4ALZA

The yersinia t3ss basal body component yscd reveals a different structural periplasmatic domain organization to known homologue prgh
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
194
structure length
194
Chain Sequence
QLVEQEVRRLLATAAYKDVVLTSPKEGEPWLLTGYIQDNHARLSLQNFLESHGIPFRLELRSMEELRQGAEFILQRLGYHGIEVSLAPQAGWLQLNGEVSEEIQKQKIDSLLQAEVPGLLGVENKVRIAPNQRKRLDALLEQFGLDSDFTVNVKGELIELRGQVNDEKLSSFNQLQQTFRQEFGNRPKLELVNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YOP PROTEINS TRANSLOCATION PROTEIN D
publication title In Situ Structural Analysis of the Yersinia Enterocolitica Injectisome.
pubmed doi rcsb
source organism Yersinia enterocolitica
molecule tags Membrane protein
total genus 65
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2012-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1770 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4alzA03
4G1IA 4ALZA 3GR0A 3GR1A
chains in the Genus database with same CATH superfamily
1KNZA 2VHGA 2H1YA 2RVJA 3KTQA 2I38A 4K8RA 4NLTA 1HYSA 3OFGA 3MM6A 3BGRB 5DRKA 2VJUA 3DRRA 3M4XA 1ZZFA 4MKAA 2ZE2A 3M9MB 2GFFA 4WZMA 1CJUB 5CABA 4WYWA 4C98A 4IFYB 3KMQA 4O3QA 3SXLA 1X4DA 2DNQA 3DN9A 2D9OA 3H5YA 3P6YC 3DM2B 2JC1A 1RT2B 1PKUA 2V0NA 4CWBA 4W90B 4GVBB 1RT5B 4CH1A 4OJ1A 1QJHA 2H51B 3OL6A 2YPZA 2HYIB 3W7BA 3GV7B 5KFEA 4X2BA 3M6XA 1Q8KA 5F8GA 4DR6J 5A2QU 3OHAA 6AT1B 1FX4A 1WUUA 3B4MA 1REVB 3VGSA 5KFIA 4F26A 2NXCA 1LQ9A 3U1NA 2HWHA 1NNDA 3ET6B 3FEXB 4QBUA 2P9CA 2EC2A 4KGXB 2DGXA 4QIGA 4Q8FA 4DV4J 5CHCB 2XG8A 2BJ3A 3MCSA 2ZM6J 2ROPA 4WK1A 1MWZA 3R7BB 2AJ1A 2DGVA 1U09A 2XMVA 2NQPA 2YXLA 4QWDA 2R7VA 2X1BA 3UW1A 5DDPC 3OTOF 1GX5A 2CPXA 3DLJA 2C42A 5F41A 3I32A 2Q43A 3NMRA 1TKXB 3DYAB 1GMWD 2DPIA 3EJMA 2Q79A 1UWBB 4HLBA 4NLXA 4IQXA 2AT1B 3DLKA 2Q6BA 2EFGA 2ZH7A 4J9OA 2MMYA 1PSDA 1HKAA 2MKKA 5J2MB 2RILA 1Z2LA 4ZHRB 2BVZA 2DIVA 2OO4A 4J9SA 3T6JA 3GQCA 1P6TA 1JLQA 3TUJC 3ZZZA 3KUGA 4I69A 3M8QB 1CPZA 2XCAA 4OIXA 1IKWB 5JUMA 2RRAA 2Z8QA 4CYUA 4DHVA 4OJ3A 4O3PA 4RUAA 1M5PC 4RLEA 1HARA 5D4NA 1WEYA 3MTKA 4EBCA 2DD8S 2B4UA 2XWXA 2QLFB 1FJEB 3HZGA 4J9QA 2NCKL 4OX7A 2IRXA 2ILYA 1L3TA 1BXNA 2H4YB 3C15A 3M2UB 3ZTQA 3KK2A 5LL6d 3GV8B 2C2RA 3CB4A 1WOPA 1FFSB 4ES2A 2C2NA 3GTYX 4M5KA 1C1CB 5A8RB 3C3LA 5DDRC 3W2VB 4DR7J 4DV1F 1KLNA 3OR2B 1UPPA 1NH8A 1FRLA 4L72B 1V5IB 2DNOA 3DOMB 4EBEA 3LGNA 3LW5C 5D0EA 3H5XA 5HBMA 4LF7J 1UZDA 1T05A 2HG4A 1RWOB 3NL0A 3NNCA 1VHIA 2WOMA 1K0TA 3MUTP 5IOLA 4I67A 2HVIA 2PIIA 3MWBA 2OPPB 2DY1A 5M2PA 1RA6A 4L3NA 5J2QA 3LWMA 4F3OA 1NSPA 3O44A 3K5MA 3CIMA 2DHGA 1RTZA 4X64J 2H4WB 2WVDA 4YEAA 3OVBA 5C2CA 1VLOA 2RRBA 1NK8A 1D9DA 2Z2YB 1X7VA 3KKFA 2VPWB 2BZ2A 1NKBA 1Q5VA 2EFNA 2VFSA 5JJBA 2QX0A 3R5JB 3D6FB 1Z1ZA 2L9WA 1RT3B 4ILLA 5HROA 1KTVA 5GMKa 3QSYB 4USKA 1TKZB 4F04B 3SDEB 2QYGA 2OI2A 2PT0A 1RA7A 3CJTA 4QYZJ 3IR6B 1N8RT 3R97A 1XR5A 2RRNA 1D3WA 4DCJB 3OT9A 1VQMS 1M1GA 1R8CA 3X3UA 2KT3A 4HHJA 4R5PB 5DM7Q 1QUPA 5D4LA 5LOQA 3PEHA 4LSLB 2IHR1 3RBZA 2HGNA 3S8SA 4KKOB 1U26A 4LBHA 2XYPB 3I5CA 3W60A 2AD9A 1ZPWX 2JJ4D 2BJDA 2KM8B 1RI7A 3JQJA 4YP3A 1O5JA 4OZJA 3MMCB 3TARA 4BC7A 1RKJA 3HVTA 2F8HA 1Y11A 4QW9A 4Q2LA 3H2UB 5E41A 1EIYB 3IS9B 3I56S 5ETPA 2CDQA 2MZSA 2YVSA 3NKYA 2VG7A 2VC1A 3R6LB 1UJ4A 4FYYB 5AJ3F 1MN7A 1XJWB 4OJGA 4MJKA 1D9AA 2A3JA 2V94A 3H98A 4PR6A 4DLEA 3J81Y 2IAJB 4IG3B 4AQYJ 3PIPQ 2ZNYA 3TI0A 1RJJA 4WIIA 3Q89A 1RTIA 1N32F 2GMLA 3MUVP 4FS2A 2KYXA 2YQ3A 3LPEA 3DKDA 1RHKB 3PX4A 2C3OA 1H2TZ 3G6ES 2HMIB 3ILLA 3EZOA 3LGMA 3VGUA 1QAYA 3VALA 4YS2A 3MAQA 3EYZA 1Z4UA 2BANA 4PQUB 2HZAA 3SCIE 1VR6A 1IXKA 5L38A 1LKZA 4DUTA 2PA8D 5KFYA 3K5OA 1G3OA 4EEYA 1VQ7S 3ISND 3I31A 4CLWA 3LALA 3TWZA 1CJKA 3UD4P 4FN5A 2W7AA 3MMBA 2BKOA 4DN9A 1IKYA 5C25B 3TAPA 3DXBA 4X4SA 5DG7A 1VRUA 2VPXB 1FT8A 1HNXF 1GMVA 3CNQP 2E5LF 3KG4A 4RU9A 3W2WB 2HFSA 2AMCB 4J9KA 4NE9C 4DL4A 3DRPA 1Z2ZA 2J5AA 4RW4A 4OYBA 4PWUA 4OI4A 2VA2A 3P5BP 3HULA 3R27A 2IM0A 5JMNA 1OSDA 4AL5A 1V3SA 4RNNA 2GJFA 5ADZA 5HK4A 1URRA 2DCUB 4KH1B 2CJXB 3HMJG 3C14B 4B9NA 3KJFB 2ASLA 1S1XB 2CNKB 1U7LA 5THWA 1ZH5A 3MPYA 1H2UX 2N3LA 5CCMA 4RKUC 2QL9B 4R0EA 4DV6J 3UE2A 3LAMA 1BUXA 4DF8A 3CJKB 4GKKJ 2VG6B 2ACMA 2RE1A 1T03A 4JI4J 3H25A 4FKYA 4AT1B 1M1HA 2DXFA 2YPYA 3R2CJ 3BDEA 4A8WA 1JIHA 2HQ3A 4HVZA 1FD2A 4OZ1A 3AQPA 4CIOA 2FJBB 1HW9A 2XGQA 1MMDA 3Q8RB 2HHTA 3VGTA 4OX9J 2C2EA 3MECA 5KFHA 1HNVB 3UR3C 3L3CA 2YNIA 3MGJA 5B0EA 1XMQF 1NZ8A 3QZ8A 4FZVA 3FGVA 3I6PA 4CTAA 1FHTA 4OX8A 2BRKA 1UVIA 1Q8IA 4QPXA 2WVBA 3TZYA 1HMVA 3D1QA 3MI7X 4UOGA 2B5JB 5H9EK 3GSIA 1DZ5A 4O0IA 4G6VB 1S76D 2BUNA 3V4IA 5KG3A 3PJWA 4K4WA 2DNYA 4P6QA 1HWUA 3LP1A 3HKZD 2HHPA 4JYAJ 1IM6A 4M94A 5KFXA 3GR1A 3V2UC 3N0VA 3H20A 2GIRA 3TZXA 2V34A 4IO1A 4Q8EA 4USMA 1RUSA 3UDEA 3CJRA 1JLFA 3TO8A 4WFNQ 3GYXB 2DNZA 5KFDA 4ANEA 4A48A 4IO9Q 3R9LA 3W65A 4ZVFA 3WX4A 3CIZA 2DNHA 4P73A 2B8QA 3TYTA 2XM3A 4NYZA 4PYDA 4C97A 1RT7B 1S1VB 1HHQA 2AHOB 1FEHA 1RABB 1LV5A 4ZPDA 2VC0A 1HD0A 1S4FA 3HDSA 5DQGA 3V6KA 2FD2A 1FRHA 2V2KA 1T9VA 4ED3A 3AA8A 4N7TA 5J1NA 3NAHA 3ETOA 2R8IA 4UZBA 4OYXA 4DL0C 3A8KA 4B3SF 1N54B 3SFGA 2EXUA 2G4BA 1AW0A 2OPRB 1JJCB 5D15A 5EUHA 4ERDA 4G1PA 1KWMA 1H98A 4V1Ak 2I0XA 4OQJA 2R8JA 4IOAQ 3ZZ0A 4DN0A 4K4ZA 3MCOA 2VQEF 2PI5A 1N5SA 1KN6A 4YR2A 4LSNB 3DOLB 3H7HB 1IJFB 5AXKA 1DTQA 3QT6A 4RW9A 3LTOA 5MAOA 2MXYA 5BR8J 4U7UD 1C0TB 4Q2MA 2EI5A 4JI7F 4DV5J 2KJWA 1LOUA 2YKNA 2UXDJ 2DK2A 1YJ9S 3R1LA 1WDTA 1O0PA 4G65A 3KJVA 1IKXB 2NS1B 4EZ6A 4J9VA 4P2MA 2CJYB 2YH0A 1ZAXA 2B0GA 4L76A 2VU5A 3U7JA 5IM0A 2RD5C 3DFEA 2ZITA 1Y3JA 4CRJA 4H4MA 2JEJA 3PNIA 2CQ2A 2NZ4A 1X5PA 4RW7B 3ILJA 4I4BA 3V5RA 2ROGA 5KOXA 4EGLA 1UVMA 2C2DA 3EVOA 3QATA 4R8UB 2LEBA 3T1HJ 4NWBA 3DU6A 2MJNA 2P8IA 4UUXA 4ZVPB 3BEGB 3IR5B 2KDOA 4H4OA 2F4VJ 4WKYA 4DSJA 3QZ7A 3THPA 4JI1F 2JL9A 1NJZA 2DGUA 5KFJA 4DI6A 5F8JA 4J9RA 2XLJA 1P1LA 2YNHA 4ECZA 3PY8A 1U0HB 1KS2A 1EP4A 5HJXA 4XAKA 3P96A 4DX5A 2ZH4A 1B7FA 2DH7A 3GG1A 2HNYB 3MTJA 3MM6B 4N8OA 2DHSA 3IBCB 4WU3A 3FRYA 2IDLA 1PBUA 3OTBA 2V8DA 2XCPA 1EZZB 3EVWA 2DR7A 2IC3A 4ED0A 2KH9A 3D9BA 4WPAA 2OSRA 2RS2A 1Y4ZB 4LF9J 2JDJA 1V6HA 4K7QA 1R89A 3PV8A 1U47A 1U2FA 5DS7A 3BSCA 3RAMA 1B3TA 3LO3A 4QJVA 1S9FA 3ZZUA 1D8YA 2H9ZA 2JNJA 3DDNA 1X9MA 2DVIA 3EZUA 1LXNA 1NH7A 1SXLA 4CO0A 1LXJA 1XR7A 5GAGU 3BSAA 1X4FA 1HR0J 2MZ1A 1WSRA 2IVFB 5KFNA 3ILIA 2IM1A 3I87A 5L9NA 3BYRA 3D4JA 2E1MC 1C2PA 2AYMA 4LF2A 2K8GA 3EE3A 1SVDA 3MF5A 3GWCA 4DV2F 1MW7A 1Q95G 4NCGB 4NZ7A 3VV2B 4QYZK 1YJ7A 1GK8A 1D0EA 4X4TA 4AQYF 2YBVA 1C4AA 3BQ2A 2YX4A 2PC6A 3Q83A 3JAMU 2R7TA 1RBOB 2LXIA 2HNZA 3DLKB 2B4PA 2WRMA 3EZ5A 2FGOA 4Y2AA 1U8SA 2XZDB 2XMAA 1I94F 2OEKA 3GIKA 3OXFA 4YMEA 1Q82T 4DR3F 4F2SA 3GPAA 4DG1B 2KN4A 4F8RA 3KHHA 3HD1A 3WDOA 2DGQA 4FYDA 2RT3A 1MN9A 3B82A 4QPTA 1RSCA 2CWXA 2ZUGA 4F67A 2LQ9A 4CYUB 1BQMA 3RW6A 1T02A 1NU4A 3G6VA 1NK4A 2UUWA 5HMXA 1VQSA 1MWYA 2VONA 3HFKA 2HSEB 4FBUA 2W2MP 4IDKB 3RYLA 1P8GA 4YHHF 2A6OA 4DWIA 1NPKA 4LF4F 3FRZA 2YKAA 1NSAA 4Q0BA 3BH7B 4HI1A 2LA4A 2M4MA 3QNWB 3C15B 4B3MJ 4DR2F 1YRXA 3KK2B 2XYHB 1HBNA 3CCUS 4JI2F 5E33A 2PE8A 3TX8A 4PG8A 1M0SA 2MY7A 3AOCA 2CWKA 1S0VA 2ASJA 2QMWA 1RAAB 4CM0A 3MD1A 1NEEA 1V9OA 3QIPA 5A8WB 4M8LA 3MM5B 2KFNA 2DTJA 4N77A 3EPIA 1T05B 2IDEA 3BN7A 3CWJA 4K5RA 2YY3A 3W8PA 3R5BA 3V81B 4JOUA 3UN3A 4RO0A 5K14B 2WOMB 3SIPB 3TUPA 1PILA 2ZH2A 2FVCA 2A6MA 3KLGB 2OD6A 3MHYA 5J2QB 1FJGF 3SI8A 2I1RA 1KKHA 4F4XA 4KO0A 3W62A 3HVWA 3AODA 4DQSA 2CIMA 3R7SB 3GJQB 1NHKL 2BYCA 3PVXA 4TYAA 4ZVQB 2CQDA 4ZVUB 4DV0F 3HHLC 2U1AA 1TP7A 3AXMA 4FBTA 1S7IA 3GSDA 5HN0A 4CLPA 1ICEB 4YB6A 4JUZA 1SPBP 1MG7A 3DGPA 3G82A 2KRRA 3FEZA 1S5ZA 4C0OC 2QA4S 3D0HE 3QRRA 1EETA 2APOA 4F50A 2BJ7A 2XNRA 1YJTA 4MT1A 2ALYB 3DOKB 2EKNA 4ZPAA 3AD8C 3T1YF 3EM1A 4DFJA 1RTJB 3N28A 1WG1A 4EYIB 1KVJA 2XS5A 1T9WA 3C6UA 4PXDA 1ZETA 3PO4A 1ZBTA 3DCAA 5JVGQ 4JI3F 1CJVA 3QLHB 1WKJA 1YRTA 1D1UA 2QFJA 4M5DA 2LP4A 3HVTB 4HKQA 2VG5B 4RNMA 2XYGB 3CVKA 1JXVA 4TY8A 1OPIA 4DL2A 4OLPA 2VICA 4RPFA 2Z0GA 1M5SA 2ILZA 3AB2B 4PEOA 1KP6A 3B54A 4JYAF 4JV2A 3IWXA 3NCPA 1RAIB 5JVHQ 3D6TB 4GMKA 3GIIA 1N5YB 5DQIA 1LWFB 2LDIA 1RU2A 3PHEA 2LXUA 4O3RA 5HMYA 4LQ9A 4U8YA 2LA6A 4P7VA 3I0RA 3P3DA 3NGDA 4J90A 3HVAA 4CLZA 3W66A 3LP2B 1RTIB 3SBMA 2W8KA 3W9HA 1FRMA 1LWXA 3R5AA 2YWWA 4QZVB 2UU9J 3J7Z5 1SH3A 2J0WA 2HRYA 1L3KA 3LAKA 1QM9A 4DSIA 1OYEA 2ZD1A 3V4MA 4C8NA 1HQ2A 1K9MT 3NS6A 4Q7AA 2BACA 2WHOA 1X4HA 4K0KJ 1ZA2B 2CZ9A 4WWSA 4ZIVA 3K57A 2EFQA 2H5IB 2JVOA 4M95A 3EGVA 4TLQA 2QL5B 1GMWA 2QL7B 2M7SA 4LUBA 3PJXA 5DQHA 1RHJB 3KHGA 4J5OA 3EDQB 1N56A 1CJKB 4MIWA 4WZQA 1JLBB 3PYGA 1VS3A 2P5VA 1IKYB 1IBMF 4A4JA 2CUYA 3CW2C 4Y2IA 2C2KB 1I5OB 3G71S 5B0CA 4OYMA 4OYZA 1B7YB 4TYBA 4DPXA 1JLGA 3PG9A 5KFCA 2YKPA 2E5IA 4DZ6A 3CJ3A 1W2BR 1A0OB 3DRPB 5DLFA 2DT9A 4RW4B 4JI6F 2IY5B 1SH0A 4DV5F 4Z7YA 1XK8A 1VQ6S 2J0XA 4N56A 2A0FB 4FF1A 3VAGA 1QSYA 2ZZTA 1NB7A 2UUCJ 1YQHA 3TUIC 3VAIA 2WB1D 1H73A 3BGFA 4I7FA 4DV7F 3GFHA 3QBCA 1B70B 5GAEU 1Q7LB 3U1LA 3FBEA 3M6UA 4ZITA 4YY3F 4ZLPA 1N0UA 1N5TA 4NI2B 1SKSA 2COLA 3KUEA 2GVZA 3MEDB 1PCAA 4OJHA 4X84A 1HLWA 1ZZNA 3RJMB 2OTLS 1MROB 4RJVA 1SUQB 1QTMA 3DLLQ 2VOOA 3M8SA 1GXLA 4USJC 2YKOA 2BJEA 4L6V3 2B7CB 3A1YG 4P9SA 1YX2A 5DGBA 1PC5A 4P2FA 2V4JA 3MECB 1OO0B 1L3SA 1VYAA 2DNPA 2OMLA 2X3GA 4O4RA 2HHSA 2WBRA 3QSIA 4USHA 2VPZB 2YNIB 1ZTTA 4DPWA 2FPHX 4TKTA 4CLTA 5FD1A 3FZBA 2E9RX 4HTIA 1FJCA 2CPDA 5HP1B 4ED2A 3J7A1 3JSRA 3RB4A 3V4IB 2V50A 1SC4B 4WFXA 3BGRA 4MK8A 1RHRB 3LP1B 3WHIA 4KQZA 2HFUA 1MMNA 3GU0A 4IFYA 1FFGB 4KC5A 3SCKE 3OHBA 3NG8A 4ZJQA 1IBLF 1HD1A 2Y1IA 2XY6A 2IRYA 3DM2A 4YQWA 1FESA 4USIA 1HNZJ 1S9EB 3LP0A 1LWEB 4GVBA 1RT5A 4ECRA 3SFUA 2ALZA 5CQGA 4E98A 3RGIA 4QWCA 1YBTA 1UEUA 1L3VA 4RZRA 5HQ8A 2MKSA 4JP8A 1REVA 1OIAA 4ILMA 4K59A 3CDEA 1S1UA 5KT4A 1QUVA 4DXLA 5IT4A 1U1MA 2B3TB 3P4UB 3C16A 4K4YA 2AEFA 3GMGA 4KGMA 2XHCA 2MQPA 4WXWA 4DQPA 1VBYA 4BWJA 4DL3A 4PWDB 3K89A 4CM2A 3GJSB 1HFEL 1T0TV 5IXUA 2ZUAA 3CC7S 4PG5A 1S6PB 2UUBJ 3MFHA 2RIJA 4C3KA 4TNOA 1Y5NB 4WYLA 1IN0A 1UVKA 1TKXA 2L9NA 1UWAA 1E6VB 2XTJP 2W01A 1UWBA 3EXCX 2EG1A 3EPGA 1SIWB 3ULHA 1X5TA 1WC3A 3T5HA 5J2MA 3H2VE 3PX0A 1B64A 3VZIA 1HW8A 4ZHRA 1NJWA 4Y6IA 4MIBA 3VR1A 3GFXA 1X9WA 1CEZA 1WHYA 2E7WA 1RWMB 5I3QA 3HHEA 4OYWA 4DSFA 3M8QA 1HHTP 3HF5A 1JX4A 1DBDA 4F4AA 2FVQA 2VA3A 1KRPA 2CQ0A 5AT1B 1UVNA 2FLPA 2DO4A 3RUBL 1TFWA 5GAGI 4NXNJ 2KXNB 4EBDA 3D6HB 3SMZA 4MIAA 2AEJA 2HBQB 2FC9A 3BBFA 3CCVS 4QIEA 3MOJB 1FE0A 4I2QB 4CLFA 4DUZF 2R8HA 3HP6A 2FHOB 2E44A 3M2UA 4JI8F 3NNHA 2ZOMA 4ED4A 4CH7A 1DRZA 1U48A 2WSCC 3ZZTA 3DRXA 2Z2LA 5A8RA 4LFAF 3W2VA 1KQKA 1KHVA 1M5VC 2R8GA 4WCEQ 5E3AA 2E7XA 4LF8J 3PR4A 5IQQA 5E3PA 5K8NA 3GJTB 2AJ4A 5D4PA 4ELUA 3Q86A 2NUHA 1SV5B 4NA1A 1NKCA 1OQ3A 3LPYA 3BGOP 3OR1A 2CPFA 2HBZB 3O8WA 1BWVA 2OPPA 4H4OB 4C9DA 4LF1A 4I2PA 4I6YA 3K59A 1RLCL 1U1OA 4J9LA 4W4MA 3MAAB 5FJ4A 4DR1J 5EWFA 1EQ0A 4UF4A 3IWLA 4IR9A 4ZPVR 2M5YA 2IJFA 3TAMA 1FRJA 1O6XA 3A13A 4J91A 4JI0F 1RT3A 3ENQA 2AP6A 3AJ2A 4A8YA 3L4BC 4X65J 4OI1A 4PWWA 3I0SB 2A1BA 2C2MB 2GC8A 3AAWB 3SDEA 4ZVEA 4L74A 4F36A 4F3QA 4ZIWA 1TL5A 4ZLNA 2CZ4A 3MR3A 3HFZB 2JVRA 2VZ9A 1HNWJ 3OD2A 3LOUA 1HQEA 1U6FA 5KG2A 4R5PA 4X66F 3HHLB 3B8HA 2IA6A 3E2EA 4USUA 1K73T 4KKOA 3UFCX 1ZAVA 3CDBA 2GIFA 4KAIA 1WC4A 2HVZA 1U1NA 1KVKA 4CNYA 1GTHA 5C2GA 1B99A 1U49A 4NOHA 2B56A 2KTQA 5FDLB 1Q16B 1RAHB 2I8EA 1BY9A 2QLJB 4NLPA 3AOAA 4ZPWR 4NMLA 3EGZA 4F4WA 4F7VA 1CVJA 4KGVB 4Y65A 3BO4A 1KEKA 3S1TA 3OXGA 3DHWC 4B3RF 3V6DB 1WHWA 5KFMA 2XWYA 2R8KA 2KXFA 1PAUB 5EWEA 2Q3PA 2FVSA 2J6TA 3LA0A 3FMWA 2OH2A 2ZC3A 2N82B 4DMZA 3TJ9A 1X4GA 4UT4A 1UEKA 4ZK7M 2EG2A 4DPTA 2YKMA 2M0GB 4C3MA 4DF4A 1NCLA 2IAJA 4IG3A 1SL0A 2ERRA 3IGNA 4DU8A 3M2VB 3D0GE 2ATCB 3IRXA 1S57A 4DOZA 1S10A 1FKAF 1DTTB 4WF9Q 2UU9F 1VK8A 2UVVA 4RW6A 4USTA 2HMIA 3DNCA 1IM4A 2R7SA 3GCXP 3D6MB 2O5DA 1HBMB 2HQCA 1BHNA 2E29A 2QLWA 1GEHA 4GO5X 4XIUA 2GA7A 1W25A 3FBFA 1BQMB 4L75A 4KTQA 3CDUA 4DR5J 3RRHA 3T5LA 1RTDB 1RHQB 4IH7A 4N76A 3PKMA 1XR6A 4DV3J 1LFPA 2QE5A 4MTPA 4Q0BB 3NAIA 4DUYF 1M5KC 1TMJA 1NO8A 3VAJA 3IR7B 3KLEB 4KV8B 4FYVB 3BV8A 5SUHA 4I1TA 3UCGA 1IWAA 3K58A 1RT4A 4NXMJ 5C25A 4P75A 2ZHBA 2BW2A 1N36J 2MQMA 1F3VA 1CQNA 3Q23A 2V5HG 2AZ1A 2NREA 2A18A 4B02A 4R25A 5D0GA 1BGXT 4W98A 2PMWA 4W92B 2GW8A 3O5TB 3TRGA 3BKFA 2KZZA 3C19A 4K2XA 4HDHA 1OY9A 1UTAA 3SQGA 1OWXA 4IKAA 1FWKA 5BYSA 5ETKA 3C14A 3MEKA 4HH0A 1UW4A 1TV6B 2YWKA 3L7UA 4KO0B 4CO5A 2AF6A 4YDXA 1YLXA 4FYWB 3EWGA 4EU0A 2HHHF 5HO4A 1FERA 3OSNA 2ZVSA 1N33J 4LRDA 3CGIA 3CJKA 5KT2A 3N6LA 2VG6A 3CCWA 2KVIA 1V3ZA 2AX0A 1RE1B 2XMKA 4UY85 5F8MA 2RUSA 1LWCB 3DGPB 1XERA 4MFBB 2MQLA 1Q81T 5EX3A 5D3GA 1EETB 2G0IA 1EX8A 3PACA 1WJ9A 3AA9A 2PFDA 1R8HA 3IP0A 2J7KA 1HNVA 5CA5A 1S6QA 4N8NA 3OL9A 2BR0A 2M2BA 5HQMA 5KG5A 2C1EB 4B17A 3ADAC 1FJ7A 1GMUA 4UQGA 1UKUA 2X1FA 1JB0C 3HHLD 5J2NB 3UNYA 4HHHA 5B0DA 1BQNB 1UMJA 3M8PB 1CJVB 3M8WA 3BO3A 5K8OA 4M5DB 4B3TF 5D6GA 2KU7A 1A6LA 4F0HA 3AHPA 4NRTA 2KB2A 4TY8B 3O6QA 1TUGB 1WWHA 4HYKA 1DJ0A 2ZKTA 1MMLA 2LMIA 5GAEI 1CSJA 2HWTA 3IXQA 2BABA 3FKBA 2VODA 4WFBQ 2L41A 3MM7A 3HVRA 1FI4A 2OAUA 1WI6A 1WDDA 1KLMB 2ZHOA 4TXSA 2ASDA 2LFVA 2AIRB 1HNZF 5I4MA 2B9XA 2HLTA 2L9DA 3HK2A 1TUWA 2IA0A 2KT2A 1TR0A 2M70A 4FXVA 1N34J 1WC6A 4IH5A 1Y9OA 2Y8YA 2IBKA 4H54A 2K3IA 1RT7A 3G86A 4EUVA 4RUBA 4IOCQ 1F6TA 1OMSA 2VFTA 4OHZA 1YG0A 3FQLA 1FDDA 3JAMY 3AJDA 4WP3A 2VBZA 3AH6A 2VASA 2HHWA 2GMHA 1HWKA 3ELHA 3A3OB 2Y0BB 1WHXA 2W9CB 3RBDA 5GADU 1TQLA 1NRKA 5E3QA 2CQ3A 4DS4A 4XPCA 1L5UA 3TA0A 4F4KA 2G0CA 3PM9A 3IBFB 2AV5A 1KQSR 1K8AT 1YITS 1PC4A 2OPRA 3Q2TC 4NRUA 1LW0B 2XULA 2BJ8A 1LFWA 2VKZG 4DJBA 1UAWA 1ZA1B 3L9ZA 1SBRA 3NY0A 3KLIB 3OSPA 4ED5A 3OLBA 2FJAB 1NPPA 1QSLA 3HXMA 2RQKA 3DOLA 4LSNA 4LFCJ 1RAJA 3ZNUA 4ECXA 2MTLA 2YNFB 4AD6A 3H8YA 3AY0A 5GAHU 2DISA 4CDIA 4DDFA 1T7PA 1C0TA 2JZ5A 1GH8A 2JH3A 2J6SA 2DH8A 5DZ6A 3UO0A 2Y1JA 4RWWA 3VAHA 5ETQA 1ITPA 4PXEA 4O0NA 1BD6A 2W2PP 3HJFA 1FXDA 2OP5A 1QY7A 4KHRA 2HBRB 2K1RB 4I7FB 4Y0FA 1NUEA 4NL5A 4C8ZA 3NS7B 2OD4A 3CULA 3PW7A 1KONA 3QGPA 2F65A 3D67A 2YTCA 3FMBA 3W5ZA 2POKA 5B0BA 2XB2D 4RW7A 2GVZB 1Q7YT 4ZVTB 5ETSA 1HWJA 2E5JA 4H4KA 2R7XA 2DNMA 1CQMA 4ZLJA 4I6AA 2ZDPA 3EMTA 5LMUF 1N4LA 4ECWA 2YWHA 1EAYC 4X4UA 4FNHA 2ZFHA 2RDJA 2WCXA 4ID5B 4PUOB 5IFMA 2JHEA 4R8UA 1HBOB 2VFVA 3CO9A 3KLHB 2V4JB 2GIQA 3UI3A 3KK1B 4IOBA 3UDVA 4B3OB 5EHHA 2EK1A 1U1RA 3M6VA 4JI5J 2UXCF 4ZP8A 3VGVA 4ES1A 2BQUA 1RT6B 1RHUB 2UVRA 1U0HA 3IBWA 3IG1B 1VQKS 3JYTB 3F56A 3W63A 3IAM9 1F0XA 2HNYA 3KWMA 4DFMA 1SJFA 2FY1A 1WEXA 3HT0A 2NUUG 1VC0A 2MKIA 3KHRA 3NXZA 1R27B 2CQ1A 4ZPCA 3S7RA 4OYOA 3LP0B 2ZWPA 4NLVA 4RW8B 5F9NA 1R6YA 2BJ9A 2WK4A 3PJ9A 5DDQC 3G6XA 3N5BA 1VRTA 1JLCA 2VQFJ 1FNMA 1N0VC 2M8HA 2D69A 2KYZA 3EX7B 3P49B 2YX1A 2GAHC 5GMDA 2WW8A 2JLEA 5BYRA 1S1UB 2VIHA 2NXEA 5J2PA 3J7ZT 2GMJA 3C16B 3TUZC 1HL6A 4KY3A 4YB1P 1X60A 3IAS9 1G1XA 2YNGA 2UXBJ 3LGHA 2AJQA 5LMNJ 1CS4B 4PQAA 3TZZA 2GCFA 1KSPA 4U7CA 3MEGA 9ATCB 1R8BA 1CBKA 3BGLA 4NCGA 4DPOA 2YH1A 2JSXA 3UPFA 1XEZA 1R0CB 1JJ2R 2ZVIA 5KFTA 4O44A 5CYJA 3I4HX 2KFYA 2W2NP 3IRWP 2XSJB 4RBVA 3G2XA 2HQDA 1XNRJ 1YK9A 4CP5A 2XMUA 3R6GB 3BM7A 1WKLA 4OL8A 1XNQJ 1IR1A 4DG1A 3H59A 1U2RA 1WOSA 4RR5A 1HI0P 1U24A 1PGZA 1K44A 1T9UA 3OUYB 4LFBJ 4NX9A 4M5IA 2U2FA 2IJNA 3HPOA 3ZZOA 4G1IA 2N7YA 2DB1A 2QIFA 4MYUA 1SC3B 5F8LA 2IM2A 1HNIB 4TLRA 2W8LA 4YUDA 5ETLA 2XMMA 4IDKA 3P8BB 3K5NA 4NCAA 4M5MA 1XQIA 4ES3A 5HQLA 2GQ2A 3OFFA 2HS3A 4LR8A 2RB7A 4X62J 3OJSA 1U25A 4KHMA 3C8YA 1RTHB 2JRSA 3CJ2A 3DXSX 4KHPF 3BSOA 4X4VA 1GXUA 2P9EA 4ZCMA 1WG4A 5A8WA 2MQNA 1J5EJ 4DS5A 3MM5A 4FPRA 1XN9A 2CNOB 2OEJA 2HHVA 3V81A 3CPWR 5K14A 1F2GA 1GQEA 5LSOA 4B9MA 3OR1B 1T3OA 1TL4A 2MZJA 1WF1A 3KLGA 4I2PB 3MAHA 2GO8A 3BH6B 4C4WA 4WU2A 2P9GA 2N4DA 2FDNA 4TU7A 1DLOB 5DO2A 2HLUA 2I5JB 4HR2A 4K5SA 2XY5A 2WONB 1ELOA 1T9TA 1A7GE 1RYRA 3TAMB 1SL2A 4UOFA 2VDHA 2VUGA 4NCBA 1WOOA 4UOHA 1VISA 4U96A 1NK9A 3D3CJ 2EK6A 4ZMMA 2J6UA 4ELVA 2DGOA 2OFGX 4QCLA 4WP8A 4OI6A 1NAQA 2Y0SD 4DSEA 1KQFB 2XNQA 2VL1A 5LXYA 3RW7A 2FB0A 2MHEA 2KO1A 1Q8BA 3TAQA 1HQEB 3DOKA 4NLQA 3M30B 3CEDA 4N5SA 1TK5A 1RTJA 3RU0A 1KFSA 2UZAA 3R7NB 1DQAA 2YKQA 2H5JB 2XO6A 4C8LA 3IWNC 5CZVA 1X4AA 2LQ5A 3N4WA 2F40A 2QG9B 1VCTA 4GKJF 3QLHA 1RAOA 3HCXA 3JTPA 5DG9A 5DETA 3SSRA 3CJSA 1X0PA 2VG5A 1TKTB 2QMXA 2LDYA 2XLIA 1NXIA 2ZOGA 2G9OA 1T3NA 3TZWA 1G6BA 2ZBPA 2CZVC 1YJUA 2RQCA 4KSEB 5F0UA 3K8VA 3D2WA 3RRGA 3ZTSA 4IFVB 4U95A 3PXGa 1RCOB 5ETVA 1E6YB 3CJ4A 1WC5A 1N5YA 1R8AA 3QT7A 2JEFA 4QOTA 1LWFA 4F02A 4OZNA 4ZJLA 2YKMB 1RHMB 1YVFA 1RKIA 2Z57B 2OJ3A 5D4OA 3BPDA 5L1JA 4HEA9 4LRAA 2E7VA 3M2RA 3UWTA 4C0BA 3LP2A 5E2QA 4V19J 5ETTA 3IRXB 4LF6F 3TR5A 3W9IA 4URQU 1RWVB 4C0HA 3FFIB 1JLAB 2DHXA 4C11A 4A8XA 4MK7A 2QSWA 4RW6B 3VAKA 1XC9A 1TK8A 3L09A 3GIJA 3MR5A 3MMAA 1P9QC 1RWWB 4A47A 4HACB 3HFVA 1VQPS 3VTIA 3QJPA 4DPYA 4ICLA 4ETXA 3ZTOA 4TN2A 1NBEB 2ZC4A 1YJNS 3PX6A 3OTOJ 1FTRA 4QU6A 1FTCA 5JXSA 4BDPA 2UP1A 2F9DA 3LF0A 3GR0A 3JTOA 4OZLA 1ZS6A 3ISNC 2RMLA 3QFHA 1JLBA 1RT4B 3IM8A 1TMMA 3JB9k 2ZKUA 1PO6A 4K2JA 4DFPA 2NXNA 3POTB 3VVUA 4DPUA 2XO7A 2MQOA 2FJVA 4OHYA 2MB0B 1QAIA 2AWZA 3AJ1A 5A6WA 1MNEA 1FX2A 3UN5A 1DAXA 2QGFB 3KDNA 4DLGA 5IC6B 4N47A 3AT1B 3ZO7A 5IWAF 3A3NB 2XSFA 1JQGA 5C24B 5AXMA 2XQCA 3SQGB 4HDGA 1PJ5A 3TJAA 4PRFA 2HS4A 2CPHA 2HW3A 3X1LB 2R7OA 2RAQA 1S48A 2H3EB 1IBCB 1FO1A 1H7WA 4OZ0A 1FDNA 2XBPA 2CQ4A 2O3DA 4DV1J 2HFNA 3C46A 3CO0P 5I3UA 1F9EB 2FVRA 3MEEB 2FLOA 3NP5A 2DO0A 2R2TA 2EC0A 4NI2A 4ZVOB 2HQFA 1S6OA 1Q4RA 2GHVC 3MEDA 1XMOJ 5K8MA 3CMQA 3ICLA 4FYXB 1RCXB 2C2ZB 2GGPA 4KRWA 4HT5A 1ZAWA 3K8WA 1MROA 1OPZA 1SUQA 2B9YA 2DGTA 3TVKA 2DITA 4A8QA 5D3GB 4LF5F 1FK9A 4IG0B 2CJKA 1YIJS 3F44A 1QD1A 5G4DA 5LSRA 2QA1A 3R5DA 1S6QB 1RWUA 5T41A 4M5GA 3DMJB 1H74A 4S0MA 5L8RC 4FVMA 5GAHI 4ZN1A 2R7WA 1TTHB 3M1VA 4AXJA 3JSBA 2PA3A 1C1BA 3CCQS 3C6TB 1OY6A 3FNNA 2GQQA 1R8PA 4FPIA 3H42A 3NWRA 4DX7A 3GZ7A 3I96A 3QAUA 3SV3A 4ZOSA 5HP1A 3D66A 4RWXA 2KM8C 4MKVA 1P27B 3UDCA 4WKRA 4WTOB 4QR1A 1K47A 4URSA 1UJ6A 3H4BA 2LYVA 2D7SA 3MM7B 2R2SA 2QSFA 3G87A 3CCSS 4CQ1A 2C2OB 1KHWA 1JXEA 5AE1A 4J9NA 2W7PA 3KLVA 4U6PA 2R9LA 4YDDB 3AB4B 3MCNA 1S9EA 4CZCA 1LWEA 3TNVA 3QRPA 4UOCA 1F5AA 3H2LA 1IR2A 1N5VA 4DR6F 4E8UA 4DU7A 1QDUB 3HO1A 3FK4A 2AEMA 1H3DA 3MR6A 2HZVA 1WNEA 5D0RA 3M7VA 1BC6A 2CQBA 3GYGA 1DHMA 1YBAA 2KXHA 1TL3A 3J7YU 5AJ3J 2FZCB 3BYPA 1S6UA 2NSCA 4DQQA 4CI0B 3H0PA 4DV4F 1U1QA 2W4PA 2G1HA 2ZM6F 2RDIA 2PFFB 4PWDA 2LU1A 5F8HA 3A8EA 2XZWA 1HBUB 1N5QA 2LU2A 1S6PA 4WIQA 5L1LA 1N52B 2J0QD 4URGA 3C2PA 1N32J 3HKWA 4I68A 3MD3A 2DPJA 2PMHA 3BZQA 7AT1B 1E6VA 2N7CA 4OMFG 5BJRA 3UVJA 3CCJS 2F3JA 1YSJA 4Y2MA 2GAGC 3SCJE 4TU9A 4K4SA 1LK7A 2JLFA 1T9XA 1EB0A 3CJQA 4NLWA 2BBEA 1PYTA 3VAMA 2B8PA 4ANDA 4HH1A 2V8HA 1JKHB 4PYAA 2E1RA 2AGQA 3GFYA 1SC1B 2J76E 1MSWD 1FNXH 1JNRB 3GCWP 3RB0A 5C42B 4NLRA 3CUNA 1HIYA 2K2PA 1PBAA 2E5GA 4I2QA 3FSYA 2VFUA 4KGZB 1PG5B 2X7IA 1HNXJ 1RWNB 1WELA 2E5LJ 4CLUA 3ITHA 3K5LA 4RX6A 2OHDA 5B7WA 2XS2A 3VCDA 2GQCA 4DR7F 1UZHA 2Q66A 4OHWA 1QE1B 1NLKL 3OW2R 3MM9B 1AA1B 2CQPA 2KRBA 3W3SA 3M9OB 1RB0A 4LF7F 3R5CA 2CQHA 3ZC4A 2YWEA 4KB7A 3QGIA 1FXRA 4DZDA 1SV5A 4C8MA 4U8VA 1CULB 2CA9A 2BX6A 1RT1B 4USVA 3T9NA 3PDNA 1NPRA 1OJ4A 3QJLA 2EFVA 4OYIA 2MLXA 8RUCA 1TL1B 1HI1A 2M8DB 1RADB 4X64F 4OI0A 3A3PB 3HSZA 3MAAA 5KFQA 5KFAA 3GJRB 2XI2A 4TQRA 2CPYA 2VF3A 4GVLA 2V69A 4IH6A 1IQZA 3LANA 1UCNA 4ECVA 3I5AA 5KFVA 1IBKJ 4ECTA 5B0FA 3I0SA 2FIUA 2B6AB 1P9YA 1VBZA 2V2ZA 4QIFA 3G96A 1NKEA 1UA1A 1I1GA 3LH2S 2ZH1A 2CXEA 1PIEA 3LWLA 1XMQJ 5DZ7A 2A2CA 3JSMA 4CT9A 4BLGA 1JNZB 3IFEA 5A8KB 1X0FA 3HHLA 4ZA1A 4PXBA 3KJQB 3WC0A 4LMZA 1LEOA 2IRUA 1VRTB 1JLCB 5HMZA 4O3SA 2DRAA 1ZPVA 4X4PA 5FDLA 2Z56B 1VI7A 2VOPA 1F3FA 3CCTA 1C0UB 5IQ6A 5EDWA 4OHXA 1FEEA 4ENOA 3W5YA 4EK2A 3GP9A 5J2PB 4K4TA 2O01C 2DEIA 4LJMA 2IM3A 1ROFA 2CQIA 1AUSL 3V6DA 3IMQJ 1WG5A 2RNEA 1PYOB 3HX9A 2YNGB 4RNOA 4ED1A 1XMBA 3D1HA 3IA0A 2IMWP 2H5EA 3HJVA 3B78A 4WJBA 4IR1A 3MEGB 4M5LA 2P6TA 4KYZA 4CT8A 3KLFA 4IQMA 4O44B 2OKQA 1RAEB 2K06A 2V9KA 3QO9B 3EGNA 3RAQA 2GHPA 3JSYA 3H40A 2X1AA 3H5SA 3I82A 1T95A 3M2VA 1YJRA 4F4YA 4CLSA 2R2UA 1SQGA 4YN3B 1FRXA 1DTTA 3KUHA 3JXOA 3BKUA 3ZTPA 5CCLA 1OSCA 4LSZB 5IC4B 1HBMA 2CFXA 5BYQA 3BQ1A 4P71A 3CJ8A 2JEIA 3I9ZA 3OXLA 1CLFA 4B3SJ 2H65B 3E51A 1HA1A 3SQOP 2L08A 1FRKA 1R31A 1AYEA 1RTDA 2OPSB 2FVPA 1Y5LB 4EO8A 4NLGA 3KLEA 3FVYA 4KV8A 3RB3A 2VQEJ 1QTNB 1S9GB 4DSKA 2LEAA 3LUYA 3Q8VA 2LXFA 1CC7A 4M5NA 2M52A 1B0PA 5HLFB 4Q5VA 1AROP 2Z2ZA 2MHNA 3QQCD 2W2OP 2V4QA 4JI7J 1D09B 5L9XA 3S6EA 4CLYA 2A2DA 3CD0A 1B0VA 1RWPB 4H4KC 4RBTA 3ZFVA 2FLNA 3DLGB 5F0WA 3KOAA 3NCQA 2BDPA 3OTCA 2BA9A 2ZHAA 1KQGB 1IQTA 3NBPB 1TV6A 3FEYB 2CVEA 1ZM9A 4OYAA 3DLEA 3PCOB 4DV6F 3NEKA 5HI7A 4GKKF 3KXDA 1SCJB 2RHQB 1S0MA 3QT8A 4JI4F 1AZSB 1JLEB 3KHLA 3NGUA 1FKPA 1XMOF 3LQVA 2K7KA 3MM8B 3MURP 4PG4A 3PKYA 4FVCA 1LWCA 2HIQA 4KGKA 3NOCA 1WTFA 2W7OA 4MFBA 2XGPA 1X4BA 4EZ9A 1HQUB 1LW2A 1GTEA 2IFXA 2W24A 4OX9F 1TFYA 4ZVGA 4NYPA 3ZZPA 2OFHX 4BC9A 2UV8A 4QW8A 2NXJA 4JI1J 4U67Q 2KHCA 3F41A 1RAGB 1RLDA 3QMQA 1VQYA 2QMUB 1H0HB 2HVHA 1R7IA 5J2NA 1K1SA 2ZH5A 1EHWA 2W1BA 1BQNA 3PR5B 2ZJQQ 3M8PA 2GVDB 5I42A 4B9TA 2DRBA 2FTRA 5CZXA 2AYGA 1QVFR 3L7OA 2O67A 4KPCA 4NLUA 2PSZA 2HKEA 3T6BA 3G6YA 2WW4A 4C8OA 3TA1A 2ZJRQ 3HSDA 2BW7A 1NDPA 2BQRA 4FF2A 2D74B 3QIDA 4BS2A 1X9SA 1URNA 4J9PA 2IVYA 1KLMA 5E5NA 4QR2A 3PTWA 3D5MA 3D68A 3FSIA 4F0KA 4RUCA 3CDAA 1U1KA 3M2RB 3TA2A 2YX7A 3RBEA 3OFHA 2ZDOA 3W5XA 4FF4A 4O4GB 3OL8A 4LVNP 4C11B 3FCWA 1Q8LA 3R1HA 5T7LB 4NA3A 1IVZA 3UD3P 3QGGA 3FBCA 2ZBIA 4Z7CA 1NB2A 4FF3A 3MMAB 4P52A 1NHUA 1WORA 2ZH9A 5K8PA 5LJ3Y 4RU2A 2HHUA 3BPSP 3TQ1A 2W4DA 4ICLB 2W9CA 4DV2J 5E0OA 4CH0S 3M32B 4CLLA 1SJQA 3S01A 5L1KA 1UETA 2ASYA 4U9RA 2RKIA 5F8NA 3QT5A 3CCZA 1LW0A 2WVFA 4DR4J 4JB8B 1I94J 5DLGA 1YI2S 4O3OA 3KDOA 5E3RA 3RTVA 4DR3J 3GFZA 3KLIA 1U6ZA 4NMXA 5D78A 1LNQA 3BR9A 4PPDA 5J1EB 1W26A 2XMJA 5BR8F 3QYYA 2Z2MA 2YNFA 4DCOB 3EDRB 1BMQB 3FJ2A 3KG0A 1HPZB 1YBUA 2NPIA 4LRCA 4YHHJ 2UXDF 4LF4J 3DDIA 4NA2A 4ZS6A 3NOGA 3J80U 3OPKA 4RUHA 1U0SA 2VB6A 4YR3A 4DR2J 1N6QB 2K1RA 5A0YB 3R2DJ 2ZEJA 3J7YI 4JI2J 4JV5J 3CMAS 1S1TA 1VQ4S 3E01A 3F73A 1FCAA 2ZWOA 4I6WA 1P1TA 1FRIA 2W2QP 5I3UB 3NCRA 1X5SA 1X4CA 3U1MA 5RUBA 1UPMB 2GO9A 1PJ6A 1QSSA 2HIYA 1ZOTA 2B43A 3P5TL 2MGZB 5M2RA 4LR7A 1ZM2A 3DRYA 4TVAB 2GGPB 4OV1A 1MU2B 4NLYA 4IYQA 2LQ8A 2F1FA 5KFOA 1JJ4A 3DHXA 1FK9B 2FJXA 3T1HF 4ID5A 1FJGJ 3QWPA 4PUOA 1HBOA 3KLHA 3KK1A 3I55S 3GV5B 3BO2A 2F4VF 2V68A 4WE1A 3EGWB 1VMBA 5E3CA 4B3OA 3I9V9 5DG8A 1VHFA 3WQPA 1CJTB 4FXWA 1NJYA 1B0TA 2KKHA 3M1VB 8ATCB 1C1BB 2WSEC 4DV0J 3PIOQ 1O51A 2F7VA 4PG6A 4YR0A 1RT6A 1RBLA 1TZ0A 5DJBA 3G8SA 5D8HB 1L3UA 1U45A 4OI3A 2FJWA 1S99A 1RZMA 3IG1A 3WC2A 3JYTA 5H9FJ 1F9FA 2EWHA 1IBKF 3Q8UA 4IRKA 4LQ3A 2V6AA 3CSKA 2BKNA 5KT7A 3N6MA 3RRKA 3T1YJ 1YJWS 1F9HA 4DQIA 2OIHA 3Q8QB 4X4NA 1OYDA 2P6SA 3MXHP 3N01A 3KK3B 4LF9F 1SQFA 5HMWA 2XI3A 2LKZA 4XK8C 3FUYA 4RW8A 4MKYA 4JI3J 4K50A 5G0RA 2BM1A 3J7AN 4Y2CA 1K0VA 3M8YA 5IT9Y 2K3KA 4QIVA 3MPUB 2MJUA 5HVGA 3BQ0A 1YTYA 1FVSA 1Y7PA 2HURA 2Q6CA 2P2CB 2NLWA 3DI6B 3F0NA 1HR0F 1TL3B 2EBGA 3CD6S 1VQ9S 4EI2A 4UUWA 1KOHA 4PABA 2BE2B 1UP1A 1CS4A 3KG1A 3Q8PB 3JQMA 3OVSA 2IBOA 2J9DE 2DXEA 3NNAA 4CNZA 1XWLA 2NYIA 3ETMA 4KE5A 3QWUA 7FD1A 1I6JA 2ZOFA 2Y1LB 2HEKA 3UVJB 5L39A 2XSJA 3HT3A 5FLXU 4CLKA 4P10A 3AXKA 1SKWA 2L3MA 2ZBQA 3UDLA 1WC1A 3AD9C 4NASA 4FDFA 2GZOA 3RB6A 1SJ4P 4MH8A 3HZEA 2RDDA 5C5JA 3OUYA 2FY8A 2MSSA 2OPQB 4OYPA 1HNIA 4ZP9A 1VRQC 4UTGA 1RDRA 3UN2A 3E3XA 5L46A 1H38A 1AB8A 1D9FA 2QA2A 4LBIA 4B9VA 1IBMJ 2UVWA 1NK6A 4LBPA 4B3MF 1TVRB 1VJWA 3W61A 4OZ2A 3WBZA 2R42A 5CYQA 2AKWB 3ITHB 4C7QA 1YHQS 1RTHA 2VV5A 1WTBA 1IJEB 2CQCA 1FKOB 1UEVA 4NEZA 2BOAA 2A10A 2V63A 2J9CA 4JI6J 3KFWX 5BXIA 2NR0A 2E5HA 4B9LA 1B4SA 4MAKA 5FIIA 4ZPBA 1RQ0A 3OLAA 1H7XA 3PRBA 2QEXS 2BQ3A 4YB5A 2FHJD 3BJYA 1VK3A 4CO2A 2MYFA 1AFJA 2M9KA 2G2OA 1S79A 2DR6A 1I3OB 4DV7J 4CO4A 3EVMA 4FXDA 2JFKA 2KJVA 4YY3J 4R0JA 5B0GA 4LRFA 1DLOA 1RWKB 2V67A 2C3MA 2I5JA 3CCMS 3D28A 2WONA 4F0MA 1MWQA 1WF0A 1VQLS 4QWAA 5CYMB 2MLYA 4O3NA 4YB7A 1N88A 3DLBA 2B9EA 1YZ7A 2PN6A 3ZTRA 2XMWA 3BS9A 1XBWA 2C3YA 5H1SV 2JX2A 4DX8H 2HHXA 3UCUP 3ENWA 2QFIA 2BE9B 1RYSA 2QYCA 1V5VA 2HGLA 1UL3A 1R0AB 2E1CA 4Q45A 2DR5A 4WK3A 4PCQA 5KFLA 8AT1B 5KAKA 3R8YA 1S49A 5C7PA 2PEBA 3JSMB 4HL9A 3D3BJ 1S59A 3M30A 3DGVA 2X51A 1JJHA 3GIRA 4N41A 4IRCA 4KPYA 2Y9HA 4P2XA 3OL7A 1FF2A 3ZXWA 4NLSA 1HYSB 2J7UA 5ETRA 3DRRB 2ZE2B 3CCRS 2AJ0A 5D77A 4A8MP 2E1PA 1TKTA 1MLAA 2MKHA 1M90T 1S7HA 1AUDA 1SL1A 4C48A 3Q24A 2LCWA 2VPYB 2ZBRA 2AX1A 2F63A 5KFZA 1SKUB 5F3TA 1GFWB 3NGRA 3NMAA 1IBLJ 3PW0A 3TP2A 4FKXA 1ULRA 3DRSA 2CG4A 4ED8A 2AJ2A 4IFVA 3GILA 5KG6A 3OJUA 1IKVA 5KFSA 5T14A 1E6YA 1W2IA 4NEYA 3IO1A 5EX0A 2D9PA 3KLFB 2B7BB 2F5GA 1A9NB 5KG4A 2ROEA 3B6BA 1FD8A 2EW9A 2V2QA 3G9CA 3HHKA 2D3UA 1NSKL 2FUG9 3T5JA 4UQTA 3W64A 1VBKA 3FFIA 5HVFA 1JLAA 2HBYB 2DNNA 3PRDA 3MUMP 1TUVA 1DURA 3OTDA 5F3ZA 4HACA 1HI8A 4F25A 2W25A 4ZPTR 4K0KF 1F2HA 3TW0A 2H54B 4XDDA 4OZ3A 4E2FB 2X3DA 1RGVA 4ECQA 3TX0A 4ITSA 2AGOA 2QA4G 2E9TA 4P7TA 4DR4F 1RP5A 1I51B 3RG6A 3BKTA 2HRUA 2HFZA 1T11A 1JLQB 2CPZA 2RF2A 5HJYA 3HHDA 3O3LA 5HVHA 2ZZNA 4Q43A 3POTA 4A8OA 4WFYA 2JC0A 4A8FA 4ZCKA 2DNLA 2UUTA 1U02A 3OFEA 4ZVSB 2ADBA 1F60B 5AE3A 2WBMA 3T5KA 4DQRA 1FNOA 4UW2A 3U02A 3FSXA 3VWSA 1SQEA 4A8SA 3Q2SC 5C24A 2XHWA 3TVZA 2UUCF 3PYEA 2ATLA 3SEOA 4DUZJ 4DL7A 4ZDNA 3HLUA 4OZ5A 4JI8J 4ALZA 3ILOA 2C22A 5HANA 2MZQA 4JV5F 3DLEB 1XIQA 2Y1RI 1KC8T 4LFAJ 1WHVA 4YOEA 2BM0A 4DSLA 2FJEB 3R5GA 9RUBA 1J5OA 3MEEA 1H6KX 3ISZA 2W9AA 3N9UC 5HBMB 3P45B 3KMSA 1VIOA 1WF2A 1FKPB 1GX6A 5IV3A 2NYHA 3DDKA 2MLZA 3QFWA 2G2YA 2HWIA 2BE7D 3TEHB 2I9SA 1S12A 1AFIA 1LW2B 2BXJA 3T1AA 4K4XA 2CADA 1R6VA 2DNKA 2QLXA 2ZH8A 3CD7A 4IG0A 1NM2A 2ZH3A 2XS7A 3HD2A 1VC6A 2KI2A 4EWTA 2IPOB 1T8EA 3IC1A 2HK3A 4LIRA 2Z30B 3CD5A 2HFOA 4Z2XA 4FS1A 3JTNA 2CQGA 4Y00A 3GG0A 3DMJA 2D41A 3TEGA 1KDNA 1FXLA 3ZZYA 5HROB 2DYAA 2C3UA 3WX8A 4JI0J 1G4CA 3C6TA 2FGCA 3MR2A 2R3VA 5I42B 2PGCA 4J7CA 1RXOB 2QRRA 2N4CA 1TU0B 3PZPA 2J9EA 4NPOA 5KT5A 2PD1A 1TL7A 1VQ8S 3R3TA 3NGSA 1HWIA 5GMEA 1S1WA 4V19X 3UD5A 5IV4A 2DGWA 2IJRA 4X66J 4M63A 2DHAA 2V8GA 5ETOA 2ZZMA 2QT7A 2ZNZA 1YGYA 5AXNA 4F2RA 1NK7A 4B9SA 4USWA 2J7WA 5HSPA 1AXQA 2KG1A 2KFZA 4G1QA 3VVTA 4DL6A 3WIVA 3CJ5A 5KG1A 5A2QY 3GLJA 1H2VZ 2V8VA 4RNFA 2DH9A 2VG7B 4B3RJ 2F8MA 1U1PA 3CMES 3HI9A 1WKKA 5SZTA 2QN6B 3PEJA 4ZKAA 1VIXA 3NRBA 3FCHA 5CD4H 1WEZA 3PRVA 2MY8A 3HSGA 2RU3A 2CJAA 5H9FK 4RL1A 4KT0C 4ZN3A 3QRQA 1LK5A 2EEYA 3T9ZA 1HBUA 1DARA 2MZTA 2UUBF 3US5A 2RKIB 1VQOS 4KFBA 5I3PA 3THVA 3BREA 4HI2A 2G13A 5B08A 2VBWA 4Y3CA 4P74A 3TQEA 1BWEA 1UFKA 4Y2KA 3UQSA 1H72C 2Z58B 3OV7A 3RR7A 4U7UK 4HTJA 2FC8A 5ITHA 4LRBA 1BLUA 1VBXA 1UVJA 2BANB 2AU0A 3J81j 3B4DA 4ID8A 1JKHA 1UVLA 2RU9A 3BBCA 4BHQA 4GC7A 5HAOA 2AQ4A 2JEGA 2BEFA 2WSFC 5C42A 4GC6A 2QZ8A 2AW0A 4DUYJ 4NXNF 4XDCA 3W9JA 3MMBB 2BJ1A 2HVDA 5AXLA 1R0BG 1FVQA 2DGSA 3C66A 1VC5A 2K7JA 1VRUB 3MZIA 1S1TB 1SI9A 1R3NA 1YJVA 1OY8A 4X4RA 3E01B 2XMTA 2V4RA 1ZM3A 4KIAA 3TJ8A 2MSTA 2VD3A 2HRTA 1EJ7L 1CG2A 3JQKA 1U4BA 1KFDA 3VZHA 2VBYA 2QTWA 5K20B 5KFBA 1QE1A 2W9BA 1Q79A 4LF8F 2HFVA 2WAQD 3MM9A 1APSA 4ZVHA 3K5PA 2MZRA 3N79A 4OFZA 2QC3A 1JK9B 1Q1KA 2HNDA 1R43A 2IYGA 1CULA 4RNHA 2Y8WA 1WSVA 1HHSA 3AOBA 4QWEA 2VKRA 4EFAC 1RT1A 4WE1B 2HHHJ 2MPUA 2NXUA 4DFKA 1Q5YA 1TL1A 4MYTA 1T03B 3EXYA 4BBYA 1Q86T 4DR1F 3GYNA 3NGTA 3CJ0A 1VJQA 2B4OA 4FP9A 3DU5A 3BF4A 4ELTA 2RHSB 3Q8SB 1T9YA 1PJ7A 2CVIA 3H5UA 1S77D 4X65F 4IUFA 1X8DA 4L3KA 2DKOB 3OTEA 2B6AA 2OEMA 1M5HA 2FJDB 3PW5A 5D0HA 3BB5A 3CCLS 2G1DA 4QWBA 1AT1B 1M1KT 1HNWF 2J8SA 4HT7A 2AYBA 4QQBA 4CTAB 5A8KA 2OLWA 3A8JA 1VGYA 4B3TJ 4M1KA 1HMVB 1K1QA 2M88A 5G0RB 1S4EA 4F3MA 5U47A 4LVOP 3T41A 5KFKA 2XY7A 4J9MA 1C0UA 1CJUA 3FC9A 2GJ2A 2GX8A 2KZMA 3G4SS 3MDFA 3M8RA 4ZLLA 4AUKA 4NLOA 2FQQB 4NYOA 3CXCR 1XTZA 3A8IA 5KG7A 1RT2A 2CPIA 1JLFB 3BSNA 4QU7A 1FWPA 3GB0A 1FDBA 4AFFA 1TAUA 4ATNA 1FDAA 6FDRA 2FLLA 1WACA 3MCMA 1IR0A 4NZ6A 3RBXA 1SJ3P 5LJ5Y 2YWGA 4QR0A 2AJFE 2RQMA 3QO9A 3GIMA 3SCLE 4PKDB 3N5FA 4PXCA 5DGAA 3THTA 2CJBA 1IUJA 2LEPA 2HQIA 3ET6A 4AXIA 5K5MA 3KYLA 4ZCLA 1KTQA 2VJVA 2RSQA 3J81U 2ADCA 4MMOA 3HM9A 2FZGB 2Q1LA 1QAJA 2UUAJ 2CAJA 5KFGA 5LT5A 4AYBD 4ECYA 1F5CA 4DR5F 2PI4A 3RR8A 4ED6A 3G8QA 3DYAA 1QAXA 4DCPB 5IT0A 2B9WA 5KFRA 4DV3F 2OPSA 4B08A 1U8WA 1NHVA 2PEHA 2RH3A 5K9FA 2HAIA 2G0JA 3Q8YA 3ONQA 2MKCA 4HHUA 3J80Y 5CYQB 4DX6A 5DDOC 1S9GA 4KBIA 4NXMF 4MKBA 2F4FA 1DTQB 4IRDA 2MDAA 4RW9B 2OELA 5HLFA 1N36F 1RACB 4JV0A 4BCAA 3VQSA 4CO3A 1IKWA 3SYZA 1NK0A 3KNGA 5KT6A 2YKNB 2JWNA 4KR0B 2OSQA 2FHKA 2X1GA 4LIWA 1PAEX 4GO7X 1QLNA 1TKDA 1W7WA 3HHNB 2SXLA 5EWGA 5KT3A 5CH7B 1NSQA 1PYSB 1Y3KA 3KJVB 4LREA 3NLCA 5MLCV 3DLGA 1YRUA 5EGYA 2CYYA 2FYXA 5GVQA 5IM0B 2CG8A 2YQ1A 3NBPA 1C4CA 1WC0A 4H4MB 4P72A 1JMTA 5HL7Q 3AQOA 1C1CA 1JXLA 3GE9A 2DXDA 2YQ0A 1N33F 2RJZA 1WI8A 3OR2A 3FQKA 3VHQA 2DCLA 2DHHA 1RK8A 1G2EA 3DOMA 1ZTWA 1AZSA 4TQSA 2V2VA 1JLEA 5LMUJ 2LECA 2JOQA 2EPIA 2IMOA 4OI2A 3BGUA 5HATA 3MM8A 5M2UA 3PYFA 1WD6A 4X4OA 1SH2A 2DR8A 2XC9A 5B0AA 2RS8A 1EKRA 2W4CA 1FA0A 2VFRA 3K2YA 3VAFA 1HQUA 1NDKA 2I6WA 1S0NA 1Q78A 5IS2A 3VF0B 3FCVA 3CCES 2HGMA 1NJIT 4ZVRB 4I56A 4LR9A 5LM7E 1ZYQA 2UXCJ 2HS0A 2L48A 4C8YA 3SSSA 2YNHB 3IM9A 1RBAA 2NPFA 3NWGA 1EP4B 3U27A 3MOZA 4WBFA 2B51A 4ED7A 2GJIA 1QVGR 2MEWA 5A76A 3SZ2A 3M6WA 5KFWA 3FZ2A 2GVDA 1TKZA 1GT8A 2VDIA 4DBQA 4MK9A 4FNIA 1O8BA 1YDLA 1T94A 4G3IA 5CAAA 2IC3B 2WVCA 2MKJA 3M05A 4AL6A 3DRSB 2DIUA 4OV6A 2XLKA 1NDLA 3Q0AA 1NDCA 4LSLA 4ECSA 1IKVB 2BRLA 4ILRA 2Y3YA 3D7SB 4YFUA 4Y28C 5J1PA 2R2RA 2E1AA 5IT9U 4E0DA 5ETNA 2IVMA 2JLGA 1FE4A 3MMCA 2ZJPQ 2G2ZA 1OQ6A 2CJ9A 1SC6A 3AFGA 4JV1A 4UZCA 1N34F 4A8KA 3H90A 1OS5A 4PPZA 1J27A 3IS9A 2FHMA 4O4GA 1VQNS 2PMZD 1UJ5A 3TVYA 3PHTA 4C2MA 5T7LA 3SSQA 2HZCA 1RAFB 2C28A 4J9UE 3OQ2A 5FLXY 3BBBA 3L95X 4WFZA 3RAXA 3CT9A 1TAQA 3CDWA 2R7QA 2KVQE 1IWGA 1NK5A 3M32A 3CF5Q 4TU8A 3JS9A 4ZP6A 1GAOA 6FD1A 5A6PA 4ANCA 2HHQA 4C6AA 2HNZB 2KT5A 4NLDA 5F9LA 2CPEA 3KNAA 3K0JA 3PYDA 4ZCIA 4JBCA 2LVWA 2RF2B 2EFOA 2KL8A 3WZ0A 2AZ3A 5F8IA 2V8PA 3CC2S 5KTQA 4F4ZA 1EQMA 3NGKA 1X5OA 4LFCF 5J1EA 5KFUA 1DQ9A 4PQUA 2CKWA 2QV6A 3K17A 2J0SD 1Y0HA 1HPZA 2R7UA 4DEZA 2DNGA 4D3GA 2BKPA 1F1BB 3TOQA 3OBIA 1SJ1A 5B09A 1S0OA 1KOOA 4WP9A 2LLZA 1N6QA 1HBNB 1DFDA 5A0YA 3G8TA 4OLOA 4C3LA 5IZHA 4KHPJ 3UR0A 1EARA 5GADI 4I0WA 1U6BA 3QIPB 2J8AA 1KD1T 3MPVA 3O2IA 3W2WA 1J5OB 3PFEA 2LQBA 3ZZRA 1RWXB 4OX6A 3PW2A 4QIWD 4D3HA 1JWWA 4OHVA 2MGZA 4ZP7A 2H48B 2CNNB 2FHJA 1MU2A 2WTFA 2UV8G 2VBXA 4DL5A 1S1XA 1VLYA 5KFFA 2LQJA 2N3OA 2HVEA 2DR9A 2XEXA 5KOWA 1M5OC 2DBBA 5KG0A 3EICA 3QAEA 2UVUA 4L73A 1CJTA 1Q0NA 4M5HA 1UFLA 2F8EX 4PZVA 1SB6A 3T3FA 4WXOA 2DRDA 5CD4A 4JI5F 2MQQA 1RISA 1X4EA 3MR7A 4ETZA 5ETMA 1NZAA 1S97A 2OMOA 4KH0B 2YWFA 3O1LA 2CPJA 2NZCA 1UA0A 4AL7A 3G82B 1TL7B 3TANA 4Q44A 1NMEB 4QYRA 1S1WB 3Q22A 3UCZP 4EO6A 1KVIA 3NS5A 2E66A 1NJXA 4XTTA 2Z4PA 2CNLB 1TK0A 2HAFA 3GONA 3DLHA 1F5BA 2CJQA 1J2VA 2BMBA 3KK3A 3C6UB 5AE2A 1YWXA 5LXRA 2XZTB 2WVEA 2QLBB 1GXTA 4ECUA 4B9UA 3PW4A 3M9NB 3L7PA 1UFWA 2R4FA 3D54A 4GKJJ 4PG7A 3EUNA 2VQFF 1Y00A 4NZ0A 2WZ1A 2GNKA 4G1QB 2B5JA 5L1IA 1G7CB 2RUGA 1VQ5S 1N48A 4BWMA 2DEJA 1SIZA 2BV3A 1Y10A 4WTYA 3A4TA 4RBUA 2CRLA 1EKSA 3FBBA 3IGVA 1BQXA 2MKYA 2O66A 2EKYA 3I4PA 3IN5A 2PDAA 3DI6A 3ENAA 4J37A 3BN4A 3MFIA 3ZNJ1 2PO4A 3V6JA 2IIHA 1CC8A 4C8KA 2UXBF 5LMNF 3MPDA 4AE5A 1VOMA 1UW9A 2BE2A 5DM6Q 1ACMB 1YKWA 2E9ZA 3I0RB 4ER8A 4XO0A 1RU1A 2BOPA 1Q53A 2VH7A 2D3ZA 3AD7C 3WIUA 4CCHA 2EFPA 2O1PA 1HWLA 4KFBB 5KFPA 3HSJA 2KG0A 1V3RA 4LF6J 1S1VA 1XNRF 2DY9A 4M5JA 3H4DA 1D8ZA 1BE4A 4TY9A 4EMDA 2ZD1B 1S72S 2FZKB 4KJIA 2HQGA 1ZM4A 1XNQF 2OUGA 2AYEA 4XPEA 3D1OA 3PFOA 4O23A 4GRSA 3BR8A 1FFWB 2EBEA 4P2SA 4LFBF 2IYIA 2UUAF 4ZJOA 4PAAA 2ACYA 3BDPA 2HK2A 3T19A 2V9WA 3W8GA 2OPQA 3ENVA 3UNGC 2I2YA 3M8ZA 1X31C 3MMJA 3FDSA 3VQTA 3CTRA 3QJJA 2J9DA 1U2CA 2NSBA 1KR4A 3W1YC 1TVRA 2DNRA 4X62F 1GNKA 3CC4S 1JLGB 2D3O1 1DQ8A 2GV1A 5EN1A 3E8OA 1FKOA 2W9BB 3MPWA 2R7RA 2F9JA 5IWAJ 1TELA 1J5EF 4K4UA 3KJNB 4I64A 4UY8T 4LT6A 2OGUA 2QO3A 2HNDB 2D3OR 1IKXA 2EVZA 3CE8A 1REGX 3DC2A 4WFAQ 2HPUA 1KBRA 3K7RA 5H9EJ 2C3PA 4Y34A 3A12A 2ABYA 2GHWA 5E7OB 4Z37A 2WB4A 1FWLA 2MQ8A 3V6HA 1Y5IB 3I5BA 2ZH6A 4CO1A 5CYMA 4X4QA 5CXTA 2M3DA 1U1LA 2OTJS 3RZAA 4LF5J 2B4VA 2KHDA 3QGHA 4EYHB 3OVAA 2RQ4A 1SKRA 2DJWA 2AGPA 1R0AA 2ZBCA 1VDHA 7FDRA 5LSLA 3SV4A 3PO5A 1YZ6A 4A46A 2CDRB 2QJ3A 4K4VA 2D1CA 3D0IE 1SJRA 2GS8A 1VFJA 2JFDA 3N6NA 3QPIA 1DY3A
chains in the Genus database with same CATH topology
1RT4B 2EW9A 4ZLPA 3G9CA 3HHKA 1N0UA 1KNZA 3JB9k 2ZKUA 1PO6A 2D3UA 2RVJA 1N5TA 3KTQA 2I38A 2FUG9 3T5JA 1SKSA 2COLA 4UQTA 4DFPA 4NLTA 1HYSA 3POTB 3OFGA 2XO7A 3MEDB 2MQOA 2FJVA 3MM6A 3BGRB 5DRKA 3FFIA 3DRRA 4OJHA 3M4XA 4X84A 1ZZFA 4MKAA 2ZE2A 1JLAA 4OHYA 1ZZNA 3M9MB 2MB0B 2GFFA 1QAIA 4WZMA 2AWZA 2DNNA 3AJ1A 3PRDA 4WYWA 5A6WA 3MUMP 2OTLS 1TUVA 1MROB 1MNEA 1SUQB 4C98A 1QTMA 4IFYB 3DLLQ 1DAXA 2VOOA 4DLGA 3KMQA 4N47A 3M8SA 1GXLA 4USJC 1DURA 2YKOA 2BJEA 4L6V3 4O3QA 3OTDA 5F3ZA 5IWAF 3SXLA 2XSFA 2B7CB 1X4DA 3A1YG 2DNQA 3DN9A 5AXMA 5C24B 2D9OA 1HI8A 4F25A 2W25A 4ZPTR 3H5YA 3P6YC 3DM2B 2JC1A 5DGBA 4K0KF 1PC5A 2V4JA 3MECB 1OO0B 1RT2B 3SQGB 4HDGA 4PRFA 2HS4A 3TW0A 2CPHA 2V0NA 2HW3A 4W90B 1L3SA 4XDDA 1RT5B 2DNPA 4CH1A 2OMLA 2X3GA 4O4RA 4OJ1A 2HHSA 2WBRA 4USHA 3X1LB 2VPZB 1RGVA 1QJHA 2YNIB 2R7OA 3OL6A 2HYIB 3W7BA 3GV7B 1S48A 5KFEA 4ECQA 4X2BA 3M6XA 1ZTTA 5F8GA 4ITSA 1FO1A 2AGOA 1H7WA 2FPHX 4OZ0A 3OHAA 2QA4G 4TKTA 2E9TA 5FD1A 1FDNA 2XBPA 2CQ4A 2O3DA 4P7TA 4DR4F 1RP5A 3FZBA 2HFNA 3B4MA 3C46A 5I3UA 1REVB 2E9RX 2FVRA 2HRUA 5KFIA 3MEEB 2FLOA 3NP5A 2DO0A 4F26A 2HFZA 2R2TA 4HTIA 2EC0A 1FJCA 2CPDA 1LQ9A 1JLQB 5HP1B 2CPZA 2RF2A 4ED2A 3HHDA 3O3LA 3U1NA 2HWHA 2ZZNA 3J7A1 4Q43A 1S6OA 3JSRA 1NNDA 3POTA 1Q4RA 3RB4A 2GHVC 3MEDA 3V4IB 4A8OA 3FEXB 4WFYA 5K8MA 4WFXA 3BGRA 4QBUA 4MK8A 2JC0A 2P9CA 4A8FA 4ZCKA 2DNLA 2UUTA 3ICLA 4QIGA 4Q8FA 2DGXA 2GGPA 3LP1B 3OFEA 4HT5A 4KQZA 1ZAWA 2XG8A 3K8WA 4KRWA 5CHCB 2ADBA 1MMNA 1F60B 5AE3A 2WBMA 1MROA 3T5KA 1OPZA 1SUQA 3MCSA 4IFYA 4DQRA 2B9YA 1FNOA 2DGTA 2ROPA 3TVKA 4WK1A 4KC5A 4UW2A 1MWZA 2DITA 3SCKE 3U02A 3FSXA 3OHBA 3VWSA 1SQEA 3NG8A 4A8QA 4A8SA 5D3GB 1IBLF 4LF5F 1HD1A 1FK9A 2AJ1A 2DGVA 1U09A 2XMVA 3Q2SC 4IG0B 2CJKA 2NQPA 5C24A 2XHWA 1YIJS 2Y1IA 4QWDA 3F44A 2R7VA 2XY6A 2IRYA 3DM2A 2X1BA 3UW1A 5G4DA 3TVZA 5DDPC 5LSRA 1GX5A 1FESA 2CPXA 2QA1A 3DLJA 3R5DA 4YQWA 1S6QB 3OTOF 2ATLA 2C42A 5F41A 4USIA 3SEOA 3I32A 1S9EB 1RWUA 2Q43A 3LP0A 5T41A 4DL7A 1TKXB 1LWEB 3DYAB 3NMRA 2DPIA 4ZDNA 3HLUA 1RT5A 4OZ5A 3DMJB 5L8RC 4ALZA 4ECRA 3SFUA 2Q79A 2C22A 1UWBB 4FVMA 5GAHI 4HLBA 2ALZA 5CQGA 4NLXA 4E98A 2R7WA 4IQXA 2MZQA 3M1VA 4JV5F 3DLEB 4AXJA 2Y1RI 1KC8T 3DLKA 2Q6BA 3JSBA 2EFGA 2PA3A 1C1BA 3CCQS 2ZH7A 4J9OA 2MMYA 3C6TB 3FNNA 4QWCA 1PSDA 1WHVA 1UEUA 2GQQA 2MKKA 4YOEA 1L3VA 2BM0A 5J2MB 2RILA 4RZRA 1Z2LA 5HQ8A 4DSLA 2FJEB 1R8PA 2MKSA 4ZHRB 1REVA 2BVZA 2DIVA 1OIAA 2OO4A 1J5OA 4ILMA 4J9SA 3T6JA 3MEEA 4K59A 3GZ7A 3I96A 3QAUA 3GQCA 1H6KX 1P6TA 3ISZA 2W9AA 4ZOSA 3SV3A 3N9UC 5HBMB 1JLQA 5HP1A 3TUJC 3CDEA 1S1UA 3KMSA 1VIOA 1WF2A 4RWXA 1FKPB 1GX6A 3ZZZA 2KM8C 5KT4A 3DDKA 1QUVA 4I69A 1P27B 3M8QB 3UDCA 1CPZA 2XCAA 4WKRA 4OIXA 4QR1A 5IT4A 1U1MA 2B3TB 1IKWB 5JUMA 2RRAA 2HWIA 2Z8QA 4K4YA 4DHVA 3GMGA 4OJ3A 4URSA 1UJ6A 3H4BA 4KGMA 2MQPA 4O3PA 2I9SA 4WXWA 4RUAA 1M5PC 4DQPA 1VBYA 4RLEA 4BWJA 4DL3A 2LYVA 4PWDB 2D7SA 1HARA 1AFIA 3MM7B 1LW2B 2R2SA 2BXJA 1HFEL 5D4NA 3T1AA 4K4XA 2QSFA 1WEYA 3CCSS 3MTKA 2DNKA 4CQ1A 4EBCA 2QLXA 2ZH8A 2DD8S 2B4UA 5IXUA 2XWXA 3CD7A 4IG0A 3CC7S 1FJEB 1KHWA 4PG5A 3HZGA 2ZH3A 1S6PB 4J9QA 2XS7A 1JXEA 5AE1A 4OX7A 2IRXA 4J9NA 2ILYA 1VC6A 2W7PA 2KI2A 3KLVA 4EWTA 3MFHA 2RIJA 4C3KA 4U6PA 4TNOA 2R9LA 1T8EA 1Y5NB 3AB4B 3IC1A 4WYLA 1IN0A 4YDDB 1UVKA 1S9EA 4LIRA 3M2UB 4CZCA 3CD5A 1TKXA 1LWEA 2HFOA 2L9NA 3TNVA 4Z2XA 4FS1A 3JTNA 3KK2A 1E6VB 2CQGA 5LL6d 4Y00A 3GG0A 3DMJA 4UOCA 2D41A 3GV8B 2C2RA 1UWBA 3CB4A 1F5AA 3H2LA 1N5VA 4ES2A 4DR6F 4E8UA 3EXCX 2EG1A 1C1CB 5A8RB 1FXLA 3C3LA 3ZZYA 5DDRC 3EPGA 3W2VB 5HROB 3HO1A 1SIWB 3ULHA 1X5TA 2C3UA 1H3DA 3C6TA 3T5HA 2FGCA 3MR6A 4DV1F 3MR2A 1KLNA 3OR2B 5I42B 5J2MA 2PGCA 3H2VE 3PX0A 1NH8A 1WNEA 1FRLA 4L72B 1HW8A 3VZIA 4ZHRA 2QRRA 1B64A 2N4CA 2DNOA 1NJWA 1BC6A 4Y6IA 2CQBA 4MIBA 3VR1A 1DHMA 1YBAA 3GFXA 4EBEA 3LGNA 3PZPA 1X9WA 1CEZA 1WHYA 2J9EA 3LW5C 4NPOA 5KT5A 3H5XA 2PD1A 2E7WA 2KXHA 5HBMA 5I3QA 1VQ8S 1TL3A 1T05A 3HHEA 3R3TA 3J7YU 1HWIA 2HG4A 4DSFA 3M8QA 3NL0A 3NNCA 1S1WA 1S6UA 1HHTP 4V19X 2NSCA 4DQQA 3HF5A 4CI0B 4DV4F 1JX4A 2WOMA 1U1QA 1K0TA 3MUTP 1DBDA 2W4PA 2FVQA 1KRPA 2VA3A 2CQ0A 1UVNA 2DGWA 2FLPA 4I67A 2ZM6F 2RDIA 2PFFB 4PWDA 2LU1A 2PIIA 2DO4A 3MWBA 2HVIA 2OPPB 5F8HA 1TFWA 5GAGI 5M2PA 2KXNB 4EBDA 3A8EA 2XZWA 1RA6A 4M63A 2DHAA 4L3NA 5J2QA 3LWMA 1HBUB 1N5QA 2LU2A 4F3OA 3SMZA 4MIAA 3O44A 2FC9A 2V8GA 3K5MA 3CIMA 3CCVS 4QIEA 2ZZMA 2DHGA 3MOJB 1FE0A 1S6PA 2QT7A 2ZNZA 1YGYA 4I2QB 5AXNA 5L1LA 1N52B 2J0QD 4URGA 3C2PA 4YEAA 4DUZF 2R8HA 3OVBA 3HKWA 4F2RA 4I68A 3HP6A 1NK7A 3MD3A 4B9SA 2FHOB 2E44A 2DPJA 3M2UA 4JI8F 3NNHA 2RRBA 1NK8A 1D9DA 2PMHA 2ZOMA 3BZQA 1E6VA 1X7VA 4CH7A 3KKFA 2N7CA 2VPWB 1DRZA 4OMFG 5BJRA 1U48A 2BZ2A 1NKBA 3CCJS 2EFNA 2F3JA 2J7WA 2VFSA 2WSCC 1YSJA 3ZZTA 3DRXA 5JJBA 1AXQA 4Y2MA 2KG1A 1Z1ZA 2L9WA 2Z2LA 5A8RA 3SCJE 4TU9A 2KFZA 4LFAF 4K4SA 1RT3B 4G1QA 1KQKA 3W2VA 5HROA 4ILLA 1KHVA 4DL6A 1M5VC 2R8GA 4WCEQ 1KTVA 5GMKa 1LK7A 3CJ5A 5KG1A 2JLFA 5E3AA 5A2QY 1TKZB 2E7XA 1H2VZ 2V8VA 4RNFA 2DH9A 3PR4A 2VG7B 5IQQA 5E3PA 2F8MA 4NLWA 3SDEB 5K8NA 2BBEA 1U1PA 3CMES 3HI9A 5SZTA 2AJ4A 5D4PA 4ELUA 3VAMA 2PT0A 4HH1A 2V8HA 1RA7A 3PEJA 4QYZJ 3IR6B 4ZKAA 1VIXA 1N8RT 1JKHB 3NRBA 2E1RA 3FCHA 5CD4H 2AGQA 3GFYA 1WEZA 2J76E 2NUHA 1FNXH 1XR5A 2MY8A 2RRNA 1MSWD 1SV5B 1D3WA 2RU3A 4NA1A 1NKCA 1OQ3A 3LPYA 2CJAA 1JNRB 1VQMS 3RB0A 5C42B 3OR1A 4NLRA 2CPFA 4KT0C 3CUNA 1R8CA 3X3UA 2KT3A 4HHJA 4R5PB 5DM7Q 1QUPA 5D4LA 3PEHA 1LK5A 2IHR1 3O8WA 2OPPA 4LSLB 4H4OB 2HGNA 3S8SA 2K2PA 4C9DA 4I2PA 4KKOB 3T9ZA 1HBUA 4I6YA 3K59A 1U26A 1DARA 3I5CA 2MZTA 1U1OA 2UUBF 2E5GA 3US5A 4J9LA 4I2QA 2AD9A 3FSYA 2RKIB 2VFUA 1ZPWX 5FJ4A 2JJ4D 1VQOS 4KFBA 2BJDA 5I3PA 2KM8B 5EWFA 1RI7A 4YP3A 1O5JA 4OZJA 3MMCB 3THVA 3BREA 1WELA 3IWLA 4HI2A 4IR9A 2G13A 3TARA 4ZPVR 5B08A 4BC7A 3ITHA 2M5YA 4RX6A 3K5LA 2IJFA 2VBWA 1RKJA 3TAMA 4Y3CA 3HVTA 2F8HA 1FRJA 5B7WA 2XS2A 1BWEA 3VCDA 2GQCA 4QW9A 4DR7F 4Q2LA 4JI0F 3H2UB 1RT3A 3ENQA 2AP6A 3AJ2A 4Y2KA 3UQSA 5E41A 4A8YA 2Q66A 4OHWA 1QE1B 3IS9B 4OI1A 3OV7A 3I56S 3RR7A 4U7UK 2CDQA 4HTJA 3OW2R 2FC8A 5ITHA 2MZSA 3I0SB 2A1BA 2YVSA 3NKYA 1BLUA 1VBXA 1UVJA 3MM9B 2VG7A 2CQPA 2GC8A 2KRBA 3AAWB 3W3SA 3SDEA 2VC1A 4ZVEA 3M9OB 2BANB 4F3QA 4LF7F 1TL5A 2CZ4A 2AU0A 1UJ4A 3B4DA 3R5CA 4ID8A 2CQHA 3ZC4A 1JKHA 5AJ3F 2YWEA 1UVLA 2RU9A 4BHQA 3MR3A 4KB7A 4GC7A 3QGIA 2JVRA 2VZ9A 1FXRA 2AQ4A 2JEGA 1SV5A 4C8MA 3LOUA 4OJGA 1HQEA 1U6FA 2WSFC 4MJKA 5C42A 1D9AA 5KG2A 2A3JA 4GC6A 2QZ8A 2AW0A 2V94A 1RT1B 3H98A 4R5PA 4PR6A 4NXNF 4X66F 4DLEA 3HHLB 3B8HA 2IA6A 4XDCA 3E2EA 3T9NA 3PDNA 3J81Y 1K73T 2IAJB 3MMBB 4IG3B 4KKOA 3QJLA 3PIPQ 2EFVA 2ZNYA 3UFCX 1ZAVA 5AXLA 3CDBA 1TL1B 3TI0A 1HI1A 4KAIA 2M8DB 1RJJA 1FVQA 2DGSA 3C66A 1VC5A 4X64F 4OI0A 2K7JA 2HVZA 4WIIA 1U1NA 4CNYA 1VRUB 3MZIA 1GTHA 1S1TB 1RTIA 1SI9A 1R3NA 1U49A 1YJVA 2GMLA 1N32F 5KFQA 4NOHA 3MUVP 5KFAA 2B56A 3E01B 4X4RA 2XMTA 4FS2A 2KYXA 2KTQA 2YQ3A 5FDLB 2V4RA 1ZM3A 2XI2A 2CPYA 4TQRA 4KIAA 1Q16B 2I8EA 2MSTA 3PX4A 2C3OA 1H2TZ 1BY9A 3G6ES 2VD3A 4NLPA 1CG2A 4ZPWR 2HMIB 4NMLA 1U4BA 3EGZA 1KFDA 4IH6A 1IQZA 3LANA 3LGMA 3VZHA 4F4WA 2VBYA 4ECVA 5KFBA 1CVJA 1QE1A 2W9BA 3I5AA 4Y65A 5KFVA 3BO4A 1Q79A 1QAYA 4LF8F 3VALA 4ECTA 1KEKA 5B0FA 3S1TA 3I0SA 3OXGA 3DHWC 4B3RF 3V6DB 3MAQA 2FIUA 2B6AB 2WAQD 1WHWA 3MM9A 5KFMA 1APSA 4ZVHA 3K5PA 3EYZA 2XWYA 2MZRA 1Z4UA 2BANA 1VBZA 2R8KA 3N79A 4OFZA 4PQUB 2KXFA 1JK9B 1Q1KA 4QIFA 3SCIE 5L38A 1IXKA 5EWEA 2Q3PA 2FVSA 2J6TA 1LKZA 3G96A 2PA8D 3FMWA 2HNDA 1NKEA 5KFYA 3K5OA 2OH2A 1G3OA 2ZC3A 1UA1A 2N82B 1I1GA 4EEYA 1R43A 3LH2S 2IYGA 4DMZA 2ZH1A 1VQ7S 3ISND 1X4GA 3LWLA 3I31A 4RNHA 1HHSA 2A2CA 3LALA 3JSMA 4ZK7M 4QWEA 2VKRA 2EG2A 4CT9A 4EFAC 1JNZB 1RT1A 3IFEA 2YKMA 2M0GB 5A8KB 4WE1B 1X0FA 3HHLA 4C3MA 4DF4A 4ZA1A 4PXBA 3WC0A 3UD4P 4FN5A 2W7AA 2IAJA 3MMBA 4IG3A 2MPUA 1SL0A 4DN9A 4LMZA 2IRUA 2NXUA 4DFKA 1IKYA 2ERRA 3IGNA 1TL1A 4MYTA 5C25B 1VRTB 1JLCB 3TAPA 1T03B 5HMZA 4O3SA 3DXBA 2DRAA 3EXYA 4X4SA 4BBYA 1Q86T 3M2VB 5DG7A 1VRUA 2VPXB 3D0GE 1FT8A 4DR1F 3GYNA 1ZPVA 1HNXF 3CJ0A 4X4PA 3IRXA 2B4OA 5FDLA 4F4KA 4DOZA 1S10A 1FKAF 2E5LF 1DTTB 4WF9Q 3KG4A 4FP9A 2UU9F 1VK8A 4RU9A 1VI7A 3W2WB 2VOPA 3DU5A 3BF4A 3CCTA 1C0UB 4ELTA 5IQ6A 5EDWA 4J9KA 3Q8SB 4OHXA 1FEEA 2UVVA 4DL4A 3DRPA 1Z2ZA 4RW6A 2HMIA 3DNCA 1IM4A 2J5AA 2CVIA 3H5UA 2R7SA 4RW4A 1S77D 4X65F 4PWUA 4OI4A 2O5DA 2VA2A 4IUFA 1HBMB 5J2PB 4K4TA 2E29A 1X8DA 2O01C 2QLWA 3R27A 4GO5X 2IM0A 1OSDA 4AL5A 1V3SA 4XIUA 4RNNA 2GA7A 1W25A 2IM3A 1BQMB 1ROFA 2CQIA 3OTEA 4LJMA 3V6DA 2B6AA 4KTQA 1WG5A 5ADZA 2RNEA 1URRA 2DCUB 3HX9A 2YNGB 1M5HA 4RNOA 2FJDB 3PW5A 4ED1A 3CCLS 1XMBA 3BB5A 2G1DA 3CDUA 3D1HA 4QWBA 3IA0A 2IMWP 2H5EA 3HMJG 1M1KT 3RRHA 3B78A 3T5LA 4B9NA 1HNWF 2ASLA 1RTDB 1S1XB 4IH7A 4WJBA 4IR1A 4HT7A 1U7LA 3MEGB 4N76A 3PKMA 5THWA 1XR6A 2AYBA 1ZH5A 4QQBA 1