1N54B

Cap binding complex m7gpppg free
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
121
structure length
121
Chain Sequence
LKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGFKEGRQYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords 80 kDa nuclear cap binding protein
publication title Structural basis of m7GpppG binding to the nuclear cap-binding protein complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2002-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n54B00
4YOEA 2QA4S 1YJNS 2X1AA 5DDPC 1R8HA 2HZCA 2RUGA 1M5VC 3G8SA 4WFNQ 4WKRA 2DGUA 1U6BA 3CMAS 2N3OA 5HO4A 5IM0A 2MKHA 2LCWA 3D2WA 1VBZA 1A7GE 3MDFA 5ITHA 3JB9k 3CCQS 2DK2A 3IWNC 2DH9A 4CH0S 1FHTA 2MKKA 2DNOA 1HD0A 1G2EA 1QVFR 1FT8A 4C7QA 2SXLA 2E44A 1N52B 5HL7Q 4QQBA 3UWTA 2XB2D 2DHSA 3CF5Q 3K0JA 2CQ4A 2XS7A 1VQMS 2B0GA 2FY1A 3B4MA 3EGZA 1PO6A 3DLLQ 2M52A 3NS5A 2DNGA 4Y0FA 2MKJA 2CPZA 4QU7A 3CXCR 1FO1A 1M90T 2FPHX 2OIHA 2XS2A 2V94A 3I56S 3CCSS 2F9DA 4OZ0A 1M5OC 2YH0A 2LQ5A 3CC7S 1U1OA 1A9NB 1IQTA 1ZH5A 1JMTA 2KU7A 1OIAA 3TYTA 3P49B 1U1PA 2ADBA 2F9JA 2M2BA 1O0PA 2QFJA 4F26A 2AYBA 5IM0B 1P1TA 1NU4A 1Q86T 1VQ5S 5D77A 2BOPA 1X4EA 2OSQA 1QVGR 1U2FA 2KFYA 3SDEA 5IQQA 2G4BA 2YH1A 3VF0B 1K9MT 5DETA 2MHNA 2LXUA 4TU9A 2NLWA 2VONA 2OSRA 4LMZA 2MQNA 3VAKA 2KN4A 4CQ1A 1X4GA 2KXFA 2E5JA 2N7CA 2CPDA 2LKZA 2ADCA 1WF0A 3S6EA 2MQOA 3R27A 2J0SD 3CD6S 1SJ3P 2DIVA 2M9KA 1KC8T 2I2YA 3PIOQ 3DXBA 2N3LA 1VBXA 2MQPA 3UCZP 2NZ4A 2LECA 1S72S 2DHAA 2D9OA 1YHQS 4P6QA 1DRZA 1SJRA 2DIUA 2HGMA 2VOOA 2MXYA 3UCUP 2FHOB 2ZJQQ 2MGZA 2ZJPQ 1QM9A 2J8AA 1WHWA 4ERDA 2MZTA 2MQLA 3CCJS 3N9UC 2DHXA 2LXIA 2JVOA 5GAEU 3VAJA 2DGWA 3SDEB 4YB1P 3I55S 4W90B 1OWXA 3BO4A 1YIJS 2EK6A 1OPIA 2HVZA 4M5DB 4EGLA 1YJWS 2RS2A 5EN1A 1XN9A 2XNRA 1F9FA 2KRRA 3THPA 3UCGA 2DGTA 2DNNA 2HGNA 3NNCA 3MD3A 2CPJA 1CVJA 3RW7A 2MKSA 4IOCQ 1FJEB 3VAFA 1YITS 3VALA 1X4CA 2RNEA 3BEGB 2XNQA 1FXLA 3V4MA 2DNPA 2D9PA 2RS8A 3TP2A 5GMKa 2BZ2A 2CQCA 5GAGU 2GHPA 3NMRA 1KOHA 2MQQA 2DGOA 5CA5A 3LQVA 1U1RA 3NNAA 4F02A 1WG5A 2DO0A 2U1AA 4QU6A 1JJ4A 2MKCA 1DHMA 3P6YC 4WF9Q 2K8GA 4IO9Q 3CCVS 2ERRA 1WEZA 4QPTA 1ZZNA 5FJ4A 2J0QD 1WI6A 3CCMS 3CMES 2DH8A 4W92B 5MLCV 4LIRA 1X5OA 2FC9A 1UAWA 2MY7A 1VQOS 2MJUA 2CQ0A 1WEXA 4C4WA 1H2UX 2DGVA 2FC8A 2RQ4A 1VBYA 3U1LA 5GAHU 4Z2XA 3G6ES 4A8XA 1SJ4P 3G8TA 5JVHQ 4WFBQ 2L08A 2MZRA 3CPWR 1NJIT 2KH9A 2HGLA 2KYXA 2M0GB 5DDQC 3MOJB 2CPHA 5LXYA 4TU8A 1DBDA 5GVQA 4PR6A 2RRAA 1KOOA 2X1FA 1M5KC 2CPXA 2E5IA 2UP1A 5DDRC 1K8AT 2VODA 2MZ1A 3H2UB 4FXVA 3FEYB 2Q79A 5LSLA 2M70A 1WI8A 1VC6A 3TO8A 1WHXA 1ZZFA 3ZZYA 2CQDA 4UY8T 2RT3A 2L9WA 3ZZZA 4RU2A 2CPEA 5DDOC 3L3CA 1H2VZ 4TU7A 2CPYA 2KM8B 2MPUA 1U1LA 2CQBA 3MI7X 5D78A 2RU3A 1YWXA 1X5SA 3MXHP 1FNXH 1WG4A 2E5HA 3FEXB 2AD9A 4PRFA 3MUMP 2JVRA 1S79A 3H2VE 2MMYA 1JJHA 2DNZA 2LYVA 2N82B 1X5PA 2XSFA 1L3KA 1D8ZA 2JX2A 1OO0B 4C0OC 1BY9A 4TLQA 2DHGA 1UFWA 2QEXS 1M5PC 3HHNB 3BO2A 1VQ8S 2DNLA 2CQ1A 2WBRA 1YJ9S 1X5TA 1VC5A 3R1LA 2M8DB 3J7YU 3ULHA 1X4FA 1B7FA 1YI2S 1WEYA 1WF2A 2PEHA 1Q7YT 3LPYA 4V19X 4OZ1A 4YUDA 2I38A 2CJKA 3NS6A 5H1SV 1N8RT 5JVGQ 5LSOA 1R8PA 1WTBA 2DO4A 3UE2A 3SMZA 3MD1A 1SXLA 2CQ2A 1H2TZ 3BS9A 2KG1A 4CH1A 1SJQA 2M4MA 3NNHA 2KT5A 3U1MA 5LXRA 2CPIA 2GO9A 3CCUS 4J5OA 3S7RA 1DZ5A 1WELA 5LJ3Y 3VAGA 1WF1A 2MKIA 2MGZB 2JRSA 2J76E 4Y00A 2AYGA 3S8SA 2DISA 5BJRA 2E5GA 2CQIA 2KHCA 3MUVP 3G9CA 4IUFA 2MQMA 1X4HA 2M8HA 4WFAQ 2CQPA 3VAHA 2RRBA 3CUNA 3UD4P 2MYFA 5LJ5Y 2DNKA 1K73T 2KG0A 4ZKAA 1VQ6S 2RQCA 4U67Q 2JWNA 4PKDB 2DNMA 2DNRA 3RW6A 1FJCA 3SXLA 1YTYA 2O3DA 1UW4A 2M88A 4UQTA 2DGQA 3CCRS 2G0CA 2MZQA 3CC4S 4ED5A 4LJMA 2XS5A 5DM6Q 3B4DA 2DNHA 1VQLS 3G4SS 2DITA 5CYJA 1VQ4S 1U1MA 2PE8A 1Q82T 3VAIA 2DH7A 1VC0A 2CPFA 4BS2A 1HL6A 1NO8A 1RK8A 1URNA 3CCES 3PIPQ 4IOAQ 2CQGA 3OW2R 2KI2A 1D9AA 2KRBA 5IFMA 2MZSA 3J7ZT 1M1KT 2M7SA 2MSSA 3Q2SC 1VQ7S 2K3KA 2YKAA 2MY8A 2U2FA 2L41A 1WHVA 3CULA 1U6FA 2X1GA 2YTCA 2X1BA 5DM7Q 1X4BA 3MUTP 3CCLS 2RVJA 2OJ3A 4WIIA 1U1NA 2VOPA 1WG1A 3UD3P 1FJ7A 2DNQA 2MB0B 2EK1A 3CTRA 2MJNA 1W2BR 2CQ3A 4CIOA 1KQSR 1HA1A 2YWKA 1UP1A 2HYIB 2LEBA 1VQPS 2AYEA 1WWHA 3VAMA 1VQ9S 2KXNB 5GADU 2KXHA 3S01A 1KD1T 3P5TL 3EX7B 1Q81T 1N88A 1U1QA 1PGZA 3R1HA 1WHYA 1VQNS 1N54B 2AYMA 2LEAA 2OTJS 2CQHA 4F25A 1HD1A 4FXWA 2LA6A 1H6KX 2D3OR 2OTLS 2MSTA 2F3JA 4WCEQ 3G96A 2MZJA 3BO3A 2LA4A 1X0FA 2DGXA 3US5A 1RKJA 1P27B 5CXTA 2KM8C 3G71S 1X4AA 1SJFA 3THTA 3EGNA 1AUDA 1U1KA 3MURP 3IRWP 3P3DA 1VQKS 3Q2TC 2LMIA 2G1DA 1JJ2R 3CC2S 2EVZA 2KVIA 2DGSA 2ZJRQ 2DNYA 2A3JA 3HI9A 2DB1A 1X4DA
chains in the Genus database with same CATH superfamily
2AHOB 1L3VA 2BQUA 2CDRB 2UVVA 2C3MA 3ELHA 4DV1J 4M5IA 1F1BB 1FE0A 3UVJB 1EKRA 2DNOA 1QVFR 4P52A 2E44A 1S0MA 1I1GA 2CUYA 2RJZA 3FNNA 1IKXA 1RI7A 5ETMA 2R8HA 3O6QA 1FKPB 3Q83A 3GV7B 4QIEA 1C1CB 3CCSS 1TFYA 4N41A 5DG9A 1IQTA 2KU7A 4DHVA 3P49B 3SZ2A 2N4DA 3A13A 1P1TA 3RUBL 4G65A 2YVSA 2IRXA 1NHKL 2I8EA 4UOCA 1U09A 1UEVA 5KFTA 1Q5YA 4OQJA 3KXDA 4TU9A 3EDRB 4LRCA 3KLEB 2FGOA 3QWPA 2UXBJ 2CPDA 3S6EA 4A8SA 2J6TA 4TN2A 4HHHA 2EXUA 2HBZB 2MQPA 5F8GA 3UCZP 5L9NA 2J8SA 1UKUA 4EI2A 2KO1A 4NA2A 1SKWA 2VC1A 4ANDA 5EWFA 2MTLA 2E5LF 2ZJPQ 3EGVA 2HVDA 3N9UC 3OQ2A 1ACMB 2LQBA 3SV3A 4CCHA 2B9YA 3IM9A 5IXUA 5EN1A 4M5MA 1XN9A 3M8QA 2KRRA 2HIYA 1OJ4A 1GMUA 3EICA 1BXNA 4LBPA 1FJEB 5L46A 1RB0A 3HVWA 3HKZD 2DYAA 1NPPA 3O3LA 1UW9A 1RADB 3Q8YA 3LTOA 1WG5A 1KTQA 3X3UA 3B8HA 4OX9F 3UDVA 3CCVS 4F04B 2BE9B 4UF4A 2H54B 3IR6B 4EZ9A 1WI6A 3ZTOA 4EO6A 4LIRA 2I9SA 2MY7A 3OXGA 1P6TA 2NCKL 1X0PA 5D4LA 2C2NA 2HGLA 4B3TJ 1NSPA 1N34F 5DDQC 1Q0NA 3AAWB 3MEGA 4LF5F 4L73A 3TZXA 1WHXA 5KFCA 2AJ2A 1S6OA 1N5SA 4DUZJ 4O3RA 1F3FA 4HACB 1M0SA 1TELA 1L3KA 1YRUA 1TKXB 1LEOA 5C2GA 4ZP6A 2HK2A 2QEXS 1RT2A 1S1UB 3P96A 2ZVIA 3I0SB 3R1LA 4DPXA 1CULA 2LP4A 2B9EA 3QMQA 3BQ1A 4MTPA 1SPBP 3MR7A 4C8MA 1DY3A 2OPQA 4RW9A 4DL7A 2PFDA 1FFGB 1UPMB 3CJ5A 1YJTA 4N77A 2WZ1A 2CPIA 1P9YA 4MAKA 4DV7J 2MKIA 1TV6A 5BJRA 2ZH8A 2AEMA 3CJ2A 1NRKA 4O3SA 1N56A 1BD6A 5J1EB 2W8KA 3L9ZA 4DV3F 2NUUG 1FJCA 4EYHB 1FWKA 2V63A 3TQ1A 4LJMA 4B9VA 3FRZA 2PE8A 2OAUA 3AOCA 2PMZD 2B7CB 3ISND 4CLWA 2XCPA 4BWJA 3AXMA 4UOHA 2CQGA 1CJVB 2ZITA 2CVIA 1PSDA 3IWXA 3EDQB 3OFGA 1GX6A 3HHLA 2QYCA 1XJWB 4DR1F 1R6YA 4F3MA 2EEYA 1NK4A 2JLGA 2NQPA 4LSLB 4GKKF 2BJ9A 2VOPA 3TUIC 4NYPA 4I4BA 4WU2A 4U7UK 1WSRA 3AH6A 1MNEA 4O23A 2PA3A 4QIVA 3EX7B 1HMVB 2HQIA 1S7HA 2X3DA 2LEAA 4NXMF 5CQGA 4DUTA 1G6BA 2OTLS 2D3OR 4DPTA 2YWGA 1TKTA 4X4UA 1X0FA 3BPSP 1NDPA 3OFHA 1JLBB 1NZ8A 2KM8C 1SJFA 1X4AA 3M2RB 3UQSA 4DSKA 5IWAJ 3CC2S 2EVZA 2RF2B 3DHWC 1M5VC 4LR9A 3G8SA 1NB7A 3MECB 5HO4A 5IM0A 3GB0A 4KH0B 4PYAA 1HIYA 4OIXA 3IWNC 4WYWA 2DH9A 3A3OB 3W9IA 3DLGB 3BKTA 4HL9A 4LF9J 1RWNB 2XB2D 2XLJA 4OJ3A 1VHIA 1K1SA 2B51A 2XO6A 2ZBQA 3OR2B 2ZUAA 5LM7E 3NS5A 2R8GA 3MMCB 2CPZA 3T19A 2CXEA 5B0AA 3I56S 3DLEB 5B08A 2WSEC 2V9KA 4L3KA 3DI6B 4LRDA 4NYOA 1WC3A 4P75A 1SUQA 3JXOA 2HNZA 3GG0A 1LKZA 1PAEX 2FJVA 4NCBA 1REVB 1S97A 4RNOA 4ZPVR 1CPZA 5F8MA 3PVXA 1YVFA 2R2SA 2VONA 3IWLA 4P2FA 2YWFA 2YWWA 1QAJA 2E5JA 2N7CA 2YPYA 1NNDA 2ACMA 2V6AA 1HNXF 3LW5C 2C42A 4KV8A 4J9OA 2PEBA 2VOOA 2MXYA 3NAHA 2ZJQQ 4CT8A 4WE1B 4LR7A 2MGZA 4NI2A 1NK9A 4F7VA 1WHWA 5IV4A 1U2CA 2Q3PA 2DHXA 1B99A 4KBIA 3W61A 1DURA 3I55S 5J2QB 3G87A 1L3SA 2IRUA 3NEKA 2BEFA 4CLZA 2E1CA 1TL7B 3GR0A 2FVCA 3MEEA 3SCLE 4MK8A 4HH0A 2RNEA 3A8EA 1KLMB 3ZZUA 1KOHA 4CP5A 3R5DA 1GTEA 4DN0A 2JHEA 2W9BB 4W92B 1B3TA 4P9SA 1H2UX 4K4XA 2VHGA 3VVUA 4QWBA 1QUPA 1ROFA 3C2PA 2W01A 4K8RA 5HATA 1L3TA 4K4UA 1KOOA 2YKOA 1HI0P 2R7XA 3E01B 1D1UA 1YDLA 2I5JB 4URSA 3GYGA 1VC6A 3ZZYA 2B6AA 5BXIA 3ZZZA 5RUBA 5K8MA 5IQ6A 3HVAA 3ENVA 3UW1A 1D0EA 1YRTA 4FS2A 4ZLPA 2RHQB 4FYYB 2UUCF 2VH7A 1BLUA 1D8YA 2JVRA 4HYKA 2E1AA 5L8RC 4RR5A 3SQGB 3KJQB 2J9EA 4OMFG 2EBGA 3QT8A 2CKWA 3GSDA 4NA1A 1X5TA 5EDWA 1RHUB 1C0UB 2VPWB 1EAYC 2AJFE 1WSVA 1SIZA 2HWTA 3FBCA 3NBPA 3MR6A 1HQ2A 2AP6A 5E3QA 3RAQA 1C4AA 3PCOB 4RO0A 1SXLA 3BS9A 1T94A 2UUWA 2Q1LA 4A47A 4B3OB 1B0PA 2RILA 4DN9A 4WIQA 2IDEA 5KFXA 1WORA 3T9ZA 3LUYA 1HKAA 1TUVA 4WZQA 3GV8B 2ALYB 4FYVB 2MLYA 3M8PA 3D4JA 4Y2IA 3OFFA 2DR7A 4IQXA 3F56A 4PG6A 4CNYA 2F8MA 4B9LA 1SL2A 4CWBA 2LXFA 3MMBA 2DCUB 1HBNA 1Y3JA 4K4VA 3HVTB 2VPZB 3NGRA 3OW2R 4DSLA 3N5FA 2VA2A 3WX4A 2I1RA 2IMOA 5D4PA 5E3AA 2YTCA 4MKVA 2C3OA 3HK2A 2WVEA 3HFZB 1EX8A 4YY3J 4CIOA 4NLTA 3RG6A 4I6YA 2VDHA 1BE4A 4AQYJ 2DTJA 4JI4J 3MAHA 4GMKA 2KXHA 2F1FA 3UN2A 4EYIB 1KWMA 8RUCA 4JI2F 4X65F 3EVMA 2V4JB 1RT1A 2OPRB 1CC7A 1HWKA 1RKJA 4FPIA 1DTQB 1P27B 5KFYA 4X64J 3QJPA 4U9RA 3VZHA 1OQ3A 1RCOB 3C6UA 2QA4S 2V9WA 1SH0A 1FDNA 3JAMU 4N47A 1KNZA 3PG9A 2MKHA 1VBZA 1T9YA 4PWDB 2E7WA 2VFSA 3JB9k 2WTFA 1JK9B 4X4TA 2IAJB 3JS9A 2RAQA 1IJFB 4USKA 2RIJA 1G2EA 2F40A 3MMJA 5C25A 4JI0F 1RTIA 4ZVEA 2OUGA 3DM2B 3EGZA 4UUWA 4K7QA 2VPXB 4EEYA 2MKJA 4QU7A 4U95A 2BYCA 2ZOMA 1IR2A 2W7PA 4TY9A 1PJ5A 2P2CB 3R7NB 2G1HA 3CC7S 4A4JA 1RWPB 2R7QA 3FFIB 1U1OA 1ZH5A 3K2YA 5GMDA 5U47A 3TVYA 1RTJA 1MROB 4JV2A 3OSPA 1QVGR 4QZVB 1RT3A 2XHCA 4F4XA 5DETA 2GGPB 2QLXA 1O5JA 4MJKA 1VRUA 4JI3F 4L3NA 2XI2A 1NAQA 2Y8YA 3W9JA 2LLZA 4K5SA 5KT5A 4I64A 3GR1A 2EKYA 3P4UB 1X7VA 2R7WA 3RRKA 3NOCA 3W2VA 1PYTA 1S48A 1W2IA 3W64A 3V6DA 1K0TA 2ZH1A 4FYXB 5J2NA 4CLFA 1OWXA 2EK6A 3GU0A 3W65A 2QT7A 1U7LA 3PZPA 4C8OA 1LWFB 5AXKA 4CO3A 1CG2A 1SC6A 4A8FA 4A46A 2C3YA 2XNQA 4JV5J 1FXLA 2DNPA 2XZTB 4DS4A 2KHDA 4QWCA 4IO9Q 3B82A 2W2OP 5IT9U 4WFZA 1S6UA 2J0QD 2VQEJ 2VBWA 2IMWP 4O4GA 4B17A 5EWGA 3NXZA 1X5OA 1U47A 1BQNA 3ZZPA 3R6LB 1EARA 2E1MC 3G6ES 3Q0AA 4DR3F 3ZTRA 1NJYA 2UUAJ 5B7WA 3PKMA 2PD1A 2CPXA 2XY7A 2HNYB 4DCPB 2G2YA 5LSLA 4DPUA 3GYNA 1JLGB 3G86A 2RT3A 3DGPA 5B0EA 3V4IA 3RU0A 2YKNB 1F2GA 4WP8A 4BC9A 1IUJA 3OUYB 4HT7A 3MUMP 2YKQA 2LYVA 2YNFA 5A8KA 2B3TB 4B3RJ 4YQWA 1BY9A 1NBEB 2R4FA 2HAFA 5THWA 4L76A 3NKYA 3ZNUA 3OLAA 5B0FA 4IG3B 4CM2A 2CJKA 3KJNB 2XYPB 3BGRB 3KJVA 2QMXA 5E2QA 2V4QA 1QTMA 2AGPA 1H2TZ 2KG1A 2LU2A 2B5JA 3HZGA 2KT5A 5LXRA 2PA8D 4QOTA 2XGQA 3RB4A 1U49A 2W4PA 1FKAF 3DOMA 3ISZA 2HHHF 2B9XA 3T1AA 1MW7A 4IUFA 2HQGA 2RH3A 9ATCB 5HROB 3SV4A 3UD4P 4LRFA 4PG4A 1HFEL 1FX4A 4Q2LA 2DNRA 3E2EA 3KLHB 4PG7A 4B9MA 1CJKB 2QL7B 5CYJA 1HQUA 2OPSB 1KHVA 1VR6A 1VC0A 4BS2A 3O1LA 1FESA 3NMAA 1HL6A 2G13A 1CS4A 2GW8A 3QGGA 2KRBA 3J7ZT 3R5CA 3Q2SC 4FF2A 1SQEA 4B3SJ 4AL6A 4DUZF 3OHAA 3QLHB 1JLQA 2VV5A 2VBXA 2IJNA 4ICLA 2RE1A 3IG1A 1IVZA 2DNQA 2W7AA 3ZO7A 3HDSA 2K3IA 3PRBA 2AYEA 3VAMA 4I67A 5GADU 3P5TL 2DY1A 5DQGA 3ZZRA 1QJHA 2W4CA 2AYMA 2P9CA 3JSYA 2VA3A 4OLPA 4DL0C 4RW7A 2YQ3A 4BLGA 3THTA 3MURP 4TYBA 1VQKS 1T9UA 4P72A 4ZVRB 4LT6A 3Q2TC 5GADI 3OTCA 2DNYA 2DB1A 1LW2B 5DG8A 1WC0A 1VRTB 3PYFA 2GJFA 2HZCA 1TVRB 4WKRA 3I9V9 3J80Y 1CC8A 3L95X 4M63A 3CIMA 3AA8A 4KHRA 1WNEA 3TUPA 3P45B 1U02A 4WFXA 4CLKA 3Q24A 1U8SA 5DJBA 1EETA 3QO9A 2CDQA 1F9HA 1UJ6A 2XS7A 4ES1A 3VCDA 4YS2A 3DC2A 1LWEA 1RWVB 2M52A 4LFCF 1UTAA 3OHBA 1FO1A 2QA4G 4DS5A 1U0HA 2V94A 3M05A 2DXDA 4Y65A 3K17A 4I69A 4K0KJ 1A9NB 1RACB 5F0UA 3TYTA 1Q95G 1UWAA 2XMAA 2M2BA 4QWDA 5E3CA 2VB6A 3DDKA 3N6MA 4LQ3A 1SC3B 1UCNA 3PEHA 3TJ8A 3OJUA 2G4BA 1K9MT 4I7FB 4M5DA 1N6QA 1U2RA 2GCFA 1S76D 1HWJA 4CQ1A 2J0WA 2KL8A 2RQMA 4DL3A 1VYAA 3ILIA 1JIHA 3VGSA 4DX6A 2BANB 1FTRA 4DWIA 2WBMA 2FB0A 4C8ZA 3LGMA 4NOHA 4G3IA 4DSFA 1LK7A 4HEA9 3EGWB 1BQMA 3G6VA 1JNZB 3MM7A 1WKLA 5HJXA 1C4CA 3C6TA 2V8HA 2AEFA 5IWAF 3AD7C 2XMWA 4XO0A 2QJ3A 3DMJA 1RISA 5CYQA 2F7VA 1SQFA 4MIWA 2EFOA 1RBLA 2WCXA 1MWYA 2Q6BA 4IOCQ 4DSIA 3VALA 5KFKA 5DG7A 4RWWA 1V5VA 3DN9A 3NNAA 4IFVB 4IFYA 3CD7A 1RWXB 1U24A 3KTQA 3T1HF 3P6YC 2IHR1 3H5UA 2CJQA 1DQ8A 4ED0A 2HAIA 2BDPA 2CJYB 3PHEA 1G1XA 3U1LA 2QMUB 1VMBA 3I9ZA 3BYPA 5AXNA 2L08A 1F5CA 4ENOA 1IKVB 1FRLA 1Q8KA 2BJ7A 2Z30B 1HHTP 4ZMMA 2E5IA 1NHVA 5KG7A 4FXVA 4ZK7M 4DFJA 4Q0BB 3BBCA 1XR6A 5KOXA 1PCAA 2L9WA 1I6JA 5A2QY 5D78A 2RU3A 3OL7A 3M9MB 2VG5B 1FNXH 4ED1A 3VZIA 4LF2A 5K20B 3BGLA 3ET6A 3MCOA 1JXEA 1X5PA 2FZKB 2OEKA 1YG0A 5C24B 1RXOB 4ED4A 3B6BA 4M8LA 3KK3B 3UVJA 2JEGA 5ETRA 1FEHA 1RAHB 2WBRA 2LQ9A 4C0BA 2XY6A 1N5YA 2NUHA 3GQCA 2I38A 1TL4A 3GP9A 4NA3A 2LDIA 3HJFA 1LW0B 4USWA 5I42B 4I1TA 2P6SA 1C1CA 1Y5LB 2GZOA 3MM9B 1OY9A 2V34A 3LALA 2ZWOA 2EFNA 3W8GA 3FGVA 1BUXA 2GMJA 3SFUA 3MFIA 3RZAA 1CULB 3GCXP 4OYIA 3J81U 1ZM9A 1K73T 3C15A 2B8QA 1UA1A 1FRMA 3KLEA 4ES2A 4DF8A 4KR0B 3SXLA 3W1YC 2OGUA 5E5NA 3CW2C 3EXCX 4TKTA 1BC6A 1TL3B 1PBAA 5DZ6A 4R0JA 3CCES 2ZUGA 3G82A 2HHUA 5HMYA 2GV1A 1FFWB 1M1KT 1TV6B 2U2FA 1QSLA 4BBYA 3H4DA 2XY5A 3BGFA 4DCJB 2O1PA 3DDIA 1WG1A 4ZN1A 2WW4A 3BBBA 4QR1A 4GKJF 2FTRA 3PYDA 5L1JA 2ZH2A 3SEOA 2FD2A 2HYIB 3M7VA 4CZCA 1RJJA 2FYXA 3LF0A 1HQEB 5FLXY 3HHLB 1NJZA 5D0EA 2J9CA 4CLPA 2HHSA 4DZDA 1X4DA 4YOEA 1OSDA 1FERA 2Z0GA 1S1WA 1NK6A 3RR8A 4WFYA 1S59A 2MKKA 2XLIA 4CO2A 1HD0A 2SXLA 2ZBRA 4MK9A 3A3PB 2RDJA 3K0JA 5EUHA 1TKTB 2K2PA 2YNIA 2WVFA 4HACA 3JSBA 4ECYA 1VJWA 8ATCB 1M5OC 4GVBA 4QIGA 3D66A 5BYQA 2OLWA 4I6AA 2GQ2A 4JI5J 4TQSA 3KYLA 2JLFA 1TKXA 2QFJA 5IM0B 2PI5A 2ZWPA 1S1UA 3CGIA 4I68A 4O44A 4TVAB 3I0SA 3POTA 2RB7A 1G3OA 2O5DA 3I5BA 3GJQB 2F4VJ 4LVOP 4OZLA 3N6NA 4PPDA 1EB0A 4EFAC 1S0OA 4YY3F 3A8JA 2P9EA 5AE3A 4OI1A 2M9KA 4AQYF 2N7YA 3PIOQ 4JI4F 3QT5A 2NZ4A 2LECA 3MR5A 4X66F 3PYEA 4CLLA 1SJRA 2FHOB 5HAOA 2IBKA 3NOGA 1QM9A 1SUQB 2HNZB 4LFBJ 4GC7A 3BR8A 2IPOB 3VHQA 4X64F 4NLPA 5KG5A 3VAJA 3FSIA 3E51A 5J1EA 1KSPA 3FBFA 5EHHA 1E6VB 2PMWA 4RLEA 2VJUA 4J9QA 3RW7A 4QWAA 4CT9A 1O6XA 4E0DA 4KV8B 3TUZC 2YNHB 5F8IA 3K57A 3C19A 1VBKA 1CJVA 3D28A 2V2KA 2AKWB 2CJBA 1N0VC 3GIIA 2Y0BB 4LSLA 2YWEA 4X4OA 2VL1A 2AGQA 2Z57B 2KYXA 4V1Ak 2M0GB 2HPUA 1D09B 3MOJB 3TAMB 1DBDA 2X1FA 3MEEB 5J1NA 1HMVA 4OZ2A 3TUJC 2LEPA 3FEYB 1RAGB 3CWJA 2D41A 2E7XA 4UY8T 4YR3A 2A2DA 5CZXA 2LVWA 1Q4RA 4TU7A 2MPUA 4DJBA 3WC2A 1X5SA 4JI8J 2RF2A 2H65B 3FEXB 4PRFA 2B4VA 5DRKA 2XSFA 3MECA 1FCAA 4DF4A 3B54A 2B4OA 3HXMA 3NGTA 1GMWD 5AE1A 4P7VA 1YJ9S 4L72B 4EBCA 1B7FA 3DLGA 4NLUA 2UUBJ 1Q8IA 5DQHA 3IMQJ 3VGTA 4KTQA 3R2CJ 2BA9A 1NK8A 5D3GA 2DR8A 2QFIA 4KYZA 3OR2A 4X4VA 2BQRA 3MMCA 4F8RA 4IYQA 1KQGB 3NNHA 3A4TA 1QAIA 3DLEA 2IM3A 4JV5F 2FJAB 3PDNA 1DZ5A 5DZ7A 5C42A 3DI6A 2VICA 2J76E 4Y00A 4NZ0A 2HBRB 4OHZA 2CQIA 5F0WA 4ELTA 1REVA 2GVDA 2XO7A 5LJ5Y 4LUBA 5KG1A 3GONA 3NBPB 5E41A 3KWMA 2JZ5A 4HI2A 3CC4S 4ED5A 1WACA 2UUAF 2DNHA 4DEZA 2EFGA 4IDKA 2DH7A 2JH3A 1MMLA 4ILRA 4MK7A 3BBFA 4LVNP 2MDAA 4WE1A 1RK8A 3PIPQ 5IT4A 3PRDA 5MAOA 2DR6A 4A8OA 1XWLA 2V2VA 4PCQA 4KPYA 3DOKA 5J2QA 4LRBA 4NLGA 2OJ3A 4WIIA 4LSNB 4ZP7A 3EJMA 4X62F 4DSJA 1VDHA 5F9NA 2COLA 1HA1A 1TL7A 5G4DA 1VQPS 3HT3A 3R5BA 1HBNB 3M6UA 1Q81T 5ADZA 1U1QA 2HS4A 1AA1B 1NHUA 4M5NA 4WCEQ 1UVIA 2QRRA 4F2RA 1GH8A 2DGXA 3BQ0A 3US5A 3AFGA 1SB6A 5A76A 2KT3A 1QAYA 1VK3A 3R7BB 3OTOJ 4NE9C 3HI9A 2G2ZA 2FJXA 3N28A 3VR1A 2WONA 1R8HA 2GIQA 2NR0A 2LCWA 4LBHA 5M2RA 4DBQA 3GJSB 4Y2CA 3BR9A 3AHPA 5DS7A 1RTDB 5KT2A 3PKYA 1GT8A 5IC4B 1PO6A 3TAPA 1UPPA 2BV3A 5EX3A 5KFOA 2FPHX 5L39A 3C6UB 2ZFHA 5CH7B 3SQGA 2V5HG 3TA2A 2GMLA 3NLCA 1NU4A 1RBAA 1V3SA 5C7PA 4P2MA 2VPYB 4C2MA 2JSXA 3PX0A 2ZDPA 4PXCA 2CZVC 4PEOA 3TEHB 3VF0B 5C25B 2HRTA 2NLWA 4LMZA 4LF8J 3U27A 2B43A 4NLSA 1U48A 1IBLJ 2O66A 1FX2A 1I94J 3M2UA 1JXLA 4Z7YA 1AB8A 2ADCA 1FDDA 4YB6A 3R27A 2CNLB 1SJ3P 2I2YA 3NG8A 3MGJA 3M32B 2LDYA 2XI3A 1S72S 1YHQS 1T03B 3KUEA 1GK8A 4ZP9A 4J9MA 4ED2A 2IM1A 5A0YB 3V81A 1RTJB 2Z2LA 2ASLA 3GIKA 1RT3B 5H9EK 4W90B 1ZAVA 2OMOA 4LF6J 3UCGA 2DGTA 1Q5VA 2FLLA 3AJ2A 4O0NA 3QAEA 3N79A 3HVTA 2RMLA 3W2VB 1WOSA 3QQCD 5CA5A 3W63A 2GIFA 1XK8A 1GX5A 4KC5A 4C6AA 3V6DB 3PM9A 2ERRA 1TL1A 4CI0B 1JXVA 3OL9A 4EMDA 2H4YB 4TNOA 4Z2XA 4DR7J 4ER8A 2KH9A 1N32J 1RAOA 1XMOJ 4TU8A 2X51A 1FXDA 3MOZA 4I56A 4J9UE 2VODA 2QX0A 1B0VA 3H5XA 1VIXA 1SJ1A 4WXWA 1IN0A 3DHXA 1SI9A 1N36J 4OI0A 1CQNA 1HPZB 3IS9A 2GVZB 2AX1A 3HF5A 3GWCA 2W2QP 4ZCKA 4PPZA 2CVEA 1LQ9A 1ITPA 3SSSA 1NSQA 2FLOA 4PWDA 1Y00A 3NWGA 3OTDA 1F5BA 4L74A 3ULHA 2W2PP 4N7TA 4OV1A 1NJWA 2QN6B 1M1HA 3DM2A 3GIJA 3IBCB 4RW8B 4B3MF 2OMLA 5J2PB 3FFIA 4AT1B 1ZM4A 3G8QA 4R25A 4I0WA 5LJ3Y 1FJGJ 2YNFB 4J9LA 4EBEA 2A6MA 2DISA 3H5SA 3ZNJ1 4OX6A 2DRBA 3L7OA 5E7OB 3CUNA 1KRPA 5IOLA 2GGPA 2GA7A 3DLHA 2RQCA 3QIPA 4DUYF 2VG7B 4BDPA 2NSCA 5GAGI 5J2MA 3Q8SB 4CO5A 2MZQA 2JDJA 4ZVHA 2XSJA 3M2VB 3HKWA 5HQLA 2AMCB 3DOMB 2EPIA 2G9OA 4DLEA 2E9TA 1Q7LB 2M5YA 1D9AA 2XMMA 3DU5A 2CZ4A 4FVCA 4DMZA 3NL0A 1NXIA 1T11A 1FRKA 4C9DA 5LSRA 4JI7J 1CQMA 2E9ZA 4G1PA 1LWFA 3WIVA 1UP1A 2DRAA 3U1NA 3S01A 2E66A 1PGZA 1CBKA 3RTVA 4QPXA 3NCQA 4F25A 1GQEA 4HI1A 2HFZA 2XC9A 4KO0A 5D0HA 3BN7A 1JLQB 3M6WA 5F3TA 4TYAA 2W24A 3HP6A 4ZLJA 2ZJRQ 3MAAA 4ZVTB 5KG6A 4R8UB 4Q43A 2JOQA 4ECRA 4ALZA 1SH3A 4YP3A 1AXQA 2D3O1 2E1RA 2HNYA 2EC0A 1YZ6A 4NEZA 1RAJA 1VQMS 5CHCB 4YDXA 4JI1F 2DNGA 4ZVFA 2YKNA 2UUTA 2QL9B 2C2MB 2W25A 3H90A 2YH0A 2ZKUA 3EM1A 4RNHA 2XYHB 3WC0A 1JLFB 1Z2LA 1UMJA 3WQPA 2GIRA 4USUA 3AB4B 1N5VA 2RHSB 3DYAB 2J7UA 2HHPA 3QPIA 2ALZA 2F5GA 2IDLA 5IQQA 1TK8A 2Z2ZA 2V68A 3VWSA 3BGRA 1XIQA 4ZCIA 4C48A 3MCNA 3GTYX 3V6KA 4X4QA 4M5LA 4M5GA 3KOAA 2AV5A 1YJ7A 1ZYQA 3QSIA 4KIAA 3UCUP 3VGVA 4IR1A 2ZZTA 2J8AA 1S9EA 5KFJA 4DU7A 2ASYA 4OJGA 2GFFA 2HBQB 3QSYB 2KVQE 2RD5C 4KGXB 5HROA 3F44A 1OPIA 4M5DB 1R27B 3FKBA 1N6QB 1ZETA 2DR9A 2KDOA 2NXJA 3AY0A 2BE7D 2FHMA 3DLKB 5AJ3J 4RBTA 1OS5A 4JYAJ 1UVNA 1HR0J 3FMWA 1RKIA 3MEKA 2MQ8A 2EI5A 5GMKa 2D69A 2BOAA 1BQMB 1DHMA 3NGSA 4H4OB 5KFVA 3ENQA 3E3XA 3MF5A 4C4WA 1C0TB 5E3PA 1OPZA 4NWBA 5CYQB 4A8XA 1SJ4P 4WFBQ 1V3ZA 2C28A 4OYMA 4U6PA 3QIDA 2R7SA 2EFVA 2A2CA 1OQ6A 2BJ1A 3CDBA 2UP1A 4X84A 2AEJA 3K5MA 3EZOA 4IFYB 5KFAA 1HNZJ 4WP9A 1FKOB 1BMQB 2PIIA 4BWMA 3TJAA 1T9VA 1PC5A 1HNVA 3MXHP 1NSAA 3K59A 2AJ4A 1VRTA 1T0TV 1WDTA 3OFEA 2DNZA 1RAAB 1HHSA 1S7IA 1X31C 4DL5A 3KUHA 2DNLA 3HLUA 3J7YU 1WEYA 1N5QA 1OMSA 3NGUA 2HMIA 1Q7YT 1FRXA 3DDNA 4EU0A 4EWTA 5KFIA 3MD1A 4CO1A 3J7YI 4DR4F 5EWEA 3KG0A 3Q8VA 1UETA 3M9NB 3ET6B 2AYGA 2HHXA 3CCTA 4AFFA 5JUMA 2E5GA 3V2UC 1LWCA 1QUVA 2IYGA 2FVPA 1ZM2A 3VAHA 4PXDA 4I7FA 1N5YB 1FXRA 1MSWD 1VQ6S 2QIFA 4IH5A 2OKQA 2FDNA 3HSJA 3ADAC 1VQLS 2EFPA 2BANA 3G6XA 1W26A 1QE1A 2WB1D 3IGNA 2KI2A 5IFMA 4IR9A 2MY8A 2X1GA 4MKBA 2ACYA 1Y10A 4DPOA 1KN6A 3C15B 5T41A 3BSOA 4CYUA 3CDAA 3UD3P 2H5IB 2MB0B 1JLCB 3UI3A 1WOOA 4DV5J 4ZHRB 2DPIA 4UT4A 1IWAA 1B0TA 1N54B 3N4WA 2W9CA 4ZPWR 2C1EB 4IFVA 4UW2A 3G82B 5CCLA 3KJFB 3QT7A 2OEMA 1HYSB 4WYLA 3RB6A 2XG8A 3CCZA 2AJ1A 2HURA 2FGCA 4DFKA 3DRXA 4I2PB 5BR8F 2X1AA 1XNQF 4LF1A 4TY8A 4WPAA 1IKVA 4DV4J 1U45A 3M1VA 1S9GB 1T3NA 4CH0S 2WB4A 4B9SA 2HFNA 4ECSA 3ILJA 1N52B 4NLVA 4Q0BA 1PC4A 4ZPTR 4FBUA 1HBOA 2NPIA 4DOZA 1WC4A 5KG3A 7FD1A 4ECWA 2GAHC 4IO1A 4TLRA 3E8OA 2VQFJ 4LREA 1BHNA 2C3UA 2VG5A 1B7YB 4DG1B 4OYZA 5LMUF 1FDBA 5K14A 3PACA 1S1WB 5C24A 1O0PA 1GXUA 1EQ0A 3KK3A 4USHA 3BF4A 3PW2A 1XR7A 1HBUB 4XDDA 4ILMA 2LXUA 2N4CA 4USTA 1UZHA 4ECXA 3KHGA 2Y3YA 3CCWA 4UY85 2MQNA 1IWGA 2YNIB 1LW0A 2XEXA 1WF0A 4PUOA 1RWKB 5I42A 4BCAA 3R6GB 1RAFB 3FUYA 2ZBPA 4GVBB 4EO8A 3MM9A 1EZZB 2PT0A 2R8KA 3TVKA 1KS2A 3IR7B 3CCJS 2V8GA 2VBZA 4YHHF 3CMQA 4O44B 4TQRA 3POTB 1MWQA 1D9FA 3OTOF 3D6HB 2ZM6F 1AZSB 4YEAA 3H98A 2RS2A 3GIRA 2EKNA 3CE8A 3UN3A 1Q53A 2PC6A 4U8VA 2HBYB 4ES3A 2QLJB 4RUCA 2E7VA 2UVUA 3VAFA 3KMQA 2XZWA 1TL3A 3V4MA 2XULA 3D1HA 2GHPA 3NMRA 4UZCA 4NEYA 4OX8A 4PAAA 2K8GA 5K8OA 3FBEA 4KGZB 1XTZA 1KLNA 3TAQA 3W62A 2FC9A 1UAWA 2MJUA 3HSZA 2R2TA 1IKWA 1CJUA 2MZRA 3EVWA 1GFWB 2PMHA 1N34J 1UEKA 3R8YA 1CJTB 3U7JA 2HQDA 3H2UB 1HQEA 1NZAA 3K7RA 3KLVA 1IBLF 1RWMB 3TO8A 2KZMA 4AE5A 3HT0A 4RU2A 3SBMA 4HH1A 3MR3A 1XMQJ 4R5PB 5LMNF 2HEKA 4IQMA 3K5NA 3TOQA 4S0MA 1PAUB 1RYSA 3NRBA 1JKHB 4G1QA 3ETMA 2KB2A 4ZJQA 1TFWA 1NK0A 1OO0B 4WXOA 3K58A 1S6PA 2CQ1A 2IRYA 3BDEA 3KLFA 2NYIA 1YI2S 3BSNA 1DARA 2DKOB 2OHDA 4FNHA 3BJYA 1QSYA 4NL5A 5H1SV 1WTBA 1IBCB 2R7UA 3PJ9A 1IBKJ 1VLOA 2GO9A 4L75A 2BMBA 4J5OA 1QLNA 3MAQA 2JC0A 1YX2A 2KHCA 2M8HA 1LXJA 2CQPA 2MYFA 3SIPB 2DNKA 5CCMA 1QD1A 4PQUB 2HNDA 5D3GB 4DR7F 4J9KA 1N32F 3NCPA 5DM6Q 3EZUA 5ETLA 3ILLA 5ETPA 5F3ZA 1Q78A 1VS3A 3K5OA 5C42B 1UJ5A 1URNA 5GAHI 3DU6A 4FBTA 1N36F 2BE2B 4QCLA 1WHVA 2GVDB 4DR1J 2W8LA 2X1BA 4PXBA 2HVHA 3W3SA 1U1NA 2ZZMA 4GKKJ 1E6VA 4AL5A 2HKEA 3RBZA 2L3MA 4C0HA 4LRAA 4UUXA 2QSWA 4Q2MA 2YQ0A 2C2EA 3C46A 3D1QA 4IDKB 4U7UD 1N88A 2YNHA 4NXMJ 4XPEA 2FJWA 2NPFA 2AW0A 5IZHA 4KY3A 3N0VA 5F41A 2VBYA 3DRYA 2EWHA 4DR6F 2FVSA 3O44A 3IRWP 3TNVA 5H9EJ 3DOKB 1R8BA 2I6WA 2XLKA 3FC9A 4FYDA 3ZC4A 1FJGF 4NASA 5L38A 5KFGA 4QR0A 4IKAA 3W9HA 2BUNA 3TAMA 2DPJA 3I5AA 1RU1A 3K89A 1MMNA 1KR4A 1D3WA 3K5LA 4OLOA 1P8GA 4DPWA 3KNGA 2B7BB 3Q86A 3ILOA 1N48A 2ZKTA 4WU3A 3CXCR 2XMVA 2MHEA 2OD6A 2OELA 2NS1B 2GNKA 5AE2A 4TXSA 3MR2A 2O01C 4WWSA 1S10A 4ANCA 3GILA 2WONB 4X4SA 1HBMB 2ADBA 2IY5B 3QZ8A 4YB7A 4ILLA 1VGYA 4FPRA 1IXKA 4F2SA 4ZVPB 2BJ8A 5KOWA 1U2FA 2KFYA 4CM0A 4M1KA 4DR5F 4ZN3A 2WHOA 2NXCA 1X4GA 5FD1A 4J90A 5CABA 2LKZA 3GSIA 3UPFA 2IC3B 5SZTA 2DIVA 3DXBA 2BJEA 3ONQA 2Q66A 1F9EB 4OZNA 3ZTPA 2E29A 4DR2J 2YBVA 1ZPVA 1F60B 1Q79A 3CNQP 3ISNC 3CJRA 3DOLB 3H0PA 4FNIA 4NLQA 3HHDA 1RT4B 1UVLA 3QJLA 1DQ9A 2FQQB 4MYTA 4DQSA 1DJ0A 2LXIA 2DGWA 4AXJA 4IOBA 1B64A 1FFSB 1RWWB 1T02A 1Y3KA 1XBWA 2FZGB 1U0SA 4HHUA 2A6OA 1OY8A 3EPGA 3M2UB 1RGVA 5CD4H 1T95A 2BVZA 1Y5NB 3TR5A 4OZJA 1YITS 3V6JA 1X4CA 3D9BA 2RS8A 2ZVSA 4RW4A 4HTIA 3V81B 3OVBA 2C2ZB 2ZH3A 2PSZA 4DV6F 1WEZA 1XQIA 3KG4A 5HVGA 2ZD1A 4LSNA 5JXSA 2RQ4A 4Q8EA 1S49A 3GLJA 1YRXA 4ZVUB 3F0NA 3WZ0A 2MLXA 2ZHOA 3H25A 3QFWA 1ICEB 1XMBA 5HLFA 4J91A 4X4RA 4OL8A 1NCLA 3MMAA 1TL1B 4LIWA 4OJ1A 2ZH9A 4Q8FA 2EBEA 3RRHA 2UUCJ 2R3VA 3C16B 2HIQA 1SL0A 1P9QC 4ZPAA 3BO2A 5D15A 2VJVA 1JWWA 1Z2ZA 5K9FA 3LANA 1RTDA 4F0MA 2D3UA 3LPYA 1JLEB 2ZNZA 1PBUA 4RX6A 2AIRB 2Y1LB 7FDRA 3L09A 1YSJA 3PTWA 1EKSA 3IS9B 5AJ3F 3Q8PB 4C11A 2BM0A 3ZTQA 4JYAF 2YQ1A 3A3NB 2ZH5A 1HR0F 2YNGA 2KKHA 4R0EA 2JEJA 4NZ7A 4Y2MA 2A0FB 2KFNA 3S8SA 3MEDA 4NYZA 2YWHA 4JOUA 3LO3A 3IA0A 3QATA 3NS7B 1YTYA 5ETTA 1IKYB 2DGQA 1A6LA 3JTOA 4HDHA 2AT1B 2HQCA 4WKYA 3M32A 5A8RA 2ZC3A 5KFPA 1TK5A 1T03A 1URRA 2IJFA 1FRHA 4ID8A 4DV2F 5ETOA 3LGHA 3UN5A 4J7CA 5A0YA 5HVHA 1HNZF 2HFUA 2YKAA 5BYRA 2BQ3A 2HFOA 1U6FA 4PG5A 1XR5A 3MZIA 2HVEA 3QIPB 3PO5A 4ZJOA 3V6HA 3CTRA 4FVMA 4L6V3 2K1RB 2CQ3A 3AT1B 5J2MB 4G6VB 2AX0A 2QO3A 4LFAJ 1T9WA 1WWHA 4Y6IA 3RBEA 2Y9HA 2XSJB 1UVMA 4CTAB 5LOQA 2DHHA 4X65J 4LF7J 2CQHA 3BN4A 2V4RA 1NDLA 4NZ6A 5CXTA 1P1LA 1YJUA 2P8IA 1PILA 3IBFB 3GYXB 2RKIB 1NEEA 3OL8A 1U6BA 3CMAS 4EBDA 4DV1F 4KHPJ 3D3BJ 3MDFA 2W1BA 3OL6A 1FT8A 1HLWA 4JI0J 5HL7Q 4QQBA 4MIBA 4KO0B 5HMWA 1RQ0A 3DLLQ 2BJ3A 3M8RA 1HPZA 4NCGB 2GVZA 3MAAB 1FA0A 2LQ5A 3TZYA 2ZE2A 3D5MA 5D0RA 4JI6J 3FQLA 1FE4A 2R7RA 3CJKA 2L9NA 1SCJB 2BOPA 2FJBB 3EWGA 3TA1A 2NXEA 4P2XA 2Z8QA 2FIUA 4W4MA 5HBMA 3K8VA 4OYPA 2DXFA 2KN4A 3C3LA 2UXBF 2FLPA 4IH7A 4RW8A 2KXFA 1XNRJ 4ECQA 4JV0A 5J2PA 5KFUA 2G0IA 3QJJA 4J9PA 3M9OB 2DHAA 4WZMA 2G2OA 1DRZA 3AXKA 2I0XA 1RHQB 2DIUA 5F9LA 4KB7A 2H5JB 1JLAB 4Y34A 4NXNJ 4ZVQB 2JVOA 2UU9J 4OZ3A 1YIJS 3RBXA 2VG7A 1NB2A 4ECUA 2EFQA 4DV4F 3NNCA 3MD3A 1PKUA 1CVJA 3CSKA 5E0OA 4E8UA 3JAMY 3M2VA 2D9PA 3UDLA 1FWLA 5A6WA 3OD2A 1S9EB 4WF9Q 1OYEA 3HHLC 1HW9A 1QTNB 2VQFF 4J37A 5FJ4A 2IIHA 3BH6B 3OBIA 4F0HA 5KT7A 1GAOA 2CQ0A 4MT1A 3W60A 1J5OA 4K2JA 3JSMA 4B3TF 4DR3J 5F8JA 1Z1ZA 1YK9A 4KQZA 2J7WA 2DCLA 3VTIA 1R43A 1LOUA 3Q8UA 2Z2YB 3IM8A 1ZZFA 4NRTA 4KHMA 4ELUA 1YKWA 1J5EJ 2VD3A 3L3CA 7AT1B 1KONA 3RB0A 1R8AA 1PIEA 1V5IB 2M3DA 2E5HA 1QAXA 3UDCA 4R8UA 4OX7A 3H2VE 1NKCA 1JJHA 1IBMJ 2WRMA 4KFBA 2Y0SD 4TLQA 5FDLA 4O3OA 3T6JA 3BPDA 3MM8A 3IP0A 4IG0A 4N8OA 2PEHA 1NPRA 4OZ1A 2DBBA 3IRXB 1GXLA 1E6YB 1HHQA 4NLRA 4P10A 1WTFA 2HVIA 2HZVA 4RNFA 3IXQA 3DRRB 1HNVB 3GJTB 1DAXA 4DV7F 1JLFA 2DXEA 3VAGA 3TWZA 3DRSA 1T3OA 2BKNA 4F3QA 4ZLLA 2FLNA 4X2BA 1SVDA 2HHHJ 2W2MP 4DDFA 4F4AA 1AFJA 3DYAA 1KQFB 2WOMA 4OYAA 4ELVA 2GHWA 1NKBA 2HMIB 4U67Q 3H7HB 5IT9Y 2HLUA 1IQZA 2M88A 1ZBTA 4NX9A 1NK5A 4ZPDA 1RT6B 3W7BA 3OXLA 5KG0A 4YR2A 1AROP 1MU2B 2CG8A 5K8NA 3D0HE 2ROPA 1S0NA 1RLCL 3ENAA 1LWCB 1XMQF 2AQ4A 3QGHA 2CFXA 3VV2B 2HS3A 1ZAXA 3WX8A 6AT1B 1IJEB 1K1QA 1H7XA 4H4KA 3DLKA 1H7WA 4U8YA 4C98A 2KXNB 4RKUC 1YBAA 1Y11A 1ZA1B 4XTTA 1WHYA 2YPZA 1QE1B 1SKSA 3O5TB 2C2KB 5CAAA 5C2CA 2PDAA 4MKYA 4H4OA 4QIFA 3TI0A 1S1XB 3P3DA 3NGDA 2EC2A 1IBKF 2W4DA 2DGSA 3GFHA 3D6MB 3G4SS 1C0TA 1YJNS 5F8NA 4CYUB 3T9NA 4ZOSA 1WKKA 4ANEA 1PJ6A 3T5LA 3KK1B 4HT5A 4K4WA 3GV5B 1FRIA 1ZS6A 2ZH6A 2XGPA 2K7JA 4C7QA 3QGPA 1BWVA 2CWXA 4LF9F 5KFRA 2QTWA 2W9CB 3JQMA 3CF5Q 3BKFA 1RT5B 3B4MA 3RAXA 1N4LA 1Y9OA 2HS0A 1FKOA 1RTZA 4LFCJ 3ETOA 4RBVA 1VLYA 2VIHA 2F9DA 2GO8A 1UWBB 2GQCA 2CAJA 3F41A 3PW0A 5C5JA 1EQMA 4TY8B 5D4NA 4ZPBA 4FF3A 4F26A 3M1VB 1X4EA 3H8YA 1GMWA 2KJVA 2H51B 3MFHA 2JEIA 2MHNA 3NCRA 1FNMA 3T5HA 4EUVA 2JL9A 1HBOB 2BJDA 2ZNYA 3PRVA 3N6LA 4ITSA 2C22A 2J0SD 2XYGB 9RUBA 2DY9A 3QNWB 5BYSA 1RT7A 1H98A 3D7SB 2D9OA 1S57A 4P6QA 2OI2A 1VHFA 5K14B 4C8LA 4CO0A 1HNWJ 2FHKA 1KKHA 2ZZNA 2O67A 1Y0HA 5J1PA 3DNCA 2BR0A 2IFXA 5B0BA 3IFEA 4MKAA 5B09A 3THPA 4DPYA 6FD1A 2XWXA 1MLAA 4PUOB 3I87A 1UEUA 1TUGB 1S6QB 3FJ2A 4ED7A 4F3OA 2Q6CA 2FHJA 3OR1A 2BZ2A 3CVKA 2MQQA 3ICLA 3D67A 2DO0A 1UJ4A 4QU6A 3KLGA 3T1HJ 1S99A 3LOUA 1U26A 3PXGa 4NMLA 3SSRA 1RE1B 4UZBA 1JLCA 3G8TA 3KMSA 4C97A 2WK4A 3KHRA 4ZHRA 2CPHA 2GC8A 1CLFA 5GVQA 3JQJA 1NM2A 1SC4B 3MCMA 1S1VA 4CLUA 5DDRC 1K8AT 1N0UA 1J2VA 4UOGA 4DCOB 2CQDA 2C2RA 6FDRA 1LV5A 1HYSA 1KQKA 3C8YA 2UV8A 1U1LA 4PG8A 5G0RA 2H4WB 1VCTA 1LK5A 4DR2F 2HWIA 4I2PA 1RWUA 4A8QA 2NYHA 1IKWB 1CJUB 2DHGA 1UFWA 3AQOA 1S9GA 3HD2A 3F73A 5ETKA 3FCHA 2B9WA 2QE5A 3MTKA 1VFJA 4HLBA 4O0IA 4V19X 4CLYA 2A18A 2OPPA 1S1TA 3W5ZA 4HR2A 4CH7A 4AL7A 2BABA 4DFPA 3T41A 1KFDA 4RW6B 2OO4A 4DG1A 4MFBB 2JJ4D 3CCUS 2VKZG 1TKZB 3TVZA 5KFFA 2IM0A 4YB5A 4G1QB 4N56A 1H72C 2JRSA 5I3UA 2YKMB 3FQKA 4N5SA 1S6PB 2MQMA 1HBUA 1JQGA 3NP5A 3KLFB 3M8WA 4ZKAA 1RTHB 3HSDA 3NY0A 2EW9A 2O3DA 4LF4J 2QLFB 2XMJA 2HHTA 2IA0A 4YFUA 3FCWA 1EJ7L 1VQ4S 3M8YA 4YDDB 4K5RA 3KDNA 4M5JA 4QBUA 3FSXA 3TEGA 5KT6A 1VQ7S 3PR4A 1VIOA 2VZ9A 4USJC 2W9AA 1LWXA 3CULA 3CJSA 4XDCA 2HHWA 1AZSA 3LH2S 5CD4A 1NSKL 5T14A 1TQLA 3MTJA 1FNOA 2HNDB 2CIMA 2V2QA 2MJNA 4GKJJ 3FMBA 1VK8A 3SFGA 2JNJA 2CNKB 5HP1B 3D54A 2QC3A 4A8KA 3CD5A 4J9VA 1VQNS 2VFTA 1HD1A 3BSAA 4FXWA 1H6KX 1M5SA 2MZJA 3TQEA 3EGNA 1U1KA 3AQPA 3DGVA 1WD6A 4K4TA 1SKRA 3P5BP 3A1YG 1EP4B 4KAIA 1W7WA 2VFUA 5KG4A 1N33J 4N76A 4ECTA 3QRPA 1ZM3A 3D2WA 5ITHA 3CCQS 4OI6A 5HSPA 3MM5B 1CJTA 1RLDA 1ELOA 2FY1A 3MPUB 4F67A 2VKRA 3TJ9A 3THVA 3J81Y 3W5YA 4R5PA 1ZTTA 1S12A 1IR1A 1S0VA 4OZ0A 1T8EA 2ZBIA 1JKHA 4I6WA 4ZJLA 2BM1A 4B9NA 2ASDA 3M30B 4DX5A 2IBOA 1IR0A 1SV5A 1UFKA 4A48A 3PFOA 1WDDA 4G1IA 3TW0A 2BKOA 3ZZ0A 3KKFA 2GS8A 4LFAF 1QDUB 1DLOB 2BACA 1R89A 4OI4A 4ZLNA 3DLBA 4B08A 1V6HA 4X66J 4LF7F 1YLXA 2IA6A 3BSCA 4FKYA 3HX9A 3IBWA 2QLWA 3DRPB 3HHLD 4ERDA 2MZTA 2MQLA 5DLFA 2YX7A 4PZVA 3MPYA 3IC1A 4DLGA 1TMJA 3KLIB 1NKEA 1FI4A 4KRWA 4PQUA 3W5XA 2K06A 3WBZA 4QYZK 1NH8A 8AT1B 4KHPF 1HW8A 3C14A 2VG6A 3T3FA 1YZ7A 3R5JB 3FZBA 1EIYB 1U8WA 3TP2A 5KFHA 2CJAA 3SSQA 3R5GA 4H4MB 3LP0A 1NJXA 4F02A 3QBCA 5F8LA 1TTHB 1JJ4A 3RGIA 2BE2A 4I2QB 4ATNA 1ZZNA 2VQEF 3CMES 3LP1B 5HQ8A 1X8DA 1R0CB 1VQOS 5L1IA 4DI6A 4UQGA 1TK0A 4JI6F 3AOBA 3TZZA 1SIWB 5T7LB 1YBUA 2CRLA 4PYDA 4PR6A 2QL5B 2FVRA 3R5AA 2FHJD 3LP2A 2MKYA 3EZ5A 2M70A 2WW8A 4RWXA 1T05B 3TZWA 4RW4B 3J7AN 1JB0C 4WP3A 4EZ6A 2YX4A 2KM8B 1XNRF 4USVA 4K2XA 5E3RA 2ZD1B 1ZPWX 3GE9A 3JSRA 5CYMA 1SKUB 3TANA 1DTTA 2A1BA 4B3RF 1IM6A 4OI3A 1VI7A 1U6ZA 5AT1B 3D0GE 4NXNF 2R8JA 2UU9F 2GAGC 1VQ8S 2J0XA 4JBCA 3LAKA 3H20A 1NK7A 1WOPA 1HNIA 2F65A 1Q1KA 5HJYA 2UXDJ 4F4KA 1N8RT 4NLOA 5HLFB 1QSSA 2DO4A 4DQRA 3MMAB 3J80U 4ED6A 1SJQA 3BYRA 2HLTA 1YBTA 3HJVA 4K59A 3HULA 3CJ4A 2PGCA 1HBMA 3SCJE 4FF4A 3SCIE 1HWLA 3JYTB 1NDCA 2BBEA 3MUVP 1TAQA 1PYOB 3U02A 3BREA 3I82A 3KDOA 4WFAQ 1LFWA 1KVJA 2X3GA 2JFKA 2CA9A 3O2IA 3W2WB 1D9DA 2JWNA 2DNMA 3V5RA 2IC3A 2R8IA 4H4KC 3B4DA 4C11B 3GCWP 3HFVA 3I96A 2DITA 2KYZA 1XEZA 3HHEA 3WIUA 2YNGB 2OEJA 2CPFA 2HG4A 2NSBA 4X4NA 3DOLA 2ILZA 3L7PA 1B4SA 1RT4A 3GFXA 4IOAQ 1FVSA 2MZSA 4B3SF 3MEDB 1J5EF 1WC6A 4KKOA 1WJ9A 4D3GA 5DO2A 1FJ7A 2CNOB 2EK1A 4ID5A 4QYRA 4X62J 2HW3A 3FDSA 1IBMF 4AXIA 4M95A 1A0OB 2V8DA 1KD1T 4NRUA 5A8RB 3KK2A 3HD1A 3H40A 2ZEJA 1AYEA 3TARA 2QGFB 1N5TA 1GTHA 1FK9A 3PNIA 3AODA 4DXLA 3QFHA 2LMIA 1JJ2R 2A3JA 4QW8A 2ROEA 1V3RA 1YQHA 1R0AB 5DDPC 3FZ2A 2GHVC 3CJ8A 1A7GE 3VQTA 2VC0A 2H3EB 3SQOP 5A8WB 4N8NA 4DL2A 3AD8C 3I0RA 1GEHA 2DHSA 1H73A 2QA2A 2D1CA 4ZS6A 1YJVA 4ZCLA 2R7OA 3KG1A 2AZ3A 2KT2A 3D6TB 4A8MP 1HI1A 1RA7A 2WVCA 1W25A 3QGIA 3C16A 4K0KF 2PI4A 4URQU 3EE3A 2LQ8A 3M8SA 3PV8A 2G0JA 4P2SA 4BC7A 2V8VA 1BWEA 1VQ5S 4B9UA 3FVYA 3UO0A 2WSCC 4QW9A 2VU5A 3HSGA 3SDEA 2UVRA 3H2LA 1JLEA 5A2QU 1Z4UA 3PX4A 2VF3A 4F4ZA 1MMDA 3UFCX 4Y3CA 3ITHB 4ED8A 5AXLA 1X60A 2VASA 2QMWA 4WTYA 2ZE2B 1I5OB 3I5CA 1Q8LA 2RRNA 4USMA 2MLZA 5HQMA 3CJKB 2EG2A 1JX4A 3CDWA 5HBMB 4DZ6A 1YJWS 4EGLA 4K4ZA 3J7A1 3R7SB 1F9FA 1IKYA 1KTVA 1WC5A 3MM6B 3ZXWA 2H48B 1JJCB 2HFSA 3HM9A 2CQCA 5GAGU 3UR3C 4Z37A 1U1RA 2MKCA 4HVZA 1IM4A 2B8PA 2HHVA 3EUNA 1C1BA 4B02A 3CCMS 1FTCA 2C3PA 5KFEA 3NAIA 3S1TA 1HI8A 3JQKA 1VBYA 4WK1A 2K1RA 1XC9A 1KDNA 1TZ0A 2RRAA 2JLEA 4CTAA 1AT1B 4WK3A 2FVQA 3DKDA 4XAKA 2Z4PA 3CDUA 2MZ1A 2ZHBA 2FY8A 1WI8A 2D7SA 2GX8A 4RL1A 2ATCB 2DEIA 5ETQA 1IKXB 2XBPA 2D3ZA 1RSCA 3K5PA 2CQBA 4GRSA 2KJWA 4FP9A 2ZC4A 2RDIA 4ZVSB 1RP5A 1WG4A 5KTQA 1S79A 1H3DA 5KFMA 2UXCJ 2RKIA 1J5OB 3JSMB 1ULRA 4NPOA 2JX2A 4DV0J 1HNWF 3UNYA 4DQPA 5FLXU 5KFNA 4HKQA 3QWUA 3D6FB 2IVYA 4PWUA 3PO4A 3M8ZA 5I4MA 4OJHA 1F0XA 2ILYA 5JVGQ 4B3MJ 3UE2A 3SMZA 3KUGA 4NCGA 4OHWA 2ASJA 1KFSA 2P6TA 5B0GA 1AUSL 3U1MA 2JEFA 5DLGA 4FXDA 3PJXA 4QWEA 4ETZA 1FEEA 3TA0A 4KFBB 2ZOGA 5FDLB 5M2PA 2DVIA 1SL1A 4M5KA 5JMNA 4KT0C 1R8CA 3T5JA 3MM8B 4DQQA 5EGYA 2RSQA 4IG0B 3I32A 3HO1A 2RRBA 4X4PA 2YY3A 3HFKA 5HVFA 4AUKA 1I3OB 2P9GA 4DUYJ 3M8QB 4ZP8A 3CDEA 1SQGA 1UW4A 2Y1RI 4UQTA 1F6TA 2BRKA 2B4UA 2Z56B 3ZTSA 1VRQC 2GQQA 1RAIB 3DRSB 1NO8A 3UDEA 4KPCA 1JLAA 5EX0A 1GXTA 2M7SA 2GJIA 2MSSA 1Y5IB 2L41A 1H38A 2WOMB 5DM7Q 2B56A 2JFDA 1X4BA 5I3PA 3MUTP 3AD9C 3KNAA 4Q5VA 4USIA 4MMOA 4OYBA 3SCKE 3PW7A 2ZH4A 3MEGB 1RA6A 4RZRA 4ZIWA 5KFQA 3R1HA 3A8KA 3PX6A 3OTEA 1UFLA 5HANA 3AOAA 3C66A 3TRGA 4DX7A 4P74A 2LA4A 3OVSA 1FKPA 1RCXB 2CJXB 3FK4A 4C8NA 3BDPA 3RBDA 2V2ZA 3QRRA 5F8HA 2RUGA 2UZAA 3NGKA 1VOMA 5E33A 1RT2B 2DK2A 2H5EA 3LGNA 1O8BA 1FHTA 2KZZA 4PQAA 5ETNA 3BGUA 3IR5B 4XK8C 3Q23A 4A8YA 3L4BC 3LWLA 4LF4F 2BRLA 3GZ7A 4JI1J 2OPQB 3R3TA 4Y0FA 4RW9B 5SUHA 2LU1A 3FSYA 2QV6A 2BW2A 3GMGA 2AF6A 1I51B 2ZDOA 2AGOA 5IC6B 4P71A 3MPDA 2ZH7A 1JMTA 4JI5F 3DFEA 1U1PA 3D3CJ 2QZ8A 2AYBA 4F4YA 2J9DE 5DGAA 3I4HX 4FS1A 5CZVA 2R7TA 4K4YA 2F4VF 2YH1A 5H9FK 3IRXA 1E6YA 3KHHA 4FF1A 3H4BA 1S4FA 3CD6S 4K50A 2N3LA 3MPWA 4B9TA 3DRRA 3P8BB 1RU2A 2V67A 1KVIA 2APOA 4WTOB 3WDOA 3PW4A 4U96A 4LSZB 4OHXA 1UA0A 4NLWA 3GFYA 5AXMA 4LFBF 2WVDA 2HRUA 5GAEU 1Q16B 1SH2A 4F50A 2HVZA 1N33F 4LQ9A 4KJIA 1RHKB 2IJRA 1F3VA 4RUHA 2HGNA 2V0NA 4ZIVA 2CPJA 2DR5A 1RT6A 5GAEI 1RT7B 2Y1IA 3I4PA 1MU2A 1J27A 4IRCA 4O4RA 3JTNA 5IT0A 2DH8A 5MLCV 2J9DA 1S9FA 2OFGX 2DGVA 2FC8A 5JVHQ 2NXUA 2DJWA 2QA1A 1NJIT 4K4SA 2NREA 3OR1B 2IYIA 3EVOA 3AB2B 2XMTA 3KLGB 2ATLA 2QG9B 1TMMA 4OV6A 3T6BA 3MI7X 1S1XA 4HHJA 4JI8F 3PHTA 2R9LA 2AD9A 2MMYA 4ZVOB 3G6YA 2AU0A 1T7PA 4JP8A 2E9RX 1UZDA 3T1YJ 3KK1A 4RNMA 4NCAA 1TL5A 1S1VB 2UUBF 1APSA 2W2NP 1MN9A 3L7UA 2VFRA 3RR7A 1RT5A 1NLKL 1RHRB 2IVFB 5B0DA 4AD6A 2UVWA 1ZOTA 1R8PA 4P73A 4EK2A 1FDAA 4F0KA 4CH1A 3K8WA 5G0RB 2BXJA 1UWBA 1H0HB 4DR4J 2K7KA 1WELA 2PFFB 2MGZB 4NI2B 5D4OA 1V9OA 2QSFA 2WAQD 3ENWA 3LPEA 1KVKA 3G9CA 1X4HA 2E1PA 3Q89A 4W98A 1XERA 4CDIA 1K44A 3GG1A 2XHWA 4PKDB 2OPPB 1S1TB 2R42A 2G0CA 1KHWA 3VQSA 2XS5A 3BQ2A 3IAS9 1RDRA 1PG5B 4KGKA 1CSJA 5HI7A 5I3UB 4Y2AA 1JLBA 1KBRA 3M2RA 3A8IA 4YN3B 1RHMB 2ABYA 4E98A 1AFIA 2X7IA 1F2HA 5KT4A 5L1LA 4KGVB 1W2BR 4OHYA 2J6UA 1TP7A 2AZ1A 3KFWX 1KQSR 2YWKA 2LEBA 4GO7X 3GPAA 1S6QA 2R2RA 3HHKA 3OJSA 4C3LA 4ZCMA 3EXYA 3N5BA 2OTJS 4FYWB 2LA6A 2E5LJ 4KH1B 2B6AB 2UXDF 2XCAA 2Q43A 3M6XA 3G71S 2LQJA 3CIZA 2G1DA 1OYDA 1LFPA 3O8WA 4GVLA 5BR8J 4QYZJ 1XNQJ 3BZQA 4ZA1A 2DGUA 1NDKA 2N3OA 3I31A 1S4EA 2XM3A 4YR0A 3CB4A 2F8EX 3OVAA 1SBRA 3SI8A 3UWTA 2ROGA 4Q7AA 4DFMA 2CADA 2CQ4A 2B0GA 3MCSA 5L1KA 1T9XA 4DSEA 2RU9A 4OX9J 5KT3A 3DXSX 1VQSA 2OFHX 1RABB 2PO4A 1M90T 2OIHA 2XS2A 4JV1A 4J9SA 1NMEB 2VUGA 3RRGA 1HWUA 5LMUJ 2F9JA 3FEZA 3LWMA 1Q86T 1ZTWA 4UOFA 5D77A 2QLBB 4CO4A 1R7IA 4LF5J 5ETVA 3OLBA 2GMHA 2OSRA 4LF8F 3M8PB 3QAUA 3VAKA 2V8PA 1I94F 4F4WA 3FRYA 1FD8A 1KC8T 3MMBB 1RWOB 4RW6A 1KLMA 4MFBA 2J7KA 5KFBA 1WUUA 1TKZA 2OD4A 3CJ3A 2HGMA 4YMEA 4MIAA 3BH7B 1BQXA 2HFVA 4MYUA 2YKMA 4YHHJ 2H9ZA 2XTJP 2W9BA 2BW7A 3PFEA 4OHVA 1SV5B 3OSNA 4CRJA 3HZEA 2ZM6J 3HMJG 1RTHA 1ZAWA 2NXNA 4LF6F 4XIUA 2XNRA 2XZDB 4RNNA 4IRDA 2DNNA 5K8PA 1RBOB 3UR0A 4DL4A 2MEWA 2MKSA 3OT9A 3E01A 1SC1B 3DLJA 4C3KA 2I5JA 3OPKA 1VISA 2DD8S 2DGOA 3LQVA 1RT1B 2U1AA 1C2PA 3EYZA 4QPTA 3ZFVA 4FZVA 4FN5A 3JTPA 3X1LB 2RDDA 1WEXA 4RUAA 5GAHU 2Z58B 3BV8A 2J5AA 4WJBA 4C3MA 4DV3J 4NMXA 1AW0A 3CPWR 3C14B 3W66A 1XMOF 2VG6B 1Y7PA 5HP1A 1M5KC 3CO9A 4OI2A 1C0UA 3PYGA 4DX8H 1RTIB 3LP0B 3QRQA 2FJEB 3LA0A 3R97A 5DDOC 1H2VZ 2CPYA 4ZPCA 1OY6A 4O3QA 5LMNJ 4B3OA 1EP4A 1MWZA 4P7TA 3RB3A 2OP5A 4HDGA 2GJ2A 1YJRA 1REGX 2N82B 4C0OC 2LFVA 4M5HA 4KSEB 4RU9A 5KG2A 3MM5A 1M5PC 3HHNB 2A10A 1VC5A 3LP2B 5D8HB 1WF2A 4XPCA 4DL6A 2RQKA 4V19J 5HMZA 3H42A 1X9WA 1VRUB 3NS6A 4MH8A 4Z7CA 4CLTA 5LSOA 2CQ2A 4J9RA 4CNZA 1VJQA 2M4MA 5CYMB 3CJTA 4DU8A 1G4CA 1DTTB 2F4FA 1BGXT 1TUWA 1FF2A 3M30A 1R31A 4FKXA 4JB8B 5J2NB 1TAUA 2J6SA 2XMUA 5M2UA 2KG0A 5JJBA 3D1OA 1T9TA 1HNIB 4M94A 2CWKA 5GMEA 3PJWA 3RW6A 2NZCA 3GFZA 3J81j 3FBBA 4F36A 3SYZA 1DLOA 2H1YA 4E2FB 3EPIA 1Q82T 4IH6A 2OH2A 1NUEA 3GIMA 4O3PA 2V4JA 3J7Z5 2OPRA 3DRPA 5IV3A 1UVJA 2AWZA 3NWRA 1RHJB 5HMXA 1DTQA 4IRKA 3KHLA 3N01A 1LNQA 4O4GB 3AJDA 3KLIA 2RVJA 3IO1A 1BQNB 1O51A 4JI7F 2CNNB 4PABA 2UXCF 2F8HA 1FD2A 4DV0F 1RZMA 3H59A 2DRDA 4U7CA 1S77D 3Q22A 4ZDNA 4OFZA 1HNXJ 2IAJA 4J9NA 3PEJA 4H4MA 1FVQA 1RYRA 1R3NA 2MSTA 2F3JA 3CJQA 3BO3A 3DGPB 3LAMA 4I2QA 3V4IB 4DR6J 3PW5A 3BM7A 2IM2A 1AUDA 3M6VA 3LP1A 4KKOB 2KVIA 3OV7A 2JC1A 4ID5B 4WFNQ 5A8KB 2BKPA 1NPKA 2DEJA 4Y2KA 5T7LA 1MROA 4JUZA 3QT6A 3KK2B 2FZCB 3HCXA 2YXLA 3T5KA 4Y28C 3G2XA 1T05A 3KJVB 1FK9B 2KFZA 2HSEB 2L9DA 1Q8BA 3CEDA 1KEKA 3VGUA 1MN7A 2B5JB 1H74A 4URGA 2WSFC 1UVKA 1R0BG 1RUSA 1UL3A 1OIAA 4QIWD 4QJVA 5FIIA 5IS2A 1LXNA 3WHIA 2Z2MA 2OSQA 4KE5A 2EG1A 5D6GA 4ECZA 3I0RB 4DR5J 5B0CA 4RJVA 5KFWA 1WKJA 2FJDB 2MQOA 1GNKA 1M5HA 3BGOP 2ZHAA 5I3QA 5A6PA 1FRJA 3CT9A 4OYWA 1VBXA 4ZITA 3H5YA 5LT5A 1HQUB 4Q45A 2Y8WA 3DCAA 1X9SA 3D0IE 5KFDA 1CS4B 1G7CB 3JYTA 1U25A 1CEZA 3M4XA 2XMKA 1QY7A 1GMVA 4GC6A 2BX6A 4KGMA 4PWWA 5KFLA 3SDEB 4YB1P 3BKUA 3FCVA 3BO4A 2ZBCA 3AA9A 4ICLB 3W2WA 1VQYA 3IG1B 2AJQA 3GJRB 5DGBA 4GO5X 2AJ0A 1TKDA 3W8PA 1L3UA 5D0GA 4OZ5A 3BEGB 3R2DJ 3RJMB 3EMTA 2HK3A 4OYXA 1JLGA 1F5AA 4DQIA 4RW7B 3UNGC 1B70B 2IVMA 1X9MA 4DV6J 1YGYA 2ZOFA 3OXFA 2L48A 2UV8G 1TR0A 3OUYA 1OSCA 1HARA 3I6PA 4A8WA 1EHWA 1K0VA 2XWYA 4QR2A 5HK4A 4WBFA 4AYBD 5LXYA 2W7OA 4NLYA 3VVTA 3D68A 3OTBA 3CD0A 1EETB 3QO9B 4C8YA 2Q79A 3ZZOA 5KAKA 4IG3A 1LWEB 2CYYA 1K47A 3A12A 2CPEA 3HPOA 1C1BB 3UD5A 1YWXA 1U0HB 1DFDA 1R0AA 5HN0A 2KTQA 4HTJA 3IGVA 1FWPA 1D8ZA 1MG7A 5L9XA 1DQAA 5LL6d 1Y4ZB 2M8DB 1S5ZA 2F63A 5A8WA 1X4FA 2YKPA 4JI2J 3HVRA 5ETSA 4YUDA 1JNRB 3KLHA 1RAEB 4ZVGA 3TX0A 3QZ7A 3AJ1A 1CJKA 2HZAA 2OPSA 4LR8A 2VFVA 3IN5A 3S7RA 4UTGA 1NH7A 1TU0B 1WF1A 2C2DA 3MM7B 2HQFA 2D74B 3RYLA 3QLHA 3C6TB 2XQCA 2HQ3A 3Q8RB 4ETXA 5KFZA 2WVBA 4NLXA 2C2OB 4H54A 4BHQA 2B4PA 5DQIA 2P5VA 4C8KA 3DMJB 1L5UA 2POKA 3ITHA 3TX8A 3CCRS 4PXEA 2YX1A 4ECVA 4NLDA 1U1MA 2QYGA 3CO0P 3VAIA 3MWBA 4D3HA 4CLSA 4DV2J 4FDFA 2RUSA 3RAMA 1PJ7A 5KFSA 2DT9A 2CG4A 4Q44A 3MHYA 2K3KA 4OYOA 3Q8QB 4RPFA 3CCLS 5H9FJ 1LW2A 1R6VA 1TVRA 3QYYA 4JI3J 4DV5F 4O3NA 2Y1JA 3MM6A 3T1YF 3R9LA 2CZ9A 2HRYA 4RBUA 2V69A 1VQ9S 1HWIA 2HWHA 2V50A 3ZZTA 2HHQA 1M1GA 4RUBA 4LBIA 2CJ9A 3IAM9 4ED3A 2FUG9 3BB5A 1KP6A 3MPVA 2R2UA 3G96A 3PY8A 2VDIA 1PYSB 3B78A 1WC1A 3PR5B 1U4BA 2R7VA 3CJ0A 5K5MA 2PN6A 1ZA2B
chains in the Genus database with same CATH topology
4FYDA 2ROEA 4YOEA 1L3VA 1V3RA 1OSDA 1YQHA 3ZC4A 2BQUA 1R0AB 5DDPC 2UVVA 1FJGF 3FZ2A 5L38A 5KFGA 2C3MA 2GHVC 1FERA 2Z0GA 1S1WA 4QR0A 4IKAA 1NK6A 3RR8A 1A7GE 2BUNA 3TAMA 3VQTA 1FE0A 2VC0A 4WFYA 2DPJA 3I5AA 2MKKA 2DNOA 2XLIA 4CO2A 1HD0A 5A8WB 1QVFR 4N8NA 1MMNA 2SXLA 1KR4A 4DL2A 2E44A 1D3WA 3I0RA 3K5LA 4OLOA 4MK9A 1S0MA 2DHSA 1I1GA 1P8GA 2RDJA 3K0JA 3KNGA 2QA2A 2RJZA 5EUHA 2B7BB 2D1CA 4ZS6A 1TKTB 2K2PA 3FNNA 2YNIA 1IKXA 2ZKTA 1N48A 1RI7A 1YJVA 4WU3A 4ZCLA 2R7OA 2R8HA 3KG1A 3O6QA 1FKPB 2KT2A 3JSBA 3GV7B 3CXCR 4ECYA 2XMVA 4A8MP 2MHEA 1HI1A 2OD6A 1RA7A 2NS1B 4QIEA 1C1CB 2GNKA 1VJWA 5AE2A 1W25A 3QGIA 4TXSA 3MR2A 3CCSS 2O01C 1M5OC 1TFYA 4N41A 4K0KF 4QIGA 2PI4A 1S10A 5DG9A 1IQTA 5BYQA 3GILA 2KU7A 2WONB 2OLWA 1HBMB 4I6AA 4URQU 2GQ2A 4X4SA 4DHVA 4TQSA 3P49B 2ADBA 3QZ8A 2JLFA 4YB7A 3M8SA 2N4DA 4P2SA 1TKXA 1VGYA 4BC7A 3KYLA 2QFJA 5IM0B 1P1TA 2V8VA 3PV8A 2PI5A 1BWEA 1VQ5S 4B9UA 2YVSA 1S1UA 2IRXA 3CGIA 3FVYA 4FPRA 1IXKA 4F2SA 2I8EA 2WSCC 4I68A 4UOCA 4O44A 5KOWA 1U09A 3I0SA 1UEVA 1U2FA 3POTA 2RB7A 5KFTA 1G3OA 3SDEA 4QW9A 2KFYA 2O5DA 3I5BA 4OQJA 2UVRA 4TU9A 3H2LA 4LVOP 4M1KA 1JLEA 4DR5F 4OZLA 1Z4UA 3KLEB 3PX4A 4F4ZA 2WHOA 3N6NA 2FGOA 4PPDA 1MMDA 4EFAC 1X4GA 5FD1A 3UFCX 4YY3F 3QWPA 1S0OA 4Y3CA 3ITHB 2CPDA 2LKZA 3UPFA 3S6EA 2P9EA 5AE3A 4OI1A 2IC3B 4A8SA 5SZTA 2DIVA 2M9KA 4AQYF 2J6TA 4ED8A 2N7YA 3PIOQ 4JI4F 3DXBA 2BJEA 4TN2A 3ONQA 2Q66A 2MQPA 5F8GA 3UCZP 4OZNA 5L9NA 5AXLA 1UKUA 2E29A 2LECA 2NZ4A 2KO1A 2VASA 4NA2A 1ZPVA 1SKWA 2QMWA 3MR5A 1F60B 4X66F 1Q79A 4WTYA 2ZE2B 1SJRA 3ISNC 2VC1A 3DOLB 3I5CA 2FHOB 1Q8LA 4FNIA 2IBKA 5EWFA 2RRNA 4NLQA 3HHDA 1RT4B 2E5LF 1UVLA 2ZJPQ 1QM9A 1SUQB 3CJKB 3QJLA 1DQ9A 2HNZB 4MYTA 3N9UC 1DJ0A 4GC7A 4DQSA 2EG2A 3BR8A 3OQ2A 4X64F 1JX4A 3CDWA 2LXIA 4NLPA 5KG5A 3VAJA 2DGWA 3FSIA 2LQBA 4AXJA 3SV3A 4CCHA 5HBMB 2B9YA 3E51A 5J1EA 1YJWS 4EGLA 5IXUA 4IOBA 4K4ZA 3J7A1 1KSPA 5EN1A 5EHHA 1B64A 1Y3KA 1T02A 1E6VB 1XBWA 1XN9A 3M8QA 1F9FA 2KRRA 3EPGA 3M2UB 1RGVA 5CD4H 1IKYA 1KTVA 3MM6B 4RLEA 1T95A 4J9QA 2BVZA 1Y5NB 3RW7A 4QWAA 3TR5A 1FJEB 4OZJA 1YITS 4CT9A 3V6JA 3HVWA 1X4CA 3HKZD 4E0DA 4KV8B 2RS8A 3TUZC 2YNHB 5F8IA 3O3LA 2CQCA 3HM9A 5GAGU 3K57A 3UR3C 4Z37A 1U1RA 2ZVSA 1WG5A 1KTQA 3D28A 3X3UA 2V2KA 4HTIA 4RW4A 3B8HA 2MKCA 4HVZA 3V81B 1IM4A 4OX9F 2CJBA 2HHVA 3CCVS 3OVBA 3EUNA 1C1BA 2ZH3A 2PSZA 4B02A 4DV6F 1WEZA 3IR6B 4EZ9A 1WI6A 3CCMS 1FTCA 1N0VC 2C3PA 5KFEA 3NAIA 3S1TA 4EO6A 3KG4A 4LIRA 2ZD1A 1HI8A 2I9SA 3GIIA 2MY7A 4LSLA 4LSNA 2YWEA 3OXGA 1P6TA 4X4OA 2VL1A 5JXSA 2AGQA 2RQ4A 4WK1A 1VBYA 4Q8EA 1S49A 1X0PA 5D4LA 2K1RA 1XC9A 1YRXA 2HGLA 1N34F 2KYXA 2M0GB 2HPUA 5DDQC 3MOJB 1TZ0A 3TAMB 1DBDA 2RRAA 3AAWB 2JLEA 3MEEB 3MEGA 2X1FA 5J1NA 3WZ0A 4LF5F 4CTAA 1HMVA 4WK3A 3TUJC 2FVQA 4XAKA 2Z4PA 3CDUA 2MZ1A 2ZHOA 2LEPA 2ZHBA 3H25A 3FEYB 1WI8A 2D7SA 3CWJA 2GX8A 1WHXA 5KFCA 2D41A 2E7XA 4UY8T 1XMBA 5HLFA 1IKXB 2XBPA 2D3ZA 2A2DA 5CZXA 1S6OA 4YR3A 2LVWA 1Q4RA 4X4RA 1N5SA 4O3RA 4OL8A 4TU7A 3K5PA 3MMAA 1TL1B 2MPUA 4LIWA 2CQBA 4DJBA 1M0SA 4OJ1A 2ZH9A 2KJWA 4Q8FA 3WC2A 1X5SA 2EBEA 2RF2A 4FP9A 2ZC4A 3RRHA 2RDIA 1RP5A 1WG4A 2HIQA 3FEXB 5KTQA 1SL0A 4PRFA 2B4VA 1S79A 1H3DA 5KFMA 5DRKA 2RKIA 1J5OB 2XSFA 3MECA 1FCAA 3JSMB 1L3KA 1ULRA 4NPOA 2JX2A 4DF4A 1YRUA 1HNWF 1P9QC 4DQPA 1TKXB 4ZPAA 2B4OA 4ZP6A 3HXMA 2QEXS 1RT2A 5KFNA 1S1UB 5AE1A 4HKQA 4P7VA 3P96A 3BO2A 3QWUA 1JWWA 3I0SB 4L72B 4EBCA 3R1LA 1YJ9S 1Z2ZA 1B7FA 3DLGA 5K9FA 3LANA 4NLUA 1RTDA 1Q8IA 5DQHA 2D3UA 4KTQA 2IVYA 3LPYA 1JLEB 2ZNZA 4PWUA 3QMQA 3PO4A 3BQ1A 4MTPA 4RX6A 2BA9A 1NK8A 5I4MA 5D3GA 4OJHA 4C8MA 2DR8A 1F0XA 3OR2A 2OPQA 7FDRA 2ILYA 4X4VA 2BQRA 3MMCA 3L09A 4RW9A 5JVGQ 3UE2A 4F8RA 1YSJA 4IYQA 1KQGB 3SMZA 4DL7A 3CJ5A 1YJTA 3IS9B 4NCGA 4OHWA 4C11A 5AJ3F 2BM0A 3Q8PB 2P6TA 4N77A 2ASJA 5B0GA 1KFSA 4JYAF 3NNHA 3U1MA 1QAIA 2JEFA 2ZH5A 3DLEA 1HR0F 5DLGA 2IM3A 2YNGA 2CPIA 4JV5F 2FJAB 3PDNA 4MAKA 2KKHA 4R0EA 4FXDA 1DZ5A 2JEJA 5C42A 3DI6A 3PJXA 4QWEA 4ETZA 4NZ7A 4Y2MA 2MKIA 1FEEA 3TA0A 2J76E 2KFNA 4Y00A 4KFBB 4NZ0A 3S8SA 2ZOGA 1TV6A 3MEDA 5FDLB 4OHZA 5BJRA 2CQIA 5F0WA 5M2PA 2ZH8A 4NYZA 4ELTA 2DVIA 1SL1A 3CJ2A 1NRKA 1REVA 4O3SA 4KT0C 2YWHA 1N56A 1R8CA 3T5JA 3MM8B 4DQQA 5EGYA 4JOUA 2RSQA 4IG0B 1BD6A 3I32A 3HO1A 2RRBA 4X4PA 2YY3A 3HFKA 5J1EB 2XO7A 4AUKA 3LO3A 5LJ5Y 3IA0A 4LUBA 5KG1A 2W8KA 2P9GA 3NBPB 3M8QB 4DV3F 5E41A 2NUUG 1FJCA 4ZP8A 3CDEA 3KWMA 1YTYA 4EYHB 1UW4A 2Y1RI 2JZ5A 4UQTA 1IKYB 2DGQA 4HI2A 2BRKA 1A6LA 3CC4S 4ED5A 3TQ1A 3JTOA 4HDHA 4LJMA 4B9VA 1WACA 2UUAF 2DNHA 4DEZA 3FRZA 4WKYA 2EFGA 2B4UA 2OAUA 2PE8A 3M32A 4IDKA 5A8RA 2ZC3A 2PMZD 2B7CB 3ISND 2DH7A 5KFPA 2XCPA 1TK5A 1T03A 1URRA 2JH3A 1MMLA 2GQQA 2IJFA 4ILRA 4MK7A 4BWJA 1FRHA 3DRSB 1NO8A 2MDAA 4ID8A 4LVNP