1N54B

Cap binding complex m7gpppg free
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
121
structure length
121
Chain Sequence
b'LKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGFKEGRQYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 80 kDa nuclear cap binding protein
publication title Structural basis of m7GpppG binding to the nuclear cap-binding protein complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 26
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2002-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n54B00
2DGWA 2DGTA 2MKHA 1WI8A 4WFBQ 3VAJA 2M8DB 2CPYA 2X1BA 3BO3A 5GMKa 2KM8B 2OSRA 4QPTA 2CQGA 1W2BR 5LXRA 2MQOA 1P27B 2HGMA 3BS9A 2MJUA 4C7QA 2DNQA 2RQ4A 2VOOA 1X5PA 3MD3A 2XNRA 1SXLA 2D3OR 1VC5A 2DNYA 1X5TA 1WHXA 4BS2A 1HA1A 3CPWR 3VAIA 2DISA 2M7SA 3I55S 3L3CA 2D9OA 1KQSR 1VC6A 1A7GE 2FC9A 2N82B 4TLQA 3R1LA 1UW4A 1HD0A 2XB2D 5GAEU 2CQDA 2LXUA 5EN1A 3CCMS 1M5VC 2QEXS 3PIOQ 2EK1A 2MGZB 4TU9A 2MXYA 1ZZFA 2I2YA 1WEZA 1WI6A 1URNA 2MQQA 2ZJPQ 2F9DA 5GVQA 2YTCA 3CCUS 1WHWA 3G6ES 2CQIA 1DRZA 1U2FA 3MURP 1YWXA 2DNOA 2MSTA 5DDRC 2EK6A 2GO9A 3MUTP 1X0FA 1A9NB 3CCES 1YHQS 1WF1A 3VF0B 1H2TZ 2X1FA 2KYXA 1XN9A 1K8AT 2F3JA 2MQPA 1U1QA 3J7YU 1FNXH 3IWNC 4ZKAA 5LSLA 2KFYA 3CF5Q 2MKKA 2LXIA 1VQ8S 2K8GA 2MQNA 1NO8A 4EGLA 3CUNA 1BY9A 5CYJA 2CQ0A 4WFAQ 1M5KC 2NLWA 2MQMA 4F26A 1P1TA 3B4MA 2CJKA 4QU7A 3CCSS 1U1LA 2CQ3A 2DNZA 4CH1A 2U1AA 5D77A 2YH0A 3CC7S 3P5TL 4ERDA 2NZ4A 1U1MA 2M9KA 3THTA 2DITA 2PE8A 2DGXA 1FJEB 4CQ1A 1D9AA 2E5HA 2MQLA 2RT3A 3G8SA 2MB0B 1KOHA 1PGZA 2MY7A 2AYEA 2KH9A 1RK8A 2ZJQQ 2AD9A 5IQQA 3PIPQ 2RRAA 2DH8A 5IFMA 2L41A 1X4HA 2KM8C 1VBYA 3UCZP 2M2BA 2KHCA 4ED5A 3CTRA 2FHOB 4Y00A 2J0SD 2LA4A 3EGNA 4UY8T 1FT8A 1VQNS 2DNMA 3UD4P 1CVJA 2JWNA 2DB1A 2ERRA 1VQLS 2DNLA 2X1GA 1N54B 3UCGA 2VONA 3UWTA 1U6FA 2N7CA 5CXTA 3CC2S 2RU3A 2K3KA 1U1PA 2MKIA 2CPFA 2U2FA 3CMAS 1VQKS 2KG1A 4YB1P 3H2UB 1VQ9S 3G9CA 1OO0B 2J8AA 1X4GA 2LEAA 1YJ9S 4CIOA 1VQ7S 2J0QD 1WHVA 3NNHA 1UAWA 2MYFA 1QM9A 1X4FA 2M52A 1R8PA 2CPEA 2DGVA 2DNGA 5DM7Q 2JRSA 3TYTA 1FJCA 1X4BA 2DGOA 2XS5A 2WBRA 1Q86T 2MHNA 2MGZA 1UP1A 4A8XA 4QQBA 1JJHA 1UFWA 1F9FA 2MZQA 2CQPA 1KC8T 3S7RA 2CQBA 1U1NA 3UCUP 4M5DB 5IM0B 2RUGA 3VAGA 1VC0A 4IOCQ 2JX2A 2HVZA 1QVGR 2KN4A 2MKJA 2G0CA 2OIHA 3VALA 3TO8A 2I38A 4WF9Q 3S6EA 2MKSA 5LJ3Y 2HZCA 5HL7Q 3DXBA 3MDFA 2MSSA 2MJNA 4TU8A 2LQ5A 1VQ5S 1NJIT 3CCLS 2LMIA 1X5SA 1YI2S 1KD1T 2HYIB 3MUVP 1FJ7A 3SDEB 2CPJA 4Y0FA 1YTYA 2M88A 2LA6A 1M1KT 3HI9A 4F02A 2UP1A 2QFJA 2KG0A 1U1RA 1WWHA 1WG5A 3JB9k 2M8HA 2KRBA 4Z2XA 5BJRA 1DHMA 1FXLA 1WEYA 2V94A 1YJWS 1OPIA 3LPYA 2DNHA 3CCRS 2XS2A 1Q82T 3SXLA 2O3DA 2E5JA 3P3DA 2DO4A 3CCVS 1YJNS 2ADCA 1U1KA 1FHTA 3CULA 4YUDA 2EVZA 2KXNB 1L3KA 1SJRA 2KXHA 1RKJA 1G2EA 1VBXA 1WTBA 2MY8A 5GAHU 2RRBA 1YITS 4WIIA 2OTJS 3HHNB 2DGUA 2HGLA 1IQTA 2MZJA 1VBZA 3K0JA 2DHGA 1X5OA 4PKDB 5DETA 1H2VZ 4IOAQ 1SJFA 2KI2A 1VQOS 2DK2A 1O0PA 2RVJA 1PO6A 2VODA 4QU6A 4W90B 3Q2TC 1NU4A 1WG1A 2D9PA 3R1HA 3MUMP 3I56S 2CQCA 4PRFA 3N9UC 2J76E 2DNNA 1HL6A 3RW7A 2AYGA 1H6KX 2DGQA 2CPDA 2OJ3A 2DNKA 3MXHP 4RU2A 1OIAA 2M70A 3VAMA 4UQTA 2CQHA 2DH9A 1ZH5A 5JVGQ 5IM0A 1U6BA 1B7FA 1WHYA 4PR6A 4P6QA 2DHAA 2YKAA 1WELA 3MD1A 2MZRA 4F25A 4TU7A 3NS5A 5DDPC 1DBDA 5LXYA 2DIVA 2CPXA 2DIUA 4CH0S 2AYBA 1M5PC 3VAFA 3NNAA 2XS7A 3VAHA 2JVOA 5LJ5Y 2ADBA 3MI7X 2DHXA 4W92B 5DDOC 4C4WA 2G4BA 2LECA 1K9MT 1X4AA 2M0GB 2DNPA 2A3JA 3THPA 2MZ1A 3SDEA 2HGNA 2SXLA 2JVRA 1X4DA 2MZTA 2M4MA 3EGZA 2OSQA 3CXCR 2DNRA 4IUFA 2MMYA 1H2UX 3NS6A 2F9JA 2DHSA 4FXVA 3EX7B 4YOEA 3G71S 2FY1A 1M90T 5CA5A 3VAKA 5JVHQ 1S72S 3DLLQ 5ITHA 1WF2A 3U1LA 1R8HA 3NMRA 1N8RT 1YIJS 1N88A 2CQ4A 3RW6A 2DH7A 4OZ1A 2LCWA 2FPHX 3MOJB 2CPIA 5H1SV 4J5OA 4C0OC 1VQ4S 2XNQA 3ULHA 2B0GA 1SJ3P 1K73T 2G1DA 1DZ5A 1OWXA 2CPHA 2DGSA 2CPZA 2Q79A 5HO4A 3V4MA 4FXWA 4WCEQ 3SMZA 3FEXB 2YH1A 3FEYB 1Q7YT 3CMES 3Q2SC 3P49B 2RQCA 1Q81T 1U1OA 3D2WA 1VQPS 2FC8A 4U67Q 4OZ0A 2KXFA 3G4SS 3ZZYA 2CQ1A 2MZSA 2E5IA 3G8TA 4WFNQ 1D8ZA 3TP2A 4LIRA 3UE2A 1JJ2R 2GHPA 3BEGB 4IO9Q 3U1MA 5GAGU 3LQVA 5D78A 1FO1A 2BOPA 1S79A 1HD1A 2KRRA 2N3LA 2L9WA 2QA4S 1N52B 5DM6Q 3NNCA 1X4CA 2AYMA 2BZ2A 2X1AA 3S01A 3G96A 5GADU 2MKCA 1X4EA 1WG4A 3OW2R 2DO0A 3S8SA 2RS8A 1KOOA 1SJ4P 2XSFA 5MLCV 2LEBA 3CC4S 1QVFR 1VQMS 5DDQC 4LJMA 3IRWP 2KT5A 2E44A 3P6YC 3BO4A 3B4DA 1JMTA 2MPUA 3ZZZA 4WKRA 4LMZA 2LKZA 5FJ4A 1WEXA 3US5A 1WF0A 5LSOA 1JJ4A 3BO2A 3H2VE 1VQ6S 1SJQA 2PEHA 3J7ZT 2LYVA 3R27A 2E5GA 3CCQS 2KVIA 2RS2A 2KU7A 4V19X 3CD6S 2YWKA 1M5OC 2RNEA 2N3OA 2VOPA 2CQ2A 2L08A 2ZJRQ 3UD3P 3CCJS 1ZZNA 1AUDA 2OTLS
chains in the Genus database with same CATH superfamily
2Q3PA 2ZKUA 5C25A 4H4OB 5B0EA 2X1BA 2B5JB 5H9FK 3L7PA 4JYAF 2KM8B 1OYDA 2B4PA 3FJ2A 4U7UD 4DUZJ 4K5RA 4J9QA 1YGYA 1WHXA 3I5AA 3W9IA 2M7SA 4EYHB 6FDRA 2N82B 1R8CA 2AT1B 3C6UA 4TLQA 2M3DA 1YLXA 3OSNA 1FRLA 2CQDA 4NA1A 4M8LA 1URNA 2RF2B 3CCUS 1YJ7A 3OBIA 2QE5A 1U2FA 5IC6B 4B3OA 3P8BB 4PWDB 2F3JA 2MQPA 1RAIB 1S9EA 5GAEI 5ETLA 1Q8IA 1UW9A 4LF5J 2I1RA 3GYGA 3I4HX 3DU6A 2ZWOA 3D3BJ 7FD1A 1RT7A 2VG5B 3WBZA 4Q44A 2F4VF 2PE8A 5KG1A 1KOHA 1UJ6A 4ZK7M 1QY7A 1WD6A 3LP2B 2KM8C 2C3YA 4ED5A 4Y00A 2VG7A 2LA4A 2JWNA 3W64A 4RR5A 4UZBA 4IDKB 1KONA 3SQGA 2GQQA 3H2UB 4H54A 2R42A 1WHVA 3D54A 1FJCA 4ZA1A 1X4BA 2NUUG 1O5JA 3GIIA 1HKAA 4FKXA 3ILJA 2D1CA 3CJ3A 2ZHBA 3D0GE 3OL6A 4GVBB 4DV0F 3Q0AA 2R8KA 3AODA 3TO8A 3R5JB 1TAQA 2OAUA 4RBUA 1XNRJ 1FRJA 1L3VA 2ZE2B 2OEMA 4IOBA 2A0FB 3LP1B 3SDEB 3DYAB 3T5JA 3HI9A 3HVAA 4ECXA 1KVIA 4RW6B 5KFHA 4EFAC 2VICA 3HLUA 1SQEA 5JXSA 4U7UK 1WEYA 2FGOA 1F9HA 4L3KA 2E1PA 2YPZA 1DURA 3P4UB 3D0IE 4O0IA 4DR2J 1WKLA 2AV5A 4ZOSA 3FCWA 4F67A 4YFUA 2LQJA 4GKKF 2WONA 3DLKA 4ZLJA 4J9SA 2FLNA 5F3ZA 2OTJS 1B0VA 2HGLA 1IQTA 1NPKA 1X5OA 4GKJF 5DETA 4IOAQ 3MM5A 4OYZA 3R1HA 8RUCA 2HG4A 3ISNC 2CQCA 3OPKA 4HT5A 3HDSA 4N77A 2AYGA 5ETPA 3FK4A 3R5GA 2GZOA 4TN2A 3TARA 3KXDA 2VZ9A 2DHAA 2ZH1A 4MIAA 1FI4A 4UT4A 4DUTA 4U7CA 1FFSB 3GR1A 4X4NA 4NLUA 3NNAA 2MLZA 1XIQA 4WE1B 1TKTA 2P9CA 2XLKA 1M5SA 4MKAA 3AFGA 2MZ1A 4C8KA 1F2HA 2YNIB 1S99A 2UUTA 3ADAC 3EGZA 3ILOA 2A1BA 1H2UX 1F3FA 4YOEA 3TI0A 1IXKA 3HJFA 4LF2A 2F1FA 1ZAXA 3R7SB 1VS3A 4USIA 2LCWA 4GC6A 4V1Ak 1UWBA 5H1SV 1VQ4S 3EZUA 1RTDB 3M8QB 1SJ3P 1K73T 3PNIA 4NRUA 4USJC 3CJSA 2RQKA 3JAMU 2L3MA 3FEYB 3W62A 3NWRA 2W9BA 1NDKA 1U1OA 1LWCA 2E5IA 3TP2A 2DBBA 3E8OA 8AT1B 3Q89A 3BN7A 4J9MA 3N28A 1BQNB 4PPZA 3ILIA 3WX8A 2BE2A 4ECQA 3RUBL 1WEXA 3FSXA 5F41A 5KFZA 1RHMB 1BGXT 3TAPA 4QCLA 1JLBA 2HWHA 1KP6A 1HI8A 4OZ2A 2M8DB 3T5KA 3CJKB 2EEYA 1UA0A 4FN5A 1P9QC 1N32F 4HTIA 2EFOA 2DNYA 1X5TA 4BS2A 4QWCA 4AUKA 1D8YA 3JTNA 3GWCA 5DRKA 1JLCB 4DQSA 3HKWA 3Q8SB 2EBEA 5AXMA 2I5JB 2ZEJA 3PR5B 3I9ZA 2XMTA 2WVFA 4UZCA 2R7RA 2WZ1A 1F2GA 1WEZA 4DPXA 1S1WA 4R5PA 1IWAA 4DV7J 4I0WA 1U02A 2Z57B 1JLEA 4LRFA 4ED1A 2B9XA 4YS2A 2R7OA 4KHMA 3HO1A 1BQMA 5AJ3F 2H3EB 3OHBA 1NO8A 4ZJQA 4DR6F 2HHHF 2WVBA 4ED6A 3BGOP 3M2VA 1TKXA 1GAOA 4CH1A 3GJRB 1FNOA 3FBFA 2DCUB 3J7YI 2VFVA 2DGXA 4DBQA 2PI5A 1CULA 1UZHA 1CC7A 2AD9A 4N8OA 1H72C 3PIPQ 2DH8A 2DHHA 4ZP6A 1TMMA 4ZVTB 3AJ2A 1APSA 1NK4A 3UD4P 3GIRA 1R0AB 2RHSB 2RHQB 1S9FA 2W8LA 3KTQA 3RB3A 5F8LA 2J8AA 2NSCA 2AMCB 4I4BA 2YKOA 2GIRA 1N34J 2OI2A 3NKYA 3CJ5A 2WBRA 1UP1A 4IKAA 1J5OB 2APOA 2NXCA 2ZBIA 3QQCD 1E6YB 1KQKA 1JLQB 1SQFA 2G0CA 1JNZB 1YDLA 3T6JA 2FVSA 2MEWA 1IKVA 2YX1A 4X65J 2L9NA 3FBCA 3EPIA 4FP9A 1CS4B 2EWHA 3HZEA 3HVWA 2DRBA 3KNGA 3MMBA 4KO0A 5HI7A 2EKYA 3JTOA 4C0BA 4ECWA 3V6JA 1EKRA 2JLFA 3S1TA 1D09B 2DO4A 2ALYB 3CCVS 4I2PA 1YJNS 4DV2F 1N6QA 4MJKA 1QDUB 3SQOP 2B4VA 5IT9Y 4J9UE 3PYFA 4ZHRA 3OJSA 4KR0B 1K0TA 2MY8A 2C2MB 3W65A 4DI6A 3PCOB 5SUHA 1B64A 2DTJA 2J9DE 1VQOS 1DLOA 5K9FA 4QWDA 3MFIA 4W4MA 3ZZUA 1NU4A 3SCJE 3DRPB 2HIYA 3TZYA 5K5MA 2YKMB 2V2ZA 2HNZA 1NXIA 1UKUA 2YKAA 4X4OA 3T1YF 4A8QA 2VASA 3Q8UA 3DN9A 1DBDA 2HWIA 5KT3A 1M5PC 4CO4A 3C14B 3MPUB 3V4IA 3C66A 3GIKA 3CNQP 3HHLC 2DNPA 2HAIA 3ZTOA 1Q1KA 3M2UA 3TUZC 9RUBA 5K8NA 2F63A 1RUSA 2IM1A 1HLWA 3VVTA 4JYAJ 3SCKE 3MGJA 2B43A 2V2KA 2XZDB 5DJBA 3MAAA 1FWKA 2JFDA 1OWXA 2WVEA 3G8QA 1FRXA 5DG9A 2YX4A 4JV2A 1FK9A 2W2PP 1BHNA 2AQ4A 5I4MA 4Q8EA 4F7VA 4I6YA 2GW8A 2XYGB 3OW2R 2E1CA 1NHKL 1AZSA 1FRKA 1QVFR 1VQMS 2GQCA 4DF4A 3I31A 1V6HA 3LF0A 1UFKA 2DEIA 2FHKA 3US5A 2PIIA 1QTMA 2GX8A 3K5OA 1RHJB 5LT5A 3R27A 3C8YA 3NGTA 8ATCB 3PW4A 1M5OC 1SJ1A 2CQ2A 1ZZNA 2V34A 1ULRA 3OL8A 3I82A 3IM9A 4J9KA 2F4VJ 1VIXA 3HHKA 3DDIA 2XI3A 2OPPA 1D0EA 4I2QA 4Z37A 4KHPF 1RTHB 4FKYA 2AEFA 1VC5A 4ZVQB 4DLEA 4Q0BA 1HBOB 4CNYA 2G2ZA 5HQMA 1YG0A 5B0BA 1NK5A 1VMBA 3DGVA 4DHVA 1VLYA 1M5VC 5HJYA 2EK1A 2MGZB 4DG1B 4NLWA 2R4FA 3AY0A 2I2YA 1D9FA 2CNKB 4M5GA 4KGZB 2RUSA 1KR4A 3QMQA 5CCMA 2VB6A 2X1FA 2C2NA 3QGPA 4DDFA 3E3XA 4DF8A 3BGRB 4ZJLA 3AJ1A 4DV0J 3UDLA 3OTOF 1HNVB 1OSCA 4J9PA 3MM8A 1AUSL 4NLVA 3SSQA 4XAKA 3M30A 2MLYA 4M5MA 5ETKA 1U1LA 3VV2B 3M8WA 5LSRA 4AXIA 4LSNA 1I6JA 3H5XA 3LUYA 3MECA 5DGAA 1FJEB 1H74A 1IQZA 2JEFA 4QYZJ 4X4UA 3G82B 1SC3B 5D3GB 2V6AA 1GTEA 1FXDA 3UCZP 2J6TA 4DQIA 3MEKA 2FHOB 2IRUA 2K7JA 4LF8F 1FDAA 2XMMA 4K50A 4UW2A 2J0XA 4TNOA 3D1OA 2N7CA 3B54A 3TANA 2MKIA 4I1TA 4GKKJ 1REVA 4I56A 4NLSA 2HHTA 2LEAA 1LW0A 4NI2A 3E51A 4ZVFA 4ZPCA 4GKJJ 2CPEA 5DM7Q 3K8VA 3LO3A 2DGOA 2MHNA 1PIEA 3CW2C 2CQBA 3H5UA 3UCUP 4TVAB 2AGQA 4OJ3A 3ZTRA 5B0CA 3BDPA 3R2DJ 1EJ7L 4DS4A 1P6TA 2QLFB 3OJUA 3KLVA 5KFXA 4K7QA 1KD1T 3M6VA 3HSGA 1KFSA 1XMOF 4ZPAA 2R7UA 4A47A 4DCPB 2B9YA 2M8HA 4MTPA 3K58A 1BE4A 3JYTA 1OPIA 1IKXA 4C8MA 3DLBA 1Y5NB 4HT7A 4HTJA 3RBEA 3ONQA 3PY8A 2A2DA 3HPOA 5I42A 3PKMA 2ZOGA 4IQXA 4QYRA 2HFOA 1RTIA 4OI6A 2DR9A 1WJ9A 2DK2A 3J81j 1HNIA 2JEIA 2HNYB 4ECRA 3Q2TC 3MUMP 3UN5A 5EWFA 2EFPA 2DNNA 3M8YA 1RLDA 1R6YA 2K1RA 4RW4B 2CZ9A 4ZN1A 4A8KA 3G6VA 4OX8A 1Z4UA 2E29A 4LRBA 4ZPVR 1WELA 4KH1B 2IAJB 1VRTA 1T9VA 4CH0S 1BQXA 2HHPA 1CPZA 4M94A 3ISND 1S77D 4WPAA 3AJDA 3B78A 2MDAA 2WOMA 3R6LB 3J80Y 2MZTA 2M4MA 1LKZA 1R43A 3R5DA 2JSXA 1SB6A 4FXVA 2XM3A 3EX7B 1FE4A 2Q43A 2UU9F 1VYAA 1R8HA 3CCZA 4AD6A 1Y3JA 4B17A 1N32J 3KHRA 4BWMA 2XNQA 3Q24A 3KK3B 2G1DA 5KFQA 5KOWA 3KMSA 4WCEQ 4FXWA 2R3VA 2J9CA 3A8JA 4EK2A 1NEEA 4DL0C 2QLWA 2XSJB 2OD6A 2CVEA 1JJ2R 1MMLA 4WFZA 1ACMB 3ET6A 3QSYB 3HMJG 5DM6Q 4IH6A 3LGMA 2DJWA 3CDEA 1SV5B 2J7WA 3IS9A 3OR1A 3ZZZA 1SL1A 1S7HA 1RQ0A 3AQOA 1EARA 1S7IA 5LSOA 4DR6J 4KH0B 2HHHJ 3C15A 3EXCX 1TV6B 4FPIA 4QR1A 4C0HA 1TUWA 3QLHB 1IBKF 1Y0HA 2VFUA 2DGWA 1WI8A 3NGKA 3SCLE 1JB0C 5LM7E 5C42A 1JNRB 2VBWA 4X4SA 4DU8A 3PZPA 3CMQA 5L1KA 2HQGA 3I55S 2GQ2A 3HVTB 2E1AA 2D9OA 2KHDA 3ENAA 2BE7D 1VK3A 2MXYA 2HS4A 1A0OB 2WHOA 2Z2LA 4WYLA 1CJUB 3PV8A 1KFDA 4Y2MA 1WHWA 3ZTSA 3MAHA 3PRVA 3CCES 4UQGA 1WF1A 2BABA 4ZVHA 3D66A 1FJGF 1RT6B 1RAAB 3MPYA 5K8OA 4J9LA 3MCSA 1UEUA 2V8HA 5I3QA 1S1VB 2MKKA 1IKYA 4NXMF 6FD1A 4ETXA 1KNZA 3CD7A 3EZ5A 1VRUA 3ITHB 3M05A 2WSEC 1IBCB 4JI8J 4EU0A 3TZZA 3A3NB 4OI2A 3FZ2A 4ECVA 5IFMA 3QJLA 5FDLB 2FJWA 1M1HA 4ZCKA 4ZVEA 4R8UB 4OIXA 4OV6A 4DV2J 3DRRB 1C0UB 4YB1P 2UVRA 2BOAA 4Q7AA 1RABB 4P74A 4DL2A 3IMQJ 2VQEF 1F5AA 3HF5A 4K0KF 2QX0A 3NP5A 2UXDF 1QM9A 1X4FA 2NPFA 3SSSA 1HBNB 1KC8T 4QR0A 3QJPA 3UQSA 3GFXA 3OLAA 3S6EA 1VJQA 5L9NA 4CYUA 1RT1B 2KFZA 2OPRB 3T1YJ 2MKYA 3T9ZA 3CCLS 2N7YA 2VG6A 4OYXA 3M9MB 3EYZA 5J2PA 4KFBA 3LW5C 1WWHA 4DPOA 4I64A 3IGNA 4MIWA 3TJAA 2QMWA 4DOZA 2GVDB 1NZ8A 2V94A 4DQPA 4A48A 2UUCF 2BJ8A 3LA0A 3GIJA 1H98A 1KLMB 2ZBQA 3CCRS 1IR0A 4DV5F 3SXLA 4DSKA 4P75A 2W7OA 4IYQA 3HX9A 3GU0A 2CDRB 2ZVIA 1G6BA 2IC3B 1LWFB 2HRTA 2KXNB 2O01C 3LH2S 4BWJA 3FFIB 2DGUA 2WVCA 2BM1A 4ZVRB 2RJZA 4NASA 3MF5A 4OYIA 2KI2A 1S6PA 2KO1A 2FY8A 1HQUB 1PO6A 2IMOA 3DOMA 2VA3A 2IPOB 1IBLF 4NPOA 2J76E 1WC1A 3MXHP 1UVJA 3T1HF 3ZTPA 2XMUA 5IM0A 1FKOB 3KLGB 1F3VA 5HANA 2HLTA 2N4CA 3TAMA 1RCXB 3IG1B 1RWNB 1QAIA 4OL8A 3ICLA 4USWA 2JVOA 1AFJA 1HBUA 4NWBA 1C1BB 3RGIA 2R2UA 3NAIA 2NXJA 3RB6A 3RAQA 3JTPA 4ZVPB 2I0XA 2HQIA 3MR2A 5GMEA 3KUHA 1NDPA 2RB7A 3GR0A 4ID5A 2XHCA 4H4MB 2KTQA 2W2NP 4YY3F 5IV4A 3I0RB 3RW6A 3SEOA 1TKZA 4KHPJ 2V2QA 4ANDA 2LXFA 1DQ9A 1YJUA 4USMA 3Q8RB 2DGSA 2E5LF 4PXBA 4A8MP 1N0UA 4IRDA 2RQCA 2B51A 3GLJA 4OZ0A 5IV3A 2KXFA 1VHIA 3HJVA 3KLEB 3UI3A 5C24A 1HWKA 1HD1A 2KRRA 3T5LA 1B0TA 1QE1B 5MLCV 2NYHA 1SC4B 1P9YA 3P6YC 1RE1B 4CH7A 5I3UA 2HVIA 1YVFA 3OTOJ 3BR8A 5F3TA 2LDIA 2FHMA 2ASYA 3CDAA 2JNJA 1ZTWA 4JOUA 2G1HA 1ZA1B 3VAJA 1HWJA 2VPXB 4LBIA 4QPTA 4ANCA 1W2BR 4C2MA 3BS9A 3AB2B 1R27B 3FEZA 1OYEA 3DOLB 2XG8A 3AOAA 2XLJA 3SIPB 5EHHA 4CLLA 4IFYA 4KT0C 5HP1A 1TL1B 4LF8J 3LANA 4DSIA 5IZHA 4OZ5A 1ZTTA 1WTFA 4RX6A 3K5PA 5CZXA 5GAEU 3PIOQ 2OP5A 3BSCA 3EDRB 1RWKB 2ZJPQ 2O66A 2D74B 4C8OA 2CG8A 4MKVA 4ER8A 1DRZA 3O5TB 3P45B 4HACB 1A9NB 2J8SA 3H5YA 1XN9A 2J7UA 1SH3A 2C3MA 3EM1A 4OX6A 5E41A 4WKYA 1YK9A 2VFRA 4DR3F 2KFYA 1MN9A 3L7OA 2EBGA 2HQCA 1VIOA 4TXSA 4J9OA 5DG7A 4HR2A 1J2VA 3RAMA 3T19A 5D0GA 3POTB 3QGGA 3CC7S 3KHLA 3I5BA 5CYMB 2M9KA 1O6XA 2YKNA 5HVGA 3G8SA 3C6TA 1WC3A 2KH9A 3UVJB 4M5LA 5F8HA 4DU7A 4JI2F 1TMJA 3QWPA 2IA0A 5HROB 4I69A 4CO1A 2YWHA 3UNGC 1CJVB 2K3KA 4QW8A 1O8BA 4DX6A 3MMAB 2PFFB 2C2ZB 4IRKA 3OV7A 4CIOA 2YKPA 4TKTA 4MAKA 3KNAA 1T95A 3QJJA 1U2RA 3EZOA 5B0FA 2XYHB 1U24A 1JJHA 5E3AA 1N5YB 1N36F 1S1UA 1S6OA 4ZVGA 1LK5A 2NXUA 3EGVA 2E9RX 4NLDA 3H90A 4OI3A 2D3O1 5A8KB 2XZTB 2YWWA 4DL7A 2OHDA 2J7KA 4Y0FA 2OFHX 1YTYA 3JB9k 4QIFA 1AW0A 3D6HB 1S1XB 4MKBA 2H4YB 2HFSA 1Z1ZA 2LLZA 4LF7F 2ATLA 1C0TB 2W4PA 3M2RA 4LSLB 4X4QA 5KT4A 3LP0B 2DKOB 4KGXB 3DLEA 2CNOB 2UU9J 3FSYA 3TUIC 4XPEA 1RKJA 1G2EA 3IC1A 3QIDA 4WIIA 2CKWA 2IVFB 4LR9A 2EXUA 1S1TA 1NDLA 3AD8C 2QN6B 3A13A 5EDWA 4QZVB 1R31A 4F4XA 1X9WA 2BW2A 1EAYC 2VBXA 3BKFA 2V8GA 4CDIA 1C1CA 3J81U 1LW2A 3RW7A 2OJ3A 2QA4G 2DNKA 4G1PA 1U49A 1IUJA 2QYCA 1U6BA 4JV1A 1RYRA 1I5OB 1G7CB 3N4WA 1FKPB 4C9DA 2ZH3A 3OFGA 5C2GA 2CPXA 5CZVA 3U02A 1Q5VA 2YQ1A 4LF1A 3MI7X 5T7LA 5DDOC 2G4BA 1K9MT 2AZ1A 4OI4A 4KRWA 5HLFB 5C25B 2OO4A 4OZJA 5LMNF 1NK6A 3UDEA 9ATCB 3KJNB 4ZVOB 2W9AA 1B70B 4X4TA 4JI6F 4X4PA 3BPDA 4TQSA 4G3IA 3JQKA 4OJHA 2FPHX 2I9SA 4OJ1A 4Y2IA 1R6VA 3C6UB 5F8JA 4AL5A 3NCQA 5HATA 3GFHA 1LFPA 5ETMA 3D28A 1EP4A 3SMZA 1YBUA 5AE2A 3D6TB 5HQ8A 4F2RA 4A46A 4K4VA 3I0SA 1Y3KA 4FYYB 4HYKA 2GHPA 1SKSA 3OTCA 4IO9Q 5D78A 4B3OB 1G4CA 3NGRA 1UVNA 3PKYA 1SUQA 3AA9A 1TK0A 1S9EB 1X4EA 1DTTA 1YBTA 2VA2A 1TL3A 1FJGJ 3DC2A 2HRYA 3CDBA 3QRQA 3FMBA 2E44A 4ITSA 1JMTA 1MNEA 4DMZA 4NXMJ 2NUHA 4P2MA 1Q5YA 2PEHA 4A8FA 2BR0A 1RT7B 4Y34A 2KVIA 2RS2A 2L08A 2Y8YA 3UD3P 3FSIA 5GMKa 3GZ7A 4NA3A 1FFGB 3PRBA 4EUVA 2VG7B 1P27B 2XCAA 4B3SF 2RQ4A 3QRRA 3I32A 4Q45A 1S0VA 3SQGB 1OY8A 1I3OB 3IBWA 3MEGA 5K20B 2DISA 2YY3A 3DU5A 4JI0F 1NAQA 1UVMA 2G0JA 1HD0A 4HHJA 1KTQA 1WI6A 2VQEJ 3MR7A 5ETRA 4B02A 2BRLA 5SZTA 4K0KJ 4LVNP 2UXDJ 3QAEA 4UOHA 3L7UA 4TYAA 5IS2A 2R8HA 4RBTA 4QIWD 4Y6IA 4RU9A 2VL1A 2X51A 4O3NA 2FHJA 1U48A 3J7YU 2GS8A 2GVZA 3IWNC 3O44A 2X3DA 3D4JA 3CDUA 1M5HA 4EMDA 1P1TA 3QO9A 3K5LA 1F9EB 3C3LA 2KKHA 1JXLA 1WNEA 2GIQA 4ERDA 2M5YA 4NLYA 2PMZD 3THTA 2CXEA 2MB0B 4LFCF 5CCLA 4DPUA 2PSZA 2UUCJ 2UZAA 4XDCA 1VBYA 1BUXA 1PAEX 4DV5J 1LWXA 2WONB 3DLKB 5ETNA 1U6FA 4OHWA 6AT1B 2U2FA 1VR6A 3MM5B 4MYTA 3HT0A 2E1RA 1HNZF 1CJTA 1NSAA 4NL5A 1GMUA 2DYAA 3Q22A 2ZKTA 4UOGA 4RNMA 4DFKA 1IBLJ 3PW2A 2XMWA 3T1HJ 1DTQB 2HHVA 1MN7A 3OUYA 4XO0A 5KFMA 2XZWA 2VV5A 4TU8A 2C28A 1TKTB 1X5SA 2BJEA 7FDRA 1FRMA 1S10A 4YB7A 2Z2YB 1TP7A 1FX4A 4NCGA 3Q83A 1Y4ZB 4MYUA 5E33A 1DHMA 4J9RA 3QFWA 3PG9A 4R25A 3DGPA 1VHFA 2R7TA 3KHGA 3K17A 1UWBB 5JUMA 2R7VA 3BYPA 2LP4A 4N56A 3M9OB 4YY3J 2EVZA 1T0TV 2E7XA 2FHJD 4PZVA 5K14B 4GO7X 1K47A 2AEJA 2RRBA 2W9BB 4ETZA 1NKCA 1VQSA 2GMHA 1EQ0A 2AZ3A 4KTQA 1LWCB 2HBYB 4DLGA 2E5LJ 1CQMA 3NBPA 4C98A 1U8WA 2ZH7A 2XEXA 4W90B 1RJJA 4ZMMA 3BGLA 4ALZA 3V5RA 5J1EA 3UN3A 3QFHA 3HULA 3R2CJ 1B0PA 1H6KX 2HFVA 3N5BA 4ZPDA 2V8PA 3VAMA 4UQTA 2CQHA 4WP9A 1NJZA 4MH8A 4Y2KA 1WHYA 2BE2B 2QT7A 1YJRA 3HZGA 3IRXA 4WU2A 4NXNF 4CLKA 3BGFA 2GV1A 4U6PA 1LXNA 4EZ9A 3T1AA 3VAHA 1JLBB 4C4WA 1EETA 1MMNA 2XBPA 2D69A 1CEZA 4DX5A 4ZLLA 1UTAA 5BXIA 5HK4A 1HHTP 4ECTA 4K4WA 2CIMA 4B9SA 5T41A 3I4PA 2BV3A 1S72S 3DLLQ 4KE5A 3D68A 5ETVA 2R7XA 4AYBD 1CBKA 1RWOB 3KK2A 4BHQA 1OY6A 3MOZA 2V68A 3IP0A 4C97A 3MEDA 4B9TA 2BW7A 2FC8A 1S1WB 4R5PB 4FYDA 4O4GA 4DZ6A 3LAMA 2BOPA 1JLEB 2GO8A 2HMIA 3AXKA 1RA7A 3NCRA 1RZMA 1SVDA 4EBDA 4FDFA 1NSQA 1BQMB 2P2CB 2HQDA 2XSFA 3LWMA 1YJTA 2ILZA 4C11A 3M2VB 1TKXB 2CJ9A 2ZVSA 5CYQA 4DR3J 4C8YA 3H4DA 5KG2A 2HK2A 1RTJA 2B6AA 3MMJA 2AJ4A 1EHWA 2PMWA 2RNEA 4LR7A 5RUBA 2C2RA 2EFNA 1CULB 1JLQA 4ED0A 3QGHA 5E7OB 2E9ZA 4C8LA 2FB0A 4N5SA 5LXRA 1NNDA 2MQOA 4M5KA 3BBBA 4G6VB 3HHLA 4JI2J 1N48A 1SIZA 5M2UA 3VAIA 3MAQA 3OTDA 1QTNB 2WSCC 2L48A 3ZFVA 1TL5A 2AEMA 5EN1A 2CNNB 1HNXF 2R9LA 4F50A 4CLWA 1TZ0A 5D0EA 4DV6F 4NX9A 3GQCA 3C19A 1N36J 2V4QA 2DR7A 1HPZA 3CF5Q 1FVSA 1I1GA 4B9UA 1KQFB 4F26A 1ROFA 2CJKA 2V4JA 4HHUA 3WZ0A 1SH2A 4ZPWR 3MMBB 4KO0B 3M8PA 3P5TL 2DXDA 4WZMA 1RBOB 4UF4A 1OY9A 1LFWA 1Y00A 2YVSA 2DITA 3VQSA 2MQLA 1PGZA 4HEA9 2X7IA 4I2PB 4RZRA 1N6QB 2RRAA 2HFZA 3IR5B 2B7CB 4LF7J 4ZHRB 3CTRA 4USKA 3L95X 3NGUA 2DB1A 1MROA 4PEOA 4F0MA 2C2KB 1IJFB 4LFBF 3GCWP 2KG1A 1IKWA 2CVIA 1LXJA 5KFCA 3BYRA 4RPFA 4DPTA 1Q86T 1U6ZA 3EPGA 2MZQA 2XHWA 3IBCB 2HNZB 3UFCX 3M32A 2RUGA 2WSFC 3G87A 1S9GA 3P5BP 4USVA 2OELA 3FNNA 3DKDA 1RCOB 3V4IB 3J7A1 2LMIA 2CUYA 2ZNZA 4A8YA 4OI0A 3RU0A 4LR8A 2QFJA 1RADB 2DR8A 4QPXA 3ETMA 2PD1A 3I6PA 3DFEA 3HSDA 5LMNJ 4CP5A 3LPYA 4NLXA 2RDIA 5AE1A 2FYXA 2O3DA 3C46A 3MAAB 1WACA 4CLYA 3CSKA 4K4SA 4B3MJ 1HWIA 1A6LA 5ETTA 2H1YA 4JI6J 3Q8YA 4X4VA 1VBXA 1Q95G 3GYXB 2HBRB 3RRHA 3DRYA 5G4DA 4YB5A 4ATNA 3IXQA 3K0JA 5CHCB 4PKDB 1FK9B 1GMVA 4OFZA 1UPMB 2VPYB 2P5VA 1N5QA 4QU6A 3TVKA 4EBCA 4PRFA 3CT9A 4ED4A 1FTCA 4ZCLA 3NOGA 1PJ7A 2M70A 4FYVB 5KT7A 2LQBA 5KFYA 4FXDA 3W63A 2ZOFA 1FWPA 1KN6A 3VAFA 4WP8A 2ACYA 4OHZA 2ADBA 5LJ5Y 1OMSA 3KOAA 2GNKA 4RW8B 1Q78A 2B9WA 2JVRA 2QLXA 2N4DA 2YQ3A 4OYWA 2QLJB 2OPPB 2HNDA 4I2QB 5FLXU 1RYSA 5A2QY 1ZM4A 3B82A 2BM0A 2NS1B 4K4ZA 3PO4A 3AT1B 4WXWA 4EI2A 4B3SJ 4Q0BB 4C3LA 3ETOA 3FCHA 3HP6A 3RBDA 3HKZD 1LNQA 2BDPA 4PG6A 2J0WA 1MU2A 3W5ZA 4JI0J 3P49B 4EYIB 3VHQA 1DJ0A 2BXJA 1HBMA 3ZZYA 3QZ7A 2V0NA 3UE2A 4LQ9A 1IR2A 2YXLA 4DUYF 3D6MB 1T02A 4RW7A 1N52B 2HS3A 1TELA 3NNCA 1PCAA 2P6TA 1GFWB 2G9OA 1HI1A 2CJXB 1WC6A 1H7WA 3IRWP 3MM8B 5EGYA 2MPUA 3M30B 4LMZA 2LKZA 5FJ4A 3PM9A 4CZCA 4LSNB 4D3GA 2VPWB 3WX4A 3MECB 4KYZA 2GHVC 3U7JA 2Y0BB 2N3OA 3PYDA 1HMVA 1IR1A 1Y10A 2VD3A 1IWGA 2GHWA 1EZZB 3VQTA 3KUGA 2NZCA 3MD3A 4XIUA 1SPBP 1EKSA 1SXLA 4WIQA 4Y28C 2HURA 3E01A 3ZTQA 5G0RA 1LW0B 4NI2B 3DI6A 1A7GE 4I68A 3OT9A 1UW4A 4Q43A 3AXMA 4B9LA 5H9EK 2G0IA 3IO1A 1S0MA 2RDDA 4KGKA 4FF1A 1YWXA 4O3QA 2RILA 2O1PA 1YHQS 3VF0B 4RNOA 2EFQA 2DPIA 3W5XA 1DQ8A 1RWUA 4ZLNA 2HQFA 2K8GA 1M5KC 2MQ8A 2IHR1 1YBAA 2DNZA 2U1AA 1EQMA 3JYTB 1SI9A 2GIFA 2ZD1B 1IKXB 5BR8F 2QFIA 1GK8A 2YPYA 3MWBA 3CD0A 2IIHA 5HMXA 2BACA 3MR5A 1V9OA 2WTFA 3WIVA 3KJQB 3JXOA 5I42B 2ERRA 1VQLS 3KLFA 1FA0A 3FQKA 1DQAA 2BMBA 1S0OA 4MFBA 4WFYA 5EWGA 2J6SA 3OL9A 2A18A 2J0QD 3NNHA 1VLOA 1R8PA 4QQBA 3VTIA 2K1RB 4PG7A 5D4NA 2VH7A 2HVZA 1SBRA 4TQRA 3T41A 3CJ2A 4NLGA 2I38A 2MKSA 1VRTB 1QAJA 2ZBCA 4UUWA 2YNFA 4PQAA 3RJMB 4NXNJ 1PG5B 4CLSA 4OZNA 3UW1A 1M1KT 1VRQC 3GV7B 2UVVA 2UP1A 2WOMB 5E3RA 3WDOA 5KOXA 2VC1A 2BJ9A 3FC9A 3PVXA 1UJ4A 4K2XA 1HQ2A 2E5JA 4L74A 2DY1A 4FF3A 3F0NA 4ICLA 2RE1A 5M2RA 1H73A 2BJ1A 2LFVA 3HFZB 2EC0A 2P9EA 2ZZTA 4DCOB 4F4YA 1XBWA 3QLHA 3M9NB 1TKDA 4C3MA 3AOCA 3H4BA 3ET6B 1RAGB 2G2YA 5THWA 2GAHC 3O2IA 3RBXA 2W2MP 2KJVA 1X8DA 4KGVB 4RU2A 3MM6A 3LTOA 1TK8A 2YKQA 3IS9B 3F56A 3OR1B 4DS5A 3SFGA 3KJVA 4JI1F 4TU7A 4DV4F 2XYPB 2F4FA 1ITPA 2AYBA 2VFSA 3C15B 2WK4A 1G3OA 5KT2A 4DV3F 4HH0A 2SXLA 5FD1A 1RHKB 4FVCA 4WYWA 2MMYA 3IWXA 1WORA 2DHSA 2C2OB 3CVKA 1LWEB 1L3TA 4F3QA 5I3PA 5C42B 4F0KA 1N8RT 4ES3A 3MFHA 2HHUA 3R7NB 1RACB 1YZ6A 1KVJA 2CFXA 1F60B 5L1IA 4I67A 2Q1LA 2PDAA 3PJWA 2PFDA 2YH1A 4OX9F 3CD5A 1VQPS 4DFMA 1GX6A 3DM2A 3G8TA 1RWMB 1YRUA 2QZ8A 4LIWA 1HNXJ 4PG5A 2JH3A 2ZC4A 4DV6J 4CLPA 1JLFA 3D1QA 4DWIA 2PMHA 1IKYB 2XC9A 5DQGA 2AX0A 5L8RC 4WKRA 2JL9A 3PJ9A 1VRUB 2H65B 1BWEA 1SJQA 1HYSA 5AXKA 4V19X 1NJYA 2XMAA 3D3CJ 3V6DA 2PGCA 4ZN3A 5ETQA 4TY8A 1DY3A 5F9NA 1RT1A 2P9GA 1AROP 2HGMA 1F1BB 1XJWB 1AB8A 4LRAA 1X5PA 4RBVA 1Q79A 4J90A 5KTQA 1M1GA 2GVDA 2LU1A 4LFBJ 1XC9A 5ETOA 4DL3A 4CLZA 2HK3A 1UVKA 3RRGA 4CM0A 1AT1B 3MURP 4O44A 1X0FA 4AQYF 4P9SA 4CYUB 2BQRA 3FFIA 3CO9A 1S48A 2VQFF 4LF6J 2JFKA 3OTEA 3Q8QB 3SBMA 2FIUA 1NJXA 2MQNA 2VG6B 2CQ0A 5J2PB 4PWUA 4KFBB 3OLBA 2AWZA 4DR5F 2CQ3A 2EI5A 1WOOA 1YRTA 3C16A 2QC3A 4F4WA 1NH8A 2AJ2A 2Y1JA 3RB0A 3MM9A 1RHRB 4PAAA 2FVPA 1U0HA 2GC8A 1NBEB 2HFUA 1RSCA 3OFFA 4W98A 1MG7A 3UWTA 1XWLA 3AB4B 3CC2S 4DX7A 2BX6A 3GG1A 2IM0A 1S6PB 3R7BB 1VQ9S 3H25A 5J2NA 3DOMB 2DXEA 3OVAA 3HK2A 4K2JA 4ELTA 2MYFA 4G1QA 4F8RA 2G2OA 2KT3A 4L76A 2IJRA 3IN5A 2XS5A 4IQMA 5DO2A 4FS1A 2KVQE 2W4DA 3S7RA 1KDNA 2QL9B 5IM0B 3VAGA 2QYGA 4H4KA 3IBFB 2V9KA 2ZUAA 2UUBF 3BR9A 3TAMB 2MKJA 4CLFA 3OTBA 4WF9Q 4RWWA 3MDFA 2MSSA 3QPIA 2MJNA 4DPYA 3CJ0A 3X1LB 5CQGA 3RZAA 1HBUB 4CO2A 3X3UA 1FJ7A 3QAUA 3R5BA 2P8IA 1JLGA 4L3NA 1W25A 2Z8QA 2XULA 1YJWS 3L4BC 4ID5B 4ZLPA 3G6YA 1HR0F 2UXCF 1JXVA 2Y1RI 5HBMA 3P3DA 1TKZB 2LEPA 3ZZ0A 4D3HA 4UOFA 1IN0A 4WTOB 2QV6A 2R7QA 3LOUA 2NPIA 4DQQA 1NPPA 3JAMY 3QT7A 2IBKA 3HHNB 4CT8A 1V3SA 2ATCB 3W7BA 2DHGA 2ZHAA 5J2MA 1ZM3A 1NDCA 3N6LA 3SFUA 1F5CA 3TA2A 5C24B 4QIEA 1RAOA 1QSLA 5A8WA 1VJWA 4DUYJ 3UO0A 3DDKA 3F73A 2AJFE 1B7FA 2F40A 3QIPA 2VU5A 4DZDA 2PC6A 3PFOA 5I3UB 1J27A 1RT3A 2MZRA 4DV7F 4NCAA 2W24A 4O3PA 3HCXA 1Y9OA 3TZXA 4W92B 2IM3A 1TU0B 2UUAF 2LECA 5IT4A 2XTJP 3W2WA 4MK7A 1ZA2B 4KAIA 3I5CA 2F9JA 2QA1A 2FY1A 4RUAA 5B7WA 3W2VB 4IFYB 4ENOA 5HP1B 4KV8A 1YIJS 4BCAA 1N88A 4OZ1A 2B9EA 3ZC4A 1ZPWX 5EX3A 3UD5A 4LBHA 1CQNA 1GMWA 5KFBA 4NLOA 1SIWB 3UN2A 3Q8PB 1HHQA 2ZDOA 3PTWA 4OI1A 2FJBB 1Q7LB 3MEEA 4DR7F 4P2FA 2VKRA 4ECSA 5A6PA 1KSPA 1UJ5A 2L9WA 2DRAA 4G65A 3QT8A 2BZ2A 2KYZA 1PYTA 3BSOA 1SQGA 3OL7A 2RS8A 1SJ4P 2CWXA 1U0SA 1PJ5A 3R6GB 5J1PA 2BJ3A 3PW0A 3QRPA 3PX4A 1RT5A 3KJFB 4ZCMA 1NUEA 4EZ6A 3IAM9 2FGCA 1WF0A 2FJEB 1JJ4A 3TAQA 4FYWB 4K5SA 4ANEA 4USHA 1HW8A 2LYVA 2YNGA 2ZM6F 3CJRA 2E5GA 3GJQB 5GADI 3CCQS 2KU7A 2YKNB 3O8WA 4DN0A 2O67A 3C6TB 1P8GA 3RG6A 2ZJRQ 2UVWA 2CDQA 2OTLS 1VQYA 2CPYA 3KDNA 2AJQA 5E3QA 1IBMF 3B8HA 4CLTA 3UPFA 4RNFA 2V2VA 3KLHA 4OZLA 2EG2A 3CPWR 3TX8A 4NLQA 4LREA 1PYSB 1NRKA 2QRRA 3R1LA 1ICEB 4I7FA 4IR1A 4E98A 4TU9A 2UV8G 1S1UB 4YEAA 3KLIA 3CJ8A 4IRCA 2D41A 5DDRC 3MR6A 3ENVA 4LRDA 1FDBA 1H2TZ 1B7YB 3SV4A 2H4WB 3VZIA 3RAXA 4TY9A 2XO7A 1ZBTA 3CJ4A 4B3RF 5B08A 2YWFA 4P72A 3OXGA 3TJ9A 4DSFA 2FTRA 2Z30B 4ED8A 2Y1IA 4BLGA 3MMCA 3M2RB 3HSJA 3ZZOA 1UCNA 4CQ1A 1S59A 3DLEB 1T03A 1ZS6A 4L6V3 1B3TA 2KZZA 1YQHA 4LFAF 1FT8A 1NPRA 1N54B 1S1TB 2RU3A 2WW8A 4OJGA 1VQKS 3ZNUA 2W9CA 1U26A 3T9NA 4DN9A 2B56A 3A3PB 1VQ7S 1U25A 1C1CB 2OGUA 2M52A 2DGVA 2DNGA 1JLAA 1LW2B 4F4KA 1FEHA 1U1NA 1VC0A 1FTRA 2JX2A 1RT2A 4KBIA 1FRHA 1OS5A 3IAS9 3UR0A 3T6BA 2IY5B 5E3CA 5T14A 5T7LB 4USUA 1VQ5S 1RT4A 3M6UA 4JI1J 4DV4J 3MUVP 4DL6A 3R5CA 2BANB 5AE3A 4XTTA 1D3WA 2OUGA 4DV3J 3M6XA 3MTJA 4IH7A 4JI7F 4JI3F 2CJBA 2DT9A 2JLEA 4N47A 1Q82T 2RQMA 4P52A 1SL2A 3OVSA 3THVA 1GX5A 1RXOB 2RKIA 4R0JA 4DFPA 1QUVA 1EP4B 5A8RA 2QLBB 1VOMA 4KB7A 2PT0A 3TOQA 3BM7A 3VGVA 3I0SB 4OQJA 3D67A 1FRIA 4NYPA 4EEYA 4OX9J 4ZCIA 1AA1B 5M2PA 2GGPA 1SUQB 5KFUA 2ZDPA 5AJ3J 5DLGA 3PEHA 3RB4A 1DTTB 3KG4A 1TL3B 3FRZA 1GH8A 3K57A 3VGTA 4CI0B 2ZH9A 1T94A 4JBCA 4X64F 4ILLA 1TTHB 4FYXB 4NZ6A 3KHHA 4DX8H 4Y3CA 2EW9A 4QWBA 5C5JA 2IBOA 4RW9A 2HEKA 3OR2A 3CCWA 1NK8A 3CXCR 4ZIWA 4NLTA 2VDIA 2FJAB 3GJSB 4DSJA 2GJFA 3SYZA 1X31C 2HHSA 1T9TA 2XLIA 2KT2A 1YSJA 4WK1A 4OHXA 1JX4A 3MEGB 2J9EA 4OYPA 2HRUA 1JKHA 2D3UA 3OQ2A 5KFSA 2Y3YA 5DQHA 4MIBA 4F3MA 5IT9U 3FBEA 2CPZA 2HPUA 5HO4A 1RWWB 3DRSA 2ROPA 1WUUA 4X4RA 4JI5F 2Q6BA 3K7RA 5E0OA 3NG8A 2KDOA 3D2WA 2JLGA 1YZ7A 4U67Q 2BKNA 4CWBA 3BEGB 1YX2A 4RJVA 2VBZA 3TX0A 1QUPA 1T05A 2Y8WA 2QA4S 4A8WA 1RAEB 4U95A 5DGBA 2XY7A 2HZAA 4FNHA 3G96A 2P6SA 4CTAA 2IRXA 2GVZB 1UETA 5LOQA 1WG4A 3PHEA 4AQYJ 1HWLA 1RKIA 5HVHA 4JV5F 4WP3A 1T9XA 5DDQC 4A4JA 2E7VA 4N8NA 2VQFJ 2RSQA 1WC0A 3QO9B 3GP9A 4Q2MA 3KK1A 1JJCB 5D4LA 4DL4A 2W4CA 3EE3A 4CNZA 4DR5J 3FQLA 2JJ4D 4M95A 1DTQA 2XMVA 4HKQA 4I6WA 2IVYA 2MKHA 2XO6A 2Q6CA 4QIVA 1U47A 2ZBPA 2G13A 4EBEA 2VOOA 1N5TA 2HSEB 1S6QB 4EO8A 5E2QA 1NZAA 1JIHA 2HS0A 4JUZA 3BF4A 4IG0A 3WQPA 1CJTB 1SH0A 5KFOA 4RL1A 4OYOA 1WSRA 5D0RA 2I8EA 4BC9A 1FFWB 3DMJA 4NYOA 4XPCA 2R8JA 5K14A 4Y2AA 1RBLA 2CYYA 3OUYB 2BKOA 2ZH5A 3DHWC 4PPDA 2UUBJ 3GMGA 2ALZA 5D0HA 1URRA 1IM6A 2LXIA 2XI2A 2LDYA 4FBTA 2BQUA 1BY9A 4NCGB 3GE9A 2QTWA 5J2QA 1ELOA 3GYNA 5U47A 1CJKA 2V5HG 2NZ4A 1KS2A 4N41A 2BRKA 4PYDA 3DGPB 1FDDA 1S5ZA 3EDQB 1RK8A 3WHIA 1T7PA 2L41A 5CD4A 4JP8A 4O4RA 4K59A 2KHCA 1HR0J 2UXCJ 3N5FA 5K8PA 4J9NA 3CGIA 3TVZA 1CVJA 4NE9C 2Y0SD 4DQRA 1V3ZA 1S49A 3NBPB 4C3KA 5KFLA 3PR4A 1S97A 4OMFG 3BB5A 4QWAA 2HQ3A 2ABYA 4PUOA 5J1EB 4KKOA 3HFKA 4HLBA 5KAKA 3LGHA 4NCBA 3FUYA 2HBQB 3ZZPA 3CB4A 2BUNA 1V5IB 3U27A 3BPSP 3IRXB 1EB0A 2MHEA 4IG3A 1RAFB 2FLOA 5LJ3Y 2DCLA 5A0YA 3ELHA 5E3PA 4YR3A 2DD8S 1EETB 3K8WA 2IMWP 1S76D 3JSMA 2UUAJ 2B7BB 3OXLA 3WIUA 3FKBA 3AHPA 3MZIA 1NLKL 4P2XA 4X2BA 1N0VC 3KK2B 4UTGA 1U1KA 1NKEA 1Q4RA 4ES1A 4DSEA 1NSKL 5HAOA 2HW3A 3MEDB 3EXYA 1QLNA 3PXGa 3MCOA 1CC8A 1NK7A 1PILA 2JEJA 5IWAF 4O4GB 1LEOA 2RVJA 2VODA 2AU0A 2MTLA 1E6VA 4JI4F 2HMIB 2YNHA 4ZPTR 4DR7J 3MTKA 3KUEA 1HL6A 3NOCA 3M1VA 4ZDNA 1SKRA 2I6WA 4QYZK 5GAHI 1B99A 3DOKA 4M5DA 3HM9A 4C11B 2R8GA 4ECZA 3O1LA 5CYQB 5F8GA 2CG4A 3NXZA 5LXYA 3JSRA 4RUHA 3OFEA 1RTJB 2B6AB 2XS7A 5AXNA 4E0DA 2OPSB 3VR1A 2W25A 3PX0A 4HL9A 2A3JA 2ZM6J 1X4DA 2FLPA 2JOQA 2VF3A 4YR0A 4IFVA 1KBRA 2BYCA 2B3TB 2DEJA 1UL3A 4GC7A 1F5BA 4KPYA 5CA5A 2H5IB 1LQ9A 3HHLB 3U1LA 3PDNA 4JI8F 2YX7A 2DH7A 3CDWA 1IBMJ 3IR6B 4ED3A 1Q8BA 4PQUA 5EX0A 1DZ5A 4P73A 4NLPA 4HI1A 1RI7A 3MM7A 2YBVA 3G4SS 1KQGB 2RD5C 2XY6A 2FZCB 4L75A 5AXLA 3LQVA 3EWGA 1XMQF 4NLRA 2WB4A 4E8UA 2FQQB 1X4CA 4QWEA 1HPZB 3TWZA 5F8IA 3H0PA 2F8HA 2FJDB 2FZKB 1FKAF 2FZGB 1XMOJ 3CC4S 4XDDA 5KFEA 5B0GA 2V4JB 1Z2LA 4B3RJ 4Z7YA 4PXDA 2K06A 1AYEA 3ILLA 3TA0A 3GFYA 3BO2A 3M8PB 4RLEA 4DR4F 5ADZA 4S0MA 1Q0NA 2IDEA 3CD6S 2YWKA 3BH7B 2AX1A 3G86A 5HQLA 1TL7A 3V81A 2QGFB 4IO1A 3MCMA 5KG3A 3J80U 4E2FB 4LF4F 3PX6A 1C2PA 2QG9B 1GQEA 1MROB 3DDNA 2XNRA 5D8HB 4LFAJ 1IKWB 5D4PA 2NREA 4ZPBA 3Q8VA 1KQSR 1VC6A 2XGPA 5DZ6A 4KQZA 3QT6A 2CA9A 2OPQA 3CCMS 4HH1A 1HQEB 1ZZFA 1FD8A 4F3OA 1FNMA 1XNQF 3M32B 3CO0P 3VZHA 1T9WA 1VI7A 2DNOA 1X0PA 1PYOB 1S9GB 1C4AA 4ZITA 1TVRA 3F44A 2CNLB 5C2CA 2YQ0A 2W2OP 4EGLA 5CYJA 1OPZA 1NCLA 2GMJA 1BXNA 3H2LA 1RWPB 1FD2A 3DLGA 5KFKA 3ZXWA 4LUBA 3PO5A 1U1MA 3VWSA 4O3OA 1PAUB 2B4UA 4RWXA 2MY7A 2AYEA 3C2PA 5LMUF 2ZJQQ 5IQQA 4H4OA 2B5JA 4JI7J 4F04B 4NYZA 1VISA 4JI3J 5JJBA 1VQNS 2H9ZA 2LU2A 2A6OA 4RW8A 3GV8B 2X1GA 1QSSA 3BGUA 4WZQA 5KG0A 1U1PA 4OYBA 3CMAS 3G9CA 3BREA 1R8BA 1UAWA 2EFGA 1EX8A 3TYTA 5KFFA 4A8XA 2LQ9A 2Z2ZA 2GCFA 2RF2A 5CAAA 1ZAWA 4BC7A 2ZZMA 3TUJC 3R3TA 1HW9A 3GONA 4NOHA 2HZCA 4OZ3A 1SC6A 4PWDA 3DXBA 3W1YC 1F0XA 3MPDA 1IBKJ 4X64J 1P1LA 1G1XA 1RBAA 1X9MA 1RU2A 2M88A 3HD1A 4J91A 4HDGA 2KG0A 1XEZA 1WG5A 2KRBA 4Z2XA 2Z58B 3SSRA 2HNDB 3BSNA 2DNHA 2VG5A 3U1NA 4IR9A 1WC4A 4Y65A 5KG7A 4Q5VA 4XK8C 3LP2A 3BBCA 1FHTA 2WAQD 2RH3A 1RISA 5A76A 1MU2B 1WTBA 2R2SA 4IDKA 2MZJA 1HBMB 2W01A 2WBMA 2RDJA 4JI5J 4RW7B 1WG1A 4LQ3A 3I56S 2ZOMA 1VBKA 2Y1LB 1GXUA 1TFWA 1OIAA 3PFEA 1QAYA 4CO5A 4PR6A 3P96A 2RMLA 4GVBA 3MD1A 2AJ0A 4JV5J 2DIUA 2J9DA 1T3NA 1WC5A 4YP3A 5KFNA 1DFDA 3H5SA 2ZE2A 3NMAA 2LVWA 2BE9B 1HMVB 3LP1A 3SDEA 2PA3A 3DYAA 3DLHA 4MK9A 3ZNJ1 2UV8A 4RW6A 4KY3A 1UWAA 3GB0A 3G71S 2GMLA 3HHEA 1Y11A 3E01B 4NZ0A 2DRDA 1FESA 5G0RB 3FBBA 3DI6B 2BBEA 3ULHA 4P7TA 1PC4A 3W8PA 2HHQA 2ZD1A 3TR5A 3CMES 5HSPA 1Z2ZA 1RU1A 3EGWB 2CQ1A 4OV1A 4QJVA 5D4OA 4LIRA 2Z0GA 2H5EA 3QZ8A 2J5AA 4TYBA 1BD6A 3W9HA 3K2YA 2QL7B 5CABA 2F7VA 3S8SA 1S57A 2CJQA 2E9TA 4OLOA 2V9WA 3SI8A 1XR6A 1UMJA 1XTZA 2AIRB 4QBUA 4NMXA 2FJVA 3H59A 3H2VE 5HMYA 4WE1A 2CJYB 1D1UA 1NK0A 2ROEA 4LRCA 2W8KA 2YNIA 2QO3A 1XMBA 4M5NA 4MT1A 4UOCA 2WRMA 1FERA 3MPVA 1R3NA 2CQGA 3W61A 1DARA 2QSFA 4C7QA 1R7IA 2DNQA 1UFLA 3JS9A 5DZ7A 2DPJA 3KLFB 4M1KA 1T8EA 5B0AA 3BQ1A 1HA1A 4MFBB 2KL8A 1Y7PA 2ZH2A 1RTDA 1TAUA 3M8QA 2V63A 5JMNA 4NA2A 2XB2D 1GXLA 3QGIA 4OYMA 3OHAA 2MQQA 5LL6d 4U8YA 4LF9F 1Y5IB 3TEHB 3EVMA 2MSTA 1BMQB 2V50A 1NSPA 1K8AT 1NB7A 2JZ5A 2YNFB 1T3OA 3CIZA 2OH2A 4ZKAA 1BQNA 3CEDA 3D0HE 1VQ8S 1EIYB 3CUNA 2NLWA 4YR2A 2IYIA 1NB2A 4DCJB 5KFDA 2QMXA 5HMZA 4GMKA 1UVLA 1D9AA 2ZNYA 3FMWA 2ZHOA 4ICLB 3WC2A 4LVOP 3I96A 3CJKA 2ZFHA 1KVKA 2J0SD 2DNMA 2KJWA 5B0DA 4NMLA 1RAHB 5CXTA 3M8RA 3QSIA 1WDTA 4CRJA 1X4GA 1JLCA 4F2SA 4O0NA 1HWUA 2I5JA 2BQ3A 1LWEA 4YMEA 3J81Y 5IWAJ 2VDHA 1QD1A 2F5GA 3R97A 4MKYA 3MM6B 4N76A 1W26A 4JI4J 4PABA 4QIGA 1QVGR 2FD2A 3KJVB 4M5HA 4GVLA 2BEFA 2KZMA 3KG0A 1SL0A 4B3TF 3EMTA 1X7VA 3NCPA 2XGQA 4KC5A 3NEKA 2IM2A 4FNIA 4X84A 1Q16B 3N79A 1FXLA 2VKZG 1ZOTA 1UVIA 2XCPA 2QIFA 4PXCA 2ADCA 3JSBA 1NMEB 1L3KA 2R2RA 2W1BA 3FRYA 1R0AA 3KWMA 5KG6A 1RHQB 2QSWA 2ZWPA 3N01A 4DR1F 3DM2B 2EPIA 5BYSA 1HFEL 4DJBA 3IFEA 2D9PA 2QA2A 4PWWA 1JLFB 3GIMA 1MMDA 4JB8B 4GRSA 1XMQJ 3RR8A 1N33F 5D6GA 2DH9A 1ZH5A 1J5OA 5BYRA 1KRPA 1E6YA 3H40A 1HI0P 3NS5A 4B9VA 1WOSA 2DIVA 4DEZA 1WKKA 1MLAA 2EC2A 1HYSB 1ZM9A 3LPEA 3HVRA 1FWLA 3V6DB 2UXBF 1C4CA 4DR4J 3IWLA 1S4FA 4TY8B 1CS4A 2DNRA 2H5JB 2OD4A 4A8OA 4USTA 1N5SA 2ILYA 2KB2A 5JVHQ 3IR7B 1WF2A 5DG8A 3NMRA 1UPPA 4LF4J 2BA9A 1RWVB 4J7CA 2CPIA 3A12A 1BWVA 1PBAA 2CPHA 3OD2A 1SKUB 2Q79A 3N6MA 3BKUA 5L46A 1S6UA 4KSEB 1IKVB 2B8PA 1RP5A 4WFXA 2V67A 2PA8D 2F8MA 4WFNQ 4O44B 1KKHA 5GAGU 4NZ7A 4WK3A 3GSIA 1XNQJ 3TVYA 3DRPA 4HHHA 1NKBA 2AYMA 3FZBA 2X1AA 4X66F 1GXTA 3S01A 5GADU 2YKMA 3RTVA 2MKCA 4ECYA 2H48B 2VBYA 1KOOA 2CZ4A 2R8IA 3N6NA 4NEZA 2LEBA 1O51A 2PO4A 4Z7CA 1SC1B 2HIQA 4FF2A 4FBUA 4F4AA 2IRYA 5HVFA 1AFIA 1WSVA 3DCAA 3C16B 1MSWD 1L5UA 3NRBA 3C14A 1T9UA 2Z56B 4AT1B 3MM9B 1AUDA 5L9XA 2DGTA 4WFBQ 1U0HB 1DLOB 2OSRA 1MW7A 1PSDA 2QL5B 5F8NA 5LMUJ 3QNWB 1K44A 5AT1B 2AW0A 2HLUA 2HBZB 3SV3A 3A8KA 4URSA 1TQLA 5J2NB 3V6HA 3L3CA 1D9DA 1XERA 2FC9A 1NK9A 4G1QB 1FX2A 2LXUA 2GA7A 5FIIA 3TA1A 2V8DA 4KGMA 2A10A 5GVQA 2YTCA 3HHLD 5DLFA 3DLJA 2EKNA 2GO9A 3MUTP 3M2UB 3AA8A 1U8SA 5J1NA 4Q2LA 5L1LA 4RO0A 4K4TA 4ZVUB 2JC0A 4BDPA 1DAXA 2BVZA 2DY9A 4PG4A 1VK8A 2FLLA 1JLGB 1Y5LB 4CO0A 5KT5A 1TL4A 1WKJA 2HZVA 2BKPA 3GTYX 4DSLA 3ZO7A 2CZVC 2YH0A 1I51B 2X3GA 1HIYA 4F36A 1SCJB 2WCXA 4FVMA 5HBMB 5F0WA 1X4HA 3T3FA 1R8AA 3O6QA 2VUGA 3EGNA 4UY8T 2C3OA 1FDNA 3K89A 5L1JA 3TRGA 1RTHA 1I94F 3I9V9 3ZZRA 5J2MB 4V19J 5BYQA 3AAWB 3EVOA 4C6AA 1HBOA 1AZSB 5B09A 5KFIA 3NLCA 2NYIA 3H20A 1FEEA 2C42A 5A8WB 3W2VA 1WDDA 3DRXA 2MGZA 4DG1A 4CCHA 2CQPA 4H4KC 4G1IA 4IOCQ 3QIPB 2VHGA 3MCNA 3PRDA 1RT3B 1N56A 3VALA 4K8RA 2EG1A 4NRTA 1XR7A 1U7LA 4TLRA 3NY0A 3BGRA 5HN0A 2HAFA 1PC5A 1YI2S 2HYIB 4B08A 1HNVA 4P7VA 3F41A 4O23A 3W2WB 2LA6A 4HI2A 2C2EA 2VJUA 1U1RA 5L38A 4DXLA 3N0VA 2J6UA 2ZITA 2YWEA 5KFPA 1H38A 4M5IA 2GJIA 1JXEA 2XS2A 5ETSA 4KV8B 3H42A 3G82A 1YKWA 5L39A 5D3GA 2H51B 3KKFA 4ILMA 4KJIA 4L72B 1GT8A 4P71A 1SJRA 2KXHA 3L9ZA 5C7PA 1YITS 1RAJA 2UUWA 1VBZA 2QJ3A 3TJ8A 3QBCA 3MEEB 2Z4PA 1U09A 1TR0A 3T5HA 1J5EF 4WU3A 1TK5A 4X62F 1RHUB 2DGQA 4Q8FA 3DXSX 2CADA 3GFZA 1Q53A 2RAQA 4ZP9A 1XK8A 4U96A 4L73A 1RT5B 3CE8A 2C22A 2PN6A 4F25A 5DDPC 3EJMA 3H98A 2VIHA 3OVBA 3I87A 2YNGB 2RIJA 5KFAA 2E7WA 2Z2MA 4LFCJ 5KG4A 2M0GB 3THPA 2WW4A 2HGNA 1REVB 4URGA 2XWXA 3BQ0A 1REGX 3JSYA 3CIMA 3GPAA 4YN3B 2C3PA 2OKQA 3FDSA 2BJDA 4O3RA 3KLHB 1NH7A 3QATA 3A8EA 1HNZJ 4URQU 5CD4H 4J5OA 2V8VA 4F4ZA 1WOPA 4YDXA 4I7FB 5IXUA 2L9DA 1R0CB 2DVIA 5D15A 1YJVA 2OFGX 3KLIB 3UDVA 1T11A 1D8ZA 1HNWF 3PYGA 3QWUA 2OEKA 3CJTA 2W7AA 3U1MA 3KDOA 2HNYA 2XMJA 1V5VA 3FVYA 1S79A 2N3LA 4ZJOA 4LF9J 2HHXA 4ZS6A 2ZBRA 4UY85 4DV1F 3HXMA 2DO0A 2KFNA 4RW4A 4C48A 2D3ZA 1N5VA 4OYAA 2OEJA 2IAJA 5KFGA 4ZVSB 3Q23A 2OMOA 3W9JA 2NXNA 1TUVA 3MMCB 3BJYA 4DFJA 2ACMA 1B4SA 2VJVA 1T03B 5KFRA 4B9NA 1RTIB 3HFVA 4A8SA 1HNIB 2W7PA 2R7WA 2MJUA 1KTVA 2IJNA 3TW0A 3BH6B 1K0VA 4YHHF 3TNVA 2D3OR 2FDNA 2BANA 4PCQA 4WBFA 3GJTB 2XWYA 5K8MA 2W9CB 2RU9A 2R2TA 5E5NA 2ZH4A 4AL7A 3KK3A 3RYLA 3BN4A 4B3MF 1JLAB 1PBUA 3AD7C 4PYAA 3NL0A 5EUHA 4AFFA 1UZDA 1ZPVA 2XSJA 1RT2B 2DR5A 3G6ES 2CQIA 4U9RA 3AQPA 2EK6A 3E2EA 3KFWX 1HARA 4QW9A 4BBYA 4OLPA 1U1QA 3MHYA 1KEKA 4J37A 4PG8A 1FNXH 1RT4B 2AF6A 1JQGA 1SV5A 3MPWA 5LSLA 1ZM2A 3G6XA 1GNKA 2HVDA 4LSZB 4WFAQ 4O3SA 2FVRA 1H3DA 2RRNA 3PJXA 2ZC3A 2UVUA 2AKWB 4QU7A 3CCSS 3IGVA 4B3TJ 3PW5A 3TEGA 3MR3A 4LT6A 2VPZB 4OHYA 3R8YA 3NWGA 1TV6A 3CCTA 4PXEA 3D1HA 4HDHA 1SKWA 3LAKA 4CM2A 1H7XA 4DUZF 1K1SA 2RKIB 2M2BA 1RGVA 3WC0A 3KYLA 3BQ2A 2B4OA 5H9FJ 2DNLA 3UCGA 2VONA 5A8RB 3BZQA 3HVTA 4RNHA 2K3IA 4ED7A 1L3SA 2GGPB 4DR1J 3UDCA 1LK7A 2JC1A 4UUXA 1UFWA 1F9FA 4ZIVA 1CJUA 3SZ2A 3D9BA 3EUNA 4ID8A 1N33J 2A2CA 2OIHA 1BC6A 4LF5F 3OXFA 1RT6A 1UEKA 2CWKA 1XQIA 1ZYQA 3FGVA 1S1VA 3PYEA 1RDRA 4RW9B 4FPRA 2CPJA 1K1QA 2GFFA 1LOUA 3OR2B 3EICA 1R0BG 2GAGC 4P10A 5FLXY 2UXBJ 5BJRA 2ZUGA 1LV5A 3ITHA 3TQEA 2MLXA 3A3OB 4MMOA 1JKHB 1JWWA 2NXEA 4I6AA 3D5MA 2D7SA 2CJAA 5F9LA 5IQ6A 4ECUA 5FDLA 3CULA 3NS7B 4R8UA 3DRSB 5GAHU 2AGOA 4IH5A 3DRRA 3J7AN 1U2CA 1H2VZ 1C0UA 1VFJA 2H54B 2FJXA 1O0PA 5CH7B 3M8ZA 1VDHA 1T05B 2NCKL 3VVUA 3NAHA 1T9YA 4CTAB 1HBNA 1GTHA 3L09A 3R5AA 1S6QA 3B6BA 3BV8A 1BLUA 5IC4B 4ILRA 1F6TA 4R0EA 4X66J 2AP6A 1TFYA 2JDJA 3HT3A 1S12A 2ZH8A 1XNRF 3AH6A 3W60A 1IVZA 3KK1B 3LALA 2NSBA 2HWTA 4F0HA 2OPRA 2DHXA 4U8VA 4MK8A 3A4TA 4M63A 5H9EJ 5KG5A 1IM4A 4RKUC 4IUFA 4B9MA 3NS6A 4WWSA 4WJBA 1NHUA 4DR2F 3VAKA 2ASLA 4RUCA 3TZWA 1KLNA 1KLMA 2IJFA 2POKA 5IOLA 1FVQA 2CQ4A 2IYGA 1JK9B 2XQCA 4IG0B 4C0OC 3GV5B 2IC3A 2B0GA 3D6FB 4YQWA 1LWFA 3BDEA 3JQJA 5MAOA 2C3UA 5DS7A 2JHEA 2EFVA 2BJ7A 3V4MA 4ZP8A 7AT1B 3PEJA 3FEXB 1Q7YT 3Q2SC 4YB6A 5F0UA 4K4XA 2DXFA 3DMJB 2C2DA 2MZSA 3M7VA 3QT5A 1HQUA 2NR0A 1FO1A 3SCIE 1ZAVA 2HVEA 2WVDA 3W3SA 1OJ4A 4AL6A 2R7SA 2B8QA 3V6KA 4KPCA 1FKOA 3KLGA 4DPWA 3W5YA 3BO4A 3B4DA 3M6WA 5J2QB 2ZZNA 2QMUB 4LBPA 5KFWA 2E1MC 3IG1A 1S0NA 2IA6A 1CJKB 1VQ6S 4KHRA 3GSDA 3J7ZT 1HHSA 3IA0A 3DHXA 2VOPA 1OQ3A 1C1BA 3CCJS 4Y2CA 3BO3A 2OLWA 5IT0A 2PI4A 5A2QU 1MWQA 1R89A 2DR6A 4DL5A 1X60A 2E66A 4H4MA 3PW7A 2V4RA 1RTZA 2WB1D 3I0RA 1FCAA 1YRXA 3M4XA 4QOTA 1AXQA 2XY5A 1I94J 4PUOB 4KKOB 4ELUA 4ED2A 3AD9C 2QEXS 2K2PA 4FZVA 4C8ZA 3H8YA 2F9DA 3ISZA 5A6WA 4K4UA 3VCDA 2AJ1A 4AE5A 3KLEA 3OSPA 3OFHA 2C1EB 4IG3B 3NGSA 2KYXA 5A0YB 2F65A 3ENWA 4CT9A 1QE1A 1FF2A 2K7KA 3AOBA 3IM8A 2MQMA 2W2QP 3B4MA 3JSMB 2NQPA 1U45A 1NM2A 3K5NA 5D77A 2FVCA 3W66A 4YDDB 3HD2A 3VGUA 4P2SA 4N7TA 2E5HA 2RT3A 3RBZA 3O3LA 3PACA 4EO6A 3BBFA 3GILA 2FVQA 2Y9HA 5KT6A 1KHWA 2OPSA 3W8GA 3QYYA 3UNYA 3KMQA 1OSDA 2VC0A 3Q86A 3LWLA 3DOLA 2FUG9 3GG0A 5KFTA 2OMLA 2CPFA 1TL1A 1OO0B 2F8EX 3EVWA 1YJ9S 4ZP7A 3V2UC 1E6VB 2YNHB 4AXJA 1MWYA 2JRSA 3BKTA 1H0HB 1FXRA 3M1VB 4QR2A 2YWGA 5HJXA 1J5EJ 3DOKB 4M5DB 4X62J 2KN4A 3BSAA 1NHVA 3TUPA 2AHOB 4HACA 4NEYA 4JV0A 4HVZA 5HL7Q 5HMWA 1CG2A 2LQ5A 1NJIT 4C8NA 2ZH6A 1QAXA 3RR7A 3HHDA 1GEHA 1VGYA 1RA6A 3CWJA 2COLA 4F02A 4IFVB 5EWEA 3POTA 1FE0A 5CYMA 3A8IA 3CJQA 2HVHA 3M8SA 1Q8LA 4PQUB 3UVJA 1S4EA 4CLUA 1CSJA 3TQ1A 2CRLA 2Q66A 4YUDA 2GJ2A 3UR3C 5HROA 1TUGB 4EWTA 3KG1A 3MM7B 1MWZA 1PKUA 1CJVA 2O5DA 1N34F 3J7Z5 3VGSA 5GMDA 1SJFA 4K4YA 3MMAA 3N9UC 1W7WA 4FS2A 2IFXA 1HNWJ 2CPDA 5GAGI 4J9VA 1NJWA 1W2IA 1N5YA 5JVGQ 5F8MA 1CLFA 1PJ6A 1UEVA 1OQ6A 4P6QA 1N4LA 2VFTA 4DV1J 1KWMA 4X65F 1HQEA 3R9LA 5BR8J 5A8KA 3K59A 3D7SB 4LF6F 1X4AA 4RNNA 1TL7B 3V81B 2OSQA 2IVMA 1M0SA 3G2XA 3PHTA 3A1YG 1RLCL 1S1XA 2XMKA 1RB0A 3DNCA 3GCXP 4OX7A 1M90T 5ITHA 1RWXB 2PEBA 1C0TA 4LSLA 1VCTA 2AGPA 4FF4A 4M5JA 4WXOA 3LP0A 3MOJB 1QSYA 4YHHJ 4WTYA 3HSZA 2ASJA 2OPQB 4ELVA 5KFJA 1Q81T 3ZZTA 4ES2A 3FCVA 3RRKA 5DQIA 2HFNA 4KIAA 3ENQA 2JEGA 3K5MA 1Q8KA 2ROGA 2A6MA 1TVRB 1X9SA 4OHVA 1GMWD 1L3UA 2HHWA 4LJMA 2CAJA 2KT5A 1IJEB 4GO5X 1QJHA 1FKPA 1ZETA 3DLGB 1U4BA 2HKEA 3LGNA 3JQMA 2LQ8A 1UA1A 2V69A 1XR5A 4RUBA 3NGDA 1KHVA 1V3RA 2IDLA 2ASDA 3H7HB 4CO3A 5KFVA 5HLFA
chains in the Genus database with same CATH topology
2YNIA 2Q3PA 2QO3A 2ZKUA 4TY8A 5C25A 4H4OB 3VAJA 1XMBA 1HWJA 2VPXB 5F9NA 5B0EA 2X1BA 2B5JB 1RT1A 3L7PA 4JYAF 4UOCA 2WRMA 1FERA 2P9GA 3MPVA 1R3NA 2KM8B 1AROP 4QPTA 2CQGA 1W2BR 2HGMA 4C2MA 3BS9A 1DARA 2QSFA 3AB2B 4C7QA 1R7IA 2B4PA 2DNQA 3FJ2A 1R27B 3FEZA 1UVMA 1UFLA 1X5PA 2DPJA 4K5RA 3KLFB 3DOLB 4M1KA 1T8EA 5B0AA 2XG8A 2XLJA 5EHHA 4RBVA 4IFYA 4J9QA 4KT0C 1YGYA 3BQ1A 5HP1A 1WHXA 1Q79A 1HA1A 1TL1B 3I5AA 4MFBB 3LANA 2M7SA 5KTQA 4DSIA 5IZHA 1Y7PA 4OZ5A 2ZH2A 1RTDA 1TAUA 1ZTTA 1WTFA 4EYHB 6FDRA 3M8QA 4RX6A 1R8CA 2LU1A 4TLQA 3C6UA 2N82B 2M3DA 4NA2A 3K5PA 2XB2D 1GXLA 3OSNA 1FRLA 5CZXA 5GAEU 2CQDA 4DL3A 1XC9A 3QGIA 3PIOQ 3OHAA 2OP5A 3BSCA 4NA1A 4M8LA 1URNA 2MQQA 2ZJPQ 1UVKA 2O66A 3RRGA 5LL6d 2RF2B 2D74B 3CCUS 4C8OA 3OBIA 2QE5A 4LF9F 1DRZA 1U2FA 1Y5IB 3MURP 4O44A 3O5TB 2MSTA 4B3OA 1X0FA 1A9NB 4AQYF 4PWDB 2BQRA 3H5YA 1XN9A 2J7UA 3FFIA 1NB7A 1K8AT 2F3JA 3CO9A 2MQPA 1SH3A 2C3MA 1S48A 2JZ5A 2YNFB 4OX6A 5E41A 1T3OA 2VQFF 2JFKA 3CIZA 4WKYA 2OH2A 1S9EA 3OTEA 2VFRA 5GAEI 4DR3F 4ZKAA 2KFYA 1BQNA 3CEDA 1Q8IA 3Q8QB 3D0HE 2I1RA 3L7OA 2FIUA 1NJXA 2MQNA 1VQ8S 2EBGA 2VG6B 3I4HX 1VIOA 4TXSA 3CUNA 4J9OA 2CQ0A 3DU6A 2NLWA 5DG7A 5J2PB 4PWUA 1J2VA 4KFBB 3OLBA 3RAMA 2IYIA 4YR2A 3T19A 2AWZA 4DR5F 2CQ3A 2EI5A 5KFDA 3POTB 7FD1A 3QGGA 1YRTA 2QMXA 3CC7S 5HMZA 4GMKA 3KHLA 3I5BA 5CYMB 4F4WA 1NH8A 1RT7A 2VG5B 2M9KA 3WBZA 4Q44A 2F4VF 1UVLA 2PE8A 2YKNA 1D9AA 2Y1JA 2ZNYA 3G8SA 3C6TA 5KG1A 3FMWA 3RB0A 1KOHA 1UJ6A 3MM9A 2KH9A 4ZK7M 2ZHOA 5F8HA 2FVPA 1QY7A 1WD6A 3LP2B 4ICLB 2KM8C 3WC2A 4LVOP 2GC8A 3I96A 3CJKA 2C3YA 4ED5A 2ZFHA 4JI2F 4Y00A 2VG7A 2J0SD 2LA4A 3QWPA 2IA0A 2DNMA 2JWNA 5HROB 3OFFA 4I69A 2KJWA 5B0DA 4NMLA 3UWTA 1XWLA 4CO1A 4IDKB 2YWHA 1KONA 5CXTA 3AB4B 3UNGC 3CC2S 2K3KA 4QW8A 1O8BA 3SQGA 3GG1A 3M8RA 2IM0A 3MMAB 1S6PB 2GQQA 2PFFB 3H2UB 1VQ9S 3H25A 5J2NA 1X4GA 4H54A 1JLCA 4IRKA 3OVAA 3OV7A 4F2SA 4CIOA 1HWUA 3HK2A 2YKPA 2I5JA 1WHVA 2BQ3A 4ELTA 2MYFA 1LWEA 4G1QA 4YMEA 4TKTA 3J81Y 4F8RA 4MAKA 3D54A 3KNAA 2KT3A 1FJCA 4ZA1A 1X4BA 1T95A 3QJJA 1U2RA 5B0FA 3IN5A 2XS5A 2NUUG 4IQMA 4MKYA 3MM6B 4N76A 1U24A 1O5JA 5DO2A 1JJHA 3GIIA 4FS1A 5E3AA 2W4DA 1N5YB 3S7RA 1N36F 5IM0B 1S1UA 3VAGA 1S6OA 4QIGA 4ZVGA 1LK5A 2D1CA 2NXUA 3CJ3A 4H4KA 2V9KA 2E9RX 2ZHBA 3D0GE 1QVGR 2UUBF 3BR9A 3OL6A 3TAMB 2MKJA 4NLDA 4DV0F 2FD2A 4OI3A 3KJVB 3Q0AA 2R8KA 3OTBA 3TO8A 4WF9Q 1TAQA 4RWWA 3MDFA 2MSSA 3QPIA 2MJNA 3CJ0A 2OAUA 3X1LB 5A8KB 4RBUA 2KZMA 3KG0A 5CQGA 1SL0A 4DL7A 3RZAA 1FRJA 1HBUB 1L3VA 4CO2A 2J7KA 2ZE2B 3X3UA 4IOBA 4B3TF 1FJ7A 3QAUA 3LP1B 3SDEB 4Y0FA 3DYAB 2OFHX 1YTYA 1X7VA 3T5JA 3HI9A 3NCPA 3HVAA 2XGQA 3R5BA 4KC5A 4ECXA 1JLGA 1KVIA 2IM2A 3JB9k 4QIFA 4L3NA 1AW0A 4RW6B 5KFHA 4EFAC 1S1XB 4FNIA 4MKBA 1Q16B 4X84A 1W25A 2Z8QA 3N79A 3HLUA 1SQEA 2XULA 5JXSA 1FXLA 4U7UK 1WEYA 2FGOA 2VKZG 1YJWS 4ID5B 1ZOTA 1Z1ZA 4ZLPA 1DURA 2LLZA 4LF7F 2ATLA 1C0TB 2W4PA 3M2RA 4LSLB 4X4QA 3G6YA 1HR0F 2UXCF 5KT4A 2Y1RI 3LP0B 5HBMA 3D0IE 4O0IA 3P3DA 1UVIA 2AV5A 1TKZB 2XCPA 2LEPA 3DLEA 3ZZ0A 4D3HA 4ZOSA 4F67A 2QIFA 4PXCA 4YFUA 2ADCA 1IN0A 3FSYA 3JSBA 2QV6A 2LQJA 2R7QA 3LOUA 2NPIA 1L3KA 3TUIC 4XPEA 4GKKF 4DQQA 1RKJA 2WONA 1G2EA 3JAMY 2R2RA 3FRYA 3DLKA 3IC1A 3KWMA 3QIDA 4J9SA 1R0AA 2IBKA 5KG6A 2FLNA 4WIIA 5F3ZA 2CKWA 1B0VA 3HHNB 2HGLA 4CT8A 2OTJS 2IVFB 2QSWA 1S1TA 1IQTA 1V3SA 5EDWA 4QZVB 1R31A 3W7BA 2DHGA 2ZHAA 4F4XA 1X9WA 1X5OA 3N01A 5DETA 4GKJF 4DR1F 3DM2B 2EPIA 2BW2A 5BYSA 5J2MA 1HFEL 1ZM3A 4DJBA 2VBXA 4IOAQ 3MM5A 3N6LA 2V8GA 3IFEA 1F5CA 2D9PA 3SFUA 3TA2A 2QA2A 5C24B 3R1HA 2HG4A 1C1CA 3ISNC 2CQCA 4QIEA 3OPKA 1JLFB 3GIMA 1LW2A 4HT5A 3RW7A 1MMDA 3HDSA 4N77A 1QSLA 5A8WA 1VJWA 2AYGA 2OJ3A 2QA4G 2DNKA 3RR8A 1N33F 3DDKA 4G1PA 5D6GA 4TN2A 3F73A 2DH9A 1U49A 1ZH5A 1IUJA 2QYCA 2AJFE 1U6BA 3TARA 1B7FA 4JV1A 2F40A 1J5OA 2VZ9A 5BYRA 1RYRA 3QIPA 2DHAA 1KRPA 2ZH1A 4MIAA 1G7CB 2PC6A 3PFOA 5I3UB 3N4WA 1FKPB 1E6YA 1RT3A 4C9DA 2MZRA 3H40A 3OFGA 2ZH3A 4DV7F 1HI0P 3NS5A 4B9VA 4U7CA 4NCAA 2DIVA 2CPXA 4DEZA 2W24A 5CZVA 3GR1A 4O3PA 4X4NA 4NLUA 3U02A 3NNAA 1HYSB 1Y9OA 1ZM9A 4W92B 3MI7X 5T7LA 4WE1B 2IM3A 5DDOC 1TKTA 2P9CA 2UUAF 2G4BA 2LECA 1K9MT 2XLKA 3HVRA 3V6DB 1M5SA 4MKAA 4OI4A 2UXBF 5IT4A 2MZ1A 4KRWA 4C8KA 3W2WA 5HLFB 1C4CA 2YNIB 3IWLA 1S4FA 4TY8B 2OO4A 5C25B 4MK7A 1S99A 2UUTA 4OZJA 5LMNF 3EGZA 1NK6A 4KAIA 2A1BA 2DNRA 2OD4A 3I5CA 4A8OA 1H2UX 1N5SA 2F9JA 2ILYA 2KB2A 4YOEA 3TI0A 1IXKA 3HJFA 2QA1A 2FY1A 4RUAA 2W9AA 2F1FA 5JVHQ 4X4TA 3IR7B 5B7WA 3W2VB 1WF2A 1ZAXA 4JI6F 4IFYB 5DG8A 5HP1B 4X4PA 1VS3A 3NMRA 4KV8A 1YIJS 4USIA 4BCAA 2BA9A 1N88A 4TQSA 4G3IA 4OJHA 4OZ1A 2LCWA 2FPHX 3ZC4A 2I9SA 4OJ1A 4Y2IA 4GC6A 1UWBA 2CPIA 5H1SV 1ZPWX 5EX3A 1VQ4S 3EZUA 1RTDB 3M8QB 3C6UB 5F8JA 4AL5A 3NCQA 1SJ3P 1K73T