4ALZA

The yersinia t3ss basal body component yscd reveals a different structural periplasmatic domain organization to known homologue prgh
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
194
structure length
194
Chain Sequence
QLVEQEVRRLLATAAYKDVVLTSPKEGEPWLLTGYIQDNHARLSLQNFLESHGIPFRLELRSMEELRQGAEFILQRLGYHGIEVSLAPQAGWLQLNGEVSEEIQKQKIDSLLQAEVPGLLGVENKVRIAPNQRKRLDALLEQFGLDSDFTVNVKGELIELRGQVNDEKLSSFNQLQQTFRQEFGNRPKLELVNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords YOP PROTEINS TRANSLOCATION PROTEIN D
publication title In Situ Structural Analysis of the Yersinia Enterocolitica Injectisome.
pubmed doi rcsb
source organism Yersinia enterocolitica
total genus 65
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2012-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1770 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4alzA03
3GR0A 4ALZA 3GR1A 4G1IA
chains in the Genus database with same CATH superfamily
5CYQB 3K2YA 2J6UA 1VS3A 2QX0A 3AY0A 3SDEB 1L3VA 5DGAA 5K8OA 4CT9A 3FSIA 2A18A 2VQEF 1URRA 1HR0F 1U47A 2A0FB 1TELA 4WF9Q 3UI3A 2XZWA 4DV5F 4ZVFA 3OLAA 2QN6B 1D8YA 4RNHA 3BREA 3Q24A 3CDAA 2HWIA 3KJVA 2ROGA 4LVOP 4QJVA 2YNHB 1VQPS 1HWKA 2XS7A 1EETB 2ZE2B 4O44B 1S1UA 4B3MJ 4V19J 1HLWA 3TW0A 1SB6A 4OYBA 3FK4A 2KT5A 1FWPA 3ZTPA 3JAMU 1CS4A 3C46A 3B54A 5DETA 1TK8A 4F4KA 2BANA 3BPSP 2OP5A 2HNZB 2UV8A 2DPJA 2OPSA 3H5UA 3MR3A 3CD6S 4AYBD 1T9WA 5KFXA 3LQVA 4C2MA 3GJSB 2VFUA 1FJGF 3HVTA 4RKUC 2J0SD 3NOGA 5J2QB 4F3MA 2IMWP 5FIIA 5A8RB 3HKWA 1WF2A 3LWLA 4ZLPA 1K1SA 4Q5VA 4NLWA 4CH1A 2QT7A 1TL1A 5KFCA 5GAHI 1VQ8S 3RB6A 4PR6A 3EJMA 1N32J 3MM8B 1JLBB 5KT2A 3FC9A 2EKYA 2R7XA 3Q22A 4MKAA 2VG6B 3RU0A 5J1EA 3HHEA 3MEDA 4OIXA 2WSCC 1AW0A 5C2GA 2YWFA 3HD2A 2CNLB 1XBWA 2JDJA 5HAOA 4YY3F 4IRDA 4K4YA 1R0AB 1VQNS 4LF2A 5KFRA 1T9UA 1QVFR 4OX7A 1NHUA 1GTEA 3VGVA 4IUFA 4A8MP 4F3OA 4NEZA 4OLOA 1ZS6A 4PG5A 3MEGA 4K0KF 3D7SB 1XMQF 1YI2S 4YP3A 4PEOA 2ZHBA 1FJCA 4IOCQ 3MPDA 1RLCL 4ZLNA 4PXEA 3HXMA 5DM6Q 1VR6A 1HBOA 1OIAA 2IY5B 4CCHA 1OYEA 4IFYB 3CULA 4KGMA 2ZEJA 3ETMA 3BEGB 2DNZA 4DBQA 2AIRB 3M8SA 2DNKA 1R43A 2UVWA 2K3IA 3EGZA 2MKCA 1P1LA 1NB7A 1BC6A 3SCKE 3UNGC 2JVRA 3GWCA 3BKUA 3MI7X 3M05A 1V5IB 2CADA 3LPEA 4NRTA 3AT1B 4L76A 3FFIB 5E3PA 1O51A 1YK9A 4YHHJ 4A8XA 3PYDA 2VU5A 1P8GA 3R5JB 4P2SA 4ECQA 4L75A 3N6LA 5D0EA 3J7AN 1SQEA 5HLFA 2KVQE 4WP3A 1YJVA 4H4KC 2QMWA 1BUXA 1XN9A 1DTTA 1HHQA 3NP5A 1M1GA 2HVHA 4OHZA 1MSWD 1OPIA 3F56A 3ADAC 3UN2A 5HVGA 3FSXA 3FZBA 1TL7A 4F2RA 1E6YA 1TAQA 1OO0B 2XZDB 1RQ0A 4LT6A 3OVBA 1N5SA 3OXFA 2AGQA 4XDCA 1M5VC 2YX7A 2C1EB 1VYAA 2DGQA 4F67A 2BM1A 4V1Ak 2DB1A 3DNCA 3LP1B 3FBFA 2C42A 4B3RF 4ERDA 1FESA 4G1QB 1RSCA 2AEMA 3NGDA 1FKOB 1CLFA 1ICEB 4KV8A 1JLFB 2HFUA 5JXSA 5B08A 1BLUA 4RL1A 2HQDA 5ETMA 2C2MB 3T3FA 5IFMA 3KG4A 2AZ3A 4PKDB 3MD1A 4I0WA 1EB0A 2UVRA 4OFZA 2V34A 1MWQA 3JAMY 3R6GB 1JLEB 3MMAA 8AT1B 2DD8S 1NK4A 1VBZA 4JYAF 2DNHA 1U1PA 2VOPA 2XO6A 3T1YJ 4HH1A 4RX6A 2VOOA 4TYBA 2GZOA 1LWEA 4DV2J 1CJUB 4NI2B 4X64J 2YKQA 4PRFA 4DQIA 3E01B 4I4BA 1RXOB 5AJ3J 2YKAA 3NG8A 2CJQA 4JI3J 1VQ6S 5H9EK 3C6UA 1Q0NA 4IOBA 1OQ6A 5EWFA 4WKYA 4KO0A 4MYUA 3VAFA 1LV5A 1P1TA 3CTRA 1JJ2R 1NBEB 2UUCJ 3R5CA 3KG0A 3CF5Q 4Y34A 4O4GA 3M1VB 2FC9A 3I9ZA 3HMJG 3Q83A 1S5ZA 2HBRB 4RZRA 3POTA 3GLJA 1Z2ZA 3K5NA 1UVNA 1NJIT 2QLFB 1SKWA 2B9EA 4OI2A 4BCAA 4U7UK 5KG4A 2IVFB 4WJBA 3IAS9 2CPFA 4DQQA 2H9ZA 1CEZA 4U7CA 1TKTB 4ID5A 4RW6B 1UVJA 2AT1B 2HHHJ 4Q45A 1LFPA 3CO0P 1KFSA 4FBTA 5J1PA 4J9UE 2PD1A 1RACB 2CJAA 5D77A 1U48A 2E9RX 2G9OA 1GQEA 2PEHA 2COLA 1NRKA 4UW2A 2FZGB 5KFDA 5CYQA 3NS7B 3CCWA 1GMWD 1RLDA 4B08A 3BF4A 4B9TA 2P5VA 3CMES 1RAHB 4WIIA 4CM0A 1S6PB 2E1AA 2YY3A 4I7FB 1X5PA 5IV4A 1S12A 3WC0A 1WACA 2B0GA 2R2UA 4DU7A 4MKBA 1G7CB 3CCZA 4NA2A 2DNNA 2POKA 4A8YA 4Y28C 1FDNA 2CIMA 4CTAB 4ZITA 4L74A 2YNHA 2N7YA 3IR5B 4K4WA 1R0CB 3B78A 2KU7A 1BD6A 2FJWA 1RYSA 4DCOB 4HKQA 1BWEA 1TKDA 3IA0A 5I4MA 1AYEA 1JLAB 5DZ7A 1EAYC 3QWPA 4BLGA 4B9MA 1S6OA 1GMVA 1H7WA 1YWXA 2HNZA 3UD3P 1X8DA 1N8RT 4KHPJ 4B3SF 4KGXB 1KRPA 1Q81T 5A2QY 1Q8KA 4ITSA 4O4RA 4KJIA 4WXOA 1N4LA 3OHBA 2CJXB 2CPJA 3CT9A 5F8IA 1YRTA 4M5GA 2JFDA 3TX0A 3CCVS 3AJ2A 1RT7B 3X1LB 3LW5C 2BXJA 3TARA 3LGHA 3I0SA 1IKYB 3PM9A 3GCXP 3R1LA 4CLLA 1S4FA 4NMLA 3PYGA 2PIIA 2W1BA 1Y4ZB 2BOAA 2ROEA 1JLBA 1PJ5A 3FCWA 2R9LA 3D6FB 2AJ4A 2VG6A 1VGYA 3LGMA 2N82B 1Q5YA 2QV6A 4Y2IA 2WB4A 1YJ9S 2BEFA 3K57A 3HPOA 2C28A 4Y6IA 2YX4A 1RJJA 4NLXA 2MSTA 2I9SA 2H4WB 4QU7A 5E7OB 3QWUA 3DRXA 4NA1A 4ZVPB 4ZKAA 1FK9B 4RUCA 3EZOA 3VQSA 2CQ1A 1U25A 1S1TB 2DCLA 1NNDA 2LEAA 5I3UB 4ETXA 2G0IA 3BSOA 3ENQA 2AHOB 2UXBJ 1F9HA 4IFYA 2RS8A 2GMJA 2XQCA 2DNQA 2IA6A 3NS5A 3PO5A 1XERA 3CNQP 1DRZA 3JSRA 2G2YA 2P8IA 2WVFA 2V50A 3EVMA 1R31A 2AYMA 1HL6A 1J5EF 2B51A 3CPWR 3DXBA 2FZKB 2F4FA 5T14A 3I82A 2KB2A 4RNOA 3KLEA 4HACB 4DR1J 4F0MA 1I6JA 2JWNA 2VC0A 2DO4A 5IQ6A 2ZH2A 5K8PA 2HURA 3FEXB 2LP4A 2OPQB 3NBPA 4ES2A 3TWZA 4DL3A 4NLSA 1ULRA 4RUHA 2IBKA 3GV8B 4DPUA 2DNLA 3V4IB 3BS9A 1WJ9A 3QAUA 4EYHB 1PC5A 5LSOA 3LF0A 1HQ2A 1M1HA 1SBRA 2NS1B 3H5YA 1BE4A 3TR5A 4X66J 1RHMB 4TU7A 3DOMB 2YXLA 1YGYA 3DLEB 3H4BA 2YQ3A 4A8SA 1S0VA 3DKDA 5DGBA 3QRRA 3PRDA 2V4JA 1JXLA 4OZJA 2D3OR 2ZHOA 3DRPB 4IO9Q 4Q2MA 4YEAA 4LMZA 2A10A 4AL5A 2OTJS 2MQNA 3NGTA 4UQTA 1DHMA 4USUA 4P9SA 2AEJA 2C3PA 1NUEA 4F26A 1R89A 1B64A 3O1LA 2Z2ZA 2FYXA 1T8EA 4G1QA 1UFLA 2W2OP 4NMXA 2LQ5A 1JLFA 3LH2S 4MH8A 2L9NA 4WCEQ 5KT7A 3N5BA 3EICA 5DG7A 3CDWA 5AXKA 1C1BA 1SKRA 2BJ8A 1F5CA 4PAAA 1FDAA 2R7RA 1KVIA 3IGVA 4OI0A 4U9RA 3MM6A 2LECA 4WPAA 3IRXB 2M52A 4Y65A 2MDAA 4J9QA 3MEEB 2CZ9A 1K8AT 2QSFA 1VOMA 2FTRA 1GXUA 3A3NB 1HNWJ 3M2RA 1YKWA 5CH7B 3W62A 2CYYA 2O67A 2XSJB 3FJ2A 2QRRA 1FTRA 1F6TA 2QA1A 3E01A 2GA7A 2QL9B 1NKBA 3I6PA 2JEJA 8ATCB 2YWKA 2IM2A 2QTWA 3GIRA 2WBMA 3SQGB 3HZEA 4E0DA 1M1KT 5JVGQ 4O3QA 1PG5B 4J9PA 3ILJA 3DI6A 3M1VA 2VPWB 2IMOA 3Q8VA 1RT5A 3H2LA 4DQRA 2EFGA 1TQLA 3ZZRA 4JI7F 4CO1A 3R1HA 2B4UA 4USVA 3Q89A 1NPPA 2EFNA 3UD5A 2HVEA 2FLPA 3A3OB 1Y5LB 2Y0BB 2P2CB 3SSSA 2LXFA 4QOTA 2KI2A 3AJDA 4RW6A 4LQ3A 3A8JA 4C8OA 4DQPA 5BXIA 1UWBB 2HVDA 2R7VA 5D4PA 4A46A 2V8GA 4FYDA 3BSAA 1UVIA 3BO3A 4Y2AA 2CUYA 1REVB 2FJDB 2GMHA 5JUMA 4IRKA 4HR2A 3O44A 2NYHA 3KK1B 4U95A 1RHJB 5B0EA 3FBCA 3BR9A 3PACA 3LTOA 1NSPA 3TJ9A 2D41A 1PJ7A 2B5JB 1WEZA 4LRAA 4ZJQA 1S6PA 1WHWA 3SMZA 4M95A 2DIUA 1HHTP 2V2VA 3GV7B 2MPUA 1O6XA 1XR7A 5F41A 3ZTOA 2LMIA 3CJRA 3MWBA 4ZHRB 2C3YA 4J7CA 4IO1A 4OV1A 3MPWA 4J9VA 3PCOB 2ASDA 3V6HA 1VRTA 3CGIA 2HS4A 4EFAC 4CTAA 1Q78A 4FPRA 2OFHX 5KFIA 4NLGA 5HQLA 1UJ5A 5CZVA 2KZZA 4ZVTB 4G6VB 1FJ7A 1PAUB 3ZTSA 5F3ZA 5F3TA 3KLGB 5LM7E 4U67Q 1DTQB 3NS6A 4AQYF 3CC4S 4DCJB 3EGNA 4AD6A 4PWDB 2RUSA 3QLHB 5IM0B 2QSWA 2BKNA 4OZ3A 2G2OA 1JB0C 1JLAA 4UOFA 5EDWA 3RB4A 1FFWB 2OLWA 1K9MT 1S0OA 2DEIA 2OD6A 1XC9A 3DOKB 1XIQA 1Y11A 2RJZA 4ZVGA 3CMQA 1D8ZA 4NX9A 2N4DA 2CJYB 3UN3A 3Q8PB 2HRUA 2AYEA 1RT7A 4RUBA 2CWXA 5KFTA 1KONA 4TY8B 2GS8A 3D1OA 4QYZJ 2Q3PA 1PIEA 1IKYA 2GHVC 2CQDA 2DHXA 3PX6A 1X0PA 2ZBRA 5E33A 2D1CA 1RAJA 1IBLJ 1CQNA 2BBEA 3W5YA 4DV0F 3T9ZA 5J2MA 3CJ0A 4OI1A 2E5GA 3H0PA 2L3MA 4NZ6A 1UETA 2M8HA 1HNZJ 4DXLA 2DGWA 1J5OB 2OGUA 4LR9A 2ZJQQ 1IWGA 4K4ZA 3U27A 4X4UA 1FK9A 2XEXA 3HVAA 4WE1B 2I0XA 3U1LA 2VFSA 5KTQA 2L08A 2QGFB 1X5TA 3T1HJ 5HVHA 4KQZA 4LF7F 3RR8A 2ADBA 3DRYA 1QVGR 3DLGB 4IH6A 4DPOA 1Q8BA 2HFOA 2XGPA 3MR6A 1KHVA 3M2VA 4OI6A 2EW9A 3K7RA 2BVZA 5M2RA 4FYVB 5AXMA 2K7JA 2HBZB 1UEVA 2ILZA 5D15A 1HKAA 3KLVA 2BRLA 2IPOB 2HNDA 1XNRF 4S0MA 2QIFA 3ITHB 5DQGA 2UXCF 1D3WA 5EX0A 1ZBTA 2NPFA 5DG8A 1U1LA 3PYFA 3BKTA 5JMNA 2MQOA 1T11A 1AUDA 1F9EB 2YPYA 2PI4A 1FWLA 1VI7A 3RGIA 2JC1A 4HACA 3OW2R 2MB0B 3M8RA 2L41A 2RE1A 3H42A 5LMUF 3JSYA 4C8NA 2AGOA 2P9GA 2DK2A 3KK2B 5BYRA 3CJSA 3MMCB 3ONQA 1KWMA 5HJYA 3IAM9 3P5BP 3IBWA 4JI6J 4RW9B 3CD5A 4FXWA 2RRBA 4XPEA 3OTCA 1PJ6A 3V4IA 3P4UB 3ILLA 4DV6J 1KP6A 4P2FA 3CCQS 1OYDA 4KPYA 5THWA 2PMHA 1EIYB 4JI5J 1HW8A 2MHNA 3DOMA 1TK0A 4KH1B 2V6AA 3DLEA 4WTOB 5AT1B 4DV7J 5HI7A 1KBRA 2KTQA 3PKMA 3BPDA 1HYSA 4O3PA 1EHWA 4NWBA 3KK3B 1JLCB 3GSIA 3BDEA 3W66A 2JRSA 2VBWA 2BV3A 2CG8A 1VDHA 3BGUA 8RUCA 4DZDA 3DOLA 2IRXA 4DLGA 5I3QA 2HHQA 5DDOC 4M5HA 3DRRB 3DCAA 4ECSA 3D0HE 5G0RB 4PWWA 4RNMA 3OXLA 2LDIA 1NDPA 1Q8IA 3IFEA 1FRMA 4A4JA 4F4WA 3DLJA 2ZHAA 3IRXA 3OFEA 1IBKJ 3PW0A 7FD1A 2HAFA 4U8YA 2M7SA 3HSJA 1WC1A 3DFEA 2NXCA 4ZPVR 4GMKA 4J9SA 3PR5B 1RTZA 3HVWA 1UA1A 4PG7A 5CQGA 5K14A 3EWGA 3QGHA 2YBVA 4EBEA 2WZ1A 1SJ3P 1S79A 1N5QA 4DF4A 1RADB 4PQAA 3BGLA 1KN6A 1VIXA 2DHAA 2GHPA 2Z8QA 2DTJA 2EC0A 3SQGA 3QO9B 3SFUA 5RUBA 1KVJA 3GFZA 3CJ2A 1U8WA 2H4YB 1PKUA 3HI9A 3ENVA 5GVQA 1S1XB 4H54A 3N6MA 1H0HB 2WAQD 3B6BA 3CWJA 4USJC 1S49A 3U1NA 3LWMA 2DEJA 3ENWA 3JYTB 1WSVA 4RBVA 1IN0A 3GV5B 1UW9A 1Y3KA 2KHDA 1TU0B 5KFLA 2GQQA 2OI2A 2MQQA 1IM6A 2ZUAA 5ETVA 2B8QA 1LXJA 3MUTP 1EKRA 2G0JA 3HDSA 2J0QD 1FNXH 2ZBIA 3IM8A 3HLUA 2KFYA 3EZUA 3ZZUA 1RT4A 3KK1A 2DR8A 1PYOB 3NLCA 2DY9A 1DZ5A 1TMJA 2R8IA 3MECB 5MAOA 1OSDA 3G6ES 4J90A 1ZA2B 6AT1B 3D28A 3EXYA 2R42A 1SJ4P 4FVMA 4CP5A 2BKPA 4NXNF 4EK2A 2FJVA 2QLWA 1NZAA 2DT9A 2KHCA 4OYIA 3M4XA 4HTJA 4EU0A 1IBMF 2CQHA 1HHSA 2B9XA 4X65F 4KGVB 4F0HA 3GG0A 2HRTA 2IRYA 4L72B 4DPYA 2ZDPA 3PRVA 2YWHA 4PWDA 1NSKL 5IM0A 4CLTA 2NXUA 1UMJA 1WDTA 4WXWA 2BMBA 1U1OA 4P2XA 1Y10A 4OYMA 1WC3A 3WZ0A 1HWUA 2DR6A 2RU9A 2PA8D 3DOKA 2XMMA 2GV1A 4Q43A 1S48A 1TR0A 3HCXA 2JJ4D 2VHGA 3THPA 2J6SA 4QCLA 1VJWA 4BHQA 3CC2S 1B3TA 3HJVA 4OZ5A 5KG5A 2HGMA 2R7QA 2KL8A 3KJQB 1HNVA 4OYXA 1FDBA 4TY8A 4ECTA 1HQEB 4J9NA 4RNFA 4YR3A 1HIYA 1EQMA 3W1YC 3RJMB 3UVJB 2DHHA 2I5JB 2HHVA 3MFIA 4ED6A 1D9DA 1FNOA 1VQKS 5LMNJ 2IJFA 4CDIA 3VAKA 5ETOA 3G4SS 1BQMA 1A9NB 2J9EA 2W7PA 1N36F 1DJ0A 2R4FA 2CNKB 1EQ0A 1XR5A 4MAKA 1UVLA 2F4VJ 3KHHA 2K06A 1GXLA 3EE3A 3T1AA 4Q2LA 1RBAA 3IGNA 1J5OA 1X4BA 3I55S 3GTYX 3FEYB 3VALA 2UUBF 4WE1A 3QT5A 1Y9OA 1C2PA 4NLOA 1X9SA 1NK7A 1ZOTA 2BJEA 1UCNA 3KLIA 3QATA 3DLGA 2RQCA 3DMJB 4ZCIA 4DV4J 4DR5J 2KH9A 4PG6A 1RAFB 1KEKA 2JZ5A 4NLPA 3O2IA 2ZNYA 5EX3A 2C2ZB 4MK9A 5CYMB 1H2UX 4DS4A 2ZOFA 1HW9A 2VDIA 3TYTA 2I38A 3AD8C 5DZ6A 3T19A 4F4AA 2AJ1A 1SKSA 4DPXA 5KT5A 4LFBJ 3UO0A 4YUDA 2AX0A 1N6QB 4GKJJ 2VF3A 3WC2A 3A12A 3LO3A 2GVDB 5KG0A 1UW4A 3VR1A 4YFUA 3MCOA 3R6LB 4LF6F 3O6QA 2M5YA 2BABA 2XMUA 3KHGA 2LEBA 2B56A 4DU8A 1FTCA 2Y9HA 3MMCA 3TUJC 3G6YA 2FUG9 5F8JA 4A8OA 4K5RA 4ANEA 4RW9A 4DL6A 3HK2A 2UP1A 5B0BA 4LRBA 3HO1A 4H4MA 4OV6A 1RK8A 4WIQA 1XMBA 3Q23A 4Y2KA 4X4OA 2A6MA 3CIZA 4YB1P 3C16B 4N77A 3A3PB 3TQ1A 1YBTA 1N33F 4DOZA 2FLOA 4BC7A 2RRNA 1VLYA 2NYIA 3M6UA 3AD9C 3P6YC 5BYSA 2EEYA 3VVTA 3CJKA 4M5DA 3N01A 1APSA 4USIA 5B09A 1PSDA 1P27B 2OEKA 1S7HA 4R8UB 1IVZA 2Q1LA 2HGNA 3IM9A 4LBPA 4PPDA 1JLCA 2DGTA 4ENOA 2K1RB 2QZ8A 4C0OC 1HQUA 1S1WB 3EGWB 2DXEA 1W7WA 3OHAA 4DS5A 3D3BJ 3PHTA 2F9JA 1KLNA 4MIBA 3G9CA 4W90B 2MZSA 3MMBA 3DLBA 1VC0A 1U8SA 3OSPA 4JI4J 2OPPB 3ZTRA 2XHCA 3DRRA 3HSGA 1XR6A 5D3GB 2KRBA 5G0RA 4JP8A 2CVEA 5IT4A 1UWAA 1EJ7L 1NDKA 5C42B 4MFBB 2JC0A 3DDKA 3AXKA 2HBQB 2FZCB 4YB6A 2OMOA 1H73A 4PUOB 2M88A 3CW2C 2FPHX 3T41A 4J9LA 5DLFA 3TZWA 3CO9A 4OHWA 1FKPB 1U02A 1F3FA 2VD3A 2KFZA 2W9BB 3DXSX 1B0TA 2KT3A 3DLHA 1T95A 3PR4A 2HYIB 2DRAA 4BC9A 1N0VC 1XK8A 3DM2B 4CM2A 4DR7F 1RT2B 3PTWA 1D09B 4AFFA 4JV0A 4FNIA 5J2PA 1Q7YT 4M8LA 3ICLA 4NXMF 1LWXA 1RISA 2ZFHA 3JQMA 3PO4A 4Q7AA 4USMA 1S59A 4V19X 1T9TA 1PAEX 3R2CJ 2DGVA 5AXNA 3HHLB 2AJ2A 3H8YA 1S1XA 1AT1B 3W9HA 1S57A 2KJVA 3GCWP 4MT1A 5K8MA 1WHVA 4K4VA 3G96A 1CJVB 1RU2A 5E2QA 3JYTA 1Q79A 1NH8A 1S6QB 3ET6B 1F60B 4ED5A 3KDNA 2BE9B 1JLQB 2JLGA 2V94A 4J91A 1VISA 1S10A 4NOHA 4NLVA 3BM7A 2J0WA 3AB2B 1SQGA 4FZVA 4FYXB 4XO0A 3OBIA 4E2FB 1X4EA 1MN9A 3DU6A 3AOCA 3J7A1 2MY8A 1X4DA 2RT3A 2HK3A 4LRFA 1NKCA 5HBMB 2B43A 2VG5A 3TX8A 3MECA 2HHUA 5KFKA 4ZMMA 1AUSL 1RT6A 1S77D 3HHLD 2B9WA 4DSJA 1LOUA 1PCAA 3EUNA 4ZLJA 1A6LA 3OPKA 2YKNB 5F9LA 2JHEA 2BJ9A 3EM1A 3TVKA 4GRSA 1FERA 4I2PA 1UFWA 3Q8RB 1MN7A 4CO4A 1D1UA 2QLJB 1Y5NB 1T7PA 3I5AA 4KKOB 3TP2A 4N41A 4BWMA 1B0VA 4C3MA 2RRAA 1MU2A 2ZOGA 2J0XA 4LF4F 4X4RA 3GZ7A 3RAMA 2PFFB 1Q95G 3H2UB 1JKHB 2XULA 3EPIA 2ADCA 2OPSB 4B9VA 1N5TA 2IDLA 1VHIA 3LANA 3IBFB 2IM3A 1SJRA 4DDFA 2R2SA 1N56A 2RF2A 2Z2MA 3KUEA 2HVIA 1YRUA 4NLQA 2VONA 1CG2A 4QR1A 1NH7A 1G6BA 4J9KA 2MHEA 3IRWP 1KOOA 1RBLA 3KXDA 3GILA 4ATNA 3PFEA 4MKYA 5A6WA 3OR2B 2GO8A 1X9WA 4R5PA 4Q0BA 5BYQA 2ZWPA 1ZH5A 4I6AA 2HVZA 3FRYA 2XM3A 1O8BA 2I5JA 5CD4A 2X1FA 1QSSA 3MEDB 3J80U 3EGVA 2NREA 2DGOA 3JSMB 1WI8A 3H5XA 4WFBQ 1M5SA 1BHNA 4YN3B 3VCDA 1C0UB 1X4FA 2O3DA 2V69A 1FRJA 3QMQA 4ER8A 1JNZB 4AUKA 1RAIB 5ETQA 4DL2A 1S7IA 3D6HB 4DF8A 4KSEB 2HFVA 2YWGA 4C0BA 1X0FA 4LUBA 2A1BA 1FEEA 3I32A 3C3LA 4DSFA 4P52A 4ECZA 2F1FA 3M8QB 3E8OA 3QQCD 3W61A 2JEGA 3I5CA 1AFIA 5IZHA 2Z2LA 2OMLA 3DMJA 1U6BA 4USHA 4TQRA 1NHKL 4KY3A 1H6KX 4QWAA 4EWTA 1K0VA 3VF0B 1J2VA 5CYMA 2KG0A 3OTOJ 2E5JA 4RNNA 4ED7A 4JV5J 4FYWB 5A8KB 1LQ9A 2NSBA 4RW8B 4CNYA 1FD2A 5MLCV 3CDBA 3H5SA 4N8OA 4P7TA 4JI8J 1N6QA 3C14A 1PYTA 3NWRA 1XEZA 3C8YA 4QPTA 4ZN3A 1JIHA 4X4SA 3VTIA 4Z2XA 4PABA 4OHYA 3RUBL 5HROB 1I94F 1VQ4S 2RMLA 3D1QA 1R8AA 4FNHA 1FF2A 2HFZA 2MQMA 4RBTA 2EKNA 1NK6A 1M5OC 3MTJA 4KFBB 3QAEA 5DQIA 4NPOA 3AA9A 1FVQA 4EUVA 2V9KA 4G1PA 2K3KA 1K0TA 1E6YB 1FX2A 4DR4J 4RU2A 2H54B 1BQNA 5DS7A 1IR2A 4C9DA 2AJ0A 4O3OA 3GYXB 1Q8LA 2HQCA 2W2PP 4NEYA 3AOBA 3W8PA 4FXDA 3US5A 4F8RA 1REGX 4ECXA 3ZZPA 2HMIB 4DR2F 3J81U 4OYPA 2K1RA 4ZVOB 4NZ7A 4KV8B 3W9IA 2ACYA 1RAAB 1UEKA 4RW4B 3BSCA 3JQJA 5KFAA 1FE0A 5LXRA 4RW7B 3CMAS 2OO4A 2DY1A 4ZIWA 2LCWA 2OPPA 2ZC4A 4UUWA 3VGTA 5KT6A 3MMAB 5D3GA 3ZO7A 1FVSA 3W2WA 5C42A 2GCFA 3U7JA 4PUOA 4PXBA 1YJWS 4ELTA 4W4MA 4JI0F 2BW7A 1SV5B 2BE2A 3NAHA 3M9NB 4LF5F 4U7UD 4B3TF 5I42B 2V63A 3C6UB 1FD8A 3N9UC 1JXVA 1XMOF 2B9YA 1L5UA 2XLJA 2YPZA 3Q8SB 5D4NA 1RYRA 2MLXA 2ABYA 4O4GB 4PZVA 2D9PA 2CG4A 4ED8A 3POTB 1JJ4A 2VQFF 3S6EA 2C3UA 4XIUA 3J80Y 4ZK7M 3RBXA 3BH6B 2GW8A 2LXUA 3SYZA 1HFEL 1SKUB 4WZMA 1HBMA 4NYZA 4M5NA 4HT7A 2KM8C 2KJWA 2N4CA 1P9YA 1EKSA 1CJVA 3OJSA 2LYVA 2N3LA 1RWXB 4I2QB 2DVIA 2XZTB 5D78A 3GB0A 1JXEA 3ET6A 3N6NA 2AW0A 3TZZA 2HLTA 4X4PA 2DBBA 2NR0A 4DV1F 4BS2A 2ZC3A 4QIEA 1YBAA 4ED4A 4RJVA 2MQPA 3H98A 3SEOA 3I96A 1R8HA 2ZD1B 5L1IA 2B6AB 3OUYB 3TJ8A 4CLKA 5DQHA 3OR1A 4D3GA 5HBMA 2ATLA 5EHHA 6FD1A 4EBCA 4BBYA 3AB4B 4PXCA 1RWWB 2BUNA 2XTJP 2QLBB 4ZJLA 4W92B 1GFWB 3M30A 2NLWA 2IDEA 1PBAA 1UP1A 2YKNA 2D69A 1FRKA 5A76A 3FBBA 3PYEA 1N34J 2R7UA 1QSLA 4KKOA 4OJ1A 4MIAA 2W7AA 1VQYA 5IWAJ 1U1QA 1N52B 5GMEA 2E7VA 2RILA 2G1HA 1U6ZA 1JKHA 3AH6A 2JOQA 2E1MC 5B0AA 2LVWA 3UCGA 1WHYA 2R7SA 3NNCA 3L7PA 2CPDA 4M5IA 2HZAA 1H74A 2XCAA 1RWMB 4OZLA 3Q8YA 2EXUA 4LF8J 3M6WA 4J5OA 1HI0P 2EPIA 3N0VA 4Z37A 2VUGA 4HDGA 1U4BA 1S99A 4DSKA 2GVZB 2I8EA 2XYPB 2BE7D 1S6UA 1TVRA 3PDNA 3I0SB 4QW8A 4I64A 2V4RA 1QE1A 1WOPA 3OR2A 2YQ0A 3W9JA 2GX8A 4TVAB 2D7SA 3J81Y 2E44A 4GKKF 2G1DA 4QWDA 2RHSB 2W2NP 4FYYB 2E5LJ 1SL0A 4DV3F 4TLRA 3GP9A 3QNWB 5HATA 4USWA 2UU9J 1FHTA 2C2OB 4M5JA 3ZZ0A 4Y2MA 3JSMA 2B4VA 3SCIE 1C0UA 2YH0A 4WFNQ 1HNXJ 2KKHA 3G71S 4XDDA 1CVJA 2ZH6A 4DR6J 3R8YA 4K4XA 2E1CA 2DCUB 1DLOB 4WWSA 1LK7A 4FS1A 3ILOA 5IT9Y 3MOZA 4FVCA 3MAAA 1IKXB 1Y0HA 3M8QA 2AGPA 4K4SA 3N4WA 3M8ZA 4Y0FA 2DGXA 2YH1A 4X4QA 4PQUA 2W25A 4KBIA 2MZJA 3OFFA 3GG1A 5KFUA 1RT1A 2GNKA 3V6JA 5K20B 1RTHB 4CO0A 3SZ2A 4AL7A 3LA0A 1HD0A 5KFYA 2WSFC 2M9KA 4F2SA 4CLWA 2BW2A 5LSLA 2W8KA 3S1TA 4CH7A 3T5HA 2AJQA 1U45A 2J8SA 3OFGA 4PG8A 3KLEB 5A8KA 4RW8A 4DFJA 3E51A 5B0GA 1W2IA 3T5KA 1X4HA 4EYIB 1U7LA 3UNYA 2F3JA 2VQEJ 4LF9F 4EI2A 1YIJS 1KHWA 1HR0J 3NBPB 3R9LA 4DV5J 4F3QA 2HNYA 2FGOA 4YDDB 3HSDA 4OL8A 3ETOA 1GT8A 4QIVA 2D3UA 5HROA 3HT0A 1QUVA 5KFQA 1RWOB 2AYBA 2JH3A 1KKHA 1C4CA 3GSDA 4L3KA 2SXLA 2RQMA 2WVBA 2FJAB 4KFBA 2YTCA 2MQ8A 2ZH7A 1XWLA 3VGSA 3A13A 5A2QU 3D2WA 1T9VA 4DUYF 2MLZA 2MKJA 2V4JB 4OYZA 2XYGB 3W8GA 4C97A 2WTFA 3FGVA 1HI1A 1M0SA 1VC6A 3EDRB 2FC8A 1GK8A 2LLZA 1FJGJ 2ZNZA 2D3ZA 3HHLC 1KSPA 3WIUA 2HMIA 2V8PA 5GAEU 1FX4A 1XJWB 1VFJA 1C1CA 4DJBA 2Y8YA 1FRIA 4AT1B 2KYZA 1VQ5S 2FVSA 4C98A 1U0HA 4RW4A 2AV5A 4ECUA 2VFVA 1C1BB 2GGPB 4RW7A 4ZCKA 2V8DA 4YDXA 3T6JA 2OIHA 3MM6B 3PNIA 3V81B 1ZTTA 2P6TA 4OYOA 5HN0A 4WBFA 4ZA1A 3FZ2A 1UAWA 5E5NA 2D74B 2J9CA 3IWLA 4YY3J 1RTJA 3M2RB 1WC0A 3M32B 2VFTA 4FF1A 1SI9A 3HSZA 1SXLA 1WELA 1KVKA 4HHHA 1VQ9S 4LBIA 4K2JA 1SV5A 4K0KJ 1XMQJ 1N5YB 5I42A 3M9OB 5HANA 4XPCA 3D1HA 1BXNA 4X4TA 1K1QA 1NO8A 2XC9A 3DI6B 4IH5A 3CCJS 2ACMA 1RT5B 4ICLB 4ALZA 4HEA9 2V2ZA 4ZPTR 2DXDA 5L9NA 3HHDA 3EDQB 3W64A 5A6PA 2XMKA 4OX9F 5HQMA 2VPYB 3RB3A 2VZ9A 1IR1A 3DYAA 5SUHA 4UY85 5HJXA 4I2QA 4JI1F 3G6XA 2ILYA 2R2RA 3TZYA 3PY8A 3LP2B 5J2NB 5F8MA 1OS5A 3CJ5A 2KT2A 1N0UA 1S72S 1UKUA 3DLKB 2GIRA 3AD7C 2DNMA 2R7TA 2WW4A 1TAUA 2XWXA 1RDRA 4ZCLA 5E3AA 2IC3A 4GC7A 4CO5A 3NCRA 4C3KA 1RTIB 2UUAF 2ZD1A 2A2DA 4RBUA 3S8SA 5K9FA 3DHWC 2B6AA 1ELOA 3V6DB 3OUYA 4TYAA 3W2VA 4CYUB 1OMSA 3MM5B 4ZPWR 4X62F 2UVUA 1IM4A 1TKXB 2JLFA 3QBCA 2J6TA 5DDPC 4DUYJ 4O3RA 1FWKA 1RHQB 4QW9A 1U09A 3RW6A 4R0JA 4UQGA 1FFGB 1VRTB 4CRJA 4YS2A 1RAOA 2UUTA 1NCLA 4I69A 5LJ5Y 4KRWA 4HHJA 2XHWA 4K4UA 5BR8F 3VV2B 4P10A 1NDLA 4B3RJ 2I2YA 4QR0A 2VBXA 4A48A 1HD1A 1SUQB 1XNQF 1FRHA 3GQCA 3D68A 2FVQA 2CJKA 5CCMA 3FCVA 5DDQC 4RWWA 1CJTA 1YG0A 3VAMA 3K17A 3B4DA 3LAMA 4DWIA 1NJWA 2MEWA 2MGZB 4JYAJ 2YWEA 1WF1A 2E1PA 2XI2A 4CLFA 4C7QA 4ECYA 1GX6A 3TANA 5C25B 2GVZA 2QFIA 3A8KA 4LSNA 2CDQA 2R2TA 3NEKA 4EO8A 4HI1A 1IKVB 3NNAA 3ZTQA 1TTHB 4CO2A 1H3DA 7AT1B 5A8WB 3SBMA 1LWCA 2EG1A 3BH7B 1TK5A 2CQ2A 3PV8A 4LFAF 2LEPA 4F4YA 2BJ7A 2RUGA 3RW7A 2XLKA 1S97A 3Q86A 5T7LB 5J2MB 4ZP7A 1RT3B 3RRHA 2PSZA 5F8LA 4DSEA 2Z30B 5KFPA 1F3VA 2Y0SD 3VWSA 3UDEA 1UTAA 3TA2A 1MROB 5KFWA 2BACA 1GTHA 1ACMB 1ZPVA 5CHCB 1SCJB 4KGKA 1A0OB 1DLOA 4X4VA 2CQPA 3KLHB 2ZZTA 4ILLA 4DR3F 4X2BA 1IKXA 2OKQA 2XLIA 2LXIA 3HFKA 3M2VB 2UXDF 3A8EA 5L8RC 2I1RA 3ZZZA 1RTHA 2HNDB 4OYAA 4ZPBA 3VAIA 2DNOA 2QYGA 2F7VA 2DJWA 5F0WA 1Q53A 1Y5IB 3W65A 1JLGB 4C48A 1R8CA 3A4TA 2ZM6F 4LFCF 1MLAA 3F41A 5L1JA 3TO8A 2VDHA 5KOXA 2C2DA 3TI0A 2GAHC 4WK3A 2IAJA 1E6VB 1H98A 5H9EJ 2RIJA 4KE5A 3B4MA 1ZZFA 3A1YG 2VBZA 5AE1A 1YQHA 2W9CB 2V8HA 4WK1A 2LQ9A 2CZ4A 3EX7B 2MZ1A 1X31C 4H4OB 4M5KA 1LWFB 2RQ4A 1ROFA 3GR1A 4Y2CA 4F36A 3L7UA 4DL5A 3GYNA 3K8VA 3KG1A 1AZSB 1N54B 4IFVB 3K8WA 3NWGA 3MXHP 2IVMA 2CNOB 1K73T 2BA9A 3I4PA 1TZ0A 2ZH3A 2W2QP 2DITA 4P72A 3SQOP 2N3OA 3G6VA 1WG1A 4B3MF 1RCOB 1HYSB 3TVZA 3JXOA 3P3DA 3ZZYA 3CJ8A 3RB0A 2CZVC 4JBCA 4B3SJ 2VKZG 3NL0A 1T9XA 2YNFB 3CUNA 3KHLA 3VAHA 2IM0A 3HHKA 5L46A 1UZHA 3M8YA 4DUTA 2P9CA 3BSNA 4QIGA 4BWJA 3AOAA 3D54A 3DOLB 4GVLA 3IC1A 5B0DA 1QAIA 4N7TA 1VBKA 1WSRA 2CQIA 2AYGA 3GPAA 2PE8A 2HK2A 3G87A 2X51A 2H48B 5C2CA 2GGPA 2IYIA 2KXFA 3D6TB 1RKJA 5KFVA 1VC5A 2VFRA 3PKYA 3V81A 1B0PA 3IWXA 4DL4A 4H4KA 2L48A 5K8NA 2CQBA 2QFJA 1S76D 4MTPA 4P6QA 2KRRA 5HMXA 4URGA 2PEBA 2HFNA 1G3OA 1U0SA 1F2HA 4DX8H 3QRPA 3TUIC 5K14B 1N32F 2LA4A 2XWYA 3M32A 1I1GA 3EXCX 3BQ1A 3ZNUA 3U02A 3IWNC 2RD5C 1V3SA 4ZS6A 1S1VA 3RYLA 1N5YA 1C0TB 3PIPQ 4OLPA 3UWTA 2VL1A 5DM7Q 2GFFA 3J7Z5 2B4OA 4OZ0A 1FFSB 2XSFA 3D67A 2F8MA 5H9FJ 2MYFA 5C24B 2AJFE 2L9DA 4ICLA 4USTA 3CCUS 1WEYA 3OJUA 4OJ3A 4E98A 3BJYA 2R8GA 3JTOA 1RP5A 2VBYA 2XO7A 4FF4A 2X3GA 4YB7A 5HP1B 2E7XA 4B9NA 1K47A 5LXYA 1Y3JA 1J5EJ 3K89A 2NSCA 1UPPA 4B9SA 4HTIA 1URNA 1U1KA 1RAEB 2IA0A 4C8ZA 4OX8A 4ZPDA 5AE3A 1T05A 1PC4A 3H4DA 3LP2A 5J2NA 3DLKA 4ZVEA 2A2CA 4IG0B 4QWBA 5AXLA 2OELA 1RT4B 3OSNA 1RA7A 1QDUB 1NMEB 1NLKL 4YHHF 2EG2A 4DFKA 3P45B 5LOQA 1RTIA 2LQ8A 3GFXA 3FQKA 2RKIA 4N5SA 5LSRA 3MEKA 3V6DA 2BRKA 5EGYA 3UE2A 4CYUA 3MM5A 2RDJA 2HW3A 3BB5A 4ZP8A 3OT9A 2X1AA 1ZTWA 1TKXA 2V67A 1LEOA 3G8SA 2IHR1 2FJXA 4EZ9A 4FN5A 2YNIB 1ZM9A 2W24A 3CEDA 1JMTA 1F5BA 2WVDA 1T3OA 3MF5A 5ETSA 2YVSA 4FP9A 4I6WA 4IR9A 1SUQA 1FRXA 4L6V3 4TKTA 5HSPA 5KFGA 5D4OA 2FB0A 3VHQA 4KC5A 4WFXA 2W4DA 4AL6A 1VQMS 3OXGA 2HQ3A 1I3OB 1R6VA 3NMRA 1GX5A 3HD1A 3FCHA 4HI2A 2MTLA 5GAEI 3R27A 2BKOA 4DSIA 2MGZA 2H5EA 5L39A 4TU8A 3FRZA 5C25A 1HNVB 2WK4A 4UOHA 2Z2YB 5HQ8A 3O8WA 1IKVA 2K7KA 1R6YA 2D9OA 3CSKA 3MM7A 2RH3A 2F8HA 5A8WA 4Y00A 3T1YF 4QBUA 4LSLB 3M2UB 3KYLA 3GE9A 2RNEA 3V4MA 2B8PA 4RR5A 4M1KA 1BQMB 2OHDA 4DV2F 4NRUA 1LW2A 4TQSA 1FXLA 5T7LA 4X64F 1RT3A 2V8VA 5DO2A 3H25A 4UY8T 5AJ3F 5CD4H 4F7VA 4JI3F 1MROA 1DY3A 4YR2A 2JLEA 3MMJA 2ZJPQ 4JI7J 1CSJA 2DIVA 5HMZA 4F4ZA 2UUCF 4UZBA 4CI0B 3K5MA 1N48A 3KLHA 1WNEA 1YJRA 2HSEB 1U2FA 3NCQA 3KLIB 3QSYB 1YTYA 3BGFA 2OFGX 2IBOA 5F8HA 4MK7A 1TL3B 2C2EA 1T03B 1SC3B 3H2VE 1OY9A 1WTBA 2XY5A 1X5OA 3LAKA 2JEFA 1V9OA 2LU1A 1I5OB 5HO4A 5IV3A 4MYTA 1SC6A 1BWVA 2WVCA 4X84A 1F0XA 2ATCB 1JLGA 1WC4A 2HHHF 3TAQA 1K44A 2BDPA 2WRMA 3WBZA 3G8QA 4LIWA 4I1TA 3TUPA 2I6WA 4IOAQ 4LBHA 3IR6B 2RQKA 3GONA 1E6VA 2IJRA 4WTYA 3R5AA 2HLUA 2W9CA 1IWAA 4H4OA 2BJDA 3PRBA 4MIWA 1LWFA 3KLFA 3ILIA 4K59A 2UVVA 4EO6A 4MMOA 4OI3A 1S9GB 4H4MB 3DN9A 4DQSA 3BGRA 2QA4G 1AZSA 4IFVA 2HFSA 3R7SB 2OPRB 3C19A 4AQYJ 1L3UA 3I0RB 5DLGA 3OFHA 2LQJA 4B3OA 2OJ3A 2HZVA 3OVSA 3AQOA 1CQMA 3CJKB 4M5DB 2HHPA 1F1BB 1QAXA 2MQLA 1H2TZ 2JSXA 2FVPA 2HS3A 2UZAA 4CZCA 1OJ4A 2EVZA 3CC7S 3PJXA 2YNFA 2H3EB 4F50A 4I6YA 4D3HA 1VBYA 1HQUB 1SVDA 2AMCB 3PXGa 3TOQA 3CCRS 2O66A 3RR7A 3F73A 4FF2A 2YQ1A 1RUSA 1MG7A 4KHPF 3TAPA 1VBXA 2NXJA 3MMBB 4NL5A 5I3PA 5ETRA 3M9MB 4WFYA 3TNVA 1WORA 1JJCB 3H40A 1RA6A 4YMEA 2NXEA 2FIUA 1Y00A 1ZM4A 4UF4A 4ZN1A 4DV0J 1VJQA 1NK9A 3G2XA 1U1MA 5IT0A 2CAJA 4MKVA 2W4PA 3K58A 4ELUA 5LT5A 4QU6A 2FHKA 3QIPA 1WG5A 1F5AA 4I56A 3OVAA 2JX2A 1R27B 3LPYA 3ZNJ1 4R25A 3TUZC 3BQ0A 4C6AA 1X5SA 2O01C 1C0TA 2VG7A 4LF7J 2AU0A 4IG3A 4N56A 1CBKA 5J2PB 2GQ2A 1VQSA 1IKWB 1YSJA 3R5GA 4ANCA 3GFHA 5D0GA 2DO0A 5B7WA 5ETLA 3FBEA 4C3LA 2WHOA 1ZYQA 1NSQA 4FXVA 4QIFA 5C24A 3E2EA 1U49A 1XNRJ 3CDUA 3WX8A 5U47A 2UXCJ 1FI4A 3HP6A 1F9FA 2GC8A 5HP1A 2J5AA 2UXBF 3DU5A 1T3NA 3FSYA 1SC4B 1HA1A 5IS2A 1G2EA 4IKAA 4AE5A 4DL7A 1RHRB 3M8PA 4YOEA 1ZM2A 5LMUJ 5GAGU 3KOAA 2ZOMA 1TL4A 3BZQA 3SDEA 2X3DA 3K5LA 4IG0A 4DR1F 4DCPB 1N5VA 4JB8B 3CJ4A 1TUVA 4HLBA 3IG1B 3KUGA 1M90T 2GIQA 4NA3A 2VG5B 1H2VZ 3HM9A 2PC6A 4WYLA 1RT6B 3JSBA 3DDNA 3M8WA 4W98A 2LQBA 2NZCA 4NLUA 1VRUB 1EETA 1SL2A 2ZE2A 4O44A 1YDLA 4NZ0A 4I2PB 1VK8A 1KQSR 1Q1KA 1IJEB 3UCUP 3GMGA 4X66F 4FKXA 1GMUA 1KDNA 3NGSA 2JNJA 2DRDA 1OQ3A 2YNIA 1A7GE 1WI6A 1JJHA 2DH7A 1MU2B 3MDFA 1Q4RA 2C2KB 4C11B 2L9WA 3CXCR 2MLYA 3TZXA 1RAGB 4TNOA 4HVZA 2E66A 2HRYA 5GADU 3LUYA 2XS2A 1PGZA 2RF2B 1UZDA 5H9FK 3ZXWA 5J2QA 3TEHB 4LR7A 5A8RA 3FQLA 1S9FA 3P96A 1RWUA 2NUHA 3D5MA 1RWVB 3H90A 2XI3A 1GNKA 2J7WA 4A8QA 4TY9A 3B82A 4R5PB 4F4XA 4NE9C 1FXDA 4Q0BB 4KTQA 4CQ1A 2ZBQA 1NAQA 4ANDA 3OL7A 3J7ZT 4N76A 2KN4A 3MM8A 1FT8A 1L3KA 3P8BB 3JB9k 5EUHA 2F9DA 1NK0A 2PA3A 1MMLA 4RUAA 2UUWA 1VQOS 4KB7A 3M2UA 4LSLA 3RAQA 1HNWF 2AP6A 5EWGA 1R0AA 3PJWA 1WOOA 1CJKB 1CC8A 1UJ4A 1LXNA 1S9EB 3AQPA 3HJFA 2E5IA 2AZ1A 1NPKA 3TA0A 2HQFA 2WVEA 3IO1A 2YKPA 2ZVSA 1U24A 3CJTA 2U1AA 3NGKA 3R5DA 1TMMA 2XG8A 3R2DJ 3DRSB 4P75A 3K5PA 3GYGA 3MGJA 1ZA1B 3MHYA 3BGOP 4QWCA 4ZVQB 3I9V9 3HX9A 1YX2A 3L09A 4NLDA 2OTLS 2XY6A 4RU9A 1TKZB 1TL3A 3GFYA 2QO3A 1T03A 1H7XA 1JK9B 2XMAA 4LRCA 1ZZNA 2XGQA 1H38A 3UPFA 2HZCA 4HDHA 2B3TB 1AFJA 5AE2A 3FFIA 3AFGA 1RCXB 2BYCA 2RDDA 1WKKA 2Z0GA 1AXQA 1Z2LA 4CT8A 3D0GE 2MKYA 3C14B 4G3IA 2F65A 1EARA 1V6HA 2VJUA 4N8NA 2W2MP 1WOSA 1WDDA 1OWXA 4OYWA 4Q8FA 4CLPA 2FGCA 4LF1A 1VQLS 4NXNJ 3ELHA 2XYHB 1NB2A 1OY6A 2E5HA 3QJJA 4WYWA 2GIFA 4ELVA 5E41A 3JTNA 1ZAXA 3FMWA 4QYZK 1X4AA 2LDYA 1S9GA 1IBMJ 4O0NA 4X65J 4URSA 4DG1B 2O5DA 4DEZA 2Y8WA 3ZZOA 2OPRA 1BQNB 3RG6A 1Q5VA 3I0RA 1SJFA 1WWHA 4IYQA 4DN0A 1SH2A 1ZPWX 4OJHA 3G82B 5KG1A 4KAIA 2VH7A 1R3NA 1V5VA 3LP1A 3UR0A 3IR7B 3GIJA 1NJYA 2ERRA 3OTEA 4ED1A 4ZDNA 2Q66A 1FKOA 2WBRA 3X3UA 2A6OA 4EGLA 2D3O1 1VCTA 2MZQA 5M2UA 2G2ZA 3NCPA 2F8EX 4HHUA 4Z7CA 1W26A 1LK5A 3AJ1A 1BY9A 1NK8A 2AD9A 1JLEA 2M0GB 4ID8A 2DHGA 9ATCB 3BBFA 4LVNP 4TN2A 3DHXA 1IQZA 3W2WB 1QSYA 2RS2A 2W8LA 2V5HG 4WU2A 3R7NB 2KFNA 5FD1A 1RGVA 3FEZA 2ZDOA 2XB2D 1CJUA 1N36J 2BQUA 3AHPA 2O1PA 4NI2A 2VODA 4RLEA 2Q79A 4O23A 3MPYA 1QAYA 2HBYB 2EFOA 3LALA 4TXSA 3QT6A 2BE2B 4DX6A 1IBLF 4WP9A 4CWBA 1WC6A 1GMWA 1LNQA 1YRXA 3PFOA 4AXIA 5KT3A 2UUBJ 1YBUA 5T41A 4Q8EA 2Y1IA 1G4CA 2RSQA 1T94A 5KFNA 1FNMA 3CIMA 3OD2A 2IM1A 4OZNA 1HNZF 2Y3YA 4DFPA 2HKEA 3VGUA 2HHTA 1IKWA 2CPXA 4GVBB 4R0EA 1U2CA 2E9ZA 4J9RA 2HHWA 1WD6A 5E3RA 1CPZA 1ZAVA 3T1HF 3MCSA 4J37A 1VK3A 2HEKA 1HBMB 2MJUA 3D3CJ 2VICA 1B70B 1TKTA 3BO4A 1JX4A 2HHXA 3H59A 3VVUA 3GIMA 3VAJA 1Y7PA 4LSZB 1FRLA 1QJHA 3PX0A 4YQWA 3GJRB 4QR2A 2PMWA 2EK1A 1ITPA 5IQQA 4LF6J 1NSAA 4KYZA 2MKIA 3DGPB 1KFDA 4DX7A 2XNQA 5CYJA 4KIAA 3MUMP 2OSRA 5KG6A 2XY7A 3NOCA 1HNIB 4I7FA 4P73A 3OV7A 3OR1B 3KMQA 3PX4A 1WEXA 3IG1A 4YR0A 1HWLA 3T9NA 3PVXA 4TU9A 2F63A 2DR5A 1N33J 1HARA 4A8KA 4JI6F 3OLBA 4NYOA 2XS5A 4DX5A 4QQBA 2ZBPA 3SV3A 1DQAA 4N47A 2ZWOA 4KH0B 4ES1A 2EFQA 2HQIA 3M30B 2OSQA 4DV6F 1VRUA 1JNRB 2N7CA 3BBCA 2QL7B 2IVYA 2KDOA 3MUVP 3G86A 2KYXA 2QJ3A 5E0OA 1WC5A 3THTA 4JI5F 2Z4PA 4DL0C 5SZTA 2ZKUA 2ZITA 1DAXA 4DV7F 4AXJA 1M5KC 2NCKL 2OEJA 5L38A 5KFZA 3QFWA 2IFXA 4C11A 2XMWA 2CJ9A 3NNHA 2YKOA 2H65B 2RB7A 3ENAA 1SQFA 3QSIA 1ZM3A 5B0CA 3UFCX 3K0JA 3QJLA 1SL1A 1GAOA 1YJUA 2DKOB 4I67A 4G65A 3QFHA 1KOHA 1NK5A 4B9UA 1FCAA 5KFEA 1FA0A 2ASJA 2J7KA 4WFAQ 4JV2A 1TVRB 5G4DA 1QE1B 2JL9A 1ZAWA 3TA1A 4NCBA 1TFYA 1LW0B 3QT8A 1SPBP 2M8DB 2FLNA 2LA6A 2XMJA 1EX8A 1YITS 1R8BA 4ZVSB 2JFKA 1QLNA 1IBKF 2R3VA 4QIWD 4DR7J 1X60A 2NZ4A 4FS2A 1XTZA 1CJKA 3EVOA 2NXNA 2EC2A 1S9EA 4PYAA 4ZP6A 2DH8A 3FKBA 4NXMJ 2GJFA 3RRGA 4IH7A 4PPZA 1S4EA 2B7BB 1B99A 4DHVA 3W7BA 1Z4UA 4P71A 1S1TA 5FJ4A 3GIKA 3DRSA 3AODA 5I3UA 1I51B 3MAAB 3T6BA 5H1SV 5KFSA 3BV8A 2CVIA 4ILRA 5CABA 2E29A 4PQUB 3SCLE 3MAQA 1OPZA 2MJNA 1TKZA 1RT1B 2ZZMA 3W5ZA 1IR0A 5CZXA 2CJBA 2IYGA 2FVCA 2Z58B 2ZH1A 2CWKA 3ISZA 2PI5A 3BYPA 2FDNA 4IQXA 2YWWA 4HT5A 1SIWB 3MURP 3OTDA 1MMDA 2OPQA 3NGUA 2DR7A 5F8GA 5GAGI 2HNYB 1HI8A 4LRDA 1NEEA 1RTDB 4DUZF 3KHRA 4ILMA 3FDSA 2JEIA 2HIQA 1FDDA 3PG9A 3SSRA 1QUPA 1FKAF 2V0NA 5D0HA 2LU2A 4FBUA 3TEGA 1YJTA 3J81j 4XK8C 3DDIA 4DPTA 2DYAA 3SV4A 3CCLS 2CA9A 2APOA 4DG1A 4LF4J 3DRPA 1WUUA 4Z7YA 1QAJA 4X4NA 5E3CA 3TQEA 3CVKA 2EBGA 5K5MA 3Q2TC 4CO3A 3EYZA 2QE5A 3C15B 4F04B 2RU3A 3G82A 2FY1A 3UDVA 2GO9A 3SXLA 2FY8A 9RUBA 3QJPA 1T02A 2GJIA 2Q6BA 5L1KA 3E3XA 2W4CA 2OH2A 3QT7A 4C4WA 1C1CB 2ASYA 4GO7X 4ZVRB 1U0HB 4U6PA 5M2PA 2QMXA 4URQU 3I87A 2OAUA 4IDKB 1RABB 3WQPA 1YVFA 3GIIA 3BR8A 5GADI 2CQ0A 5IC4B 3Q0AA 2HHSA 2H51B 3KTQA 4JUZA 2AKWB 3LGNA 2LKZA 3MEEA 1KQFB 2EFVA 3KMSA 1DQ9A 3PEHA 3RBEA 1MW7A 2CXEA 5ETPA 5E3QA 3V5RA 3IXQA 1RTJB 5KFMA 5IT9U 1X9MA 1B4SA 2XSJA 3H20A 2X1BA 3HKZD 4PG4A 1VQ7S 1EZZB 1D9AA 2KO1A 3OTBA 4BDPA 1BQXA 4B17A 3TRGA 5LMNF 3R3TA 4HL9A 1PYSB 4CNZA 1WTFA 3RAXA 3RBDA 3KNGA 2AEFA 4CIOA 1FEHA 2P9EA 2WW8A 3PW2A 3P49B 2AQ4A 4UOCA 4YB5A 2FHJD 4DZ6A 1Q16B 5ETNA 1RB0A 3HFZB 2F4VF 3C6TB 2HWHA 5KFHA 2ZKTA 3IBCB 4DI6A 5KFBA 2ASLA 1NHVA 4GVBA 3I56S 3O3LA 1V3ZA 2ALYB 2C2RA 2AF6A 1LKZA 5KG2A 2C3OA 4HYKA 2ZBCA 1NM2A 4MK8A 3MTKA 2MSSA 1Q82T 3GR0A 3FMBA 4O0IA 4DR5F 4DV4F 2V2KA 3DYAB 1HPZB 3BYRA 2U2FA 3O5TB 2EFPA 3MR2A 3PW4A 1UWBA 4G1IA 3CB4A 1S0MA 4WZQA 3NXZA 1WG4A 3KJNB 5LL6d 1RZMA 1QY7A 2WSEC 1REVA 2ZJRQ 1VIOA 1M5PC 2VPXB 3PEJA 3V6KA 3DGPA 2FJBB 4DUZJ 3RRKA 4LFBF 4ED2A 1I94J 2IC3B 2B5JA 1KS2A 4GKJF 3I31A 1YLXA 1HNIA 2R8JA 3N79A 3SIPB 3MCMA 4OQJA 3W2VB 3PHEA 2IRUA 4JV1A 5DDRC 1MWYA 4MJKA 1QM9A 4NLRA 1WKJA 4EEYA 4ZHRA 4NCGB 3M7VA 4M63A 1KQGB 4ZIVA 4C8KA 4NLYA 4RPFA 2HQGA 2R8HA 3J7YU 4NLTA 1KTQA 2CNNB 3LP0B 3OL8A 3KLGA 1DTQA 4OI4A 4OMFG 4ZVUB 5JJBA 2DNYA 1TFWA 4DR2J 3QLHA 5D8HB 2KM8B 2BQRA 3KWMA 5KOWA 3GJQB 3CJQA 2VIHA 2WCXA 1TV6B 4OZ2A 4OHVA 5HL7Q 2ZH9A 3CE8A 4ECVA 5GMKa 3ISND 2C3MA 5C7PA 3PW5A 3U1MA 1CJTB 2PN6A 2FHMA 3EZ5A 4NASA 2VASA 2IJNA 5J1NA 3QZ8A 1AA1B 3P5TL 1SH3A 2XBPA 3HVRA 1HBNB 1HWIA 2XMVA 5FDLB 2FD2A 2QYCA 4JI4F 1RHKB 4LSNB 4L3NA 2MKKA 2M2BA 1DFDA 2FJEB 3D4JA 1LW0A 3MOJB 1HBUB 4IQMA 4JI0J 1VLOA 4QWEA 3EVWA 1D9FA 2VA3A 3HHNB 4LF5J 1HMVB 1LWCB 1JQGA 4B3TJ 2VV5A 2G4BA 4JOUA 5DJBA 4L73A 1TUGB 1VRQC 4OJGA 1XMOJ 1FJEB 4B9LA 1O0PA 4ED0A 2MY7A 2QMUB 1GXTA 3QGGA 2FLLA 4DPWA 2V9WA 2Y1JA 2VQFJ 5HK4A 4P74A 1KNZA 3BBBA 5D0RA 2VC1A 2J9DE 5F9NA 1Q86T 1GH8A 4WP8A 2V4QA 3C2PA 2BQ3A 4OX6A 2BX6A 3TAMB 2KXNB 4UT4A 2UV8G 3PIOQ 2H1YA 4IR1A 4O3NA 6FDRA 3MAHA 2X7IA 3L9ZA 3B8HA 3ULHA 3GJTB 1DURA 4NCAA 2QL5B 5KG3A 3IS9B 4ECRA 1P6TA 3ITHA 2AX1A 2YNGB 4DV1J 2DNRA 4ETZA 1O5JA 1GEHA 4UTGA 1F2GA 2RVJA 3BN4A 3OL9A 4K5SA 2QC3A 2WOMB 2ROPA 1KLMB 3L4BC 3G8TA 2HPUA 4K7QA 4PXDA 1TUWA 2J76E 1SH0A 5IOLA 3UW1A 2JVOA 2IAJB 1B7YB 4M5MA 3KK2A 2M3DA 2DXFA 2PGCA 3UN5A 2BM0A 1UFKA 2E1RA 4CLYA 4FPIA 1RTDA 5L1LA 5D4LA 3NY0A 2VB6A 3QPIA 2G13A 3R5BA 2BJ1A 3NAIA 3CCSS 5KAKA 3W60A 1UVMA 1QTMA 3DC2A 3NRBA 2B7CB 3OQ2A 1UA0A 5CXTA 4FKYA 3F44A 2EI5A 2EBEA 2HIYA 2E7WA 3AXMA 3BKFA 5D6GA 4XAKA 2CPZA 3KJFB 2ZH8A 2GHWA 3M6XA 1NZ8A 1EP4B 1JWWA 2CQGA 4QPXA 1C4AA 1R8PA 4J9MA 2C22A 3AA8A 3KK3A 4PYDA 4F25A 1W2BR 3C15A 1PO6A 3MM9B 2CRLA 3K5OA 1CC7A 4RWXA 3L3CA 2RAQA 4DSLA 2CQ4A 1NXIA 3NKYA 4PWUA 4ZP9A 2FHJA 1UEUA 1WKLA 3L7OA 3RBZA 1FO1A 3BN7A 1PILA 5GAHU 3CCTA 2QLXA 2QG9B 2YKMB 1FXRA 4ZJOA 5BJRA 4KPCA 4GKKJ 3MPUB 4IDKA 1LFWA 4DV3J 1CULB 1N88A 1S0NA 3CCES 3CD7A 4LR8A 3SFGA 5KG7A 5KT4A 3KNAA 1NDCA 5L9XA 3UD4P 2V68A 1Z1ZA 2Z57B 4JI2F 1RU1A 4K4TA 4O3SA 1KR4A 2WONB 3NGRA 3I4HX 1IQTA 1S1VB 3QGIA 4FF3A 1U1RA 1BGXT 4KHRA 4LREA 3QO9A 4ECWA 3W63A 4UUXA 3VZHA 3S01A 3PW7A 2J8AA 3C6TA 4ZPAA 3QYYA 3DGVA 2HAIA 3W3SA 2BJ3A 1IXKA 1Q7LB 3Q2SC 3FUYA 2GAGC 1V3RA 3UCZP 3AAWB 2CPYA 2G0CA 1PBUA 4Y3CA 1UJ6A 3NMAA 2CQCA 2HGLA 4DFMA 2ZUGA 1HPZA 1T9YA 5EWEA 3JTPA 2R7OA 2W7OA 4C0HA 5A0YB 2VJVA 3KUHA 4LF9J 1T05B 3OTOF 3SSQA 1RWKB 1NJZA 3EPGA 3HULA 2BZ2A 4A8WA 4JV5F 3WHIA 3QZ7A 1TP7A 2PFDA 4UZCA 1X4CA 2Y1LB 4B02A 2C2NA 4P2MA 3KKFA 4JI8F 2H5IB 4USKA 4KHMA 1BMQB 4I68A 2RKIB 5IC6B 5IXUA 1NJXA 1UVKA 2Q43A 3I5BA 3UDCA 3KJVB 2M70A 2F5GA 2CQ3A 1U26A 3N5FA 3R7BB 1S1UB 4NCGA 5JVHQ 3GU0A 4PCQA 1U6FA 2PO4A 5EN1A 1NPRA 4ZLLA 1J27A 4RO0A 1CS4B 1QD1A 4DR4F 3LP0A 5GMDA 4C8LA 3T5JA 4NYPA 2BANB 3FNNA 3CCMS 4M5LA 2KZMA 2EWHA 3QGPA 2MMYA 2ZZNA 5ETKA 4QYRA 3MR5A 1TV6A 5HVFA 3W5XA 1VHFA 3HVTB 3D9BA 2HS0A 5DRKA 3HZGA 2FQQB 1TL5A 2ZH5A 5KFFA 1AB8A 1SC1B 1W25A 2RHQB 2CPEA 4DMZA 1TL1B 2A3JA 4P7VA 3BO2A 2LFVA 1HBNA 5FDLA 1HQEA 1DBDA 2NPIA 1XQIA 1FE4A 5J1EB 1RE1B 4DN9A 1MMNA 3UVJA 4JI2J 3MM7B 3Q8UA 1HBUA 3PZPA 2KXHA 2DPIA 1IUJA 4ZCMA 1HMVA 3D66A 5FLXU 5CA5A 2OD4A 2BOPA 4DLEA 2HWTA 3KDOA 4GC6A 1LW2B 3WIVA 2MKSA 3D0IE 4F0KA 2BR0A 1B7FA 2CDRB 3MEGB 4K50A 1YZ6A 2R7WA 2Z56B 2H5JB 5CAAA 2K8GA 1YJNS 4FDFA 1KD1T 1RBOB 1HBOB 2IIHA 4A47A 4XTTA 4WKRA 4Q44A 4LIRA 1RHUB 2DGSA 3BDPA 2CKWA 4OX9J 1HWJA 1NKEA 3TAMA 3K59A 2DRBA 3M6VA 4JI1J 4CLSA 5C5JA 2MXYA 2AWZA 2OEMA 3CD0A 4GO5X 1IJFB 2DR9A 1H72C 2GMLA 3IS9A 2OUGA 2YNGA 1YZ7A 2J9DA 1OSCA 4CH0S 2EK6A 2B4PA 3ZFVA 2WOMA 3D6MB 2PDAA 5ETTA 1KLMA 2UUAJ 1U1NA 2HG4A 2GVDA 5ITHA 1KC8T 3TJAA 3VQTA 1VMBA 5HLFB 2DGUA 3Q8QB 2KVIA 3UQSA 4UOGA 4X62J 4HH0A 4C8MA 1RKIA 3ZZTA 1DTTB 1AROP 5F0UA 3QRQA 3KLFB 1G1XA 2WB1D 3CDEA 4WU3A 1X7VA 1TL7B 2VPZB 3BGRB 3THVA 5KFJA 3C16A 4KR0B 4WFZA 5BR8J 1KTVA 2MZRA 2X1GA 5HMYA 5CCLA 5ADZA 2XNRA 1R0BG 4B3OB 1M5HA 1XNQJ 3L95X 2KG1A 1DQ8A 3HFVA 1ZETA 1SJ1A 1EP4A 4KGZB 1RI7A 1OY8A 2NQPA 2K2PA 2GQCA 1MNEA 3CJ3A 4R8UA 2Q6CA 3SI8A 1N34F 3BQ2A 2CPIA 2Y1RI 3J7YI 3DLLQ 4F02A 3UR3C 1WHXA 4K2XA 2CFXA 3IP0A 3MM9A 2VA2A 1S1WA 5IWAF 4ZVHA 4IRCA 4EZ6A 1X4GA 1D0EA 1L3SA 2R8KA 3SCJE 1IBCB 3KFWX 4LJMA 3A8IA 1L3TA 1SIZA 2DHSA 1RWPB 2F40A 2RDIA 1YJ7A 3MPVA 4U8VA 2VKRA 2YKMA 3OL6A 3HF5A 4LQ9A 1MWZA 5KFOA 4LF8F 3JS9A 1NU4A 3IN5A 4MFBA 3N28A 3QIDA 2MKHA 2NUUG 4C8YA 4ES3A 2DNGA 3JQKA 1CULA 1SJQA 2DNPA 1T0TV 4LFAJ 4CLZA 3ISNC 1LWEB 2V2QA 3VAGA 4KT0C 4M94A 1FKPA 4ED3A 2ALZA 5B0FA 4ZOSA 2W9BA 2QA4S 3C66A 4CLUA 3S7RA 2E5LF 5LJ3Y 3F0NA 4QZVB 2XMTA 2PMZD 3QIPB 3RZAA 1KQKA 4KO0B 2QEXS 2UU9F 4TLQA 3DM2A 4K8RA 4OZ1A 2DH9A 3HT3A 3MFHA 3RTVA 3ZC4A 1RT2A 3MCNA 3UDLA 2WONA 2W9AA 2FVRA 4A8FA 1P9QC 2M4MA 4J9OA 2VG7B 5DG9A 3PJ9A 1QTNB 2J7UA 1HNXF 4DR3J 3IMQJ 3EMTA 4IG3B 2GJ2A 2QA2A 1UPMB 4ZPCA 5F8NA 2XCPA 4DR6F 4EBDA 1UL3A 2ZVIA 2MZTA 3MD3A 3R97A 1RWNB 5FLXY 2UXDJ 4EMDA 3HHLA 4OHXA 2P6SA 3VZIA 3WDOA 3H7HB 3T5LA 4E8UA 1YHQS 3LOUA 2ZH4A 4ID5B 4U96A 2DISA 2FHOB 3WX4A 7FDRA 3FVYA 3TVYA 5HMWA 2ZM6J 1WF0A 1S6QA 2E9TA 2W01A 4LFCJ 1DARA 1JLQA 3MZIA 3V2UC 3MR7A 1U2RA 2CPHA 3M8PB 5A0YA 1R7IA 2YX1A 2PT0A
chains in the Genus database with same CATH topology
2ZBIA 5CYQB 3HLUA 2DNMA 2KFYA 2R7TA 1TAUA 3K2YA 2XWXA 2J6UA 1VS3A 3EZUA 1RDRA 3ZZUA 4ZCLA 1RT4A 5E3AA 3AY0A 2XNQA 2IC3A 5CYJA 3KK1A 3SDEB 4GC7A 4KIAA 4CO5A 3MUMP 1L3VA 2OSRA 2DR8A 5DGAA 3NCRA 4C3KA 5K8OA 5KG6A 4CT9A 1RTIB 2XY7A 3NLCA 2UUAF 1HNIB 2ZD1A 2A2DA 4RBUA 3S8SA 5K9FA 1DZ5A 4I7FA 3FSIA 2A18A 3DHWC 2B6AA 1ELOA 2R8IA 3OV7A 3V6DB 3OUYA 3OR1B 2VQEF 3KMQA 3MECB 4TYAA 3PX4A 1WEXA 3W2VA 1URRA 5MAOA 1HR0F 1U47A 1OSDA 3IG1A 4YR0A 3G6ES 1HWLA 4WF9Q 3MM5B 4ZPWR 2XZWA 3UI3A 3T9NA 4DV5F 3PVXA 4X62F 4ZVFA 2UVUA 1IM4A 3D28A 3OLAA 1TKXB 3EXYA 4TU9A 2JLFA 1D8YA 4RNHA 2J6TA 5DDPC 1SJ4P 4O3RA 3BREA 2DR5A 4FVMA 4QW9A 3Q24A 3CDAA 2HWIA 1HARA 4A8KA 3KJVA 4JI6F 2ROGA 4LVOP 1U09A 4QJVA 3RW6A 2YNHB 4NXNF 3OLBA 1VQPS 4R0JA 4UQGA 4NYOA 2XS5A 1HWKA 4QQBA 2FJVA 2XS7A 3SV3A 1DQAA 2QLWA 4N47A 1VRTB 1EETB 1NZAA 2ZE2B 4O44B 1S1UA 2DT9A 4ES1A 2EFQA 2HQIA 3M30B 2KHCA 2OSQA 1VRUA 2UUTA 4DV6F 4V19J 1JNRB 4I69A 5LJ5Y 3TW0A 2N7CA 3M4XA 1SB6A 4HTJA 4KRWA 4HHJA 4EU0A 2IVYA 1IBMF 2CQHA 1HHSA 2KDOA 3MUVP 2B9XA 2XHWA 4K4UA 3G86A 2KYXA 5E0OA 4X65F 5BR8F 3THTA 2KT5A 4JI5F 3GG0A 2Z4PA 2I2YA 2IRYA 4L72B 4DL0C 5SZTA 2ZKUA 2ZDPA 3C46A 4QR0A 2VBXA 2YWHA 4A48A 2ZITA 5DETA 1TK8A 1DAXA 4DV7F 4PWDA 4AXJA 1HD1A 1M5KC 1SUQB 1XNQF 4F4KA 1FRHA 2BANA 3GQCA 5L38A 5IM0A 2FVQA 2OP5A 2HNZB 2UV8A 2CJKA 2DPJA 5KFZA 5CCMA 2NXUA 2IFXA 1UMJA 4C11A 4WXWA 2XMWA 2OPSA 3H5UA 3MR3A 2CJ9A 1U1OA 3NNHA 3CD6S 3WZ0A 4AYBD 1HWUA 5DDQC 4RWWA 2RU9A 5KFXA 3LQVA 2YKOA 2PA8D 2RB7A 1YG0A 4C2MA 3VAMA 3DOKA 2VFUA 2XMMA 1FJGF 3HVTA 4RKUC 3B4DA 2GV1A 4Q43A 1ZM3A 5B0CA 3UFCX 2J0SD 1S48A 5J2QB 3LAMA 3K0JA 1TR0A 1SL1A 3QJLA 4F3MA 4DWIA 2JJ4D 2IMWP 5FIIA 5A8RB 3THPA 3HKWA 1NJWA 2J6SA 1WF2A 3LWLA 1GAOA 4QCLA 2MGZB 1VJWA 1YJUA 4BHQA 3CC2S 4I67A 2YWEA 1WF1A 4ZLPA 2XI2A 1KOHA 4OZ5A 1NK5A 4C7QA 4ECYA 1K1SA 4B9UA 1GX6A 3TANA 5C25B 5KG5A 4Q5VA 2HGMA 2R7QA 4NLWA 1FCAA 5KFEA 4CH1A 1FA0A 2ASJA 2J7KA 4WFAQ 4JV2A 2QT7A 1TVRB 1TL1A 1HNVA 5KFCA 4LSNA 2CDQA 2R2TA 5GAHI 1VQ8S 5G4DA 1FDBA 1QE1B 3RB6A 4EO8A 2JL9A 4TY8A 4HI1A 1ZAWA 4PR6A 3TA1A 4ECTA 1HQEB 4NCBA 4J9NA 1TFYA 1IKVB 4RNFA 1LW0B 4YR3A 3NNAA 3MM8B 1JLBB 5KT2A 2M8DB 2FLNA 2EKYA 4CO2A 2R7XA 3Q22A 4MKAA 2LA6A 1H3DA 2VG6B 2I5JB 5A8WB 3RU0A 5J1EA 2HHVA 2XMJA 3MFIA 4ED6A 1YITS 1D9DA 1R8BA 1FNOA 1LWCA 2JFKA 3HHEA 1VQKS 2EG1A 1TK5A 1QLNA 2CQ2A 2IJFA 1IBKF 3PV8A 3MEDA 4LFAF 4OIXA 2LEPA 4F4YA 3VAKA 2RUGA 3RW7A 2XLKA 2WSCC 3G4SS 1BQMA 1S97A 1AW0A 1A9NB 2YWFA 5T7LB 5J2MB 1XBWA 4QIWD 2JDJA 2J9EA 4YY3F 4ZP7A 1RT3B 2W7PA 4IRDA 1N36F 4K4YA 1R0AB 1VQNS 1DJ0A 2NZ4A 2R4FA 2PSZA 4FS2A 3RRHA 5KFRA 1QVFR 1XTZA 4OX7A 1XR5A 4MAKA 1NHUA 1UVLA 5F8LA 4DSEA 1GTEA 5KFPA 1S9EA 2Y0SD 3VWSA 4ZP6A 2DH8A 3TA2A 4IUFA 1MROB 3KHHA 4A8MP 4F3OA 3RRGA 1GXLA 4IH7A 4PPZA 3T1AA 2B7BB 4OLOA 4PG5A 4Q2LA 5KFWA 3MEGA 4K0KF 4DHVA 1XMQF 3W7BA 1YI2S 3IGNA 1Z4UA 4YP3A 1J5OA 2BACA 1GTHA 1X4BA 2ZHBA 3I55S 1ZPVA 1FJCA 3FEYB 1S1TA 4IOCQ 5CHCB 5FJ4A 4KGKA 3VALA 2UUBF 1DLOA 4X4VA 2CQPA 4WE1A 3GIKA 4PXEA 3HXMA 5DM6Q 3KLHB 1Y9OA 1C2PA 3DRSA 5I3UA 4NLOA 1HBOA 1X9SA 1OIAA 4ILLA 4DR3F 1ZOTA 2BJEA 3T6BA 1NK7A 4CCHA 3KLIA 5H1SV 4X2BA 1IKXA 2OKQA 3DLGA 4IFYB 2RQCA 3CULA 3DMJB 4KGMA 5KFSA 4ZCIA 3BEGB 2DNZA 2KH9A 2CVIA 2XLIA 2LXIA 3HFKA 3M2VB 4ILRA 4DBQA 4PG6A 2E29A 2DNKA 3M8SA 1R43A 4PQUB 3SCLE 3MAQA 1OPZA 1KEKA 2UXDF 2MJNA 1TKZA 1RT1B 2JZ5A 3A8EA 4NLPA 3O2IA 2ZNYA 5EX3A 2ZZMA 2UVWA 5L8RC 2I1RA 2K3IA 4MK9A 3ZZZA 1RTHA 5CYMB 2HNDB 1H2UX 4DS4A 4ZPBA 3EGZA 1IR0A 2DNOA 3VAIA 2F7VA 2MKCA 1P1LA 2ZOFA 5CZXA 1NB7A 1BC6A 2DJWA 3SCKE 3UNGC 1HW9A 2CJBA 2JVRA 3GWCA 5F0WA 2IYGA 1Q53A 1Y5IB 2FVCA 3TYTA 3MI7X 3M05A 2ZH1A 2I38A 1JLGB 3ISZA 3T19A 1R8CA 2ZM6F 2PI5A 2AJ1A 2FDNA 1SKSA 5KT5A 4NRTA 4LFCF 3F41A 3FFIB 5E3PA 1O51A 5L1JA 3TO8A 5KOXA 4YUDA 2AX0A 4A8XA 2C2DA 1N6QB 4IQXA 3TI0A 3WC2A 1P8GA 3LO3A 4WK3A 4HT5A 2IAJA 4P2SA 5KG0A 1UW4A 3VR1A 1E6VB 4YFUA 4ECQA 1SIWB 1H98A 5H9EJ 3MURP 3OTDA 1MMDA 2OPQA 2RIJA 3O6QA 4LF6F 4KE5A 2DR7A 3N6LA 3B4MA 1ZZFA 2M5YA 2BABA 2XMUA 3A1YG 5F8GA 3KHGA 2LEBA 2B56A 2VBZA 5GAGI 1SQEA 1YQHA 1FTCA 5AE1A 2HNYB 2W9CB 1HI8A 5HLFA 2V8HA 4WK1A 2LQ9A 2CZ4A 3EX7B 2MZ1A 1YJVA 4H4OB 3MMCA 3TUJC 3G6YA 4H4KC 1NEEA 1RTDB 4DUZF 1LWFB 2FUG9 2RQ4A 3KHRA 2QMWA 1ROFA 4OL8A 5F8JA 4A8OA 4ILMA 3FDSA 3GR1A 2JEIA 4K5RA 4Y2CA 4RW9A 4DL6A 1XN9A 2HIQA 1FDDA 3SSRA 3HK2A 1DTTA 2UP1A 1QUPA 5B0BA 1FKAF 3NP5A 2V0NA 4DL5A 2LU2A 4H4MA 3GYNA 1RK8A 3K8VA 1XMBA 4OHZA 3KG1A 3Q23A 4FBUA 1MSWD 4Y2KA 1YJTA 4X4OA 1OPIA 1N54B 3F56A 3K8WA 4IFVB 3CIZA 3NWGA 4XK8C 3MXHP 2IVMA 4YB1P 3FSXA 3FZBA 4F2RA 4N77A 1K73T 3TQ1A 1E6YA 1TAQA 1N33F 4DOZA 1OO0B 2FLOA 4BC7A 3SV4A 1RQ0A 4LT6A 2BA9A 3I4PA 1TZ0A 3CCLS 2ZH3A 3OVBA 2APOA 1VLYA 2RRNA 2NYIA 3M6UA 4DG1A 3DRPA 2DITA 3P6YC 5BYSA 1N5SA 3OXFA 1QAJA 4X4NA 5E3CA 2N3OA 3G6VA 1WG1A 3CVKA 4B3MF 2AGQA 4XDCA 2EBGA 5K5MA 1M5VC 2YX7A 3CJKA 4M5DA 3TVZA 1HYSB 3Q2TC 4CO3A 3N01A 1APSA 2DGQA 3P3DA 4F67A 3EYZA 2QE5A 3ZZYA 4USIA 5B09A 1PSDA 3RB0A 1P27B 2RU3A 2BM1A 1S7HA 2CZVC 2DB1A 3DNCA 3LP1B 4JBCA 4R8UB 2Q1LA 2VKZG 3NL0A 2HGNA 2FY1A 2GO9A 2YNFB 2C42A 3CUNA 3SXLA 4PPDA 1JLCA 2DGTA 3KHLA 4B3RF 4ERDA 3QJPA 3VAHA 2IM0A 2K1RB 1FESA 1T02A 3HHKA 2GJIA 2Q6BA 2QZ8A 4G1QB 5L1KA 4C0OC 3E3XA 1HQUA 3NGDA 1FKOB 1S1WB 2P9CA 3EGWB 2W4CA 3BSNA 4QIGA 1CLFA 2OH2A 4KV8A 4BWJA 1JLFB 3D54A 4C4WA 3OHAA 3DOLB 5JXSA 5B08A 4DS5A 1BLUA 1C1CB 2F9JA 3IC1A 3T3FA 1KLNA 2ASYA 5IFMA 3KG4A 4MIBA 3G9CA 5B0DA 1QAIA 4W90B 4GO7X 4PKDB 2MZSA 3MMBA 3MD1A 4I0WA 3DLBA 4U6PA 1VC0A 2CQIA 1U8SA 5M2PA 2UVRA 2QMXA 4URQU 3OSPA 3I87A 2OAUA 4OFZA 2AYGA 2OPPB 2PE8A 4IDKB 3DRRA 2X51A 1YVFA 3JAMY 3GIIA 3BR8A 5GADI 1XR6A 5D3GB 2CQ0A 2KRBA 1JLEB 3MMAA 2GGPA 5G0RA 3Q0AA 2IYIA 3HO1A 2CVEA 5IT4A 2KXFA 1RKJA 2HHSA 5C42B 4MFBB 5KFVA 1VC5A 2DD8S 3KTQA 1NK4A 1VBZA 4JYAF 4JUZA 2JC0A 2VFRA 2DNHA 3DDKA 3PKYA 3V81A 3LGNA 1U1PA 2LKZA 3MEEA 1KQFB 1B0PA 2EFVA 3KMSA 2VOPA 1DQ9A 3IWXA 4DL4A 4HH1A 4YB6A 2OMOA 4PUOB 4H4KA 3PEHA 2M88A 2L48A 3RBEA 5K8NA 2CQBA 2FPHX 2QFJA 1S76D 4MTPA 4J9LA 5DLFA 4RX6A 2VOOA 1MW7A 4P6QA 4TYBA 1LWEA 3CO9A 4OHWA 2KRRA 1FKPB 5E3QA 3V5RA 5HMXA 3IXQA 4URGA 1RTJB 2HFNA 5KFMA 1G3OA 2VD3A 2YKQA 2KFZA 4DX8H 3TUIC 5K14B 1X9MA 1N32F 2W9BB 4PRFA 4DQIA 2XSJA 2LA4A 3DXSX 1B0TA 3E01B 2KT3A 4I4BA 3DLHA 1T95A 3H20A 2X1BA 3HKZD 4PG4A 3PR4A 1VQ7S 2HYIB 1D9AA 2DRAA 2XWYA 2KO1A 3OTBA 2YKAA 3M32A 3NG8A 1I1GA 4BDPA 2CJQA 1BQXA 3EXCX 4B17A 3TRGA 5LMNF 4BC9A 3BQ1A 3R3TA 3U02A 3IWNC 4HL9A 1N0VC 2RD5C 4CNZA 1V3SA 4ZS6A 1VQ6S 1WTFA 3C6UA 1XK8A 4IOBA 1OQ6A 3RAXA 3DM2B 3RBDA 1S1VA 3KNGA 5EWFA 4WKYA 4KO0A 4MYUA 4CIOA 4DR7F 3RYLA 1RT2B 1N5YA 1C0TB 3VAFA 1P1TA 3CTRA 2WW8A 1FEHA 2P9EA 3PW2A 1LV5A 1JJ2R 3P49B 3PIPQ 2AQ4A 4UOCA 4AFFA 3R5CA 4YB5A 4OLPA 2FHJD 3KG0A 3UWTA 3CF5Q 4JV0A 1Q16B 4FNIA 4Y34A 2VL1A 5DM7Q 4O4GA 3M1VB 2FC9A 3I9ZA 5J2PA 3HMJG 2F4VF 1Q7YT 4M8LA 3ICLA 4NXMF 4RZRA 3C6TB 3POTA 2HWHA 5KFHA 2GFFA 1RISA 2ZFHA 2ZKTA 3J7Z5 1Z2ZA 2B4OA 3PO4A 4Q7AA 3K5NA 4OZ0A 2XSFA 5KFBA 2ASLA 1NJIT 1UVNA 2F8MA 5H9FJ 1NHVA 1SKWA 4V19X 2MYFA 3I56S 2DGVA 2AJFE 2L9DA 3O3LA 1V3ZA 4ICLA 3HHLB 5C24B 3H8YA 5AXNA 3CCUS 2C2RA 4OI2A 1S1XA 4BCAA 1WEYA 2AF6A 1LKZA 5KG2A 4U7UK 3OJUA 2C3OA 2KJVA 4HYKA 2ZBCA 5KG4A 4OJ3A 2IVFB 4E98A 4MK8A 5K8MA 3BJYA 4WJBA 2R8GA 3IAS9 3JTOA 1RP5A 2VBYA 3MTKA 1WHVA 2MSSA 2X3GA 2XO7A 3G96A 1Q82T 4YB7A 5HP1B 2E7XA 2CPFA 4B9NA 4K4VA 4DQQA 2H9ZA 3GR0A 1CEZA 5E2QA 4U7CA 5LXYA 3FMBA 4O0IA 3JYTA 1Y3JA 1Q79A 4DR5F 1TKTB 1NH8A 4DV4F 4ID5A 4RW6B 2V2KA 3DYAB 1UVJA 1HPZB 2NSCA 4B9SA 1S6QB 4Q45A 1LFPA 4HTIA 1F60B 2U2FA 3O5TB 1KFSA 4ED5A 2EFPA 4FBTA 5J1PA 1JLQB 3MR2A 3PW4A 1UWBA 2JLGA 2PD1A 1URNA 1U1KA 4G1IA 3CB4A 1S0MA 2CJAA 4WZQA 5D77A 2IA0A 2V94A 4C8ZA 4OX8A 1U48A 1WG4A 4ZPDA 2E9RX 5LL6d 5AE3A 1QY7A 1S10A 1PC4A 2WSEC 1T05A 2G9OA 3H4DA 1GQEA 4NOHA 4NLVA 2PEHA 2COLA 1REVA 3BM7A 3LP2A 5J2NA 1NRKA 2J0WA 2ZJRQ 3AB2B 1VIOA 4UW2A 1M5PC 2VPXB 3PEJA 3V6KA 3DGPA 2FJBB 3DLKA 4FZVA 4ZVEA 2A2CA 4IG0B 5KFDA 5CYQA 5AXLA 4QWBA 3RRKA 3CCWA 4XO0A 4LFBF 1RT4B 3OSNA 4ED2A 1RA7A 3OBIA 4B08A 2IC3B 3BF4A 4B9TA 2P5VA 3CMES 1X4EA 2B5JA 4YHHF 1KS2A 4GKJF 3DU6A 4WIIA 2EG2A 1S6PB 2E1AA 3I31A 4DFKA 3J7A1 2YY3A 4I7FB 2MY8A 1RTIA 1X4DA 1X5PA 3GFXA 2RT3A 1HNIA 2R8JA 3FQKA 3N79A 2RKIA 1NKCA 4OQJA 3WC0A 5HBMB 3W2VB 4N5SA 2B43A 1WACA 5LSRA 3MEKA 3V6DA 2VG5A 3PHEA 3TX8A 2BRKA 2IRUA 3MECA 2B0GA 2R2UA 5EGYA 4JV1A 3UE2A 5DDRC 5KFKA 2HHUA 4ZMMA 1MWYA 4MJKA 1QM9A 4NLRA 4MKBA 1RT6A 3MM5A 2RDJA 2HW3A 3BB5A 4ZP8A 1S77D 4EEYA 1G7CB 3CCZA 2X1AA 1ZTWA 4NA2A 2DNNA 4ZHRA 1TKXA 2POKA 4NCGB 4M63A 3HHLD 4A8YA 2B9WA 4Y28C 1FDNA 4DSJA 1LOUA 3EUNA 2CIMA 1A6LA 4CTAB 2YNHA 3OPKA 2YKNB 2N7YA 1KQGB 5F9LA 2JHEA 3G8SA 3TVKA 1FERA 3IR5B 4I2PA 4K4WA 3B78A