2GMHA 3K8VA 3BN4A 4OJGA 3T41A 3SSQA 3CC7S 2EPIA 1HNVB 2B4VA 3TANA 2DGUA 1TUWA 2EK1A 1FRLA 2MZJA 4QPXA 1F3FA 4PQUA 2X7IA 3CDUA 2YXLA 1Y00A 2GHVC 1RT2A 1W26A 2IM2A 1SIWB 3G96A 1FRHA 5ETVA 4M5KA 1FD8A 4LBIA 1IWGA 4RUAA 4DR2J 1YSJA 3DDIA 4JI4J 1ZA1B 5D8HB 2JEJA 4MH8A 1GTEA 2B8PA 1PILA 1NDKA 4I4BA 4S0MA 4LREA 5KFSA 2O1PA 4FNIA 3MMCA 3H7HB 5IC4B 2VH7A 3GCXP 2KXNB 1Q16B 2Q1LA 3BR9A 2RDDA 2A6OA 2ADCA 4DPWA 4YEAA 1AYEA 3MEDB 2Y1LB 3NNHA 4C2MA 3NWRA 1TKXB 1FNXH 3AH6A 3B78A 1FERA 2GJFA 3FCWA 1SJFA 4CIOA 4PG5A 4PUOA 5H9FK 2GS8A 2V2KA 4CLLA 4WTOB 4F0MA 3PNIA 2MZ1A 5E41A 5HANA 1T8EA 5LMNJ 2XZWA 1KLMA 3K2YA 2DEJA 4I1TA 1SQGA 2AGPA 3R2CJ 3DFEA 2RF2B 3CJ0A 5BXIA 2CJBA 2Y1IA 4K4ZA 3E2EA 1WUUA 2IYIA 1VGYA 2I5JB 2CQ4A 3K58A 4HDGA 1QAXA 4P52A 3I96A 1YJ9S 3EUNA 1U48A 4UOFA 1HARA 2W9BB 3R7SB 4ZITA 3QO9A 1VQKS 2A2CA 2AJFE 2DYAA 4PWWA 2A6MA 1VQPS 3D5MA 1IKVB 4RW8A 4K0KJ 5CZXA 1CC8A 1UW9A 3M9NB 4NLRA 1HNXJ 5ETLA 1SJRA 3W60A 3W2WB 4OQJA 1CJUA 5HQMA 3DRXA 1FD2A 1FVQA 3PYEA 2HVDA 1PJ7A 4LF5F 4AD6A 3DOLA 1H3DA 2HHPA 4HHJA 4B3SJ 2FQQB 2AZ1A 3CJ4A 2VG5B 1TP7A 5IQQA 5EWGA 5J2MB 2EKYA 3QJPA 3BGLA 4QJVA 2AKWB 5G0RB 1BQNA 3G8TA 5D0EA 1N32J 2Z8QA 4C0HA 1TK0A 2XZDB 1RTDB 2RSQA 1RT4B 3KK2A 1S79A 3IGVA 2XMJA 4LFBF 3PR5B 1X5SA 3I5AA 1N33J 5ETRA 3PG9A 3L7UA 2ZVIA 1TK8A 1HW9A 3PIOQ 1TMJA 1AXQA 2PN6A 4ES2A 1SH0A 5K8PA 4KH0B 3IP0A 2P6SA 1PYOB 2OO4A 1VJWA 4L73A 2M7SA 4NMXA 1M5PC 4F4AA 1SV5A 3OTOF 5KFEA 4ILLA 4DR4J 3ZZYA 3SFUA 3OLBA 2LVWA 3CGIA 3KJNB 1HHQA 3VAJA 2VHGA 1LQ9A 2FHJA 2XEXA 3JQJA 1RT2B 3KWMA 3UN5A 1VHIA 4LR9A 3QLHA 4FPIA 2KVIA 4NMLA 2MSTA 4M5LA 1B0TA 1K0TA 1RQ0A 4Z7YA 3C8YA 2YX4A 4DQIA 2QX0A 2EK6A 1PC4A 1NJZA 1B4SA 2XHCA 3AB2B 4CNZA 2GFFA 1DBDA 1Q79A 2RU3A 2OJ3A 1GNKA 4QZVB 2V8DA 2FUG9 2GVZA 2A18A 4TQSA 3ENVA 4TU8A 4NEZA 4DV1F 3CIZA 3CNQP 4NXMF 3UR3C 4AL6A 2PGCA 3KG0A 3OSPA 1KVIA 4Y2CA 3OVAA 3KK1A 1VMBA 2DNOA 4LF2A 3MR7A 3P4UB 2BW2A 1YKWA 2C3PA 4JI1F 4NASA 1H2TZ 1FFSB 3IR6B 3TO8A 3MUVP 1WORA 3Q89A 3VR1A 2C3YA 5CXTA 1NH8A 2E66A 1EJ7L 5KFOA 1YHQS 1SJ3P 1Q7LB 4DCJB 1X5TA 2RNEA 3QO9B 4NLQA 3D1QA 2KB2A 5IV4A 5L8RC 1LWFA 1FRJA 4RW8B 4HKQA 3JQMA 4BBYA 3JSYA 3SCLE 2BE7D 5DZ6A 2DR9A 1DAXA 4JYAJ 1J2VA 1CJUB 1GX5A 2OEMA 3MXHP 1WDTA 1WTBA 5JMNA 1QVGR 2BYCA 2VBZA 3TUJC 1YG0A 3LH2S 1TQLA 4X64F 2G13A 4FXDA 3OFGA 4XK8C 1EKSA 3IN5A 1KQSR 3PRBA 2ZH4A 2BMBA 1RT7A 2CWKA 1MWQA 1N6QA 3KLEA 2N82B 3TX0A 2QGFB 4FDFA 4ZKAA 3FVYA 4TKTA 1TKTA 2DPJA 1BQNB 5GAEU 2B56A 2JEFA 1HBNB 1O5JA 4ZLNA 4OZJA 3C6TA 3QRQA 4XIUA 2AYMA 4QBUA 3MMAB 1UAWA 5CCLA 3CW2C 1A6LA 2ERRA 3NMRA 4UOGA 3N79A 2E7XA 2JLEA 4DV6J 1LW2A 3VQSA 4ZPVR 2RH3A 5FDLA 4OYXA 3IWLA 5D77A 1F0XA 3NOGA 1SV5B 4QIGA 3TEGA 4JI2F 1I1GA 4C4WA 4LSLB 2QYGA 3DM2B 1UWAA 1D0EA 1WHXA 3W5YA 1S97A 1MW7A 4N8OA 4U6PA 3QLHB 3RRHA 2RIJA 1S9EA 3E8OA 1S5ZA 2B9EA 1VISA 3M8SA 2E5JA 2BABA 1PSDA 1AFJA 2BM1A 2VG7A 3MD3A 3M30B 9RUBA 2UV8G 3F44A 5K8OA 4CLPA 3QZ7A 1AB8A 4J9VA 3BJYA 2NXEA 3TZZA 2B6AA 5KT6A 1M1HA 3QGHA 3I9V9 2CJ9A 1GXUA 4GKJJ 3IS9A 1BWEA 4KR0B 2Z57B 1HWKA 2BM0A 2ZOMA 3HT0A 3LP2A 5FJ4A 3G2XA 3NEKA 2GVZB 1U2FA 2C3OA 1DHMA 3P3DA 2UUAJ 3P5TL 3DRPA 2EFQA 4CO0A 2OMLA 2RHSB 3MEGA 3NNAA 2DGVA 1EIYB 2VPXB 2GAGC 2O5DA 2N7CA 3KK1B 1JK9B 5LSLA 1OIAA 4QOTA 4GC7A 1Z4UA 2E5IA 2CQPA 1QD1A 2AW0A 4EWTA 2ZC4A 1NLKL 1RYSA 2PI4A 3W7BA 1HR0F 4QYZK 2L9NA 4C11B 1TU0B 4CO3A 2B4UA 4LVOP 2YKPA 3CCWA 5B0CA 2MY8A 1HNIA 2CQDA 1IBMF 3OHBA 3FK4A 5KFDA 4ICLA 4GVLA 3D3BJ 5BYSA 1RTHA 3KUGA 3JSRA 5IT4A 1X5PA 5A0YA 4DFKA 1VBXA 3HK2A 1KSPA 3V6HA 3ZZ0A 2HWTA 3W2VA 5F8NA 1VQ9S 2G2OA 3BREA 5L1JA 4F4YA 1WD6A 2Y3YA 5CYJA 3DKDA 3M4XA 4U7UD 1VIXA 3PJ9A 1RT7B 3D1HA 4KY3A 3GV8B 3PO4A 3QPIA 1N6QB 3TEHB 4JI3F 3CD5A 5BR8F 4CH1A 5CYQA 2DGOA 2AP6A 2V8VA 2XBPA 4NEYA 2HHQA 4O23A 3ET6A 3FDSA 4ED0A 4ZN3A 4P6QA 3LWMA 3W61A 2G2YA 1SH2A 3GR1A 4Q2MA 1SCJB 4IG3A 1S0MA 2H51B 4YY3F 5LJ3Y 4TY9A 5ETSA 1SJ1A 1S99A 4NL5A 3NBPA 3FFIA 4LF9F 2CPFA 1BUXA 4DV2F 3I31A 1R8HA 5FDLB 3AD9C 3T5KA 4WKRA 2DD8S 4BS2A 1REGX 4NRUA 2DBBA 2WZ1A 3DLJA 1Q53A 1NH7A 4ZVRB 3V4IA 2VU5A 2IM3A 3KG4A 2J76E 3UCZP 4RU2A 3M8YA 4QIEA 3CCES 4DN9A 4MTPA 4TYAA 3Q8YA 3OW2R 1K1QA 2NLWA 2C2KB 1WWHA 4DCPB 4RO0A 3PEHA 4CO5A 5AJ3J 3CJ8A 3AOCA 5EN1A 2P9GA 4G1QA 4M5MA 3I56S 3MECA 3A8JA 2JSXA 2VBWA 2DNRA 1FT8A 3GR0A 4DJBA 4F4KA 2B6AB 2FHMA 4TYBA 2D3ZA 1WACA 3IGNA 4OZ5A 4E98A 3MR6A 2QL7B 3B4DA 3IS9B 2QYCA 3M2UA 3LP2B 3UDCA 3RRKA 5C7PA 4KJIA 2B7CB 3M6XA 4HLBA 5KT2A 3DRPB 2GAHC 3MEGB 3PIPQ 4IR9A 4RR5A 4PXCA 1JLCA 3K17A 1FX4A 4URQU 4TLRA 3UN3A 1U8SA 2OFHX 5J2PA 4OZ1A 4USHA 4DQSA 5B0BA 4NYZA 1APSA 4MK9A 2VFUA 4I7FA 1GH8A 4DQRA 2Q43A 2MKIA 3IWNC 2ZH5A 1OYDA 5JUMA 3MCMA 1FK9A 4BCAA 2J9CA 4X4QA 2RDIA 5MLCV 3N6MA 4LF6J 2DXFA 1GXTA 2WB4A 5DGAA 1YGYA 1HNIB 3MZIA 5KT4A 3TQEA 4CH7A 4ICLB 4PWUA 4FBUA 4TU7A 2LKZA 2MQQA 1R8CA 3W1YC 1Z2LA 1OSCA 4FVMA 1YZ7A 1FX2A 4JOUA 5A0YB 2W9CA 3EVMA 4M5IA 4X66J 1YRXA 3OFEA 1IM6A 2CPXA 2WVEA 3W2VB 4F4WA 3UWTA 3V5RA 2VKZG 2QJ3A 1H2UX 4KTQA 3AQOA 4OYMA 1RB0A 2YNFA 4M8LA 2JLGA 5KG3A 4F7VA 3D67A 4NZ0A 4OI0A 1VQOS 3CCZA 5CA5A 5DJBA 5C2CA 4M94A 4RL1A 4FYWB 3LGNA 3MPUB 3D54A 3VALA 1VRUA 2MQPA 2IVMA 4O4RA 3NNCA 3FZ2A 4NXNF 3E3XA 4WP8A 2OPQA 1ZM4A 5D4NA 3BQ1A 1X7VA 4FNHA 3P8BB 3HHLD 4ECWA 3HO1A 1PAEX 2CJAA 1VDHA 5D0RA 3GE9A 4ID8A 4IG3B 2BZ2A 2HGNA 1H38A 5F8MA 3VVTA 5AXMA 4F0HA 3OL6A 3NBPB 3FFIB 2YWEA 2K2PA 4OJHA 5GAGU 3A3PB 1FESA 5C2GA 2O3DA 2RB7A 2HFUA 2HQCA 2LXIA 3G9CA 1M5OC 4EK2A 3DRSA 3MEEA 3V4IB 3AA9A 1QY7A 2XYPB 2I8EA 2VFRA 1KC8T 1IQZA 4HI1A 1U09A 3FEYB 3OTEA 4H4KA 4CLFA 3L7OA 1H72C 5GADI 2XY7A 2ACYA 1K44A 4USKA 4PXEA 2MTLA 2I6WA 1JQGA 2OGUA 3TAMA 1HNXF 3KUEA 2HRTA 1AA1B 4Y2KA 4WBFA 4G1IA 4DR1J 4G1QB 3FQKA 2VA2A 2WBRA 1JMTA 2KZZA 2M9KA 3GQCA 4LRAA 2ZH8A 2GHPA 1Y4ZB 3HSZA 4DR6J 1RLDA 1NZAA 1U02A 4DR7J 2C2DA 1N0UA 4WYLA 1QAIA 2M2BA 2YKNB 1U2RA 1AFIA 1XMOF 1L3UA 1D9FA 4JI6F 2MLYA 3CB4A 5KFWA 4ZJQA 2VOOA 3M2UB 2XGPA 3NRBA 3HVWA 5KT5A 5HQ8A 3S01A 1N0VC 2HKEA 4DR3J 1U47A 1TV6A 1Q8IA 2C22A 4QU6A 3E01A 1JLCB 5E3QA 4B3TJ 2KN4A 4DSJA 2IDLA 5GADU 2D9PA 4FP9A 2CADA 5GMKa 5J2PB 1RWVB 4B3OA 5CHCB 3RB6A 2GMJA 4EU0A 3L3CA 4I7FB 4P72A 5F9LA 2BJEA 5HK4A 1KDNA 2Y1RI 1J5EJ 1FJ7A 2WVBA 3ENWA 3I5BA 1FK9B 2KHDA 1X5OA 1P9YA 2WOMB 1Q78A 1VC0A 2UUCF 1Q8BA 4ZPWR 1WEZA 2PA8D 2Q6BA 1RADB 3HF5A 3KMQA 2ZBIA 4Y00A 2RT3A 1ZA2B 3OR2B 3VAKA 2ZBQA 2HHUA 1JJCB 2K8GA 2W9CB 4H4OA 1KOOA 2J0XA 3VVUA 2HFZA 3B82A 2EBEA 3HT3A 1JWWA 4OV6A 2QA1A 3RBXA 3P45B 4RW9A 2ALZA 1JKHA 4NI2A 2FC9A 2IPOB 2PE8A 9ATCB 3DHXA 1RWOB 2OPRA 4TVAB 2MZQA 5A2QU 1ZM3A 3JSMA 2YNFB 1GXLA 4YR0A 3BM7A 4ZS6A 5IV3A 2CJQA 2BOPA 1WJ9A 3FEXB 2VG6A 3UD3P 5J1NA 2C3MA 4RW7A 1R8AA 2H3EB 1VRUB 1QJHA 2SXLA 4JI7J 1K47A 4F2RA 5IXUA 5DG8A 4PABA 2W2MP 3CDWA 3PKYA 3WDOA 4HYKA 1U1RA 3KMSA 1T9TA 3PX4A 3TJ8A 4J9LA 1S57A 3NGRA 3RTVA 2L48A 2IC3A 1U0HA 2WSFC 4DG1A 3AOBA 1CS4A 4WKYA 3BKFA 2C2RA 5HMZA 1HBUA 4LRFA 2J7KA 3S6EA 3CT9A 4MIBA 4YN3B 4LF8F 1TR0A 2LEAA 1EHWA 1F9EB 1FNOA 3MEEB 4QYZJ 1KVJA 1XNRF 1U0SA 2CZ9A 3GIMA 5LXYA 3UPFA 2ZH7A 3C66A 2OPPA 4C8ZA 3CJQA 2K3IA 1RUSA 2DNKA 3PW7A 3UDEA 3TAMB 2BJ7A 2JL9A 3PZPA 5MAOA 4WTYA 4DQQA 3PY8A 4DLEA 3OHAA 4JV2A 4ERDA 5HSPA 2GJ2A 1PO6A 4P2FA 1FVSA 3H5SA 4MKYA 4B9SA 2DHHA 1L3KA 3GONA 4AYBD 4EMDA 1SC6A 2FZGB 1U24A 4JI5J 3M2VA 2XZTB 2MEWA 4FYVB 4RU9A 1BHNA 1XMQF 2J9EA 2CPYA 4E8UA 3MM6B 4RNNA 4I67A 4I68A 5EX3A 4HTJA 7AT1B 1TV6B 1RT1B 4KC5A 2XSJA 1ELOA 4HHUA 3AFGA 2J0QD 4RNMA 3E01B 4F04B 3SBMA 2E1CA 2HAIA 1FO1A 4K8RA 1RT3B 4BHQA 4YP3A 4IUFA 1VRTA 4OX6A 4B3OB 2UVRA 2W1BA 4F36A 1RWNB 4DV6F 2LECA 2V0NA 5KG0A 3HVAA 3D4JA 4J9OA 1KKHA 1C2PA 4K4XA 2DNZA 1ACMB 2VD3A 3ILIA 4KB7A 2XQCA 2KU7A 2MGZA 3V6DA 1SVDA 5SZTA 5U47A 3EZ5A 3P49B 3VCDA 3CF5Q 3RUBL 3SQGA 1K0VA 2GC8A 2W2QP 4H4OB 3RR8A 1DY3A 3NOCA 2FYXA 3LP0A 3W62A 4MK8A 3IAS9 4RW9B 1P9QC 3WX8A 1JKHB 3GWCA 4X4VA 5CD4H 2DH7A 2OPRB 3VWSA 1S6PA 4NOHA 3JSMB 1HI1A 4MKVA 3GG1A 3G6VA 1DTTA 5K9FA 3CD7A 1N5VA 2E7VA 1VFJA 4NYPA 1YTYA 2VG6B 4GKJF 4NLVA 1G2EA 1XJWB 5AE3A 3QBCA 2GQCA 4DBQA 2WRMA 2W7PA 1N36F 2CPEA 4RW7B 4JI8F 2L9WA 1VIOA 2VDHA 5C24A 2XO7A 2UVWA 2VB6A 3GFZA 2ZKTA 1U1PA 2V67A 2I38A 2VFTA 1NPKA 1Y10A 2HWHA 2XLKA 2E9TA 1KEKA 4KGMA 4QWEA 4DUYJ 4A8FA 2ZBRA 2UUTA 2DK2A 1RK8A 3DLEA 3RYLA 2XCPA 2JVOA 3BYPA 2DVIA 1B70B 3QT7A 2Z2MA 2EWHA 2H9ZA 3MF5A 4AXIA 3R5CA 4DG1B 1CS4B 3PACA 2BW7A 1HBUB 1RAOA 3A4TA 2OD6A 1WC3A 4B3MF 1NEEA 4DZDA 1N5YA 3R6GB 4NLDA 1S1UA 2PDAA 1C1CA 3JYTA 4DCOB 3MTJA 3EGZA 2RMLA 4PWDA 3ZZOA 2UUBJ 4RWWA 5HROA 3KK3A 2OPPB 1I94F 4HEA9 3T9NA 3MMJA 2O67A 2J6TA 4ZP6A 1LV5A 2B4OA 3VTIA 5HJYA 2ZH2A 4C48A 3IFEA 1WKKA 1RHJB 2C28A 4IOBA 3FBBA 2HNYA 4G6VB 4DV5F 3RU0A 3LALA 3H59A 2E5HA 3ICLA 2A1BA 1R31A 4ANEA 1VLYA 1VJQA 1MMLA 1UVKA 1KQKA 3AAWB 3WC0A 4F02A 3FGVA 5L46A 1OY8A 1QUVA 4RZRA 2HGLA 3BGUA 5HP1A 1BWVA 1DFDA 2JDJA 3MCNA 4RWXA 2KZMA 1FNMA 3Q22A 5J1PA 3M6VA 3BO2A 2VKRA 1QM9A 2QSWA 4R0JA 3S1TA 1TK5A 3DU6A 4A8WA 2UXCF 2XSJB 2V4RA 4NLWA 3HX9A 1VQ6S 2LA4A 4MYTA 1BC6A 2VC0A 1V5IB 1OQ6A 1TMMA 4AFFA 2LCWA 3Q24A 2VL1A 2J8SA 3BZQA 2FHJD 3TUZC 3CPWR 2XWYA 3N6LA 4QYRA 5T41A 1TUGB 1PBUA 3TUPA 3RBZA 4QQBA 3TZWA 5EHHA 4OYOA 2R7RA 2EFOA 3PXGa 4AQYF 2C3UA 3R97A 1Q95G 4K4VA 1RAHB 3GB0A 1PIEA 1Q0NA 1GMVA 3M8PA 2MGZB 3V6DB 4MKBA 5KFKA 4Y6IA 4Q43A 2VONA 4LF4F 1X0PA 3MI7X 4L72B 2OPSB 4B9LA 1YJWS 1LK7A 3LP0B 2BRLA 3K8WA 1FKOA 1SH3A 3FEZA 5HI7A 1FFGB 4YHHJ 3G71S 1RGVA 1JXLA 2F65A 2BX6A 4RUCA 3OTDA 1S6PB 3QWUA 2D3UA 3NGUA 1JXVA 1YJUA 4LMZA 1JJ2R 1RHKB 4KGXB 3LQVA 4ZVPB 5KFHA 2R2TA 2W4CA 5C24B 2DNLA 4HACA 2FVPA 2K1RA 3DLGA 7FD1A 2GQQA 1TFWA 3H5XA 1YBTA 1UP1A 2Q79A 3TVYA 2MQOA 2J8AA 3HPOA 5HLFA 3T5LA 4ZCMA 1U1LA 1FE4A 3A12A 1TL4A 1DTQA 2IJRA 2HZCA 4NLXA 5E7OB 4LFBJ 3UNYA 1YJTA 1UMJA 1DURA 2EC2A 5DM7Q 1TELA 5HN0A 4N8NA 4IOAQ 4PQAA 2DNMA 1X0FA 2FVRA 1N5YB 2WK4A 1C1CB 3F41A 1F5AA 4PWDB 3MM9A 2EI5A 3DOKA 1NSPA 1O6XA 2QC3A 5HROB 1VS3A 1UFKA 3MPDA 3OTOJ 1IBLF 2W01A 1ZZFA 3J7AN 3K5PA 2YNIA 2ZC3A 4ZCLA 4KRWA 2AT1B 1NMEB 5D4PA 1Q5VA 1E6VA 2BE2A 2C2ZB 4TLQA 1WC1A 2J6UA 1IKWB 1QE1A 1U26A 5AXLA 3A8IA 3CJKA 5CD4A 3EZOA 3J7A1 4CO4A 4YB6A 2FLNA 2LQ9A 2OLWA 5HP1B 3CCQS 4LUBA 1NSKL 4FYYB 1U6ZA 2JJ4D 4HL9A 5C25A 5IT9U 4CNYA 5SUHA 2ASJA 4M5HA 3CD6S 2ZDPA 4O3PA 3JQKA 1S6QB 5HATA 2MKKA 4ZP8A 1HQEB 4PG6A 1YITS 3BH7B 4C9DA 3IWXA 2HHXA 1UPMB 4ATNA 4CYUB 3ISNC 2I9SA 2DNHA 3QT8A 3NMAA 3T1YF 3UW1A 2QA4G 3ZZZA 4PYAA 2Q66A 4I64A 2P6TA 2V8GA 4DV1J 2OAUA 4TNOA 1UPPA 4NXMJ 3M6UA 5IZHA 4DL6A 2NXNA 3FBEA 1MNEA 1T94A 4R5PA 4JI1J 3K5NA 1XNQF 3MAHA 4QR1A 2MLZA 5I3UA 1HI8A 4A8YA 3MAAA 5DZ7A 2PD1A 3DMJA 2ZUGA 4PYDA 1F5CA 2RILA 3M8PB 2DIVA 4DFJA 1OPIA 3IO1A 2X3GA 2EG2A 4X84A 1HYSA 1HNZF 2MZSA 2ZE2A 3BO3A 4WU3A 3B54A 4DR1F 2JWNA 1YRTA 4ZCKA 1SC1B 3H42A 2BBEA 3WIVA 3AA8A 4DR6F 1IKYA 1KLNA 4DR7F 4YB7A 2APOA 1F2HA 3MWBA 4M63A 1NAQA 1IXKA 2COLA 3KJQB 2KYZA 2VQEJ 4X64J 1J5OB 1AUDA 2HFNA 4V19J 3HDSA 3CVKA 2AGQA 3TX8A 8RUCA 1RWWB 3TZXA 4HACB 1UETA 2K1RB 2V5HG 2H54B 1U6FA 4OZNA 2LEBA 2UXBF 3IG1B 2R7SA 3ULHA 4DQPA 4DU7A 3QFHA 3CCLS 3THVA 3T5HA 4B3TF 3PJXA 5HLFB 1QSSA 2MHNA 5JVGQ 4FXVA 1N48A 3LPYA 3W8PA 1P1LA 1DTQB 3PKMA 1CEZA 1Q82T 4RW6A 4DS4A 4C3KA 3W5XA 2DGTA 3EPIA 4LSZB 2PC6A 5LOQA 3BSCA 4LR8A 4PR6A 1R6VA 1JLBA 4MIWA 3K7RA 1JLFB 1XEZA 1W2IA 3GFYA 2CNLB 1UVMA 3WC2A 5B08A 3MM9B 3O5TB 4RBUA 3DOKB 1ZAVA 2KXHA 3MR3A 1DQAA 4GMKA 3G6ES 1AT1B 4JI2J 2FJDB 2YNIB 5CQGA 5B09A 4USUA 3J80Y 4LT6A 4HI2A 2BE2B 3NGTA 3LW5C 3TJAA 1KTQA 2KT5A 4MYUA 4ELUA 4KQZA 4CTAB 1U1QA 3CJKB 3POTA 2YNHA 4ZLLA 3O2IA 3F56A 2RU9A 4F0KA 1N5TA 2BOAA 3TA2A 1FJEB 2BQUA 1S10A 2AEFA 3PYFA 3KHGA 1LOUA 5C25B 4HH0A 4NA1A 4MJKA 2DR7A 1BD6A 2LQJA 4ED2A 1D9DA 1JLEA 2CVEA 4ELTA 5KFGA 3GJQB 1CLFA 2HBZB 2NZCA 1B0PA 2W25A 2J0SD 4WK1A 3H2UB 2GX8A 4IFYA 2HHHJ 2F8EX 1MROB 4IQXA 2PA3A 3L7PA 5ETOA 3US5A 2FJWA 2AYEA 2ZJPQ 1C1BA 2IYGA 1FFWB 3EICA 1IN0A 5F41A 3FMBA 4P7TA 4K5SA 1IKXA 4OV1A 1R89A 1GMUA 4R5PB 3OSNA 4I56A 3QQCD 3ZZTA 4KHPF 1D09B 1RP5A 2Y1JA 3MAAB 4DV3F 1X9MA 5DLGA 1HR0J 3CSKA 1NSQA 3DMJB 4C6AA 3MMBA 1S48A 2VZ9A 2IRUA 3BBCA 2NZ4A 2CXEA 2KFYA 4Z37A 1N5SA 4X4SA 2OELA 3K5MA 1FEHA 2DHAA 2RHQB 2VPZB 2ZE2B 2RUSA 2ZD1B 4WZQA 2KT2A 2PMZD 1XBWA 4ED6A 4DPYA 2XYGB 3I82A 1PGZA 2HHSA 2VV5A 2N3OA 2QZ8A 4J90A 4JI5F 4P2XA 2ZH9A 2R8KA 1QTNB 4WU2A 4U7CA 2ZITA 3TJ9A 3GZ7A 3S8SA 4A8SA 2E29A 4Q8EA 3G4SS 2N7YA 2HVEA 2RUGA 2QG9B 2JLFA 4PZVA 2YNGA 2DNPA 1VYAA 1XK8A 2I1RA 2HVHA 1BMQB 3GV7B 4YY3J 1O51A 3LPEA 4B9MA 1UCNA 4ZPCA 1IJEB 1JLBB 1HD1A 3TZYA 5DQGA 3HVRA 5IOLA 3ETOA 3FRZA 4LF9J 4RKUC 2C42A 3KJVA 2FJBB 4NYOA 3G6XA 3GLJA 1VQLS 3HFZB 1WF1A 1M1GA 5A8KB 1H7XA 3BR8A 1KVKA 2ZEJA 4ILRA 3EVWA 1NK7A 3TA1A 4YR3A 1WC6A 3MURP 1DRZA 1IBKF 1Y5NB 2HFSA 3DC2A 1RA7A 1SPBP 3NAHA 4JI0F 2WW8A 1BQXA 4J9RA 4DSEA 2G0IA 3OV7A 4R8UA 4I6YA 2QSFA 3SEOA 1ZTTA 3FRYA 2L41A 4AL7A 4IYQA 3TP2A 5J2NB 2EKNA 3FC9A 1ZZNA 2HZVA 1MMDA 2JFKA 5CZVA 4BWMA 3O1LA 2CG4A 3UD5A 3G86A 4YR2A 4B08A 2WVDA 2XLJA 3G87A 3QAUA 2CJXB 3QIPA 3DN9A 4EUVA 4LR7A 3LANA 3TYTA 2XYHB 1NHUA 4IFYB 3MR5A 3B4MA 2CNOB 3SFGA 2EC0A 2QLJB 3NG8A 4LF1A 1C1BB 1F2GA 3MEKA 2OTJS 3KLGA 1N54B 2AGOA 2G4BA 4KO0A 1IKXB 2FIUA 3UNGC 3EM1A 2ZFHA 3PV8A 2ZHOA 2EFGA 4ZDNA 2AJ1A 4O4GA 2RJZA 3ISND 3THPA 2UUBF 5F3TA 1S0VA 1KS2A 2O01C 3MMBB 2D9OA 1XWLA 3OTCA 3W64A 3BSAA 4DSFA 1ZS6A 3KYLA 1R8BA 2ZBPA 2F5GA 4DPOA 1FDNA 2C2NA 4M5GA 2ILZA 1RWUA 2W7AA 1YWXA 2QLBB 2HURA 5F8HA 1NK0A 4G65A 3T6BA 2W8KA 1LWEA 3D68A 4MIAA 4UF4A 3EXCX 3D7SB 3HI9A 5DDOC 2DGWA 3KHLA 2XTJP 3W66A 3Q23A 4B9UA 3PM9A 2LU2A 3UQSA 1OQ3A 2RD5C 2X1AA 3W9IA 1NPPA 2W4PA 2ZJRQ 3PW0A 3TRGA 2G1DA 2VQFF 4H4MB 2ZVSA 4FXWA 1C4CA 2MDAA 4DPXA 3W3SA 3H4DA 2H65B 4NXNJ 3FQLA 2V63A 2JC1A 2IMWP 1YLXA 2YNGB 4USTA 5EWFA 3BDEA 3OL8A 3LO3A 2MQMA 2PEHA 2QV6A 2LMIA 3ZC4A 5ITHA 1M0SA 4NCGA 4J9MA 1PG5B 5DLFA 1FTRA 2U2FA 4RW4A 2XS5A 2GO8A 3SCJE 1FJCA 4UOHA 2QFIA 1RU2A 3JSBA 4V19X 4EZ6A 3WZ0A 3CO9A 2MYFA 3AD7C 1NJIT 1HKAA 4F25A 2DRBA 4RLEA 4YHHF 2EVZA 1QTMA 4FF4A 1T03A 2OFGX 2AZ3A 5B7WA 4B9NA 4JV0A 4TY8A 1T11A 4N7TA 3MM8A 1X4EA 1H73A 3GFHA 1I6JA 1VRQC 2CPZA 3D0IE 4C98A 1HW8A 1SUQA 4WFAQ 2VFVA 2OD4A 3LOUA 1X4AA 5E2QA 3ZTOA 1XMOJ 1S12A 3Q8VA 4JI6J 3Q86A 4AL5A 3QIPB 1WHWA 1SB6A 4IH5A 4P73A 3CDBA 5D4LA 4A47A 2CNKB 3UD4P 4X4NA 2ATCB 3KLFA 4DL0C 3M8ZA 3EGVA 3LWLA 4DR5J 5KFJA 1X8DA 3ILJA 2QO3A 4I0WA 1TUVA 2XY6A 1F3VA 4ED1A 3KLGB 3KLIA 1T05A 3OR1A 2YWFA 2E9RX 2Q3PA 3HSDA 2PEBA 2NPFA 5EWEA 4FKYA 4O4GB 4OYZA 2Z58B 3TVZA 4J9QA 2BEFA 3B6BA 1RCXB 4OYAA 2HQGA 3UE2A 1Q86T 1L3SA 4A8MP 5KFIA 2UUCJ 4PQUB 3IAM9 4CLTA 1S76D 1OY6A 2ROPA 2ZZTA 4F4XA 2NSCA 3LAMA 1DLOA 4MMOA 2YBVA 2PI5A 2IBKA 4EI2A 2BXJA 2DRAA 4QPTA 3O8WA 5K8MA 3UVJA 2R8GA 4A8KA 3PX0A 5F3ZA 4Q8FA 3BO4A 1EB0A 1WC0A 4LIWA 3L4BC 5B0GA 1NDCA 2XMWA 2F63A 1YRUA 5KT7A 2X3DA 3MMCB 2NR0A 1FRMA 4WPAA 4NWBA 2H4YB 2KG0A 1T7PA 4PPZA 3Q83A 1LW0A 1OO0B 1T9VA 2Y0SD 3SCKE 1TAUA 5J1EA 4OHYA 2CDRB 4KE5A 5A6PA 3EJMA 1T3NA 3R5BA 1UFWA 1RTIA 1SKUB 1VR6A 2R2UA 5ETTA 4J91A 3LGHA 2KRBA 4O0NA 2NYIA 3AOAA 4PUOB 2YKMA 5D4OA 2D1CA 2GVDA 3WX4A 3CUNA 1D8ZA 5C42A 3GIKA 3PJWA 1KLMB 3BEGB 3D6FB 4M5DA 2MPUA 3VGVA 3MM7A 4A46A 2IJNA 2V8HA 5F8GA 4BWJA 1HHSA 1OJ4A 1PYTA 2QA4S 1VQMS 4DUZF 3NL0A 3J81j 1Y3JA 5CYMA 2Y0BB 4A8QA 4YB1P 2HNDA 3KG1A 1R7IA 4NCGB 1G6BA 4O3OA 4ZVSB 1KR4A 2FC8A 3A1YG 2AEJA 1VHFA 2VC1A 5IM0A 4WIIA 4RW4B 1G4CA 2FZCB 5GAEI 3MOJB 2UXDJ 1JX4A 4LF8J 1WOOA 5GAHI 4WE1A 4CDIA 2ZWPA 5C5JA 1XNRJ 2IA6A 3M6WA 3HULA 4KGKA 4CZCA 2LLZA 1F9FA 5HVHA 3MGJA 1IUJA 2VJUA 3HP6A 1RAAB 4ZLPA 1T03B 4U8VA 1RAGB 2OSRA 2W9AA 3HM9A 2LQ8A 1RISA 4J9SA 3R1LA 2VQEF 2IHR1 3FMWA 4ED5A 3HFVA 4RBVA 3DOLB 1CJTA 5EDWA 1JLGA 5D15A 1SUQB 4L3NA 1F1BB 1SQFA 2G9OA 4WCEQ 2PT0A 1YJRA 3ETMA 4NZ7A 4IO1A 3MHYA 5DM6Q 2MQLA 4ECZA 1M90T 1LFWA 2VASA 1JIHA 2AYGA 2QIFA 2NREA 2KFNA 2BJ8A 2RKIA 1XMQJ 3QSYB 3LAKA 5GAHU 3EGNA 1B0VA 3KLFB 4OJ3A 1WHVA 3KK2B 1WKJA 4A8XA 3DXSX 3MUMP 1LNQA 2AJQA 3KLIB 3IRWP 5GVQA 2ZBCA 3D1OA 5HJXA 3D0GE 3C14A 4PEOA 5LMUF 1Q5YA 1IBCB 3MM5A 2FDNA 5KFFA 3HVTA 3Q8SB 6AT1B 1R6YA 2WVFA 4CLKA 2AJ2A 4U8YA 2BKPA 1ROFA 5ETNA 2DCUB 2DHSA 3DXBA 2E1MC 2XMTA 1LFPA 3IMQJ 1DLOB 3SCIE 1QAJA 2W7OA 4ZA1A 2RQ4A 4B3RJ 2NXCA 1RWPB 3DYAA 2QL9B 2D7SA 3O44A 3TVKA 4JUZA 3U27A 3UVJB 4B9TA 2F9JA 3T19A 2DO4A 2WAQD 3UN2A 1UW4A 1RWKB 2RQCA 5D0GA 2M52A 1C0TA 3EMTA 3VZHA 1VQNS 4P2MA 3EYZA 1LW0B 3W5ZA 2XMUA 4GC6A 1UZHA 1BGXT 5J1EB 2F40A 2HS4A 4PG4A 1RTIB 4FKXA 1N36J 4JI8J 3KDOA 2FJAB 4NLOA 4L3KA 3R9LA 1RZMA 4R0EA 2GVDB 2HHHF 3VAHA 5C42B 1IWAA 3C46A 3MM7B 5AT1B 3PW2A 2Z30B 3D6HB 1REVA 3I4PA 2UVUA 1BXNA 4W4MA 5CYMB 4WFNQ 2YPYA 2BDPA 4K2JA 3BF4A 1DQ9A 2HNDB 1RHQB 1NKCA 2NYHA 1FXLA 4U67Q 4B3MJ 1X60A 3H2VE 3DLKA 2ROEA 1CPZA 1S59A 1JJHA 1V9OA 4WFBQ 1HBMA 4WE1B 3QZ8A 1X9WA 2MLXA 1N34F 1NB2A 2HRYA 1YIJS 5KG1A 4O44A 1RWMB 3PFEA 3LA0A 1I94J 1R3NA 4DF8A 1LWFB 2KVQE 2PIIA 3KLHA 1EETA 5LSRA 2FHKA 3PYGA 3NP5A 4C8YA 1QAYA 4DV5J 3J81U 4DSKA 3Q2SC 2ZZMA 3DOMA 1IVZA 3AXMA 4JBCA 1SI9A 1CJTB 1JLGB 1X31C 2CQ3A 2NQPA 5LXRA 2EFNA 2H5EA 3D66A 2DB1A 1VOMA 3KLEB 2A2DA 2H5IB 1UJ5A 4P2SA 1RTJA 1UTAA 2DTJA 2R8HA 2YH0A 2X1BA 3AODA 1HNWF 2ABYA 4P10A 4P74A 3N9UC 1TKTB 1FHTA 2G0CA 3M9MB 1T9YA 2B51A 2UXCJ 3BB5A 3HFKA 2CQIA 3EVOA 2IMOA 5E3RA 3BS9A 3C6TB 1IM4A 3RAXA 4DPTA 3SDEA 1HQUA 5E3PA 5AXKA 3EDRB 3RR7A 3GILA 1CSJA 1WHYA 3K5LA 3HD2A 3K0JA 1U6BA 3CJTA 1FXRA 3ENAA 3VHQA 2GV1A 4J5OA 2AV5A 3R5GA 3H40A 3SQOP 1UZDA 1LW2B 3C14B 1SKRA 1GX6A 1D1UA 3MM5B 5BYQA 1X4HA 1G7CB 3IM9A 3HVTB 1EKRA 1YQHA 4AQYJ 4MFBA 4OJ1A 3SZ2A 1FDBA 4Y2IA 4DZ6A 4C97A 1NM2A 2FY8A 3QJJA 3HD1A 1S9EB 3VAIA 3F73A 3N28A 3DYAB 4LF4J 3SYZA 2XMMA 4C8LA 3FSIA 2VG7B 4E0DA 3RW6A 4B9VA 1I3OB 4DL2A 3ZNUA 2QA2A 1S7HA 2ACMA 1FXDA 2JH3A 1C0TB 4LFAF 2A10A 2ZOGA 1TL1A 2P5VA 3QMQA 3HLUA 3T1HJ 3FSYA 3UI3A 1CG2A 5IWAF 5JJBA 2EEYA 4ELVA 3CULA 3JS9A 5KG7A 4X4OA 3UFCX 4P7VA 1GTHA 2V4JA 1NK6A 3CXCR 2RVJA 3PRVA 1D9AA 3OT9A 1RT5A 2AHOB 2IFXA 2WB1D 3K89A 4ECRA 1WTFA 3JAMU 3W2WA 3M8QA 4C0BA 2DO0A 2YWHA 1Z2ZA 2BKOA 3Q0AA 2QN6B 3CCUS 2N4DA 4F8RA 3BGRA 2DITA 4Y65A 2R8IA 1GFWB 4USJC 1HBMB 4M5JA 5J2MA 1RA6A 2DXDA 2XCAA 4O44B 1Y5IB 4UQGA 1SJ4P 3VAGA 4NA3A 4ZOSA 4ZK7M 1RTHB 4DMZA 1MU2A 4MAKA 1IBLJ 1R8PA 3T9ZA 2XG8A 4ED4A 2FGCA 2LFVA 4D3HA 4DV0F 3KLHB 1EETB 1S6OA 2OP5A 2I2YA 2J9DE 2BQRA 5RUBA 5GAGI 2XO6A 2YWKA 1WOPA 2AYBA 1S6UA 3N01A 1EX8A 2WW4A 1X4BA 2HBYB 3EWGA 2B3TB 3AQPA 5LM7E 3EX7B 5DRKA 4J7CA 3R3TA 4HT7A 1XR7A 5CAAA 3MPVA 4NLPA 3V2UC 2NS1B 2KJVA 1RTJB 3RBDA 3CCTA 1DZ5A 5CYQB 4WWSA 1HD0A 4X65J 3DCAA 2E9ZA 1TZ0A 2BANA 3MFHA 1Q4RA 3ET6B 4ES1A 3AB4B 2E5LF 4X4PA 1QVFR 4GO7X 3SDEB 1HQUB 1SC4B 3CMES 2CVIA 2XC9A 3T1YJ 3QGIA 3DLBA 2Z2ZA 3RG6A 4CRJA 3RB3A 1W7WA 5ETMA 1DJ0A 4QIVA 1QSLA 3RAMA 3HHEA 1UWBA 2YY3A 1VQ4S 2H48B 1FCAA 2U1AA 3JB9k 1XNQJ 4ECVA 1XTZA 3QAEA 3QIDA 2WONA 4EYHB 3OL9A 3GJSB 2RQMA 2RRBA 4MFBB 2RS8A 3VZIA 1SC3B 1S72S 4ED8A 1URNA 3OFFA 1HMVA 3PYDA 3CJ2A 4TN2A 4LQ9A 5K5MA 1HI0P 3GYXB 1HNZJ 1UL3A 4UQTA 4LVNP 1HWJA 5KG6A 5E3CA 2QMUB 3R5JB 3U1MA 2CUYA 3MECB 3HSJA 2AF6A 4X4UA 1IR2A 2XLIA 2BA9A 1TL1B 4LQ3A 2EFPA 2RS2A 1Y5LB 2YX7A 3JTPA 2P8IA 4DV4J 2CNNB 3W65A 2R2SA 4YDXA 1N4LA 3DGVA 3I0RA 3IBWA 4DHVA 3DNCA 2R9LA 1ITPA 2V4JB 4I6AA 2UXBJ 1UFLA 1T9XA 2N3LA 4DR5F 3KNAA 2B7BB 5DDPC 2J9DA 2CQCA 1RT5B 1RJJA 1RXOB 1C4AA 2ZDOA 5K20B 3M8QB 2RRAA 1J27A 1N56A 4K50A 3QATA 3G82A 4F2SA 1I51B 2X51A 1VI7A 4OLPA 2JEIA 3BGRB 2BV3A 3P96A 2V50A 1JJ4A 4OMFG 2FVSA 2YH1A 3WIUA 1KFDA 1X4CA 2LP4A 2WTFA 1S4EA 2HK3A 4DL5A 2UZAA 4OHZA 4XAKA 5F9NA 4F4ZA 1HBNA 1MU2B 4UZBA 5D3GA 1WEXA 1RBLA 1IJFB 1X4DA 3TAQA 4DX7A 4UY8T 2D74B 4YMEA 3MMAA 3RZAA 1V3ZA 3QNWB 4IQMA 4RX6A 2LU1A 5KFZA 3UCUP 1VC5A 3ZTRA 3OJUA 3A8KA 1X4FA 2NPIA 4IOCQ 4NLGA 2R8JA 1MN9A 5BYRA 1LK5A 4Z7CA 1HA1A 4DL7A 1SXLA 1FE0A 1VBZA 4L76A 2PFDA 5ETPA 2QE5A 3CWJA 2KHCA 4LSLA 3DM2A 4L75A 3IXQA 3QT5A 1Z1ZA 3FSXA 2P9EA 4N77A 2OPQB 2WVCA 2JNJA 2BANB 3D3CJ 3T3FA 2W4DA 4LF7F 2CA9A 2ATLA 2G1HA 3M30A 4DSLA 3H2LA 4ALZA 1KQGB 3MCSA 3MCOA 1Y9OA 3GYNA 2HAFA 5FIIA 2CJKA 1UWBB 3CDAA 2MQ8A 5EX0A 1EZZB 2UXDF 3VGUA 2CZ4A 4OI1A 4USMA 3DRSB 2N4CA 4URGA 2F8HA 4W98A 2KDOA 2WONB 4KHPJ 4Y2AA 4QR0A 4PKDB 3KDNA 4IH6A 3HXMA 5E33A 4DV3J 5B0DA 3PRDA 2KI2A 4Q0BA 2DT9A 3PFOA 1FWKA 3BKUA 1HMVB 4KFBA 3JTNA 1RBOB 4K5RA 1KP6A 3TARA 3MOZA 1KONA 4ANDA 3HKWA 3ILOA 4PXDA 2JEGA 2KJWA 3HHNB 1NSAA 4WK3A 3M05A 3A13A 3C6UA 1P27B 1ZYQA 2CYYA 4IKAA 3QSIA 4FN5A 4DS5A 1MWZA 1B7YB 1QDUB 1GK8A 4OZ3A 1X9SA 3OUYA 2HBQB 2M0GB 3NCPA 4ECYA 4C11A 1W2BR 2FD2A 4BLGA 4IRDA 2Q6CA 3I0RB 1ICEB 1CJVA 1NDLA 4DXLA 2HS0A 1VQ8S 5J2QA 2BRKA 2V94A 2ZM6F 3WHIA 1N5QA 1Y7PA 2XGQA 2FHOB 3J81Y 1RAFB 4L74A 4UUXA 2ZOFA 2LA6A 4ECTA 4ZVTB 1B64A 3H5UA 4EO8A 5KFVA 4HR2A 4CT8A 2HIYA 4QW8A 4M5NA 2DGXA 1XMBA 5KG2A 2G2ZA 4NA2A 1S4FA 1KTVA 3G82B 3VAMA 4OX9J 1OY9A 1DQ8A 4RPFA 2LXFA 3CJ5A 5D6GA 3HHLC 1FJGJ 2YQ0A 4ILMA 4OFZA 4DV7F 4YFUA 1I5OB 4P75A 3OPKA 1Q8KA 4ETXA 5AXNA 3CCJS 7FDRA 2GGPA 1B7FA 4XDDA 4ZVEA 1Y11A 4ZP9A 4B3RF 3BBBA 4DPUA 1YJVA 1WNEA 4JV5F 5D3GB 3GYGA 1WC4A 2KTQA 3TW0A 3KOAA 2XHWA 4G3IA 1CQNA 3RB4A 1IBKJ 4R25A 1OYEA 4ECSA 1FRIA 4JI0J 4NI2B 3AJ2A 3X3UA 1YK9A 1LEOA 2FLLA 1NHVA 2R7VA 4IR1A 2MMYA 1U8WA 4BDPA 3IA0A 4CLYA 1TKDA 4CM0A 1FKPA 4KIAA 2HPUA 4U96A 1FI4A 2CAJA 1GQEA 1RHMB 2AEMA 5DDRC 3OXGA 1EP4A 2IDEA 4PRFA 3H98A 2QEXS 2ILYA 2DR8A 1S9FA 2OI2A 2NSBA 1CQMA 3DLHA 2BJ1A 1CJKA 4K4SA 1M5SA 2GCFA 2QTWA 4DSIA 2EBGA 3KNGA 2IC3B 3VGSA 1U0HB 1RYRA 2MQNA 4PPDA 4CM2A 3SMZA 4G1PA 3IM8A 4ZHRA 1UJ6A 4D3GA 1ULRA 4ED3A 4P9SA 5A8WA 3I0SA 2X1FA 1UVLA 3PW4A 4K4WA 2V2QA 2NUHA 2GIRA 1NPRA 2DNQA 2Z0GA 4USWA 3I55S 4QR2A 1R0BG 4Q0BB 2HQ3A 5CABA 3QYYA 4URSA 3PHTA 4H54A 4KFBB 4CLSA 1U7LA 3FBFA 3JAMY 5HQLA 1C0UA 3U1NA 3D6MB 3QJLA 2R7OA 3ZO7A 4LFCJ 4IFVA 3MTKA 1A9NB 4AE5A 1XN9A 2R7XA 2ZZNA 4N56A 3GIJA 1M1KT 3V81A 1FEEA 3C6UB 3NS5A 1S1VA 4ECQA 3ZFVA 2CKWA 1XERA 1P1TA 2VICA 3BQ2A 4F3MA 4KH1B 4WXOA 3OUYB 4HHHA 4OI3A 1RAIB 1WKLA 3M2VB 4OIXA 2FZKB 4RUBA 2Y8YA 2CQGA 3CC4S 3I4HX 4EGLA 1VQYA 4DFMA 3AJDA 3VV2B 1GMWA 1CJVB 3BGOP 1BY9A 5J2QB 1O8BA 1F9HA 2UU9J 1HWLA 3FJ2A 2E1PA 2VQFJ 2B9YA 3G6YA 2H1YA 1F5BA 3MR2A 3FBCA 3AXKA 3BV8A 4DEZA 3OBIA 3PX6A 3PVXA 5B0AA 3Q8UA 1VRTB 1KN6A 2VPWB 2IY5B 4QIFA 2DRDA 4F67A 3PW5A 4I69A 3NGDA 5KTQA 3ZZRA 2UP1A 2XMKA 1BLUA 3KFWX 4P71A 2KH9A 2XY5A 2NXJA 2DGQA 4OI4A 3ZZUA 2IBOA 4K4UA 2CPJA 1UJ4A 3MPWA 4ZVOB 1K1SA 1NHKL 2ZKUA 2GGPB 2FLOA 1NU4A 1O0PA 5H9FJ 4USVA 4Z2XA 2FJEB 1X4GA 3SQGB 2IM1A 4A48A 4ECUA 4ZPTR 4ZIWA 4V1Ak 2VIHA 5GMDA 1U1MA 3D9BA 5L1LA 2J5AA 4NLSA 2BVZA 1V3SA 4WJBA 5T7LA 4B17A 3T1HF 4AT1B 1HFEL 1K73T 4WFZA 4WYWA 1DTTB 4HVZA 5KFMA 2MB0B 3JTOA 4CCHA 2L9DA 2MXYA 3ADAC 2HHWA 3C16A 1FKPB 2DISA 2DIUA 5CCMA 1EP4B 2A3JA 3Q8QB 2C1EB 3GG0A 1AROP 1CJKB 3U1LA 4YB5A 1HIYA 2BQ3A 3UDVA 1T9UA 3DLEB 3FCVA 5ADZA 3U7JA 2ZWOA 4O0IA 3SXLA 2ZJQQ 3B8HA 2M3DA 4ZHRB 3H90A 2HVZA 3QGGA 5I3QA 3GJTB 3HSGA 1S1UB 5A8WB 3I0SB 4Y28C 3JYTB 3PO5A 2YKNA 1YVFA 1UA0A 5KFBA 3J7Z5 1LKZA 3KK3B 2GIFA 2EXUA 4WP3A 5E0OA 4Y34A 4F50A 4QW9A 4HT5A 4ZVUB 5F0WA 1C0UB 4K2XA 1WEYA 3QRRA 3BQ0A 1RU1A 2HNYB 5HMWA 1FRKA 1SL1A 2D41A 2E5GA 1V3RA 4LBPA 4OZ0A 5IQ6A 2ZH3A 2H4WB 2AD9A 2X1GA 4IFVB 3HHKA 1NJXA 1SKSA 4QWDA 4EBDA 3V81B 1G3OA 1S1VB 1PKUA 3R7BB 2DNGA 2OMOA 2GA7A 1H74A 3M2RA 2J7WA 5KOWA 4M95A 1ZPWX 1S49A 2Z56B 3PHEA 4KPYA 2R2RA 2BACA 4CLUA 4QWAA 3D28A 3QWPA 2P2CB 4IDKA 1QLNA 2WOMA 3DGPA 4QWBA 3CJ3A 2MKHA 2PO4A 2GW8A 4CO2A 2QL5B 3ELHA 1Q7YT 4X65F 1FDAA 3FKBA 3D2WA 2ROGA 2BJ3A 3OR2A 1CC7A 2MJNA 2J7UA 4DR2F 1ZAWA 4JI4F 3R27A 3V4MA 5A8RA 4I2PA 5A2QY 3HCXA 3NXZA 1KFSA 4YDDB 2GQ2A 4KV8A 1U1NA 1T0TV 4DUZJ 2AX0A 2VUGA 5HMYA 1XC9A 3OJSA 2KL8A 1HQ2A 3AT1B 3GJRB 1TAQA 2WSEC 3N5BA 1S1XA 4X62J 5F8IA 3ENQA 5KFCA 1Q8LA 3I87A 3O6QA 5LMNF 2XS2A 2KFZA 1HHTP 1L5UA 4ANCA 2YWWA 1TFYA 5LJ5Y 1L3VA 3AHPA 3M7VA 5DO2A 1FKOB 4UOCA 3CCSS 2QRRA 3LUYA 2HWIA 3RAQA 1H6KX 2IVYA 2OEKA 2V2ZA 5T7LB 5THWA 1FA0A 2MKSA 3EZUA 2ASDA 2V8PA 2FVCA 4GKKJ 4DV4F 4C8KA 5JVHQ 1IR0A 3C16B 2LQBA 3DLGB 4FVCA 4BC9A 2EFVA 5DG7A 2CWXA 3MFIA 4ECXA 5L39A 4K0KF 3BPDA 2B5JA 3NY0A 2IRXA 2V9WA 4C8NA 2FJVA 2B0GA 5BJRA 2EW9A 5KFLA 1UEKA 5KG5A 2CQ1A 3HKZD 3I6PA 8ATCB 2PFFB 2YX1A 1Y0HA 5D78A 4QIWD 3VQTA 1R27B 1Y3KA 1UVNA 3BPSP 1VC6A 1K8AT 3IR7B 3H0PA 4OX8A 4B3SF 2HVIA 1RLCL 5H9EK 1PC5A 4FF2A 2UVVA 2M70A 5LMUJ 2CPDA 1AUSL 2UV8A 3OLAA 3BKTA 1N32F 4KSEB 3MM6A 3I5CA 1RT1A 1XQIA 1H0HB 2NXUA 2R7UA 4NPOA 1E6VB 1YX2A 2AX1A 1N33F 4U95A 1QE1B 4WIQA 2BJDA 2XMVA 4ZN1A 1RT3A 1S1WA 1JLQA 1NRKA 2VFSA 2VBXA 5K14A 3M2RB 2DNYA 1PYSB 3H5YA 1UVJA 2ZUAA 1S0NA 4EZ9A 3FCHA 4A8OA 3E51A 4IDKB 3DGPB 4DR4F 4IO9Q 5L1IA 2R7QA 2VJVA 4C3MA 2DY1A 3NGKA 2FTRA 4O3SA 5CH7B 3MPYA 2KXFA 4DL3A 1HLWA 4C7QA 3CO0P 3NWGA 5LT5A 4HH1A 1ZETA 5A8RB 3SV4A 1EARA 4I2PB 1FDDA 3H4BA 2R7TA 5L1KA 5B0FA 4MKAA 1ZM2A 2R3VA 3GMGA 4FS2A 3NAIA 4X2BA 4KV8B 5JXSA 2DH9A 4EBEA 1VQSA 1M5HA 3H20A 3GFXA 2ASLA 5I3UB 2FGOA 4USIA 2BJ9A 3M32A 4LRDA 2NUUG 3TA0A 4MT1A 1PBAA 2VODA 1KRPA 3HJVA 2EG1A 3R6LB 2HRUA 1S1XB 2HQIA 3SIPB 3CDEA 4F3OA 4J9KA 2PSZA 1N34J 5HAOA 1HYSB 1EQMA 4FYDA 2D3OR 2FVQA 1HL6A 2E1RA 4FYXB 3KXDA 4OZ2A 3R7NB 2O66A 4GVBA 2VF3A 4Y2MA 1IKYB 1MN7A 4WXWA 2LDYA 4Q2LA 2CZVC 3LP1A 1R0AA 4C0OC 4N5SA 2KRRA 5KFTA 2ZHBA 1V5VA 1LXNA 1NJWA 4J9UE 1PJ5A 5KFYA 4BC7A 3W63A 3BGFA 4LIRA 3GV5B 3FZBA 3RBEA 2HQDA 4CT9A 1NK8A 5DGBA 1HNWJ 2B5JB 2QFJA 2JFDA 2CFXA 1TTHB 1S1TA 2HNZA 2OH2A 4ZVQB 4JYAF 2ASYA 1Q81T 2LYVA 3ZXWA 3GIIA 2DXEA 4WFYA 2WSCC 3CJRA 4RW6B 1VK3A 3NS7B 4OX9F 1HPZA 4ZJOA 5LSOA 1FJGF 2ZNZA 2C2EA 1WOSA 3AY0A 3GSDA 1FWPA 4FF3A 2M88A 3ONQA 5KAKA 2JRSA 4KKOA 2D3O1 4U7UK 3KHHA 2VBYA 5DG9A 5AE2A 1GEHA 3GU0A 1P6TA 4CH0S 2BR0A 4GO5X 4WF9Q 2DR6A 2OKQA 4PAAA 3A8EA 1RTZA 3BSNA 4OLOA 2MZTA 2RDJA 1XR6A 4XO0A 5T14A 1JLAA 1RSCA 3X1LB 3DRYA 4U9RA 1T9WA 4DX6A 2HIQA 4UW2A 3J80U 1FF2A 2WCXA 2PMWA 3TR5A 3POTB 4FPRA 2YNHB 1S1WB 3KLVA 1JLQB 1HWUA 3OFHA 3AD8C 4Q45A 1KD1T 5K14B 4JB8B 5L9NA 1WI6A 4EO6A 6FDRA 4I2QA 3MAQA 2W2PP 2DHGA 3GPAA 1RACB 1WG1A 3QGPA 1FWLA 4LFAJ 2LQ5A 4IG0A 2H5JB 2RAQA 1JLEB 3EXYA 3AJ1A 2HLUA 5IWAJ 3CIMA 3L95X 2A0FB 1B99A 3ZTQA 4I6WA 1R43A 2M8HA 4NX9A 1QUPA 1S9GA 3MUTP 3QRPA 1NCLA 2KYXA 2OPSA 4CI0B 2R42A 2FPHX 1IR1A 2DNNA 2HEKA 1A0OB 3TNVA 4DOZA 3RW7A 4IRKA 1T3OA 5DQIA 1KWMA 3N0VA 4ZVFA 1RT6A 3ZNJ1 1AZSA 2XB2D 1F6TA 2KKHA 3HJFA 4OYIA 4X4RA 2W8LA 3DRRA 5M2RA 2W24A 3M32B 4NLTA 2DCLA 4YS2A 4OHXA 2G0JA 4XTTA 2AWZA 5G4DA 1KHVA 4LSNA 4PG7A 4DF4A 4PG8A 4ZIVA 2UUAF 4FZVA 1JNRB 3PTWA 2ADBA 5HVGA 2ZH1A 1SIZA 3VAFA 2E7WA 1UA1A 4ZPDA 1R0CB 2JC0A 2XI2A 4KPCA 4LFCF 2HLTA 2XM3A 4DV0J 1RCOB 3VGTA 5IFMA 2ZNYA 4GVBB 1TL3A 1WI8A 2K7KA 2F4VJ 4CLWA 1TKZA 3R1HA 3CTRA 1FRXA 3TQ1A 2XS7A 1N8RT 3LP1B 2QLWA 4Q5VA 1R0AB 2B9WA 4W90B 3KHRA 2MKYA 1U1OA 2JOQA 2Y8WA 4RNHA 2NCKL 3G8SA 1WF2A 3K59A 3LTOA 2UU9F 4ID5A 5A6WA 5HMXA 4Q44A 4DN0A 1WF0A 3OQ2A 4JP8A 1S1TB 3D6TB 2HFVA 4E2FB 2HNZB 3IRXA 1NNDA 4EEYA 1IKWA 4F3QA 4KT0C 1OMSA 4RBTA 1G1XA 2OIHA 1WDDA 3UR0A 4O3RA 2HW3A 2E5LJ 2AJ0A 1HPZB 4DDFA 5IT9Y 1Q1KA 1UEUA 1JB0C 4KKOB 5KFQA 1S0OA 2FLPA 5KFXA 3KJVB 2ZHAA 3C15A 2Z2YB 2ALYB 2E44A 1SQEA 2YWGA 1S6QA 4QU7A 4LRBA 3C2PA 3H8YA 5IS2A 2HHVA 1VQ7S 1B3TA 1HQEA 1H98A 2AMCB 3ISZA 4ZCIA 6FD1A 2JVRA 3TI0A 3WQPA 3IBCB 1GAOA 3NGSA 4N76A 3EDQB 3IBFB 3HMJG
chains in the Genus database with same CATH topology
3R2CJ 4DR3J 4DV5J 5LM7E 1N36J 5A2QU 4JI8J 5FLXU 3R2DJ 3J81U 4LF5J 4X66J 4DV7J 4LF9J 3D3BJ 4AQYJ 4KYZA 5LMUJ 3JAMU 1N32J 4B3TJ 1HNZJ 4V1Ak 3D3CJ 4DR2J 5IT9U 4GKJJ 4JI4J 1IBMJ 4JV5J 4LFBJ 3J80U 4GKKJ 4LF7J 4X65J 4DUYJ 2UU9J 4LF4J 4JI7J 2MTLA 4DV2J 2HHHJ 1N33J 2VQFJ 4DV6J 1HNWJ 2UUAJ 3IMQJ 2E5LJ 1IBKJ 1J5EJ 4JYAJ 2ZM6J 4B3RJ 4PWWA 4JI2J 4JI0J 4DR1J 4DUZJ 4B3MJ 2UUCJ 4NXNJ 4K0KJ 4DV4J 4KY3A 4RJVA 4YHHJ 2VQEJ 3T1YJ 2MQ8A 4LFAJ 2UXCJ 4JI5J 4X64J 5AJ3J 1HNXJ 4DV1J 2MEWA 3T1HJ 2KL8A 4DR6J 4KHPJ 4DV0J 4NEZA 5IWAJ 1IBLJ 4NXMJ 1XMQJ 3OTOJ 1N34J 4DR7J 2UXBJ 3J7AN 2F4VJ 4DV3J 4LF6J 4DR4J 1I94J 2UUBJ 1HR0J 1XMOJ 4NEYA 4JI1J 4JI6J 4X62J 2UXDJ 4LF8J 1XNQJ 5LMNJ 2KVQE 4HHUA 4LFCJ 4OX9J 4JI3J 1XNRJ 4YY3J 3W1YC 1FJGJ 5BR8J 4B3SJ 4DR5J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R2C J;  4DR3 J;  4DV5 J;  5LM7 E;  1N36 J;  5A2Q U;  4JI8 J;  5FLX U;  3R2D J;  3J81 U;  4LF5 J;  4X66 J;  4DV7 J;  4LF9 J;  3D3B J;  4AQY J;  4KYZ A;  5LMU J;  3JAM U;  1N32 J;  4B3T J;  1HNZ J;  4V1A k;  3D3C J;  4DR2 J;  5IT9 U;  4GKJ J;  4JI4 J;  1IBM J;  4JV5 J;  4LFB J;  3J80 U;  4GKK J;  4LF7 J;  4X65 J;  4DUY J;  2UU9 J;  4LF4 J;  4JI7 J;  2MTL A;  4DV2 J;  2HHH J;  1N33 J;  2VQF J;  4DV6 J;  1HNW J;  2UUA J;  3IMQ J;  2E5L J;  1IBK J;  1J5E J;  4JYA J;  2ZM6 J;  4B3R J;  4PWW A;  4JI2 J;  4JI0 J;  4DR1 J;  4DUZ J;  4B3M J;  2UUC J;  4NXN J;  4K0K J;  4DV4 J;  4KY3 A;  4RJV A;  4YHH J;  2VQE J;  3T1Y J;  2MQ8 A;  4LFA J;  2UXC J;  4JI5 J;  4X64 J;  5AJ3 J;  1HNX J;  4DV1 J;  2MEW A;  3T1H J;  2KL8 A;  4DR6 J;  4KHP J;  4DV0 J;  4NEZ A;  5IWA J;  1IBL J;  4NXM J;  1XMQ J;  3OTO J;  1N34 J;  4DR7 J;  2UXB J;  3J7A N;  2F4V J;  4DV3 J;  4LF6 J;  4DR4 J;  1I94 J;  2UUB J;  1HR0 J;  1XMO J;  4NEY A;  4JI1 J;  4JI6 J;  4X62 J;  2UXD J;  4LF8 J;  1XNQ J;  5LMN J;  2KVQ E;  4HHU A;  4LFC J;  4OX9 J;  4JI3 J;  1XNR J;  4YY3 J;  3W1Y C;  1FJG J;  5BR8 J;  4B3S J;  4DR5 J; 
#chains in the Genus database with same CATH topology
 1ZM9 A;  1JLA B;  4CYU A;  5IT0 A;  3R2D J;  1RAJ A;  4R8U B;  2B43 A;  3QFW A;  3H25 A;  2VOP A;  2CQB A;  1SKW A;  2WBM A;  1A7G E;  3R5A A;  1P8G A;  3CE8 A;  5KFP A;  5KFN A;  4I2Q B;  2AU0 A;  4C8M A;  3M9O B;  2M5Y A;  3DI6 A;  2R7W A;  2CRL A;  4IG0 B;  1EQ0 A;  3CCM S;  2QMW A;  1HBO A;  3LGM A;  3R5D A;  3J7Z T;  3CMQ A;  4ENO A;  5B0E A;  1YJ7 A;  4HDH A;  2M4M A;  1QSY A;  1S9G B;  3P6Y C;  4OI6 A;  3G8Q A;  5FD1 A;  5AJ3 F;  5F0U A;  2IIH A;  4ZVH A;  4DX5 A;  2Y9H A;  3I9Z A;  3N4W A;  3IC1 A;  1NBE B;  5L38 A;  4ITS A;  3K57 A;  2DKO B;  3L9Z A;  4KO0 B;  2XSF A;  4AXJ A;  4K4Y A;  3CC2 S;  2HSE B;  2XWX A;  4WZM A;  1RT6 B;  1UVI A;  1AZS B;  2DY9 A;  4AUK A;  2FY1 A;  1CBK A;  5FLX U;  2JHE A;  3DRR B;  4XPC A;  4LF5 J;  5E3A A;  2B4P A;  5H9E J;  1J5O A;  1U45 A;  2J0W A;  1YI2 S;  2DHX A;  1PCA A;  2XMA A;  3O3L A;  4LSN B;  2BKN A;  5F8L A;  3C19 A;  3IG1 A;  3JXO A;  5HBM A;  3KUH A;  4O3Q A;  5EUH A;  2DGS A;  4CLZ A;  5KT3 A;  2FB0 A;  2KM8 B;  1NK9 A;  1OWX A;  1U49 A;  4W92 B;  4UT4 A;  4J37 A;  5GME A;  5LL6 d;  4KBI A;  3GCW P;  1TL3 B;  1CUL A;  4OL8 A;  1TKZ B;  1LWE B;  4DFP A;  1VK8 A;  2F4F A;  2KT3 A;  2MSS A;  4DL4 A;  4A4J A;  2F3J A;  1VBY A;  2BUN A;  3RJM B;  4DI6 A;  1LWX A;  2RE1 A;  1JLF A;  4TQR A;  1RI7 A;  1MMN A;  1RHR B;  4NCB A;  2HZA A;  4KGZ B;  1NJY A;  4LF6 F;  1RE1 B;  4FBT A;  5DQH A;  4UZC A;  2L3M A;  5DDQ C;  5EGY A;  4X4T A;  4ID5 B;  3CCR S;  1U25 A;  2DJW A;  4M1K A;  1YDL A;  3UDL A;  2OHD A;  2V9K A;  1L3T A;  3CD0 A;  3MDF A;  3PR4 A;  4NRT A;  3FNN A;  4YUD A;  2AJ4 A;  3IRX B;  3K5O A;  4X66 F;  1T02 A;  4CWB A;  2HGM A;  4UY8 5;  3UO0 A;  1MWY A;  2CJY B;  4CTA A;  1F60 B;  4LF7 J;  4RNO A;  1IQT A;  3BN7 A;  4ZLJ A;  4C3L A;  2CG8 A;  2F7V A;  3MD1 A;  2RRN A;  2GZO A;  2D69 A;  2HQF A;  1NB7 A;  1NO8 A;  4OYB A;  2P9C A;  5ETQ A;  3C15 B;  3V6K A;  4IRC A;  1YZ6 A;  4H4K C;  3T6J A;  4X62 F;  1NK4 A;  2OEJ A;  2MY7 A;  3GP9 A;  1NZ8 A;  1XR5 A;  2GJI A;  1N88 A;  1VCT A;  5E5N A;  3M1V A;  2WHO A;  1DAR A;  3P5B P;  2V68 A;  1NUE A;  1GT8 A;  3OXL A;  4TXS A;  1MRO A;  2DEI A;  1S7I A;  2JZ5 A;  2GHW A;  5M2P A;  1OPZ A;  2IA0 A;  1W25 A;  3NKY A;  5I42 A;  2MKJ A;  1N52 B;  4TY8 B;  2CQH A;  4GKK F;  3MM8 B;  2F9D A;  2LXU A;  2Z2L A;  1UEV A;  3F0N A;  4TU9 A;  3NS6 A;  3DI6 B;  2BE9 B;  3ILL A;  1WSV A;  3BYR A;  1MLA A;  4ZVG A;  3NLC A;  4OI2 A;  1JXE A;  2W2N P;  4DLG A;  2V34 A;  1HBO B;  2K7J A;  2MKC A;  5HVF A;  3ZTS A;  4PCQ A;  3NCQ A;  3ITH A;  4CP5 A;  4OX7 A;  5KOX A;  4Y0F A;  1WG5 A;  2QLF B;  2ZM6 J;  1MG7 A;  3DDN A;  3PDN A;  4RNF A;  2ZD1 A;  4K59 A;  4ZJL A;  4L6V 3;  4ED7 A;  1NK5 A;  3HHD A;  3UCG A;  4ZMM A;  3L09 A;  3GIR A;  4KHR A;  3C3L A;  2R4F A;  2HG4 A;  2CQ0 A;  1KBR A;  3EE3 A;  1T05 B;  1M5K C;  3OR1 B;  4EFA C;  1UKU A;  5K8N A;  1KQF B;  3A3N B;  1E6Y A;  3VF0 B;  5F8J A;  3DLL Q;  2GML A;  4KGV B;  3OXF A;  1ZBT A;  5KFU A;  5AE1 A;  1KHW A;  2I0X A;  3TWZ A;  1RBA A;  1EAY C;  4LBH A;  4DV7 J;  5DS7 A;  1YBU A;  1D3W A;  2IRY A;  4DR3 F;  4FS1 A;  5HBM B;  4B02 A;  2B9X A;  4OYW A;  2F1F A;  5I4M A;  3DDK A;  4CO1 A;  1U4B A;  1T95 A;  1WSR A;  5H1S V;  3EPG A;  4Y3C A;  4JV5 J;  4QCL A;  1XIQ A;  4O3N A;  1GMW D;  3U02 A;  3OVB A;  1CUL B;  2IAJ A;  1AW0 A;  2JX2 A;  2VA3 A;  4NCA A;  1H7W A;  2YVS A;  1J5E F;  2CDQ A;  2OUG A;  2HMI A;  1D8Y A;  1TVR A;  3SSR A;  2YKQ A;  3HHL A;  4XPE A;  4K7Q A;  3A3O B;  2KO1 A;  4UTG A;  2LEP A;  1YBA A;  2YQ3 A;  5KFR A;  5A8K A;  1BQM A;  1U2C A;  1OSD A;  3W8G A;  3DU5 A;  3WBZ A;  2YKM B;  4NLY A;  1ZOT A;  3OVS A;  3LF0 A;  1VBK A;  3PCO B;  2YPZ A;  4M5D B;  3PEJ A;  2C2M B;  1RDR A;  2FJX A;  2F8M A;  3KKF A;  3TUI C;  2VPY B;  2XUL A;  4KYZ A;  4IH7 A;  1WG4 A;  2W2O P;  4GRS A;  2YKO A;  4OHW A;  4JV1 A;  5J2N A;  1V6H A;  4WFX A;  1SL2 A;  4MK7 A;  1NKB A;  3NCR A;  5IM0 B;  2V2V A;  2HS3 A;  1RHU B;  1WC5 A;  4JI7 F;  3T1A A;  2KG1 A;  1LWC A;  4FF1 A;  2CPH A;  2E1A A;  2ZH6 A;  5L9X A;  5DET A;  1H2V Z;  3M1V B;  3DHW C;  3V6J A;  2DH8 A;  4LRC A;  2C2O B;  3S7R A;  1MSW D;  1TL7 A;  4OYP A;  1FKA F;  3W9J A;  4QWC A;  4ETZ A;  2XNQ A;  2RQK A;  4DX8 H;  2V4Q A;  3J7Y I;  5D0H A;  3Q2T C;  1ZH5 A;  5I42 B;  3W9H A;  3RB0 A;  4J9N A;  1RKJ A;  1VQ5 S;  5ETK A;  4ES3 A;  4NE9 C;  3I32 A;  2K3K A;  4NZ6 A;  4EYI B;  1NDP A;  1WEL A;  2IM0 A;  4N47 A;  4CQ1 A;  1S77 D;  1RAB B;  1SL0 A;  1HNV A;  3ZZP A;  4EBC A;  2V69 A;  2AIR B;  3ITH B;  3TOQ A;  5I3P A;  4N41 A;  1NXI A;  2RKI B;  1RKI A;  1JNZ B;  3GSI A;  1IBM J;  2MJU A;  3KJF B;  1ZPV A;  2LDI A;  1SJQ A;  3IR5 B;  1RWX B;  4NLU A;  4YOE A;  4KHM A;  1HWI A;  2L08 A;  1OS5 A;  1M5V C;  3ZTP A;  2MZR A;  1E6Y B;  4RJV A;  1VLO A;  2HK2 A;  2MHE A;  3J7Y U;  3OD2 A;  2DR5 A;  3Q8P B;  4LJM A;  4ZPB A;  3EGW B;  3BSO A;  2XI3 A;  1FTC A;  2V6A A;  3MED A;  4C8O A;  1TKX A;  5IC6 B;  2GNK A;  2CPI A;  2CQ2 A;  5A76 A;  4H4M A;  5KFA A;  1KOH A;  4JI3 J;  3SI8 A;  1U1K A;  1KNZ A;  5BR8 J;  4J9P A;  4YQW A;  5M2U A;  3N6N A;  1TL5 A;  4DU8 A;  4ZP7 A;  4ZPA A;  3OTB A;  4Q7A A;  2HBR B;  2IAJ B;  4K4T A;  2RF2 A;  1URR A;  3RGI A;  3TAP A;  1SBR A;  3CJS A;  3GTY X;  5HO4 A;  3KTQ A;  4KAI A;  2I5J A;  2HMI B;  1ZAX A;  4WP9 A;  1YJN S;  1TVR B;  4DV2 J;  3HHL B;  2B8Q A;  3RRG A;  2HFO A;  1LXJ A;  3N5F A;  2IJF A;  3CMA S;  4DUT A;  3CED A;  3SV3 A;  1BQM B;  2K06 A;  3BDP A;  2W9B A;  4PXB A;  1NKE A;  2KM8 C;  2PMH A;  3HZG A;  2YKA A;  4HTI A;  3QT6 A;  2OSQ A;  1IKV A;  3M8W A;  2AQ4 A;  2VDI A;  1REV B;  3FUY A;  4OZL A;  3SSS A;  2QT7 A;  1CVJ A;  3D0H E;  2Z4P A;  2UUW A;  5KG4 A;  3THT A;  3R8Y A;  3DLK B;  2J6S A;  4F26 A;  2POK A;  1BE4 A;  2IVF B;  3BH6 B;  2HHT A;  2VG5 A;  2OTL S;  1LWC B;  2HYI B;  2DPI A;  5HL7 Q;  5G0R A;  4RUH A;  1PAU B;  4DUY F;  3T5J A;  3Q8R B;  1PJ6 A;  8AT1 B;  2GO9 A;  1RTD A;  3M8R A;  4UUW A;  3CCV S;  1RT4 A;  2GIQ A;  1TL7 B;  2QLX A;  2YQ1 A;  3BBF A;  1K9M T;  2F4V F;  4ER8 A;  4OHV A;  2M8D B;  2CIM A;  2YTC A;  2XNR A;  5FLX Y;  4XDC A;  3OL7 A;  3HZE A;  2QMX A;  1ZTW A;  3DOM B;  4DWI A;  1RAE B;  2GMH A;  3K8V A;  3BN4 A;  4OJG A;  3T41 A;  3SSQ A;  3CC7 S;  2EPI A;  1HNV B;  2B4V A;  3TAN A;  2DGU A;  1TUW A;  2EK1 A;  1FRL A;  2MZJ A;  4QPX A;  1F3F A;  4PQU A;  2X7I A;  3CDU A;  2YXL A;  1Y00 A;  2GHV C;  1RT2 A;  1W26 A;  2IM2 A;  1SIW B;  3G96 A;  1FRH A;  5ETV A;  4M5K A;  1FD8 A;  4LBI A;  1IWG A;  4RUA A;  4DR2 J;  1YSJ A;  3DDI A;  4JI4 J;  1ZA1 B;  5D8H B;  2JEJ A;  4MH8 A;  1GTE A;  2B8P A;  1PIL A;  1NDK A;  4I4B A;  4S0M A;  4LRE A;  5KFS A;  2O1P A;  4FNI A;  3MMC A;  3H7H B;  5IC4 B;  2VH7 A;  3GCX P;  2KXN B;  1Q16 B;  2Q1L A;  3BR9 A;  2RDD A;  2A6O A;  2ADC A;  4DPW A;  4YEA A;  1AYE A;  3MED B;  2Y1L B;  3NNH A;  4C2M A;  3NWR A;  1TKX B;  1FNX H;  3AH6 A;  3B78 A;  1FER A;  2GJF A;  3FCW A;  1SJF A;  4CIO A;  4PG5 A;  4PUO A;  5H9F K;  2GS8 A;  2V2K A;  4CLL A;  4WTO B;  4F0M A;  3PNI A;  2MZ1 A;  5E41 A;  5HAN A;  1T8E A;  5LMN J;  2XZW A;  1KLM A;  3K2Y A;  2DEJ A;  4I1T A;  1SQG A;  2AGP A;  3R2C J;  3DFE A;  2RF2 B;  3CJ0 A;  5BXI A;  2CJB A;  2Y1I A;  4K4Z A;  3E2E A;  1WUU A;  2IYI A;  1VGY A;  2I5J B;  2CQ4 A;  3K58 A;  4HDG A;  1QAX A;  4P52 A;  3I96 A;  1YJ9 S;  3EUN A;  1U48 A;  4UOF A;  1HAR A;  2W9B B;  3R7S B;  4ZIT A;  3QO9 A;  1VQK S;  2A2C A;  2AJF E;  2DYA A;  4PWW A;  2A6M A;  1VQP S;  3D5M A;  1IKV B;  4RW8 A;  4K0K J;  5CZX A;  1CC8 A;  1UW9 A;  3M9N B;  4NLR A;  1HNX J;  5ETL A;  1SJR A;  3W60 A;  3W2W B;  4OQJ A;  1CJU A;  5HQM A;  3DRX A;  1FD2 A;  1FVQ A;  3PYE A;  2HVD A;  1PJ7 A;  4LF5 F;  4AD6 A;  3DOL A;  1H3D A;  2HHP A;  4HHJ A;  4B3S J;  2FQQ B;  2AZ1 A;  3CJ4 A;  2VG5 B;  1TP7 A;  5IQQ A;  5EWG A;  5J2M B;  2EKY A;  3QJP A;  3BGL A;  4QJV A;  2AKW B;  5G0R B;  1BQN A;  3G8T A;  5D0E A;  1N32 J;  2Z8Q A;  4C0H A;  1TK0 A;  2XZD B;  1RTD B;  2RSQ A;  1RT4 B;  3KK2 A;  1S79 A;  3IGV A;  2XMJ A;  4LFB F;  3PR5 B;  1X5S A;  3I5A A;  1N33 J;  5ETR A;  3PG9 A;  3L7U A;  2ZVI A;  1TK8 A;  1HW9 A;  3PIO Q;  1TMJ A;  1AXQ A;  2PN6 A;  4ES2 A;  1SH0 A;  5K8P A;  4KH0 B;  3IP0 A;  2P6S A;  1PYO B;  2OO4 A;  1VJW A;  4L73 A;  2M7S A;  4NMX A;  1M5P C;  4F4A A;  1SV5 A;  3OTO F;  5KFE A;  4ILL A;  4DR4 J;  3ZZY A;  3SFU A;  3OLB A;  2LVW A;  3CGI A;  3KJN B;  1HHQ A;  3VAJ A;  2VHG A;  1LQ9 A;  2FHJ A;  2XEX A;  3JQJ A;  1RT2 B;  3KWM A;  3UN5 A;  1VHI A;  4LR9 A;  3QLH A;  4FPI A;  2KVI A;  4NML A;  2MST A;  4M5L A;  1B0T A;  1K0T A;  1RQ0 A;  4Z7Y A;  3C8Y A;  2YX4 A;  4DQI A;  2QX0 A;  2EK6 A;  1PC4 A;  1NJZ A;  1B4S A;  2XHC A;  3AB2 B;  4CNZ A;  2GFF A;  1DBD A;  1Q79 A;  2RU3 A;  2OJ3 A;  1GNK A;  4QZV B;  2V8D A;  2FUG 9;  2GVZ A;  2A18 A;  4TQS A;  3ENV A;  4TU8 A;  4NEZ A;  4DV1 F;  3CIZ A;  3CNQ P;  4NXM F;  3UR3 C;  4AL6 A;  2PGC A;  3KG0 A;  3OSP A;  1KVI A;  4Y2C A;  3OVA A;  3KK1 A;  1VMB A;  2DNO A;  4LF2 A;  3MR7 A;  3P4U B;  2BW2 A;  1YKW A;  2C3P A;  4JI1 F;  4NAS A;  1H2T Z;  1FFS B;  3IR6 B;  3TO8 A;  3MUV P;  1WOR A;  3Q89 A;  3VR1 A;  2C3Y A;  5CXT A;  1NH8 A;  2E66 A;  1EJ7 L;  5KFO A;  1YHQ S;  1SJ3 P;  1Q7L B;  4DCJ B;  1X5T A;  2RNE A;  3QO9 B;  4NLQ A;  3D1Q A;  2KB2 A;  5IV4 A;  5L8R C;  1LWF A;  1FRJ A;  4RW8 B;  4HKQ A;  3JQM A;  4BBY A;  3JSY A;  3SCL E;  2BE7 D;  5DZ6 A;  2DR9 A;  1DAX A;  4JYA J;  1J2V A;  1CJU B;  1GX5 A;  2OEM A;  3MXH P;  1WDT A;  1WTB A;  5JMN A;  1QVG R;  2BYC A;  2VBZ A;  3TUJ C;  1YG0 A;  3LH2 S;  1TQL A;  4X64 F;  2G13 A;  4FXD A;  3OFG A;  4XK8 C;  1EKS A;  3IN5 A;  1KQS R;  3PRB A;  2ZH4 A;  2BMB A;  1RT7 A;  2CWK A;  1MWQ A;  1N6Q A;  3KLE A;  2N82 B;  3TX0 A;  2QGF B;  4FDF A;  4ZKA A;  3FVY A;  4TKT A;  1TKT A;  2DPJ A;  1BQN B;  5GAE U;  2B56 A;  2JEF A;  1HBN B;  1O5J A;  4ZLN A;  4OZJ A;  3C6T A;  3QRQ A;  4XIU A;  2AYM A;  4QBU A;  3MMA B;  1UAW A;  5CCL A;  3CW2 C;  1A6L A;  2ERR A;  3NMR A;  4UOG A;  3N79 A;  2E7X A;  2JLE A;  4DV6 J;  1LW2 A;  3VQS A;  4ZPV R;  2RH3 A;  5FDL A;  4OYX A;  3IWL A;  5D77 A;  1F0X A;  3NOG A;  1SV5 B;  4QIG A;  3TEG A;  4JI2 F;  1I1G A;  4C4W A;  4LSL B;  2QYG A;  3DM2 B;  1UWA A;  1D0E A;  1WHX A;  3W5Y A;  1S97 A;  1MW7 A;  4N8O A;  4U6P A;  3QLH B;  3RRH A;  2RIJ A;  1S9E A;  3E8O A;  1S5Z A;  2B9E A;  1VIS A;  3M8S A;  2E5J A;  2BAB A;  1PSD A;  1AFJ A;  2BM1 A;  2VG7 A;  3MD3 A;  3M30 B;  9RUB A;  2UV8 G;  3F44 A;  5K8O A;  4CLP A;  3QZ7 A;  1AB8 A;  4J9V A;  3BJY A;  2NXE A;  3TZZ A;  2B6A A;  5KT6 A;  1M1H A;  3QGH A;  3I9V 9;  2CJ9 A;  1GXU A;  4GKJ J;  3IS9 A;  1BWE A;  4KR0 B;  2Z57 B;  1HWK A;  2BM0 A;  2ZOM A;  3HT0 A;  3LP2 A;  5FJ4 A;  3G2X A;  3NEK A;  2GVZ B;  1U2F A;  2C3O A;  1DHM A;  3P3D A;  2UUA J;  3P5T L;  3DRP A;  2EFQ A;  4CO0 A;  2OML A;  2RHS B;  3MEG A;  3NNA A;  2DGV A;  1EIY B;  2VPX B;  2GAG C;  2O5D A;  2N7C A;  3KK1 B;  1JK9 B;  5LSL A;  1OIA A;  4QOT A;  4GC7 A;  1Z4U A;  2E5I A;  2CQP A;  1QD1 A;  2AW0 A;  4EWT A;  2ZC4 A;  1NLK L;  1RYS A;  2PI4 A;  3W7B A;  1HR0 F;  4QYZ K;  2L9N A;  4C11 B;  1TU0 B;  4CO3 A;  2B4U A;  4LVO P;  2YKP A;  3CCW A;  5B0C A;  2MY8 A;  1HNI A;  2CQD A;  1IBM F;  3OHB A;  3FK4 A;  5KFD A;  4ICL A;  4GVL A;  3D3B J;  5BYS A;  1RTH A;  3KUG A;  3JSR A;  5IT4 A;  1X5P A;  5A0Y A;  4DFK A;  1VBX A;  3HK2 A;  1KSP A;  3V6H A;  3ZZ0 A;  2HWT A;  3W2V A;  5F8N A;  1VQ9 S;  2G2O A;  3BRE A;  5L1J A;  4F4Y A;  1WD6 A;  2Y3Y A;  5CYJ A;  3DKD A;  3M4X A;  4U7U D;  1VIX A;  3PJ9 A;  1RT7 B;  3D1H A;  4KY3 A;  3GV8 B;  3PO4 A;  3QPI A;  1N6Q B;  3TEH B;  4JI3 F;  3CD5 A;  5BR8 F;  4CH1 A;  5CYQ A;  2DGO A;  2AP6 A;  2V8V A;  2XBP A;  4NEY A;  2HHQ A;  4O23 A;  3ET6 A;  3FDS A;  4ED0 A;  4ZN3 A;  4P6Q A;  3LWM A;  3W61 A;  2G2Y A;  1SH2 A;  3GR1 A;  4Q2M A;  1SCJ B;  4IG3 A;  1S0M A;  2H51 B;  4YY3 F;  5LJ3 Y;  4TY9 A;  5ETS A;  1SJ1 A;  1S99 A;  4NL5 A;  3NBP A;  3FFI A;  4LF9 F;  2CPF A;  1BUX A;  4DV2 F;  3I31 A;  1R8H A;  5FDL B;  3AD9 C;  3T5K A;  4WKR A;  2DD8 S;  4BS2 A;  1REG X;  4NRU A;  2DBB A;  2WZ1 A;  3DLJ A;  1Q53 A;  1NH7 A;  4ZVR B;  3V4I A;  2VU5 A;  2IM3 A;  3KG4 A;  2J76 E;  3UCZ P;  4RU2 A;  3M8Y A;  4QIE A;  3CCE S;  4DN9 A;  4MTP A;  4TYA A;  3Q8Y A;  3OW2 R;  1K1Q A;  2NLW A;  2C2K B;  1WWH A;  4DCP B;  4RO0 A;  3PEH A;  4CO5 A;  5AJ3 J;  3CJ8 A;  3AOC A;  5EN1 A;  2P9G A;  4G1Q A;  4M5M A;  3I56 S;  3MEC A;  3A8J A;  2JSX A;  2VBW A;  2DNR A;  1FT8 A;  3GR0 A;  4DJB A;  4F4K A;  2B6A B;  2FHM A;  4TYB A;  2D3Z A;  1WAC A;  3IGN A;  4OZ5 A;  4E98 A;  3MR6 A;  2QL7 B;  3B4D A;  3IS9 B;  2QYC A;  3M2U A;  3LP2 B;  3UDC A;  3RRK A;  5C7P A;  4KJI A;  2B7C B;  3M6X A;  4HLB A;  5KT2 A;  3DRP B;  2GAH C;  3MEG B;  3PIP Q;  4IR9 A;  4RR5 A;  4PXC A;  1JLC A;  3K17 A;  1FX4 A;  4URQ U;  4TLR A;  3UN3 A;  1U8S A;  2OFH X;  5J2P A;  4OZ1 A;  4USH A;  4DQS A;  5B0B A;  4NYZ A;  1APS A;  4MK9 A;  2VFU A;  4I7F A;  1GH8 A;  4DQR A;  2Q43 A;  2MKI A;  3IWN C;  2ZH5 A;  1OYD A;  5JUM A;  3MCM A;  1FK9 A;  4BCA A;  2J9C A;  4X4Q A;  2RDI A;  5MLC V;  3N6M A;  4LF6 J;  2DXF A;  1GXT A;  2WB4 A;  5DGA A;  1YGY A;  1HNI B;  3MZI A;  5KT4 A;  3TQE A;  4CH7 A;  4ICL B;  4PWU A;  4FBU A;  4TU7 A;  2LKZ A;  2MQQ A;  1R8C A;  3W1Y C;  1Z2L A;  1OSC A;  4FVM A;  1YZ7 A;  1FX2 A;  4JOU A;  5A0Y B;  2W9C A;  3EVM A;  4M5I A;  4X66 J;  1YRX A;  3OFE A;  1IM6 A;  2CPX A;  2WVE A;  3W2V B;  4F4W A;  3UWT A;  3V5R A;  2VKZ G;  2QJ3 A;  1H2U X;  4KTQ A;  3AQO A;  4OYM A;  1RB0 A;  2YNF A;  4M8L A;  2JLG A;  5KG3 A;  4F7V A;  3D67 A;  4NZ0 A;  4OI0 A;  1VQO S;  3CCZ A;  5CA5 A;  5DJB A;  5C2C A;  4M94 A;  4RL1 A;  4FYW B;  3LGN A;  3MPU B;  3D54 A;  3VAL A;  1VRU A;  2MQP A;  2IVM A;  4O4R A;  3NNC A;  3FZ2 A;  4NXN F;  3E3X A;  4WP8 A;  2OPQ A;  1ZM4 A;  5D4N A;  3BQ1 A;  1X7V A;  4FNH A;  3P8B B;  3HHL D;  4ECW A;  3HO1 A;  1PAE X;  2CJA A;  1VDH A;  5D0R A;  3GE9 A;  4ID8 A;  4IG3 B;  2BZ2 A;  2HGN A;  1H38 A;  5F8M A;  3VVT A;  5AXM A;  4F0H A;  3OL6 A;  3NBP B;  3FFI B;  2YWE A;  2K2P A;  4OJH A;  5GAG U;  3A3P B;  1FES A;  5C2G A;  2O3D A;  2RB7 A;  2HFU A;  2HQC A;  2LXI A;  3G9C A;  1M5O C;  4EK2 A;  3DRS A;  3MEE A;  3V4I B;  3AA9 A;  1QY7 A;  2XYP B;  2I8E A;  2VFR A;  1KC8 T;  1IQZ A;  4HI1 A;  1U09 A;  3FEY B;  3OTE A;  4H4K A;  4CLF A;  3L7O A;  1H72 C;  5GAD I;  2XY7 A;  2ACY A;  1K44 A;  4USK A;  4PXE A;  2MTL A;  2I6W A;  1JQG A;  2OGU A;  3TAM A;  1HNX F;  3KUE A;  2HRT A;  1AA1 B;  4Y2K A;  4WBF A;  4G1I A;  4DR1 J;  4G1Q B;  3FQK A;  2VA2 A;  2WBR A;  1JMT A;  2KZZ A;  2M9K A;  3GQC A;  4LRA A;  2ZH8 A;  2GHP A;  1Y4Z B;  3HSZ A;  4DR6 J;  1RLD A;  1NZA A;  1U02 A;  4DR7 J;  2C2D A;  1N0U A;  4WYL A;  1QAI A;  2M2B A;  2YKN B;  1U2R A;  1AFI A;  1XMO F;  1L3U A;  1D9F A;  4JI6 F;  2MLY A;  3CB4 A;  5KFW A;  4ZJQ A;  2VOO A;  3M2U B;  2XGP A;  3NRB A;  3HVW A;  5KT5 A;  5HQ8 A;  3S01 A;  1N0V C;  2HKE A;  4DR3 J;  1U47 A;  1TV6 A;  1Q8I A;  2C22 A;  4QU6 A;  3E01 A;  1JLC B;  5E3Q A;  4B3T J;  2KN4 A;  4DSJ A;  2IDL A;  5GAD U;  2D9P A;  4FP9 A;  2CAD A;  5GMK a;  5J2P B;  1RWV B;  4B3O A;  5CHC B;  3RB6 A;  2GMJ A;  4EU0 A;  3L3C A;  4I7F B;  4P72 A;  5F9L A;  2BJE A;  5HK4 A;  1KDN A;  2Y1R I;  1J5E J;  1FJ7 A;  2WVB A;  3ENW A;  3I5B A;  1FK9 B;  2KHD A;  1X5O A;  1P9Y A;  2WOM B;  1Q78 A;  1VC0 A;  2UUC F;  1Q8B A;  4ZPW R;  1WEZ A;  2PA8 D;  2Q6B A;  1RAD B;  3HF5 A;  3KMQ A;  2ZBI A;  4Y00 A;  2RT3 A;  1ZA2 B;  3OR2 B;  3VAK A;  2ZBQ A;  2HHU A;  1JJC B;  2K8G A;  2W9C B;  4H4O A;  1KOO A;  2J0X A;  3VVU A;  2HFZ A;  3B82 A;  2EBE A;  3HT3 A;  1JWW A;  4OV6 A;  2QA1 A;  3RBX A;  3P45 B;  4RW9 A;  2ALZ A;  1JKH A;  4NI2 A;  2FC9 A;  2IPO B;  2PE8 A;  9ATC B;  3DHX A;  1RWO B;  2OPR A;  4TVA B;  2MZQ A;  5A2Q U;  1ZM3 A;  3JSM A;  2YNF B;  1GXL A;  4YR0 A;  3BM7 A;  4ZS6 A;  5IV3 A;  2CJQ A;  2BOP A;  1WJ9 A;  3FEX B;  2VG6 A;  3UD3 P;  5J1N A;  2C3M A;  4RW7 A;  1R8A A;  2H3E B;  1VRU B;  1QJH A;  2SXL A;  4JI7 J;  1K47 A;  4F2R A;  5IXU A;  5DG8 A;  4PAB A;  2W2M P;  3CDW A;  3PKY A;  3WDO A;  4HYK A;  1U1R A;  3KMS A;  1T9T A;  3PX4 A;  3TJ8 A;  4J9L A;  1S57 A;  3NGR A;  3RTV A;  2L48 A;  2IC3 A;  1U0H A;  2WSF C;  4DG1 A;  3AOB A;  1CS4 A;  4WKY A;  3BKF A;  2C2R A;  5HMZ A;  1HBU A;  4LRF A;  2J7K A;  3S6E A;  3CT9 A;  4MIB A;  4YN3 B;  4LF8 F;  1TR0 A;  2LEA A;  1EHW A;  1F9E B;  1FNO A;  3MEE B;  4QYZ J;  1KVJ A;  1XNR F;  1U0S A;  2CZ9 A;  3GIM A;  5LXY A;  3UPF A;  2ZH7 A;  3C66 A;  2OPP A;  4C8Z A;  3CJQ A;  2K3I A;  1RUS A;  2DNK A;  3PW7 A;  3UDE A;  3TAM B;  2BJ7 A;  2JL9 A;  3PZP A;  5MAO A;  4WTY A;  4DQQ A;  3PY8 A;  4DLE A;  3OHA A;  4JV2 A;  4ERD A;  5HSP A;  2GJ2 A;  1PO6 A;  4P2F A;  1FVS A;  3H5S A;  4MKY A;  4B9S A;  2DHH A;  1L3K A;  3GON A;  4AYB D;  4EMD A;  1SC6 A;  2FZG B;  1U24 A;  4JI5 J;  3M2V A;  2XZT B;  2MEW A;  4FYV B;  4RU9 A;  1BHN A;  1XMQ F;  2J9E A;  2CPY A;  4E8U A;  3MM6 B;  4RNN A;  4I67 A;  4I68 A;  5EX3 A;  4HTJ A;  7AT1 B;  1TV6 B;  1RT1 B;  4KC5 A;  2XSJ A;  1ELO A;  4HHU A;  3AFG A;  2J0Q D;  4RNM A;  3E01 B;  4F04 B;  3SBM A;  2E1C A;  2HAI A;  1FO1 A;  4K8R A;  1RT3 B;  4BHQ A;  4YP3 A;  4IUF A;  1VRT A;  4OX6 A;  4B3O B;  2UVR A;  2W1B A;  4F36 A;  1RWN B;  4DV6 F;  2LEC A;  2V0N A;  5KG0 A;  3HVA A;  3D4J A;  4J9O A;  1KKH A;  1C2P A;  4K4X A;  2DNZ A;  1ACM B;  2VD3 A;  3ILI A;  4KB7 A;  2XQC A;  2KU7 A;  2MGZ A;  3V6D A;  1SVD A;  5SZT A;  5U47 A;  3EZ5 A;  3P49 B;  3VCD A;  3CF5 Q;  3RUB L;  3SQG A;  1K0V A;  2GC8 A;  2W2Q P;  4H4O B;  3RR8 A;  1DY3 A;  3NOC A;  2FYX A;  3LP0 A;  3W62 A;  4MK8 A;  3IAS 9;  4RW9 B;  1P9Q C;  3WX8 A;  1JKH B;  3GWC A;  4X4V A;  5CD4 H;  2DH7 A;  2OPR B;  3VWS A;  1S6P A;  4NOH A;  3JSM B;  1HI1 A;  4MKV A;  3GG1 A;  3G6V A;  1DTT A;  5K9F A;  3CD7 A;  1N5V A;  2E7V A;  1VFJ A;  4NYP A;  1YTY A;  2VG6 B;  4GKJ F;  4NLV A;  1G2E A;  1XJW B;  5AE3 A;  3QBC A;  2GQC A;  4DBQ A;  2WRM A;  2W7P A;  1N36 F;  2CPE A;  4RW7 B;  4JI8 F;  2L9W A;  1VIO A;  2VDH A;  5C24 A;  2XO7 A;  2UVW A;  2VB6 A;  3GFZ A;  2ZKT A;  1U1P A;  2V67 A;  2I38 A;  2VFT A;  1NPK A;  1Y10 A;  2HWH A;  2XLK A;  2E9T A;  1KEK A;  4KGM A;  4QWE A;  4DUY J;  4A8F A;  2ZBR A;  2UUT A;  2DK2 A;  1RK8 A;  3DLE A;  3RYL A;  2XCP A;  2JVO A;  3BYP A;  2DVI A;  1B70 B;  3QT7 A;  2Z2M A;  2EWH A;  2H9Z A;  3MF5 A;  4AXI A;  3R5C A;  4DG1 B;  1CS4 B;  3PAC A;  2BW7 A;  1HBU B;  1RAO A;  3A4T A;  2OD6 A;  1WC3 A;  4B3M F;  1NEE A;  4DZD A;  1N5Y A;  3R6G B;  4NLD A;  1S1U A;  2PDA A;  1C1C A;  3JYT A;  4DCO B;  3MTJ A;  3EGZ A;  2RML A;  4PWD A;  3ZZO A;  2UUB J;  4RWW A;  5HRO A;  3KK3 A;  2OPP B;  1I94 F;  4HEA 9;  3T9N A;  3MMJ A;  2O67 A;  2J6T A;  4ZP6 A;  1LV5 A;  2B4O A;  3VTI A;  5HJY A;  2ZH2 A;  4C48 A;  3IFE A;  1WKK A;  1RHJ B;  2C28 A;  4IOB A;  3FBB A;  2HNY A;  4G6V B;  4DV5 F;  3RU0 A;  3LAL A;  3H59 A;  2E5H A;  3ICL A;  2A1B A;  1R31 A;  4ANE A;  1VLY A;  1VJQ A;  1MML A;  1UVK A;  1KQK A;  3AAW B;  3WC0 A;  4F02 A;  3FGV A;  5L46 A;  1OY8 A;  1QUV A;  4RZR A;  2HGL A;  3BGU A;  5HP1 A;  1BWV A;  1DFD A;  2JDJ A;  3MCN A;  4RWX A;  2KZM A;  1FNM A;  3Q22 A;  5J1P A;  3M6V A;  3BO2 A;  2VKR A;  1QM9 A;  2QSW A;  4R0J A;  3S1T A;  1TK5 A;  3DU6 A;  4A8W A;  2UXC F;  2XSJ B;  2V4R A;  4NLW A;  3HX9 A;  1VQ6 S;  2LA4 A;  4MYT A;  1BC6 A;  2VC0 A;  1V5I B;  1OQ6 A;  1TMM A;  4AFF A;  2LCW A;  3Q24 A;  2VL1 A;  2J8S A;  3BZQ A;  2FHJ D;  3TUZ C;  3CPW R;  2XWY A;  3N6L A;  4QYR A;  5T41 A;  1TUG B;  1PBU A;  3TUP A;  3RBZ A;  4QQB A;  3TZW A;  5EHH A;  4OYO A;  2R7R A;  2EFO A;  3PXG a;  4AQY F;  2C3U A;  3R97 A;  1Q95 G;  4K4V A;  1RAH B;  3GB0 A;  1PIE A;  1Q0N A;  1GMV A;  3M8P A;  2MGZ B;  3V6D B;  4MKB A;  5KFK A;  4Y6I A;  4Q43 A;  2VON A;  4LF4 F;  1X0P A;  3MI7 X;  4L72 B;  2OPS B;  4B9L A;  1YJW S;  1LK7 A;  3LP0 B;  2BRL A;  3K8W A;  1FKO A;  1SH3 A;  3FEZ A;  5HI7 A;  1FFG B;  4YHH J;  3G71 S;  1RGV A;  1JXL A;  2F65 A;  2BX6 A;  4RUC A;  3OTD A;  1S6P B;  3QWU A;  2D3U A;  3NGU A;  1JXV A;  1YJU A;  4LMZ A;  1JJ2 R;  1RHK B;  4KGX B;  3LQV A;  4ZVP B;  5KFH A;  2R2T A;  2W4C A;  5C24 B;  2DNL A;  4HAC A;  2FVP A;  2K1R A;  3DLG A;  7FD1 A;  2GQQ A;  1TFW A;  3H5X A;  1YBT A;  1UP1 A;  2Q79 A;  3TVY A;  2MQO A;  2J8A A;  3HPO A;  5HLF A;  3T5L A;  4ZCM A;  1U1L A;  1FE4 A;  3A12 A;  1TL4 A;  1DTQ A;  2IJR A;  2HZC A;  4NLX A;  5E7O B;  4LFB J;  3UNY A;  1YJT A;  1UMJ A;  1DUR A;  2EC2 A;  5DM7 Q;  1TEL A;  5HN0 A;  4N8N A;  4IOA Q;  4PQA A;  2DNM A;  1X0F A;  2FVR A;  1N5Y B;  2WK4 A;  1C1C B;  3F41 A;  1F5A A;  4PWD B;  3MM9 A;  2EI5 A;  3DOK A;  1NSP A;  1O6X A;  2QC3 A;  5HRO B;  1VS3 A;  1UFK A;  3MPD A;  3OTO J;  1IBL F;  2W01 A;  1ZZF A;  3J7A N;  3K5P A;  2YNI A;  2ZC3 A;  4ZCL A;  4KRW A;  2AT1 B;  1NME B;  5D4P A;  1Q5V A;  1E6V A;  2BE2 A;  2C2Z B;  4TLQ A;  1WC1 A;  2J6U A;  1IKW B;  1QE1 A;  1U26 A;  5AXL A;  3A8I A;  3CJK A;  5CD4 A;  3EZO A;  3J7A 1;  4CO4 A;  4YB6 A;  2FLN A;  2LQ9 A;  2OLW A;  5HP1 B;  3CCQ S;  4LUB A;  1NSK L;  4FYY B;  1U6Z A;  2JJ4 D;  4HL9 A;  5C25 A;  5IT9 U;  4CNY A;  5SUH A;  2ASJ A;  4M5H A;  3CD6 S;  2ZDP A;  4O3P A;  3JQK A;  1S6Q B;  5HAT A;  2MKK A;  4ZP8 A;  1HQE B;  4PG6 A;  1YIT S;  3BH7 B;  4C9D A;  3IWX A;  2HHX A;  1UPM B;  4ATN A;  4CYU B;  3ISN C;  2I9S A;  2DNH A;  3QT8 A;  3NMA A;  3T1Y F;  3UW1 A;  2QA4 G;  3ZZZ A;  4PYA A;  2Q66 A;  4I64 A;  2P6T A;  2V8G A;  4DV1 J;  2OAU A;  4TNO A;  1UPP A;  4NXM J;  3M6U A;  5IZH A;  4DL6 A;  2NXN A;  3FBE A;  1MNE A;  1T94 A;  4R5P A;  4JI1 J;  3K5N A;  1XNQ F;  3MAH A;  4QR1 A;  2MLZ A;  5I3U A;  1HI8 A;  4A8Y A;  3MAA A;  5DZ7 A;  2PD1 A;  3DMJ A;  2ZUG A;  4PYD A;  1F5C A;  2RIL A;  3M8P B;  2DIV A;  4DFJ A;  1OPI A;  3IO1 A;  2X3G A;  2EG2 A;  4X84 A;  1HYS A;  1HNZ F;  2MZS A;  2ZE2 A;  3BO3 A;  4WU3 A;  3B54 A;  4DR1 F;  2JWN A;  1YRT A;  4ZCK A;  1SC1 B;  3H42 A;  2BBE A;  3WIV A;  3AA8 A;  4DR6 F;  1IKY A;  1KLN A;  4DR7 F;  4YB7 A;  2APO A;  1F2H A;  3MWB A;  4M63 A;  1NAQ A;  1IXK A;  2COL A;  3KJQ B;  2KYZ A;  2VQE J;  4X64 J;  1J5O B;  1AUD A;  2HFN A;  4V19 J;  3HDS A;  3CVK A;  2AGQ A;  3TX8 A;  8RUC A;  1RWW B;  3TZX A;  4HAC B;  1UET A;  2K1R B;  2V5H G;  2H54 B;  1U6F A;  4OZN A;  2LEB A;  2UXB F;  3IG1 B;  2R7S A;  3ULH A;  4DQP A;  4DU7 A;  3QFH A;  3CCL S;  3THV A;  3T5H A;  4B3T F;  3PJX A;  5HLF B;  1QSS A;  2MHN A;  5JVG Q;  4FXV A;  1N48 A;  3LPY A;  3W8P A;  1P1L A;  1DTQ B;  3PKM A;  1CEZ A;  1Q82 T;  4RW6 A;  4DS4 A;  4C3K A;  3W5X A;  2DGT A;  3EPI A;  4LSZ B;  2PC6 A;  5LOQ A;  3BSC A;  4LR8 A;  4PR6 A;  1R6V A;  1JLB A;  4MIW A;  3K7R A;  1JLF B;  1XEZ A;  1W2I A;  3GFY A;  2CNL B;  1UVM A;  3WC2 A;  5B08 A;  3MM9 B;  3O5T B;  4RBU A;  3DOK B;  1ZAV A;  2KXH A;  3MR3 A;  1DQA A;  4GMK A;  3G6E S;  1AT1 B;  4JI2 J;  2FJD B;  2YNI B;  5CQG A;  5B09 A;  4USU A;  3J80 Y;  4LT6 A;  4HI2 A;  2BE2 B;  3NGT A;  3LW5 C;  3TJA A;  1KTQ A;  2KT5 A;  4MYU A;  4ELU A;  4KQZ A;  4CTA B;  1U1Q A;  3CJK B;  3POT A;  2YNH A;  4ZLL A;  3O2I A;  3F56 A;  2RU9 A;  4F0K A;  1N5T A;  2BOA A;  3TA2 A;  1FJE B;  2BQU A;  1S10 A;  2AEF A;  3PYF A;  3KHG A;  1LOU A;  5C25 B;  4HH0 A;  4NA1 A;  4MJK A;  2DR7 A;  1BD6 A;  2LQJ A;  4ED2 A;  1D9D A;  1JLE A;  2CVE A;  4ELT A;  5KFG A;  3GJQ B;  1CLF A;  2HBZ B;  2NZC A;  1B0P A;  2W25 A;  2J0S D;  4WK1 A;  3H2U B;  2GX8 A;  4IFY A;  2HHH J;  2F8E X;  1MRO B;  4IQX A;  2PA3 A;  3L7P A;  5ETO A;  3US5 A;  2FJW A;  2AYE A;  2ZJP Q;  1C1B A;  2IYG A;  1FFW B;  3EIC A;  1IN0 A;  5F41 A;  3FMB A;  4P7T A;  4K5S A;  1IKX A;  4OV1 A;  1R89 A;  1GMU A;  4R5P B;  3OSN A;  4I56 A;  3QQC D;  3ZZT A;  4KHP F;  1D09 B;  1RP5 A;  2Y1J A;  3MAA B;  4DV3 F;  1X9M A;  5DLG A;  1HR0 J;  3CSK A;  1NSQ A;  3DMJ B;  4C6A A;  3MMB A;  1S48 A;  2VZ9 A;  2IRU A;  3BBC A;  2NZ4 A;  2CXE A;  2KFY A;  4Z37 A;  1N5S A;  4X4S A;  2OEL A;  3K5M A;  1FEH A;  2DHA A;  2RHQ B;  2VPZ B;  2ZE2 B;  2RUS A;  2ZD1 B;  4WZQ A;  2KT2 A;  2PMZ D;  1XBW A;  4ED6 A;  4DPY A;  2XYG B;  3I82 A;  1PGZ A;  2HHS A;  2VV5 A;  2N3O A;  2QZ8 A;  4J90 A;  4JI5 F;  4P2X A;  2ZH9 A;  2R8K A;  1QTN B;  4WU2 A;  4U7C A;  2ZIT A;  3TJ9 A;  3GZ7 A;  3S8S A;  4A8S A;  2E29 A;  4Q8E A;  3G4S S;  2N7Y A;  2HVE A;  2RUG A;  2QG9 B;  2JLF A;  4PZV A;  2YNG A;  2DNP A;  1VYA A;  1XK8 A;  2I1R A;  2HVH A;  1BMQ B;  3GV7 B;  4YY3 J;  1O51 A;  3LPE A;  4B9M A;  1UCN A;  4ZPC A;  1IJE B;  1JLB B;  1HD1 A;  3TZY A;  5DQG A;  3HVR A;  5IOL A;  3ETO A;  3FRZ A;  4LF9 J;  4RKU C;  2C42 A;  3KJV A;  2FJB B;  4NYO A;  3G6X A;  3GLJ A;  1VQL S;  3HFZ B;  1WF1 A;  1M1G A;  5A8K B;  1H7X A;  3BR8 A;  1KVK A;  2ZEJ A;  4ILR A;  3EVW A;  1NK7 A;  3TA1 A;  4YR3 A;  1WC6 A;  3MUR P;  1DRZ A;  1IBK F;  1Y5N B;  2HFS A;  3DC2 A;  1RA7 A;  1SPB P;  3NAH A;  4JI0 F;  2WW8 A;  1BQX A;  4J9R A;  4DSE A;  2G0I A;  3OV7 A;  4R8U A;  4I6Y A;  2QSF A;  3SEO A;  1ZTT A;  3FRY A;  2L41 A;  4AL7 A;  4IYQ A;  3TP2 A;  5J2N B;  2EKN A;  3FC9 A;  1ZZN A;  2HZV A;  1MMD A;  2JFK A;  5CZV A;  4BWM A;  3O1L A;  2CG4 A;  3UD5 A;  3G86 A;  4YR2 A;  4B08 A;  2WVD A;  2XLJ A;  3G87 A;  3QAU A;  2CJX B;  3QIP A;  3DN9 A;  4EUV A;  4LR7 A;  3LAN A;  3TYT A;  2XYH B;  1NHU A;  4IFY B;  3MR5 A;  3B4M A;  2CNO B;  3SFG A;  2EC0 A;  2QLJ B;  3NG8 A;  4LF1 A;  1C1B B;  1F2G A;  3MEK A;  2OTJ S;  3KLG A;  1N54 B;  2AGO A;  2G4B A;  4KO0 A;  1IKX B;  2FIU A;  3UNG C;  3EM1 A;  2ZFH A;  3PV8 A;  2ZHO A;  2EFG A;  4ZDN A;  2AJ1 A;  4O4G A;  2RJZ A;  3ISN D;  3THP A;  2UUB F;  5F3T A;  1S0V A;  1KS2 A;  2O01 C;  3MMB B;  2D9O A;  1XWL A;  3OTC A;  3W64 A;  3BSA A;  4DSF A;  1ZS6 A;  3KYL A;  1R8B A;  2ZBP A;  2F5G A;  4DPO A;  1FDN A;  2C2N A;  4M5G A;  2ILZ A;  1RWU A;  2W7A A;  1YWX A;  2QLB B;  2HUR A;  5F8H A;  1NK0 A;  4G65 A;  3T6B A;  2W8K A;  1LWE A;  3D68 A;  4MIA A;  4UF4 A;  3EXC X;  3D7S B;  3HI9 A;  5DDO C;  2DGW A;  3KHL A;  2XTJ P;  3W66 A;  3Q23 A;  4B9U A;  3PM9 A;  2LU2 A;  3UQS A;  1OQ3 A;  2RD5 C;  2X1A A;  3W9I A;  1NPP A;  2W4P A;  2ZJR Q;  3PW0 A;  3TRG A;  2G1D A;  2VQF F;  4H4M B;  2ZVS A;  4FXW A;  1C4C A;  2MDA A;  4DPX A;  3W3S A;  3H4D A;  2H65 B;  4NXN J;  3FQL A;  2V63 A;  2JC1 A;  2IMW P;  1YLX A;  2YNG B;  4UST A;  5EWF A;  3BDE A;  3OL8 A;  3LO3 A;  2MQM A;  2PEH A;  2QV6 A;  2LMI A;  3ZC4 A;  5ITH A;  1M0S A;  4NCG A;  4J9M A;  1PG5 B;  5DLF A;  1FTR A;  2U2F A;  4RW4 A;  2XS5 A;  2GO8 A;  3SCJ E;  1FJC A;  4UOH A;  2QFI A;  1RU2 A;  3JSB A;  4V19 X;  4EZ6 A;  3WZ0 A;  3CO9 A;  2MYF A;  3AD7 C;  1NJI T;  1HKA A;  4F25 A;  2DRB A;  4RLE A;  4YHH F;  2EVZ A;  1QTM A;  4FF4 A;  1T03 A;  2OFG X;  2AZ3 A;  5B7W A;  4B9N A;  4JV0 A;  4TY8 A;  1T11 A;  4N7T A;  3MM8 A;  1X4E A;  1H73 A;  3GFH A;  1I6J A;  1VRQ C;  2CPZ A;  3D0I E;  4C98 A;  1HW8 A;  1SUQ A;  4WFA Q;  2VFV A;  2OD4 A;  3LOU A;  1X4A A;  5E2Q A;  3ZTO A;  1XMO J;  1S12 A;  3Q8V A;  4JI6 J;  3Q86 A;  4AL5 A;  3QIP B;  1WHW A;  1SB6 A;  4IH5 A;  4P73 A;  3CDB A;  5D4L A;  4A47 A;  2CNK B;  3UD4 P;  4X4N A;  2ATC B;  3KLF A;  4DL0 C;  3M8Z A;  3EGV A;  3LWL A;  4DR5 J;  5KFJ A;  1X8D A;  3ILJ A;  2QO3 A;  4I0W A;  1TUV A;  2XY6 A;  1F3V A;  4ED1 A;  3KLG B;  3KLI A;  1T05 A;  3OR1 A;  2YWF A;  2E9R X;  2Q3P A;  3HSD A;  2PEB A;  2NPF A;  5EWE A;  4FKY A;  4O4G B;  4OYZ A;  2Z58 B;  3TVZ A;  4J9Q A;  2BEF A;  3B6B A;  1RCX B;  4OYA A;  2HQG A;  3UE2 A;  1Q86 T;  1L3S A;  4A8M P;  5KFI A;  2UUC J;  4PQU B;  3IAM 9;  4CLT A;  1S76 D;  1OY6 A;  2ROP A;  2ZZT A;  4F4X A;  2NSC A;  3LAM A;  1DLO A;  4MMO A;  2YBV A;  2PI5 A;  2IBK A;  4EI2 A;  2BXJ A;  2DRA A;  4QPT A;  3O8W A;  5K8M A;  3UVJ A;  2R8G A;  4A8K A;  3PX0 A;  5F3Z A;  4Q8F A;  3BO4 A;  1EB0 A;  1WC0 A;  4LIW A;  3L4B C;  5B0G A;  1NDC A;  2XMW A;  2F63 A;  1YRU A;  5KT7 A;  2X3D A;  3MMC B;  2NR0 A;  1FRM A;  4WPA A;  4NWB A;  2H4Y B;  2KG0 A;  1T7P A;  4PPZ A;  3Q83 A;  1LW0 A;  1OO0 B;  1T9V A;  2Y0S D;  3SCK E;  1TAU A;  5J1E A;  4OHY A;  2CDR B;  4KE5 A;  5A6P A;  3EJM A;  1T3N A;  3R5B A;  1UFW A;  1RTI A;  1SKU B;  1VR6 A;  2R2U A;  5ETT A;  4J91 A;  3LGH A;  2KRB A;  4O0N A;  2NYI A;  3AOA A;  4PUO B;  2YKM A;  5D4O A;  2D1C A;  2GVD A;  3WX4 A;  3CUN A;  1D8Z A;  5C42 A;  3GIK A;  3PJW A;  1KLM B;  3BEG B;  3D6F B;  4M5D A;  2MPU A;  3VGV A;  3MM7 A;  4A46 A;  2IJN A;  2V8H A;  5F8G A;  4BWJ A;  1HHS A;  1OJ4 A;  1PYT A;  2QA4 S;  1VQM S;  4DUZ F;  3NL0 A;  3J81 j;  1Y3J A;  5CYM A;  2Y0B B;  4A8Q A;  4YB1 P;  2HND A;  3KG1 A;  1R7I A;  4NCG B;  1G6B A;  4O3O A;  4ZVS B;  1KR4 A;  2FC8 A;  3A1Y G;  2AEJ A;  1VHF A;  2VC1 A;  5IM0 A;  4WII A;  4RW4 B;  1G4C A;  2FZC B;  5GAE I;  3MOJ B;  2UXD J;  1JX4 A;  4LF8 J;  1WOO A;  5GAH I;  4WE1 A;  4CDI A;  2ZWP A;  5C5J A;  1XNR J;  2IA6 A;  3M6W A;  3HUL A;  4KGK A;  4CZC A;  2LLZ A;  1F9F A;  5HVH A;  3MGJ A;  1IUJ A;  2VJU A;  3HP6 A;  1RAA B;  4ZLP A;  1T03 B;  4U8V A;  1RAG B;  2OSR A;  2W9A A;  3HM9 A;  2LQ8 A;  1RIS A;  4J9S A;  3R1L A;  2VQE F;  2IHR 1;  3FMW A;  4ED5 A;  3HFV A;  4RBV A;  3DOL B;  1CJT A;  5EDW A;  1JLG A;  5D15 A;  1SUQ B;  4L3N A;  1F1B B;  1SQF A;  2G9O A;  4WCE Q;  2PT0 A;  1YJR A;  3ETM A;  4NZ7 A;  4IO1 A;  3MHY A;  5DM6 Q;  2MQL A;  4ECZ A;  1M90 T;  1LFW A;  2VAS A;  1JIH A;  2AYG A;  2QIF A;  2NRE A;  2KFN A;  2BJ8 A;  2RKI A;  1XMQ J;  3QSY B;  3LAK A;  5GAH U;  3EGN A;  1B0V A;  3KLF B;  4OJ3 A;  1WHV A;  3KK2 B;  1WKJ A;  4A8X A;  3DXS X;  3MUM P;  1LNQ A;  2AJQ A;  3KLI B;  3IRW P;  5GVQ A;  2ZBC A;  3D1O A;  5HJX A;  3D0G E;  3C14 A;  4PEO A;  5LMU F;  1Q5Y A;  1IBC B;  3MM5 A;  2FDN A;  5KFF A;  3HVT A;  3Q8S B;  6AT1 B;  1R6Y A;  2WVF A;  4CLK A;  2AJ2 A;  4U8Y A;  2BKP A;  1ROF A;  5ETN A;  2DCU B;  2DHS A;  3DXB A;  2E1M C;  2XMT A;  1LFP A;  3IMQ J;  1DLO B;  3SCI E;  1QAJ A;  2W7O A;  4ZA1 A;  2RQ4 A;  4B3R J;  2NXC A;  1RWP B;  3DYA A;  2QL9 B;  2D7S A;  3O44 A;  3TVK A;  4JUZ A;  3U27 A;  3UVJ B;  4B9T A;  2F9J A;  3T19 A;  2DO4 A;  2WAQ D;  3UN2 A;  1UW4 A;  1RWK B;  2RQC A;  5D0G A;  2M52 A;  1C0T A;  3EMT A;  3VZH A;  1VQN S;  4P2M A;  3EYZ A;  1LW0 B;  3W5Z A;  2XMU A;  4GC6 A;  1UZH A;  1BGX T;  5J1E B;  2F40 A;  2HS4 A;  4PG4 A;  1RTI B;  4FKX A;  1N36 J;  4JI8 J;  3KDO A;  2FJA B;  4NLO A;  4L3K A;  3R9L A;  1RZM A;  4R0E A;  2GVD B;  2HHH F;  3VAH A;  5C42 B;  1IWA A;  3C46 A;  3MM7 B;  5AT1 B;  3PW2 A;  2Z30 B;  3D6H B;  1REV A;  3I4P A;  2UVU A;  1BXN A;  4W4M A;  5CYM B;  4WFN Q;  2YPY A;  2BDP A;  4K2J A;  3BF4 A;  1DQ9 A;  2HND B;  1RHQ B;  1NKC A;  2NYH A;  1FXL A;  4U67 Q;  4B3M J;  1X60 A;  3H2V E;  3DLK A;  2ROE A;  1CPZ A;  1S59 A;  1JJH A;  1V9O A;  4WFB Q;  1HBM A;  4WE1 B;  3QZ8 A;  1X9W A;  2MLX A;  1N34 F;  1NB2 A;  2HRY A;  1YIJ S;  5KG1 A;  4O44 A;  1RWM B;  3PFE A;  3LA0 A;  1I94 J;  1R3N A;  4DF8 A;  1LWF B;  2KVQ E;  2PII A;  3KLH A;  1EET A;  5LSR A;  2FHK A;  3PYG A;  3NP5 A;  4C8Y A;  1QAY A;  4DV5 J;  3J81 U;  4DSK A;  3Q2S C;  2ZZM A;  3DOM A;  1IVZ A;  3AXM A;  4JBC A;  1SI9 A;  1CJT B;  1JLG B;  1X31 C;  2CQ3 A;  2NQP A;  5LXR A;  2EFN A;  2H5E A;  3D66 A;  2DB1 A;  1VOM A;  3KLE B;  2A2D A;  2H5I B;  1UJ5 A;  4P2S A;  1RTJ A;  1UTA A;  2DTJ A;  2R8H A;  2YH0 A;  2X1B A;  3AOD A;  1HNW F;  2ABY A;  4P10 A;  4P74 A;  3N9U C;  1TKT B;  1FHT A;  2G0C A;  3M9M B;  1T9Y A;  2B51 A;  2UXC J;  3BB5 A;  3HFK A;  2CQI A;  3EVO A;  2IMO A;  5E3R A;  3BS9 A;  3C6T B;  1IM4 A;  3RAX A;  4DPT A;  3SDE A;  1HQU A;  5E3P A;  5AXK A;  3EDR B;  3RR7 A;  3GIL A;  1CSJ A;  1WHY A;  3K5L A;  3HD2 A;  3K0J A;  1U6B A;  3CJT A;  1FXR A;  3ENA A;  3VHQ A;  2GV1 A;  4J5O A;  2AV5 A;  3R5G A;  3H40 A;  3SQO P;  1UZD A;  1LW2 B;  3C14 B;  1SKR A;  1GX6 A;  1D1U A;  3MM5 B;  5BYQ A;  1X4H A;  1G7C B;  3IM9 A;  3HVT B;  1EKR A;  1YQH A;  4AQY J;  4MFB A;  4OJ1 A;  3SZ2 A;  1FDB A;  4Y2I A;  4DZ6 A;  4C97 A;  1NM2 A;  2FY8 A;  3QJJ A;  3HD1 A;  1S9E B;  3VAI A;  3F73 A;  3N28 A;  3DYA B;  4LF4 J;  3SYZ A;  2XMM A;  4C8L A;  3FSI A;  2VG7 B;  4E0D A;  3RW6 A;  4B9V A;  1I3O B;  4DL2 A;  3ZNU A;  2QA2 A;  1S7H A;  2ACM A;  1FXD A;  2JH3 A;  1C0T B;  4LFA F;  2A10 A;  2ZOG A;  1TL1 A;  2P5V A;  3QMQ A;  3HLU A;  3T1H J;  3FSY A;  3UI3 A;  1CG2 A;  5IWA F;  5JJB A;  2EEY A;  4ELV A;  3CUL A;  3JS9 A;  5KG7 A;  4X4O A;  3UFC X;  4P7V A;  1GTH A;  2V4J A;  1NK6 A;  3CXC R;  2RVJ A;  3PRV A;  1D9A A;  3OT9 A;  1RT5 A;  2AHO B;  2IFX A;  2WB1 D;  3K89 A;  4ECR A;  1WTF A;  3JAM U;  3W2W A;  3M8Q A;  4C0B A;  2DO0 A;  2YWH A;  1Z2Z A;  2BKO A;  3Q0A A;  2QN6 B;  3CCU S;  2N4D A;  4F8R A;  3BGR A;  2DIT A;  4Y65 A;  2R8I A;  1GFW B;  4USJ C;  1HBM B;  4M5J A;  5J2M A;  1RA6 A;  2DXD A;  2XCA A;  4O44 B;  1Y5I B;  4UQG A;  1SJ4 P;  3VAG A;  4NA3 A;  4ZOS A;  4ZK7 M;  1RTH B;  4DMZ A;  1MU2 A;  4MAK A;  1IBL J;  1R8P A;  3T9Z A;  2XG8 A;  4ED4 A;  2FGC A;  2LFV A;  4D3H A;  4DV0 F;  3KLH B;  1EET B;  1S6O A;  2OP5 A;  2I2Y A;  2J9D E;  2BQR A;  5RUB A;  5GAG I;  2XO6 A;  2YWK A;  1WOP A;  2AYB A;  1S6U A;  3N01 A;  1EX8 A;  2WW4 A;  1X4B A;  2HBY B;  3EWG A;  2B3T B;  3AQP A;  5LM7 E;  3EX7 B;  5DRK A;  4J7C A;  3R3T A;  4HT7 A;  1XR7 A;  5CAA A;  3MPV A;  4NLP A;  3V2U C;  2NS1 B;  2KJV A;  1RTJ B;  3RBD A;  3CCT A;  1DZ5 A;  5CYQ B;  4WWS A;  1HD0 A;  4X65 J;  3DCA A;  2E9Z A;  1TZ0 A;  2BAN A;  3MFH A;  1Q4R A;  3ET6 B;  4ES1 A;  3AB4 B;  2E5L F;  4X4P A;  1QVF R;  4GO7 X;  3SDE B;  1HQU B;  1SC4 B;  3CME S;  2CVI A;  2XC9 A;  3T1Y J;  3QGI A;  3DLB A;  2Z2Z A;  3RG6 A;  4CRJ A;  3RB3 A;  1W7W A;  5ETM A;  1DJ0 A;  4QIV A;  1QSL A;  3RAM A;  3HHE A;  1UWB A;  2YY3 A;  1VQ4 S;  2H48 B;  1FCA A;  2U1A A;  3JB9 k;  1XNQ J;  4ECV A;  1XTZ A;  3QAE A;  3QID A;  2WON A;  4EYH B;  3OL9 A;  3GJS B;  2RQM A;  2RRB A;  4MFB B;  2RS8 A;  3VZI A;  1SC3 B;  1S72 S;  4ED8 A;  1URN A;  3OFF A;  1HMV A;  3PYD A;  3CJ2 A;  4TN2 A;  4LQ9 A;  5K5M A;  1HI0 P;  3GYX B;  1HNZ J;  1UL3 A;  4UQT A;  4LVN P;  1HWJ A;  5KG6 A;  5E3C A;  2QMU B;  3R5J B;  3U1M A;  2CUY A;  3MEC B;  3HSJ A;  2AF6 A;  4X4U A;  1IR2 A;  2XLI A;  2BA9 A;  1TL1 B;  4LQ3 A;  2EFP A;  2RS2 A;  1Y5L B;  2YX7 A;  3JTP A;  2P8I A;  4DV4 J;  2CNN B;  3W65 A;  2R2S A;  4YDX A;  1N4L A;  3DGV A;  3I0R A;  3IBW A;  4DHV A;  3DNC A;  2R9L A;  1ITP A;  2V4J B;  4I6A A;  2UXB J;  1UFL A;  1T9X A;  2N3L A;  4DR5 F;  3KNA A;  2B7B B;  5DDP C;  2J9D A;  2CQC A;  1RT5 B;  1RJJ A;  1RXO B;  1C4A A;  2ZDO A;  5K20 B;  3M8Q B;  2RRA A;  1J27 A;  1N56 A;  4K50 A;  3QAT A;  3G82 A;  4F2S A;  1I51 B;  2X51 A;  1VI7 A;  4OLP A;  2JEI A;  3BGR B;  2BV3 A;  3P96 A;  2V50 A;  1JJ4 A;  4OMF G;  2FVS A;  2YH1 A;  3WIU A;  1KFD A;  1X4C A;  2LP4 A;  2WTF A;  1S4E A;  2HK3 A;  4DL5 A;  2UZA A;  4OHZ A;  4XAK A;  5F9N A;  4F4Z A;  1HBN A;  1MU2 B;  4UZB A;  5D3G A;  1WEX A;  1RBL A;  1IJF B;  1X4D A;  3TAQ A;  4DX7 A;  4UY8 T;  2D74 B;  4YME A;  3MMA A;  3RZA A;  1V3Z A;  3QNW B;  4IQM A;  4RX6 A;  2LU1 A;  5KFZ A;  3UCU P;  1VC5 A;  3ZTR A;  3OJU A;  3A8K A;  1X4F A;  2NPI A;  4IOC Q;  4NLG A;  2R8J A;  1MN9 A;  5BYR A;  1LK5 A;  4Z7C A;  1HA1 A;  4DL7 A;  1SXL A;  1FE0 A;  1VBZ A;  4L76 A;  2PFD A;  5ETP A;  2QE5 A;  3CWJ A;  2KHC A;  4LSL A;  3DM2 A;  4L75 A;  3IXQ A;  3QT5 A;  1Z1Z A;  3FSX A;  2P9E A;  4N77 A;  2OPQ B;  2WVC A;  2JNJ A;  2BAN B;  3D3C J;  3T3F A;  2W4D A;  4LF7 F;  2CA9 A;  2ATL A;  2G1H A;  3M30 A;  4DSL A;  3H2L A;  4ALZ A;  1KQG B;  3MCS A;  3MCO A;  1Y9O A;  3GYN A;  2HAF A;  5FII A;  2CJK A;  1UWB B;  3CDA A;  2MQ8 A;  5EX0 A;  1EZZ B;  2UXD F;  3VGU A;  2CZ4 A;  4OI1 A;  4USM A;  3DRS B;  2N4C A;  4URG A;  2F8H A;  4W98 A;  2KDO A;  2WON B;  4KHP J;  4Y2A A;  4QR0 A;  4PKD B;  3KDN A;  4IH6 A;  3HXM A;  5E33 A;  4DV3 J;  5B0D A;  3PRD A;  2KI2 A;  4Q0B A;  2DT9 A;  3PFO A;  1FWK A;  3BKU A;  1HMV B;  4KFB A;  3JTN A;  1RBO B;  4K5R A;  1KP6 A;  3TAR A;  3MOZ A;  1KON A;  4AND A;  3HKW A;  3ILO A;  4PXD A;  2JEG A;  2KJW A;  3HHN B;  1NSA A;  4WK3 A;  3M05 A;  3A13 A;  3C6U A;  1P27 B;  1ZYQ A;  2CYY A;  4IKA A;  3QSI A;  4FN5 A;  4DS5 A;  1MWZ A;  1B7Y B;  1QDU B;  1GK8 A;  4OZ3 A;  1X9S A;  3OUY A;  2HBQ B;  2M0G B;  3NCP A;  4ECY A;  4C11 A;  1W2B R;  2FD2 A;  4BLG A;  4IRD A;  2Q6C A;  3I0R B;  1ICE B;  1CJV A;  1NDL A;  4DXL A;  2HS0 A;  1VQ8 S;  5J2Q A;  2BRK A;  2V94 A;  2ZM6 F;  3WHI A;  1N5Q A;  1Y7P A;  2XGQ A;  2FHO B;  3J81 Y;  1RAF B;  4L74 A;  4UUX A;  2ZOF A;  2LA6 A;  4ECT A;  4ZVT B;  1B64 A;  3H5U A;  4EO8 A;  5KFV A;  4HR2 A;  4CT8 A;  2HIY A;  4QW8 A;  4M5N A;  2DGX A;  1XMB A;  5KG2 A;  2G2Z A;  4NA2 A;  1S4F A;  1KTV A;  3G82 B;  3VAM A;  4OX9 J;  1OY9 A;  1DQ8 A;  4RPF A;  2LXF A;  3CJ5 A;  5D6G A;  3HHL C;  1FJG J;  2YQ0 A;  4ILM A;  4OFZ A;  4DV7 F;  4YFU A;  1I5O B;  4P75 A;  3OPK A;  1Q8K A;  4ETX A;  5AXN A;  3CCJ S;  7FDR A;  2GGP A;  1B7F A;  4XDD A;  4ZVE A;  1Y11 A;  4ZP9 A;  4B3R F;  3BBB A;  4DPU A;  1YJV A;  1WNE A;  4JV5 F;  5D3G B;  3GYG A;  1WC4 A;  2KTQ A;  3TW0 A;  3KOA A;  2XHW A;  4G3I A;  1CQN A;  3RB4 A;  1IBK J;  4R25 A;  1OYE A;  4ECS A;  1FRI A;  4JI0 J;  4NI2 B;  3AJ2 A;  3X3U A;  1YK9 A;  1LEO A;  2FLL A;  1NHV A;  2R7V A;  4IR1 A;  2MMY A;  1U8W A;  4BDP A;  3IA0 A;  4CLY A;  1TKD A;  4CM0 A;  1FKP A;  4KIA A;  2HPU A;  4U96 A;  1FI4 A;  2CAJ A;  1GQE A;  1RHM B;  2AEM A;  5DDR C;  3OXG A;  1EP4 A;  2IDE A;  4PRF A;  3H98 A;  2QEX S;  2ILY A;  2DR8 A;  1S9F A;  2OI2 A;  2NSB A;  1CQM A;  3DLH A;  2BJ1 A;  1CJK A;  4K4S A;  1M5S A;  2GCF A;  2QTW A;  4DSI A;  2EBG A;  3KNG A;  2IC3 B;  3VGS A;  1U0H B;  1RYR A;  2MQN A;  4PPD A;  4CM2 A;  3SMZ A;  4G1P A;  3IM8 A;  4ZHR A;  1UJ6 A;  4D3G A;  1ULR A;  4ED3 A;  4P9S A;  5A8W A;  3I0S A;  2X1F A;  1UVL A;  3PW4 A;  4K4W A;  2V2Q A;  2NUH A;  2GIR A;  1NPR A;  2DNQ A;  2Z0G A;  4USW A;  3I55 S;  4QR2 A;  1R0B G;  4Q0B B;  2HQ3 A;  5CAB A;  3QYY A;  4URS A;  3PHT A;  4H54 A;  4KFB B;  4CLS A;  1U7L A;  3FBF A;  3JAM Y;  5HQL A;  1C0U A;  3U1N A;  3D6M B;  3QJL A;  2R7O A;  3ZO7 A;  4LFC J;  4IFV A;  3MTK A;  1A9N B;  4AE5 A;  1XN9 A;  2R7X A;  2ZZN A;  4N56 A;  3GIJ A;  1M1K T;  3V81 A;  1FEE A;  3C6U B;  3NS5 A;  1S1V A;  4ECQ A;  3ZFV A;  2CKW A;  1XER A;  1P1T A;  2VIC A;  3BQ2 A;  4F3M A;  4KH1 B;  4WXO A;  3OUY B;  4HHH A;  4OI3 A;  1RAI B;  1WKL A;  3M2V B;  4OIX A;  2FZK B;  4RUB A;  2Y8Y A;  2CQG A;  3CC4 S;  3I4H X;  4EGL A;  1VQY A;  4DFM A;  3AJD A;  3VV2 B;  1GMW A;  1CJV B;  3BGO P;  1BY9 A;  5J2Q B;  1O8B A;  1F9H A;  2UU9 J;  1HWL A;  3FJ2 A;  2E1P A;  2VQF J;  2B9Y A;  3G6Y A;  2H1Y A;  1F5B A;  3MR2 A;  3FBC A;  3AXK A;  3BV8 A;  4DEZ A;  3OBI A;  3PX6 A;  3PVX A;  5B0A A;  3Q8U A;  1VRT B;  1KN6 A;  2VPW B;  2IY5 B;  4QIF A;  2DRD A;  4F67 A;  3PW5 A;  4I69 A;  3NGD A;  5KTQ A;  3ZZR A;  2UP1 A;  2XMK A;  1BLU A;  3KFW X;  4P71 A;  2KH9 A;  2XY5 A;  2NXJ A;  2DGQ A;  4OI4 A;  3ZZU A;  2IBO A;  4K4U A;  2CPJ A;  1UJ4 A;  3MPW A;  4ZVO B;  1K1S A;  1NHK L;  2ZKU A;  2GGP B;  2FLO A;  1NU4 A;  1O0P A;  5H9F J;  4USV A;  4Z2X A;  2FJE B;  1X4G A;  3SQG B;  2IM1 A;  4A48 A;  4ECU A;  4ZPT R;  4ZIW A;  4V1A k;  2VIH A;  5GMD A;  1U1M A;  3D9B A;  5L1L A;  2J5A A;  4NLS A;  2BVZ A;  1V3S A;  4WJB A;  5T7L A;  4B17 A;  3T1H F;  4AT1 B;  1HFE L;  1K73 T;  4WFZ A;  4WYW A;  1DTT B;  4HVZ A;  5KFM A;  2MB0 B;  3JTO A;  4CCH A;  2L9D A;  2MXY A;  3ADA C;  2HHW A;  3C16 A;  1FKP B;  2DIS A;  2DIU A;  5CCM A;  1EP4 B;  2A3J A;  3Q8Q B;  2C1E B;  3GG0 A;  1ARO P;  1CJK B;  3U1L A;  4YB5 A;  1HIY A;  2BQ3 A;  3UDV A;  1T9U A;  3DLE B;  3FCV A;  5ADZ A;  3U7J A;  2ZWO A;  4O0I A;  3SXL A;  2ZJQ Q;  3B8H A;  2M3D A;  4ZHR B;  3H90 A;  2HVZ A;  3QGG A;  5I3Q A;  3GJT B;  3HSG A;  1S1U B;  5A8W B;  3I0S B;  4Y28 C;  3JYT B;  3PO5 A;  2YKN A;  1YVF A;  1UA0 A;  5KFB A;  3J7Z 5;  1LKZ A;  3KK3 B;  2GIF A;  2EXU A;  4WP3 A;  5E0O A;  4Y34 A;  4F50 A;  4QW9 A;  4HT5 A;  4ZVU B;  5F0W A;  1C0U B;  4K2X A;  1WEY A;  3QRR A;  3BQ0 A;  1RU1 A;  2HNY B;  5HMW A;  1FRK A;  1SL1 A;  2D41 A;  2E5G A;  1V3R A;  4LBP A;  4OZ0 A;  5IQ6 A;  2ZH3 A;  2H4W B;  2AD9 A;  2X1G A;  4IFV B;  3HHK A;  1NJX A;  1SKS A;  4QWD A;  4EBD A;  3V81 B;  1G3O A;  1S1V B;  1PKU A;  3R7B B;  2DNG A;  2OMO A;  2GA7 A;  1H74 A;  3M2R A;  2J7W A;  5KOW A;  4M95 A;  1ZPW X;  1S49 A;  2Z56 B;  3PHE A;  4KPY A;  2R2R A;  2BAC A;  4CLU A;  4QWA A;  3D28 A;  3QWP A;  2P2C B;  4IDK A;  1QLN A;  2WOM A;  3DGP A;  4QWB A;  3CJ3 A;  2MKH A;  2PO4 A;  2GW8 A;  4CO2 A;  2QL5 B;  3ELH A;  1Q7Y T;  4X65 F;  1FDA A;  3FKB A;  3D2W A;  2ROG A;  2BJ3 A;  3OR2 A;  1CC7 A;  2MJN A;  2J7U A;  4DR2 F;  1ZAW A;  4JI4 F;  3R27 A;  3V4M A;  5A8R A;  4I2P A;  5A2Q Y;  3HCX A;  3NXZ A;  1KFS A;  4YDD B;  2GQ2 A;  4KV8 A;  1U1N A;  1T0T V;  4DUZ J;  2AX0 A;  2VUG A;  5HMY A;  1XC9 A;  3OJS A;  2KL8 A;  1HQ2 A;  3AT1 B;  3GJR B;  1TAQ A;  2WSE C;  3N5B A;  1S1X A;  4X62 J;  5F8I A;  3ENQ A;  5KFC A;  1Q8L A;  3I87 A;  3O6Q A;  5LMN F;  2XS2 A;  2KFZ A;  1HHT P;  1L5U A;  4ANC A;  2YWW A;  1TFY A;  5LJ5 Y;  1L3V A;  3AHP A;  3M7V A;  5DO2 A;  1FKO B;  4UOC A;  3CCS S;  2QRR A;  3LUY A;  2HWI A;  3RAQ A;  1H6K X;  2IVY A;  2OEK A;  2V2Z A;  5T7L B;  5THW A;  1FA0 A;  2MKS A;  3EZU A;  2ASD A;  2V8P A;  2FVC A;  4GKK J;  4DV4 F;  4C8K A;  5JVH Q;  1IR0 A;  3C16 B;  2LQB A;  3DLG B;  4FVC A;  4BC9 A;  2EFV A;  5DG7 A;  2CWX A;  3MFI A;  4ECX A;  5L39 A;  4K0K F;  3BPD A;  2B5J A;  3NY0 A;  2IRX A;  2V9W A;  4C8N A;  2FJV A;  2B0G A;  5BJR A;  2EW9 A;  5KFL A;  1UEK A;  5KG5 A;  2CQ1 A;  3HKZ D;  3I6P A;  8ATC B;  2PFF B;  2YX1 A;  1Y0H A;  5D78 A;  4QIW D;  3VQT A;  1R27 B;  1Y3K A;  1UVN A;  3BPS P;  1VC6 A;  1K8A T;  3IR7 B;  3H0P A;  4OX8 A;  4B3S F;  2HVI A;  1RLC L;  5H9E K;  1PC5 A;  4FF2 A;  2UVV A;  2M70 A;  5LMU J;  2CPD A;  1AUS L;  2UV8 A;  3OLA A;  3BKT A;  1N32 F;  4KSE B;  3MM6 A;  3I5C A;  1RT1 A;  1XQI A;  1H0H B;  2NXU A;  2R7U A;  4NPO A;  1E6V B;  1YX2 A;  2AX1 A;  1N33 F;  4U95 A;  1QE1 B;  4WIQ A;  2BJD A;  2XMV A;  4ZN1 A;  1RT3 A;  1S1W A;  1JLQ A;  1NRK A;  2VFS A;  2VBX A;  5K14 A;  3M2R B;  2DNY A;  1PYS B;  3H5Y A;  1UVJ A;  2ZUA A;  1S0N A;  4EZ9 A;  3FCH A;  4A8O A;  3E51 A;  4IDK B;  3DGP B;  4DR4 F;  4IO9 Q;  5L1I A;  2R7Q A;  2VJV A;  4C3M A;  2DY1 A;  3NGK A;  2FTR A;  4O3S A;  5CH7 B;  3MPY A;  2KXF A;  4DL3 A;  1HLW A;  4C7Q A;  3CO0 P;  3NWG A;  5LT5 A;  4HH1 A;  1ZET A;  5A8R B;  3SV4 A;  1EAR A;  4I2P B;  1FDD A;  3H4B A;  2R7T A;  5L1K A;  5B0F A;  4MKA A;  1ZM2 A;  2R3V A;  3GMG A;  4FS2 A;  3NAI A;  4X2B A;  4KV8 B;  5JXS A;  2DH9 A;  4EBE A;  1VQS A;  1M5H A;  3H20 A;  3GFX A;  2ASL A;  5I3U B;  2FGO A;  4USI A;  2BJ9 A;  3M32 A;  4LRD A;  2NUU G;  3TA0 A;  4MT1 A;  1PBA A;  2VOD A;  1KRP A;  3HJV A;  2EG1 A;  3R6L B;  2HRU A;  1S1X B;  2HQI A;  3SIP B;  3CDE A;  4F3O A;  4J9K A;  2PSZ A;  1N34 J;  5HAO A;  1HYS B;  1EQM A;  4FYD A;  2D3O R;  2FVQ A;  1HL6 A;  2E1R A;  4FYX B;  3KXD A;  4OZ2 A;  3R7N B;  2O66 A;  4GVB A;  2VF3 A;  4Y2M A;  1IKY B;  1MN7 A;  4WXW A;  2LDY A;  4Q2L A;  2CZV C;  3LP1 A;  1R0A A;  4C0O C;  4N5S A;  2KRR A;  5KFT A;  2ZHB A;  1V5V A;  1LXN A;  1NJW A;  4J9U E;  1PJ5 A;  5KFY A;  4BC7 A;  3W63 A;  3BGF A;  4LIR A;  3GV5 B;  3FZB A;  3RBE A;  2HQD A;  4CT9 A;  1NK8 A;  5DGB A;  1HNW J;  2B5J B;  2QFJ A;  2JFD A;  2CFX A;  1TTH B;  1S1T A;  2HNZ A;  2OH2 A;  4ZVQ B;  4JYA F;  2ASY A;  1Q81 T;  2LYV A;  3ZXW A;  3GII A;  2DXE A;  4WFY A;  2WSC C;  3CJR A;  4RW6 B;  1VK3 A;  3NS7 B;  4OX9 F;  1HPZ A;  4ZJO A;  5LSO A;  1FJG F;  2ZNZ A;  2C2E A;  1WOS A;  3AY0 A;  3GSD A;  1FWP A;  4FF3 A;  2M88 A;  3ONQ A;  5KAK A;  2JRS A;  4KKO A;  2D3O 1;  4U7U K;  3KHH A;  2VBY A;  5DG9 A;  5AE2 A;  1GEH A;  3GU0 A;  1P6T A;  4CH0 S;  2BR0 A;  4GO5 X;  4WF9 Q;  2DR6 A;  2OKQ A;  4PAA A;  3A8E A;  1RTZ A;  3BSN A;  4OLO A;  2MZT A;  2RDJ A;  1XR6 A;  4XO0 A;  5T14 A;  1JLA A;  1RSC A;  3X1L B;  3DRY A;  4U9R A;  1T9W A;  4DX6 A;  2HIQ A;  4UW2 A;  3J80 U;  1FF2 A;  2WCX A;  2PMW A;  3TR5 A;  3POT B;  4FPR A;  2YNH B;  1S1W B;  3KLV A;  1JLQ B;  1HWU A;  3OFH A;  3AD8 C;  4Q45 A;  1KD1 T;  5K14 B;  4JB8 B;  5L9N A;  1WI6 A;  4EO6 A;  6FDR A;  4I2Q A;  3MAQ A;  2W2P P;  2DHG A;  3GPA A;  1RAC B;  1WG1 A;  3QGP A;  1FWL A;  4LFA J;  2LQ5 A;  4IG0 A;  2H5J B;  2RAQ A;  1JLE B;  3EXY A;  3AJ1 A;  2HLU A;  5IWA J;  3CIM A;  3L95 X;  2A0F B;  1B99 A;  3ZTQ A;  4I6W A;  1R43 A;  2M8H A;  4NX9 A;  1QUP A;  1S9G A;  3MUT P;  3QRP A;  1NCL A;  2KYX A;  2OPS A;  4CI0 B;  2R42 A;  2FPH X;  1IR1 A;  2DNN A;  2HEK A;  1A0O B;  3TNV A;  4DOZ A;  3RW7 A;  4IRK A;  1T3O A;  5DQI A;  1KWM A;  3N0V A;  4ZVF A;  1RT6 A;  3ZNJ 1;  1AZS A;  2XB2 D;  1F6T A;  2KKH A;  3HJF A;  4OYI A;  4X4R A;  2W8L A;  3DRR A;  5M2R A;  2W24 A;  3M32 B;  4NLT A;  2DCL A;  4YS2 A;  4OHX A;  2G0J A;  4XTT A;  2AWZ A;  5G4D A;  1KHV A;  4LSN A;  4PG7 A;  4DF4 A;  4PG8 A;  4ZIV A;  2UUA F;  4FZV A;  1JNR B;  3PTW A;  2ADB A;  5HVG A;  2ZH1 A;  1SIZ A;  3VAF A;  2E7W A;  1UA1 A;  4ZPD A;  1R0C B;  2JC0 A;  2XI2 A;  4KPC A;  4LFC F;  2HLT A;  2XM3 A;  4DV0 J;  1RCO B;  3VGT A;  5IFM A;  2ZNY A;  4GVB B;  1TL3 A;  1WI8 A;  2K7K A;  2F4V J;  4CLW A;  1TKZ A;  3R1H A;  3CTR A;  1FRX A;  3TQ1 A;  2XS7 A;  1N8R T;  3LP1 B;  2QLW A;  4Q5V A;  1R0A B;  2B9W A;  4W90 B;  3KHR A;  2MKY A;  1U1O A;  2JOQ A;  2Y8W A;  4RNH A;  2NCK L;  3G8S A;  1WF2 A;  3K59 A;  3LTO A;  2UU9 F;  4ID5 A;  5A6W A;  5HMX A;  4Q44 A;  4DN0 A;  1WF0 A;  3OQ2 A;  4JP8 A;  1S1T B;  3D6T B;  2HFV A;  4E2F B;  2HNZ B;  3IRX A;  1NND A;  4EEY A;  1IKW A;  4F3Q A;  4KT0 C;  1OMS A;  4RBT A;  1G1X A;  2OIH A;  1WDD A;  3UR0 A;  4O3R A;  2HW3 A;  2E5L J;  2AJ0 A;  1HPZ B;  4DDF A;  5IT9 Y;  1Q1K A;  1UEU A;  1JB0 C;  4KKO B;  5KFQ A;  1S0O A;  2FLP A;  5KFX A;  3KJV B;  2ZHA A;  3C15 A;  2Z2Y B;  2ALY B;  2E44 A;  1SQE A;  2YWG A;  1S6Q A;  4QU7 A;  4LRB A;  3C2P A;  3H8Y A;  5IS2 A;  2HHV A;  1VQ7 S;  1B3T A;  1HQE A;  1H98 A;  2AMC B;  3ISZ A;  4ZCI A;  6FD1 A;  2JVR A;  3TI0 A;  3WQP A;  3IBC B;  1GAO A;  3NGS A;  4N76 A;  3EDQ B;  3IBF B;  3HMJ G; 
#chains in the Genus database with same CATH homology
 3R2C J;  4DR3 J;  4DV5 J;  5LM7 E;  1N36 J;  5A2Q U;  4JI8 J;  5FLX U;  3R2D J;  3J81 U;  4LF5 J;  4X66 J;  4DV7 J;  4LF9 J;  3D3B J;  4AQY J;  4KYZ A;  5LMU J;  3JAM U;  1N32 J;  4B3T J;  1HNZ J;  4V1A k;  3D3C J;  4DR2 J;  5IT9 U;  4GKJ J;  4JI4 J;  1IBM J;  4JV5 J;  4LFB J;  3J80 U;  4GKK J;  4LF7 J;  4X65 J;  4DUY J;  2UU9 J;  4LF4 J;  4JI7 J;  2MTL A;  4DV2 J;  2HHH J;  1N33 J;  2VQF J;  4DV6 J;  1HNW J;  2UUA J;  3IMQ J;  2E5L J;  1IBK J;  1J5E J;  4JYA J;  2ZM6 J;  4B3R J;  4PWW A;  4JI2 J;  4JI0 J;  4DR1 J;  4DUZ J;  4B3M J;  2UUC J;  4NXN J;  4K0K J;  4DV4 J;  4KY3 A;  4RJV A;  4YHH J;  2VQE J;  3T1Y J;  2MQ8 A;  4LFA J;  2UXC J;  4JI5 J;  4X64 J;  5AJ3 J;  1HNX J;  4DV1 J;  2MEW A;  3T1H J;  2KL8 A;  4DR6 J;  4KHP J;  4DV0 J;  4NEZ A;  5IWA J;  1IBL J;  4NXM J;  1XMQ J;  3OTO J;  1N34 J;  4DR7 J;  2UXB J;  3J7A N;  2F4V J;  4DV3 J;  4LF6 J;  4DR4 J;  1I94 J;  2UUB J;  1HR0 J;  1XMO J;  4NEY A;  4JI1 J;  4JI6 J;  4X62 J;  2UXD J;  4LF8 J;  1XNQ J;  5LMN J;  2KVQ E;  4HHU A;  4LFC J;  4OX9 J;  4JI3 J;  1XNR J;  4YY3 J;  3W1Y C;  1FJG J;  5BR8 J;  4B3S J;  4DR5 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...