3BR8A

Crystal structure of acylphosphatase from bacillus subtilis
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
90
structure length
90
Chain Sequence
MLQYRIIVDGRVQGVGFRYFVQMEADKRKLAGWVKNRDDGRVEILAEGPENALQSFVEAVKNGSPFSKVTDISVTESRSLEGHHRFSIVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Probable acylphosphatase
publication title Conformational Transitions Revealed by Structures of Acylphosphatase from Bacillus subtilis in Different States
rcsb
source organism Bacillus subtilis
total genus 19
structure length 90
sequence length 90
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3br8A00
1S6UA 3BB5A 4HI2A 1Q8LA 3KNGA 2OD6A 1KVIA 2ROGA 4F67A 2AP6A 2XMTA 3DXSX 4HI1A 5B0FA 1AFIA 1OPZA 1W2IA 1Y3JA 4Y2KA 2RMLA 2QIFA 3IWXA 2OAUA 1VQSA 1GXTA 1Q8BA 2Q3PA 1JWWA 1P6TA 2HFNA 1OQ3A 2KT3A 1Q53A 3CJKB 4Q2MA 1GXUA 1X8DA 1YJUA 1YJTA 1YRXA 1MWYA 1TL5A 3FGVA 3BF4A 3HDSA 3QGPA 5B0CA 3BR8A 2OMOA 2EW9A 1TZ0A 2RSQA 5B0BA 1AW0A 4ZOSA 4A48A 1OQ6A 1CC8A 2K7KA 1FEEA 1Y9OA 1FVQA 1LQ9A 4OJHA 4Y2MA 1KVJA 2W4PA 2LQBA 3KG1A 2XMJA 3FMBA 3MZIA 2IYGA 1XBWA 4U9RA 3VTIA 2OFGX 4A4JA 1R6YA 2L3MA 2K1RB 2GGPB 5IXUA 3BM7A 5B09A 5B0DA 2ROPA 3TNVA 2ASYA 1N5SA 2FHMA 1Y0HA 1OSDA 2ACYA 1QUPA 2BJEA 1U7LA 2AJ1A 2FTRA 1YG0A 4NPOA 3QMQA 1SB6A 1TUVA 5A6WA 4DPOA 3LGMA 2VH7A 1RJJA 1JK9B 2QYCA 2AW0A 2W4CA 3GZ7A 2XMMA 3UDCA 2GCFA 4ZA1A 4DL0C 2XMWA 5B0AA 4OJ3A 4FNIA 1KQKA 2GO8A 3I9ZA 2OD4A 2IFXA 4A46A 1YJRA 3HHLC 1V3ZA 2GFFA 2LQ9A 5T7LB 1URRA 2FIUA 2ROEA 2XMKA 3CJKA 1FE0A 1FESA 2OP5A 1FE4A 3F44A 2HFOA 3HHLB 3BDEA 4HL9A 3WDOA 1N5VA 2BJDA 2JDJA 5B0EA 4EFAC 3T9NA 1P8GA 1APSA 2CRLA 4YEAA 2PD1A 3LGNA 2FB0A 3HX9A 2K2PA 1VQYA 2ZDPA 1TL4A 3TRGA 4Y2IA 3KKFA 2KYZA 5B08A 4OJ1A 4YDXA 4OIXA 1Q4RA 4DN9A 2GGPA 2BUNA 2HIQA 3TOQA 2ZDOA 1CPZA 5F0UA 3IWLA 1X0PA 1SI9A 2G9OA 3KG0A 2BYCA 1N5TA 2N4DA 1Y3KA 4HH1A 3HF5A 4OJGA 2QLXA 2RU9A 1AFJA 4A47A 3HFKA 2XMVA 1S6OA 2GA7A 1MWZA 2K7JA 2RILA 1K0VA 2IYIA 2HLTA 5KAKA 2KT2A 2PGCA 3BGUA 2N4CA 1ULRA 4Q2LA 5K9FA 3FRYA 2N7YA 1SQEA 4QOTA 3HHLD 4NL5A 2VV5A 1CC7A 1FVSA 2OFHX 5B0GA 4FNHA 5F0WA 2GV1A 3DCAA 1FD8A 5T7LA 2OKQA 2W4DA 2KKHA 2QLWA 1TR0A 3LO3A 5A6PA 2AJ0A 3K7RA 3MCSA 1WD6A 2HQIA 2LDIA 1YJVA 2K1RA 2BBEA 2XMUA 1IUJA 3HHLA 2HLUA 3E8OA 4HH0A 1N5QA 3BN7A 2LXFA 1X7VA
chains in the Genus database with same CATH superfamily
5DGBA 4OLOA 4MFBB 1YZ7A 1I1GA 5H9FK 3KLEB 5E5NA 3I5CA 4BDPA 1S9FA 1DAXA 1S4FA 2DGWA 4OZ1A 2XHWA 2DNLA 5I3UA 3I5AA 2RNEA 2Y1RI 2ATLA 1FD2A 2DGXA 3JYTA 4AQYF 2C2EA 3TA0A 2ALZA 4DL2A 4DR3J 4RO0A 4CLTA 2ZBPA 3UDEA 5KG4A 4B3MF 2FJXA 3IG1A 4N76A 1QAIA 2ZM6F 4J7CA 2MZTA 3D5MA 3PW4A 2RU9A 2BKPA 1RAGB 2HFVA 4ZP9A 3RRGA 4B08A 1WTBA 5HQ8A 3MR6A 1UL3A 2HGNA 1J5OA 1S1TB 4X4RA 3HO1A 1RCXB 4V19J 4XO0A 2ZZNA 2FJAB 5CHCB 3GSDA 1DQ8A 1EKRA 1PJ6A 3KNGA 1SH0A 3J80Y 1WC1A 2VFSA 2GIRA 1H2UX 2CNLB 3BQ0A 5FJ4A 4LF8F 2DNQA 3N0VA 2ERRA 3K89A 2ABYA 4A8FA 2UZAA 1J27A 3QWPA 2LA4A 2HQDA 1HQUA 2MKYA 3OFFA 3S1TA 3J7Z5 4DV2F 2HHUA 1SJ4P 4K4ZA 1EZZB 2NXNA 4I4BA 1V5IB 2CQDA 1UZDA 4Q7AA 2WVEA 4QCLA 2HWHA 5IWAF 2V4JA 2QFJA 1RCOB 2V8DA 8RUCA 3W61A 1U1QA 3TOQA 5LJ5Y 1B0TA 2YKNB 1E6VA 1H2TZ 5EHHA 2VASA 3EDQB 1RXOB 2CFXA 3NY0A 4NYOA 5CYQB 3AT1B 5E0OA 4V1Ak 3GYNA 3CF5Q 2FVQA 1N6QB 1O5JA 3RBXA 3G82A 2CIMA 2AF6A 4PZVA 3FNNA 2DGTA 2WRMA 3MD3A 4AE5A 1VJQA 3MCNA 3GIRA 4NXNJ 1FKPA 1IQZA 3CCSS 2DD8S 1FWKA 5ETPA 1BUXA 2WOMB 4DU7A 4EYHB 2X51A 2KG1A 2V50A 3GQCA 3ILJA 3FBFA 5HROA 5FDLB 2JHEA 2FZGB 3LP0B 4FS2A 1RJJA 1DLOA 3NNHA 3UE2A 5IFMA 3SSRA 3V6JA 3ELHA 1R43A 3P45B 3CW2C 3D0HE 6FDRA 2Y3YA 2CQ3A 2XHCA 2WW8A 1YJWS 3DI6A 3M8YA 3PJXA 2W24A 3CJ2A 1RWPB 3HCXA 2BUNA 1X0FA 2R7SA 1KVKA 5HP1B 4XIUA 3IFEA 4FNHA 2DGOA 4OL8A 2QTWA 3HVRA 3JQJA 1YI2S 3UD4P 1S1WB 2B51A 2YX1A 4G65A 1HMVA 3EGZA 4TY8A 3LOUA 4U67Q 2SXLA 4CO5A 2HFZA 3RB4A 3ITHA 1QTMA 3NEKA 4Q43A 4M5NA 2E1MC 1GX5A 1MW7A 1MLAA 1X4HA 3P5TL 4BWJA 4HDGA 3CD7A 4C8MA 2OI2A 2MMYA 1U7LA 1RACB 2DCLA 4PPZA 6AT1B 4ID5A 8AT1B 4I64A 2PA3A 3TO8A 4EU0A 1D0EA 4X4SA 4Q45A 2XEXA 4HACA 4KGXB 2D9OA 2DR9A 3OV7A 3UW1A 2ILYA 4A8KA 4TLRA 1O6XA 1HBOB 4F25A 5D0HA 4DUTA 1Q4RA 4X65J 4XPCA 2N3OA 4A47A 4P52A 4F2SA 2LP4A 2ZJPQ 4RZRA 3VVTA 3M32A 2DCUB 3C8YA 1ZM9A 5LMNJ 1CJKB 1Q16B 2W7AA 3QIPA 5A2QU 1SBRA 2GW8A 4I68A 1RT1A 1IKVB 2JL9A 2FHOB 1X7VA 3GILA 2V67A 1AT1B 1OPZA 1TK0A 1TFWA 2Q3PA 3TANA 2MGZB 4MKVA 3J7YU 3CCUS 2V8VA 2F4VF 3GPAA 5C2GA 4B3OB 2FVRA 4RW7A 2HYIB 2IMWP 2UV8G 2XY6A 1HWKA 4OYZA 2QC3A 1K0TA 1P27B 1BGXT 3N5BA 3M8PB 2OPPB 4ER8A 3LUYA 4DL0C 4DR1J 1C2PA 3B54A 1ZOTA 4OHWA 2ZZTA 1FKOB 4MIBA 3NAIA 2QYGA 3TJAA 2XO6A 4RBTA 3WQPA 4WFBQ 4B9TA 1CULB 2JC0A 5DLFA 4OJGA 2XMVA 3U1MA 2MSTA 1JLEB 4DR2J 3BGUA 4TLQA 3CCRS 3DCAA 3NRBA 1T03A 2VPWB 4ELUA 1VHIA 1Y10A 1M5OC 3KUGA 1Y4ZB 2EG2A 4K7QA 2KXFA 3MI7X 1U1MA 5KFKA 3SXLA 4JYAJ 2XBPA 3K57A 1NHUA 2DRAA 3MGJA 2D74B 4NCGA 3AOBA 1VR6A 3OUYA 2DIUA 1ZPWX 3TNVA 3BO3A 5E3PA 4U7CA 4NLWA 1JK9B 2YXLA 3PYFA 4IYQA 2B9XA 4X62F 4LR9A 1VQ8S 2CZ9A 3THVA 4NLUA 2UUCF 1S49A 2YPYA 2GMJA 4K5SA 4MIWA 5J2MB 2H54B 2HS0A 2R8GA 3CJTA 3AQOA 1VQ5S 2HGLA 1UEUA 1RI7A 1DY3A 1KQSR 1HNWJ 3Q2TC 4PKDB 2GS8A 2KO1A 3MEDB 4LBHA 3HZGA 1K0VA 2VICA 1NZ8A 5AXKA 5K9FA 4F02A 2HFSA 3HHLD 2R7OA 5CD4A 2DNOA 2HQIA 4QR1A 1N5QA 2J7WA 5KFHA 2AYGA 3T3FA 5IQQA 2AP6A 1XMQF 2CAJA 4B3RF 4OZ0A 2CJ9A 3WZ0A 5DQHA 2CZVC 5DQIA 2YPZA 2F7VA 4AT1B 4ZN3A 3TQEA 1VQ4S 3H90A 3R8YA 2LQBA 4LBIA 1HNIA 5HATA 3NS5A 1RTIB 1E6YB 1QUVA 1LK5A 2G4BA 3MMBA 2UXCF 4YR0A 2ZH4A 2PFFB 1YIJS 3CC2S 1F6TA 2ZE2B 2ZD1A 4CQ1A 1V3ZA 5F3ZA 4KAIA 1F5AA 2J9EA 2ZDPA 4M5GA 2CADA 4YB5A 4DR4F 2BYCA 4ED0A 3K8WA 3DOMB 2MPUA 1JXVA 4U7UK 4RW8A 1JXEA 5LL6d 2E7XA 5A76A 2OTLS 1OWXA 3KYLA 1U8SA 5DJBA 3ZZRA 1CS4B 3HJFA 3CNQP 4WE1B 1HYSB 2YNGA 4JI1F 3FVYA 1Y3JA 1VQSA 3VQSA 3QT8A 5GADI 3PO4A 4LF6J 2BE2A 1VJWA 2K3KA 3HP6A 2PE8A 2B9EA 1QAJA 1NPPA 2PEBA 4QIGA 2EFNA 5E7OB 3A8KA 3BYPA 2IM3A 3ENWA 4X66J 3FSXA 2GIFA 2NXUA 5GAHI 3BGRB 2FLLA 1S1VA 1S99A 5HL7Q 1CJVB 3TZXA 5D0GA 4IFVB 1OY9A 3CJKA 4B02A 3KTQA 1N52B 4K50A 4BCAA 3RAXA 1Q86T 1WKKA 2DNNA 1T0TV 1MN9A 4KR0B 5C25A 5CXTA 4DX7A 4RNMA 4ECSA 4I7FA 4USMA 3V6DA 5C42A 2MKKA 2IYIA 5GAEI 1XJWB 4MAKA 1TL7B 3DLKB 3DLHA 4USWA 4PWDA 3VCDA 2WONA 3J7YI 3RYLA 3S7RA 3PW2A 3KFWX 1FNXH 2B8PA 1DARA 1RWXB 2RRAA 2RT3A 4G6VB 4OI0A 5SUHA 3IAS9 1JLFB 1FA0A 3P6YC 1VMBA 4BWMA 1I3OB 3QRRA 4MK9A 2ZH7A 2HK2A 2BOAA 2RU3A 5KG3A 9ATCB 3BDPA 4ED3A 3UVJB 4ANDA 2AX0A 1GMVA 5C24A 2XSJB 3GJRB 1PBUA 1TV6B 5KFMA 3MECA 3T1AA 3SDEA 4L74A 1S48A 4LFCF 2B43A 4EFAC 1GMWD 3CCLS 3ZXWA 3WIVA 5KFNA 3EGNA 4ZPDA 2HIQA 2MXYA 1XERA 1BWEA 3HSZA 1N32J 1SC3B 3T6BA 4PXCA 3D4JA 2OKQA 1L5UA 3GMGA 4ECXA 4X4QA 1IM4A 2PEHA 3NOCA 4DXLA 1VC0A 4V19X 4PUOB 2E5IA 3TX0A 1SJQA 2KHDA 1S0MA 3BGFA 3OR2A 4YDDB 4DV5F 4MKAA 2ZNZA 4JI5J 1NNDA 2C3PA 3ETOA 1HNXJ 2WSFC 2MSSA 1LQ9A 4KPYA 1B70B 2FVCA 3MZIA 4DV7F 1PKUA 1U09A 4K8RA 1IKWB 1UAWA 4ZJLA 5F3TA 1HA1A 2ADBA 4WFNQ 1SB6A 1QY7A 2X7IA 4DUZF 4JB8B 3H2VE 3JXOA 2ZKTA 4MTPA 4CLYA 3AOCA 2MYFA 3I4PA 1FE0A 4DZ6A 5KFJA 3ET6A 3MFIA 5FLXU 1HR0J 3FSYA 3CD6S 4L3KA 2V68A 5I3QA 4USUA 3T5KA 4OJ1A 2GGPA 2HAFA 3Q8RB 5DG8A 1CLFA 4A8QA 2R7WA 2UUBF 2OO4A 3HKWA 4DG1A 3I87A 1CVJA 4IRCA 2LEPA 1ITPA 2VONA 3PX6A 3D6HB 3R27A 2V4RA 2XTJP 4F4ZA 3BS9A 3KLIB 2VC1A 3M9NB 3B82A 1U2RA 3BEGB 3BB5A 5KFCA 1HNVB 2DNHA 1WDDA 2P9GA 4TVAB 4ED6A 2DT9A 3QAEA 1QAYA 2HHHJ 3IP0A 1GXUA 3V2UC 2OUGA 3E3XA 1S4EA 3M8QA 3T1YF 2A2DA 4ECTA 1TMMA 1XBWA 4JUZA 4KV8A 1KOHA 1UVJA 3MAHA 1P9QC 3WX4A 4J9SA 3R2DJ 4NPOA 4NWBA 4ZMMA 2UU9F 4B3TF 5K8PA 4KHPF 2A3JA 1BD6A 4RUBA 3UCUP 2EK6A 3TUPA 3GV8B 3DYAA 3CTRA 1GXLA 2Y1IA 2PMZD 1RT6A 2H1YA 3PW7A 5HVFA 3BSOA 3BREA 4NLVA 2DGQA 1BLUA 4BHQA 3CMAS 4ECQA 3ILLA 3GP9A 3LP2A 1SQEA 2OEMA 3R5JB 4CO3A 3Q8PB 2O67A 1AROP 5A6PA 4PABA 3OSPA 1XN9A 3P5BP 4K5RA 5I3UB 4CM0A 4UY85 3CO9A 4ALZA 1G4CA 3BN7A 1KHWA 1YQHA 2IC3A 3R97A 3JYTB 4YOEA 2R2TA 2QIFA 2DXFA 1VQ6S 1GXTA 1L3TA 4X4TA 1KTQA 4C8KA 3IWNC 3AA8A 5H9FJ 5KFWA 4ED1A 3FGVA 1YJTA 4YMEA 2OMOA 3FSIA 2AIRB 5LSRA 1OQ6A 1WWHA 4S0MA 1F9FA 4ZVTB 3FDSA 4QR2A 3MUMP 5IZHA 2VB6A 3SEOA 1OSDA 2E44A 4JP8A 5HJXA 4WFAQ 2FJWA 4EZ6A 1VRQC 4LF9F 3IBFB 3BH6B 4H4KA 2X1GA 2EFQA 1J5OB 4F4WA 2RF2A 2YY3A 1KD1T 4XDDA 3R6LB 1WELA 3Q8UA 4CM2A 1HPZA 4CH7A 2RIJA 1UETA 3G6ES 2ASDA 4LREA 1AFJA 4OZ3A 3IR5B 4LSNA 3CDBA 1XIQA 5IT4A 4OV1A 4C98A 1VQ7S 5GAGU 4FXDA 4KGZB 2GO9A 3D0GE 3SCLE 2VFUA 4N47A 4DR5F 2GC8A 2YNHA 2NSCA 3X1LB 1RBLA 2EWHA 1HQUB 3D1HA 3R5AA 2RDIA 2P6SA 3H5YA 2YKMA 1JWWA 1RWNB 2MZSA 2HFNA 3QFWA 3DRPB 3BZQA 5IV3A 3ETMA 1GK8A 3K8VA 3K5MA 4OZJA 3ZZTA 2ZWOA 4AQYJ 5KFAA 4LMZA 1E6VB 4ED2A 1RP5A 5ETMA 3U1LA 3MM7A 1W7WA 4B3MJ 1LW0A 2KH9A 1FWPA 2ZM6J 1X4GA 3L9ZA 1IJFB 2QLBB 3W2WA 2YWWA 4R5PA 3DLGB 2J6UA 3K5NA 3D54A 1FKPB 5J2PA 5HANA 2ZH2A 3TQ1A 2A0FB 5BJRA 3CO0P 2W7PA 2RILA 3OLAA 2E5LF 4Q2LA 2HIYA 5HROB 1S7HA 5C7PA 2YTCA 4NA3A 2QX0A 1WD6A 4CLUA 3VF0B 4CO4A 4LF8J 1DLOB 1SC4B 3G6YA 4I2PA 3US5A 2PI5A 1GX6A 3ZZOA 4PYDA 2J9DE 2XYPB 2CNKB 3NWRA 2YNIA 4EMDA 4F04B 1FRHA 3QSYB 4TY9A 4F3QA 1H6KX 1G2EA 2DHSA 2JFKA 2ZITA 3DI6B 4PXBA 4RNFA 4Y2MA 4C3MA 4ZK7M 4CLFA 2CA9A 4U9RA 1U45A 4NCBA 1BQNA 1U25A 3D1QA 2CQ1A 3SCJE 4YHHF 3CCZA 3BBFA 5IWAJ 3EZOA 2RRBA 1SKWA 3AJ1A 2XO7A 3RBZA 1HLWA 4HTJA 4M5IA 2MY7A 3OD2A 3DDIA 1R7IA 1O0PA 1VS3A 5FLXY 1HMVB 4X4NA 3ITHB 1XQIA 3MPDA 3OFHA 3Q8VA 2XZDB 2W2MP 3H0PA 3T19A 2OPSA 3VQTA 4HT7A 4USKA 4X64F 1T8EA 4H4KC 2AX1A 1HW8A 2ZBCA 1D09B 2Q79A 1B7YB 3CIZA 4JBCA 3KDOA 4HACB 3TEGA 5LJ3Y 1IR1A 3PVXA 1GAOA 1M5SA 3PKYA 4FVCA 4AXJA 2UUWA 3VAJA 4O4GA 5H9EK 1QUPA 1D3WA 1HQ2A 1G3OA 5HVHA 1TU0B 2VG6B 1Y5IB 5KFUA 3QIPB 3TZZA 1GH8A 1RT1B 2GJFA 5ETVA 5D6GA 3HHNB 4BS2A 5B08A 2F9JA 1NDKA 2QMXA 3MTJA 2MQQA 2BMBA 1DFDA 4IO1A 1CJTA 4OI2A 4CNYA 2IDLA 3SIPB 1SJ3P 4RW7B 2GV1A 4WF9Q 1IR0A 4YR3A 1FKAF 2J6SA 2PFDA 3W7BA 5CCMA 4XTTA 4OX7A 4PWWA 2VFRA 3ZZ0A 2OD6A 4HHUA 4WBFA 3MEEA 3G71S 3KK2A 2DNKA 3HFVA 1TAQA 3TP2A 2F8EX 1ICEB 4M5DB 1NJZA 3C16B 4ZN1A 1P9YA 1M0SA 2YH0A 3KNAA 7FDRA 2CG8A 4LSLA 3MPVA 2HFUA 4HTIA 5D77A 4KJIA 5B7WA 1WC5A 1URRA 2R7TA 3F44A 1NDCA 4R0EA 1N5VA 1TL3A 4LFBF 3RUBL 3N6LA 4CT8A 3R6GB 1N0UA 2X1BA 5L1LA 2DH7A 4WXWA 3TUJC 4FXVA 2IM2A 3TVYA 4DL5A 5EDWA 2EC0A 2PGCA 3THPA 2OEKA 2NPIA 1SL0A 2HHVA 3OUYB 1OYEA 1WG5A 1X9WA 4F50A 3BQ2A 1R8PA 3BKTA 4R0JA 2F4VJ 1NZAA 2IJNA 4F67A 4PYAA 1ZTTA 4HR2A 4WXOA 2PC6A 4WFYA 4Z7CA 3PCOB 1SQGA 4GVBA 1RA6A 2MQMA 2BDPA 4OI1A 1NDLA 1TMJA 1FRKA 2DH8A 1TUVA 1URNA 4NE9C 3R5BA 2KHCA 3RBEA 2W2NP 4J9LA 3EWGA 2ZJQQ 3V4MA 4BC9A 1YITS 2HAIA 2C2DA 2CQHA 2HQ3A 3A8IA 2YVSA 1KBRA 2FC8A 2DY9A 1RAAB 2XGPA 3K58A 3OHBA 3NCRA 4NEZA 3AOAA 3HVTA 2RUSA 4NL5A 4RKUC 4ZHRB 2J9DA 1HNIB 1T02A 1TL1A 3D1OA 2GHPA 3HVAA 3V81A 2KVQE 5KFPA 3N01A 3T9ZA 3K5LA 4IOAQ 3HD1A 4P2FA 5J1PA 3QGHA 2ZD1B 3BPSP 4FYDA 3LWMA 2HWTA 4ZPCA 2YKQA 2MQNA 3OL9A 4X62J 4A8MP 3PACA 3W2VA 2UUCJ 3O44A 3O2IA 4GC6A 3JB9k 2DHHA 3H40A 2VDHA 5A6WA 3M9MB 3DGPA 3PW5A 4IR9A 2QE5A 4QIEA 2LXUA 2YKOA 3EX7B 4RW8B 3DLLQ 1LWEB 2CDRB 3G8QA 3MDFA 3A13A 4C3LA 3FZBA 3M2VA 2IY5B 2JRSA 4LIRA 1HI0P 1UW9A 4YB1P 3K5PA 2MKCA 1RWWB 5L9NA 4CZCA 2YNGB 2XM3A 4DX8H 2DY1A 3TUZC 4IQXA 3SZ2A 1KN6A 1YK9A 4CTAA 4L72B 3E2EA 2DK2A 3A3NB 3RAMA 1XMQJ 4B3RJ 2D41A 2FDNA 1T9UA 2GQQA 4KH1B 4LRFA 3E51A 2R7UA 3BGLA 2AT1B 3EICA 1S1VB 1C0TA 1Q8KA 5KFVA 3CJKB 3QGPA 4P72A 2UXCJ 1DQ9A 3KJFB 5KT2A 3C46A 3FMBA 5C25B 1C4CA 3CCJS 2IMOA 1YSJA 4F3MA 4I7FB 3U1NA 3V6DB 1U48A 2MHNA 5C42B 2DXEA 3GZ7A 3N6MA 4Y28C 4JI2F 1Q8IA 4ZCKA 4PWDB 2QV6A 4IQMA 2QFIA 5E3QA 2V0NA 4DR4J 2GQ2A 1U4BA 2HRYA 4QQBA 3Q0AA 2KFYA 2ZHAA 3SFUA 3I0RA 3Q83A 3RTVA 1TL4A 1KHVA 2VA2A 1F1BB 1TTHB 3NS7B 3FKBA 3HI9A 1TELA 2N4DA 4ZVSB 2K7JA 4FPIA 4AFFA 3FRYA 3JSBA 3AJDA 1RE1B 4ES3A 1VQMS 2QEXS 4F2RA 1WKLA 3FUYA 5C24B 3LALA 3AD8C 3G9CA 5ETKA 3LTOA 1FDAA 2AHOB 3BSNA 4EWTA 2Z0GA 2CJXB 3MECB 4N56A 3SDEB 5ETOA 3QJJA 1IVZA 2CQBA 3H2LA 1WEXA 1Q95G 3TVZA 3THTA 1Y11A 3DGVA 1CC8A 3RR8A 4OJHA 3L95X 3H42A 3PNIA 1NK5A 1IBMF 4NXMF 1OO0B 1RISA 1QLNA 2P9EA 2X1AA 2GVZA 1KONA 1T9WA 2XI3A 3S8SA 4Q8FA 4F0KA 3J7A1 4M5KA 2P2CB 3VWSA 3C2PA 2C2KB 1TP7A 2FYXA 4L75A 4U8VA 3KMQA 2YNFA 1XMBA 3OR2B 4ZLPA 5E41A 2M70A 1C0UA 3MHYA 2PMHA 5KFZA 2CNNB 3VALA 2CQCA 2DNMA 5HLFB 2IAJA 3TEHB 1WHYA 1S9EB 1J5EF 1LKZA 2FLPA 2Y8YA 3QRQA 3X3UA 2HHQA 1FDBA 2HHTA 5KFLA 4ECVA 4JV1A 1JJ2R 1F2HA 1IKXA 3AD7C 3ET6B 5DQGA 4C6AA 3W5ZA 4RL1A 4MJKA 1Y9OA 4LJMA 1V3RA 1WOPA 4QZVB 4DHVA 3IS9A 3R1HA 2GGPB 2ZOFA 3SSQA 3BSAA 5BR8F 2E1RA 4NLRA 2LYVA 4LFCJ 2BRKA 2XC9A 4CCHA 5ETQA 4DG1B 2A6MA 5FIIA 3GFYA 4J5OA 1LFPA 1YJRA 4CLSA 3MMAB 2KFNA 5KFBA 3B4DA 2V2ZA 3LGHA 3LANA 2G1DA 2R8IA 5AJ3F 1KSPA 4FVMA 2C1EB 4W98A 4DCOB 2YWKA 3M30A 4PWUA 1X4DA 1AUSL 4C0HA 5JVGQ 4WFXA 1R27B 4DV5J 2WBMA 1UP1A 4EZ9A 2DRDA 2NPFA 4NCAA 1TKTB 2H3EB 5A8RA 3KLFA 4Q8EA 3RJMB 3MPUB 5EX3A 3KXDA 3FC9A 3PR5B 1AFIA 1W2IA 1H38A 4DV7J 1Q8BA 1YLXA 5CYMA 3DYAB 5SZTA 1K1QA 4DQPA 2BE9B 4DDFA 4DUZJ 1R0BG 3GU0A 4N5SA 2OFGX 1SIZA 1WI6A 3KG4A 2ROPA 4O44A 1FRJA 2PDAA 2O5DA 1VQPS 3DLEA 2DEJA 2D3ZA 1OIAA 3LP2B 2XMWA 4A8WA 2MKJA 4DJBA 2WVBA 2ZUAA 1SQFA 1SV5B 2KVIA 1VQLS 3DRYA 3MXHP 2HNYA 2UUBJ 5T14A 5KFXA 2IC3B 2PO4A 4OHXA 2KT5A 3AJ2A 2DR8A 5DM6Q 4NI2A 3KDNA 3PW0A 2WW4A 4ZVFA 1AZSA 1YVFA 2VG7A 1X4EA 1WF1A 2OFHX 1CG2A 2D9PA 2OEJA 2XNQA 1NBEB 3OL7A 3D0IE 3GJQB 5IV4A 3L7PA 2RS8A 5THWA 2LU2A 4LF7F 2RKIA 4PXEA 3W8PA 3D3BJ 3T1YJ 1RT3A 1WF0A 2YWFA 4J9UE 1JLQA 2ALYB 1H7XA 2CPXA 4A8OA 2RF2B 1MWYA 1N4LA 4G1PA 1KTVA 3BR8A 4JV5J 4ZOSA 1R8BA 2P5VA 4DFMA 2UU9J 2IVFB 1AUDA 4KHPJ 1HPZB 1OMSA 2Y1LB 2CPYA 1EARA 2VPZB 3I4HX 4LSNB 3MUTP 3NCQA 1RAIB 2HHXA 2LCWA 1KQKA 3QJPA 4MYUA 2IFXA 2KYXA 1DTQB 2YNHB 3M4XA 1HHQA 3I0SB 2KM8C 3CWJA 1G1XA 3CIMA 4IG3B 2UVRA 3TRGA 3QNWB 4F4KA 2ZHBA 3FBBA 2KN4A 4HH1A 2W1BA 2QSWA 1U1LA 3L4BC 3ICLA 1MWZA 3UCGA 1S59A 4IKAA 3CDEA 1ULRA 2KL8A 5F0WA 4I2QB 2KKHA 3BQ1A 4KO0B 5F9LA 2V2VA 4ERDA 3GWCA 4CIOA 4P2XA 2LQ5A 3MM7B 4OYXA 1HBMA 3DXSX 2XY5A 4FKYA 5C2CA 2XYGB 1NSQA 1VRUB 1VI7A 4EGLA 1S6QA 3EPGA 4X4VA 3PYGA 4NA2A 3TA1A 5KFTA 5J2PB 3CPWR 1NO8A 1R6YA 1HBUA 1VIXA 4Q0BA 1M5PC 4ZCLA 4IFYA 1H7WA 4NZ7A 3D67A 2EK1A 2DB1A 2J9CA 3V4IA 5ETSA 5KFIA 2Y0BB 2V69A 2NXJA 2XMKA 1FE4A 2Y9HA 4NLOA 2RQMA 1P8GA 4QIVA 3CDAA 4NOHA 4KGKA 5AE3A 5I42A 3I32A 3EVOA 1NRKA 2VL1A 3J80U 4DR5J 2YNIB 2KFZA 1YJ9S 2GZOA 2HHWA 4P10A 1EIYB 4OX9F 1FXDA 2F8MA 4C48A 2G1HA 3CE8A 5K8NA 1F2GA 2NCKL 4HH0A 2H5JB 1UWBA 1KLMA 5DGAA 4OYAA 2XMTA 1UVMA 1UPPA 4Q44A 2FJVA 3SQGA 5LOQA 2B3TB 3PIPQ 5K5MA 1DQAA 2DR5A 2DVIA 4DR6J 4E98A 2W01A 4ZLJA 3B78A 3PIOQ 1CJUA 1HI1A 3KLGB 4LT6A 3VHQA 2JOQA 2KU7A 5L1IA 2QLJB 5IT9Y 2AJ1A 3H2UB 4K4WA 1H73A 3Q22A 2FHKA 1S9GB 4OJ3A 1GT8A 1ZAVA 2EFVA 3PYEA 5AT1B 2OPSB 4ZPTR 1FFSB 1RT2A 1QAXA 4I6YA 4O0IA 3CCTA 3TVKA 2E5LJ 3KKFA 3TX8A 1Y7PA 2EC2A 1I94F 2BV3A 1S6OA 3EYZA 5KAKA 4DL6A 2DNZA 2GAGC 1TKDA 5F8JA 4RW6A 4O4GB 1FCAA 1D8YA 2PSZA 2LXFA 3A8EA 1UEVA 1Y5LB 2MDAA 3C14A 5FD1A 3M6XA 1KQGB 4DU8A 3RW7A 5B0BA 4FF3A 4YHHJ 3CDWA 3HSDA 4FF4A 2GJ2A 2BANA 2IJRA 2V5HG 4KFBA 2C2RA 2FTRA 5MAOA 4YB6A 5H9EJ 4O3QA 3SFGA 1CJTB 3R5DA 5L9XA 3TW0A 3K5OA 1RTHB 1H74A 4B3SF 3GCWP 5A8KA 4YS2A 5HAOA 3LQVA 2ROEA 4IRDA 3UDLA 2AU0A 1SH2A 2BJDA 2BA9A 1H2VZ 2CRLA 3NKYA 4P9SA 4JI0F 2VHGA 3MEEB 2ZNYA 1EAYC 5EUHA 3PV8A 1H0HB 3MTKA 3KK2B 2CPEA 1RHUB 4KPCA 5A8WA 1C1CB 4X64J 3AD9C 2VBWA 5DDOC 2FD2A 3MMJA 2WZ1A 3K7RA 2EXUA 3D9BA 1L3SA 3HD2A 2JVOA 4LSLB 1X9MA 4FXWA 5DS7A 4J90A 1HQEA 4KKOB 1XR6A 5HMZA 1SPBP 1TL3B 4DV1J 3ZNJ1 3KJVA 3M1VA 1X4AA 2Q1LA 2E7WA 2IBKA 2I5JA 1OY8A 2L3MA 4IDKB 1M1KT 4WP3A 4QBUA 3K17A 3OXFA 1X5TA 3HFZB 3HSJA 3QPIA 3DRRA 2ZH8A 2MKIA 4FNIA 4NZ6A 2LQ8A 4LRAA 2VQFF 4B9VA 2XYHB 4UOGA 1YRTA 2KRBA 1WC3A 2MKHA 1JXLA 2B5JA 4FN5A 2IRUA 2K2PA 3I5BA 2CYYA 1S0NA 1L3VA 4TU8A 2JEIA 1NAQA 3MOJB 3G6XA 2RVJA 4K4YA 3KLHA 3KLEA 2YQ1A 2BOPA 3G4SS 1YX2A 5D4PA 4GVBB 5E3RA 2ACMA 3L7OA 1S77D 3PFEA 2J0SD 2IA0A 4F0MA 2C28A 2V6AA 2VBZA 5DG9A 3PKMA 2QA2A 1I51B 1SKRA 2JX2A 3OFEA 2GAHC 3ENVA 3QO9B 4PG7A 4Y2KA 2BXJA 4LBPA 2JEJA 1WC0A 2VG5A 3O5TB 2GIQA 5DDQC 1VBKA 3G87A 1JLGA 3MM5A 3PX0A 4JI7F 3K2YA 4ZVOB 3C15B 1PG5B 2VBYA 2VH7A 2CPFA 2GMLA 4LFBJ 3JSMA 1YZ6A 5KFOA 2LLZA 1TL1B 1DJ0A 3DM2A 3V81B 1S1TA 4MT1A 3TAMA 2XY7A 2AGPA 4RWXA 1U0HA 1QVFR 1VFJA 5CD4H 4C7QA 3AAWB 1PC5A 4JI6F 1B0VA 1Y00A 4QOTA 1MROB 3QYYA 1OY6A 2GX8A 3O6QA 3OTBA 3PM9A 4K2JA 2PN6A 2OTJS 3BSCA 2AEJA 4OZ2A 1IXKA 3DGPB 3A12A 1FNMA 1D9DA 3DKDA 3MPWA 2JSXA 5HO4A 5JMNA 2FQQB 1K47A 4RWWA 1WEZA 3M2VB 3D66A 2L41A 4DCPB 2BR0A 5DO2A 3SI8A 2H5EA 2FZKB 2BEFA 4ZLNA 2A6OA 1WC4A 2QYCA 3DNCA 1UA0A 4DSFA 3PJWA 2DO0A 5U47A 3Q24A 2NXCA 1BY9A 1RTZA 3HM9A 1R8HA 5EGYA 1QJHA 1WEYA 2ASLA 5LM7E 4DX6A 1UZHA 3NGDA 1HARA 1S1XA 3IA0A 1U6ZA 4O3RA 1C0TB 2W2PP 2AEMA 3WIUA 4GO7X 3PDNA 2WOMA 4MYTA 3OR1A 3NMRA 3DMJA 2WCXA 5D4NA 2RQCA 4IUFA 2QL5B 3Q86A 4IG0B 2NZ4A 4DV6F 5BYSA 3TR5A 1FVSA 4ILRA 3RW6A 4OZNA 4DPWA 3QJLA 1RK8A 2E7VA 1XEZA 1A9NB 2QG9B 5HN0A 4DV3F 4ZVQB 3BO4A 2UXDF 1EB0A 4KQZA 1NCLA 4ECRA 1YJUA 4DR7F 2HG4A 2QO3A 1FEHA 5KFRA 3R7SB 4ZCMA 1B7FA 4LQ3A 5LMNF 4D3HA 3LAMA 3PXGa 3CULA 3JSYA 3D6TB 3DU6A 2HVDA 2LQJA 3NGRA 3J7ZT 3H8YA 2CNOB 3LGNA 2V34A 2WSCC 1O8BA 5AXLA 4I69A 1Q7YT 4M63A 2GJIA 4TU7A 2NR0A 3QBCA 2HURA 4YN3B 2I38A 5B0GA 2RDJA 2CJAA 5JVHQ 2CDQA 1L3UA 2EFGA 1K8AT 2GVZB 2HVZA 4QYZK 2X1FA 3EZ5A 3W3SA 1S97A 5GADU 1IR2A 3HXMA 3M8SA 4ZLLA 1HBNB 3N28A 2QZ8A 2BJ1A 4WK1A 1TKXB 2G0CA 2WK4A 3GG1A 1YBTA 2QGFB 3VAIA 4JI2J 4ANCA 2DGVA 3H5XA 4CP5A 1KR4A 1Z2ZA 5B09A 2AYBA 3DU5A 2ASYA 2PMWA 4O4RA 1C0UB 5GAHU 1FJEB 2QN6B 3I9V9 2Z2MA 5KFFA 3KHHA 4UUXA 4B17A 2NS1B 4CWBA 1KLNA 1SKSA 4RNHA 2IAJB 2X3GA 2KM8B 1IKVA 3I96A 5HMXA 4URQU 2NQPA 3DOKB 4DS5A 2CPJA 2VF3A 2QL9B 1VBZA 4CI0B 1IKXB 2MGZA 1N54B 5GAEU 3T5LA 1EP4B 1L3KA 2FPHX 5F41A 3GIKA 1SIWB 1VRTA 3OTEA 2Q66A 4BLGA 4O3OA 4MK7A 4X84A 2R9LA 1UW4A 3KWMA 5CYJA 4N8OA 3RGIA 2A1BA 4PAAA 2O3DA 1HI8A 1YHQS 2IM0A 3UNGC 4NZ0A 1IBMJ 1REGX 4IH7A 4NXMJ 3BV8A 3ZTQA 2XWXA 3HDSA 2M8DB 1WUUA 3QGIA 5JUMA 2AGOA 4C11A 2M88A 2J6TA 2R3VA 2M4MA 3QZ7A 3ILOA 3HHDA 1CULA 1VCTA 1SJRA 3M30B 1S6PB 4UZCA 1YTYA 4F36A 1RADB 3VZIA 1MWQA 1UMJA 5I3PA 1G6BA 1JLEA 3BO2A 3KOAA 2Q6CA 2OD4A 2AJ2A 2U2FA 3M6WA 4QIFA 4F4AA 3LP1A 5A8RB 3T1HF 4LR8A 4QWBA 3HULA 1OSCA 2ZVIA 1VK8A 2AWZA 5KFYA 4NLXA 1RHKB 4UQGA 1SCJB 1J5EJ 2ZJRQ 3I56S 2CJYB 1FD8A 6FD1A 4CLKA 4O44B 4ID8A 3UNYA 1PYSB 1EJ7L 3M6UA 4PG5A 1ZM2A 2G2OA 3OVBA 1YBUA 1M5HA 1QM9A 3P4UB 5J1EA 4CH1A 3GFZA 2B4VA 3EMTA 5BR8J 4TYAA 1NJXA 1TZ0A 2HNYB 3JTOA 1AW0A 2DNRA 1JLAB 1RAOA 1QDUB 4J9QA 1T05A 1RUSA 1HWIA 3J81Y 4Y34A 1B4SA 7FD1A 5IC6B 4NI2B 4P75A 3KJNB 5AJ3J 2VOOA 4DSJA 3EXYA 5M2RA 1R31A 1KNZA 3M6VA 2HMIA 3VZHA 1KKHA 2RKIB 1N5YA 2YKPA 3PFOA 1RT3B 2W7OA 1JLQB 4U8YA 3H59A 3H4DA 5MLCV 3UDVA 3LO3A 1RTIA 4QWAA 3BYRA 4LRBA 4RUCA 2OELA 2DNPA 3CMQA 1BMQB 2RDDA 2AYEA 4NLYA 4PPDA 1UVLA 4DPYA 2C42A 4I1TA 1U0SA 3IO1A 4URGA 2ZE2A 2W9BA 4ITSA 1Q53A 4NLDA 1IBKF 4EBDA 3C6UA 3GJTB 3PHEA 4FYXB 4ZPBA 3I82A 3GYGA 1K73T 4Z37A 1F0XA 1MMLA 2XZTB 2BJEA 4C8OA 4DV4F 2C2NA 1LNQA 4ECZA 3DOMA 4PG8A 1VBYA 1NSAA 2NUUG 4PRFA 3KMSA 1X60A 3OJSA 2XZWA 5J2NA 2HFOA 1RTJA 2ZWPA 2IRXA 4WU3A 2BW7A 1XC9A 3NBPB 3D28A 1HBMB 5L8RC 4N41A 1UEKA 4C4WA 1S6QB 1FHTA 4XDCA 5D8HB 4WPAA 3P49B 4ZVHA 4LF7J 1BWVA 4JI3F 2ZC3A 4RUAA 4Y00A 1HBUB 4DS4A 4Q0BB 1QVGR 2FUG9 3FBCA 5E3CA 2ZH9A 1RAFB 1OS5A 2Z56B 1FWLA 2H4YB 4P73A 3MF5A 3W66A 1V5VA 1CJVA 1JQGA 3CD0A 4DSEA 4I56A 5I42B 4G3IA 4GKJF 2BX6A 1LW2A 3OJUA 2H65B 3TA2A 1KFDA 4ECWA 2L9WA 5LXRA 2GCFA 3GIMA 4WYLA 2IVYA 1TL7A 3RG6A 2HVIA 4UW2A 3R1LA 2JVRA 1Z2LA 1GNKA 5KT7A 2HQCA 1WG1A 1UWBB 2PD1A 5BXIA 4J9KA 2NYIA 3CC7S 1IKYB 3MM9A 3PO5A 4WCEQ 3W60A 3K0JA 5KFSA 2QJ3A 3M8RA 1ZPVA 4OYOA 2FHJA 4LF1A 2N82B 3MR2A 3ULHA 1CJUB 4Q5VA 1S10A 2R8HA 4ES1A 3F56A 2ATCB 3AQPA 2XLIA 4ZS6A 4W4MA 3OVSA 4ZPVR 1SH3A 5A0YA 3FZ2A 4UT4A 3BH7B 4WYWA 5KT3A 5B0CA 2EW9A 3AH6A 1QE1B 1U02A 1ZZNA 1IM6A 1WTFA 2XMAA 3TI0A 4QWCA 5IXUA 1PAEX 1N5SA 1PYTA 4NLSA 2DH9A 3ISZA 3QMQA 3C6TA 3QGGA 2KDOA 4GKKF 4DV0F 4X4UA 2HNDA 4OZLA 2JEGA 1TK5A 1TKZA 5D3GB 4CYUA 1A7GE 2QLFB 2A10A 4USIA 3T9NA 3HX9A 4MKYA 2OPRA 2LKZA 2MKSA 4KH0B 2DISA 3KG0A 1M5VC 1F3FA 1RDRA 1CQNA 1PO6A 2R7RA 5IM0A 1FNOA 5M2PA 3ZFVA 4UOFA 4OYWA 2ZBIA 4I6AA 1DBDA 2BANB 2C3UA 5J1NA 5KG6A 4I0WA 2LDIA 1T9VA 1IN0A 5EWEA 1S6UA 2LXIA 4ILLA 5LSLA 4KHMA 5A8KB 2CPIA 4A8SA 3PX4A 1X8DA 4J9VA 3DFEA 1FEEA 3IAM9 1C1BA 1DZ5A 2LECA 2V2KA 1JLBA 3ONQA 2K1RB 1HNZF 3M2RA 1HWJA 3KUHA 5F8MA 3OL6A 4IOBA 4DQSA 2B9WA 1I94J 3WDOA 3F0NA 4YEAA 3J81j 2KYZA 3IC1A 1HQEB 1JNZB 4O3SA 9RUBA 1RBAA 1PILA 1REVA 4DUYF 4ECUA 1RBOB 4TQSA 2VC0A 1XR7A 3KJVB 5DETA 2N7YA 5G4DA 2I5JB 2DTJA 2V63A 4BC7A 4LF5F 2BQRA 2QT7A 2AJ0A 2G2YA 4RBUA 2BJ7A 3DRRB 2H51B 2D7SA 1S1UB 2HBZB 2DHXA 2B5JB 2DEIA 2PA8D 2Z58B 4WWSA 5CZXA 1WHXA 2IM1A 4B3SJ 2ZBRA 4A8XA 3ZTSA 3OHAA 4QW8A 3JTNA 4ILMA 1ZA1B 1YG0A 3KLHB 5DRKA 2R7XA 1R0CB 3EPIA 1RSCA 2FVSA 3TARA 4OI3A 2FJDB 4CDIA 4JI0J 3PYDA 4WZMA 4KGMA 4FYVB 4HL9A 3OTDA 4RU9A 1DTTA 1T3NA 2R2SA 2G13A 2YX7A 3R7BB 4MK8A 2V4QA 3CCVS 3NWGA 2VG5B 5E33A 2H9ZA 2N4CA 1SKUB 1JLGB 3Q8YA 3FEXB 2BVZA 3MM5B 2B4UA 4JV2A 4ZVPB 1R8CA 1FXRA 3IG1B 2AQ4A 3FQKA 4AL6A 2CVIA 2G0IA 3JSMB 1AB8A 1V9OA 3DDNA 4RBVA 2VA3A 3NP5A 1RHJB 3DM2B 3MR7A 4GC7A 3TAMB 2BE7D 1NPKA 1K9MT 1U0HB 2Z2LA 4FPRA 1NUEA 1RZMA 2JH3A 1P1TA 4L3NA 3GR0A 1Q5VA 3I6PA 3SCIE 2VQFJ 2XS5A 2F63A 2K8GA 1SJFA 1Q1KA 2BM0A 2QMWA 4UOHA 3UDCA 3EZUA 2N3LA 4OLPA 4YFUA 2CQ0A 3D6FB 2E9RX 4WTYA 1MU2A 4ZKAA 2KJWA 1GMUA 3S6EA 2J0QD 3CGIA 1UFWA 3H25A 2HNZA 1RKIA 4J9PA 1YKWA 3NAHA 3HT0A 3DRPA 3VV2B 1R6VA 1HWLA 2V4JB 2CQ4A 2NZCA 4U96A 5CABA 1X4BA 5HJYA 4JI7J 4UY8T 1BC6A 3RAQA 3VVUA 4C8LA 2OLWA 2M3DA 4ZVUB 2W9CA 3QATA 1R0AA 3NS6A 1UKUA 4DSKA 4PQUA 4YP3A 4TYBA 3G82B 1S1XB 3DLGA 2XMJA 1TAUA 4OYBA 4HVZA 2KI2A 1KRPA 5GVQA 1UFLA 1NK0A 3OR1B 5F9NA 3DMJB 4DPOA 1G7CB 3IBWA 4P74A 1C4AA 3JQMA 2GO8A 3LPYA 5C5JA 1PYOB 1EX8A 1A0OB 4Z2XA 3NG8A 2KTQA 3UN3A 2B7CB 4JI6J 3MM6A 2GMHA 1WSVA 2X3DA 4OYMA 4YDXA 1SL1A 1RT7A 4TXSA 2XGQA 2QLXA 5DDRC 4P2MA 3N4WA 3HKZD 4QWEA 3SBMA 2ZHOA 1Q5YA 3DRXA 1RGVA 1VDHA 4CLWA 2BQ3A 1RWKB 4B9MA 2KB2A 4NMXA 3M05A 3E8OA 3EDRB 2DXDA 4TN2A 3QLHA 2MTLA 4DV2J 4M1KA 1KVIA 1LWCA 1SJ1A 3DRSA 5L46A 1NU4A 4M5JA 4JI4F 3LWLA 3HSGA 3O3LA 4Y6IA 3T41A 2VKZG 3SCKE 3GE9A 2ZC4A 2JLGA 1UCNA 3CCWA 5ETRA 1IBLF 2E1AA 2XULA 4ELVA 3RU0A 3GIIA 2CWKA 4TY8B 4OHZA 2HRUA 1SC6A 1U2FA 3CDUA 4HEA9 2LQ9A 4Y0FA 4PG6A 3CVKA 2VKRA 3GV7B 3UN2A 2FY8A 1U1KA 1U1PA 2WVFA 4DV6J 2XCAA 4GMKA 1NXIA 4WIIA 3FCHA 2M52A 1VHFA 3A3OB 3ENAA 4ID5B 2XCPA 2BKNA 4DV3J 5ITHA 1RLCL 1LOUA 2UXDJ 1CC7A 1XMOF 5T7LA 2DGSA 5CAAA 2AV5A 1TFYA 2L08A 4C0BA 2GVDA 2ASJA 4RLEA 4DR7J 2B4OA 4WKYA 2F3JA 3C3LA 2FJEB 4HI1A 4QYZJ 4KC5A 4CO0A 2VG6A 1GTHA 2MB0B 1MN7A 4WP9A 3M32B 2AJFE 3ZO7A 2D3OR 3T6JA 2D1CA 2GHWA 2RUGA 4FS1A 4WJBA 5B0DA 1Q79A 2M5YA 5AXNA 2HHSA 1VQKS 2WAQD 1GQEA 3MCMA 2VQEF 1KOOA 2R7QA 3DDKA 3BR9A 3OXGA 1VRTB 5HMWA 4RW4A 3GJSB 2HPUA 3CJ5A 3OW2R 3BDEA 1FFGB 3MWBA 2C2OB 4DFJA 1FJCA 1LWXA 3Q8SB 4EO8A 1UFKA 1RAJA 4AL5A 1GFWB 3OT9A 3W64A 4JI8F 3D68A 3B8HA 4ZP8A 2UXBF 2F5GA 1Z1ZA 2LEAA 1PCAA 4C11B 2P8IA 5K14A 4M5DA 3RR7A 3VAMA 3C16A 4UTGA 3N6NA 5CH7B 4USVA 1VLYA 4B9LA 5BYQA 1F9HA 4HKQA 3TAQA 2NUHA 4DWIA 1N0VC 3OBIA 5M2UA 4DN0A 2HW3A 4EBCA 3LP1B 1NKBA 4X2BA 3MOZA 1W26A 3CC4S 1X31C 1T03B 1NK8A 1UJ4A 3O1LA 3L3CA 2EKNA 5EN1A 1VC5A 1NPRA 1NJWA 4ANEA 3R2CJ 4OQJA 2FC9A 3W65A 2IDEA 4FKXA 3MM8A 1U1OA 2E5HA 3MAQA 3HHKA 3CB4A 3J7AN 4M8LA 4NCGB 3FJ2A 3P8BB 2UV8A 5T41A 3L7UA 5J1EB 3OLBA 3D6MB 1OPIA 1N48A 1RWMB 3QWUA 3R7NB 3PRBA 3RB3A 1ZTWA 1M1HA 1T05B 2NXEA 4QJVA 4C97A 2BRLA 3AODA 4LIWA 4NLGA 2MJNA 1S0VA 4B9SA 4OMFG 3C19A 4HDHA 5KG1A 4IH5A 1P6TA 2E1CA 1RHQB 4A48A 3JS9A 4RPFA 1JB0C 2HMIB 3ZZYA 4YY3F 3KG1A 4DBQA 4K0KF 1WC6A 2HS3A 1N5YB 3LA0A 4ZDNA 2XI2A 3SV4A 3FRZA 1RU2A 2MQOA 3HT3A 2PIIA 4AXIA 2XLKA 1YRUA 3T1HJ 2EKYA 2I2YA 2AZ3A 4ZHRA 2KJVA 3RRHA 1S12A 4LF4F 2HQGA 3U7JA 3BBBA 4K4UA 4R8UA 4U6PA 2C2MB 1FX2A 3FEYB 4OIXA 3MMBB 2FY1A 4NLPA 1YWXA 2LDYA 2W9BB 4K4TA 4C2MA 2AYMA 3C6UB 2HBYB 4DI6A 1MSWD 2VV5A 3DOLA 2AD9A 3M2UA 2MJUA 1RT5A 1PJ5A 4O0NA 1U24A 4CT9A 3H4BA 1GTEA 1N88A 4P71A 4Y3CA 1LWFA 4USHA 1LWEA 2MQLA 2V8GA 3MAAA 3R3TA 2C2ZB 5J2NB 1RTJB 4DSLA 3ISNC 4ZITA 3CCMS 4OZ5A 4USTA 1WG4A 2O01C 1F5CA 3UWTA 4H4MA 1R89A 4UZBA 1BHNA 5F8NA 2YBVA 2AW0A 2XMMA 1QD1A 1KQFB 2W8KA 2BE2B 3RRKA 2CQPA 3UR0A 1KP6A 3CMES 4F26A 3QFHA 4C0OC 2B4PA 1X0PA 4UUWA 1FT8A 2FVPA 4J9OA 3EE3A 1S72S 1S5ZA 2E5GA 1VQ9S 3OFGA 3U02A 2CKWA 1Y5NB 2QLWA 5D4OA 8ATCB 1LW2B 1KFSA 5AE2A 1IBKJ 2R2UA 1IWAA 4OV6A 2YQ3A 4DPXA 1WI8A 4DZDA 1H3DA 3IN5A 1YDLA 1SVDA 1YRXA 3AB4B 1DRZA 1FK9A 1FERA 4L6V3 4DV4J 4UQTA 4O3PA 2M0GB 4XAKA 3R5GA 2WONB 3MM9B 5A2QY 2WVCA 5I4MA 4F3OA 2ACYA 4QIWD 1N33F 2CPDA 2F8HA 1VQNS 1EETA 1XNQF 4RJVA 1W25A 3QAUA 1D9FA 3AHPA 2WB1D 5F8HA 2R8JA 2LVWA 4JI1J 1FXLA 2MLYA 1VQYA 2E5JA 1HHTP 4OX8A 4RR5A 2LFVA 3UFCX 5A0YB 4JI3J 2EFPA 1VGYA 4RNNA 3DXBA 3QT7A 2LA6A 4KT0C 2RQKA 5CZVA 3C6TB 5HBMA 2G0JA 5HQLA 2E9ZA 2I6WA 2HNDB 3A3PB 3QIDA 1TKZB 1X5PA 4GKJJ 2Z57B 4CYUB 3MUVP 1IBCB 1BXNA 3UO0A 1NH8A 4M95A 1JIHA 2OPRB 2C3OA 4A4JA 1U1RA 4WIQA 1B64A 2JEFA 1I5OB 1D9AA 2YWEA 1TVRA 5IM0B 4DOZA 5HQMA 2DHGA 4FDFA 2QA1A 4Y2CA 1Z4UA 1VYAA 2DO4A 4P2SA 5HLFA 2AJQA 1YGYA 4RUHA 3NNCA 2XG8A 1S9EA 4A8YA 1RYRA 2H5IB 2IRYA 4W92B 4DQIA 1JMTA 2OPQA 5HMYA 2W8LA 4QWDA 3HZEA 2B6AA 3GLJA 1FTRA 5JJBA 2KT2A 3A1YG 4ECYA 3KK1A 2L48A 1C1BB 3VGVA 1JLBB 2FGCA 4H4OA 3OTOF 2BBEA 1QSSA 3T5JA 2IVMA 2WB4A 5IT9U 5ETTA 3M2RB 2XLJA 1RA7A 1XNRF 4M5HA 1VIOA 1QSLA 5AE1A 2EG1A 1ZM3A 3W8GA 1PSDA 2RS2A 3MMAA 4NASA 4GKKJ 4CLLA 2RHSB 2Q43A 4DV0J 3QT5A 4XPEA 4CNZA 1REVB 1F3VA 1RTDA 2GHVC 3E01A 1PAUB 3FMWA 2UUAF 2DNYA 4Z7YA 4X4PA 3M8QB 2QA4G 2QSFA 1APSA 3GTYX 4JV5F 1TKTA 2O66A 4KV8B 4L76A 4OI4A 1FRLA 3JSRA 4ICLA 2ILZA 2G9OA 3DLJA 1PJ7A 2MLXA 5HVGA 4LFAF 4J9NA 2BKOA 2J0WA 2IPOB 1TK8A 2JZ5A 4OX6A 1Q81T 1FI4A 3CJ0A 1JLCA 2XNRA 1RT6B 1OJ4A 1NEEA 4IH6A 4FYWB 2BJ9A 4WK3A 5CA5A 5G0RA 1NHKL 4E0DA 1TL5A 1HNZJ 4USJC 2XQCA 1SV5A 4HHJA 5KTQA 1FVQA 3POTA 1DTTB 1RWUA 2CUYA 1FJGF 2O1PA 1CEZA 1VLOA 3FFIA 3GFHA 1NSKL 2AEFA 2HQFA 1VQOS 2QL7B 5ETNA 3L09A 5F8LA 3EM1A 4DX5A 4NYPA 1NDPA 1HWUA 2OHDA 3TYTA 2YH1A 2VDIA 4DUYJ 2POKA 5B0EA 3D3CJ 2BABA 4CRJA 4Y2IA 2CZ4A 1D8ZA 3QZ8A 5GMKa 3IWLA 4LF5J 1N5TA 4X4OA 1B3TA 1NKEA 4Y65A 1RLDA 3ZC4A 3EVWA 2ZH5A 3GSIA 3HMJG 1KDNA 1ZBTA 5K20B 3KJQB 2U1AA 1S79A 2HLUA 1ELOA 4B3TJ 4G1QA 4HI2A 2DHAA 3C66A 4ZCIA 5IT0A 4DPTA 3SSSA 4GO5X 4ED8A 3VR1A 3N79A 1B99A 7AT1B 4DF8A 4DPUA 3ENQA 2IHR1 1DTQA 2RJZA 4J91A 5DZ7A 1MU2B 3I0SA 4ZJOA 3VAKA 5GMDA 1X4CA 3OXLA 1HIYA 4OHVA 4IG3A 1FDDA 5KFEA 2J0XA 4HYKA 2YKMB 2HNZB 3CUNA 4K4VA 1IWGA 4ZIVA 1ZH5A 4I67A 4LRCA 5EWFA 4KHRA 3UR3C 4KGVB 2VPXB 1N36F 2M8HA 1WHWA 5J2QA 1N34F 2FJBB 4I2QA 4K2XA 2OP5A 1N56A 2FLOA 4KO0A 4G1IA 4DMZA 4F4XA 3EXCX 4DR6F 3BKFA 4RU2A 1YJNS 2YWGA 2L9NA 4IO9Q 4LVOP 3EVMA 2N7CA 2W9CB 2HK3A 1VRUA 1R0AB 1JKHA 1LW0B 4PQUB 3W2WB 4R5PB 2IJFA 3HHLA 3UPFA 2BW2A 5L1JA 4LF9J 3RB6A 2ZOGA 1SUQA 3FQLA 3B4MA 3CXCR 4MIAA 3G2XA 3MM6B 3TUIC 1ZA2B 1RT7B 3VAFA 2LU1A 1ZAWA 1ZZFA 4O3NA 1NLKL 2VJUA 3LGMA 4I2PB 2JLFA 2UUTA 4ZA1A 4KSEB 1VK3A 1U49A 2L9DA 1NK6A 1S0OA 2QRRA 3V6HA 1FDNA 3QLHB 4RW9A 3D7SB 2VODA 3AXMA 1LWCB 3DRSB 1BQNB 4N7TA 1S76D 5KOXA 2Y8WA 1CPZA 3MEGA 4D3GA 3V5RA 3HF5A 2ZUGA 4CLZA 3HJVA 4DLGA 1PIEA 2V8HA 4NRTA 4WP8A 2DPJA 4ZPWR 3KLGA 1NSPA 1MMDA 2VFVA 4KBIA 4OI6A 2JNJA 2JC1A 3HVWA 2ROGA 2DPIA 5LMUF 4XK8C 1S9GA 4P7VA 2QMUB 4ZVRB 3Q89A 2PT0A 2RB7A 3WC0A 2VD3A 1CBKA 1WHVA 4J9RA 3UD5A 3ZNUA 3ZTOA 3HLUA 1RT4A 1ZM4A 3UQSA 1VC6A 2KXHA 2HZCA 2J76E 4UOCA 2CPHA 3H7HB 1BQMA 1JNRB 1FFWB 2E1PA 3RZAA 1NM2A 3MR3A 4CLPA 4WKRA 4EO6A 2MZJA 5T7LB 3LAKA 4TQRA 1TUWA 1ZS6A 4K59A 3R9LA 2GVDB 5JXSA 2EBGA 4DV1F 1NK9A 3ADAC 3CCES 2MLZA 2VPYB 3KK3A 1WOOA 3M9OB 5DM7Q 4FP9A 1PC4A 4ZP7A 5KT4A 3K59A 3M7VA 4ZIWA 1QTNB 2UVWA 2W4DA 3ZZZA 4JI4J 2J7KA 4WFZA 1Q82T 2KXNB 1GEHA 1NMEB 5IOLA 2OSQA 2HBRB 1U6BA 2J7UA 1RTHA 3Q23A 1H72C 3NLCA 1XR5A 4RW4B 1T94A 3BF4A 5RUBA 1IBLJ 3MMCA 1Q7LB 5ETLA 3OTCA 3VGTA 3QRPA 3VTIA 1X5SA 4F8RA 2H4WB 3WHIA 3DHXA 2ZH6A 3NGSA 4CO2A 3S01A 3OL8A 3BN4A 1HL6A 5KOWA 1RB0A 1C1CA 4FF1A 3W9HA 3HHLC 3MPYA 3KHGA 4LRDA 5K14B 4NRUA 4FBUA 2YWHA 5KT6A 4KYZA 4DR3F 2AZ1A 4KKOA 1XMOJ 1GMWA 1RAEB 1CQMA 1T9TA 3D2WA 2A2CA 1VBXA 5D0EA 1IJEB 1FX4A 4K4SA 3AFGA 4AYBD 5GAGI 4C3KA 2G2ZA 1YJVA 4IDKA 1IUJA 4NYZA 2DBBA 2HZAA 3OSNA 4WZQA 3IRXA 5B0FA 1XWLA 1LK7A 3MM8B 3IWXA 3OVAA 4YUDA 2R4FA 1ZETA 1S57A 2CPZA 2JWNA 5HK4A 2K7KA 1HD1A 3CJRA 2VQEJ 2BQUA 4PR6A 3QQCD 3I31A 3IR6B 2AMCB 4E2FB 1Y0HA 2VOPA 3W5YA 1WF2A 4LVNP 5LXYA 4MFBA 4DL7A 2MQ8A 4EYIB 3EUNA 1NB7A 2VUGA 2RAQA 2WHOA 1NHVA 1YJ7A 4YQWA 4ZJQA 4QU7A 4DF4A 4JI8J 1NH7A 4DN9A 1X5OA 3QO9A 2UXBJ 3NMAA 1JJCB 2VIHA 2J8SA 2XS7A 3SQOP 3A8JA 2ZH1A 4LF2A 2RHQB 1LFWA 1TR0A 5KG0A 2XMUA 1RYSA 4DCJB 3CSKA 3C15A 1R8AA 5E3AA 2BM1A 3MURP 2YKAA 3CD5A 2AJ4A 3W62A 2I9SA 2GNKA 2CQGA 1LXJA 5KG2A 5ADZA 3UN5A 4Q2MA 4EUVA 1RAHB 4NXNF 3HVTB 1RWOB 3GCXP 5H1SV 4R8UB 2R8KA 2FZCB 4P6QA 2HBQB 2V9KA 2FHMA 4J9MA 3NOGA 1WDTA 4ATNA 1U2CA 4DL4A 4ZVEA 3DOLB 2J8AA 1MROA 2BACA 3M2UB 2FIUA 1RT5B 1FESA 1UWAA 3IBCB 4TU9A 1FF2A 1VOMA 3FK4A 3NNAA 1WJ9A 2APOA 3W2VB 2FHJD 1LWFB 1NK4A 3MD1A 4DEZA 4OHYA 2KG0A 2E9TA 3MAAB 2M7SA 4F4YA 3KHLA 5K8MA 3QSIA 1N8RT 4KIAA 1T9YA 3IR7B 1EHWA 3J81U 4OYIA 2MQPA 4H4MB 1IQTA 2MEWA 3JAMU 4C8ZA 4B9UA 4YY3J 4K0KJ 2YKNA 3V6KA 4RNOA 2B9YA 5CYQA 2K3IA 4CTAB 4ED5A 4AUKA 4KRWA 1N6QA 1KVJA 1UA1A 1HFEL 3GYXB 2ZKUA 3FBEA 2EBEA 4LF4J 3NCPA 5CCLA 2LMIA 3IGNA 3PR4A 2W4CA 3PHTA 1JX4A 3P3DA 2Z8QA 3CJ3A 3CEDA 3F73A 4IG0A 4MKBA 1MMNA 2F1FA 3EJMA 4B9NA 4NA1A 2B56A 2NLWA 2FB0A 5FDLA 4LSZB 3LP0A 3H98A 2OIHA 2XS2A 1RWVB 4HHHA 2HZVA 1FK9B 2GA7A 2EI5A 2HHPA 3U27A 4X65F 4BBYA 4FYYB 4ES2A 4FZVA 3GG0A 4U95A 2NSBA 3M8ZA 3I0RB 4EK2A 2F9DA 2IIHA 2HRTA 2DYAA 2RH3A 1EETB 2FLNA 4ZP6A 2V9WA 5HP1A 2C3YA 4HLBA 2LEBA 3H20A 3ZZUA 1ACMB 2WBRA 2YQ0A 1U47A 1KWMA 2COLA 4C8NA 1S1WA 3NL0A 1FO1A 1WOSA 2A18A 3UCZP 2I0XA 3SV3A 3T5HA 2F65A 1AYEA 3PG9A 2OGUA 5F8IA 1PGZA 1WKJA 1D1UA 2DR7A 1RU1A 3W9IA 1U8WA 2ZEJA 5HBMB 4DR1F 4EEYA 1DURA 2XSFA 5D78A 2ZOMA 2CJBA 2ZDOA 2ZH3A 4KB7A 2B7BB 4R25A 1HBNA 5LT5A 1S7IA 1TKXA 5HI7A 1PBAA 1W2BR 2UVVA 1BQXA 3F41A 2FGOA 4MMOA 3JTPA 1Q78A 2HKEA 4N77A 3HHEA 1SXLA 4DR2F 2EPIA 2AGQA 2YNFB 3FCWA 3Q8QB 1Q8LA 1TVRB 2UP1A 1HBOA 1JJHA 2DJWA 3NXZA 3W1YC 1WORA 4QPTA 1B0PA 2D69A 2Z2ZA 3OPKA 1YBAA 1T9XA 1N33J 3QT6A 4NEYA 2DKOB 1CJKA 4LR7A 2J5AA 1XNQJ 3DOKA 1LXNA 4JYAF 2OPQB 1HD0A 2B6AB 2DIVA 1EP4A 3LH2S 2EEYA 3KK1B 2OSRA 5B0AA 1M5KC 2WTFA 4DFKA 4ED7A 3AA9A 2GFFA 4PCQA 4H4OB 3O8WA 2W2OP 5L39A 4HT5A 2Y1JA 1FJ7A 2JDJA 3UD3P 5DLGA 1KEKA 4B3OA 3IS9B 1F5BA 2ADCA 3CJSA 3W5XA 3HFKA 2AKWB 3M8PA 2OPPA 4QPXA 1HNWF 1UTAA 3EGWB 1KS2A 3R5CA 1FKOA 2R2RA 3AY0A 3IRWP 3G6VA 5KFDA 1RTDB 3E01B 3MFHA 2VFTA 3Q2SC 1S6PA 4M5LA 2OAUA 4RX6A 1F60B 3SMZA 5E2QA 2P9CA 4JOUA 1F9EB 2IYGA 4ICLB 3BM7A 3UI3A 2WVDA 2RD5C 3N9UC 4IR1A 3KLFB 1QSYA 3G86A 3NGUA 4EI2A 4L73A 3GFXA 3MR5A 3A4TA 3GR1A 5CYMB 1UVIA 2VZ9A 4ZVGA 4PEOA 1HW9A 1XTZA 1JLCB 4PG4A 3AXKA 4KY3A 1M1GA 1AXQA 2EVZA 5CQGA 2BJ3A 4LUBA 5D4LA 2CVEA 2RE1A 3WBZA 2CXEA 5G0RB 1SI9A 2Z2YB 3OTOJ 1WSRA 3DLEB 5IC4B 4YB7A 3DN9A 4OFZA 3H5UA 3POTB 2F4FA 1JLAA 2W25A 1XNRJ 1RABB 5J2MA 1V3SA 4DQRA 3FFIB 2F40A 1FRIA 3ZTPA 5BYRA 2RRNA 1LEOA 3JAMY 2NYHA 3DLBA 1OQ3A 2KT3A 4ETZA 1UJ6A 3MEDA 1AZSB 1T3OA 2VG7B 3PRVA 2XWYA 2QA4S 5DDPC 4FBTA 3G8TA 1RQ0A 2UUAJ 3VGUA 4LF6F 1T11A 2W9AA 2KZZA 1K44A 1NKCA 5KT5A 4J37A 3TZYA 5DZ6A 2Z30B 3LW5C 2I1RA 2R7VA 3TZWA 3OQ2A 2DNGA 2Z4PA 2RQ4A 3P96A 3KLVA 4X66F 2HEKA 4G1QB 1ZAXA 3VGSA 4C9DA 4LFAJ 2UVUA 2KRRA 3MEKA 4F0HA 3ZZPA 2HSEB 1E6YA 1KC8T 2I8EA 4CH0S 1U6FA 3ILIA 3NGTA 2CQ2A 1XK8A 3DC2A 1RHRB 3VAGA 1FRXA 5KFGA 4QW9A 5HSPA 2MZQA 1NJYA 1NJIT 1X4FA 5D15A 1RHMB 4ELTA 1EQMA 1V6HA 2HS4A 2WSEC 2RMLA 4NLQA 5KG5A 3GONA 5J2QB 3G96A 1FJGJ 3PJ9A 3I55S 2P6TA 3M8WA 1VISA 1UJ5A 3PRDA 2HVEA 2E66A 2W4PA 2YX4A 3PEJA 2OH2A 1HKAA 3NBPA 4DQQA 2IBOA 1CS4A 4K4XA 2MHEA 1JKHB 4WTOB 4WE1A 1HYSA 1H98A 2VBXA 1I6JA 3TAPA 4DSIA 3W9JA 2B0GA 3JQKA 3HHLB 2EFOA 4M94A 2W2QP 1RKJA 1SC1B 3PTWA 1SUQB 5IQ6A 4IFYB 1NK7A 1WNEA 3TJ8A 2XB2D 2MY8A 1UVNA 2M2BA 3BGRA 3V4IB 1J2VA 3HPOA 2VJVA 4TNOA 5L38A 5DG7A 2IA6A 3KHRA 4IFVA 3TJ9A 1N32F 4UF4A 3CJQA 3AB2B 3PZPA 3GV5B 3DHWC 1UVKA 4WU2A 4FF2A 1ROFA 3GIJA 4I6WA 1M90T 3DLKA 2ZBQA 4RW9B 4NMLA 4AD6A 1AA1B 5LSOA 3MCOA 1N36J 4JI5F 1IKYA 4IOCQ 1P1LA 1N34J 3MEGB 1KLMB 1HNXF 2Y0SD 2D3UA 5IS2A 1JLFA 3SQGB 2E29A 3I9ZA 4ETXA 2HVHA 1Q0NA 3ISND 3CJ4A 2CQIA 3CCQS 2MZ1A 2VU5A 3UVJA 1EQ0A 4U7UD 1O51A 4GVLA 2XSJA 1Y3KA 1HR0F 5EX0A 2CWXA 2HGMA 1TV6A 5AXMA 1MNEA 1QE1A 4H54A 2D3O1 5GMEA 1T7PA 1RT2B 1TQLA 3MCSA 1NB2A 3BKUA 1RT4B 2V8PA 1BQMB 3HK2A 1R3NA 2BJ8A 2ZVSA 3PY8A 4C8YA 2CJKA 4KTQA 4P7TA 1SL2A 4EBEA 4PQAA 5D3GA 2NREA 3G8SA 4M5MA 2M9KA 4F7VA 2HHHF 2OJ3A 4ZPAA 2ZFHA 4RW6B 1LV5A 3KK3B 3H5SA 1T95A 4DLEA 4QU6A 5KFQA 1CSJA 3GB0A 4OX9J 2KZMA 4O23A 4PUOA 4CO1A 4IRKA 1HHSA 3TWZA 1FRMA 1MG7A 3C14B 2JJ4D 1A6LA 4QR0A 4A46A 5K8OA 3LF0A 3IM9A 5KG7A 2DR6A 4OYPA 3SYZA 2DGUA 3PEHA 1IKWA 4KFBB 2JLEA 3NGKA 5F0UA 3WX8A 3RBDA 4NLTA 2CG4A 2HLTA 4URSA 5L1KA 3MMCB 1U26A 2ZZMA 1K1SA 3BJYA 5LMUJ 4QYRA 3WC2A 3IXQA 2K1RA 1UPMB 4AL7A 2V2QA 4Y2AA 2DRBA 4JV0A 5D0RA 4TKTA 4ED4A 1X9SA 2PI4A 3N5FA 4ENOA 1EKSA 3FCVA 4N8NA 4KE5A 5A8WB 2JFDA 3IGVA 3CT9A 1WACA 2H48B 2RSQA 3W63A 2Q6BA 1OYDA 3IMQJ 3CJ8A 3RB0A 3KUEA 2V94A 3KLIA 4PXDA 1BE4A 2B8QA 2BZ2A 2C3MA 1HNVA 3BBCA 3VAHA 3FEZA 1ZYQA 3BPDA 4DL3A 2R42A 5EWGA 2DITA 2K06A 3EGVA 3M1VB 4MH8A 4GRSA 4NX9A 3IRXB 3B6BA 2C22A 1U1NA 2HWIA 2MZRA 3ZTRA 3LPEA 1DHMA 4LQ9A 4E8UA 1S1UA 1TUGB 4YR2A 2OMLA 2GQCA 3IM8A 1JJ4A 5F8GA 2CJQA 3BGOP 4W90B 4DFPA 1FTCA
chains in the Genus database with same CATH topology
1NEEA 5DGBA 3M6UA 4IH6A 2IJNA 4PG5A 1ZM2A 4OLOA 4F67A 3OVBA 1ZTTA 4WK3A 1M5HA 4MFBB 5CA5A 5G0RA 1QM9A 1I1GA 4WXOA 2PC6A 5J1EA 4CH1A 3KLEB 5E5NA 3I5CA 4E0DA 3GFZA 2B4VA 4WFYA 1TL5A 4TYAA 4USJC 1NJXA 1RA6A 4BDPA 2MQMA 1SV5A 1TZ0A 2HNYB 3JTOA 4HHJA 1S9FA 1AW0A 5KTQA 2BDPA 2DNRA 1JLAB 1FVQA 1DAXA 3POTA 1DTTB 1S4FA 4OI1A 2DGWA 1RWUA 4OZ1A 4J9QA 2XHWA 1FJGF 2DNLA 1T05A 1HWIA 3J81Y 4Y34A 5I3UA 2O1PA 1CEZA 3FFIA 7FD1A 3I5AA 1FRKA 2DH8A 2RNEA 3GFHA 2Y1RI 2ATLA 1TUVA 1FD2A 2DGXA 1URNA 3JYTA 1VQOS 3L09A 3R5BA 2VOOA 4AQYF 2KHCA 5F8LA 2C2EA 3TA0A 3RBEA 4NYPA 1HWUA 2ALZA 4DL2A 4DSJA 3TYTA 4J9LA 2YH1A 3EXYA 5M2RA 2ZJQQ 1R31A 1KNZA 2POKA 5B0EA 5KG4A 3V4MA 4B3MF 4BC9A 2FJXA 3M6VA 3IG1A 3VZHA 2HMIA 2BABA 1YITS 4N76A 2HAIA 4Y2IA 2CZ4A 1QAIA 1D8ZA 2RKIB 3QZ8A 2ZM6F 2YKPA 1N5YA 2MZTA 3PFOA 2C2DA 5GMKa 1RT3B 2CQHA 3D5MA 3PW4A 2HQ3A 3IWLA 2W7OA 1JLQB 1N5TA 4X4OA 2YVSA 4Y65A 1NKEA 2RU9A 2FC8A 3ZC4A 2XGPA 3K58A 4ZP9A 3OHBA 3RRGA 3NCRA 4B08A 2ZH5A 1WTBA 3H59A 5HQ8A 3HMJG 3MR6A 3HVTA 3H4DA 5MLCV 4NL5A 1ZBTA 4RKUC 4ZHRB 1UL3A 1HNIB 2HGNA 2J9DA 1T02A 1J5OA 1TL1A 3LO3A 1S1TB 3D1OA 4X4RA 2GHPA 3HO1A 4V19J 3HVAA 2U1AA 1RTIA 3V81A 4XO0A 4QWAA 2ZZNA 1S79A 5KFPA 4RUCA 2FJAB 5CHCB 2HLUA 3N01A 3GSDA 1ELOA 1DQ8A 2DNPA 3T9ZA 2AYEA 4G1QA 4NLYA 4HI2A 3K5LA 2DHAA 4IOAQ 3C66A 4PPDA 1UVLA 3KNGA 1SH0A 4ZCIA 5IT0A 3SSSA 4GO5X 4ED8A 2C42A 3J80Y 4I1TA 5J1PA 2VFSA 3QGHA 2GIRA 2ZD1B 3VR1A 3N79A 3IO1A 4FYDA 4DF8A 4URGA 2ZE2A 2W9BA 4ITSA 3LWMA 1Q53A 3ENQA 4NLDA 1H2UX 2IHR1 1IBKF 1DTQA 2HWTA 2RJZA 2YKQA 4ZPCA 3BQ0A 1MU2B 5FJ4A 3I0SA 4EBDA 4LF8F 3VAKA 3C6UA 2DNQA 3N0VA 1X4CA 2ERRA 2MQNA 3OXLA 3OL9A 2ABYA 3PHEA 4A8MP 4OHVA 4IG3A 3PACA 4ZPBA 4A8FA 1FDDA 3I82A 2UZAA 3W2VA 3O44A 1K73T 3QWPA 5KFEA 2LA4A 3O2IA 4GC6A 3JB9k 3H40A 4Z37A 2J0XA 1F0XA 1MMLA 1HQUA 4HYKA 2BJEA 2YKMB 5A6WA 4DV4F 2HNZB 3CUNA 4C8OA 3OFFA 3M9MB 4K4VA 3DGPA 3S1TA 3PW5A 4IR9A 1ZH5A 4I67A 2QE5A 4QIEA 4KHRA 5EWFA 2LXUA 3J7Z5 3UR3C 2YKOA 3EX7B 3DOMA 4RW8B 4PG8A 4ECZA 2VPXB 4DV2F 3DLLQ 1LWEB 1N36F 2HHUA 1VBYA 2M8HA 1SJ4P 4K4ZA 1WHWA 2NUUG 4I4BA 4PRFA 3G8QA 3KMSA 3MDFA 5J2QA 1N34F 2FJBB 3OJSA 2XZWA 2CQDA 4I2QA 4K2XA 5J2NA 2OP5A 2HFOA 3FZBA 4C3LA 1N56A 2FLOA 3M2VA 4Q7AA 4QCLA 1RTJA 2HWHA 4KO0A 2JRSA 4G1IA 4DMZA 5IWAF 2V4JA 4LIRA 1HI0P 2QFJA 4YB1P 2IRXA 3K5PA 4WU3A 2MKCA 3EXCX 4F4XA 5L9NA 3NBPB 1XC9A 4DR6F 4CZCA 4RU2A 2YNGB 1YJNS 2YWGA 3D28A 1HBMB 2V8DA 2L9NA 4IO9Q 1U1QA 5L8RC 3TOQA 5LJ5Y 4DX8H 4N41A 1B0TA 2YKNB 1E6VA 4LVOP 4C4WA 1H2TZ 5EHHA 2N7CA 2VASA 3TUZC 1S6QB 2CFXA 2W9CB 1FHTA 1VRUA 4NYOA 5CYQB 1R0AB 4XDCA 4IQXA 3SZ2A 1JKHA 5E0OA 5D8HB 1LW0B 4PQUB 3GYNA 1KN6A 3CF5Q 4CTAA 2FVQA 4L72B 1N6QB 3E2EA 2DK2A 3P49B 4ZVHA 1O5JA 2CIMA 2AF6A 4JI3F 2ZC3A 4RUAA 3FNNA 2DGTA 3RAMA 2WRMA 1HBUB 4Y00A 3W2WB 4DS4A 2D41A 4R5PB 2FDNA 4Q0BB 3MD3A 4AE5A 1QVGR 2IJFA 3HHLA 2FUG9 2GQQA 3UPFA 2BW2A 5L1JA 5E3CA 3E51A 1FKPA 2R7UA 1IQZA 2ZH9A 3BGLA 3CCSS 2DD8S 3RB6A 2ZOGA 1S1VB 1C0TA 2WOMB 1SUQA 1OS5A 3MF5A 3FQLA 4EYHB 3B4MA 3CXCR 5KFVA 3CJKB 2X51A 4MIAA 3QGPA 2KG1A 1DQ9A 3GQCA 3CD0A 5KT2A 4DSEA 5HROA 3MM6B 5FDLB 3C46A 3TUIC 4I56A 2JHEA 3FMBA 5C25B 1C4CA 5I42B 3CCJS 3LP0B 4G3IA 2IMOA 1YSJA 1RT7B 3VAFA 4GKJF 2LU1A 4F3MA 1ZAWA 1ZZFA 4I7FB 3U1NA 4O3NA 1LW2A 3V6DB 1U48A 2MHNA 4FS2A 3OJUA 3LGMA 3TA2A 1KFDA 5C42B 1RJJA 4I2PB 4ECWA 3GZ7A 1DLOA 2L9WA 3N6MA 5LXRA 2JLFA 3UE2A 3NNHA 2GCFA 2UUTA 4Y28C 4JI2F 3SSRA 5IFMA 3V6JA 4ZA1A 1Q8IA 4KSEB 4WYLA 4ZCKA 2IVYA 3GIMA 4PWDB 1R43A 2QV6A 1VK3A 4IQMA 3D0HE 1U49A 2HVIA 5E3QA 4UW2A 6FDRA 2L9DA 3R1LA 1NK6A 2JVRA 2V0NA 1Z2LA 2CQ3A 1GNKA 5KT7A 2WW8A 2GQ2A 1U4BA 1YJWS 1S0OA 2QRRA 3V6HA 2HRYA 4QQBA 3Q0AA 1WG1A 1FDNA 1UWBB 3DI6A 2KFYA 2ZHAA 2PD1A 3SFUA 3I0RA 3QLHB 4RW9A 3PJXA 4J9KA 2VODA 3RTVA 2NYIA 1TL4A 1IKYB 2W24A 3CJ2A 3MM9A 1LWCB 3CC7S 1KHVA 2VA2A 3DRSB 1BQNB 3PO5A 4WCEQ 5KOXA 1S76D 2BUNA 1CPZA 1X0FA 3HI9A 3K0JA 3MEGA 4D3GA 3V5RA 5KFSA 2R7SA 2N4DA 3HF5A 3M8RA 1ZPVA 5HP1B 2ZUGA 2FHJA 2K7JA 4DLGA 4XIUA 4AFFA 3FRYA 2N82B 2V8HA 4NRTA 3IFEA 3JSBA 3MR2A 3ULHA 4FNHA 2DGOA 4ES3A 1VQMS 4OL8A 4Q5VA 1S10A 2QEXS 3HVRA 2R8HA 4F2RA 2DPJA 1YI2S 4ES1A 5C24B 3F56A 4ZPWR 3UD4P 3LALA 3KLGA 3AQPA 1S1WB 3G9CA 1MMDA 2VFVA 4KBIA 1FDAA 2XLIA 2B51A 3BSNA 4OI6A 4ZS6A 2YX1A 4EWTA 2Z0GA 2JC1A 3HVWA 3OVSA 4ZPVR 2ROGA 1HMVA 3EGZA 4TY8A 3LOUA 5LMUF 3MECB 1SH3A 2SXLA 4XK8C 4U67Q 2DPIA 4N56A 4CO5A 5A0YA 3SDEB 1S9GA 3FZ2A 3QJJA 2HFZA 2CQBA 4P7VA 3RB4A 3H2LA 3ITHA 4WYWA 1WEXA 5KT3A 1QTMA 5B0CA 2EW9A 3TVZA 2PT0A 3THTA 3AH6A 1QE1B 2RB7A 1ZZNA 1CC8A 3RR8A 1WTFA 3WC0A 4OJHA 2VD3A 3L95X 4Q43A 3TI0A 4QWCA 3PNIA 1NK5A 1WHVA 2E1MC 4J9RA 1GX5A 1IBMF 1MW7A 1X4HA 3P5TL 4BWJA 5IXUA 4NXMF 4HDGA 3CD7A 4C8MA 1OO0B 1RISA 1N5SA 3HLUA 4NLSA 1QLNA 1RT4A 2DH9A 2MMYA 1U7LA 1ZM4A 3ISZA 2P9EA 2KXHA 3QMQA 3UQSA 1VC6A 2HZCA 3C6TA 2X1AA 3QGGA 2DCLA 2KDOA 2J76E 1KONA 4UOCA 2XI3A 3S8SA 4Q8FA 2CPHA 1BQMA 3J7A1 1JNRB 4PPZA 4GKKF 3RZAA 4ID5A 3MR3A 4WKRA 4I64A 4DV0F 4X4UA 2PA3A 3TO8A 4EU0A 2HNDA 2MZJA 4EO6A 1D0EA 4OZLA 4X4SA 3VWSA 4Q45A 2XEXA 2JEGA 1TK5A 1TKZA 5T7LB 3LAKA 4TQRA 5D3GB 3C2PA 1A7GE 4K59A 2D9OA 2A10A 1TP7A 4USIA 3OV7A 2DR9A 3T9NA 5JXSA 3UW1A 2EBGA 3KMQA 3HX9A 2ILYA 4DV1F 4A8KA 2YNFA 4TLRA 4MKYA 1HBOB 2OPRA 4F25A 3CCES 1NK9A 1XMBA 3OR2B 2VPYB 1Q4RA 3KK3A 2LKZA 2MKSA 4ZLPA 4XPCA 2DISA 5E41A 2M70A 2N3OA 3KG0A 1M5VC 1C0UA 4A47A 1RDRA 1CQNA 1PO6A 3MHYA 4F2SA 2PMHA 2R7RA 3M9OB 5DM7Q 5KFZA 2ZJPQ 5IM0A 4FP9A 1FNOA 4RZRA 1PC4A 3M32A 5M2PA 4ZP7A 5KT4A 2DCUB 3VALA 3ZFVA 3C8YA 1ZM9A 2CQCA 1Q16B 2ZBIA 2DNMA 2W7AA 1DBDA 3QIPA 4I6AA 3K59A 2UVWA 2BANB 2C3UA 2W4DA 5J1NA 5KG6A 5HLFB 1SBRA 2GW8A 3ZZZA 4I0WA 4I68A 2J7KA 2LDIA 2IAJA 1RT1A 4WFZA 1IN0A 1WHYA 2KXNB 1IKVB 1Q82T 2JL9A 5EWEA 2FHOB 1X7VA 1S9EB 1S6UA 2LXIA 3GILA 1J5EF 1LKZA 2FLPA 4ILLA 2OSQA 5LSLA 1U6BA 1OPZA 2J7UA 1TK0A 1RTHA 3X3UA 4KHMA 3Q23A 2HHQA 1FDBA 5KFLA 1TFWA 2Q3PA 5A8KB 2CPIA 2MGZB 4ECVA 3TANA 2HHTA 4JV1A 3NLCA 1JJ2R 1XR5A 3J7YU 3CCUS 2V8VA 4RW4B 4A8SA 1IKXA 3PX4A 1X8DA 1T94A 2F4VF 3BF4A 5DQGA 3DFEA 3MMCA 1Q7LB 4MJKA 1FEEA 3IAM9 1Y9OA 1C1BA 4B3OB 4LJMA 3OTCA 2FVRA 4RW7A 1V3RA 2HYIB 2IMWP 1DZ5A 2UV8G 4QZVB 2LECA 2XY6A 2V2KA 4DHVA 1HWKA 3IS9A 1X5SA 1JLBA 3ONQA 3VTIA 4F8RA 3R1HA 2K1RB 2GGPB 2ZOFA 3SSQA 3BSAA 5BR8F 1HNZF 3DHXA 2ZH6A 1K0TA 1P27B 2E1RA 4CO2A 1BGXT 4NLRA 3S01A 2LYVA 3M2RA 1HWJA 3N5BA 2BRKA 3OL8A 3M8PB 2OPPB 3BN4A 2XC9A 1HL6A 3LUYA 4CCHA 4DL0C 4DG1B 5F8MA 3OL6A 5KOWA 1C2PA 1C1CA 5FIIA 3GFYA 4FF1A 4J5OA 1LFPA 4IOBA 1ZOTA 1YJRA 3HHLC 4OHWA 3MPYA 3MMAB 3KHGA 4DQSA 2KFNA 5K14B 5KFBA 3B4DA 4NRUA 1FKOB 4MIBA 2B9WA 3NAIA 3LANA 2G1DA 3WDOA 4FBUA 2R8IA 2YWHA 4YEAA 5AJ3F 1KSPA 5KT6A 4FVMA 2KYZA 4RBTA 3IC1A 1HQEB 4WFBQ 1JNZB 4B9TA 4DR3F 4O3SA 4KKOA 1PILA 2JC0A 1CQMA 3D2WA 5DLFA 4OJGA 1REVA 4DUYF 2YWKA 4ECUA 2XMVA 3U1MA 2A2CA 2MSTA 3M30A 4PWUA 4TQSA 1JLEB 2VC0A 1XR7A 1VBXA 3BGUA 3KJVB 4TLQA 1IJEB 5DETA 2N7YA 5G4DA 2I5JB 4K4SA 2DTJA 1X4DA 4BC7A 4C0HA 3CCRS 4LF5F 3DCAA 2BQRA 5JVGQ 4WFXA 1R27B 4AYBD 3NRBA 4C3KA 5GAGI 2WBMA 1UP1A 2QT7A 2AJ0A 2VPWB 1T03A 4EZ9A 4ELUA