4ALZA

The yersinia t3ss basal body component yscd reveals a different structural periplasmatic domain organization to known homologue prgh
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
194
structure length
194
Chain Sequence
b'QLVEQEVRRLLATAAYKDVVLTSPKEGEPWLLTGYIQDNHARLSLQNFLESHGIPFRLELRSMEELRQGAEFILQRLGYHGIEVSLAPQAGWLQLNGEVSEEIQKQKIDSLLQAEVPGLLGVENKVRIAPNQRKRLDALLEQFGLDSDFTVNVKGELIELRGQVNDEKLSSFNQLQQTFRQEFGNRPKLELVNV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YOP PROTEINS TRANSLOCATION PROTEIN D
publication title In Situ Structural Analysis of the Yersinia Enterocolitica Injectisome.
pubmed doi rcsb
source organism Yersinia enterocolitica
molecule tags Membrane protein
total genus 65
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2012-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1770 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4alzA03
3GR1A 4ALZA 4G1IA 3GR0A
chains in the Genus database with same CATH superfamily
3W65A 3EM1A 3G2XA 4ZPVR 2BEFA 1CULA 3UO0A 3CULA 1SC3B 4C48A 4RW6A 4CO2A 4YOEA 3L7OA 4OZ0A 5GAHI 4DV1F 2FVSA 4ZA1A 1M0SA 3GG0A 1RU2A 4WBFA 1NKBA 1S97A 2M5YA 3TWZA 2M4MA 4LR9A 4ECUA 3ILIA 3FCWA 3CJTA 4PG5A 3SMZA 2BMBA 2EFOA 2LXIA 3TUZC 3BSCA 1FVSA 2CWKA 3D6HB 2LLZA 4LR7A 3W66A 3B6BA 2PA3A 4LMZA 1JLCB 4KHPF 1RAIB 3EUNA 3GB0A 4CLPA 4KHRA 4LRBA 2HHHF 2AEMA 1VRUB 2ZHOA 4R5PA 3W1YC 3OHAA 1D0EA 1VGYA 4TQRA 3OD2A 4RUHA 4CO1A 2VH7A 5C2GA 1SC4B 2AYGA 1RT3B 2H4WB 2DHGA 3MPVA 4LF7J 5LMNF 2XY6A 1RYSA 5I42B 1FNMA 2G1DA 4ZMMA 1Y5IB 1EIYB 2DHXA 1WC3A 2RAQA 2AT1B 1HBUB 3EXCX 4Y2KA 2YNFB 3HJFA 2RQMA 4ZJLA 1FFGB 1GQEA 4LVOP 2Q6CA 2X7IA 3CIMA 3DRRB 3LA0A 3AXKA 5KFAA 4K4XA 2DTJA 4P2SA 1UMJA 5B0EA 1ZTWA 4UTGA 3BSOA 4WK3A 4DUYJ 3U27A 5FDLB 2XYPB 1H2UX 3W60A 1RTHB 1OIAA 4J9RA 5LJ5Y 2V2VA 1NZ8A 3I5BA 3VQSA 1QY7A 2Q3PA 5HLFA 5CHCB 2WSCC 2N7CA 3L7PA 2X1FA 2EBEA 4FF2A 3DKDA 4ZVHA 2FHOB 6FD1A 1S9GB 3HT3A 3TARA 2P8IA 3VV2B 4ZVEA 2Z4PA 3HZEA 4XPEA 4I68A 5A8KA 3NGKA 1QM9A 2FJAB 5HJXA 3T5KA 4ZLPA 1DTQB 3A3PB 4LF2A 3PO5A 1RLCL 3C66A 4O3SA 1FFWB 2ALYB 1Q53A 1RT2A 3LTOA 3PRDA 3P45B 1NJXA 5HP1B 3SFUA 3BGUA 4IOAQ 4JV0A 4K4SA 2IM3A 4QWCA 4J9NA 3HHLD 4DJBA 3NEKA 1UJ6A 2CVEA 3WC2A 4ANEA 1FCAA 2BKNA 3FBEA 1HD1A 2FYXA 1MG7A 2OEJA 5E0OA 2MKKA 3PIPQ 1L3KA 1FJEB 3I55S 2HS3A 2E7WA 1UKUA 1CS4B 3ZC4A 5B0BA 5HAOA 2QLBB 5J1EB 3KDOA 4IG3B 1SCJB 4DL5A 2ZUAA 1BXNA 3N79A 1EKSA 3MTKA 1PIEA 3PDNA 4K4TA 4WKRA 3PTWA 3MOZA 1NJYA 2JLGA 5HI7A 4DFPA 5L1KA 3W64A 3GYNA 4A4JA 1JLEB 5J2MA 1WKLA 4PXCA 2J0WA 2PN6A 4NCGA 4DQQA 1U45A 1RT1A 2AQ4A 2DRAA 2ZJRQ 5ETKA 3D1OA 2HBQB 2R7SA 1X0PA 1SL2A 4WE1A 4DSJA 4UZBA 5HVFA 5DM6Q 1NH8A 5CABA 4JV1A 4LFBF 2QT7A 2ZH4A 5KT2A 1GMWA 1N0UA 4B3TJ 3DI6A 1IKWA 3MDFA 2E9TA 1YBUA 3AJ2A 1TUVA 3GJSB 3H7HB 5E5NA 1A0OB 2CQPA 4RNFA 5D4PA 4KFBB 2OPSA 4QPXA 2Q66A 2XZWA 3L3CA 4J37A 3NP5A 4LF5J 2LECA 3VZIA 3MR2A 4IOCQ 2OTJS 1UEUA 3AXMA 1KHVA 3L95X 3RB0A 2CRLA 3H0PA 3EVOA 3FEZA 1VHIA 2DNLA 1WF1A 4MIWA 3MZIA 3AY0A 2AMCB 1U4BA 2HFZA 2QO3A 4HDHA 2E5GA 1VISA 4LFAJ 4DV0F 3TA2A 3UDLA 3GTYX 3BGOP 2VKRA 2J0QD 4KRWA 4EBEA 1Q81T 3QT6A 1XNQF 4PUOB 1OS5A 3V4IA 3UN5A 2AEFA 2IMWP 2ZM6F 3I0SA 1BE4A 3V2UC 3VGVA 4EO6A 3CB4A 1HL6A 2R8HA 1K1SA 1VLYA 2E9RX 1TL7B 3F41A 4TVAB 3RB4A 5LL6d 3CO0P 2ERRA 1R27B 1IM6A 3NG8A 5LT5A 2JFKA 2IM2A 1VRTB 1I1GA 1D9AA 3BQ0A 1JJ4A 1QUVA 3NOCA 3QLHA 3ILLA 2NXJA 2AGPA 2FUG9 3KJVB 4OYOA 5AE2A 2ZH1A 4B9SA 1WHWA 4ZVRB 4DDFA 4TXSA 1PG5B 1ZM9A 2BJ7A 2CNOB 3UN3A 4N8NA 2DHSA 3ZTPA 3W7BA 1DQ8A 4LT6A 3PM9A 3AJDA 3J7A1 1FWPA 3VAMA 2KYXA 4X2BA 3VGTA 1Y7PA 3BDPA 2J8SA 3OFEA 2O5DA 5B08A 4B3MJ 1JKHB 3SV4A 1U2FA 2QJ3A 3HZGA 4ZPTR 3LP1A 1RGVA 1XR6A 2W25A 2Y3YA 4DL7A 3SSSA 2L3MA 4U7UK 4MIBA 4N7TA 2RH3A 3G82A 5K8NA 1K0VA 3ISZA 1Y3KA 5CZVA 3H98A 2N4DA 1PYTA 2CVIA 3BGRA 2VJVA 3N28A 3JAMY 2MQMA 3CT9A 4YDXA 3DU5A 3HT0A 3EWGA 4OX9F 2BV3A 3QGHA 1N33J 1S1WA 2PDAA 5F3ZA 1LXNA 2M9KA 5KFYA 2CQ2A 3J7AN 4F3QA 2IFXA 1FA0A 1SQGA 2PI5A 3LH2S 4YB7A 2ZH9A 2BJ3A 5DRKA 1S77D 2JEFA 4O3QA 1SI9A 3P96A 4J9KA 1FKPB 4LQ9A 2VF3A 1UEVA 2C28A 1SKSA 1FHTA 1OPIA 2RDIA 2BJ1A 5L8RC 1X4GA 1TFYA 2DNYA 2VKZG 1NSPA 5AJ3J 4GMKA 2AP6A 1C0TB 4DWIA 2HW3A 2R7TA 4KV8A 5KOWA 2ZH7A 1CJUA 1R7IA 1E6VB 3IO1A 1UVMA 3V6DB 5KTQA 3QWUA 3HLUA 3OJUA 3TZXA 4QWDA 3FSXA 3GIRA 3HSZA 4AQYF 5A8RB 1HWUA 1HQ2A 1P8GA 5CYQB 1GTHA 2CJXB 2LYVA 4HVZA 2YNHA 3B4DA 3QMQA 1U7LA 4M94A 3Q22A 1JX4A 2XZTB 2GX8A 1DLOB 2VBWA 1C4CA 1EHWA 2I1RA 3KDNA 4UOFA 2R2TA 3MM8B 2ZD1B 2J7KA 1N88A 5L38A 1B64A 2GGPB 4C8KA 1JJCB 2GIFA 2XMWA 3CJ3A 1IM4A 1TV6B 4L76A 3DLGA 4MK9A 2DPJA 1X4CA 1N56A 4U67Q 2XZDB 1WEZA 4P73A 3JSYA 1IKVA 2B8PA 1NRKA 3PACA 4F36A 2HHUA 2FVCA 1SH2A 2YQ1A 3SV3A 4IO1A 2KTQA 1SH0A 4I6WA 4C3LA 4ED8A 2P2CB 3A3OB 3DLBA 3BS9A 4U8YA 2L9DA 2I9SA 1L5UA 3C15B 3KLGA 1N5YA 2UXCF 4EUVA 2UXBJ 1SXLA 2HAFA 4MK7A 1T0TV 2NLWA 1R0BG 2XS7A 3W5XA 3HK2A 4IFVB 3ISNC 4M5HA 2NPFA 3MECA 3B4MA 5HVHA 4TYBA 3X3UA 2UXDJ 2HPUA 1XMQF 1U8WA 3GIIA 2MKCA 1YG0A 3R97A 1KTVA 1HW8A 1N5VA 4ZIWA 1DQ9A 3H8YA 4MH8A 1RTIA 4NYPA 1EX8A 1MU2A 3SEOA 3VALA 4KQZA 5ETLA 1QVFR 1RZMA 1N36F 2B4VA 4B3OB 2CPEA 3MAAA 3PYDA 4W98A 2E1PA 1GEHA 2HVZA 2R8GA 3L4BC 4H4MB 4BDPA 3Q8VA 3HMJG 3KHGA 2VQEJ 4J5OA 5F8LA 4CH1A 2OEKA 4J9SA 3UR0A 1VCTA 3R3TA 5C24B 4C0BA 3FVYA 3RR8A 1RWUA 3HFKA 2BE2A 3ZZUA 3WQPA 4BS2A 2KXHA 5KFTA 3C6TB 2DCLA 3IWLA 3BPSP 1AZSA 3FDSA 3GPAA 4IQXA 1Q1KA 4C98A 3KHRA 1TUGB 3QNWB 3R5DA 4ILRA 1RE1B 3RAXA 4C8LA 4DN0A 2HGLA 1CJKA 1BUXA 2DH7A 3PY8A 3I56S 1U2RA 1YJTA 3HJVA 5GMEA 2OMLA 5L1JA 4RW9A 3OW2R 1NHVA 4URGA 1DTTA 1WC1A 2VFSA 1HHQA 4DR6J 4YB5A 2GA7A 2F4VF 3TI0A 3DOKB 1NHKL 4RBVA 3LOUA 4CO4A 4NI2A 4I56A 2FHMA 3EPGA 2AYEA 2DVIA 3SCJE 2C22A 4YR2A 1VIXA 1T9WA 4JI4J 3IS9A 1RACB 1YKWA 2U1AA 3T3FA 3CW2C 3S8SA 1XNRF 5E3RA 2H51B 1QE1B 2VG5B 1NK9A 3KOAA 3RR7A 3OR2B 1X5TA 1HWJA 3EVWA 4URQU 2PIIA 3EGNA 4JI3F 4E2FB 1NPKA 1U6ZA 3CJ2A 4USUA 1IWAA 1YI2S 2AGQA 3P49B 1NJWA 2OGUA 3IM8A 2M8DB 1W25A 1VRUA 1F5AA 5CAAA 2JH3A 4DSLA 2V8GA 2O66A 2XS5A 4FNHA 3NRBA 5F41A 1X4BA 1CVJA 1HNZF 1RT3A 1SJ4P 4ZN1A 1ZZNA 2E5LJ 2DR8A 2FJDB 1HNXJ 1SPBP 4P2FA 2H4YB 2XMJA 3V81A 2HQDA 1IN0A 5HN0A 1HBUA 2YNFA 3M8WA 3OTCA 1S10A 5K8OA 3UDCA 3IXQA 2V8HA 1KBRA 1RT7B 3DRRA 2FZCB 1BMQB 1C2PA 2VC0A 2ZBQA 3UCUP 4FBTA 4DMZA 1KLMB 3LQVA 3KTQA 3G4SS 3BO4A 1PJ5A 4JI2F 2RUGA 3GZ7A 1RTHA 2ZH5A 1FTCA 3IBFB 3BEGB 1Y0HA 2JEIA 4AXIA 1S9GA 3AJ1A 4O0IA 2B6AB 1UJ4A 3THPA 1AROP 2CJAA 1S6QB 1WKKA 3D4JA 4DV6J 3AHPA 2AWZA 3HM9A 5KFQA 3GG1A 1U1NA 4DUZJ 3CD6S 1SC1B 4OV1A 1TZ0A 4CO0A 3GV5B 3E8OA 2YY3A 2JWNA 4IH6A 2AU0A 3CDWA 3IMQJ 3P6YC 1XMOJ 2XLKA 2Y8WA 3UNGC 3V6JA 2HQGA 2HIQA 2WTFA 5HP1A 3K17A 4LFCJ 1U1PA 3M2VA 5KFHA 2IYGA 2F8HA 2QSFA 4ICLB 4ZP9A 1TKZB 2I8EA 2ZVIA 2MQQA 4O3OA 2A6OA 2Y1LB 4IDKA 2RNEA 4NCAA 2FGCA 4CT9A 4ALZA 4PWDB 5JJBA 3IWNC 4X65J 3H5SA 2OPRB 1M1GA 2HSEB 2YQ0A 1RHUB 1XN9A 2HVDA 2DH8A 3G86A 2Z2LA 4K5SA 5A0YA 1DJ0A 3VVUA 4RUBA 3UPFA 1HNVB 3JSMB 2R7WA 2KHDA 1RBLA 2VUGA 1TU0B 3VAKA 3WIUA 2NXCA 4DQSA 2KZZA 4LF7F 3MPUB 1Y11A 2PGCA 2EFNA 2WSFC 2MGZB 4LQ3A 3DLEB 1PBUA 2VHGA 1ROFA 4R8UB 1HR0J 1O5JA 4EBDA 5K5MA 1H74A 1UTAA 2RQ4A 4UT4A 2XLJA 2D9PA 1JLEA 2MLXA 1B0TA 2QSWA 2J6TA 4LBHA 3KMSA 3CJKB 2DNZA 5A6PA 5MAOA 3R27A 2GIQA 2EFQA 4PPZA 5B0FA 1B0VA 2LP4A 4DPTA 1S12A 4Y3CA 2HVEA 2IC3B 2FHJA 1KR4A 2YPZA 1N4LA 2GVDA 2MEWA 4DUYF 3IR6B 2EI5A 1LWCA 2UUWA 4CM2A 3Q24A 2FJBB 4IRCA 3ENAA 4F67A 1YJUA 3GQCA 1XJWB 2V63A 4X4TA 4K4VA 3K5OA 3MCNA 3BZQA 2BR0A 2ASDA 2OSQA 2A2DA 2RF2B 4AL7A 2ROGA 3RBXA 1H7WA 1VHFA 8AT1B 1LWEB 2Z57B 2BABA 3H25A 1S1TB 4NLTA 1OO0B 2RUSA 4DG1A 2MYFA 5D0EA 4IR9A 2FZGB 1RT6A 1O51A 1PYSB 2GQCA 4WCEQ 3PV8A 1F6TA 4UY8T 2KL8A 4WKYA 3CWJA 4PYDA 4LF8F 5KFFA 2CA9A 4DV7J 5B09A 2OP5A 2WCXA 1WDDA 3FQLA 1HPZB 4IFYB 5AE1A 2B9WA 2VZ9A 3RBZA 4XAKA 1GNKA 3GSDA 4KJIA 3I0RA 1FJGJ 1DARA 1C1BB 1YZ6A 4DX8H 1IKXB 3OUYA 2WVFA 4I6AA 2YH1A 4DV3J 1JLFB 8RUCA 4CDIA 1BGXT 2J7WA 3O2IA 4USJC 2ZH2A 3K5NA 2MKSA 3CGIA 1R0AB 2XC9A 3O8WA 1VRTA 3PKMA 2OO4A 4QPTA 2IRXA 3I5CA 2MZTA 1H72C 5EHHA 2M8HA 2E1RA 1Q5YA 2K1RB 3OPKA 4C11B 1S4FA 5M2UA 1RA7A 5KT3A 2KO1A 3LGNA 1KFDA 9ATCB 3OTEA 1FI4A 1RT5A 1Y00A 2UVWA 2IA0A 1HWIA 3R9LA 3LP2B 2FLNA 1YJVA 1YGYA 4Y28C 8ATCB 2MY8A 2BM0A 4AT1B 4HACA 4U7UD 2F4FA 4X84A 1V5VA 2I2YA 5IWAJ 3QJPA 4I7FA 2ZBCA 2BACA 2MKYA 1MW7A 3DLJA 1KQGB 2BQRA 1B70B 2LXUA 1JK9B 1KTQA 2RRNA 2UVUA 2A0FB 3GCXP 1BD6A 4DCOB 3QATA 3BH6B 3OTBA 5DO2A 4LF5F 3GV7B 2BM1A 3SFGA 2CQIA 2JVRA 1Y5NB 3W61A 2AV5A 3OV7A 3R5JB 4OYIA 3NCQA 1I5OB 3BM7A 3KKFA 2L41A 3DHWC 2ZHAA 5MLCV 4EO8A 2OAUA 3MR5A 2F9JA 4O0NA 4OYXA 4F25A 2FC9A 1M90T 1FKPA 1KLNA 1D9FA 3S6EA 2HMIB 1D3WA 4WTYA 1NK4A 1NDCA 4DPYA 2OD6A 4ZJQA 2ZZNA 1C0TA 3UD3P 2V8VA 4WZQA 1K8AT 4RWWA 1NSAA 3EE3A 3MEKA 1S9EA 1E6VA 4NL5A 2JX2A 2WVEA 3WX4A 3HKZD 4OZNA 4DV1J 1R8CA 3TANA 3R5GA 2MZ1A 2HYIB 4B9TA 3GLJA 2CZVC 2HWTA 5DZ6A 3CCJS 1T11A 3SDEB 2XI2A 4LRFA 2LKZA 2E1MC 2N3LA 4NLUA 4NZ6A 1HI8A 2B5JA 4OYPA 3FKBA 3AB4B 4J7CA 3C46A 1S6OA 3PJ9A 2M2BA 4DI6A 1HMVB 1W26A 2ZD1A 3KLIB 3T5JA 2GQQA 2C2OB 2V4JA 4QIWD 4D3HA 2GGPA 1W2BR 5JUMA 1U1KA 1TELA 1HHSA 1G4CA 2HHHJ 2HNDB 2XSFA 2HBRB 4KAIA 1TV6A 2DNKA 1E6YA 1O8BA 3PR4A 4KKOA 5HL7Q 3PW7A 1BC6A 2D1CA 5T14A 4P71A 4DL2A 4B3MF 3HF5A 3CPWR 3KXDA 5LMNJ 5KG5A 1Q95G 2WRMA 1AUDA 3CVKA 1YHQS 4AFFA 1FXRA 1HQUB 4X4PA 2FLLA 3V5RA 5JXSA 5DDQC 2V69A 3JSBA 3EGZA 1N33F 3U1MA 4ECTA 3C15A 3RGIA 3R7NB 3DOMA 3J7YI 4ER8A 1U48A 2CQHA 1RA6A 5LMUF 4ITSA 3P5BP 2B8QA 1AA1B 1SKUB 2WONA 4ANCA 3EVMA 3BV8A 3GU0A 5DETA 2KG1A 3KUGA 1FXLA 4ZVTB 2F7VA 2ASJA 2CAJA 4ED7A 1RTJA 1TKDA 3HXMA 3OQ2A 4PR6A 3HHLA 4FF3A 1UETA 3B78A 5A2QU 5AJ3F 4DR3J 4DL4A 3VVTA 2BVZA 3SCIE 3KLHB 2BZ2A 2LEBA 3R5CA 4RW6B 1NEEA 5D0HA 4B3OA 2YX4A 1ZS6A 1AXQA 3HFVA 2AZ3A 4RBUA 3PRVA 3C14B 4YY3J 4OHWA 5JMNA 4PG8A 3D7SB 2ZH3A 2G0CA 1J27A 1ZETA 4A8SA 1L3TA 2EG1A 3M8PB 3T1HF 1UZDA 1TL5A 5C24A 1FWKA 1M5OC 3VWSA 3VF0B 3M2RA 4OI0A 2AJQA 1RCXB 3DOLB 3LAMA 1GH8A 3N5BA 5CD4A 1WC0A 2A2CA 2P6TA 2LMIA 1S7HA 2HIYA 4K4UA 1FRXA 2XNQA 1PJ7A 1YJWS 1B4SA 4DPWA 3M30B 1NO8A 1FTRA 3HHLC 3UN2A 4LUBA 2VICA 5JVGQ 3QYYA 3LWMA 4ZOSA 2BYCA 2MZJA 1ZOTA 5CYMA 3QWPA 1QSYA 4GVLA 2MMYA 4CH0S 2PMZD 3SI8A 3DOKA 4CT8A 1KRPA 3P3DA 3ELHA 1WOPA 4P2XA 3W2VA 1RI7A 4KHMA 2UXBF 3NNAA 4I6YA 2VQFF 4LFBJ 3SIPB 1R3NA 2OTLS 3UR3C 1FVQA 2E5JA 5KT4A 1EQMA 4WJBA 4ZPBA 4LSLB 1G6BA 2EKYA 2ZC4A 5IOLA 5KG4A 1HI1A 4UOCA 1IKYA 3UNYA 1JLBA 4IH7A 1LKZA 3GFXA 1YDLA 5K20B 2CPDA 3R1LA 2HHQA 4QU7A 3DC2A 2VB6A 3R1HA 4DV2F 4ELUA 2ZNZA 4AYBD 1FX2A 5ETTA 3QAUA 2L48A 4JUZA 1RADB 3BBCA 2UU9F 4YB1P 4H54A 5A8KB 5GMKa 2DXEA 3CCLS 2IVYA 2C2RA 4O3RA 5FD1A 1WD6A 2AKWB 4DV0J 2XY7A 2DKOB 1N8RT 4ES1A 3AD8C 2MKHA 2RQKA 2MQNA 1Z2LA 2G13A 4P7VA 2ZM6J 2BW7A 5KFCA 5H9EK 4DN9A 1RT7A 1ZH5A 4OZLA 2AF6A 3H42A 4UQGA 3G6ES 1UVNA 1FFSB 3U7JA 4W4MA 2NXNA 2HURA 1KONA 2HS0A 2VL1A 4NLXA 3LGMA 2ZITA 2G4BA 1WUUA 3CJRA 3PXGa 4OI6A 3R5AA 1A9NB 3GSIA 4L3NA 3CMAS 5KFXA 3R6GB 3RZAA 3HULA 2B51A 2DNMA 1URRA 3TYTA 1RUSA 4ECXA 2V34A 4JI0J 2B6AA 1YSJA 5H9FK 5IT9U 1S6QA 1X4AA 4PZVA 3Q8QB 3WIVA 5KG2A 4NCGB 4QIGA 4F4ZA 5DM7Q 1YJNS 1HBNA 4WE1B 4RUAA 2JC0A 3DI6B 3UVJB 4A48A 2AJFE 4GRSA 1U1LA 3GYXB 4ECZA 2C2MB 2OPSB 3DXBA 4NLRA 4ICLA 1RSCA 1TKZA 1RWNB 1CJTB 1YRUA 4OX9J 5KG3A 4DXLA 1TL1B 2RIJA 4DLGA 4MMOA 3EX7B 2B4PA 4K4WA 1S57A 1VC6A 3FFIA 2YBVA 3K8WA 4PWDA 4IR1A 4F0HA 2OPRA 2MHNA 2GJ2A 3LO3A 5F0WA 2CPHA 2HZAA 2CQDA 3W5YA 3DRXA 3BH7B 4RL1A 4UUWA 3HPOA 2A6MA 4MFBB 4DFMA 4N47A 2F3JA 1HNVA 4M5KA 1FK9B 1N32F 3I32A 4WXOA 2DR9A 3CC7S 5GAGU 2E5LF 2GMJA 4R8UA 3M05A 4KO0A 3BBFA 4EGLA 2YWEA 2IDEA 4L74A 3FUYA 4OJ1A 3DLHA 4QYZK 3EGVA 1OYDA 3V4IB 3I0SB 1PBAA 4ZKAA 2QA1A 1IXKA 1X60A 3CJKA 3D66A 1URNA 4FF4A 4WYLA 3VHQA 5HMWA 4G3IA 2ZOGA 5LXRA 5ETNA 4AQYJ 1UVKA 1KVIA 4K8RA 2XS2A 1Q8BA 2J0XA 1SUQB 4I2PA 2OPQB 2YKOA 3M9OB 4PABA 3NBPB 1IVZA 3LUYA 2ILYA 2KFZA 2W4DA 1GK8A 5ETQA 2Z0GA 5HSPA 1T9YA 2FC8A 4TKTA 2CPJA 2RF2A 2VJUA 1J2VA 3H5XA 2BUNA 1LNQA 1IBMJ 1LWEA 3Q8SB 5E3PA 4ATNA 2QYCA 1EB0A 4DUZF 2J76E 3AAWB 3MM6B 1Q82T 5KT7A 4WIIA 5GADU 3JXOA 1HBOB 1QTNB 2QYGA 3LP1B 3AD7C 2ZBIA 5KFPA 4A8WA 3AT1B 4HH0A 5AXLA 2YXLA 3G82B 3TEGA 5AXKA 1PSDA 2O67A 5A6WA 3US5A 3BN4A 5KFMA 1HPZA 2ZKTA 3BGRB 5HMZA 3TZWA 4IFYA 2AJ0A 4PWUA 3MGJA 3NCRA 3I9ZA 4TY9A 1S1WB 3GIKA 1SIZA 1IKXA 3CCES 5D4NA 4X65F 2UXCJ 2R7XA 1JLFA 1VK3A 1MWQA 3FZ2A 3GWCA 5D0RA 1PAUB 4EFAC 1VJQA 4ES3A 4Q0BA 3Q8RB 3RRHA 2C3UA 2R7OA 2CPXA 1YWXA 2ZWPA 1O0PA 4LREA 1JIHA 2DR7A 2GMLA 3J81j 1EP4B 1JXVA 1MROB 2LVWA 2K1RA 1XMQJ 2JNJA 1H73A 2HFUA 3H2LA 4OZJA 3AD9C 1WTBA 5KG0A 2F8EX 4KV8B 1TK8A 5KOXA 2R7VA 2CPIA 1N36J 3FNNA 2HBZB 3LP2A 2V8PA 3CD0A 2E66A 4UQTA 4J9LA 2JLFA 5KFUA 1R31A 3KNAA 2VIHA 2MB0B 2BJ8A 3D1HA 3W9HA 5A8WA 4DCPB 1D8ZA 4DPUA 2IJRA 3DDKA 3M9NB 2ZDPA 2XQCA 4KC5A 4WK1A 1EETA 4K5RA 3F56A 2RHSB 3Q83A 2RDDA 4PXEA 3CUNA 1R0CB 3H90A 3OHBA 2V50A 3KLEA 4QIFA 1QJHA 3A8IA 3D6FB 4NLSA 5KFVA 1VMBA 5J1NA 2RMLA 3DLGB 1IBKJ 2NYHA 2W4CA 2VPXB 1ZPWX 2J6UA 1YTYA 1U6BA 4PXBA 5D77A 3V4MA 2QMWA 5G4DA 2ZHBA 1LK7A 5J2NA 2KI2A 1N52B 4OX8A 3U1NA 3ZXWA 3LWLA 4B02A 4DV4F 2O01C 2HK2A 5F3TA 1NM2A 3VQTA 1YIJS 1RAJA 4LSNA 2F4VJ 4KY3A 2AJ1A 3KHLA 3RRGA 5ETOA 3VAFA 2XMUA 1KOOA 4YUDA 2KU7A 3OR1B 4KGMA 2R9LA 1IJFB 4DV3F 3BF4A 1X4FA 3K59A 4I0WA 5KFGA 3QO9A 3J81Y 3SDEA 5HROA 2GNKA 1XNRJ 3FRYA 3CCRS 7AT1B 1RLDA 1YVFA 4USIA 1TK0A 4M5JA 3EGWB 2FPHX 2V5HG 2PMHA 1WACA 4JI3J 1YBTA 5C42B 3HI9A 3W8GA 1HMVA 4ES2A 5IFMA 3DDIA 3FJ2A 2Y0BB 1BQMB 5F8IA 1KHWA 2Q1LA 1NZAA 2DGQA 2FDNA 4RW4A 4JI8F 1MU2B 4P7TA 2QEXS 1RWXB 3MHYA 2W2NP 3MMAA 3C6UA 3AQOA 4EBCA 1NK8A 2EVZA 4LBIA 3MAAB 4DF4A 2NXUA 1CG2A 2E5HA 2ZFHA 1HNZJ 3QBCA 1HWKA 1N34J 1CEZA 2ALZA 4ELTA 1VC0A 2AW0A 2YQ3A 1JB0C 2HLUA 5EX0A 2DK2A 4NWBA 1RTDB 4GKJJ 3DN9A 3DDNA 4OQJA 1RABB 3KJFB 2BE2B 4R0JA 1RAHB 1I6JA 3GR0A 3ULHA 5K9FA 2CQ3A 1QLNA 2K7KA 3FBBA 3AH6A 1F9EB 1Q16B 2M52A 4F2SA 4NLVA 4CNZA 4FVCA 3I31A 2GZOA 4BBYA 3BKFA 3D0GE 4F4AA 2E9ZA 1RJJA 1S79A 4OHZA 4ZCMA 2CG4A 4RW9B 2XM3A 3Q2SC 4B17A 3UI3A 2E29A 1F3FA 2VBYA 4X4SA 1VQ8S 2K7JA 1KQSR 3KLHA 4M63A 2OUGA 3ETMA 3PX0A 4ZVUB 3I87A 2HHVA 2AHOB 3KUHA 2E44A 2B4UA 2Y9HA 3NAIA 5J2QA 4CLZA 2EG2A 4NI2B 1ZZFA 3WX8A 4O4GA 3M2UA 4M5DB 2X1GA 3C14A 4OYMA 4ZP7A 3JYTA 4DHVA 5F0UA 3G8QA 3M8RA 1HNIA 2G0JA 5K14B 3IS9B 1EJ7L 1T95A 2L9WA 4URSA 1FERA 3SCKE 3M8PA 2Y0SD 2K06A 3LF0A 5HATA 2PMWA 3BDEA 4RNOA 3HHNB 2RILA 4DL0C 2HLTA 2XMVA 3DYAA 3DOLA 1UW4A 1NK7A 2B9XA 1Q78A 2LDIA 5D4LA 1ZAWA 3QPIA 1XC9A 1XEZA 2FZKB 4QW8A 2NR0A 1BQXA 1HHTP 1B3TA 3KK1B 3M30A 2W7OA 4YEAA 4CTAB 2HHTA 5BYQA 2ZZTA 2NREA 2ABYA 4MYTA 3V6KA 3ZTSA 2KT3A 1R8PA 2ZC3A 2XI3A 5AT1B 1GX5A 1GTEA 3THVA 1X5SA 2QE5A 3V81B 4OZ3A 5A76A 5DZ7A 2DNQA 3OL7A 1IR2A 4WWSA 4BHQA 3LP0B 2Z30B 2HEKA 4QWBA 4UZCA 3RAMA 4DU7A 3PVXA 4CZCA 2Z8QA 2QG9B 2LA6A 3RB3A 2OKQA 1GX6A 3OXFA 4L6V3 2AJ4A 2V9KA 2R2UA 4WTOB 2XNRA 2CPFA 4ZP8A 3ZNJ1 1WG4A 2J7UA 1HBMA 4C8YA 4KPCA 4LSLA 4A8MP 5IM0A 4QIEA 1S1XA 3C8YA 1P1LA 1S0NA 1IJEB 4DR3F 3MMCA 2KDOA 1DHMA 1QUPA 4ZLJA 3LPEA 1NPRA 2E7XA 3RBDA 1B99A 1P9YA 3ZNUA 4UOHA 4DBQA 5AE3A 2DJWA 5F8MA 1PYOB 2DHHA 4FZVA 1S0VA 4YY3F 2EC2A 2M3DA 4USWA 2HAIA 4RW7B 1SQFA 4W90B 4IKAA 3K8VA 2CJYB 4LF8J 4JI7F 2XO7A 2LCWA 4ZCIA 4MYUA 2XG8A 5L1IA 5BXIA 1FE0A 3M2VB 2XWYA 4JV5F 5I4MA 3ISND 4M5LA 4IDKB 4YN3B 3M6UA 2CADA 5AXNA 3QRRA 2CQ0A 1EAYC 2UVRA 4M5IA 1FKAF 1FRMA 1NJZA 2X3DA 3BGLA 4HI1A 3NCPA 3DRSB 3BKTA 3CCUS 5A0YB 1P6TA 5IQ6A 1HLWA 2LA4A 5LOQA 4F0MA 2W1BA 2NUHA 1LFWA 2RS2A 4Y2CA 2DR6A 4OYAA 4G65A 5ADZA 4GC7A 1OYEA 1VJWA 4C3KA 4CLYA 2GJFA 4NYZA 1HW9A 5IQQA 5KFJA 3I9V9 1RWOB 4DV5F 5HVGA 3T6JA 3R6LB 2YWHA 2YH0A 2HG4A 2BA9A 3IG1A 2H1YA 3T19A 3NAHA 3SYZA 2FVPA 3CCWA 1IR0A 2BE7D 4F3OA 2BDPA 2UV8G 4OMFG 2Q79A 2IDLA 3UVJA 2IVMA 1S1UA 5EWFA 2M70A 2LDYA 1FRIA 2GVDB 2DNOA 4IG0B 1LWCB 3K5PA 4WPAA 3L9ZA 4Y2IA 3TOQA 1M1HA 1ZTTA 2XEXA 4HKQA 1CJTA 4JI6J 3T9ZA 4YHHF 3FSIA 1TL1A 4YP3A 3S01A 2HFVA 2G1HA 5HQLA 5E33A 1SJ3P 1NSKL 4PAAA 1UVJA 4MFBA 5IT0A 5ETSA 1ZA1B 4FS1A 4K4ZA 1RWMB 4OJHA 4OI2A 1RWKB 4U7CA 4DG1B 3G8SA 2CG8A 1V5IB 1FK9A 1RT6B 1QVGR 3DRPA 5HMXA 4H4KA 1M5KC 4F3MA 2YKMB 2IHR1 4KGVB 4EYIB 3MXHP 5KFKA 2XO6A 1SJQA 2B9YA 2AYMA 2CFXA 1I94J 4MJKA 3JQJA 2OEMA 2Y1RI 1VQLS 1WWHA 3B82A 4HI2A 4EYHB 1Q0NA 4ZCLA 4PKDB 2NPIA 3I0RB 1PO6A 3QRPA 4KYZA 5IC4B 2N4CA 2D69A 3OUYB 2HBYB 4RNHA 2CYYA 3RAQA 2HQIA 4Z7YA 2CZ4A 4CLWA 3MI7X 5U47A 1WJ9A 4DZDA 4PG4A 1SUQA 2OPQA 1BWVA 2BKOA 5ETMA 3NBPA 4YQWA 1RHMB 4FDFA 5G0RB 3CCVS 3IWXA 4FPRA 1CC8A 4JBCA 1V3RA 2CUYA 2FY8A 3L09A 3OFHA 4IUFA 2DGTA 3D6TB 3FZBA 1VQPS 3TJ9A 4JI0F 2UZAA 1RT5B 1BLUA 2K3KA 3UE2A 1DAXA 2WVDA 5FLXY 2VPZB 2HFSA 3A13A 3MM6A 4H4KC 1X5OA 2PFDA 1SJRA 2UUTA 4MKBA 4HACB 4BC9A 5D0GA 2ADCA 1HBOA 2DY1A 3ITHA 3JAMU 2E7VA 4I7FB 2DIUA 1N5SA 2GS8A 1N48A 4K59A 3QAEA 1WKJA 3LGHA 4MK8A 1DRZA 4FP9A 3KG4A 2B3TB 4DZ6A 3HO1A 3N6NA 5KG6A 3BO3A 1B0PA 2CJKA 3NGRA 1HKAA 2R7UA 1RTZA 2WSEC 1NDPA 5LMUJ 3NS7B 1WHYA 2XYHB 2JHEA 3M4XA 3CSKA 3TJAA 4OYBA 3D2WA 2OIHA 4P6QA 2DO4A 3WC0A 2RD5C 1B7FA 1U09A 4ZVFA 1D1UA 1FDAA 4CLSA 3PRBA 5C5JA 2ZBPA 4Q8FA 1EP4A 3HVAA 4B9UA 1MROA 4JOUA 1FD2A 2DNPA 2OJ3A 3HHDA 4A8FA 4LBPA 1NBEB 1HA1A 4YMEA 4WFNQ 1FRKA 2J5AA 5J1PA 1S9EB 2X3GA 1U26A 2JDJA 4QJVA 2DGSA 2JLEA 2ATCB 3MMBA 3CJSA 3I5AA 2KRRA 1HARA 4LRCA 1WC5A 3FQKA 3H2VE 4JYAF 2HZVA 3JTPA 3CF5Q 4QYZJ 4TN2A 1WG5A 2WOMA 3NWGA 3S7RA 3DGPA 3T1HJ 1KEKA 2B5JB 4ED3A 1RWVB 2CQCA 1HQEA 3ILOA 3NS5A 4G1QB 2KT2A 4WF9Q 3SQGB 2B0GA 2BOAA 2Z2YB 1FJ7A 4N41A 2FVRA 4JB8B 3QGPA 3F0NA 2GJIA 1ZBTA 2VA2A 2LQ5A 2V4JB 1APSA 4IO9Q 5J2PB 2HWIA 2VU5A 1REVB 5B7WA 1IBMF 1E6YB 1J5EJ 4KKOB 3HCXA 2HQCA 2P6SA 1NDLA 2N82B 4CP5A 5C25B 5HANA 1VBZA 4ED2A 2MSTA 2QMXA 1N5QA 3MD3A 3JSRA 1XTZA 1NK5A 2IJFA 1T94A 1S9FA 1U24A 2HFNA 2AX1A 3EICA 3QJJA 1Q8LA 4K0KF 3T5HA 3Q23A 2UUBJ 2KXFA 2RDJA 1XQIA 5DJBA 5F9NA 3ZZTA 2C1EB 1RAOA 3E3XA 1VOMA 3OR1A 1GXUA 3AA8A 1YJRA 4X4RA 2I6WA 2HRTA 4N5SA 3U1LA 4C9DA 3DOMB 2H9ZA 4NYOA 2KJVA 3T1YF 4AL5A 4IOBA 4LRAA 2LU2A 2VQFJ 3PYFA 2KM8C 3NS6A 3W63A 2WONB 1YJ9S 4B9VA 4CLUA 4I2QA 4ED6A 1QAXA 4TLRA 4TU9A 1J5OB 3W62A 3TX0A 1V9OA 2W4PA 4WXWA 2FY1A 2IY5B 3JQKA 4LF4J 5C42A 1RTJB 3HHLB 5F8JA 4CWBA 3AOBA 4LF1A 2R2SA 1BQMA 4TU8A 4RJVA 4J9VA 1WHVA 1AFJA 4TY8A 1Q4RA 1K1QA 4DV2J 2ACYA 4KB7A 3MR6A 2WBMA 3IRXA 3MEGA 2ZZMA 1DY3A 2D3UA 3LANA 4DS4A 2GQ2A 2UU9J 2RT3A 2IBKA 4DX7A 4MTPA 4P2MA 1CJVB 2GVZA 5E41A 3K2YA 2C2ZB 1RWWB 4OIXA 1LFPA 4TU7A 4C7QA 4A46A 5IV3A 1TAUA 4WYWA 5DGAA 1X4HA 1PAEX 4X64F 5ITHA 2CQ4A 2KYZA 1H38A 1VLOA 2HNZB 1RTDA 1LW2A 2VG6A 2KVQE 4HYKA 2VFUA 4Y34A 2DNGA 4DR5F 3M2RB 2F8MA 1RAGB 1MMNA 1ACMB 2MKJA 2ZWOA 2X1BA 1T03B 4DR1F 3RRKA 1RAFB 4IRKA 3OLBA 2QMUB 1SV5B 4HR2A 3K5MA 4R0EA 4FXWA 2IBOA 3J80Y 2ZVSA 5LSOA 3NMAA 1IBKF 4PG7A 2CIMA 3OFFA 4DSFA 4DR4J 3GFYA 2I5JB 2QL5B 1Y10A 4CIOA 2XLIA 3QIPA 1WI8A 4FYXB 4A8XA 3EYZA 1F2HA 4KH1B 5CYMB 2QX0A 3ENQA 4AD6A 2FVQA 3SCLE 3M1VB 3T5LA 1NDKA 4JI1J 1TKXA 4B9NA 3KLFB 4ZJOA 5K8PA 2FJVA 4FVMA 2H48B 3PYGA 1XIQA 1S0OA 4A8YA 4HLBA 3W2VB 4P10A 1AW0A 3RBEA 1IQTA 4ZS6A 1BWEA 3GCWP 4M5DA 2WVBA 3TRGA 1FRHA 2A3JA 3DLLQ 3NOGA 4B3SF 5K14A 4J9UE 4RNNA 1FF2A 2HRUA 4L3KA 2V2ZA 4J9PA 1MWYA 1TR0A 4ZVQB 3FSYA 2XB2D 2CNKB 2DISA 4DF8A 2W7AA 1IKYB 1JLBB 1VQNS 1BHNA 1FJCA 2XYGB 5L46A 4ZN3A 4UOGA 3GILA 4K4YA 1U8SA 3NY0A 3HVTB 2ZBRA 3N9UC 2X51A 5AXMA 3BSAA 3KK1A 4C4WA 2AZ1A 2V4QA 5ETRA 2PE8A 4CTAA 2HFOA 2WBRA 4Y65A 5LJ3Y 2W8LA 2DXFA 1N32J 1RBAA 2KJWA 2WB4A 1KC8T 1N34F 4ED4A 4RU9A 4ECRA 2VPWB 2W2OP 1FO1A 2CJQA 3OSNA 2EBGA 2NSBA 1UJ5A 3LP0A 4GKJF 1OY9A 1UWBA 1TK5A 2IAJB 2DXDA 1QDUB 4CYUA 2HNYB 4QIVA 1TFWA 5GVQA 4EWTA 5KFBA 2QA4S 2FJWA 3G9CA 4NZ0A 1C0UB 3KK3B 4Q45A 2VFTA 2QLJB 5HQ8A 3GYGA 1U1OA 3TW0A 4X4VA 4F7VA 2MQOA 1T9TA 3PW2A 3HD2A 1N5TA 4ID5B 3NMRA 2ZJPQ 4QW9A 2BQUA 4HTIA 4QWAA 1CLFA 4OYZA 3J7Z5 2DBBA 4WZMA 2I0XA 2G2ZA 4ZVOB 2YPYA 2R42A 4NLWA 2QRRA 5EX3A 2NUUG 2VFVA 2CJ9A 2H65B 4FNIA 3FGVA 1FNXH 4K2JA 1UFWA 3HKWA 1MN7A 5K8MA 4NA2A 2M88A 5E3CA 2W9BA 1HBNB 1DQAA 2UP1A 2LQBA 5GMDA 2VASA 4KGKA 2CNNB 4RW7A 4CO3A 1U1MA 2JFDA 1S72S 1HFEL 4M5GA 1RAEB 3Q8UA 3RYLA 2GHWA 2JEGA 3EDQB 2VBZA 2FB0A 2QA2A 4XPCA 3D9BA 2MY7A 5BR8F 5GAEU 4LRDA 2DHAA 5DG9A 2QFIA 3A4TA 1F9FA 3FFIB 4NPOA 1PC4A 4ZIVA 1XMBA 1C1CB 3DRSA 2B56A 2Q43A 1JXEA 3CJ5A 4MAKA 2BE9B 3G87A 2KKHA 2XULA 5KFNA 4J9MA 3C2PA 4OI4A 2DNHA 4ILLA 5GAHU 1NAQA 4KO0B 3PR5B 2L08A 2KT5A 4NEYA 4LJMA 3K0JA 2DGVA 4HT5A 4G6VB 4OL8A 1U2CA 4FYYB 3PJWA 4QZVB 4K2XA 2YNIB 4BWJA 2RU3A 4EU0A 1R8HA 1OY8A 1RT4A 3F73A 1VK8A 5B0DA 2FD2A 1ZM2A 1WOSA 3FMBA 2Y1JA 5CYJA 4I4BA 3RU0A 3RB6A 4HH1A 3N01A 4LF6F 3KJQB 3M32B 5B0GA 4EMDA 4IG0A 3M8YA 4I2PB 1OMSA 2KG0A 1YQHA 3M9MB 5ETVA 3CJQA 4GVBB 3P8BB 2W9AA 1S5ZA 3OVBA 1BY9A 2D3ZA 3CCMS 2ZE2A 4U9RA 1U6FA 5KFSA 2J9DA 2ROPA 4HDGA 1Q8IA 4ED5A 3ZTQA 2KH9A 3POTA 2GC8A 2VOOA 5HK4A 4DQPA 2G2OA 1S7IA 5KFRA 3PFEA 3MM7B 3PEHA 4FYWB 1LWFB 3H4BA 1LW0B 1KFSA 3JTOA 2YKMA 3DCAA 4L75A 4Y2AA 1NKEA 1D9DA 2W2QP 3G6YA 3DM2B 2OFHX 4DV4J 1NJIT 2Y8YA 4LSZB 4BC7A 2OI2A 2DEIA 2QC3A 4ED1A 2WVCA 2MLYA 5DLGA 2JZ5A 4OLOA 3QSYB 4NLOA 3PW4A 2GO9A 4BLGA 3GMGA 4BWMA 3BSNA 4C6AA 1RHKB 4KGXB 2V2QA 3KNGA 4Q43A 4Q0BB 3MUMP 2ADBA 5F8NA 3PEJA 3GE9A 2B7CB 2ZKUA 3SBMA 5G0RA 1LEOA 3NKYA 2RRBA 3P5TL 4M5NA 3MM5A 3R8YA 2YNGB 3I4HX 5LSLA 3K7RA 4KGZB 1NKCA 1CQNA 3EMTA 4JI8J 3MOJB 4RX6A 4DLEA 1X9WA 3KLVA 2QLWA 3ET6A 3ICLA 4N8OA 3KK2A 1MMDA 1HI0P 2XWXA 3PO4A 2J8AA 4FPIA 1ZAVA 2KHCA 2FJEB 5A8WB 1NU4A 2FHKA 1V3ZA 4GO7X 4JI6F 3PCOB 1EETB 1RAAB 4V19X 3DU6A 1QAYA 4G1IA 1NLKL 3KLEB 2FLPA 2R8JA 4ZVGA 3FK4A 2XMTA 1P1TA 4P9SA 2CDRB 3AB2B 5D6GA 2M7SA 5D3GB 4MT1A 2PT0A 1OSDA 1ZM3A 3LALA 3IGNA 3IGVA 2PD1A 3K5LA 4M95A 2E1AA 1TVRB 4EZ9A 4UW2A 5J2NB 3TP2A 4Z37A 3MURP 3IM9A 1UAWA 3GJRB 2IM0A 1FDBA 1WC6A 1I94F 3M7VA 3W3SA 4LSNB 4RBTA 1S48A 2OHDA 4RU2A 2C3MA 3Q86A 4QR2A 3GR1A 2W8KA 1GT8A 2H3EB 4XO0A 2NCKL 2F63A 2YVSA 2KXNB 3QO9B 1FT8A 4TNOA 5HROB 4ZPWR 2C2DA 4B9MA 4ZDNA 4OHYA 3BREA 3CIZA 3D0HE 4G1QA 3UFCX 3UQSA 1WTFA 3SQGA 3IA0A 3HDSA 3MUTP 3SSRA 1IBLF 1MWZA 1F0XA 2BJEA 3PNIA 2ASLA 4O4RA 3JTNA 2JC1A 1KSPA 4CQ1A 4XIUA 3IAM9 4DUTA 2VPYB 4RW4B 2VDHA 3NNHA 5M2PA 1IWGA 5J2PA 5IC6B 1REVA 4ID8A 3MMAB 2DT9A 2IIHA 3C6UB 3E2EA 5C25A 3WHIA 4DR2J 1LWXA 3NXZA 1W2IA 1D8YA 1PCAA 4NXNF 1Q7LB 2LEPA 3M8ZA 1KVJA 1UFLA 1S6UA 4LVNP 5JVHQ 4ZLNA 4OI3A 1FDNA 2MQLA 4QYRA 3D28A 1TMJA 2RS8A 1JJ2R 1F1BB 1FKOA 1BQNB 2ILZA 1PILA 5KG7A 3NL0A 2UUCJ 3B54A 3IFEA 3MM9A 3GV8B 3OJSA 4WFZA 1FWLA 2LQ9A 1LQ9A 3BKUA 4N76A 3O44A 2LU1A 1VQ4S 3DLKB 2J9EA 2XGQA 3KG1A 1J5OA 3ZTOA 2EXUA 3ZO7A 2DD8S 1NMEB 3N6MA 2RB7A 2XSJA 3M8QB 5E3AA 1UPPA 3Q8PB 1TKTB 4F26A 1NUEA 2W2PP 4RW8A 5I3UA 1WC4A 5EGYA 4ZPCA 1PGZA 3RW6A 4NRTA 5IS2A 4YR0A 5DGBA 4FYDA 4FN5A 1U25A 3THTA 2MLZA 4RR5A 4LIWA 4I69A 2LQJA 1CSJA 4DPOA 3TVKA 2QA4G 4WFAQ 3Q8YA 5J2QB 2N3OA 3TQEA 2OMOA 4O4GB 3M2UB 2APOA 1CJVA 4PG6A 3JYTB 3R2CJ 1HNIB 2YWKA 4Y0FA 3RUBL 4PQAA 3C3LA 2DRDA 5CXTA 2HZCA 4ELVA 2PC6A 3UW1A 4JI7J 4U95A 3FBCA 4C8OA 4H4OA 2J9DE 5DG7A 2HNZA 7FD1A 2IRYA 3W2WA 4ILMA 4JV5J 1SC6A 2MPUA 3Q89A 1AUSL 1R8BA 3G6VA 4Q2LA 3DYAB 1M5HA 3UDVA 1T03A 5IV4A 2G2YA 4DSEA 1X9MA 1YK9A 1T02A 2D74B 1VQ5S 2EC0A 1Z1ZA 4O44B 4NX9A 4OV6A 2DGOA 1FXDA 2HQFA 4W92B 1J5EF 1SV5A 2ZOMA 3QRQA 1JWWA 2ROEA 3CJ4A 5DDPC 3CDBA 4ZHRB 2I5JA 4ED0A 1T05B 3ZTRA 4K7QA 3JS9A 1FESA 3QQCD 4DR7F 3DHXA 3G8TA 5M2RA 1UVLA 4C8NA 3LW5C 4DV5J 1VQ9S 3M1VA 3ZZOA 2UUBF 4NXMJ 2Y1IA 2O3DA 3KLFA 1KDNA 2W9CA 1RWPB 2EEYA 3MD1A 4S0MA 1EARA 2FLOA 1K73T 3N5FA 1MLAA 1UA1A 3I96A 3U02A 3CCTA 5D78A 4O3NA 2NS1B 3OVAA 2WAQD 3Q2TC 3KWMA 4NMXA 1JLQB 4CLKA 4Q8EA 2YWFA 1N54B 2IM1A 1VBKA 2NQPA 2DY9A 1HBMB 4LF4F 2DCUB 5IM0B 2BQ3A 1R6YA 4YHHJ 2QLXA 1T3NA 3M6XA 1S1XB 2PEHA 2VG7A 5KFLA 2G0IA 2VONA 2BANA 2XY5A 3ZZPA 1P27B 3A8KA 3MMCB 4P52A 3SSQA 4X62F 3TUIC 4USHA 1NSQA 5EDWA 2HK3A 3HVTA 1F3VA 3QSIA 4Q5VA 2J0SD 2DGWA 4X66F 2O1PA 4NZ7A 3HSGA 1F5BA 3CE8A 4LF9F 2IYIA 1F60B 3CCSS 1SKWA 1MMLA 1EQ0A 4ZVPB 4FF1A 4OZ2A 2XTJP 2DYAA 4OZ1A 1W7WA 1R43A 3CDUA 2GCFA 2H5IB 1JLAB 1VI7A 2IAJA 4ZITA 5GAGI 3AQPA 4B3RJ 2KVIA 2HNYA 5KFOA 4USVA 2QGFB 4DEZA 4MIAA 3BJYA 2P5VA 1C0UA 7FDRA 3KK3A 1S49A 1WEYA 3E01B 2E5IA 4DX6A 1FD8A 1KD1T 3BO2A 4ID5A 4DR4F 5HMYA 2XCAA 2POKA 3R7BB 3WZ0A 3ENWA 3TA1A 1JLCA 1S6PB 4L73A 3V6HA 4YS2A 1UCNA 3NLCA 1U0HB 4JI1F 1F9HA 4E0DA 4FKXA 3IG1B 4UUXA 4RNMA 3TAMB 1NCLA 2XMAA 2Z56B 3MWBA 2CKWA 3CCZA 2KZMA 1JLGB 1OQ6A 4DQIA 5KFDA 5B0AA 2AGOA 1X5PA 5I42A 1S1UB 4CLTA 4Q2MA 3AA9A 2U2FA 2QFJA 2XHWA 4FKYA 2DO0A 5DQIA 2V4RA 2F5GA 3MPWA 3PFOA 5GADI 2HHXA 2OELA 2COLA 4NA3A 1AFIA 2AD9A 3PX4A 5KG1A 1C1CA 2MKIA 2MHEA 2NZ4A 4Q7AA 4WP3A 2PI4A 2ZJQQ 4NMLA 4KT0C 2GIRA 2WZ1A 1WI6A 2DH9A 3LAKA 2C3PA 3TQ1A 5FDLA 4M5MA 3DRPB 5D4OA 4P75A 4NLGA 1JMTA 3CD5A 3MR3A 1OWXA 4AUKA 2V6AA 3K58A 3G71S 2IJNA 1K9MT 1XBWA 2CDQA 2Z58B 2YNIA 2UUAJ 4I64A 4KH0B 1CC7A 1UPMB 1XR7A 3OLAA 3UDEA 2C2EA 3DFEA 3IR7B 2V9WA 2V67A 3ENVA 3OTDA 3BYRA 2K2PA 4TQSA 3CCQS 1YLXA 2HKEA 4JYAJ 2XBPA 1HD0A 5DLFA 4RUCA 1DTQA 2HVHA 1Q79A 3BB5A 4OI1A 4A8QA 3NNCA 3M32A 1I51B 2QLFB 2OPPB 2ACMA 1GFWB 2C2KB 1CBKA 1HYSB 2AJ2A 2ZOFA 1TAQA 4GVBA 2A18A 3MEEB 3G96A 3FCVA 2DGXA 4NCBA 2GMHA 4F4XA 4CO5A 4KTQA 3JB9k 3OL6A 4OHXA 3OL9A 1R89A 2DIVA 2WW4A 1G3OA 1CS4A 2JEJA 5C2CA 1WSRA 5J1EA 2RQCA 4IG3A 3MM7A 2B7BB 3SXLA 2BJDA 1LWFA 4MKAA 1AYEA 1LW0A 4CM0A 2V94A 3ITHB 5T7LB 4KBIA 5BYSA 1QSSA 2XMKA 2SXLA 4IYQA 3A1YG 3DM2A 3DXSX 4DU8A 5IXUA 4K0KJ 4WFBQ 5T41A 1WNEA 1IQZA 2IRUA 3X1LB 3C16B 3H20A 3HX9A 1Q7YT 3GONA 4EI2A 4Y00A 2OSRA 4V1Ak 5HBMB 3OTOJ 3T1YJ 1O6XA 2XCPA 2Z2ZA 1PKUA 2RKIB 2H54B 3W9JA 4K50A 4U6PA 4J9QA 3CNQP 3O6QA 4KFBA 5KT5A 1ZM4A 3TNVA 1GMUA 2YKPA 3ZZYA 2VV5A 4OJ3A 2CZ9A 2MTLA 1WEXA 1X7VA 2DNRA 3CO9A 1CQMA 1RU1A 2QN6B 4KR0B 3TR5A 4G1PA 2YNGA 1UFKA 1NK6A 1QAIA 1KS2A 1VQYA 4QU6A 1XR5A 1X9SA 3VAJA 2KRBA 3TEHB 4DPXA 1WG1A 3MMBB 2UVVA 2VDIA 3PJXA 2YX7A 2K3IA 2VC1A 4RZRA 2R8KA 1GMVA 1DURA 1XK8A 2WHOA 2WOMB 3MTJA 2KM8B 4X64J 3DGPB 3MEDB 6AT1B 4RWXA 5C7PA 3QT7A 4PUOA 1HQEB 4JV2A 4DR5J 4DL3A 1DZ5A 2ZDOA 3K57A 1YRXA 2N7YA 4NA1A 1XWLA 1NB7A 4GO5X 4DR1J 1TL7A 4J9OA 1U49A 3QJLA 2MQPA 2KFNA 2B4OA 3K89A 1M1KT 2W01A 3PX6A 3MMJA 1RKIA 4PPDA 3UD5A 4X4QA 2WK4A 1MNEA 3FMWA 5D3GA 4USTA 2AEJA 2EKNA 4OLPA 1TVRA 3VAIA 3TAPA 2BJ9A 4B9LA 3KJVA 3N4WA 2JVOA 1TL3B 3M6VA 2W7PA 1FEHA 1HNWJ 3IN5A 2VA3A 2G9OA 2F1FA 3MPYA 5HO4A 4F0KA 1YBAA 3J81U 2C3OA 4DS5A 1XERA 3ZZ0A 1LK5A 2YKAA 2YTCA 2R4FA 5I3PA 3ZFVA 1JKHA 2RVJA 4B3SJ 3D1QA 3MCOA 4B3TF 2EPIA 4WP9A 2ZUGA 4I2QB 2MXYA 1RHRB 3WBZA 4CCHA 2YWWA 1B7YB 1C4AA 1T9VA 4GKKJ 3EDRB 1I3OB 4M1KA 4CLLA 1SB6A 4JI5J 3D5MA 3UD4P 5ETPA 5L1LA 4NOHA 4TY8B 3AODA 1FEEA 4F8RA 4RO0A 3J7ZT 3KG0A 2YKQA 2V8DA 3MCSA 3HP6A 3CMES 3IRXB 3MEGB 1IUJA 2YKNB 3H5YA 4X4OA 2ZH8A 1VQ7S 3OSPA 1H3DA 2GVZB 3N6LA 5BYRA 3G6XA 4NEZA 1SQEA 1GMWD 3VZHA 1R8AA 2GV1A 1JXLA 2HS4A 4WFYA 4LFAF 2HWHA 4USMA 4F02A 1MN9A 4NLYA 3TO8A 3OL8A 1LW2B 2VG6B 1FDDA 3DMJB 3QT8A 4O3PA 1BQNA 2LXFA 3WDOA 1TL4A 3V6DA 4PXDA 3TAQA 3D54A 1VQ6S 3D0IE 2P9CA 1SL1A 5SZTA 1RBOB 3ILJA 5EN1A 3DLKA 5L9XA 3TA0A 4AXJA 2OH2A 1N6QB 3F44A 5A8RA 1UL3A 3FC9A 3N0VA 5CYQA 4Y6IA 2H5EA 4FYVB 1FRLA 1S1VB 3CXCR 3M8QA 3W5ZA 4HHJA 1DLOA 1TKTA 1JNRB 3QIPB 5FJ4A 3DGVA 3MM8A 2EK1A 3RG6A 4Q44A 2AIRB 4KHPJ 2QL9B 1UW9A 2A10A 5BJRA 1H0HB 3RJMB 1KN6A 4DSKA 3CJ8A 2HVIA 4IRDA 1TKXB 3BR9A 4U96A 2OFGX 3DNCA 5DG8A 1OQ3A 3R2DJ 3QZ7A 1AB8A 1S59A 3PW0A 3T9NA 1YJ7A 4XK8C 2MQ8A 2LEAA 4Z2XA 3T1AA 3T41A 1FNOA 2MDAA 2AYBA 1VC5A 1ITPA 1JQGA 4QR0A 4AL6A 3OXGA 5HQMA 1RCOB 1KQFB 5BR8J 3C19A 3VAHA 4E98A 3GIJA 4NASA 5CZXA 1VQMS 1G7CB 4CH7A 3FEYB 3D3BJ 1G1XA 4HHHA 1DFDA 1U02A 4O44A 4HEA9 4WIQA 1A6LA 4I1TA 2BX6A 2F40A 1YZ7A 3FRZA 4HT7A 3HHKA 2IA6A 4IFVA 4HTJA 4EZ6A 4ZHRA 3VGUA 1T05A 4WU3A 4DR2F 2NXEA 4MKYA 1NK0A 3KYLA 3HVWA 4PQUB 1Y4ZB 1QAJA 2CWXA 1RQ0A 4PCQA 1RHQB 1GXLA 3HFZB 3IBWA 1U1RA 4ENOA 5CQGA 3NGDA 1RHJB 4CRJA 3IP0A 4F2RA 2HQ3A 2D3O1 3TUPA 2BKPA 1UWBB 1KNZA 4ZK7M 4OHVA 1CULB 5A2QY 1YX2A 4R25A 2B9EA 3A3NB 4CYUB 4WU2A 5L39A 2UUCF 2R8IA 2QZ8A 2KFYA 2YWGA 1TTHB 1L3UA 2PEBA 2VFRA 1WDTA 2R3VA 1M5VC 2CPYA 2IMOA 4H4MA 1WSVA 1JLQA 2HHWA 4EK2A 4LF6J 2QL7B 1ZYQA 2KB2A 4Z7CA 2C2NA 2PFFB 2IVFB 3PHEA 4CLFA 3M8SA 1F2GA 3QFWA 4OX7A 5RUBA 1F5CA 3EZUA 1K47A 4ETXA 3C6TA 3D3CJ 1V6HA 4AE5A 4IQMA 3PYEA 1WOOA 1QTMA 2HHPA 5KAKA 5KFZA 4R5PB 1LOUA 2WW8A 1H98A 2W9BB 2P9GA 1Z4UA 1SJ1A 3HVRA 1KWMA 5DDOC 1Z2ZA 4C3MA 2MZSA 3J7YU 2DGUA 2D41A 4JP8A 3BBBA 3A12A 2E1CA 1VFJA 3NWRA 4DL6A 2RJZA 1S76D 4QOTA 1JLAA 1UZHA 3D68A 2HRYA 3MFHA 3W9IA 3QFHA 2WB1D 3CEDA 4U8VA 3AOAA 1KP6A 4OZ5A 2NYIA 4C8MA 2C42A 3MR7A 3PIOQ 4C2MA 2W2MP 5KFWA 3E01A 3ADAC 1RK8A 1SJFA 2NZCA 5EWGA 3O1LA 3BN7A 2R2RA 1QE1A 2VG5A 2XGPA 4I67A 4WFXA 3OR2A 1SKRA 4FBUA 1OPZA 2UXDF 3IR5B 4C8ZA 5HLFB 1S6PA 4A47A 5SUHA 1YITS 1REGX 1JNZB 2GAHC 3HD1A 1FRJA 1U0HA 1RXOB 4NXMF 3IBCB 2J9CA 3TAMA 2VODA 1QD1A 3AOCA 3O5TB 1N0VC 4QBUA 3E51A 1RT4B 1X0FA 5CD4H 1NH7A 3GJQB 1JLGA 3EXYA 5EWEA 3OXLA 2ZH6A 3PHTA 4PRFA 1H6KX 2MZQA 5HJYA 4XDDA 2BXJA 2EWHA 3KHHA 2VQEF 2RSQA 1ELOA 1RT2B 2BRLA 2HGNA 1XNQJ 2EW9A 3LPYA 2GO8A 1X4EA 2IPOB 4QQBA 4F4KA 1RB0A 3JQMA 2ZE2B 1SBRA 5DQHA 2FGOA 4P74A 4FXVA 3ONQA 3CTRA 4X4UA 3MAQA 2DB1A 3POTB 5E2QA 3BQ1A 1KLMA 3NGUA 1U47A 2BBEA 1UVIA 5FIIA 5KT6A 1ICEB 3ZZRA 5H1SV 1S0MA 4YR3A 2W24A 4ERDA 3VAGA 1EZZB 3UCZP 5CCLA 2HGMA 3BQ2A 4ECQA 3FBFA 3P4UB 2ATLA 4QR1A 3H59A 3MAHA 4DR6F 1R6VA 5J2MB 3UCGA 4B3RF 4YFUA 4HHUA 5CA5A 1VYAA 2HHSA 4NRUA 3ZZZA 4J90A 1RT1B 2CPZA 2D9OA 5DDRC 2OLWA 4KPYA 5IT9Y 4V19J 3SQOP 4ECVA 4DFJA 3TVZA 6FDRA 1RDRA 4JI4F 3D6MB 1EKRA 3NGTA 1IKWB 2KN4A 1GXTA 2CQ1A 1WORA 3BYPA 2OPPA 4ANDA 2AX0A 1HYSA 1YRTA 5H9EJ 2J6SA 3HSJA 2C3YA 3FCHA 4XDCA 4RKUC 3MFIA 5F9LA 3MEEA 3TVYA 1NPPA 1IBLJ 4TLQA 1G2EA 1VBXA 3MM5B 1SIWB 3UWTA 3BPDA 4OYWA 5FLXU 1IR1A 1VQOS 3CMQA 1D09B 3QZ8A 4ZP6A 2RU9A 1VQKS 3R5BA 3IRWP 1K44A 4NE9C 1FE4A 2DR5A 3JSMA 3ET6B 1KOHA 2MGZA 3DLEA 5T7LA 3KK2B 5H9FJ 2F9DA 4B08A 4NXNJ 4WP8A 1HNXF 4ZCKA 1LV5A 1V3SA 2JJ4D 3KJNB 1Q86T 4IH5A 2Q6BA 4C97A 2XMMA 2JOQA 4CI0B 2JSXA 3KUEA 4CNYA 3C16A 1ZAXA 3TX8A 4DX5A 2PSZA 5IT4A 2GAGC 2X1AA 5HBMA 2PA8D 3ETOA 4XTTA 1RYRA 2RKIA 2IC3A 3L7UA 1OJ4A 3TZZA 5EUHA 2LFVA 1K0TA 3PKYA 5LM7E 1JJHA 5KFEA 3BGFA 1MSWD 3I6PA 2UV8A 4TYAA 3KFWX 3QLHB 4QCLA 3GFZA 3EZ5A 2CXEA 3CD7A 2CNLB 4A8KA 4OFZA 1S4EA 4PEOA 2RE1A 2UUAF 3A8JA 1VS3A 3OFGA 4DV6F 1GAOA 5LSRA 3RTVA 2BW2A 1S1TA 2LQ8A 4ETZA 1T7PA 1U0SA 3DRYA 2VD3A 1H2VZ 2DPIA 2GHPA 2DRBA 2R7RA 1ZA2B 4ECYA 1XMOF 5D8HB 1TP7A 4DSIA 1VIOA 1NB2A 4P72A 3MEDA 3B8HA 1PJ6A 4LFCF 2V68A 4DFKA 3MF5A 1WF0A 1T8EA 3BR8A 1VQSA 3H5UA 3VGSA 1C1BA 4X4NA 1WHXA 2DITA 5E3QA 3HHEA 4USKA 1RKJA 3R7SB 4OX6A 4D3GA 1A7GE 3EPIA 2QV6A 1VR6A 1SH3A 4C0HA 4ZPDA 1HWLA 5CCMA 1VDHA 1UWAA 1R0AA 2BOPA 2FTRA 2K8GA 4UF4A 1X4DA 4HL9A 3VCDA 4PWWA 4FS2A 1HR0F 4DR7J 5DQGA 1TL3A 4C11A 3T6BA 3OT9A 1ZPVA 3GJTB 2MJNA 9RUBA 3QGGA 3AFGA 4KE5A 1L3VA 1Q8KA 3CJ0A 1IBCB 4F50A 2DNNA 1H2TZ 3IAS9 2BRKA 1CJUB 1X31C 2ASYA 3I4PA 1NHUA 1FKOB 1SVDA 3W8PA 3KMQA 1WELA 3MM9B 1WF2A 3OTOF 4GC6A 4ZLLA 4BCAA 4M8LA 1L3SA 1ULRA 2P9EA 1Q5VA 3PG9A 2GHVC 2YNHB 4J91A 5E7OB 2MZRA 4C0OC 3S1TA 4KSEB 4DQRA 1S99A 2XSJB 2Z2MA 4LIRA 3CC4S 3QIDA 5B0CA 4NLPA 4RW8B 5I3UB 3EZOA 5I3QA 4ZVSB 3RW7A 4X62J 4NLQA 1H7XA 4X66J 3EJMA 4YB6A 2YKNA 5D15A 2PO4A 3H2UB 1TMMA 4RPFA 2HMIA 3HSDA 4YDDB 3D67A 1IKVB 4LF9J 5CH7B 4F04B 1RP5A 1QSLA 3GP9A 2H5JB 3QT5A 2QTWA 4N77A 1FX4A 2FHJD 2EFGA 1OSCA 3Q0AA 1PC5A 1UA0A 2XHCA 2VBXA 5KFIA 4H4OB 3TUJC 4DV7F 2MSSA 1T9UA 3I82A 3W2WB 3MCMA 3O3LA 2CQBA 3DMJA 4QWEA 1LXJA 2VOPA 2A1BA 1FJGF 3FEXB 1VBYA 1X8DA 3OVSA 3KLGB 2FQQB 4ECSA 3OBIA 1N5YB 3J80U 2JRSA 3A8EA 1OY6A 2R7QA 1N6QA 5LXYA 1DBDA 1TUWA 2JL9A 1S1VA 1NXIA 4FXDA 3SZ2A 3M6WA 3MECB 3MUVP 4PYAA 2B43A 1UP1A 1KVKA 2M0GB 3QGIA 2V0NA 1Y9OA 3KLIA 1VRQC 3GIMA 3CDEA 1HNWF 3CC2S 1AT1B 3TJ8A 1UEKA 4LR8A 2CQGA 3PW5A 1RTIB 2CJBA 3CDAA 2W9CB 4DCJB 2GW8A 3GFHA 1HIYA 2HNDA 2YX1A 3IC1A 1CPZA 3H4DA 2RHQB 4L72B 4UY85 2ZEJA 2ZNYA 4O23A 1Y5LB 2F65A 5IWAF 1NNDA 3NGSA 4E8UA 2NSCA 1TQLA 4NLDA 1HQUA 5F8HA 4RLEA 2I38A 5IZHA 3H40A 4GKKF 4MKVA 5DS7A 4JI5F 2QIFA 1KKHA 2VG7B 2D7SA 2BANB 3MPDA 3VR1A 2GFFA 4KIAA 2RRAA 4F4YA 5L9NA 2EK6A 3VTIA 1AZSB 2MJUA 1T3OA 2EFPA 1Y3JA 4F4WA 1M5PC 1U1QA 4DOZA 2L9NA 1RISA 4ZPAA 2DEJA 2D3OR 1SL0A 2FJXA 1CJKB 5GAEI 4ECWA 4N56A 5F8GA 4JI2J 3TZYA 4PQUA 2V2KA 1KQKA 2FIUA 5THWA 1T9XA 2EFVA 4A8OA 4EEYA 1M5SA 2OD4A 1DTTB 4OJGA 3PZPA 1P9QC 4Y2MA
chains in the Genus database with same CATH topology
4BC9A 2ADCA 1C1CA 1HBOA 2MKIA 4ZPVR 3AB4B 3C46A 3ITHA 1S6OA 3CULA 2MHEA 4I7FB 2NZ4A 2M2BA 4Q7AA 4RW6A 1HMVB 4CO2A 2PI4A 2ZJQQ 4YOEA 2DIUA 2ZD1A 3KLIB 4NMLA 4KT0C 3L7OA 4OZ0A 2GIRA 1N5SA 1WI6A 5GAHI 2DH9A 3LAKA 4DV1F 3T5JA 2GQQA 2FVSA 1N48A 2C3PA 4ZA1A 3TQ1A 5FDLA 1M0SA 3GG0A 2V4JA 4QIWD 4K59A 4D3HA 2GGPA 1W2BR 3DRPB 1NKBA 5D4OA 1S97A 5JUMA 3QAEA 4NLGA 1U1KA 2M5YA 1HHSA 2M4MA 2HNDB 2XSFA 4MK8A 4KAIA 1DRZA 1JMTA 4FP9A 1TV6A 2DNKA 3CD5A 4ECUA 1E6YA 3MR3A 1O8BA 3KG4A 1OWXA 4PG5A 3SMZA 4AUKA 3PR4A 4KKOA 5HL7Q 2B3TB 3HO1A 3K58A 3N6NA 2EFOA 2LXIA 5KG6A 3PW7A 2D1CA 1B0PA 3BO3A 3G71S 2CJKA 1BC6A 5T14A 2IJNA 1K9MT 2R7UA 1XBWA 2CDQA 3TUZC 4DL2A 2WSEC 4B3MF 3BSCA 3HF5A 3CPWR 1FVSA 2YNIA 1WHYA 2JHEA 2LLZA 3M4XA 4I64A 5KG5A 1CC7A 3CSKA 2PA3A 4LMZA 2WRMA 1AUDA 1JLCB 3CVKA 1XR7A 3D2WA 3OLAA 1YHQS 2C2EA 2OIHA 4KHPF 3DFEA 3IR7B 4P6QA 2V9WA 4AFFA 2DO4A 1FXRA 3ENVA 1HQUB 2RD5C 3EUNA 3OTDA 1U09A 3WC0A 1B7FA 2K2PA 4ZVFA 1D1UA 4TQSA 3CCQS 1FDAA 4X4PA 3PRBA 2FLLA 3V5RA 5C5JA 3GB0A 5JXSA 4Q8FA 1EP4A 3HVAA 2XBPA 4B9UA 4KHRA 5DDQC 1HD0A 1MROA 4JOUA 5DLFA 1FD2A 4RUCA 2HHHF 3JSBA 1DTQA 1VRUB 2ZHOA 4R5PA 3OHAA 2HVHA 3EGZA 1D0EA 1VGYA 2DNPA 1N33F 2OJ3A 3HHDA 1Q79A 3U1MA 3BB5A 4TQRA 4ECTA 4OI1A 4A8QA 3NNCA 3M32A 4RUHA 4A8FA 2OPPB 4CO1A 3DOMA 3J7YI 2VH7A 1HA1A 1HYSB 1U48A 4YMEA 2CQHA 2AYGA 1RA6A 2ZOFA 4WFNQ 1TAQA 5LMUF 1RT3B 3MPVA 2DHGA 4ITSA 5LMNF 1FRKA 2A18A 2J5AA 2XY6A 5J1PA 3MEEB 1S9EB 2X3GA 3G96A 1U26A 1RYSA 2WONA 5I42B 1FNMA 2JDJA 4QJVA 2DGXA 2DGSA 2JLEA 2G1DA 4ZMMA 4NCBA 1Y5IB 2GMHA 4F4XA 5DETA 2KG1A 3MMBA 1FXLA 4CO5A 2DHXA 3I5AA 2KRRA 1HARA 2F7VA 2ASJA 4KTQA 3FQKA 3H2VE 4JYAF 1HBUB 3EXCX 4Y2KA 4ED7A 3JB9k 1RTJA 2YNFB 3OL6A 1TKDA 4OHXA 3HXMA 3OL9A 1R89A 3OQ2A 3HJFA 3JTPA 2DIVA 4PR6A 3CF5Q 3HHLA 4QYZJ 4TN2A 1G3OA 4FF3A 2RQMA 1UETA 1WG5A 2JEJA 3B78A 5AJ3F 2WOMA 3NWGA 5J1EA 1GQEA 2RQCA 3S7RA 4LVOP 3DGPA 4IG3A 4DL4A 3MM7A 2Q6CA 2BVZA 2B7BB 3SXLA 1KEKA 2BJDA 1LWFA 2B5JB 3CIMA 3DRRB 3SCIE 3KLHB 4ED3A 4MKAA 1LW0A 2BZ2A 2CQCA 1HQEA 3NS5A 4G1QB 2KT2A 2V94A 4WF9Q 3ITHB 3SQGB 5T7LB 2B0GA 4KBIA 5BYSA 1QSSA 2LEBA 2XMKA 2SXLA 3R5CA 4RW6B 5KFAA 4K4XA 4IYQA 2DTJA 1FJ7A 4N41A 3A1YG 4P2SA 2FVRA 1UMJA 1NEEA 4B3OA 5B0EA 2YX4A 3DM2A 3QGPA 3BSOA 1AXQA 4WK3A 1ZTWA 3DXSX 4RBUA 3U27A 2GJIA 1ZBTA 5FDLB 5IXUA 2VA2A 2LQ5A 1H2UX 2V4JB 1APSA 4OHWA 4WFBQ 4IO9Q 5T41A 1RTHB 4PG8A 1OIAA 4J9RA 1IQZA 1WNEA 2IRUA 5LJ5Y 2ZH3A 2G0CA 5J2PB 3X1LB 3H20A 2HWIA 5B7WA 1REVB 3HX9A 3I5BA 3VQSA 1IBMF 1QY7A 2Q3PA 5HLFA 5CHCB 1E6YB 2WSCC 1Q7YT 4KKOB 1ZETA 2N7CA 4A8SA 3L7PA 2P6SA 1L3TA 2EG1A 2EBEA 2X1FA 3M8PB 3T1HF 2N82B 4Y00A 2OSRA 1TL5A 5C25B 4FF2A 5HBMB 4ZVHA 2FHOB 6FD1A 1VBZA 1S9GB 2MSTA 3HT3A 4ED2A 3TARA 2QMXA 1N5QA 5C24A 2XCPA 1M5OC 3VWSA 2RKIB 3MD3A 3VF0B 3JSRA 1XTZA 3M2RA 1NK5A 4OI0A 2IJFA 1T94A 2AJQA 4ZVEA 4K50A 4U6PA 4J9QA 1S9FA 1U24A 2HFNA 3DOLB 3LAMA 2AX1A 3O6QA 3QJJA 1Q8LA 4KFBA 2Z4PA 3HZEA 4XPEA 5KT5A 4I68A 1GH8A 5A8KA 1ZM4A 3N5BA 3NGKA 2A2CA 3TNVA 3T5HA 2YKPA 3Q23A 3ZZYA 2P6TA 4K0KF 2VV5A 2KXFA 2RDJA 1QM9A 2FJAB 4OJ3A 2LMIA 5DJBA 1S7HA 3T5KA 5F9NA 3ZZTA 4K4UA 1FRXA 2XNQA 3E3XA 4ZLPA 1WEXA 1DTQB 1VOMA 1X7VA 2DNRA 3OR1A 3CO9A 1CQMA 1GXUA 3AA8A 1YJRA 1YJWS 3PO5A 3C66A 4X4RA 4KR0B 3TR5A 4G1PA 4O3SA 2YNGA 1NK6A 3M30B 4N5SA 1Q53A 1QAIA 3U1LA 4C9DA 1KS2A 1RT2A 1NO8A 2H9ZA 1VQYA 3PRDA 1FTRA 3HHLC 4NYOA 2KJVA 4QU6A 4LUBA 3T1YF 5JVGQ 5HP1B 1NJXA 3SFUA 4AL5A 3BGUA 4IOBA 1XR5A 1X9SA 3QYYA 4IOAQ 4JV0A 4K4SA 3LWMA 2LU2A 4ZOSA 3VAJA 2IM3A 2KM8C 2BYCA 2MZJA 3NS6A 4QWCA 3HHLD 4DJBA 4J9NA 2WONB 1ZOTA 1YJ9S 1UJ6A 4B9VA 5CYMA 2CVEA 4I2QA 4ED6A 3WC2A 1QAXA 3QWPA 4TLRA 4TU9A 1J5OB 2KRBA 2MMYA 1QSYA 1FCAA 1WG1A 1V9OA 3MMBB 4CH0S 2UVVA 2PMZD 2W4PA 4WXWA 2FY1A 1HD1A 3SI8A 3PJXA 5E0OA 2YX7A 2MKKA 3PIPQ 1L3KA 5C42A 1FJEB 1RTJB 2K3IA 3DOKA 2VC1A 3I55S 4RZRA 3HHLB 2HS3A 2R8KA 5F8JA 2E7WA 4CT8A 1UKUA 1DURA 1XK8A 1KRPA 3P3DA 3ZC4A 5B0BA 2R2SA 1BQMA 4TU8A 3W2VA 2WHOA 1RI7A 2WOMB 3MTJA 4KHMA 5J1EB 2KM8B 1WHVA 4IG3B 1AFJA 4TY8A 2UXBF 3MEDB 3NNAA 1Q4RA 4DL5A 4RWXA 1K1QA 3N79A 4PUOA 4I6YA 1HQEB 2ACYA 4JV2A 2VQFF 4KB7A 3MTKA 3MR6A 1R3NA 2WBMA 4DL3A 2OTLS 3PDNA 4K4TA 4WKRA 3UR3C 3IRXA 1FVQA 3MEGA 2ZDOA 1DZ5A 2ZZMA 2D3UA 3K57A 1YRXA 3MOZA 3LANA 1NJYA 2E5JA 2JLGA 5HI7A 2GQ2A 2N7YA 5KT4A 4DS4A 4NA1A 2RT3A 4DFPA 2IBKA 5L1KA 4WJBA 1XWLA 1NB7A 4GO5X 4MTPA 5E41A 3K2YA 3GYNA 4A4JA 4ZPBA 1JLEB 5J2MA 4OIXA 4LSLB 1G6BA 4J9OA 1LFPA 2EKYA 4PXCA 4TU7A 4C7QA 1U49A 4A46A 2ZC4A 3QJLA 2J0WA 5KG4A 2MQPA 1HI1A 2KFNA 2B4OA 1M1KT 4UOCA 2PN6A 1TAUA 1IKYA 4NCGA 3MMJA 4DQQA 3PX6A 1RKIA 4WYWA 1U45A 1JLBA 5DGAA 1X4HA 1RT1A 4PPDA 4IH7A 4X64F 2AQ4A 1LKZA 2DRAA 2ZJRQ 4X4QA 2WK4A 3GFXA 3D1OA 5ITHA 2CQ4A 2KYZA 2R7SA 1X0PA 4QU7A 2CPDA 3R1LA 1H38A 1MNEA 3FMWA 3DC2A 4WE1A 1SL2A 4DSJA 5D3GA 2VB6A 2HNZB 1RTDA 3R1HA 5DM6Q 1LW2A 4DV2F 2VG6A 4ELUA 1NH8A 4HYKA 4JV1A 2ZNZA 2VFUA 2QT7A 2ZH4A 4LFBF 4OLPA 2DNGA 4Y34A 5KT2A 1TVRA 1N0UA 4AYBD 3DI6A 3VAIA 1IKWA 3MDFA 4DR5F 3TAPA 2E9TA 3M2RB 4B9LA 2F8MA 3KJVA 3AJ2A 1TUVA 1MMNA 2JVOA 2L48A 3N4WA 2MKJA 3QAUA 5E5NA 1TL3B 3M6VA 4JUZA 2W7PA 1FEHA 2CQPA 2UU9F 3IN5A 2X1BA 4RNFA 5D4PA 4YB1P 4KFBB 4H54A 2VA3A 1T03B 4DR1F 5A8KB 5GMKa 2OPSA 2G9OA 2F1FA 3RRKA 3CCLS 3MPYA 5HO4A 2IVYA 4QPXA 2C2RA 4O3RA 2Q66A 2XZWA 3L3CA 4IRKA 3OLBA 5FD1A 1WD6A 1YBAA 1SV5B 4J37A 2XY7A 2C3OA 4DS5A 3K5MA 4R0EA 1XERA 4FXWA 3NP5A 2IBOA 3ZZ0A 1LK5A 2ZVSA 4ES1A 5LSOA 2YKAA 3J80Y 2LECA 1IBKF 3NMAA 4PG7A 2CIMA 2YTCA 2R4FA 3OFFA 4DSFA 3GFYA 5I3PA 3VZIA 2MKHA 2RQKA 3ZFVA 3MR2A 4IOCQ 2MQNA 2OTJS 1Z2LA 1UEUA 1JKHA 2I5JB 2G13A 2RVJA 4P7VA 3D1QA 4CIOA 2XLIA 3QIPA 4B3TF 1KHVA 1WI8A 4A8XA 2EPIA 3EYZA 3L95X 2ZUGA 3RB0A 2CRLA 5CYMB 4I2QB 2MXYA 3FEZA 5KFCA 2DNLA 3WBZA 3ENQA 4CCHA 4DN9A 1RT7A 1WF1A 2FVQA 3SCLE 4MIWA 1ZH5A 3M1VB 3AY0A 1C4AA 3MZIA 3T5LA 1U4BA 2HFZA 2QO3A 4OZLA 2AF6A 4HDHA 4UQGA 1TKXA 4B9NA 3KLFB 2E5GA 5K8PA 2FJVA 3G6ES 4M1KA 1UVNA 4FVMA 1SB6A 1S0OA 3U7JA 4A8YA 3D5MA 3UD4P 4DV0F 3TA2A 4HLBA 3UDLA 5L1LA 3W2VB 1KONA 2HS0A 2VL1A 4NLXA 3LGMA 2ZITA 4NOHA 3RBEA 1AW0A 1IQTA 4ZS6A 1BWEA 4M5DA 4TY8B 2G4BA 2VKRA 2J0QD 3TRGA 4KRWA 1FEEA 4EBEA 1FRHA 2A3JA 1Q81T 4F8RA 3DLLQ 3J7ZT 1XNQF 4PUOB 3PXGa 1OS5A 3V4IA 3KG0A 4OI6A 2IMWP 3R5AA 4B3SF 5K14A 2ZM6F 2YKQA 3I0SA 2V8DA 1A9NB 4L3NA 3MCSA 3CMAS 3HP6A 5KFXA 3RZAA 4RNNA 1FF2A 3CMES 2B51A 3IRXB 3MEGB 2HRUA 1IUJA 3V2UC 2YKNB 3H5YA 2DNMA 4J9PA 4EO6A 3CB4A 4X4OA 1URRA 1HL6A 3TYTA 2R8HA 1K1SA 1VLYA 4ECXA 2ZH8A 1VQ7S 1MWYA 1TR0A 3OSPA 1H3DA 2E9RX 3N6LA 3FSYA 2B6AA 1YSJA 5BYRA 2XB2D 3F41A 1S6QA 2DISA 4DF8A 3G6XA 1X4AA 1SQEA 3VZHA 3RB4A 2W7AA 1R8AA 3Q8QB 2GV1A 1JXLA 2HS4A 4WFYA 5KG2A 5LL6d 4LFAF 1IKYB 4NCGB 2HWHA 1JLBB 4QIGA 4F4ZA 5DM7Q 1YJNS 1VQNS 4F02A 1FJCA 2ERRA 4NLYA 1R27B 3TO8A 3NG8A 5LT5A 3OL8A 1HBNA 2JFKA 2IM2A 3GILA 4WE1B 4K4YA 4RUAA 1VRTB 1I1GA 1D9AA 1U8SA 3BQ0A 1LW2B 2VG6B 1JJ4A 1QUVA 1FDDA 3QLHA 2JC0A 3DMJB 3HVTB 3N9UC 3DI6B 2FUG9 2AGPA 2X51A 5AXMA 4A48A 3BSAA 4O3PA 3KJVB 1BQNA 2LXFA 3KK1A 3WDOA 4C4WA 1TL4A 2AJFE 5AE2A 2V4QA 1WHWA 2ZH1A 3V6DA 4B9SA 4PXDA 3TAQA 3D54A 2PE8A 1VQ6S 1U1LA 4CTAA 3D0IE 4DDFA 3GYXB 2HFOA 2P9CA 2WBRA 4TXSA 4ECZA 4Y65A 5LJ3Y 2W8LA 1SL1A 2OPSB 5SZTA 2KJWA 1ZM9A 3DXBA 4NLRA 4ICLA 2WB4A 1KC8T 5EN1A 3DLKA 1TKZA 2DHSA 4N8NA 5L9XA 3TA0A 1N34F 3W7BA 1DQ8A 4RU9A 4AXJA 1YRUA 4ECRA 2OH2A 2VPWB 4LT6A 1N6QB 3PM9A 5KG3A 1TL1B 2RIJA 3F44A 5A8RA 1UL3A 3N0VA 4DLGA 5CYQA 3J7A1 4MMOA 3EX7B 4Y6IA 1FO1A 2H5EA 3VAMA 2B4PA 4K4WA 4PWDA 1VC6A 3FFIA 3K8WA 2CJQA 2KYXA 4IR1A 4X2BA 3OSNA 1FRLA 1Y7PA 1S1VB 2EBGA 2OPRA 3BDPA 2MHNA 2GJ2A 3LO3A 3CXCR 3OFEA 3M8QA 2CPHA 5F0WA 2O5DA 2NSBA 2CQDA 5B08A 1JKHB 1UJ5A 3LP0A 4GKJF 3DRXA 3SV4A 1U2FA 1UWBA 3HZGA 4UUWA 1TK5A 3HPOA 4HHJA 1DLOA 1TKTA 4ZPTR 1N8RT 1JNRB 3QIPB 5FJ4A 3LP1A 2IAJB 4MFBB 1RGVA 1XR6A 2W25A 4DFMA 4DL7A 3SSSA 2L3MA 4N47A 3MM8A 4U7UK 4MIBA 2EK1A 2HNYB 4Q44A 2F3JA 2RH3A 2A10A 5BJRA 1H0HB 1HNVA 4QIVA 1TFWA 5K8NA 1K0VA 3ISZA 1Y3KA 5CZVA 5GVQA 3H98A 1KN6A 4DSKA 4EWTA 2AD9A 2N4DA 1FK9B 2CVIA 1N32F 2HVIA 5KFBA 3BGRA 2QA4S 2FJWA 3G9CA 3N28A 4IRDA 3I32A 3JAMY 4WXOA 2MQMA 2DR9A 1TKXB 3CT9A 3BR9A 4YDXA 3CC7S 4NZ0A 1C0UB 5GAGU 2OFGX 4Q45A 2VFTA 3DNCA 3DU5A 3KK3B 2E5LF 2GMJA 5HQ8A 4R8UA 5DG8A 4OX9F 1U1OA 3M05A 1OQ3A 2BV3A 3TW0A 4KO0A 4X4VA 3QGHA 2MQOA 1S1WA 3PW2A 3QZ7A 4EGLA 2PDAA 5F3ZA 2YWEA 1N5TA 1LXNA 2M9KA 4OJ1A 4ID5B 3NMRA 3PW0A 5KFYA 2CQ2A 3T9NA 3DLHA 4XK8C 4F3QA 2ZJPQ 4QW9A 2IFXA 1FA0A 3V4IB 2PI5A 3LH2S 2BQUA 4HTIA 3I0SB 4YB7A 4ZKAA 4QWAA 1CLFA 2LEAA 2ZH9A 2QA1A 5DRKA 4Z2XA 1S77D 1IXKA 3CJKA 3J7Z5 2DBBA 2JEFA 4O3QA 3T1AA 4WZMA 2I0XA 1SI9A 3P96A 4J9KA 1FKPB 1URNA 1FNOA 4LQ9A 1UEVA 2MDAA 2C28A 4FF4A 1SKSA 2AYBA 4NLWA 2QRRA 1FHTA 5EX3A 4WYLA 1OPIA 2NUUG