1N54B

Cap binding complex m7gpppg free
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
121
structure length
121
Chain Sequence
LKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGFKEGRQYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of m7GpppG binding to the nuclear cap-binding protein complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords 80 kDa nuclear cap binding protein
total genus 26
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2002-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n54B00
2KVIA 1M5OC 2DNKA 1Q81T 2KG0A 1WI8A 2KM8C 1X5PA 1HA1A 2AYMA 4C0OC 3BEGB 1WI6A 2RT3A 1JJHA 2M88A 1QVFR 2FHOB 3BO4A 3EGNA 2LMIA 5DDPC 5GAEU 2ERRA 1ZZFA 1WF2A 1ZH5A 4CQ1A 1VQ8S 3J7ZT 4QU7A 2HVZA 1VC6A 5EN1A 2YH0A 2KXNB 2AYBA 1H2TZ 1AUDA 1XN9A 2LKZA 3SMZA 1D8ZA 2MQQA 3MXHP 3BS9A 3S7RA 1M5PC 2XB2D 2JVRA 1QM9A 1WEXA 1WWHA 2DNGA 2ZJPQ 2MJUA 5IQQA 2XS5A 2OIHA 3CCLS 2N3LA 2YKAA 1X4HA 5IFMA 2U2FA 1FT8A 3B4MA 1K8AT 2D3OR 2MKJA 3UE2A 1UP1A 2OTLS 3DLLQ 3MOJB 2KT5A 1OIAA 2MKHA 3MDFA 1VQ5S 2RRAA 2DNQA 2VOPA 4PRFA 1X4EA 2M8HA 4QPTA 1WF1A 2LCWA 2DIVA 1F9FA 2MKCA 4IOAQ 1M1KT 3RW7A 3VAGA 1DBDA 1U1QA 4OZ1A 2JVOA 5GVQA 1OPIA 2AD9A 2WBRA 5LXRA 2GO9A 4LIRA 3BO3A 2MHNA 2DGWA 2EK6A 2A3JA 2L9WA 3CMAS 2DGOA 3CF5Q 4IOCQ 2DH8A 2KYXA 1WHXA 1FXLA 3R1HA 2KFYA 2K8GA 2M9KA 3P6YC 2CPHA 3EX7B 3NMRA 2M8DB 3K0JA 2KU7A 2DHAA 2MY7A 2I2YA 2QFJA 2MQMA 5LSLA 1U1NA 2VOOA 1SJFA 5LJ3Y 3FEXB 2MYFA 2DGUA 5JVHQ 2FC8A 2X1GA 2F9DA 2G0CA 3MURP 3CUNA 1CVJA 2DNMA 1OWXA 1R8PA 3IWNC 2KXFA 1Q7YT 2CPXA 3VAFA 1HD0A 1D9AA 2UP1A 4WCEQ 2E5GA 2LEAA 2CQ1A 1A9NB 3PIOQ 2E5JA 2MZTA 2XS2A 2CQ4A 3VAJA 4M5DB 2JRSA 3CC7S 2AYEA 3NNAA 5DDRC 2CPDA 3UD4P 4WF9Q 3G71S 1UW4A 1H2UX 2KXHA 1KOOA 2MZRA 5LSOA 4LJMA 5CA5A 5IM0A 2CQ2A 3FEYB 3MD1A 4YOEA 2MZ1A 1K9MT 2MSTA 1X4AA 1BY9A 2DISA 2PEHA 1G2EA 1VQ4S 2LXUA 2B0GA 3H2VE 5MLCV 4W90B 1JJ2R 2YH1A 2FC9A 2DO0A 4WFBQ 3S01A 3NNHA 4Y00A 2LA4A 4C7QA 2CQGA 2KM8B 2O3DA 4WFNQ 1KQSR 1N88A 4C4WA 2D9PA 3OW2R 2LEBA 1YJ9S 2MGZB 5DDOC 1R8HA 2E44A 1Q82T 5GAGU 2XNRA 3D2WA 4QQBA 3CC4S 3TO8A 4UY8T 4QU6A 1K73T 2DGVA 2DNLA 5LJ5Y 1U1LA 3SDEA 3N9UC 4UQTA 1VC0A 3VF0B 2X1BA 4P6QA 4TU9A 1RKJA 3VAHA 4RU2A 2YWKA 2CPYA 2DGSA 2MQOA 2N7CA 5H1SV 1WTBA 3CXCR 2CPFA 3Q2SC 2M7SA 3JB9k 2BOPA 3NS6A 1HD1A 3R1LA 1WG5A 4CIOA 2FY1A 2Q79A 3DXBA 4F02A 1VQ6S 1VBZA 2F3JA 1U1RA 1KOHA 2XSFA 1Q86T 1QVGR 1IQTA 3CCUS 1X5OA 3SDEB 2OSRA 4CH1A 2CQBA 1X5SA 1FNXH 1YHQS 3THPA 3HHNB 2NZ4A 4WKRA 3MI7X 2MY8A 4PKDB 3MD3A 2OSQA 4YUDA 5DM6Q 1S79A 1ZZNA 3LPYA 4U67Q 1NO8A 2VONA 1P1TA 2I38A 4ZKAA 5IM0B 4Y0FA 4TU7A 4Z2XA 2JX2A 3G9CA 5CYJA 1DHMA 3U1MA 2CQ3A 5HO4A 5HL7Q 3I55S 2X1FA 1X4FA 1VQNS 1WEZA 5GMKa 1RK8A 2RQ4A 3SXLA 3G4SS 4WFAQ 4PR6A 2EK1A 5DM7Q 1U1KA 2GHPA 1VQ9S 4A8XA 3PIPQ 2RS2A 2N3OA 2ADCA 2CJKA 2VODA 1FHTA 3CTRA 2YTCA 3UD3P 2HZCA 3IRWP 2CQ0A 1URNA 2MPUA 2CPIA 1SJQA 2CPZA 2MZSA 2DGXA 2CQPA 1X4DA 3P49B 1VQPS 2DITA 4FXWA 3I56S 1DZ5A 3HI9A 3THTA 4ED5A 2ZJRQ 2BZ2A 3UCUP 2KHCA 2CQCA 2QEXS 2MJNA 3VAMA 3UWTA 1U1PA 3Q2TC 1VQKS 2XNQA 4F25A 3U1LA 1U6BA 3EGZA 1N52B 3TP2A 2MQNA 3G96A 1X4CA 5JVGQ 1YI2S 2RNEA 1W2BR 2SXLA 2MMYA 1U1OA 2N82B 1NJIT 3G8SA 2MKIA 1WG1A 3S8SA 2AYGA 2J0SD 1S72S 2DHSA 2DGTA 2M52A 2DGQA 2J76E 1VQMS 3NNCA 3LQVA 4F26A 1SJRA 2KI2A 2M0GB 3H2UB 2F9JA 1UAWA 2DNZA 2M2BA 3G6ES 3UCGA 4YB1P 2RQCA 1SJ4P 2DHXA 4FXVA 5GADU 4OZ0A 5GAHU 4EGLA 2HYIB 1YIJS 2M4MA 2J8AA 3US5A 2LECA 1M90T 2MQLA 5LXYA 1NU4A 3VAKA 2JWNA 2G4BA 2X1AA 1YWXA 2E5HA 2D9OA 2DNYA 1YJNS 1VQ7S 2MZQA 2CQHA 1KC8T 1M5KC 1U2FA 1WHVA 2RU3A 2NLWA 4J5OA 1L3KA 2M70A 3MUVP 2DB1A 1P27B 2DO4A 2KH9A 2RS8A 1M5VC 2HGLA 1WEYA 2HGNA 2KN4A 2MGZA 1H6KX 2MKSA 2KRRA 2ZJQQ 3CCJS 2MSSA 2KRBA 2OTJS 1WHWA 2MZJA 4TLQA 4ERDA 3ZZYA 2U1AA 2K3KA 2MB0B 3CCRS 5ITHA 1HL6A 1YITS 2J0QD 2DNPA 1A7GE 5DDQC 1U6FA 2PE8A 3CCQS 3L3CA 2RUGA 1FJCA 1WF0A 2DHGA 1N8RT 3VALA 3CCVS 1JJ4A 2CQDA 1DRZA 2MKKA 3CC2S 3R27A 3J7YU 2DIUA 3MUMP 3CCES 2DNHA 3B4DA 3MUTP 2DNRA 1X0FA 3CPWR 2CPEA 2FPHX 1PO6A 1FJEB 1FJ7A 2OJ3A 4CH0S 1VQLS 2DK2A 2L41A 4TU8A 2V94A 3TYTA 3P3DA 4LMZA 1VQOS 5CXTA 3NS5A 2HGMA 3ZZZA 2DNOA 1SJ3P 3CULA 2QA4S 2L08A 3S6EA 3RW6A 2G1DA 2EVZA 5DETA 2KG1A 1YTYA 2DH9A 2LQ5A 1JMTA 3CCMS 2DNNA 1H2VZ 1X5TA 5BJRA 2XS7A 5D77A 5FJ4A 3V4MA 4IO9Q 1KD1T 4WIIA 4IUFA 4BS2A 1VBXA 4V19X 1B7FA 4W92B 2CPJA 1VC5A 2LYVA 3UCZP 2LA6A 1WHYA 1N54B 1VBYA 1FO1A 1WELA 2MXYA 1O0PA 2E5IA 2ADBA 3VAIA 3CMES 1PGZA 3ULHA 2RRBA 1U1MA 1X4GA 1SXLA 2RVJA 1WG4A 3G8TA 1UFWA 2CQIA 2LXIA 5D78A 3BO2A 1X4BA 3CCSS 3CD6S 1YJWS 2MQPA 1OO0B 3P5TL 2DH7A
chains in the Genus database with same CATH superfamily
5C25B 1NEEA 1RYSA 1FF2A 2ZUGA 3FQKA 3QATA 1M5OC 1GK8A 4PWDB 1B70B 4YY3F 1FEHA 2DNKA 2DXEA 4IFYB 4FF4A 2I0XA 1T94A 2BA9A 5JMNA 1RT2B 4OYIA 4OQJA 1ZM2A 3PRDA 2IVYA 4XPCA 3GG1A 3MAAA 1N0VC 1FE0A 2DRDA 4G1IA 1HA1A 2AYMA 4RWWA 1TKXA 5J2MB 1JJHA 3HHLC 4DG1B 1JLGB 2FJBB 1Y0HA 3BN4A 2RQKA 3D68A 4NMXA 4ZK7M 4YR3A 3ILLA 2W9BA 2AZ3A 1RAAB 1JNZB 4WFXA 2AJ1A 3CO0P 3BO4A 4DR2J 1E6VA 5GAEU 1ZZFA 3QJJA 4OHXA 1TUGB 4YHHF 4A8YA 1E6YA 2HVZA 1VC6A 3NMAA 3ITHA 3U7JA 2YH0A 5EN1A 4W98A 4X4OA 2KXNB 2VFSA 3BGLA 1I51B 1WORA 2NYHA 3HSDA 1NDKA 2O1PA 1KQGB 1Z2ZA 3DOKA 5KFRA 3NAIA 4EFAC 3R5JB 5C2CA 4HEA9 2MQQA 3X1LB 3IR7B 1S9GB 1Q53A 3S7RA 5HN0A 4MIAA 2EPIA 1IUJA 1RDRA 1WEXA 1MSWD 2C2OB 1MN9A 3G82B 1RT3B 1UW9A 4LF7F 1N4LA 4DF8A 4DCPB 2OIHA 1IR0A 1C1CA 1TKZA 2YKAA 4ITSA 2XLJA 3S1TA 1WKLA 4AQYJ 1PJ7A 2HHSA 4U96A 3TX0A 3G87A 4ZP6A 2ZD1A 2C2KB 3PW5A 2I1RA 3OL9A 5HATA 4QYRA 3D6MB 5JXSA 1UP1A 1JLGA 1SCJB 2HNDB 1VIOA 4LSZB 3BH7B 2VQEF 7AT1B 2OTLS 3DLLQ 4PQUA 1ZPWX 4HACB 4JI5J 4MKBA 3PKYA 2FVCA 1O6XA 3KTQA 3CJKB 4TYAA 1NKBA 4DR7J 5A2QU 4MTPA 4PRFA 3RRGA 4HR2A 1X4EA 4QPTA 4CNYA 2J0XA 3FZBA 3GTYX 4YB6A 2ZM6F 3RBXA 2LCWA 4F50A 2IAJA 4UT4A 4RNHA 3DRRB 4LVNP 4KAIA 3R97A 1QSSA 3Q8SB 4IOAQ 3PYDA 3VAGA 2BRLA 5AXMA 2FJXA 2XZTB 2HHHF 1S48A 4NZ7A 1MW7A 3HKWA 1SL0A 4TY9A 3BQ1A 1DBDA 3GMGA 3BBBA 4OZ1A 4J9UE 2JVOA 2WRMA 4A8OA 1HI1A 2AD9A 4MYTA 1HWUA 3GE9A 1H98A 3MEDB 4MAKA 2MHNA 3MM6A 4B9LA 5H9FK 2F1FA 1H72C 3T19A 2PC6A 3DOKB 2V8HA 2A3JA 1HNZJ 2L9WA 4X84A 3Q8PB 2DH8A 3M2VA 3FKBA 1LXNA 3J81U 1JLCA 2GAGC 2CJBA 4NYPA 3UNYA 3KMSA 3PV8A 3DKDA 2YNGA 3P6YC 1R8BA 2VC0A 2CPHA 3UVJA 4J9RA 2WOMA 3R6GB 3MEEB 2NXJA 3KK2B 3MMJA 2KU7A 2DHAA 2RSQA 4QIFA 2ZVIA 5CQGA 3X3UA 3BREA 3E01B 3QGHA 2MQMA 3QT7A 2ZBRA 3OVSA 4J9SA 4R0EA 2VOOA 4P2SA 4DV1F 2VG5B 2W4DA 3T9ZA 1TKXB 3H59A 2E1RA 1Q4RA 4XK8C 4UQGA 2MYFA 4F4ZA 1UJ6A 2HKEA 4DV0J 5IQ6A 2ZUAA 2V4RA 4URSA 2OTJS 2W01A 1CVJA 4N8OA 2GVZB 3AA8A 1OWXA 3BH6B 4L76A 2G0IA 4DFKA 3TANA 2KXFA 4D3HA 1U4BA 4L3KA 4DR4J 3DI6B 4B3OB 3GZ7A 4MKAA 4H4OA 1X9MA 1HD0A 3HHKA 3QZ7A 2CRLA 2LEAA 2B56A 4OYMA 4IR9A 5HMYA 5GADI 2YWWA 2XHWA 3AQPA 4ETXA 2HHHJ 4KBIA 1LWFA 2BXJA 4A48A 4M5DB 2JRSA 1SVDA 3Q8YA 2XCAA 1H7WA 2AYEA 2GFFA 3M6VA 3OXFA 3M9NB 5CD4A 4HKQA 2F7VA 5DDRC 3AJDA 3UD4P 3AB2B 4TN2A 2RMLA 2LQ9A 2NPFA 1YJVA 4K59A 4RKUC 2BMBA 2EI5A 1H2UX 2MLXA 5J1NA 5I3UA 1EZZB 3VCDA 1WC6A 4QPXA 1Q5VA 3DNCA 3OR1A 2AT1B 1FX4A 1M1HA 4JI5F 2RF2B 3M6XA 1YVFA 4N77A 1RI7A 1IXKA 1NKCA 2HNDA 1KLMA 2CVEA 2EG2A 2CQ2A 2WHOA 5L8RC 5KFFA 3FEYB 4H4MB 3SBMA 4AFFA 2WOMB 4FPRA 3OT9A 1GX6A 4ZP9A 3F0NA 5A8WB 2DISA 1BQMB 4J9NA 1RWXB 1VOMA 2MEWA 4HVZA 2LXUA 4LSNB 1R31A 5MLCV 4U6PA 3J7AN 1ZAWA 3KHRA 4DV3F 1JJ2R 2RU9A 1RHUB 4CZCA 1RT5A 3A3OB 3R5BA 3HMJG 4H4KC 3MFHA 2VICA 4GKKF 2FVSA 1G1XA 2XMMA 3RBZA 2G0JA 4DR5F 3KMQA 4ANEA 4RX6A 4DV5J 2JEGA 2W2NP 2HRUA 3EZOA 1VJWA 2OI2A 3ETOA 4F67A 4WFNQ 1Z1ZA 3OV7A 3NRBA 2D9PA 1X7VA 4U95A 3QO9A 3IA0A 2FIUA 3TUIC 1Q1KA 3TRGA 2ZH2A 4AL6A 3PX0A 4UOFA 3UR3C 5EUHA 5DDOC 2A2DA 2HWHA 1FA0A 1GFWB 2H3EB 3FBFA 4JI8F 4YHHJ 4OX9J 5L38A 2E44A 4P74A 5GAGU 4L3NA 3EDRB 4I2QB 1SIZA 1PCAA 4EMDA 2R7TA 2AQ4A 4DR2F 4DU8A 1XQIA 5E3CA 1UKUA 2R3VA 2ZBIA 1KR4A 2WVDA 1PC4A 3QBCA 3HD1A 4I4BA 9RUBA 2C42A 5ETKA 3W65A 2DGVA 2VJUA 1S0OA 5MAOA 4Y6IA 3HK2A 3MPWA 1NK9A 2H65B 1KVIA 1U1LA 3GFHA 2W9CA 2Y1IA 2YX1A 1RHKB 1S7IA 2WONA 2V9WA 3LP1A 2HS3A 1RKJA 2POKA 5K14A 2IYIA 1HNIA 2YWKA 3MECA 4Z37A 1RT1B 2H5JB 2V68A 2ZITA 3B82A 3IC1A 2CG8A 3DMJA 5E5NA 2MQOA 1AFIA 2E9TA 3CJ3A 2BE7D 3EXCX 3PHEA 2BM1A 4LBPA 1FWKA 2VBZA 4RW7A 4B3MJ 1DY3A 5LMUJ 2IVFB 2FJAB 3GPAA 4DR6F 4UZCA 3TQ1A 1U25A 5A0YB 4F02A 4IH6A 1Q8IA 4FBUA 1HYSB 1LFWA 1VQ6S 4Q43A 4DV5F 5HLFA 2UUBJ 1EAYC 1D1UA 1KTVA 2F3JA 3G2XA 1N33J 2FUG9 1U1RA 3CDUA 3MM5A 2RKIA 2IBOA 1RCOB 3SFUA 1KKHA 4OLOA 4QIGA 4Q8FA 4WFYA 3JYTB 2N7YA 1BGXT 2VZ9A 2HHWA 3NMRA 3SQGB 3JSMB 3FJ2A 2B7CB 4WWSA 3KK3A 1JXEA 1RT6B 3MM6B 5CYQA 1CJTA 3DC2A 1VGYA 3SCLE 3PXGa 1YHQS 2CAJA 3HHNB 3B54A 3VGTA 4XPEA 4ECQA 3H25A 2NZ4A 3BR8A 3N6MA 4WKRA 3IRXB 2F63A 2MY8A 2V4JA 4DLEA 2KT2A 1UTAA 2VG7B 4CT9A 5M2PA 3DHXA 2VONA 1BWEA 1KLMB 1P1TA 4ZVQB 4CO0A 4ZKAA 1NPPA 5F8GA 3M30A 3ZNJ1 5G4DA 4NI2B 1HQUB 2HIYA 4EI2A 1JLAB 5DZ6A 2BEFA 4Q0BB 2V8GA 3KXDA 1HBUB 4PEOA 1QY7A 3SCKE 5D3GA 3C6UA 3L95X 1CULA 3HSJA 3MM8A 1VCTA 3I55S 2GHVC 3WDOA 2ZH7A 1I6JA 2KT3A 3MMBA 4ZVTB 2E5LJ 5DM7Q 4FNHA 5GAGI 1U1KA 4B3OA 1WKJA 2XYHB 2GHPA 4ZDNA 3VTIA 3EVOA 4A8XA 4MFBA 2VODA 3H40A 2BABA 2PFFB 1FHTA 3EPIA 3C16A 3MPYA 3TEHB 5DO2A 3TI0A 4K4WA 3RAXA 1K0VA 4H4OB 2CPIA 2JOQA 3CO9A 4P75A 1P6TA 1SJQA 3PY8A 1S0VA 2CPZA 4IYQA 4J37A 2MZSA 3HSGA 4UUWA 4C3MA 1K44A 5L46A 2RKIB 1X4DA 3P49B 4I7FA 1NB2A 1T9YA 2LEPA 4RW8B 1ZM9A 3T1HF 3FCVA 4XDDA 3G86A 2XG8A 4Q45A 3Q86A 3SQGA 3D0HE 3G8QA 4Y2IA 3OTOF 2BJ1A 3AH6A 2GCFA 3SCIE 4ED5A 1KVKA 3DLBA 2QL9B 4NLVA 4C3LA 1JX4A 2GNKA 3DGPA 1RHMB 3MCMA 5L1LA 2HG4A 4AT1B 1TK8A 3VAMA 1K1SA 3OD2A 2KFZA 4OYPA 2XGQA 3MECB 2NXCA 4IG0B 4AYBD 1U1PA 3ILIA 2DEIA 1JLCB 4FYVB 1HHTP 1F5BA 3NGRA 3M8PA 4WE1B 1YQHA 2DXDA 1B4SA 3SIPB 1ZM4A 4F25A 3OHBA 4DQSA 3KJNB 1U6BA 1D3WA 1NUEA 1RAIB 2MQNA 3R7BB 4OJHA 1S5ZA 5ETMA 5KFGA 1X4CA 3G96A 4JI0J 2QG9B 3N28A 2V4QA 1KNZA 1NLKL 3FZ2A 3H98A 1YI2S 3FQLA 2RNEA 2W24A 3TVZA 1N5VA 4NLYA 1W2BR 2GW8A 2W9BB 3KKFA 2N82B 1YBTA 2OFGX 4ZLNA 2FGOA 1RBAA 1ICEB 2HFNA 5LOQA 2C3MA 2Z2ZA 1WUUA 2J0SD 1IKVB 1Q78A 2DGQA 2HSEB 4ENOA 4M8LA 3ZTPA 2BE2B 2B3TB 3KLEB 1SL1A 1AZSA 2HVEA 2ASJA 4P52A 4RLEA 1SJRA 5DG9A 4OV1A 2KI2A 1QUPA 4B17A 4YR0A 4ECVA 3T5HA 3H2UB 2F9JA 1MROB 1VK3A 1X31C 3DDKA 1U2RA 2DHXA 3PR5B 4OZ0A 2RQCA 1SL2A 5ETOA 2VQEJ 1WNEA 3ZXWA 3RRHA 1RAGB 2ROGA 5GAHU 2VG7A 1HI8A 4LREA 2QX0A 3E2EA 1F5CA 4NLXA 4LSLB 5HMZA 4OI1A 1YIJS 3C2PA 4C8ZA 3DYAB 3ZZ0A 2BQ3A 4EZ9A 2I6WA 2MQLA 1VS3A 2H5EA 3PEJA 5B0GA 2COLA 2HLTA 4HLBA 4N5SA 3VAKA 3JAMY 2HBYB 5HJYA 4NASA 3ONQA 2X1AA 4LF7J 2G4BA 3PNIA 4ZVPB 2E5HA 3HULA 5D8HB 1Q5YA 4FVMA 4ZHRB 4DQPA 2AKWB 5T14A 4RWXA 2QMWA 2ZHOA 4XDCA 3BKFA 3RJMB 3KLFB 3SV4A 4A8KA 2F4VJ 1IR2A 1KC8T 1N5SA 3MM9B 1U2FA 1M5KC 5CH7B 1XMOJ 4NYOA 2XI3A 4WP9A 2QMUB 4DS5A 4J5OA 4RU9A 1DLOA 5KFKA 3KLEA 2M70A 3MUVP 1NK0A 2DB1A 2VD3A 3C16B 3ILOA 3OFFA 8AT1B 3HX9A 2RS8A 4JI2F 2IFXA 4LR7A 5ETLA 4DBQA 2PMHA 1L3TA 1M5VC 2KTQA 1MROA 2HGLA 4ZOSA 2ZDPA 3A12A 1ACMB 1B3TA 3D6FB 4O4RA 3J80U 4A8WA 3DLKB 2DRAA 4CWBA 3ZZOA 1RTZA 3KUGA 2FLLA 1JXVA 3R3TA 3QIPB 1G3OA 4WXWA 1ZA2B 3ZTQA 1YDLA 2MGZA 3NOGA 3BQ2A 1S4FA 4OJGA 3QGIA 2U1AA 3ZZYA 4CO5A 2GZOA 3I0RA 4DFPA 2MKYA 4JI7J 2NQPA 2JZ5A 1VQSA 1KP6A 2K3KA 1N56A 1TVRA 2KVQE 4JI0F 2VKZG 2CJAA 2KZZA 1VDHA 1HBNB 5G0RA 8ATCB 3QFWA 1FTRA 2BUNA 4KTQA 3UPFA 4B02A 1SBRA 4CLYA 1URRA 3GSIA 4E8UA 3QIDA 1WC4A 1B64A 2PE8A 2HNZA 3L3CA 5KOXA 1FFWB 2RUGA 4IG0A 1FJCA 3OVBA 5KFEA 1GMWD 3HVTB 5FDLA 2R42A 3ZC4A 2GJFA 4HT5A 1J2VA 1TKDA 4M5MA 1DRZA 1FVSA 4F0MA 3PO4A 4PUOB 2QA1A 4ZMMA 2FLNA 3K58A 1RAFB 4RW9A 3J7YU 5EWFA 4ECXA 1UVLA 2OFHX 2Z4PA 3QJLA 3B4DA 2P9CA 3KLFA 1X0FA 4ZLJA 1NSQA 5KFPA 4AE5A 3CVKA 1TU0B 2PIIA 1FJEB 3T1HJ 3PM9A 1E6VB 1OJ4A 2GMLA 4CH0S 1ZYQA 4B3RF 1Y5NB 3KLHA 2PI4A 2JSXA 4P72A 3IM9A 4LMZA 3CDBA 4KT0C 4ZVOB 4LRFA 2D74B 4UOHA 3K7RA 1TL3A 2QA4S 4X2BA 2L08A 3RW6A 4NCGA 4ED0A 5D6GA 2DR5A 4NEZA 2EVZA 4X4NA 3ET6A 5IWAJ 4YY3J 3A8IA 4IFYA 3NBPA 2ABYA 2XYGB 1OY9A 2W4CA 2YNIB 4OLPA 4P2XA 4NI2A 1NMEB 2WB1D 3D0IE 4I6YA 4X65J 1UA1A 2YVSA 1F3VA 1X9WA 3QT5A 1CULB 3MM8B 4LBIA 3C14A 3PG9A 2VG6A 4UUXA 2GQ2A 5E33A 4A47A 2Y1RI 5L9NA 1N6QB 2XS7A 1PYTA 4IO9Q 2QA4G 4Y2CA 2XY5A 4WK3A 5E3RA 3BR9A 4V19X 2IRUA 3QT6A 4PG4A 3SV3A 4DL7A 2R8JA 4S0MA 1YJUA 3Q0AA 2WTFA 3KWMA 4J9OA 1YRUA 1VC5A 2M5YA 2LA6A 3IO1A 1WHYA 2K3IA 2ZH1A 2HURA 3I0SB 3AFGA 2E66A 2FHJD 1SKUB 1VBYA 4K0KF 2OP5A 4DUYJ 4HHJA 1D9FA 4WJBA 4HI2A 4AXJA 3OVAA 1GQEA 3VAIA 2ADBA 1BLUA 3GFZA 4RPFA 2RB7A 4EO6A 5SUHA 3A8JA 1U1MA 3QRQA 1XR5A 2GIQA 1U24A 4YDDB 3TZWA 1VK8A 3FCHA 1JLEB 1Q8LA 3BJYA 4N76A 2CQIA 2LXIA 5A8RA 5DGAA 3EVWA 1UWBA 1F1BB 1M0SA 4B3MF 1LXJA 1S57A 5KFBA 5G0RB 3FFIB 3DGPB 2Z2MA 3FVYA 1OYEA 4RUCA 3P5TL 2YWEA 4B3SF 1DQ8A 2BBEA 2BJEA 1HIYA 4USVA 3N79A 2VDIA 4G1PA 4FF3A 2AP6A 5EDWA 2ZH6A 3T1YF 3F41A 2QT7A 3MEKA 1T95A 2HFZA 3LANA 3M8YA 3FDSA 5DRKA 2XLKA 2WVBA 1APSA 2WONB 2EC2A 2VDHA 1ZTWA 3I0SA 1WI8A 2HQDA 3IR5B 1JB0C 2JLEA 2ZVSA 5KFVA 2KM8C 3QRRA 1NPRA 1YZ6A 3DRRA 5IT9U 1WI6A 5KFCA 1T05A 2GQQA 4ZVEA 2EG1A 5KT4A 1IKYA 4TNOA 4OI2A 3UN3A 3P5BP 4CNZA 1LWEB 3EGNA 2LMIA 3NAHA 4OJ3A 1IKXB 4I56A 2R8HA 5J1EA 5AJ3F 1SQEA 1NK6A 1KFSA 3TZYA 2OHDA 1WF2A 1ZH5A 4CQ1A 3K8WA 1PC5A 4QWBA 1VQ8S 4ERDA 4QU7A 2HS0A 3UNGC 1JNRB 2FJVA 3P45B 1S9EA 3L9ZA 2A2CA 2UUTA 2V2QA 3Q8RB 2C2EA 4ANCA 5FLXY 5B0CA 1H2TZ 1L3VA 1AUDA 3SI8A 1XN9A 4ES1A 4Y2KA 4O44B 4DUTA 1DTTB 3BS9A 3M2VB 2KO1A 1PAUB 2QGFB 1QM9A 4NYZA 2DNGA 3MMAA 3UFCX 4M5IA 2IBKA 1W26A 5H9EK 2MJUA 2V63A 5IQQA 5HVHA 5D0RA 1A6LA 3KK2A 4DSFA 3IFEA 3EDQB 4RW6B 1KHVA 3CNQP 3FSYA 4RW4B 3MR2A 4F3QA 3DLGB 3B4MA 1K8AT 1TP7A 2X7IA 3MGJA 3UE2A 1EETA 5I3QA 5E3PA 4BC9A 5DQIA 3H4BA 4WZQA 3A13A 5CHCB 3L09A 1PAEX 1NK4A 1N32F 3LH2S 3M05A 1H74A 1GAOA 1OIAA 1JIHA 1SC4B 2FHJA 1UA0A 2Z2YB 3NY0A 3QFHA 1E6YB 1P9QC 2F40A 5GMDA 4TQRA 2ZH8A 3HKZD 2OD4A 4FN5A 5HMWA 2MKCA 3QLHB 3V81A 3PX4A 1NDCA 1HYSA 2XMUA 5J1PA 2KL8A 3Q24A 2XY7A 3V6HA 3GP9A 3MFIA 5I42A 1FDNA 4DV2F 3RB0A 1M1KT 2HHQA 3EWGA 4OL8A 2QYGA 4C8KA 4PXCA 2B6AB 1IKXA 5IC6B 1N34J 2EFVA 4F0HA 2IJRA 2IM2A 2LFVA 3POTB 4ILRA 1S12A 3GU0A 5M2RA 3T41A 4CLPA 2BACA 5GVQA 4OJ1A 1OPIA 1RTDB 4X64J 2WBRA 4J9PA 2GO9A 1C1BA 4LIRA 3BO3A 5KFWA 1TVRB 3R5GA 4U9RA 1BQNB 2IMOA 2DGWA 2EK6A 2EFPA 5KG7A 3HFVA 3FFIA 5EX3A 3QSYB 2DR6A 2DGOA 3PZPA 3EE3A 1Y00A 2CFXA 2KYXA 2BJDA 2ZC4A 4KGVB 2HK2A 2KFYA 2K8GA 4LIWA 3R1HA 6FDRA 2M9KA 2RIJA 4ID8A 4USHA 4DV1J 3I0RB 1AROP 2WCXA 2Z30B 3KUHA 1UFKA 2I5JB 4GKJF 5C24A 2C2MB 2MHEA 4XIUA 2QFJA 3MCOA 1WC1A 4LF2A 3QLHA 3V81B 1FFGB 3Q8VA 3CD5A 3P8BB 3RB6A 1SJFA 3NCQA 4CRJA 1YBAA 2HHPA 1HNVA 2DGUA 2NXUA 2P8IA 4K4TA 1IBKJ 1ZAVA 3OR2A 2FC8A 5JVHQ 3CUNA 5A8KB 3OHAA 4RW7B 2XMVA 4Y28C 6AT1B 1QTMA 2HHUA 5F0UA 1T3OA 3QJPA 3IGVA 1XK8A 3N6LA 1EARA 4RNMA 3T5KA 3AA9A 3GQCA 3RAMA 2GVDB 4OYBA 2ASYA 4FYWB 3JSBA 3P4UB 2L3MA 2GX8A 2VHGA 3VAFA 1D9AA 4HTJA 4OX6A 3W5XA 4WCEQ 2UP1A 1GMWA 2CQ1A 4YQWA 4DR7F 1D8YA 2IRXA 5C7PA 5K8OA 3PIOQ 1T03B 1A9NB 1RT4B 5KG2A 2XS2A 1IBCB 2GA7A 2CQ4A 3C3LA 2Y0BB 2VU5A 4F0KA 1N5YB 2OEMA 3AY0A 3MMAB 3AXKA 1TKTA 2YNIA 4BWMA 3DOMB 1BD6A 1SV5B 4DPOA 1UW4A 1YRXA 1G4CA 4FF1A 2KXHA 4F3OA 1TAUA 1TL3B 5E2QA 2Y1LB 3DLJA 3N01A 1XC9A 2VA3A 3M7VA 5LSOA 2MZRA 1HBMA 5KFNA 2NSCA 5CA5A 5IM0A 4EYHB 2OPQB 3EUNA 1I94J 1RACB 3NBPB 1U02A 5ETVA 4DSLA 2CXEA 4QYZK 1S4EA 2MZ1A 4YEAA 3JSRA 3PW7A 5IV3A 1KONA 2V5HG 4CLTA 3L7PA 4EBDA 2YNFB 2PEHA 4OZNA 4JYAF 1XNRJ 2QSWA 2GVDA 3H2VE 2LXFA 3UCUP 3O44A 1CJUA 4LF6J 2DO0A 4L72B 5F8LA 4KPYA 4WFBQ 2UXDF 2RQMA 2VG5A 1V5IB 3RZAA 3QZ8A 1F6TA 3GJTB 3NNHA 4Y00A 3M8RA 1S9FA 3MM5B 4C7QA 2KM8B 1ELOA 1IN0A 2O3DA 1N88A 2ROEA 3CJQA 5KT5A 4ED8A 1PJ6A 4DPTA 4C4WA 2J9EA 1GMVA 3EICA 3PHTA 4GO5X 3VR1A 5K8MA 3M9OB 3LWLA 1YJ9S 2UVWA 2YX7A 1SI9A 5KG5A 2H5IB 4W4MA 2MGZB 3FEZA 3OJSA 3AOAA 2W8LA 4ZVSB 3PW4A 3DDIA 1CQNA 3DXSX 1RKIA 5KFTA 4RUHA 3VQTA 1BC6A 1M1GA 4KH0B 2WW4A 3CW2C 3D2WA 4KFBA 5D4PA 3HFZB 4V19J 5KOWA 5IT9Y 2Q1LA 4QU6A 2Q6CA 3LAKA 2CIMA 5AXKA 2VQFF 5KFXA 1RB0A 1RWNB 2J6TA 2JEIA 2PD1A 2JFKA 2K7KA 3GLJA 4I2PA 5F8IA 4KC5A 1PBUA 4UQTA 2BANA 4PG6A 1VRTB 3MCSA 2HMIA 2CVIA 3MAAB 3IP0A 4RL1A 5HAOA 4RU2A 4C8LA 1JXLA 2FZKB 2XWXA 4ID5B 3TW0A 2DT9A 2DGSA 2NUUG 2LQBA 2DEJA 1N5TA 3CEDA 2IIHA 4JI4F 3CXCR 2O67A 1S99A 1RHQB 2FLOA 5ETPA 4C0HA 4EU0A 5SZTA 3NS6A 1HD1A 1DLOB 1U48A 2Y3YA 1WG5A 4URQU 1ZM3A 4CIOA 2FY1A 4F3MA 3M8QB 2XO6A 2CNLB 2LU1A 3QWPA 2IJFA 3SEOA 1YG0A 1RGVA 1YJTA 4DR5J 4FPIA 2N4DA 3WIVA 4GKKJ 4B9SA 1FD8A 3HO1A 1GMUA 1TL5A 1X60A 1UVKA 4TQSA 1BWVA 4DUZJ 1HKAA 2BYCA 2QJ3A 2BX6A 3ZNUA 1ULRA 1Q86T 4LF5F 1JLFA 1HMVA 4PWUA 3W2WA 4CDIA 3CCUS 1KQFB 3SDEB 3OLAA 1SH0A 2B5JA 3BBCA 3K5PA 4ZPBA 3DRXA 2R7UA 3MZIA 3THPA 4C3KA 5B0DA 3GB0A 2HPUA 3MI7X 2YKPA 4DL3A 5KG1A 1U0HA 3Q8QB 3MD3A 4DS4A 3M6UA 4YUDA 1ZZNA 2UUAJ 2RF2A 1A0OB 1C4AA 4U67Q 1NO8A 2E9RX 3UN5A 4FS2A 2I38A 3Q22A 2KJVA 2NS1B 4TU7A 1G7CB 1WD6A 2G1HA 4FS1A 3IN5A 2OPRB 1NXIA 1SC3B 5CYJA 4QJVA 4DX7A 3MPDA 1RAJA 5HK4A 1YJ7A 2H1YA 1Y7PA 4L6V3 2JL9A 5A0YA 5HL7Q 2X1FA 4AXIA 4K4XA 2HHVA 1CLFA 2OEKA 3PKMA 1X4FA 3I4PA 1WEZA 3D9BA 2NUHA 4MH8A 4O3OA 5GMKa 3G4SS 1VQNS 1HR0F 2G2OA 1CJKB 2BKPA 4CLSA 4KV8B 2VL1A 1VQ9S 2GVZA 2N3OA 5HROB 2CJKA 3HPOA 4YFUA 4B9TA 1HWLA 1ZTTA 3CWJA 4DR4F 2YTCA 3DI6A 1ZETA 1WOPA 2QMXA 3DRSB 1RWOB 2B4UA 3CT9A 3FMWA 1URNA 2IA0A 3IAS9 3T5JA 3O5TB 3H20A 3Q89A 1NCLA 1NJYA 2DGXA 3MF5A 1RWWB 2J5AA 3MMCA 4LUBA 2PN6A 4IQMA 4JUZA 4DQIA 5F3ZA 5LMNJ 3N5BA 4EUVA 2HS4A 4KIAA 2MQ8A 2QO3A 2WBMA 2YNGB 3M2UA 3R7SB 3HDSA 2C22A 4A4JA 1JQGA 4DL0C 1Y3KA 2OELA 2IY5B 2ZJRQ 3K2YA 3MEEA 3GFXA 3QGGA 2IMWP 4UY85 5D0HA 5GMEA 5C42B 2CQCA 1NRKA 4JI1J 2MJNA 1DARA 1EB0A 2YY3A 3DU5A 4LR9A 1V5VA 3LP0A 3UWTA 3I82A 4H4KA 3JQKA 3K5MA 4NZ6A 2XMTA 4RNNA 3Q2TC 3IG1A 1KVJA 2VPZB 2UU9F 1HW9A 3IWLA 5D0GA 4LF8F 3ENWA 1N52B 2VB6A 2XZDB 4L74A 2A18A 4EK2A 2P9EA 2IDLA 2RJZA 2IM0A 4IR1A 1UVIA 4DDFA 1HHSA 5KT7A 2DR8A 1O51A 2UUCF 3OFEA 1RWKB 3EGWB 3F73A 2B9EA 2MMYA 1PBAA 3VQSA 4F2SA 3GJSB 3JTPA 4MYUA 3LP2B 4PXDA 4M5HA 1ZOTA 3W60A 3DLKA 3OR2B 4PYAA 3S8SA 1S72S 2AYGA 2DGTA 4MFBB 1VQMS 1MU2A 3CJTA 2QYCA 1C4CA 4KGMA 3VVUA 3TUZC 4UTGA 4CCHA 4USTA 3MHYA 3W8PA 1YGYA 4KJIA 4QCLA 1CSJA 1TKTB 4C48A 1S9EB 2M0GB 1Y3JA 1TUWA 4K4SA 3H5XA 2OJ3A 2M2BA 2D3UA 3UCGA 3EYZA 4FXVA 1YZ7A 4WYWA 2HNYA 3CJ4A 3RGIA 4E2FB 2K06A 2B4VA 3OSNA 1QDUB 3WIUA 1UEUA 4EBEA 2B4OA 5U47A 4HACA 1V3ZA 1HNWF 2E1PA 2HHTA 4RNOA 3G82A 2I9SA 1L3SA 4C8YA 3CCZA 4ELUA 1VMBA 1NU4A 3MCNA 1IBLF 4DR1J 3OFHA 3B6BA 3VGUA 2ZD1B 4A8QA 4Q2LA 3TJ8A 2YKMB 2D1CA 4P7TA 3GIRA 4P9SA 1YWXA 2WZ1A 1UMJA 4USIA 4WTYA 4ZA1A 1XBWA 3UQSA 2R2SA 1YKWA 4WP3A 5KFIA 4HHUA 2NR0A 3QT8A 3V4IB 3D1QA 1M5HA 4BCAA 5J2NA 1C0TB 5EX0A 2B6AA 2NXNA 4H4MA 4PQAA 1RTDA 1XMQJ 1YBUA 1PKUA 2ALYB 1CJVA 3GSDA 4HI1A 4LRAA 2FDNA 1NAQA 3KDOA 2KH9A 3NGUA 3TJAA 5T41A 4GMKA 4YB5A 2BM0A 3MTKA 1WEYA 2HGNA 4TVAB 3KFWX 3CCJS 2ZJQQ 3MEGB 2HAFA 3IM8A 3F44A 4GVBB 3U27A 5LSRA 1RISA 2P6SA 2Z8QA 2MZJA 1IQZA 4TLQA 2HBQB 3HVAA 3UDVA 2QLBB 1HWJA 2HWTA 2IPOB 3D5MA 3GV5B 3MAQA 2IA6A 2MB0B 5ITHA 1SH3A 3WHIA 1FRJA 3MEDA 3TJ9A 4JV5J 3ELHA 2A1BA 3LP1B 2DNPA 2CJQA 1OSCA 5DS7A 2BJ7A 2OPSB 3D66A 1NK5A 1A7GE 2CJXB 4USWA 3V4IA 1R8AA 2OKQA 1RA6A 1S1VB 4ZS6A 1FD2A 4DMZA 5I4MA 2L9DA 4DR1F 4F4AA 2GO8A 1WF0A 2PMZD 2DHGA 4OHZA 1FTCA 3LGNA 2OPRA 2AGPA 2NCKL 3CCVS 2C1EB 4DCJB 1R8CA 3JTNA 1TV6B 2CQDA 2H54B 3HSZA 4ZVHA 5D3GB 1AA1B 2UUAF 2L9NA 4LF1A 1KFDA 4DR3J 4DSIA 4G1QA 2DNHA 4Y65A 5BR8F 3CCES 4I69A 3MUTP 4LFAF 4P7VA 5LL6d 5HQ8A 3RR7A 2OO4A 2C2NA 3KJVA 1Y9OA 4DV6F 3W61A 2CKWA 2CPEA 2W2QP 3MM9A 4O3PA 1MN7A 3KNAA 2DK2A 3LP2A 3WC0A 2L41A 2FVPA 2V9KA 5F9LA 2XSJB 1Q8BA 3FCWA 2X3DA 1B99A 4MKYA 1GNKA 2NPIA 4DPWA 3THVA 3GCWP 2HGMA 3NS5A 4PZVA 4B9NA 1KSPA 2DHHA 1T03A 3D6HB 2D41A 3MEGA 2IVMA 4LF9F 1REVB 4BLGA 1OY6A 4JV0A 3DHWC 1R43A 2IC3A 4ZVFA 4DN9A 3T5LA 4NA2A 2UU9J 2R7XA 1R0CB 1QAXA 3K59A 2HIQA 2C28A 4UW2A 3C6UB 4NEYA 5C42A 4I0WA 3CCMS 3AQOA 4LVOP 1UWBB 1WOSA 4RW9B 2GV1A 3H8YA 4A8MP 2WW8A 1L3UA 1XWLA 5HVFA 4FXDA 1QE1B 2DNNA 3PFEA 4ECUA 3E51A 3NG8A 3CJ2A 3PJ9A 3IMQJ 3QYYA 1FKPA 2HFVA 4PG5A 2EFQA 5D77A 3UDCA 2QIFA 3V4MA 4OX8A 5ADZA 1KD1T 3V6DB 4FNIA 5E0OA 1CG2A 1LWEA 2UZAA 4P2MA 1Q95G 6FD1A 1PYOB 3HJVA 4OV6A 1VBXA 2FVRA 4BS2A 2KKHA 4EZ6A 3AODA 2KFNA 3C8YA 3PJXA 2LYVA 2ZWOA 3UCZP 3A8KA 1N54B 3OJUA 2W8KA 1QD1A 4UZBA 1FERA 1O0PA 5AT1B 2E5IA 2Z58B 4F04B 1IM4A 9ATCB 4IQXA 4ZPWR 5CCLA 2XY6A 3CMES 3GYNA 3N0VA 4IRCA 1RU1A 1Q7LB 4K4VA 3ULHA 3IXQA 5HQLA 3PX6A 1BQXA 1WSVA 3AHPA 2PSZA 1SXLA 2QV6A 3BQ0A 5HROA 3M2RA 3V6JA 4ZVRB 1RABB 1WSRA 1UVMA 1KDNA 5D78A 5FIIA 4PG8A 3C14B 1SB6A 2FB0A 5FJ4A 2XTJP 1DTQB 2J8SA 2DPJA 2AMCB 3H5UA 2MQPA 2H48B 1OO0B 1OY8A 1LWCA 2KDOA 2HFOA 2MDAA 2ZOMA 4NA1A 3K89A 5ETSA 2KVIA 4IH7A 3EPGA 3DRYA 3RR8A 4DI6A 4TY8B 4DCOB 3TWZA 2KG0A 3OLBA 4LF9J 2BQRA 1NZ8A 2XO7A 4Q44A 1RXOB 3DM2A 3KNGA 4OYZA 4J9KA 4FKXA 1VYAA 1X5PA 2ZZTA 4PABA 4C0OC 2RT3A 1AB8A 2FJWA 1KHWA 3GR1A 4USMA 1SC6A 3PACA 2M88A 4WXOA 1TL4A 2BRKA 5B0FA 5AE2A 1PG5B 3UR0A 5KG6A 1T9VA 1BHNA 3HZEA 4MJKA 4LF5J 4IG3B 4DV6J 2F4FA 2JHEA 3FUYA 1U8WA 4CH7A 1YSJA 3MTJA 2D69A 3J7ZT 4PWWA 4LF4F 4NXNJ 5BR8J 1TFYA 4DOZA 1KS2A 1W7WA 4QWEA 3UDLA 2IAJB 4AUKA 1KWMA 1FCAA 4NPOA 2UV8G 3SMZA 2FLPA 3JQJA 1GH8A 3MXHP 5T7LB 4ILMA 4NCGB 1M5PC 4DV7J 5LM7E 5EGYA 4M5LA 4ZVUB 3OTBA 2ZH3A 3HD2A 2VIHA 4RO0A 4ECZA 2HVHA 2ZJPQ 4NRUA 2ZZMA 2G9OA 1J5OB 8RUCA 3CCLS 2FZGB 2N3LA 1V9OA 3CIZA 4LFCJ 4O4GB 1IWGA 5IFMA 3FSXA 3BB5A 4UOCA 1HBNA 1CJTB 1IR1A 2W2MP 3BGUA 2YNHB 2FD2A 1FT8A 3H5YA 1J5OA 4JV5F 2V4JB 2D3OR 2MKJA 1JLBA 4X4TA 3PO5A 3ENQA 5F8NA 1N48A 4KH1B 1MWQA 2MLZA 4JB8B 2LP4A 3MOJB 1GTHA 1S1TA 2OPPA 2YQ1A 2KZMA 2MKHA 1RWMB 2GMJA 5KFDA 1FXDA 1VQ5S 3QNWB 5KFUA 2DNQA 2RRNA 3M9MB 2RRAA 2VOPA 2M8HA 3FK4A 4L73A 2X51A 1NNDA 2EC0A 2YKOA 4PYDA 2GJIA 3OQ2A 1NHVA 1F9FA 1WJ9A 1FX2A 3W5YA 1FJGJ 5GADU 5DZ7A 1QUVA 3RW7A 1CS4B 3QMQA 4JBCA 1J5EF 4YR2A 1C0TA 4ECRA 2FYXA 1EJ7L 4KHPJ 3AXMA 4MIWA 3W63A 4CO1A 3UDEA 1U1QA 2N4CA 1TMJA 3W64A 4DL5A 1RQ0A 2B8PA 1JLEA 3SQOP 4B3TJ 3W3SA 4Z7YA 3LGHA 2GC8A 2QLWA 3UW1A 5LXRA 3AD8C 1GT8A 1EP4A 1X9SA 1YJRA 1N0UA 3HP6A 3BGRA 5AXLA 4K2JA 5B0AA 3TAMB 3ZFVA 3C6TA 1RCXB 3CMAS 1UL3A 3EVMA 1FDBA 4Q7AA 5KFZA 3CF5Q 4IOCQ 4NXMF 1WHXA 2OPQA 3BDEA 5D0EA 5E3AA 4DX8H 4OYXA 4IO1A 2H4YB 3AJ2A 3EX7B 1IJFB 1G6BA 1ZPVA 4OHWA 4QIEA 3H42A 3CDWA 3J7A1 2M8DB 4CM2A 1TTHB 2YNFA 4X62J 3K0JA 1RSCA 2MY7A 1MLAA 5A76A 4K4YA 1LW0B 4Y2MA 2Q6BA 1OS5A 3PEHA 1EETB 2XHCA 4BC7A 3SYZA 1U1NA 3T6BA 5GAHI 3LTOA 2JC1A 4WU2A 5LJ3Y 3OL8A 4ILLA 4PQUB 5K9FA 5HI7A 2UVUA 4NXMJ 1T05B 4JI3F 3E3XA 2CDRB 2X1GA 2F9DA 2G0CA 3MAHA 3MM7B 4OZ2A 2DNMA 3CJKA 5KFHA 3MURP 1R8PA 1F9HA 3IWNC 4DL6A 3NCRA 1N36J 3D28A 2J6UA 3W5ZA 1Q7YT 1XNQF 4NOHA 2OUGA 4KO0B 1NZAA 1RADB 4R5PB 2AGOA 3DU6A 2E5GA 1NBEB 1WC3A 4ZCLA 1RT5B 1C2PA 4H54A 4DV4J 2C3UA 2DR9A 1CBKA 3BM7A 4XO0A 4X4UA 2JLFA 2HWIA 2R7RA 3VAJA 4ECWA 1S6QB 2W2OP 1NB7A 4IRDA 3CC7S 1FRIA 4O0NA 1NM2A 4ZLPA 1X0PA 1O5JA 5D4LA 3KLHB 3AOCA 3RB4A 1RTHB 2CPDA 2LVWA 4QR0A 2CADA 5KTQA 4QIVA 4PPZA 2AJ0A 1UEKA 3L7UA 3HM9A 3G71S 2D3O1 1TK0A 1JKHA 2WSEC 4BDPA 1R0AB 2IM1A 3I31A 2JLGA 2ZEJA 1YK9A 4HDGA 4OI6A 1CQMA 2EEYA 2Y0SD 4OI3A 1W25A 5K14B 4TYBA 4ZCMA 4EEYA 1JLBB 5HBMA 3KUEA 3DMJB 2R7VA 1Y5LB 3MD1A 3R5AA 4G65A 4OFZA 3K57A 4ED7A 1X4AA 2ALZA 1BY9A 1NDLA 2HZVA 1G2EA 1GEHA 2YPZA 4W90B 1RTIA 3FNNA 3D1HA 3KHGA 1V3RA 2FC9A 2J9CA 3EZUA 5BYRA 1XJWB 5AE3A 3CCWA 5KAKA 4Q8EA 1WC5A 1S6PA 2BJ8A 2NSBA 1FKPB 1HHQA 1I1GA 3ZTSA 4R25A 1HW8A 3CJ8A 4KY3A 4R0JA 4HL9A 2RUSA 1CS4A 3KG1A 5B0BA 2O01C 3W9HA 5AE1A 2HEKA 3J80Y 3R2CJ 1TAQA 4ZN1A 1Z2LA 4KHPF 1FNMA 5CZVA 3OW2R 2NREA 3PDNA 3GYXB 3ITHB 4DSEA 3AD9C 4WYLA 4EO8A 4NLUA 3W2VA 2MTLA 5A8RB 2GJ2A 5DLFA 1S7HA 3JAMU 1R8HA 1HFEL 1RHRB 1RT4A 2W4PA 2A10A 3D4JA 4NRTA 2ZH9A 4RW8A 5HP1A 2HBRB 2Y8YA 3K5LA 1FKAF 2HQFA 2LDIA 4DSKA 3TO8A 4G3IA 2DJWA 4ICLA 2UXCJ 1B0TA 3QPIA 5KFLA 2QFIA 2C3OA 2HFSA 5A8WA 1OSDA 4QBUA 3SDEA 3QWUA 1K0TA 2B51A 3VF0B 1YLXA 3H2LA 4K5SA 1NSPA 3DLGA 4X4SA 2B9XA 2X1BA 3C66A 3D3CJ 3D54A 4P6QA 4TU9A 3G6YA 3TAPA 1TL1A 1OYDA 3OR1B 4GKJJ 4USUA 1MWZA 4PPDA 3AAWB 4LQ3A 3P96A 2GGPA 5H1SV 5JUMA 1R7IA 3BF4A 3BPDA 1WTBA 4DZDA 2CPFA 1XIQA 1WOOA 3BGOP 2M7SA 5D4OA 5THWA 2ZE2A 4HYKA 2CNNB 4MT1A 2BOPA 3LA0A 2XEXA 2Q79A 3DXBA 3W2VB 2ASLA 4LQ9A 3SFGA 5J2QA 3QRPA 1AFJA 4ETZA 3MWBA 4OHVA 4RNFA 2RDJA 1DTTA 4A46A 1UFLA 1WDTA 2FY8A 2V0NA 4GO7X 5A6PA 1T3NA 2V8DA 2I8EA 1LWXA 3OL6A 3KLIB 3NKYA 4Y3CA 4LRCA 4N56A 1IKWB 4Q2MA 1VIXA 1U0SA 1N5YA 3D1OA 3T9NA 3GJRB 1X5OA 2OSRA 2GIRA 2GS8A 4URGA 1PILA 1W2IA 2CNOB 1U7LA 2R7SA 1Q8KA 1FRLA 3NL0A 4LT6A 3U1NA 2APOA 2R7OA 4X66F 5CAAA 1Q0NA 4PKDB 5HQMA 2OSQA 2VQFJ 5DM6Q 4F4XA 2WSFC 2EFOA 5HBMB 1S1TB 2HQ3A 3ILJA 2ZC3A 2OEJA 4ZIVA 5LT5A 2JX2A 4NLOA 5D4NA 2A6OA 2I5JA 3KDNA 4IRKA 2B7BB 2AEMA 3U1MA 2LQJA 1RUSA 2CJYB 2BKNA 2E7VA 2ZKTA 4KRWA 4C98A 1JLQA 1RK8A 2QLFB 2RQ4A 4FVCA 4IOBA 4WFAQ 3KLGB 1T7PA 1FI4A 2EK1A 1S6PB 3CD0A 3DLEA 1HNXJ 4TXSA 1D9DA 4A8FA 3MR3A 5DG7A 3HHDA 4M5JA 2ADCA 4OYWA 2DR7A 4RBUA 3CTRA 1UJ4A 4C11B 3LOUA 2R2RA 2ACMA 2H4WB 3UD3P 2AU0A 1S1WA 2CQ0A 5I3PA 1FDAA 1U2CA 3FGVA 4R5PA 4GC7A 3KJFB 2JDJA 3IS9B 1XNRF 3NWRA 3GIJA 4JI3J 5K8PA 3R8YA 4DUYF 2HNYB 1DFDA 2L48A 2CQPA 1HI0P 3NWGA 2ZOGA 4I2QA 3CJ5A 4KKOB 1VQPS 2YKQA 4AD6A 4ED3A 3I56S 3KLIA 1KRPA 1QSYA 1IKWA 3HI9A 4X62F 3THTA 3PVXA 1SV5A 5DJBA 4DR3F 3ETMA 2AF6A 4K5RA 5ETRA 2JJ4D 1TL7A 1T02A 2DY9A 1LW0A 3CJSA 4RR5A 4DFMA 3E8OA 3DN9A 3LGMA 1ZS6A 3I96A 3IRXA 4QR2A 2OLWA 2HMIB 3MMBB 4D3GA 3RTVA 4AL7A 4ZHRA 1Y4ZB 1L5UA 4CM0A 1VLYA 2XNQA 4U7UK 2V6AA 1JLAA 1Y5IB 3G6XA 1RYRA 3K5OA 4LSNA 4DV4F 4N8NA 4B3TF 1S1WB 4K8RA 1QTNB 4A8SA 3PYEA 1KN6A 3DM2B 1P8GA 2VPWB 1JLQB 2ZWPA 2V69A 3IR6B 2SXLA 4WU3A 4WTOB 4JP8A 2ZZNA 3VGVA 3DDNA 3BYPA 3MOZA 4O44A 3TVYA 1SIWB 2CJ9A 3G8SA 1UCNA 4N41A 2R2UA 1IWAA 2Q43A 2VUGA 2PO4A 1H73A 3MPUB 2DHSA 2M52A 2J76E 4CYUB 2B43A 1NK7A 2EKNA 1UETA 4BHQA 3ICLA 1WDDA 2IRYA 3TUJC 3CE8A 3M1VB 1MG7A 2CUYA 2O5DA 4OI4A 4ZP8A 1BMQB 1XR6A 3CMQA 1UAWA 2PGCA 2VV5A 4WFZA 1KTQA 4YB1P 3MMCB 1SJ4P 2D3ZA 5IOLA 2KB2A 2PT0A 3Q83A 4NZ0A 2ROPA 4ATNA 5IZHA 2YXLA 3O8WA 4X4QA 2R8IA 3GFYA 4EGLA 5E41A 4KKOA 2HYIB 1S1VA 2M4MA 2J8AA 3M2UB 4FYYB 4OYOA 3T6JA 3GJQB 3HVWA 3L7OA 2HQCA 5ETNA 4DPYA 2HQIA 4KQZA 1VISA 2W9CB 1U49A 2JWNA 1RT7A 5L39A 5BYQA 1FESA 2XGPA 2LQ8A 1T9TA 2NYIA 2EBEA 2F8HA 2D9OA 1YJNS 1RP5A 2E29A 3GCXP 3KHHA 2YWGA 4ID5A 1ITPA 3GV8B 1VQ7S 5C5JA 1UVNA 4HDHA 2MZQA 1GTEA 2CQHA 5H9FJ 3V6DA 4Z7CA 2ZFHA 2VFTA 2J9DE 3DLEB 2YX4A 5K8NA 2NLWA 1BUXA 2DPIA 3HF5A 3G8TA 1NJWA 3ENVA 1J5EJ 1TK5A 4IFVB 1M5SA 1L3KA 3OSPA 4LF4J 2MLYA 1FJGF 1P27B 2AW0A 2DO4A 2O66A 2JEFA 4ELTA 1VRUA 2UXBJ 3FBCA 1HWKA 2ZH4A 1ZAXA 3OXLA 3DFEA 4DFJA 2IYGA 5H9EJ 2JNJA 2KN4A 1F5AA 3D3BJ 2CG4A 1RTJB 3DOLB 4OZ5A 5IXUA 1F9EB 2MKSA 2KRRA 4KE5A 1OQ3A 3KLVA 5E7OB 3I4HX 2MSSA 2IC3B 2KRBA 3OTDA 4RBTA 4WP8A 2LU2A 3TA1A 4C8OA 1N32J 2C2ZB 1JJCB 4M94A 1XERA 4DF4A 1GXLA 1HMVB 3ADAC 3W2WB 4EBCA 4CTAA 2B5JB 4ECTA 1U8SA 4MK9A 2YKMA 2AX1A 4PAAA 2J0QD 1H0HB 2CDQA 1B7YB 2OAUA 3I9V9 3BGFA 4J91A 2HZAA 2AJ4A 5DDQC 2A6MA 5F9NA 3WBZA 2Y8WA 1N6QA 3N5FA 1QAYA 3DYAA 1UPMB 2QL7B 3OPKA 2AEJA 1PIEA 3PRBA 4J90A 2VFUA 5KG0A 3VALA 4P73A 4DV7F 4F4WA 1N8RT 2J7UA 1JJ4A 4Q0BA 2BW2A 3I5AA 3CC2S 4DV0F 4FBTA 2DIUA 3MUMP 2PA8D 3PYGA 2ZKUA 1S6UA 3IGNA 3C15B 2ZNZA 2K7JA 2M3DA 1RAEB 4DX6A 2FPHX 3UN2A 2XMWA 2GGPB 3A4TA 1PO6A 2BR0A 1T11A 7FD1A 1FJ7A 4V1Ak 1I3OB 4TU8A 2V94A 1V3SA 3TYTA 1LK7A 2HRYA 3P3DA 2P6TA 3JYTA 3BSNA 1AZSB 5CXTA 3H90A 2WAQD 1RT6A 2J0WA 3ENAA 1LFPA 1C1BB 1LEOA 5CYQB 3FBEA 1R0AA 1SJ3P 3CULA 3S6EA 1FWPA 3A1YG 4QW8A 4ES2A 1HNXF 4C9DA 1KEKA 2YH1A 2HBZB 1D09B 2QLXA 1ZA1B 1P1LA 3K8VA 1RT3A 3PRVA 4GVBA 4PXBA 1YTYA 4K7QA 2K1RB 2VH7A 1HR0J 2E1CA 3DLHA 2DH9A 3NNCA 2IJNA 2LQ5A 2W1BA 4J7CA 4P2FA 1OMSA 4ANDA 1JMTA 2E9ZA 3F56A 3TARA 4O3NA 1KBRA 2F5GA 1S6OA 3FC9A 3IBCB 3QQCD 4YS2A 4WZMA 3BSOA 4WBFA 2E7XA 2CNKB 3LO3A 1UWAA 5IS2A 4WPAA 4UOGA 2XMAA 1BE4A 2XLIA 1JWWA 3LF0A 4DG1A 2ZBQA 3I5BA 3EGVA 2XWYA 2EWHA 3LAMA 5J2NB 4CLFA 2PDAA 1RWVB 2ZDOA 1XTZA 1B7FA 3V6KA 2KHDA 5L1JA 4EWTA 1B0PA 4QWDA 1VQYA 3DRSA 3C15A 2J7WA 4ED1A 1AYEA 1XEZA 2XM3A 2CWKA 3KJVB 3QSIA 4DUZF 3VV2B 4I7FB 5T7LA 1R3NA 4LFAJ 4KV8A 2RRBA 4BBYA 3W7BA 2GAHC 2R7WA 2VBYA 1DQ9A 2KYZA 1WG4A 3O2IA 3OFGA 4ZCIA 5IC4B 1REGX 3OBIA 4OMFG 2Q3PA 4N47A 2J9DA 1RBOB 1UFWA 1VR6A 2H51B 2WVEA 3CSKA 3QAEA 5CYMA 5KFJA 4DQRA 4X4PA 2RDIA 1K73T 1J27A 3TQEA 3CCSS 3VVTA 4FF2A 3GR0A 2CZVC 3EZ5A 1TL1B 3NGTA 2J7KA 2V2KA 4XAKA 2UXCF 1LOUA 1RLDA 2QLJB 4TKTA 3MPVA 4ZPDA 2C2RA 2NXEA 3KOAA 3M4XA 3PFOA 4ED6A 2E1MC 4KYZA 3LPEA 1Q81T 4I6WA 2BANB 4C8MA 3KK1B 3CJRA 4R8UA 1HWIA 2RH3A 2AV5A 3R6LB 3VWSA 3ZZUA 1LKZA 1SUQB 2F8MA 2YBVA 4Y34A 2H9ZA 3BEGB 3VZIA 4ZITA 1HNVB 4U8VA 1QVFR 2FHOB 3A3NB 3PTWA 1FXRA 3IG1B 5HJXA 4ECSA 3AJ1A 3AB4B 1TELA 2IM3A 4IH5A 5DDPC 2BDPA 2ERRA 2Q66A 2UXBF 4J9VA 1QSLA 2FHMA 3KK3B 1TZ0A 3NGKA 1CPZA 2QN6B 2ZH5A 2ASDA 1FRMA 4B9VA 2AYBA 3HHLD 3IBFB 2BJ9A 3M8SA 2LKZA 1D8ZA 2CZ9A 2E1AA 1F60B 2OGUA 3EM1A 3PR4A 4NX9A 4M5DA 5IV4A 5EHHA 2XB2D 2JVRA 5ETQA 3BV8A 3M2RB 1WWHA 4E98A 3J81Y 2PMWA 2DBBA 2V34A 4BWJA 4ZPCA 2BE2A 3NOCA 2XS5A 2B8QA 2LLZA 1X4HA 4C6AA 5HMXA 2U2FA 3G6VA 1FKOA 2RHQB 1RT7B 4YMEA 4JYAJ 3HCXA 1H7XA 4PG7A 2RDDA 4ELVA 5J2MA 2BJ3A 2B4PA 4PWDA 4DLGA 2ILZA 2WB4A 4OYAA 1I94F 1HNIB 2V2VA 4JI7F 3FSIA 2UVVA 3C46A 3PYFA 4ED2A 2KT5A 1MMLA 2P2CB 5IT4A 4F4YA 3BSAA 4KHMA 3MDFA 1NDPA 1HQUA 3AT1B 2Z57B 4I68A 3J81j 5B08A 2JEJA 1UEVA 4ECYA 4L75A 1WF1A 2ILYA 2DIVA 2AHOB 2VC1A 1SQGA 3Q8UA 4JI8J 1GXTA 1T9WA 3ZO7A 4RUAA 3W62A 2XCPA 2XBPA 3I32A 3RAQA 3CJ0A 1DQAA 4LRBA 1R89A 3HLUA 2EXUA 1VJQA 2RD5C 1MWYA 1SH2A 2YWFA 2UUCJ 4I67A 2F4VF 2PEBA 3OTCA 4MIBA 3LWMA 1LQ9A 1UZHA 4PCQA 3R5DA 5J2PB 2DKOB 3H5SA 4KO0A 1T9UA 2YQ3A 1N36F 4OHYA 1B0VA 2IDEA 2QE5A 2HW3A 2UXDJ 4OX9F 2LDYA 3AD7C 5HP1B 3LP0B 4M95A 4C0BA 4JI1F 1FXLA 3BKUA 2QA2A 4O23A 3NGSA 3GIIA 1HNWJ 1VHFA 3MR5A 1NSAA 3NXZA 3TZZA 3TUPA 4CTAB 4O4GA 1NHUA 1S0MA 1S1UA 1BQMA 1DJ0A 5K5MA 1S97A 3R2DJ 1TV6A 2I2YA 1TL7B 1S76D 2PA3A 4HH0A 4CI0B 2E7WA 4K2XA 5LSLA 2ACYA 1FE4A 1RAOA 1RJJA 1UPPA 2Z2LA 3KYLA 1OPZA 3FEXB 2AX0A 2VFVA 3FRYA 3KJQB 1QLNA 1F2GA 1XMBA 1Q16B 3LW5C 2R2TA 2CA9A 3BYRA 3LALA 5IT0A 2Y1JA 1FVQA 4C97A 3TAQA 1TR0A 2CPXA 2Z0GA 3FBBA 3HHLB 5JJBA 5KT6A 1RE1B 4EYIB 2J6SA 3QGPA 4DN0A 1BQNA 1HQ2A 3R5CA 4IDKB 4DZ6A 5L1IA 4YDXA 1U6ZA 1N34F 2E5JA 2MZTA 3V2UC 1S0NA 2XMJA 3RU0A 5CZXA 1S9GA 2NZCA 4KFBB 1EIYB 4CLZA 3GYGA 5CD4H 2W7PA 3RUBL 4NMLA 3NNAA 2HVIA 3IWXA 4NLQA 1RA7A 4RUBA 4IKAA 4WF9Q 2BOAA 3TOQA 3TZXA 3EMTA 3PCOB 2DXFA 3UD5A 2WK4A 1T8EA 3BDPA 5F8HA 3CB4A 2DY1A 3D6TB 3L4BC 2YQ0A 4WKYA 4OZ3A 1RT1A 1KOOA 2RAQA 4OZJA 1ZBTA 3W66A 1RWUA 4LJMA 4X66J 3OTOJ 2ATCB 4QWCA 1TQLA 3UVJB 1U26A 4J9MA 4QOTA 1CEZA 4YOEA 1RT2A 1GXUA 4LRDA 4C8NA 1K9MT 2ZBPA 4U8YA 2MSTA 2ZHBA 1HARA 3B78A 4OI0A 3UO0A 1NH8A 1VQ4S 2B0GA 3HHLA 3NLCA 4F2RA 3ISZA 4ZPAA 3ISNC 1QAJA 2VA2A 4LFCF 2G2YA 3W8GA 3RG6A 2V8PA 3NCPA 4QW9A 5J2QB 2BQUA 1NHKL 4CP5A 4WIQA 1CJKA 1DURA 3O3LA 4NA3A 1F3FA 3S01A 2ZOFA 1PJ5A 2PFDA 3JQMA 1FEEA 3CC4S 1NKEA 1WTFA 2F65A 2BVZA 2LA4A 1PSDA 2VBXA 2CQGA 4XTTA 4M1KA 1IKVA 1KQSR 3HJFA 4O0IA 3POTA 4K4UA 4O3QA 4FKYA 2LEBA 1LV5A 5CYMB 2AJQA 3N4WA 4PXEA 4NXNF 3CDAA 3M8QA 3J7YI 4JI4J 3EJMA 4O3SA 2WSCC 3W1YC 4DL4A 1RLCL 2HFUA 1RBLA 1Q82T 3KG0A 2YKNB 4LR8A 2XNRA 1U0HB 4QQBA 1T0TV 2BW7A 4UY8T 2CYYA 4P10A 1C0UB 3SSSA 2VPXB 3NP5A 4NLRA 1SPBP 3H0PA 3ISND 5F0WA 3VZHA 2DNLA 1SKSA 1SC1B 2FVQA 5LJ5Y 1AXQA 3H4DA 4TY8A 2R4FA 1IJEB 5KT3A 1Y10A 2CWXA 5EWEA 3N9UC 4R8UB 5DG8A 1H3DA 1VC0A 3KK1A 1VFJA 1SKRA 2BE9B 3VAHA 1TFWA 4I1TA 3MR7A 5KT2A 4AQYF 3D7SB 4M5KA 2CPYA 4OIXA 1SJ1A 2N7CA 2XC9A 4MK8A 5M2UA 1WACA 4M5GA 2JC0A 3Q2SC 3BSCA 2EFNA 3I9ZA 4M63A 4C11A 5FDLB 4ZIWA 5DQHA 2JFDA 3JB9k 1N33F 3I5CA 2QTWA 3M32B 3OUYA 4PUOA 1WC0A 3R1LA 3AOBA 3RBDA 1H38A 4DSJA 3BPSP 2ATLA 2Y9HA 5F3TA 2VBWA 1S10A 2OH2A 4TLRA 1VBZA 4HHHA 5LMUF 3A8EA 3V5RA 4IDKA 2QC3A 2AZ1A 2FTRA 1KOHA 2Z56B 4NLWA 3ZZTA 1IKYB 1S1XB 2AJFE 4ALZA 2HK3A 2XSFA 2K1RA 2RE1A 4NL5A 1IQTA 1QVGR 5J1EB 4GVLA 4KHRA 2GQCA 5AXNA 2WVFA 2V67A 2W2PP 4U7CA 2CQBA 4CH1A 1X5SA 1FKOB 3DRPB 4NE9C 4OZLA 4DJBA 4X4RA 5DLGA 1FNXH 2UUWA 1VRTA 3O6QA 3OTEA 4ZLLA 5DGBA 4Q5VA 1JKHB 1YX2A 1AW0A 2V8VA 1QE1A 2FQQB 4JV1A 4KSEB 1S79A 2BKOA 2DCUB 3LPYA 3K5NA 5IM0B 4WE1A 4ZP7A 4Y0FA 4M5NA 4F7VA 2EKYA 1S1UB 4Z2XA 1FK9A 4DQQA 2DRBA 2FHKA 5HANA 3G9CA 3T1YJ 1DHMA 1EKRA 1HPZA 2GHWA 1CC7A 2CQ3A 5HO4A 3HXMA 1S49A 4X65F 1RHJB 4CO3A 2VG6B 3BBFA 3SXLA 2A0FB 3D67A 1FDDA 1IM6A 4PR6A 2XQCA 2ZBCA 4NLDA 4ZPVR 1VI7A 1F2HA 4QYZJ 4KPCA 4CYUA 1S59A 1FFSB 4HT7A 3EXYA 3PIPQ 2KJWA 2RS2A 2HHXA 3M8ZA 1XNQJ 2ZE2B 3SSRA 2XSJA 2HZCA 3IRWP 5F41A 5B0EA 2VASA 1LW2A 1EHWA 2MPUA 3GG0A 4ZJOA 3R9LA 5CCMA 4DV3J 4LF6F 2FJEB 5HLFB 2K2PA 1V6HA 2FJDB 1IBKF 4K50A 4QR1A 1LWCB 3LUYA 2V50A 3FMBA 2YKNA 2DITA 1EX8A 4FXWA 3M6WA 3ZTRA 1EKSA 1R0BG 2AGQA 1C0UA 1JLFB 3C19A 4LSLA 4GC6A 1DZ5A 1KLNA 4JV2A 1FNOA 4FYDA 3VGSA 2HQGA 1VLOA 3DOMA 4NWBA 1HPZB 2BZ2A 3GV7B 3R7NB 3J7Z5 5I3UB 2G2ZA 2KHCA 4B9UA 1IVZA 5ETTA 1IBMF 1WKKA 2W7OA 1EP4B 2XMKA 1DTQA 3W9JA 5B09A 2QEXS 4B08A 4E0DA 4O3RA 1FRHA 1F0XA 4J9QA 1EQMA 2CZ4A 2HNZB 2FGCA 5KG4A 4F36A 3UI3A 4GRSA 1NK8A 4AL5A 1VQKS 2W7AA 3M30B 5GAEI 4G6VB 3HVTA 1LK5A 2AWZA 5BXIA 3U1LA 1MNEA 4I6AA 3EGZA 3IBWA 1HQEB 2OMLA 1FK9B 1HBUA 1NPKA 2C3PA 3CGIA 3TP2A 2B9YA 3CD7A 1FRXA 1HLWA 1RTIB 4NLTA 5D15A 3I6PA 4NCAA 3JTOA 3PW2A 5JVGQ 2HLUA 3IS9A 3HFKA 4OX7A 4ZJQA 3KLGA 4DV2J 1TUVA 5HSPA 1U1OA 2PI5A 1X8DA 1NJIT 2MKIA 1WG1A 3HVRA 2B9WA 1VBKA 2EBGA 2R9LA 2X3GA 5KFOA 3TA2A 3KG4A 3FRZA 5K20B 4B3RJ 2P5VA 3BZQA 1CJVB 1DAXA 1R27B 3LQVA 4CLWA 4U7UD 4X4VA 4NLGA 4F26A 4JI2J 3IAM9 4FP9A 4JI6F 2DNZA 3G6ES 2BV3A 2HVDA 1REVA 3SCJE 2QRRA 1XMOF 1XR7A 5KFSA 4DPXA 1S6QA 4YP3A 1BXNA 3US5A 3T3FA 2LECA 1U47A 1M90T 3ZTOA 1JK9B 1HQEA 3WQPA 5LXYA 1LNQA 1HNZF 2VKRA 1AUSL 3RB3A 2DTJA 2YNHA 2AJ2A 2UV8A 4RW4A 2R8KA 3ZZPA 3Q23A 4USJC 3MR6A 4F8RA 1UZDA 1CJUB 2YWHA 2DNYA 2EW9A 3CCTA 3TNVA 2P9GA 4X64F 1YRTA 5DQGA 3TEGA 4HTIA 1FRKA 4CLLA 5I42B 1HBMB 2W9AA 3RBEA 1WHVA 3HZGA 2RU3A 4CLUA 4RJVA 2XULA 4B9MA 4I64A 3WX4A 2UVRA 4LFBJ 3NS7B 3M1VA 1FWLA 1K47A 1GX5A 1EQ0A 2DCLA 4KR0B 2ZM6J 1N5QA 3D0GE 4G1QB 3TR5A 4DPUA 2JH3A 5BYSA 1H6KX 4FYXB 4YB7A 4ZVGA 2ZHAA 5A2QY 1O8BA 1MMDA 1VRQC 4NLSA 2VJVA 3ET6B 4KGKA 3U02A 3GIKA 4KGXB 1MU2B 1Q79A 1D0EA 2RHSB 3DGVA 4LFBF 1I5OB 1WHWA 2AIRB 4F4KA 3VHQA 5KG3A 3JSMA 3WC2A 3GWCA 2QSFA 1HBOB 5J2PA 3QO9B 5KFAA 1RU2A 3W9IA 3NEKA 1C1CB 1TKZB 3HHEA 4I2PB 3CCRS 1S77D 1HL6A 1SQFA 1YITS 3O1LA 4RW6A 4P71A 3C6TB 4DX5A 4RZRA 4LF8J 4DL2A 5HVGA 3BGRB 3TAMA 3K17A 5KFMA 5EWGA 4KB7A 4DWIA 1U6FA 4USKA 1ROFA 1SKWA 3CCQS 4WK1A 3CDEA 4MKVA 3MM7A 4RBVA 4ICLB 2XI2A 2XYPB 3M8PB 2RILA 3BKTA 4DHVA 3QAUA 3RRKA 5C24B 5RUBA 2WVCA 2AEFA 3JS9A 2MKKA 2YPYA 1NJXA 3R27A 3M32A 1VRUB 2F8EX 4LBHA 3OUYB 3E01A 3B8HA 2VF3A 3PJWA 2GMHA 1RTJA 2DNRA 4CO2A 4JI6J 5A6WA 5C2GA 3CPWR 5AJ3J 5LMNF 3JSYA 1AT1B 1RAHB 3N6NA 2VPYB 3BN7A 1VQLS 4JOUA 1U09A 1Y11A 3M8WA 1MMNA 4C2MA 1IBLJ 2DD8S 1U45A 4IFVA 5B7WA 1HBOA 1NH7A 4FDFA 3A3PB 4QIWD 1VQOS 3SZ2A 3OXGA 3DRPA 3DCAA 2W25A 3ZZZA 1TMMA 2DNOA 2OMOA 4MK7A 4ZJLA 3SSQA 2OPSA 4K4ZA 4DU7A 1LWFB 4ZN3A 4NLPA 4ER8A 3GILA 2G1DA 1RZMA 2IHR1 3QIPA 5C25A 4FZVA 1S1XA 5DETA 2R7QA 3ZZRA 4ES3A 3I87A 5CABA 2KG1A 3HT3A 4CT8A 1QJHA 1K1QA 4KGZB 1RTHA 7FDRA 1VHIA 3KHLA 5F8JA 4B3SJ 1R6YA 1XMQF 3RYLA 3HT0A 4CO4A 3JXOA 2XZWA 4YN3B 5IWAF 3OL7A 1OQ6A 5E3QA 2EFGA 2DVIA 3WZ0A 1H2VZ 1X5TA 2V2ZA 4DEZA 5BJRA 1IBMJ 2HAIA 5L9XA 3TA0A 2QZ8A 5KFYA 4WIIA 4CLKA 1T9XA 3TX8A 2OPPB 2DYAA 4J9LA 4MMOA 4QWAA 2GIFA 4IUFA 2D7SA 3CIMA 5A8KA 1NJZA 4ED4A 1UVJA 2G13A 2CPJA 4IG3A 4W92B 1P9YA 4UF4A 1QAIA 4Y2AA 4K0KJ 4ZCKA 1FO1A 1LW2B 1WELA 1SUQA 1R6VA 4N7TA 1NSKL 1KQKA 2MXYA 4NCBA 3PW0A 1UJ5A 5FLXU 2R8GA 3DOLA 3WX8A 1Z4UA 1PGZA 4HH1A 2VFRA 4DXLA 2OD6A 1RWPB 2ZNYA 3TVKA 2FZCB 1X4GA 1CC8A 2RVJA 3NGDA 2C3YA 5KFQA 5FD1A 3GIMA 2UUBF 3H7HB 2HRTA 5F8MA 3T1AA 1PYSB 2C2DA 4ZPTR 2E5LF 4DR6J 3BO2A 1X4BA 3GONA 3CD6S 1YJWS 5L1KA 2QL5B 4QZVB 2DH7A
chains in the Genus database with same CATH topology
5C25B 1NEEA 1RYSA 1FF2A 2ZUGA 3FQKA 1M5OC 4PWDB 4YY3F 1FEHA 2DNKA 4IFYB 4FF4A 2I0XA 1T94A 2BA9A 1RT2B 4OQJA 1ZM2A 3PRDA 2IVYA 4XPCA 3GG1A 1N0VC 1FE0A 4G1IA 1HA1A 2AYMA 4RWWA 1TKXA 5J2MB 1JJHA 3HHLC 4DG1B 1JLGB 2FJBB 1Y0HA 3BN4A 2RQKA 4ZK7M 1H38A 2W9BA 4YR3A 1IBLF 3BO4A 1JNZB 4WFXA 2AJ1A 1E6VA 5GAEU 1ZZFA 3QJJA 4OHXA 4YHHF 4A8YA 1E6YA 2HVZA 1VC6A 3NMAA 3ITHA 3U7JA 2YH0A 5EN1A 4X4OA 2KXNB 2VFSA 3BGLA 5KFRA 2O1PA 1KQGB 1Z2ZA 3DOKA 4EFAC 3NAIA 2MQQA 3X1LB 4HEA9 3IR7B 1S9GB 1Q53A 3S7RA 5HN0A 4MIAA 2EPIA 1IUJA 1RDRA 1WEXA 1MSWD 1RT3B 4LF7F 1N4LA 4DF8A 2OIHA 1IR0A 1C1CA 1TKZA 2YKAA 4ITSA 2XLJA 3S1TA 2HHSA 4ZP6A 2ZD1A 3PW5A 3OL9A 2I1RA 4QYRA 5JXSA 1UP1A 1JLGA 2HNDB 2VQEF 1VIOA 2OTLS 4B9SA 3DLLQ 4PQUA 1ZPWX 4MKBA 3PKYA 2FVCA 3KTQA 3CJKB 4TYAA 1NKBA 4MTPA 4PRFA 3RRGA 1X4EA 4QPTA 4CNYA 2J0XA 3FZBA 4YB6A 2ZM6F 2LCWA 4F50A 2IAJA 4RNHA 3DRRB 4LVNP 4KAIA 1QSSA 3Q8SB 4IOAQ 3VAGA 2BRLA 5AXMA 2FJXA 2HHHF 1S48A 4NZ7A 1MW7A 3HKWA 1SL0A 4TY9A 3BQ1A 1DBDA 3GMGA 4OZ1A 2JVOA 2WRMA 4A8OA 1HI1A 2AD9A 4MYTA 1HWUA 3GE9A 1H98A 3MEDB 4MAKA 2MHNA 3MM6A 4B9LA 2F1FA 3T19A 2PC6A 3DOKB 2V8HA 2A3JA 2L9WA 4X84A 3Q8PB 2DH8A 3M2VA 1LXNA 3KMSA 1JLCA 4NYPA 2CJBA 3PV8A 2YNGA 3P6YC 1R8BA 2VC0A 2CPHA 4J9RA 2WOMA 3MEEB 3KK2B 3MMJA 2KU7A 2DHAA 2RSQA 4QIFA 5CQGA 3X3UA 4ALZA 3BREA 3E01B 3QGHA 2MQMA 3OVSA 4J9SA 4R0EA 2VOOA 4P2SA 4DV1F 2VG5B 2W4DA 3T9ZA 1TKXB 3H59A 2E1RA 1Q4RA 4XK8C 4UQGA 2MYFA 4F4ZA 1UJ6A 5IQ6A 2V4RA 4URSA 1CVJA 4N8OA 3AA8A 3TANA 1OWXA 4DFKA 2KXFA 4D3HA 1U4BA 3DI6B 4B3OB 3GZ7A 4MKAA 4H4OA 1X9MA 1HD0A 3HHKA 3QZ7A 2CRLA 2LEAA 2B56A 4IR9A 5HMYA 5GADI 4ETXA 2XHWA 3AQPA 4KBIA 1LWFA 2BXJA 4A48A 4M5DB 2JRSA 2XCAA 1H7WA 2AYEA 2GFFA 3M6VA 3OXFA 3M9NB 4HKQA 2F7VA 5DDRC 3UD4P 3AB2B 4TN2A 2RMLA 2LQ9A 2NPFA 1YJVA 4K59A 4RKUC 2EI5A 1H2UX 5J1NA 5I3UA 3VCDA 4QPXA 3DNCA 3OR1A 4JI5F 2RF2B 3M6XA 1YVFA 4N77A 1RI7A 1IXKA 1NKCA 2HNDA 1KLMA 2CVEA 2EG2A 2CQ2A 2WHOA 5L8RC 5KFFA 3FEYB 4H4MB 4AFFA 2WOMB 4FPRA 4ZP9A 1GX6A 5A8WB 2DISA 1BQMB 4J9NA 4LSNB 1VOMA 4U6PA 4HVZA 2LXUA 5MLCV 1R31A 2IA6A 1ZAWA 3KHRA 4DV3F 1JJ2R 2RU9A 4CZCA 1RT5A 3R5BA 3HMJG 4H4KC 3MFHA 4GKKF 1G1XA 2FVSA 2XMMA 3KMQA 4DR5F 4RX6A 2JEGA 2HRUA 1VJWA 3ETOA 4F67A 4WFNQ 3OV7A 1Z1ZA 3NRBA 2D9PA 1X7VA 3QO9A 3IA0A 2FIUA 3TUIC 1Q1KA 3TRGA 2ZH2A 4AL6A 3PX0A 3UR3C 5EUHA 5DDOC 2A2DA 2HWHA 1FA0A 4JI8F 5L38A 2E44A 5GAGU 4L3NA 4I2QB 1SIZA 2R7TA 2AQ4A 4DR2F 5E3CA 1UKUA 2ZBIA 4I4BA 1KR4A 5T14A 1PC4A 1S0OA 1K73T 3CC4S 2C42A 2DGVA 5MAOA 4Y6IA 3HK2A 3MPWA 1NK9A 1KVIA 1U1LA 3GFHA 2W9CA 2Y1IA 2YX1A 2WONA 2V9WA 3LP1A 2HS3A 1RKJA 2POKA 5K14A 2IYIA 1HNIA 2YWKA 3MECA 4Z37A 1RT1B 3B82A 2ZITA 5E5NA 3IC1A 3DMJA 2MQOA 1AFIA 3CJ3A 3EXCX 3PHEA 2BM1A 2VBZA 4RW7A 2IVFB 2FJAB 4DR6F 3TQ1A 1U25A 5A0YB 4F02A 4IH6A 1Q8IA 4FBUA 1HYSB 1LFWA 1VQ6S 4Q43A 4DV5F 5HLFA 1D1UA 1KTVA 2F3JA 2FUG9 1U1RA 3CDUA 3MM5A 2RKIA 2IBOA 3SFUA 4OLOA 4QIGA 4Q8FA 4WFYA 3JYTB 2N7YA 1BGXT 2VZ9A 2HHWA 3SQGB 3JSMB 3FJ2A 2B7CB 3KK3A 1JXEA 1RT6B 3MM6B 5CYQA 3DC2A 1VGYA 3SCLE 3PXGa 1YHQS 3HHNB 2NZ4A 4XPEA 4ECQA 3H25A 4WKRA 3BR8A 3N6MA 3IRXB 2MY8A 2V4JA 4DLEA 2KT2A 2VG7B 4CT9A 5M2PA 3DHXA 2VONA 1BWEA 1KLMB 1P1TA 4CO0A 4ZKAA 5F8GA 3M30A 5G4DA 1HQUB 4Q0BB 1JLAB 2V8GA 1HBUB 3SCKE 1QY7A 5D3GA 3C6UA 3L95X 3MM8A 2ZH7A 1I6JA 3I55S 2GHVC 3WDOA 2KT3A 3MMBA 5DM7Q 4FNHA 5GAGI 1U1KA 2GHPA 4ZDNA 3VTIA 4A8XA 4MFBA 2VODA 3H40A 2BABA 2PFFB 1FHTA 3EPIA 3MPYA 5DO2A 3TI0A 4K4WA 3RAXA 1K0VA 4H4OB 2CPIA 2JOQA 3CO9A 3PY8A 1P6TA 1SJQA 1S0VA 2CPZA 4IYQA 4J37A 2MZSA 4UUWA 4C3MA 2RKIB 1X4DA 3P49B 4I7FA 2LEPA 4RW8B 1ZM9A 3T1HF 4XDDA 3G86A 2XG8A 4Q45A 3SQGA 3D0HE 3G8QA 4Y2IA 3OTOF 3AH6A 2GCFA 3SCIE 4ED5A 3DLBA 4NLVA 4C3LA 1JX4A 2GNKA 3DGPA 5L1LA 2HG4A 1TK8A 3VAMA 1K1SA 2XGQA 3MECB 4IG0B 4AYBD 1U1PA 1HHTP 1JLCB 1F5BA 3M8PA 4WE1B 1YQHA 4F25A 1U6BA 3OHBA 1ZM4A 4DQSA 1D3WA 2MQNA 5KFGA 3G96A 4OJHA 1X4CA 3N28A 2V4QA 1KNZA 3FZ2A 3H98A 1YI2S 3FQLA 2RNEA 2W24A 3TVZA 1N5VA 4NLYA 1W2BR 2GW8A 2W9BB 3KKFA 2N82B 2OFGX 2FGOA 2HFNA 2J0SD 2C3MA 1IKVB 1Q78A 2DGQA 4M8LA 2BE2B 2B3TB 3KLEB 1SL1A 2ASJA 4RLEA 1SJRA 5DG9A 4OV1A 2KI2A 1QUPA 4B17A 4YR0A 4ECVA 3T5HA 3H2UB 2F9JA 1MROB 1VK3A 3DDKA 2RQCA 1U2RA 2DHXA 3PR5B 4OZ0A 1SL2A 1WNEA 3RRHA 2ROGA 5GAHU 2VG7A 1HI8A 3E2EA 1F5CA 4NLXA 4LSLB 5HMZA 4OI1A 1YIJS 3C2PA 3DYAB 3ZZ0A 2BQ3A 4EZ9A 2MQLA 1VS3A 2H5EA 3PEJA 5B0GA 2COLA 2HLTA 4HLBA 4N5SA 3VAKA 3JAMY 2G4BA 2X1AA 3ONQA 3PNIA 5D8HB 2E5HA 4FVMA 4ZHRB 4DQPA 4RWXA 2QMWA 2ZHOA 4XDCA 3KLFB 3SV4A 4A8KA 1KC8T 1N5SA 3MM9B 1U2FA 1M5KC 5CH7B 4NYOA 2XI3A 4DS5A 4J5OA 4RU9A 1DLOA 5KFKA 3KLEA 2M70A 3MUVP 1NK0A 2DB1A 2VD3A 3OFFA 4ECSA 3HX9A 2RS8A 4JI2F 2IFXA 4DBQA 1L3TA 2PMHA 1M5VC 2KTQA 1MROA 2HGLA 4ZOSA