3BR8A

Crystal structure of acylphosphatase from bacillus subtilis
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
90
structure length
90
Chain Sequence
MLQYRIIVDGRVQGVGFRYFVQMEADKRKLAGWVKNRDDGRVEILAEGPENALQSFVEAVKNGSPFSKVTDISVTESRSLEGHHRFSIVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Transitions Revealed by Structures of Acylphosphatase from Bacillus subtilis in Different States
rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Probable acylphosphatase
total genus 19
structure length 90
sequence length 90
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3br8A00
2ROPA 4HI2A 5B0CA 2GV1A 2AW0A 3HHLC 2KT3A 2ACYA 1FVSA 2Q3PA 3IWXA 4U9RA 2VV5A 4OJ1A 4YDXA 2GGPA 2IFXA 1SI9A 4DL0C 3HHLA 2XMVA 1AW0A 2K7KA 2QLWA 5B0BA 1OQ3A 2OD4A 2KT2A 3FMBA 4OJHA 1AFJA 1Q53A 2BUNA 2GO8A 2ZDOA 1W2IA 3KG1A 4HH1A 2K2PA 2N4CA 2ZDPA 4HI1A 2ROEA 1FE0A 1YJUA 2BJDA 2KYZA 2LDIA 1WD6A 4F67A 5A6WA 2AJ1A 2LQ9A 2N4DA 4A4JA 2OKQA 2K1RB 1JK9B 3HFKA 3E8OA 2RSQA 3CJKA 1Q4RA 3KNGA 3T9NA 3BGUA 3BM7A 2RU9A 2OFHX 1KVJA 5B08A 1FESA 3HHLB 1Y9OA 4QOTA 3HF5A 2ROGA 3DCAA 1SQEA 3HHLD 4OJGA 5IXUA 2LQBA 1S6UA 1S6OA 1YRXA 3LGNA 2XMWA 1Y3JA 3BR8A 1TUVA 3KG0A 1RJJA 1OSDA 3K7RA 3MZIA 2XMUA 4HH0A 3FRYA 2BJEA 1CC7A 2JDJA 3BDEA 1Q8BA 1X7VA 1Y0HA 5B0FA 1TL5A 3F44A 1APSA 4ZOSA 1CC8A 2EW9A 2QYCA 4FNIA 1VQSA 2GFFA 3QGPA 4A48A 2BBEA 4OIXA 1N5TA 2FHMA 2AP6A 1OPZA 1TZ0A 1U7LA 2HIQA 2IYIA 3GZ7A 3LGMA 2OP5A 1VQYA 1YJTA 2HFNA 2GA7A 2OFGX 2RILA 2XMMA 1YG0A 1LQ9A 2FTRA 2HQIA 2W4PA 3HX9A 5T7LB 1SB6A 2IYGA 4A46A 2L3MA 4YEAA 1AFIA 2HLTA 2XMJA 1P8GA 1URRA 2K7JA 2OD6A 1Q8LA 4Y2KA 1XBWA 1CPZA 4Y2IA 4Q2LA 1TR0A 2GGPB 4FNHA 3VTIA 4Q2MA 1IUJA 2PD1A 5B09A 1FE4A 2OMOA 1FD8A 2FIUA 4Y2MA 1KQKA 1N5VA 3UDCA 5F0WA 5KAKA 1K0VA 2QLXA 5T7LA 2CRLA 2N7YA 2RMLA 5F0UA 3TOQA 2BYCA 1R6YA 3WDOA 1X0PA 2XMTA 1X8DA 3BB5A 4NPOA 5B0GA 2PGCA 1JWWA 2W4CA 2XMKA 4OJ3A 1FEEA 1OQ6A 1Y3KA 3BN7A 2W4DA 4A47A 1YJRA 1MWZA 2AJ0A 2HLUA 2KKHA 2LXFA 5A6PA 4DN9A 3BF4A 4NL5A 2ASYA 2OAUA 5B0AA 3LO3A 1MWYA 2VH7A 1GXTA 3KKFA 3QMQA 2GCFA 1KVIA 1V3ZA 1GXUA 1P6TA 5B0EA 2HFOA 1QUPA 4EFAC 3MCSA 5B0DA 3FGVA 4ZA1A 3HDSA 4HL9A 3TNVA 1N5QA 1N5SA 4DPOA 2K1RA 3I9ZA 3CJKB 1FVQA 1TL4A 2FB0A 3TRGA 3IWLA 5K9FA 1YJVA 2QIFA 3DXSX 1ULRA 2G9OA
chains in the Genus database with same CATH superfamily
1WHVA 2GV1A 3HHLC 3JTOA 1X0FA 2ABYA 1H7WA 1U1QA 4DQIA 2LCWA 1TK0A 2CPHA 3IS9B 3JQMA 4TLQA 2A3JA 1IR1A 3TZXA 2JEGA 3C6UB 3W66A 4QWCA 3TUIC 3KG1A 3OUYA 2BXJA 3Q2TC 1DRZA 2J0QD 2RKIB 3MECB 3O8WA 3QGGA 3MAQA 4EBDA 4P7VA 1S6QB 2M70A 5ETOA 5JMNA 2E5LF 2MXYA 2DY1A 4O3PA 3SV3A 4NA1A 2BE9B 3ZTQA 1N88A 3HVWA 1RT5B 3PG9A 2IM2A 2DCLA 3D0GE 4O4GA 3HT3A 1TUWA 4KTQA 2B7CB 1SL0A 4I1TA 3S1TA 3KLEA 1WJ9A 1YJNS 4K50A 4FF3A 2XY6A 4P74A 4ZLPA 1XMOJ 2R7OA 2MMYA 2HVEA 2F4VF 4DCPB 5J2PB 4KGVB 7FDRA 3G8SA 1Q82T 3OTEA 3LGHA 3T5HA 3W9JA 2YNIA 1D8YA 4C8ZA 4ZKAA 2UVUA 2YPZA 3KJQB 1L3TA 1WF2A 4ZPVR 4KC5A 4CM0A 2EFQA 2LQ8A 4ATNA 3NNHA 1R89A 3HD2A 5K20B 2MQOA 2V68A 2IBOA 1HKAA 2GFFA 1UPMB 1NHUA 3N6LA 5E5NA 3IMQJ 2XYGB 4RNOA 4CDIA 1ZZFA 2YNFB 4E8UA 3LGMA 1FJEB 1D9DA 1JLEA 3PRBA 1CULA 1HR0F 2DY9A 5KT4A 4KO0B 5AE2A 1VC0A 4JI7J 1IM6A 2BJ8A 1FTCA 1NCLA 2C2ZB 3IGVA 4RJVA 1HR0J 3LP1B 4DUYJ 2DPJA 2ZH3A 1FA0A 3IM8A 1VQLS 3MM6A 2IYGA 3SSQA 2ALZA 4G3IA 3AOAA 4YY3F 3T1HF 1N0UA 1VQPS 3GYXB 1VQ4S 4QBUA 3UCZP 4OLPA 1IBMF 2K7JA 4TXSA 1L5UA 2DPIA 2VG7B 3PX4A 1RLCL 1SV5B 2YXLA 2VBXA 3EVOA 1KOHA 3V81B 5DG7A 1VQMS 2NPIA 1EQMA 3GR1A 2MZTA 2JEFA 2B56A 2MLYA 4Y28C 4CNZA 4B3RJ 1KQKA 2IVMA 3FFIA 2CQBA 3AA8A 2V6AA 1FK9A 2B9YA 2HFUA 2N7YA 3NG8A 3ULHA 3MUTP 4H4OA 1S9EA 2I5JB 4MFBB 5K8MA 5HROB 4MKVA 1SJFA 2EVZA 4ILRA 4NLDA 3UCGA 3NCPA 4YS2A 4XO0A 2MB0B 4C8LA 4B9LA 4HKQA 2VQFJ 2ZOMA 3H2VE 3ZFVA 1QJHA 3ITHA 1RAIB 1NKBA 5ETSA 2FQQB 2NUUG 2GVDA 5LSRA 5KOXA 2OO4A 4ZIVA 1JLFA 2N7CA 2P6TA 2KHCA 3KWMA 1VS3A 1C2PA 3KLFA 1DTTB 2L9WA 3UW1A 5DG8A 3CF5Q 5DLGA 4EBEA 2W9CB 2NSBA 2CQPA 2Q6CA 1IWGA 3LP0B 3HP6A 2ZH9A 2IM1A 3DDNA 3HCXA 5B0EA 3F41A 5KFUA 1IBCB 2HYIB 4DBQA 2Z8QA 3VQSA 2YVSA 5E3RA 4UT4A 1A9NB 1FO1A 5MAOA 1WSRA 2MQLA 4FF4A 5KG6A 1FRJA 1HWLA 3MOJB 3ZTSA 4P75A 4Y2AA 1G1XA 4JYAJ 2XTJP 4OHZA 5KFKA 1S1XB 2V0NA 1UCNA 1KD1T 2O1PA 1U45A 3F56A 1HLWA 1BQMA 4DV5F 3QJLA 3FCVA 1S1TA 2AEMA 4JV2A 1HARA 1K0TA 1SVDA 2B4PA 1B0PA 4ZVTB 3GP9A 1MNEA 4U9RA 3WC2A 2ZBQA 2C3MA 1N54B 2DEJA 5D4OA 2HHWA 2Y0BB 3M8QA 4C0HA 2VFRA 4RNNA 4J9KA 4CLLA 2ZNZA 4K4WA 3L9ZA 3ZNJ1 4DR3J 3L3CA 1T95A 4RNFA 4LFAF 2Q66A 3W65A 3GILA 4NE9C 4DUZJ 2HHHJ 4NXNF 2DRAA 5HMZA 3EICA 1PC5A 1CEZA 4AXJA 4C8NA 1SKWA 5BXIA 1M90T 2LA6A 4U8VA 4ED8A 4JI1F 5B08A 1B4SA 2KZZA 3BQ0A 1U2CA 4NASA 3H20A 3BSOA 3TAPA 1Y4ZB 3R5GA 4NXMF 3HHLD 1TP7A 1HYSB 1NZ8A 2RQ4A 2V63A 1B0TA 2CQ0A 4J37A 4JI5F 4TY8A 3UD3P 1X4HA 1UVJA 2XNRA 1FD2A 4ECXA 5IM0A 3A12A 1F9HA 4ED7A 3KHLA 5A2QU 1HWJA 2XY7A 2DNRA 3K5OA 1RWNB 1X5PA 2G1DA 3DGPA 1D09B 2FLNA 1WNEA 1HBUA 2YWEA 1S4FA 3PNIA 2R8KA 4ZPDA 2GMLA 1JLCB 2F3JA 3UN2A 4KV8B 4PUOA 3PW5A 2L9NA 1EJ7L 5HQMA 1R27B 1N36F 4DSEA 3FVYA 3R6GB 3GJTB 1N5TA 5LMUF 2BW7A 4BBYA 2BJ9A 3T5KA 3M8WA 5KTQA 2MY8A 3UQSA 1M5KC 1KS2A 1TKXB 3AD8C 1SPBP 5T7LB 4USMA 3PJ9A 3DOLA 3R97A 2DRDA 3CDBA 4Z2XA 4YHHJ 3PW4A 1U1KA 2CXEA 2XYHB 3K57A 3Q22A 2EPIA 3FC9A 3I0SB 5A8RB 4JV5J 2UUTA 4CTAB 4YB6A 2QA1A 4JV5F 1XN9A 3CJRA 2V94A 4EEYA 2XYPB 2DNGA 3D7SB 3L7PA 4E98A 2PD1A 2VA3A 5B09A 3CC7S 2UXBF 2YNHA 5BR8F 2MLZA 4Y2MA 4K4XA 3MF5A 4FP9A 5M2RA 2HBYB 3IRWP 2I2YA 1REVB 3CD5A 4DS5A 3T1HJ 4QW9A 3W3SA 2DHAA 4USVA 4BWMA 1WKLA 2B8QA 1GTEA 4ED4A 5A2QY 2V5HG 4X4RA 2ZH8A 2QL7B 1IQTA 1FDNA 1ACMB 2IJFA 2RKIA 5HJYA 2RU3A 1YJRA 1RHQB 4DI6A 2YWHA 2AT1B 2VC0A 3G6ES 2VG6A 3NEKA 2R2SA 2FVRA 3LO3A 4JV1A 2W2OP 4XAKA 2D3O1 4OLOA 3MGJA 6FDRA 1NJYA 2F4FA 2DNMA 3AY0A 5DM6Q 1PYOB 5D4PA 3IRXA 4WFYA 2E1AA 1HQEA 4BC7A 1T0TV 4TY9A 5J2NB 4AQYJ 1RWWB 3CMES 2IMOA 2PN6A 3P5BP 3W8GA 3WIVA 2G2YA 4CH7A 1UEKA 4L3KA 3LPYA 3CJKB 1J2VA 4QCLA 1FVQA 4NMXA 4GKKJ 5BR8J 2XBPA 1HNWJ 3FQKA 2UXBJ 1F2GA 4J9RA 1BD6A 1QY7A 2WVEA 2DYAA 5HAOA 5C24B 4DPWA 2W9BB 1H38A 5HQ8A 4IOCQ 2VONA 2OMLA 3NAIA 3HVTB 2QTWA 1M5PC 1SIWB 1SBRA 3RU0A 1BHNA 1NDLA 2VG7A 4IFVA 2VV5A 4OJ1A 4ZPTR 1JJ4A 2W25A 1OQ3A 2WRMA 4RBUA 1PGZA 5AXNA 3ZZUA 4HI1A 4ICLA 1WEZA 2ROEA 3QBCA 2FD2A 3DU5A 4I68A 1VRQC 4WU2A 4ZVHA 2V8PA 1CBKA 3VWSA 4YP3A 1YWXA 3M6WA 3D54A 2DXDA 2PT0A 5KG5A 3IAM9 2OKQA 2I8EA 5KFRA 4CQ1A 2RSQA 3KUHA 3GSIA 4NLPA 2KYXA 2ZWPA 1NU4A 4H4KC 2XLIA 3V6KA 5J2MA 3KK1B 2KRRA 1RWMB 5HLFA 1N5YB 4K4SA 2YWGA 2OFHX 2V9KA 8RUCA 1GNKA 4A8MP 1VQNS 4LFCF 2R7UA 2ZH6A 4QIGA 2IAJA 5E3PA 2HNDB 3BO3A 4OI0A 4IOAQ 1Z1ZA 3J80U 1KSPA 4KT0C 1WELA 5B7WA 3TUJC 5JVHQ 1JNZB 1Q95G 3OBIA 3QT8A 3MZIA 4DG1B 2ZH7A 1FWLA 2X1FA 3LP0A 3PJWA 5IC6B 2KB2A 1CC7A 2JDJA 2QLBB 2GVDB 5M2UA 3PO4A 5LM7E 1VGYA 1RTHB 1QAXA 1RK8A 3R5DA 1WC6A 5A0YA 2U1AA 4B9NA 1NK7A 1XJWB 2AGPA 3KLEB 1VHIA 1TAQA 1QVFR 4NLYA 4D3HA 4WP9A 4DCJB 4K0KJ 4ZK7M 2OP5A 3NBPB 4NA3A 2QFJA 2OEMA 1YJTA 4M8LA 4C8MA 4F4XA 4TQSA 5HP1B 3MM5B 2DGUA 5IT4A 1RXOB 4QPTA 4DQPA 2HNDA 2A18A 3C14A 4DV3J 4O4RA 4RO0A 2KFNA 2QL5B 1AZSB 4IG0B 4IRKA 1JLGA 2DGQA 3DLGA 4UOCA 4O3NA 2V4QA 2R8HA 4BDPA 3MAHA 1M1KT 5I3UB 2F5GA 3GIMA 2LP4A 1D3WA 1ZETA 2FHJA 2GGPB 4WIIA 3LP2A 4A8FA 3Q8QB 3VAIA 1FE4A 3E01B 1RT1B 1BMQB 1SXLA 3D3CJ 3DOKA 1X5OA 3G6YA 1C1CA 4LF5F 4C11B 4F3OA 2C2DA 1K0VA 4ZVGA 4F04B 1WEYA 2CRLA 2KVIA 1RUSA 3GG1A 4YR0A 2VQEJ 1UWBB 2A1BA 2R2UA 3ONQA 2DISA 4C4WA 2F8EX 3N79A 4P2XA 2HFSA 2M2BA 2WW8A 3LTOA 5GAGU 3TJ9A 1CQMA 3BO2A 2D3OR 2FC9A 3LA0A 1NK4A 4OZ5A 4IUFA 3PX6A 4M5MA 3N0VA 5EX3A 4JI3J 5KFWA 2DNOA 3BN7A 3CNQP 5IOLA 4A47A 2F8MA 4X4VA 3CIMA 1N6QA 2IHR1 1M1HA 1YTYA 1TTHB 3R5JB 4DN9A 1L3VA 1TL7A 3J7YI 2J6SA 3Q89A 1GXTA 1Y00A 2FJWA 4FBTA 5JXSA 2FGCA 1H0HB 2YX4A 4DPXA 2CPYA 5E3AA 2HK2A 4KGZB 2VQFF 4UOFA 3MMBB 3SV4A 3MPUB 1S76D 4H4MA 4HTIA 5KFVA 1RT6A 4TY8B 1N4LA 2H9ZA 2IJNA 5K14B 1EAYC 1TL4A 3HHNB 3T3FA 1LK7A 1XR7A 2VICA 3BKFA 1MN7A 4ED3A 2OIHA 5AE1A 2VIHA 3JB9k 2C2NA 3M30A 2ADBA 2YKMA 2BACA 2FC8A 2DT9A 5AJ3F 2RD5C 4C3LA 1X60A 2YQ0A 4IH5A 2J9DE 3D5MA 2LXUA 4EZ6A 4B3SF 1RA7A 4OZJA 2F7VA 3UD4P 1NJWA 3LUYA 5J2QA 4NYOA 1FKAF 1I5OB 1GEHA 1HI8A 1GMWD 5B0BA 1RTZA 3QGIA 4WXOA 2DNLA 2HRTA 2ZC4A 4G6VB 4CTAA 1Q53A 5J2PA 1HBNA 4DQRA 1TKXA 5FD1A 4AYBD 3QZ7A 1CQNA 2BJ1A 4MAKA 2MQMA 4ZVRB 1FXDA 4DF4A 3R1HA 1D0EA 4OZ2A 1RZMA 4LF4J 1HQ2A 2N4DA 2QSFA 3OXGA 5DLFA 3UN5A 2WSEC 3PVXA 1V6HA 5F3ZA 1N56A 5DDPC 4UZBA 2VJVA 2FPHX 4V19J 2MKCA 1U6FA 3NNCA 3HHLB 2E9ZA 1FJGF 4A8YA 1JLBA 3OV7A 4R25A 4ED5A 2W7AA 4EMDA 2XS5A 2FHKA 2QO3A 3O6QA 1JLAA 2PDAA 2ZD1A 3R6LB 3W8PA 5CABA 4DV1F 2CJBA 1TUVA 2CG4A 1N34F 4RW7A 3B82A 5KG1A 2MGZB 3VAGA 1M5VC 1QSYA 2MQQA 3R5AA 4M5DB 3EM1A 3JAMY 5AJ3J 2R7RA 5LSOA 5LJ5Y 4FZVA 3H2LA 1K8AT 2ZWOA 1OS5A 2AJFE 4UOHA 4WFAQ 4DV7F 1S72S 3BH7B 1RAOA 3EX7B 4M1KA 2MQPA 2OSRA 3IRXB 3NNAA 1ZPVA 2EW9A 1VISA 3DLKB 3PJXA 4WTYA 1RWPB 4FYXB 4EU0A 3MFIA 4LBIA 3U1MA 3UDEA 1NKCA 1KNZA 2KXNB 3MI7X 2B5JA 4DU7A 4HEA9 2FVPA 1NDPA 1RHKB 1TL1B 2DCUB 3EVWA 5IM0B 3P45B 3QIDA 3N6MA 4DV6F 5F8JA 4DV0F 5FDLB 2ACMA 2FTRA 2WVCA 3UWTA 2FZCB 1UA0A 1RTDB 3M32A 1DAXA 1HNIB 2DGTA 1S1WA 2HS0A 4G1QA 2WSCC 5IFMA 1UVLA 3DLEA 2EFGA 1RB0A 1RTIA 2F40A 1N36J 4JI3F 1X9MA 1U8WA 2BEFA 4MKAA 2MDAA 3ISZA 4Q2MA 1IUJA 2XCAA 5CD4H 3HJFA 1R8CA 2D7SA 1BGXT 1G4CA 1UJ6A 5DDRC 3KLGB 2Q6BA 5D0HA 4ERDA 2W9AA 1V5VA 1U09A 1KRPA 4IR9A 4DSLA 5RUBA 3NGTA 5F0UA 2MLXA 5J2MB 3UN3A 3RGIA 3TOQA 4ETZA 3EPGA 3I5BA 3KUEA 1R6YA 4FXVA 4PQAA 5C7PA 1N48A 5CZXA 2QV6A 1S1XA 2HURA 2RRBA 2QMUB 3H98A 5KFOA 3KMQA 2B0GA 2X3DA 2CNLB 3UDVA 4ICLB 4J9SA 3M8SA 3G6XA 3JQJA 5DDOC 4IH6A 3TW0A 4FF2A 1DHMA 3NWGA 2W4DA 5CD4A 2FHJD 2XHWA 4OV6A 5C5JA 1UETA 2AV5A 2HHPA 3OHBA 2B9WA 1WUUA 1BQMB 2GCFA 3F0NA 2OPRA 2UZAA 1GMVA 3LAMA 1QUPA 4RX6A 4EFAC 3GE9A 3MCSA 4PXBA 3V6JA 2G0IA 4KY3A 4NX9A 5DQGA 3I9ZA 3OVAA 3VGSA 3I5CA 1IKVB 4NYZA 3TEGA 1UFWA 4KQZA 3DXSX 3MWBA 2BX6A 3W7BA 1T7PA 3R2DJ 4AXIA 1DJ0A 1KWMA 2PA3A 3I55S 3AJ2A 3ENQA 4F26A 4X64F 2MSSA 3GFYA 3T5LA 2W2PP 4DS4A 1NLKL 3MAAA 4I56A 4UW2A 4Z37A 2HWTA 2CZ4A 4WP3A 2DITA 2HQFA 5IZHA 5KT7A 4K4TA 2IFXA 4B3TF 5IWAJ 2XHCA 2K7KA 2R2TA 4ANCA 5IS2A 3ILLA 4KHRA 4Q45A 3R7BB 1HBMB 3ITHB 5IQ6A 4C2MA 2KHDA 2CJXB 3US5A 1QAJA 2LDIA 4PKDB 1CVJA 1RT1A 2AJ1A 4R0JA 2Y1IA 1SJ4P 2NZCA 2ZKTA 3DLGB 3HFKA 3IBCB 1SL1A 2D74B 2OPSB 3C6TB 1OO0B 1NDCA 2J9EA 3P5TL 3N28A 2RU9A 4A8QA 1RWKB 3ET6B 3PW7A 2ROGA 3Q8VA 5F8GA 4MK8A 3IR6B 3M9MB 2W2MP 2Z56B 5HMXA 1ZTWA 3P8BB 3LGNA 3EGVA 1S99A 3CPWR 3N01A 5L1IA 4ZJQA 1KEKA 1RT4B 4GVBA 1AUDA 2HHTA 4HHHA 2ADCA 2XMUA 4GO7X 1P9QC 4ZPWR 2BMBA 3M4XA 2A10A 1Q8BA 3DFEA 4EO6A 4QIFA 1RT6B 4N41A 1PSDA 3I0RB 4DFJA 3U27A 2IAJB 1CC8A 3MMBA 3K5LA 3CT9A 2WZ1A 2JLFA 4DV2J 1S4EA 1IKXA 1DARA 1RHMB 1WKKA 2EBGA 2BANA 3A3PB 4KB7A 4MK9A 4TVAB 2EFVA 4KGXB 4RR5A 3VAHA 5HSPA 1VK3A 2WVDA 2GX8A 1WOSA 5FIIA 4WFNQ 3ETMA 4X4SA 4TQRA 2NPFA 4PWDB 1U0SA 1B7YB 1R0BG 3CD6S 4IFYA 2B4VA 2V8HA 1TVRA 4H4MB 4F7VA 2D3UA 1U6BA 4KAIA 5L46A 1KR4A 2FZKB 2XMJA 1URRA 3FUYA 4IO9Q 4TU9A 2KXFA 1H98A 3MMAB 3GLJA 4U67Q 3AH6A 3V2UC 1SQGA 4ELVA 1TK5A 4NEYA 4LMZA 1Q86T 2QT7A 3MURP 1JQGA 3Q23A 4F0HA 3ZZZA 5DO2A 4K2XA 4XDDA 1VIOA 5KAKA 5IT0A 5D3GB 2QLXA 3E51A 3EVMA 3AJDA 1S6PB 4BS2A 3M2UA 2RMLA 1BWEA 1TU0B 2JLEA 3LQVA 1VJWA 3W1YC 1JB0C 1AZSA 3MR7A 4IG0A 1X0PA 2XMTA 4MIAA 2E5IA 3QIPA 4URQU 4OYWA 3U1NA 2KM8C 3CCES 1EZZB 4OZ3A 3AD7C 2B4OA 2B4UA 1RHUB 3O2IA 2IVYA 1IKWB 1TL3A 1TVRB 3D9BA 4QYZK 4N47A 3RYLA 3MHYA 1PIEA 4B3SJ 4AT1B 5KFDA 2RUGA 3C16B 2GHPA 3H4DA 1E6VA 2E7WA 4G1IA 1EB0A 2ZD1B 4IQXA 1TKTA 4OI2A 2PEBA 1HW9A 2CPXA 2CQ3A 3A8IA 3DRSB 4WYWA 4LF4F 1WC5A 4YFUA 4Y65A 1DBDA 1FDAA 1O8BA 4F36A 2K06A 2E1RA 4ZVUB 3T9ZA 2RVJA 4A8KA 1N34J 5HATA 3SDEB 3GFHA 2RDJA 3DHXA 4IFVB 1G2EA 5IWAF 3RW6A 1MMLA 1VC5A 2V4JB 5E3CA 2BE7D 2FJAB 3BGRA 4XIUA 4JI8J 3FQLA 1Y5NB 2RDDA 2NXUA 4IG3B 4O3QA 1VC6A 1J5EF 4QWDA 3TARA 5DGBA 2NXJA 2GIRA 2M52A 2B43A 3A8EA 3AQOA 5B0CA 2ASJA 1EX8A 2CPDA 1D9AA 1WF0A 2KT3A 1GXLA 3GONA 2KFYA 2EFPA 2M8HA 1KFDA 3NL0A 1PJ6A 2JVRA 4WZQA 4RUCA 2J0XA 1NJZA 2QLWA 3MEEB 3C19A 3OFFA 1WORA 5K14A 3G8TA 3GIIA 4C0OC 3M05A 4HH1A 1FNOA 2BDPA 2UUBF 1EP4B 3SQGA 3WBZA 2OPPA 3M1VA 4ZIWA 2QYGA 2QC3A 3DM2A 4HDHA 3IGNA 5KT2A 2UV8G 1K1QA 1Q5VA 5KG2A 2QLJB 3H4BA 2DHHA 2GC8A 3BM7A 4KPCA 4DUZF 2HHHF 3SEOA 1H72C 1MG7A 2MHNA 3HF5A 3NCQA 4FVMA 3TO8A 1QAIA 1U2FA 2CNOB 1S77D 4OL8A 1LOUA 1ZAXA 2CAJA 4C0BA 1S6UA 4I6YA 2WBRA 3UR3C 4BCAA 3CULA 1WSVA 5D0GA 2DR8A 4NI2B 2H65B 1OSDA 3FSYA 2EG1A 2E5HA 1RGVA 1GK8A 5DZ6A 3CCQS 4DOZA 2RIJA 3MPDA 3THPA 1UEVA 1XEZA 3VCDA 1ELOA 4URSA 4FBUA 3QPIA 1NBEB 2Y1RI 4J90A 1AA1B 1ZYQA 1BQNA 2OSQA 4WFZA 2HAFA 1VQSA 1Q78A 2YNGA 3MM8A 3QO9A 4A48A 2C2EA 2H3EB 4RW6B 2V8GA 3DYAB 4CIOA 1U7LA 4PYAA 1U1RA 4ZHRB 2VFSA 3QFHA 3J81j 3RAMA 3SFGA 4O4GB 4K2JA 1X5SA 5KFEA 2W4PA 2YNIB 3CCRS 4DL3A 4MJKA 2MYFA 4UZCA 2JFKA 1KTQA 3FEZA 4L3NA 2AJ2A 2L3MA 4ANEA 3IBWA 4YEAA 4MYUA 3TEHB 2X51A 5HL7Q 2FGOA 3AOCA 3DLKA 2KG1A 1IQZA 4CCHA 1RAGB 2DGVA 3K5NA 4FS1A 1IXKA 3VTIA 3OFHA 2VKRA 4J5OA 2XI2A 5KG7A 4DV7J 1VYAA 2RRNA 1W26A 1KC8T 4IO1A 5KFCA 3E3XA 2FIUA 4HDGA 3MUMP 1N5VA 4PQUB 3NGSA 5F0WA 2C2MB 1BQXA 4R0EA 3GYNA 4HYKA 1RT7B 2W7OA 2CQGA 3HHDA 2IM3A 3BN4A 1CS4B 2IRUA 4YB5A 3VQTA 3H25A 4G1QB 4DV1J 2BOAA 1AT1B 2EKNA 3FEXB 2HFVA 2W7PA 3DLEB 1U47A 1ICEB 3RR8A 4LF7F 4ZJOA 1SKUB 4DCOB 1QDUB 3V81A 1FJGJ 3M2RB 4JI4J 1HIYA 3MM9B 4P2MA 1RT2B 2YKQA 1FJ7A 5KFQA 2Z57B 1T02A 2ASYA 4NRUA 1A7GE 2JSXA 4I2PA 4IH7A 4AQYF 2KI2A 2UUBJ 1S9EB 2BOPA 2G2OA 1MWQA 2ZOFA 3GR0A 3IXQA 3MMJA 2ZZMA 1GXUA 4ZPAA 2CA9A 3MM5A 1FRIA 2ZH5A 1HNVB 2E5GA 4FKXA 1IBKJ 2P8IA 4TU7A 5T14A 3Q0AA 2RHQB 5J2QB 3IC1A 2DTJA 2OLWA 2K1RA 3FDSA 3K2YA 3K0JA 2E9TA 2UUCJ 4O23A 4ES1A 5ETTA 2EI5A 2HMIA 1VQOS 3LOUA 1CJVB 1V3RA 1OY6A 1Y7PA 4RUBA 4GC7A 2EC0A 1WEXA 4DQQA 2XB2D 2Z30B 3QAEA 1JLFB 3IR7B 2R7QA 3MR2A 2JFDA 1H7XA 1U02A 1TUGB 3EE3A 3GV7B 5LMNJ 4FPIA 4DPTA 2ZE2B 1CLFA 3CDUA 4F4WA 4Q8FA 3TQ1A 1DTTA 1HWKA 3H5YA 1Q7LB 5K5MA 1M0SA 5L1KA 3HHLA 3BKTA 2UXDF 2KT2A 3TUZC 4W90B 5T41A 1XMQJ 1RDRA 1DZ5A 3GWCA 2YKPA 4NLQA 1FE0A 1JLAB 3FNNA 1UVNA 1S6PA 3BS9A 4LF6J 2VOPA 2WAQD 4ZLLA 1LXNA 4LT6A 2K1RB 3PXGa 1S0OA 4QU6A 1EQ0A 3ZZPA 2HHVA 1TKDA 3BBFA 3SCLE 3DC2A 4N77A 2NUHA 1KVJA 4MMOA 3R9LA 2XLKA 2GQ2A 3OW2R 2SXLA 1WOPA 4LIWA 3OR2B 4Y0FA 1FCAA 1NSPA 2VZ9A 3HMJG 3PFOA 1KHWA 3I96A 1YGYA 5D15A 1VDHA 1JLEB 3SFUA 1CJTB 5GAGI 2QX0A 5KFYA 2C3PA 4B17A 2AEJA 2CVEA 2OPSA 3C6TA 4X4OA 2ZBPA 3LP1A 3W64A 2N3OA 3BDEA 1FWPA 3HHEA 2O67A 2Z2LA 4OYZA 3GV8B 2UV8A 2LQJA 4F50A 1WG5A 2DEIA 1B7FA 3HHKA 1RAJA 1MLAA 1FKPB 2XGPA 3GJRB 3M7VA 3QGPA 5LL6d 3J80Y 4OIXA 3LWLA 2AGQA 2R7SA 1VRTB 4DV3F 1NB2A 3MTKA 3HULA 1WI8A 2VPYB 5D6GA 3JS9A 1B70B 1HBNB 1NPKA 1AB8A 1WTFA 2ZC3A 1YG0A 2Q79A 2HQIA 4Z7YA 4A8XA 1P1TA 2VG5A 1NK8A 1FWKA 3A4TA 3Q8YA 3R27A 3PM9A 4L75A 4RW8A 4DFPA 1KVKA 1UTAA 1P8GA 2O01C 3CCWA 4LR7A 5F9NA 2Y1JA 4JI0J 1R0AB 4K4VA 3C6UA 3RRKA 4PWUA 5H9EJ 1WC0A 1TR0A 4DEZA 3CJ5A 4AL5A 3SBMA 4LFAJ 1PJ5A 2KVQE 1RAEB 1RT5A 2H4WB 3TWZA 3P6YC 1JLBB 1BC6A 2BKPA 2WSFC 2GIQA 2B51A 3LF0A 5GVQA 5HJXA 2MY7A 1FT8A 2WB1D 2GJIA 5L1JA 3C66A 1F1BB 4P52A 2ZZNA 5KFGA 3SCKE 1VLOA 2RQKA 3CIZA 3HVAA 4M95A 1IKVA 2DXEA 3D67A 2FJEB 5L1LA 4YOEA 3DI6B 4L76A 1PBAA 2J7UA 3V6DB 4OJ3A 1ZM4A 2VBZA 4D3GA 4CM2A 3R7NB 2MZ1A 4PR6A 1I94F 2OPPB 3M1VB 4USKA 4JYAF 3IO1A 1RYRA 3A1YG 5A8RA 1F6TA 1UMJA 1KLMA 2CIMA 5HVHA 1IR0A 2XI3A 4WU3A 2R9LA 5H9FJ 3RB4A 1MWYA 4FYDA 1U1OA 1XC9A 3QMQA 1I94J 1NNDA 4NLWA 5A8WB 1RBAA 4NCAA 4NLOA 2HW3A 1N52B 1P6TA 4QYRA 2XM3A 3OD2A 2J8SA 3QQCD 5KFIA 1XNQJ 4DL4A 4KHMA 4XPCA 3MM6B 2WVFA 4C6AA 3AQPA 3C15A 4KE5A 2DNPA 2R8GA 3UVJB 4DPOA 1C0UA 1ZA2B 4N5SA 2WVBA 4WXWA 3KNAA 1BQNB 4DSJA 3NMRA 2FB0A 1E6YA 2IC3A 3VF0B 4LQ3A 3IWLA 3RBDA 4PXCA 4YQWA 1XNRF 1UVKA 2WK4A 4FXWA 4RNHA 3DXBA 4LF6F 1ZTTA 4UF4A 2BQ3A 1HNZF 4CLKA 2ROPA 1L3UA 1SUQA 2EKYA 4GO5X 5EWEA 1IJFB 4LVNP 4M5KA 2UVRA 5LXRA 2QMWA 3PHEA 3KFWX 1S59A 4PG7A 3LANA 4LR9A 6AT1B 3DYAA 1NHKL 2XMVA 4PCQA 4BHQA 5THWA 3W2VB 5DM7Q 2IBKA 2AJ4A 1U25A 2EFNA 3TX8A 2HSEB 4PXDA 1VFJA 1RE1B 2A2CA 2E5JA 1UZHA 2K2PA 1FFWB 2N4CA 5G4DA 4UQTA 3ZTRA 4X65F 4FYYB 2HZVA 3FKBA 5GMDA 3FBBA 4ED0A 1S1VA 3PR4A 1LV5A 3AAWB 4ZPBA 1R3NA 1C0UB 2VFUA 4EYIB 3PW2A 5IT9U 2D1CA 4NLVA 3BGUA 4IRCA 1NZAA 5HROA 1WDDA 2FHOB 4F4KA 1Y9OA 4QOTA 1HI0P 4KPYA 3E01A 2DXFA 2LFVA 1GH8A 2I9SA 2EWHA 4B3OB 4I67A 2OELA 2B6AA 3L4BC 1UVMA 1S6OA 4LREA 3Q24A 2XSFA 3BR8A 5JVGQ 3KMSA 2DRBA 3AJ1A 5L8RC 5KFXA 2LEPA 1K9MT 4HH0A 2ZJPQ 4IKAA 2B9XA 2QLFB 2JWNA 2YX7A 3K17A 4UQGA 2A6MA 1U4BA 3RZAA 1V3SA 1FDBA 4HTJA 5KFLA 1JX4A 4RBTA 1DTQB 4QWBA 2JX2A 5F3TA 3F44A 3GV5B 2F9DA 3IWNC 4DR7F 1RQ0A 4ZOSA 4N7TA 2QYCA 4JI8F 2AU0A 2CWXA 3NGRA 4URGA 2AHOB 2FHMA 3GSDA 2AP6A 2DH9A 4ER8A 3QIPB 2CQ2A 3NGKA 3DDIA 3NS7B 4ECWA 2BQUA 1HBOB 2J9DA 4LSLA 5EDWA 1PILA 1NXIA 4H4KA 4I0WA 1KP6A 4IDKA 1NK6A 2B6AB 2XZWA 2BV3A 1RYSA 4ED6A 2F1FA 1X4EA 5BYRA 2IRXA 2Z2YB 2A2DA 2WCXA 2Z2ZA 2ZE2A 3ELHA 4MH8A 4DU8A 2DGXA 2YWWA 1UZDA 4NLTA 4PZVA 1VRUB 5LMNF 3MCMA 3K5MA 3BO4A 2R4FA 4NLRA 4NOHA 1S57A 4QZVB 3SQOP 3A13A 2HHXA 1GTHA 3M8RA 1B3TA 2ZH1A 4GKJJ 4KR0B 1ZH5A 2R8IA 2XEXA 1F3VA 2DGOA 3RJMB 1T8EA 4ES2A 4DLEA 1RAFB 1KLNA 1AUSL 1YHQS 2QZ8A 3QRPA 4C98A 2LXIA 4P9SA 3UE2A 5C42B 1X5TA 1X4DA 4YDDB 1X8DA 3BB5A 1CJUB 5EUHA 1T94A 2MJNA 3GFZA 2ZJRQ 4MKYA 4CH1A 4HACA 3ZZTA 1RADB 1SKSA 2W01A 4WZMA 4FXDA 1OWXA 5EGYA 2I0XA 2CYYA 3V4MA 4DZDA 2VL1A 1QLNA 2AJ0A 2KKHA 1YJ9S 2UVWA 4EI2A 2ZZTA 2AKWB 3H5XA 2GVZA 3PY8A 3PRVA 3OPKA 2P5VA 2CQIA 2OTLS 1U1MA 1UWBA 3KDOA 3CDAA 2XS2A 1Y5LB 2B8PA 3TVKA 1XWLA 3OLBA 4NZ7A 1JKHB 2BE2B 2M3DA 2YY3A 3OR1A 4ETXA 5DQHA 4ZMMA 5CAAA 2ZM6F 2W8LA 2AMCB 3D0IE 4K5SA 4PWWA 3TNVA 1LXJA 3H5SA 2PMZD 2HBRB 3PEJA 3Q83A 2LEBA 1RTJB 4OZLA 2QFIA 4BWJA 2HS4A 2DGSA 2YX1A 4MTPA 4KYZA 2JOQA 4NLXA 3EZ5A 3FZ2A 2UU9J 2MKSA 4C8YA 1WOOA 1RSCA 1X31C 1XQIA 2IMWP 1O0PA 2HVIA 2R7WA 3Q8UA 2DR5A 3QT7A 5K8NA 3KLVA 4ZLNA 2VU5A 4F3QA 1W25A 2K3KA 4ZVSB 4Y2CA 4J91A 1DURA 3DRPB 5GAHU 2IA0A 3FBCA 1H6KX 1R6VA 2LVWA 4OJHA 3OTOF 1NSAA 1AFJA 3H8YA 2CJYB 4I2QA 2HEKA 2ZDPA 2APOA 1OYEA 4U7UK 3HKWA 2V69A 3H2UB 1VOMA 4G65A 4F8RA 2NS1B 3ISNC 3QO9B 4JI6F 4DR1F 1WG1A 3T9NA 4ID5A 2PI5A 4J9LA 3D4JA 1DQ9A 2FDNA 4DWIA 3N5BA 1NAQA 1FESA 5AXMA 1DFDA 1HW8A 4HHJA 5D4LA 5E7OB 4QQBA 4C97A 1J27A 1RHRB 2RE1A 2RT3A 2HWIA 1EKRA 2P9EA 4OYIA 2JEJA 4CLZA 2OJ3A 1RWXB 4LUBA 1EIYB 1YRXA 2UXCJ 1B64A 5CCMA 3QRQA 2HVDA 2V4JA 2Z0GA 3J7A1 1I6JA 5BJRA 5HP1A 4EUVA 4DSFA 3IA0A 1T9YA 1UFKA 2C42A 4UUXA 3OL7A 1K44A 1NDKA 2POKA 3JTPA 3NKYA 3W2WB 1YI2S 1MU2A 3POTA 4ZP6A 1U24A 3PTWA 4NCBA 1APSA 1QD1A 2KFZA 5GMKa 2DB1A 2MHEA 2R8JA 4CO3A 3RBEA 1X9WA 4USTA 1KQSR 1OIAA 2VBYA 3W5YA 1NJIT 3QJPA 2V2ZA 1KTVA 4YY3J 3T41A 3MR3A 7AT1B 4MIWA 4C8OA 2Z2MA 1VQYA 4DUYF 2HFNA 2GA7A 2RILA 2IDEA 2XMMA 4DPYA 2NR0A 4QWAA 2HHQA 5H9FK 4QIEA 4KBIA 4A46A 3TZZA 4X4PA 5C24A 2W9BA 1VJQA 4NRTA 3FSXA 2XNQA 1PYTA 2QJ3A 3DU6A 2DR7A 1WACA 1NUEA 4Y2KA 3DLLQ 4A8OA 5HANA 1UKUA 1RISA 3C2PA 3P96A 1QSSA 2RJZA 1YJ7A 4FNHA 3UR0A 2AGOA 2VPWB 4WFBQ 1C0TA 1R0CB 1TL1A 4ECYA 3M2VB 3KDNA 3TA1A 2N82B 5KFZA 3W62A 1TL7B 2F4VJ 4WKYA 1FTRA 3R5CA 2Y8YA 1VQ6S 4X62F 3UI3A 4OX7A 2G1HA 2KO1A 5B0GA 5KFBA 1ZAWA 3HO1A 4LRFA 1HNVA 3J7ZT 1KOOA 1FERA 4TN2A 2RF2A 3D1HA 4R8UB 2XWYA 3OXFA 1GMUA 2H4YB 2LXFA 5D78A 1ZPWX 2KH9A 4J9MA 2E5LJ 4CO5A 2Q1LA 3FSIA 2RH3A 3AA9A 4OZ1A 2HMIB 4OYOA 3IFEA 1RU2A 3WX8A 3GIJA 1VLYA 1PYSB 3BSCA 2XQCA 3KK2B 3KG4A 3B54A 4RW9B 2R3VA 4CT8A 4YHHF 2FLLA 1KVIA 2HFOA 3D6MB 4JUZA 1DQAA 2WB4A 3M6XA 1JJHA 2MZJA 4B3OA 3FGVA 3OSPA 4HL9A 4OHWA 1K47A 2ZHAA 2C3UA 4JOUA 3R1LA 2FJVA 3DRYA 4LF9J 2JEIA 1IBLF 1LW2B 2NXCA 1SJ1A 2NYIA 1JMTA 2IPOB 3A8KA 4OX8A 4DX5A 4YMEA 2R7XA 2I1RA 1NSQA 2G9OA 2CG8A 2HFZA 3RRHA 2MZSA 1HNWF 3QZ8A 3CMQA 3BGFA 3ENAA 3I0RA 5E0OA 1T3NA 2VKZG 4NLGA 4LSLB 4MK7A 1RWVB 2C2OB 4X62J 3PZPA 2XZTB 2HZCA 2ZKUA 5HO4A 4M5JA 4L72B 3CCJS 1YDLA 2G4BA 1U6ZA 2QE5A 4YDXA 2P9CA 5BYSA 2PSZA 4K8RA 2CPFA 4EO8A 2E1MC 4JI5J 3KLHB 3PYEA 3DOKB 1YKWA 2ZDOA 3QYYA 1BUXA 2VA2A 5HBMA 3DGPB 4CLYA 1PBUA 1RT3A 2E7XA 2O3DA 4NLUA 3IN5A 3UDLA 4JI1J 2XLJA 2AYBA 1ZBTA 3TAMB 3X1LB 1FKPA 1HL6A 2JH3A 3GG0A 4B02A 1T9TA 4B9VA 2PFDA 1WHYA 3KNGA 4ECRA 4Y6IA 1URNA 2HHUA 5KOWA 3BREA 1VQ5S 2VFTA 1REGX 3VAKA 4CYUB 1BY9A 3VZIA 3J7YU 1N32J 2NXNA 4GMKA 5DG9A 3JAMU 3DOLB 1IKYB 5IXUA 1WG4A 4YR3A 5D3GA 2GHVC 3VAMA 2NSCA 4GVLA 3UD5A 3IR5B 1VI7A 2ALYB 3I0SA 1YQHA 4J9VA 4RW4A 4DSIA 3RAQA 3I32A 3I4PA 1O5JA 2K8GA 2XWXA 4HLBA 4Y34A 1LKZA 1HHSA 1LW0B 1MN9A 3ZNUA 1DLOB 1HQUA 4P2FA 1QE1A 3CD0A 1TELA 3I6PA 3PFEA 7FD1A 1Q0NA 2HGLA 3CDWA 3JTNA 3M30B 4O0IA 3QSYB 1RP5A 1WHWA 2KN4A 5D77A 2YKAA 1TL5A 2MKKA 2KM8B 3HPOA 4V1Ak 3D28A 1VBXA 3A3NB 2IRYA 1RABB 1ZOTA 4E2FB 1VQ8S 4C9DA 2F8HA 4PABA 1MMDA 3CDEA 1LWEB 3ISND 3Q86A 3ZC4A 1FXLA 2DK2A 1CJKB 1S1UB 2XG8A 4WBFA 4EBCA 2UUWA 2HIQA 3W9HA 2XY5A 2IYIA 2WOMB 2VF3A 1JJCB 3Q8SB 2OFGX 2FJXA 2PMHA 4PEOA 2DNYA 3KYLA 3VVUA 4I6AA 2QRRA 3RB6A 2J9CA 3ENVA 3WC0A 4DL6A 1AFIA 2KJWA 2C1EB 3VVTA 1UW4A 2RRAA 3E2EA 3FMWA 3IG1A 2OD6A 4DR7J 4XK8C 1XBWA 2MKJA 2MPUA 3U7JA 3JSBA 4LBPA 1QM9A 2F9JA 1HA1A 3CE8A 3G86A 4YR2A 2R7VA 3GIRA 2VUGA 5HMWA 2E9RX 1SL2A 5EWGA 5I3PA 5EWFA 1S49A 4DV6J 2PO4A 2CUYA 1IR2A 4U6PA 2H54B 3KXDA 3SCJE 3TX0A 1T03B 1LWEA 3BJYA 2HRYA 3B6BA 3KHHA 1SH3A 1UAWA 3HVRA 3C46A 4ID5B 2QL9B 1GAOA 2AZ3A 4XPEA 1SJQA 3D3BJ 3NGUA 4J9NA 5KFJA 3C15B 5F8NA 5E2QA 4WPAA 1YBUA 4WYLA 3NOGA 1GX5A 2M4MA 2HZAA 2PEHA 4RW7B 1R7IA 2MGZA 2BW2A 3BF4A 3TP2A 4B9UA 1IBMJ 3BV8A 2RAQA 1MU2B 3POTB 4F2SA 1SUQB 1X4BA 3R3TA 4WWSA 4HVZA 1FRHA 2DJWA 4NCGA 4O0NA 4QWEA 4U96A 4ZA1A 4OFZA 4FN5A 1GFWB 2EEYA 4OYBA 1RTDA 1IKWA 1TL3B 3JSYA 3OFEA 3MUVP 1YRTA 1N5QA 1MMNA 1RHJB 1O6XA 3FCHA 3H42A 1T03A 1NH7A 2H5JB 3D6HB 3FBFA 5EHHA 3Q8RB 4A8SA 3HZGA 3KK1A 2DHXA 5I42B 4K4YA 2RDIA 2HWHA 1YJVA 2X7IA 2DGWA 2EK6A 1AXQA 3BSAA 2CQ4A 4USWA 5CXTA 3TANA 1GX6A 4IYQA 4TNOA 4AD6A 2DHSA 5CH7B 4KO0A 4P6QA 3KJNB 4WTOB 2KZMA 2ZEJA 2NYHA 2ACYA 3HFVA 4P10A 3MD1A 3RBZA 4DR1J 3TI0A 4NZ0A 2YNGB 3MM8B 3DN9A 4JV0A 2GIFA 1SC6A 4Q7AA 3NS6A 4LF2A 2C3YA 4ID8A 1S1WB 1XMOF 3GQCA 1HFEL 3KOAA 2YNFA 3NMAA 2IVFB 5LOQA 1UL3A 3FMBA 2Y0SD 2QA2A 1S10A 2H5EA 3OL8A 3FRZA 2DNNA 4P72A 5DS7A 5E41A 2AIRB 3DRXA 1HQEB 1R8BA 1RTHA 4OYXA 1FFSB 4W4MA 2DIUA 5A6WA 1KONA 1PAUB 4I7FB 2PI4A 1X4GA 2DHGA 2I5JA 3K8VA 4DUTA 2DR9A 2HAIA 4Q0BA 5C25A 4J9UE 3IP0A 3FFIB 1T9UA 4ZP8A 2D41A 3HM9A 4IG3A 1QSLA 4C8KA 4RL1A 4OMFG 3QATA 4RUHA 1ITPA 4OQJA 5E3QA 2OPRB 4QR0A 1SIZA 3UNGC 3D68A 4F3MA 3ZZ0A 2CFXA 2FJBB 3DCAA 4OJGA 4AL7A 1Q1KA 1SCJB 4P7TA 5DGAA 2CJKA 1EP4A 2Z4PA 4JB8B 4USUA 1FK9B 5JUMA 4L6V3 2UUAF 1U49A 5CYMB 5AT1B 2XGQA 5ETQA 4WKRA 3VV2B 4ZN3A 3MEEA 1U8SA 3G6VA 4DFKA 1YITS 1J5OA 3D1OA 1UA1A 1N33F 3N5FA 1I1GA 4PAAA 4ES3A 2NREA 5CQGA 1N6QB 3T19A 1KDNA 4R8UA 2KDOA 4I7FA 2XO6A 1RWOB 1TKZB 3L95X 1FF2A 4QJVA 3H59A 4J9QA 3W63A 4DLGA 3TA2A 2LECA 1JXLA 3OTCA 4CH0S 2XO7A 4DR2F 2V2KA 2J76E 2NLWA 1UFLA 1VIXA 1XERA 3BR9A 1EHWA 3MM7B 1Q7YT 1SC1B 2HRUA 2H48B 3MAAB 2ZJQQ 2QEXS 4B3RF 2FJDB 2BKNA 4RWWA 3DMJA 1U1LA 2HLTA 1R8PA 5CYMA 3RG6A 2GMJA 1Q8LA 1Y5IB 2LU1A 4AUKA 1Y10A 4GC6A 1JNRB 4C3KA 1FRXA 3MCOA 3MMCB 4ZN1A 5CYJA 4R5PB 5GAEU 4MKBA 4B08A 3UFCX 2CQHA 1PC4A 3MEDB 3PHTA 3JSMA 3TA0A 1GMWA 3ZXWA 1GQEA 2OTJS 4LSZB 4NWBA 4O3SA 3HJVA 2DO4A 1ZM2A 2DR6A 5F8IA 1FDDA 4LQ9A 4X66J 2QGFB 3WDOA 3CCMS 3DLJA 2VPXB 4U7UD 3D0HE 5K8PA 1R31A 2Y8WA 1Q8KA 3AOBA 1M5SA 1RBOB 4ZLJA 3BQ2A 1HPZA 1JKHA 2BE2A 2W4CA 2XMKA 3OR1B 4OI4A 1FEEA 3I82A 1HNZJ 1MSWD 2V2VA 3EWGA 4KSEB 1F5AA 1XNRJ 3L7UA 5IV4A 3I31A 3HLUA 1RA6A 3HSGA 4P73A 1Z2ZA 5ETLA 4CLUA 5DDQC 1LWCA 2HBQB 2F65A 2G13A 1RT7A 1NMEB 3EUNA 2X1GA 3TVYA 3WQPA 1NB7A 2D9PA 4DSKA 1U2RA 3PKMA 3K89A 2V4RA 2LKZA 2RHSB 4GVBB 2DVIA 5KT3A 1CG2A 3OUYB 2AX0A 1TMMA 4F4YA 4I2QB 1DLOA 1HQUB 4X4TA 3J81U 3WHIA 2CPIA 2H1YA 4EYHB 1RKJA 4ELTA 3CCUS 3V6HA 1M1GA 1CJKA 1NRKA 5F9LA 5LJ3Y 1FRLA 5KFMA 4JI6J 4KH0B 4J7CA 4M63A 4UTGA 4LF5J 2BANB 3SSRA 2M0GB 1Q5YA 3B4DA 3LPEA 3VR1A 2DD8S 5B0AA 2A0FB 5D0EA 5E33A 2AW0A 3G8QA 3BYPA 3PV8A 3R2CJ 1Z2LA 2EBEA 1FVSA 3GMGA 4M5HA 4N76A 1OYDA 5HMYA 3S7RA 4KHPF 4WF9Q 5D8HB 1RT2A 2Q3PA 2Y3YA 4DV4J 5KFNA 2EXUA 5I4MA 3N9UC 3T6JA 5CA5A 1ZA1B 2WOMA 4NXMJ 3PDNA 5HVGA 3U1LA 4NLSA 4U7CA 5KG0A 1NKEA 3K5PA 3OL6A 1YBTA 2ASLA 1YX2A 3MFHA 1U48A 2HNYB 5HVFA 3JQKA 2V8DA 2JC1A 2PA8D 4I69A 4WIQA 3SIPB 4GKKF 3M6UA 4JI0F 4TYBA 4XTTA 1BWVA 3M2UB 2MSTA 5EX0A 2E29A 2WHOA 2RS2A 1F2HA 2V67A 1Y11A 2OPQB 4DR3F 4PRFA 1H2TZ 1SC4B 4JI2F 2KJVA 2BVZA 4OYPA 3ETOA 3CJSA 5CZVA 2LQBA 1OY9A 1HNIA 5ETRA 1FKOB 4DJBA 2R42A 2CADA 1Y3JA 3GCXP 3PO5A 4ZHRA 2LDYA 3QWUA 3OJUA 1EETA 1R8AA 1RTJA 2AZ1A 3T6BA 1SV5A 3K7RA 3U02A 4W92B 2GAHC 1V9OA 1XR6A 4UUWA 4KKOA 4ANDA 1MROB 2HHSA 2CDQA 2MTLA 5B0FA 2HNYA 3G2XA 5KG4A 4CYUA 3I87A 5CHCB 2O5DA 4N8OA 2AX1A 1IBLJ 3WX4A 5GAEI 2B7BB 3TAQA 4S0MA 1S0VA 3FCWA 1S7IA 1TZ0A 2ATCB 4RW4B 1A0OB 2VJUA 4A8WA 4DX6A 1IVZA 3B78A 4N8NA 1EKSA 1YVFA 4CI0B 3ILIA 5J2NA 3SQGB 4ENOA 4N56A 2L08A 2DNZA 3JSRA 4WFXA 5LSLA 4F2RA 2ZVSA 1S6QA 3CC4S 2XCPA 2HS3A 2X3GA 4PUOB 5KT5A 1RKIA 1CPZA 4CLFA 4DMZA 1OSCA 3CSKA 3QFWA 1RWUA 1FNXH 2RF2B 2KU7A 4TKTA 3CCVS 4LF8J 1FRKA 4OZ0A 1IM4A 1ZZNA 2YTCA 3R8YA 3UDCA 2EG2A 4M5NA 2WTFA 1LEOA 1TQLA 3IBFB 1OJ4A 4NEZA 3THTA 3AT1B 4X66F 1W7WA 3VALA 1L3SA 3HZEA 4Q44A 2MKIA 3M6VA 5MLCV 2C22A 4ED1A 3UPFA 4O3RA 4Q0BB 2G2ZA 2OHDA 2B5JB 1NPRA 3QT5A 4I4BA 1NSKL 5C2CA 4LIRA 3DKDA 1MW7A 4DL5A 1Y3KA 3KK3A 2DNKA 1S0MA 3CGIA 2JHEA 2ZITA 3PKYA 2KG0A 2YNHB 1BLUA 2V2QA 4ZCMA 2UUCF 1RAHB 3KUGA 2M9KA 2VOOA 3UO0A 2HQCA 3AFGA 5ETKA 2JVOA 4M5LA 5G0RB 4J9OA 1RCOB 2VH7A 1N5YA 3CJTA 1YSJA 3EZUA 3MEKA 1WHXA 4DZ6A 5L9NA 2J8AA 2CJAA 2NXEA 4FKYA 4MIBA 5HQLA 3V6DA 3GIKA 4OX6A 1K73T 1KHVA 2FVCA 4ZS6A 4FYVB 4ZVQB 2EC2A 2BJ3A 4IOBA 4O3OA 2P2CB 3M9NB 3CWJA 1TKZA 2LMIA 3H90A 1LFPA 3I5AA 3NAHA 4JI4F 2ZVIA 3CCTA 3CTRA 5K9FA 4GKJF 3THVA 2ZBCA 2OGUA 3V4IA 4WE1A 1H2UX 2WW4A 3EPIA 1KFSA 3DOMB 4KIAA 5CYQA 1QUVA 1U26A 3NRBA 3G4SS 4ILMA 1S0NA 3SI8A 2C2KB 1NEEA 1VHFA 2KRBA 4NCGB 4KJIA 5L38A 1VMBA 4TYAA 2MJUA 3IWXA 1PAEX 2VPZB 2GGPA 3MMCA 1JLGB 2FY8A 3BBBA 1XMBA 4R5PA 4U8YA 3S8SA 1ZM9A 2BKOA 2OD4A 3W5ZA 2UXCF 5I3UA 3BGOP 2GO8A 3BYRA 3SSSA 1HBOA 4DXLA 3FJ2A 1C1BA 3MEGA 3T1AA 3C14B 3BZQA 3CVKA 1WD6A 1IN0A 1TMJA 1YRUA 4Y3CA 4F67A 5FLXU 4LRBA 2HNZB 1C1CB 3KLIA 3D66A 2W2QP 1F9EB 1JK9B 2KT5A 3E8OA 2DIVA 4KGMA 1Q4RA 2O66A 4ZVPB 4CWBA 4DN0A 5A76A 1SQFA 3OVSA 3CW2C 1S48A 1F5BA 5ETVA 1WC4A 3MPYA 2OUGA 1HBUB 1YLXA 2H51B 4B9TA 2LEAA 3NGDA 2CKWA 4LBHA 4PWDA 5F8HA 3QAUA 4PG5A 2HIYA 3K58A 3OTOJ 2KL8A 3HSJA 4X4NA 3M2RA 2ZHBA 2XMWA 3CUNA 1VCTA 2YQ1A 2VQEF 3G9CA 5A8KB 4X4UA 1YJWS 2BZ2A 2R2RA 1IBKF 4RU9A 4RKUC 4K4ZA 3W2VA 2F63A 2JLGA 3F73A 3GJQB 3FRYA 3WIUA 5HLFB 3O3LA 5L39A 1F9FA 1PG5B 1CJVA 5U47A 3GCWP 4NYPA 5M2PA 2V50A 1S1TB 3OQ2A 4WJBA 4ZCKA 3GJSB 9RUBA 2Q43A 4FNIA 5AXLA 2XC9A 1R0AA 2D69A 3BPDA 2MQ8A 1X4FA 2IY5B 4KH1B 3MD3A 5GADI 2LYVA 1HHQA 4DDFA 2W8KA 3X3UA 1I51B 3ZTPA 2BQRA 3DLBA 3QSIA 4ZVEA 2YWKA 3QGHA 2JZ5A 4X84A 4DF8A 4JI2J 3QLHB 2ZUGA 1U1PA 3MCNA 2GW8A 4LSNB 3W60A 1KN6A 1HD1A 3PR5B 5KFPA 3VAJA 4DQSA 1C4AA 1KQFB 5DQIA 1M5OC 2L41A 1LK5A 3AB4B 2GO9A 4RWXA 5A0YB 3MDFA 5H1SV 2NZ4A 3DI6A 1QAYA 3L7OA 3KHRA 1AROP 2BRKA 4TLRA 1A6LA 3R7SB 4Q5VA 4LVOP 2H5IB 2E44A 2YKMB 2YKNA 4ZVFA 4CLPA 1T05A 3MR5A 5ETPA 4ZITA 3CB4A 2QA4G 1NK9A 1IKYA 1HYSA 4Q8EA 1F0XA 3GU0A 2JNJA 5F41A 2VG6B 4AE5A 4DV4F 3RB0A 1H73A 1IKXB 2B9EA 2BRLA 2BYCA 3DMJB 3VHQA 5IV3A 4OV1A 4CLWA 3DRRB 4CRJA 4NPOA 4DFMA 3D6FB 4ECZA 4RU2A 2Y9HA 1XNQF 2L48A 2HGMA 3MPVA 4DR4J 5KT6A 3R5BA 2VHGA 2N3LA 4I6WA 3OTDA 4LSNA 4LFCJ 4USHA 1FXRA 2OEJA 4X4QA 1DY3A 3VAFA 4KRWA 2HVHA 1QVGR 2CPEA 1CJTA 3AD9C 1PO6A 1WF1A 3NOCA 3S6EA 5KFSA 2ZH4A 4M5DA 2J0WA 5KFAA 5F8MA 3D2WA 5C42A 3ZZRA 1X4CA 2WBMA 3RTVA 4B3MJ 2PFFB 2OH2A 2YH0A 3P49B 2VG5B 2Y1LB 4B3TJ 5AXKA 3D1QA 3EZOA 4QR1A 1N5SA 1V5IB 2D9OA 2J0SD 1TV6B 4ALZA 1T11A 2CQDA 2RB7A 2DH8A 4X64J 3TRGA 4RLEA 1D1UA 2GVZB 1KQGB 1VRTA 4QPXA 3BDPA 4DL7A 4OX9F 4KKOB 1ULRA 3ILOA 1MROA 3ILJA 5KFFA 2YKOA 1Q8IA 5GMEA 3VGUA 4CNYA 2AD9A 5LMUJ 1HWIA 2P6SA 5FDLA 1VBYA 3ZO7A 2AQ4A 1NHVA 3GTYX 2M5YA 2MEWA 2ZBRA 1U0HA 3AODA 4HT7A 2E1CA 1JWWA 6FD1A 1IWAA 2EK1A 2GHWA 2VFVA 3EGZA 3DRSA 2QG9B 3QNWB 3CJ8A 3CC2S 1T9VA 5DZ7A 2CNNB 1JXEA 4JBCA 1F5CA 1C4CA 3CCSS 1YJUA 1HMVB 4JI7F 1WC1A 3ZTOA 3FZBA 3M32B 5F8LA 2UP1A 3RR7A 2LQ9A 3EMTA 5KFTA 1YZ7A 3B4MA 1W2BR 1D8ZA 4GRSA 3Q8PB 1CSJA 1S9FA 5HI7A 2XS7A 1RTIB 3G87A 1RACB 1JIHA 1T9XA 1U1NA 3HK2A 3DRPA 3G82B 1SH2A 1DTQA 4DR5F 4MYTA 2GZOA 3PYGA 1C0TB 4X65J 4O44B 2HG4A 2CJQA 2MZRA 1OPIA 1SJ3P 1D9FA 4OHVA 5JJBA 3NLCA 1JLQB 1RCXB 1RLDA 4USIA 1F60B 4LRDA 2C28A 3MXHP 4CO0A 3H0PA 1WDTA 3KG0A 4PPZA 3OVBA 2VBWA 3JXOA 1HNXF 1ZM3A 2R7TA 2BJEA 3CO9A 5D4NA 3RAXA 1PKUA 4CLSA 1P27B 4NMLA 5A8WA 1SJRA 1X7VA 1N33J 2FZGB 1VQ9S 3EYZA 3MEDA 2ILYA 3JSMB 1G7CB 1E6YB 2IC3B 2MKHA 3CO0P 4WK3A 4U95A 1CS4A 4F4AA 1S9GA 4IR1A 3V4IB 1FX4A 3UVJA 1SC3B 3LP2B 2YQ3A 4QIVA 1X4AA 3DHWC 3DOMA 5CYQB 3OLAA 2JL9A 1EETB 4AFFA 1WTBA 1HPZB 1VBZA 3TZWA 1XMQF 2FVQA 3G71S 2GJFA 1VQ7S 3W2WA 2ASDA 1SB6A 3S01A 2PE8A 2CQ1A 3CEDA 1FI4A 1IJEB 2W2NP 1LWCB 1CJUA 1R43A 4YB7A 1HHTP 1LW2A 2V34A 3ZZYA 2DBBA 4I2PB 3H40A 3BSNA 4OI6A 3J81Y 4QYZJ 5GADU 5J1NA 4CLTA 3P3DA 3W5XA 5C2GA 2C2RA 3CJ4A 1N0VC 1S1VB 2HBZB 4KGKA 1HNXJ 4DR4F 3AXMA 4K7QA 1TAUA 2RQMA 2J5AA 1M5HA 2M7SA 4MT1A 3EJMA 1B0VA 3LALA 3KTQA 8ATCB 3CJ2A 2JC0A 3EDQB 3CJ3A 3M8QB 4IRDA 4OHXA 1LWFA 2PGCA 3SXLA 5HBMB 3M9OB 1AYEA 1C1BB 1UWAA 3MEGB 2HVZA 4HT5A 3V5RA 1S5ZA 2ILZA 2UVVA 1I3OB 1WC3A 3ICLA 3J7AN 3EDRB 4DV2F 1MWZA 2E66A 4ECVA 3TAMA 2JRSA 3T1YF 1Q16B 2M88A 2ZHOA 2ZOGA 3NY0A 3JYTB 3TZYA 3HXMA 3NS5A 3RUBL 1FX2A 1EARA 3OL9A 4ECUA 1RT4A 4UOGA 4NXNJ 3WZ0A 1V3ZA 2AYMA 4K59A 3ET6A 4H54A 3RBXA 2QSWA 3NXZA 5DETA 3MM7A 5SZTA 1L3KA 4NZ6A 3NCRA 1F3FA 1FHTA 2IA6A 3N6NA 3M8PB 5I3QA 5HN0A 1QTNB 2GQCA 4JP8A 2CNKB 1UJ4A 2UUAJ 4H4OB 4MFBA 4YN3B 4F02A 3HSDA 4KFBB 3CJQA 4PYDA 2FYXA 3MTJA 5J1EA 4RUAA 5L9XA 4PG4A 3PX0A 3VGTA 4DV5J 1VK8A 4CO2A 4RW9A 4OYAA 2CZ9A 4OZNA 3EGNA 1JLCA 3ADAC 4C11A 3QLHA 2G0CA 4CZCA 3TJ8A 3CMAS 5IT9Y 1XIQA 1LNQA 3FK4A 1WI6A 1UJ5A 3JYTA 5CCLA 2J6TA 4ZCIA 1SI9A 2OPQA 2P9GA 4B3MF 4ITSA 1H2VZ 5FJ4A 2NQPA 1KBRA 2BUNA 2VD3A 4CO1A 3H7HB 4FPRA 3TR5A 4M94A 1FKOA 2KYZA 3EXYA 4ZP7A 2YBVA 4PG6A 1T05B 4RNMA 3GB0A 1XR5A 3PW0A 2X1AA 3LAKA 3HKZD 5KFHA 1B99A 1YK9A 3PCOB 4M5GA 4PG8A 3KJVA 5J1EB 1BE4A 4I64A 4DX8H 1UW9A 1OMSA 3K59A 2YKNB 2VDHA 4DV0J 4UY8T 2CWKA 1NO8A 1UPPA 3BH6B 2VASA 1SQEA 2COLA 1R8HA 4ZVOB 2ZBIA 4RW8B 1RT3B 4WK1A 1O51A 3I56S 2UXDJ 3KLFB 1XTZA 2IDLA 4LFBF 3L09A 2HNZA 3KLIB 2W1BA 3C16A 3OTBA 3C3LA 3CCZA 1TKTB 3AXKA 2BA9A 2GS8A 2W24A 4ZDNA 1RI7A 4DR6J 1LWXA 3GYGA 2UU9F 2RS8A 3KLGA 1WKJA 3OJSA 1YIJS 3DDKA 1SH0A 1TFWA 2V8VA 1PJ7A 2YWFA 5IC4B 1NM2A 3HSZA 2QA4S 2BBEA 2WONA 2MZQA 4LRCA 4C3MA 1NK0A 4L73A 2EFOA 3FEYB 3CXCR 3KJFB 3M8ZA 5AE3A 4X2BA 5KG3A 3M2VA 4IQMA 3W9IA 1YBAA 3TUPA 1N32F 1XK8A 4P2SA 3DGVA 3BKUA 3HX9A 3OR2A 3SDEA 2VODA 5EN1A 2DH7A 5ITHA 2E1PA 2HPUA 4QW8A 3RW7A 3DLHA 2HQDA 2IM0A 1VR6A 3IM9A 4OYMA 2MKYA 2BJ7A 3PACA 4LR8A 5DJBA 4DHVA 1LW0A 5LXYA 2LLZA 3KHGA 2PIIA 3LW5C 3SZ2A 2ATLA 3O5TB 5GAHI 3T5JA 2QN6B 2IJRA 3KK3B 4F0MA 2OMOA 2ERRA 3FBEA 2HQ3A 4ZJLA 1NH8A 1PCAA 1S7HA 2OEKA 3B8HA 3HVTA 4KV8A 3W61A 1UP1A 5T7LA 4IFYB 4LF7J 5G0RA 2J7KA 5BYQA 2KTQA 2WONB 4USJC 4WP8A 3G82A 4J9PA 4FS2A 2GNKA 2CPZA 3A3OB 3LWMA 2HK3A 3CD7A 3BPSP 2ZFHA 5K8OA 1NJXA 5H9EK 4LF8F 2K3IA 4K4UA 2X1BA 3HD1A 2NCKL 3I9V9 3UNYA 5FLXY 4B9MA 2LU2A 4O44A 4UY85 5A6PA 1DQ8A 1JXVA 1FEHA 4LF1A 2I38A 3AHPA 4DPUA 3IG1B 4NL5A 3EGWB 4EK2A 1JLQA 1REVA 4C48A 3M8YA 2FLPA 4FF1A 4WE1B 3SCIE 5ADZA 3PYFA 2XMAA 4CO4A 4BLGA 1HBMA 2CJ9A 3D6TB 1RBLA 2B3TB 4HR2A 5ETMA 1GT8A 3QT6A 5LT5A 4FVCA 3HDSA 1S9GB 3QWPA 2ZUAA 1HWUA 4RW6A 2RQCA 3LH2S 3OFGA 1RAAB 2HGNA 2GMHA 3AB2B 2CPJA 3MPWA 3OXLA 4LJMA 1ROFA 3KLHA 4ELUA 1J5OB 4RZRA 2QIFA 2GJ2A 3CJ0A 2CDRB 3ZZOA 4TU8A 1BXNA 2CQCA 2U2FA 3DNCA 3SMZA 1CULB 4HI2A 4L74A 4C7QA 1QTMA 2YPYA 1UVIA 1JJ2R 4F4ZA 2FVSA 2AYEA 1G6BA 4F0KA 2GQQA 3O44A 1KLMB 4B9SA 1FJCA 1VQKS 4DL0C 2YH1A 1AW0A 4QR2A 3NWRA 3Q2SC 1S79A 4M5IA 4ECSA 3SYZA 1W2IA 1Q81T 1FRMA 5SUHA 4CT9A 1H3DA 2BJDA 3UCUP 4PXEA 4A4JA 2FUG9 5A8KA 4PQUA 2AF6A 2L9DA 3CJKA 3PRDA 1KKHA 3CCLS 4FYWB 2PC6A 5I42A 3OHAA 2G0JA 2BM0A 2FY1A 2RNEA 2JJ4D 4P71A 1Z4UA 3RRGA 2PMWA 1LWFB 3EXCX 3RB3A 4IDKB 4ZP9A 3PEHA 3A8JA 4EZ9A 4K0KF 4HHUA 4LFBJ 2D3ZA 4DR6F 3TJAA 2ZNYA 2DNHA 4EGLA 2BABA 2C3OA 1P9YA 3DM2B 4G1PA 3T1YJ 3QRRA 4KHPJ 1RJJA 2BM1A 1P1LA 2CZVC 3MR6A 3PIOQ 2W9CA 3VZHA 4OX9J 3KK2A 1Y0HA 3PYDA 3J7Z5 2E7VA 2DNQA 1J5EJ 1TFYA 2M8DB 2QMXA 3HT0A 5C25B 4OHYA 2V9WA 1H74A 3C8YA 1OPZA 3DRRA 3GFXA 3GZ7A 4OI3A 4KFBA 3HFZB 4NI2A 1FNMA 4QU7A 2VB6A 2DKOB 4HACB 3H5UA 3OSNA 4Z7CA 1LQ9A 4ED2A 5DRKA 1N8RT 1HI1A 2XSJA 3M8PA 2AYGA 2LQ5A 3IAS9 2KXHA 4YUDA 4ECTA 1FFGB 8AT1B 4DL2A 1ZAVA 2FLOA 1E6VB 1SKRA 1RU1A 4NA2A 4BC9A 1YZ6A 4Y2IA 4DG1A 5HK4A 1Q79A 4Q2LA 4ZCLA 1G3OA 4RPFA 5D0RA 1NK5A 3QJJA 4YB1P 3NBPA 2I6WA 1FD8A 3K8WA 4EWTA 3TYTA 2XZDB 4RBVA 2J6UA 4AL6A 1T9WA 2J7WA 2XULA 3BQ1A 3BGRB 2LA4A 2IIHA 3PIPQ 1LFWA 5ETNA 2RUSA 3NP5A 4ZPCA 4CP5A 3KJVB 1TK8A 4E0DA 2BR0A 5IQQA 2AEFA 1K1SA 2MQNA 1OQ6A 4OI1A 3BBCA 1OY8A 2XSJB 4W98A 1NPPA 1S12A 4F25A 1X9SA 3ENWA 1S97A 1TV6A 2HLUA 4ILLA 3TQEA 4XDCA 4Y00A 3IS9A 3N4WA 4QIWD 2OAUA 3BEGB 1VBKA 3BGLA 4PPDA 1S1UA 1VRUA 3HI9A 3KKFA 3TVZA 5J1PA 2ZM6J 2AJQA 3I4HX 4LRAA 1QE1B 2HQGA 1WWHA 4FDFA 5B0DA 4DR5J 3GPAA 4ECQA 1T3OA 1U0HB 3MECA 9ATCB 2VDIA 1UEUA 4V19X 2AWZA 2VC1A 3O1LA 3OT9A 4DR2J 2DO0A 1HD0A 4DX7A 4WCEQ 2A6OA 4LF9F 3MM9A 2OI2A 4K5RA 2ZH2A 4Q43A 2CVIA 2HKEA 1ZS6A 3MOZA 3MMAA 3P4UB 3G96A 1HMVA 2Z58B 2GAGC 3VGVA
chains in the Genus database with same CATH topology
1WHVA 2GV1A 3HHLC 3JTOA 1X0FA 2ABYA 1H7WA 1U1QA 4DQIA 2LCWA 1TK0A 2CPHA 3IS9B 4TLQA 2A3JA 2JEGA 3C6UB 4QWCA 3TUIC 3KG1A 3OUYA 2BXJA 3Q2TC 1DRZA 2J0QD 2RKIB 3MECB 3O8WA 3QGGA 3MAQA 4EBDA 4P7VA 1S6QB 2M70A 2E5LF 2MXYA 4O3PA 3SV3A 4NA1A 1N88A 3HVWA 1RT5B 2IM2A 2DCLA 3D0GE 4O4GA 3HT3A 4KTQA 2B7CB 1SL0A 4I1TA 3S1TA 3KLEA 4K50A 1YJNS 4FF3A 2XY6A 4ZLPA 2R7OA 2MMYA 2F4VF 5J2PB 7FDRA 1Q82T 3G8SA 3OTEA 3T5HA 2YNIA 1D8YA 4C8ZA 4ZKAA 2UVUA 1L3TA 1WF2A 4ZPVR 4KC5A 2EFQA 4ATNA 3NNHA 1R89A 2MQOA 2IBOA 2GFFA 3N6LA 1NHUA 5E5NA 4RNOA 1ZZFA 2YNFB 4E8UA 3LGMA 1FJEB 1D9DA 1JLEA 3PRBA 1HR0F 5KT4A 4KO0B 5AE2A 1VC0A 1FTCA 3IGVA 3LP1B 2DPJA 2ZH3A 1FA0A 4G3IA 1VQLS 3MM6A 2IYGA 3SSQA 2ALZA 4YY3F 3T1HF 1N0UA 1VQPS 3GYXB 4QBUA 3UCZP 4OLPA 1IBMF 2K7JA 4TXSA 1L5UA 2DPIA 2VG7B 3PX4A 1SV5B 2VBXA 1KOHA 3V81B 5DG7A 1VQMS 2NPIA 3GR1A 2JEFA 2MZTA 2B56A 4Y28C 4CNZA 1KQKA 2IVMA 3FFIA 2CQBA 3AA8A 1FK9A 2B9YA 2N7YA 3NG8A 3ULHA 3MUTP 4H4OA 1S9EA 2I5JB 4MFBB 5K8MA 5HROB 1SJFA 2EVZA 4ILRA 4NLDA 3UCGA 3NCPA 4XO0A 2MB0B 4C8LA 4B9LA 4HKQA 2ZOMA 3H2VE 3ZFVA 1QJHA 3ITHA 1NKBA 2NUUG 5LSRA 5KOXA 2OO4A 1JLFA 2N7CA 2P6TA 2KHCA 3KWMA 1VS3A 1C2PA 3KLFA 1DTTB 2L9WA 3UW1A 5DG8A 5DLGA 4EBEA 2W9CB 2NSBA 2CQPA 2Q6CA 3LP0B 3HP6A 2ZH9A 2Q66A 2IM1A 3DDNA 5B0EA 5KFUA 3F41A 2HYIB 1A9NB 4DBQA 2Z8QA 3VQSA 2YVSA 5E3RA 1FO1A 5MAOA 4FF4A 2MQLA 5KG6A 1FRJA 1HWLA 3MOJB 4Y2AA 1G1XA 5KFKA 4OHZA 1S1XB 2V0NA 1KD1T 2O1PA 1U45A 3F56A 1BQMA 4DV5F 3QJLA 1S1TA 4JV2A 1HARA 1K0TA 2B4PA 1B0PA 1MNEA 4U9RA 3WC2A 2C3MA 1N54B 5D4OA 2HHWA 3M8QA 4C0HA 2VFRA 4RNNA 4J9KA 4K4WA 2ZNZA 3L3CA 1T95A 4RNFA 4LFAF 3GILA 4NXNF 2DRAA 5HMZA 1PC5A 1CEZA 4AXJA 4C8NA 1SKWA 1M90T 2LA6A 4ED8A 4JI1F 5B08A 2KZZA 3BQ0A 3H20A 3BSOA 3TAPA 1Y4ZB 4NXMF 3HHLD 1TP7A 1HYSB 4J37A 2RQ4A 1B0TA 2CQ0A 4JI5F 4TY8A 3UD3P 1X4HA 1UVJA 2XNRA 1FD2A 4ECXA 5IM0A 4ED7A 3KHLA 1HWJA 2XY7A 2DNRA 3K5OA 2G1DA 1X5PA 2FLNA 3DGPA 1WNEA 1HBUA 2YWEA 1S4FA 3PNIA 2R8KA 4ZPDA 2GMLA 1JLCB 2F3JA 4KV8B 4PUOA 3PW5A 2L9NA 1R27B 1N36F 4DSEA 3FVYA 1N5TA 4BBYA 3T5KA 5KTQA 2MY8A 3UQSA 1M5KC 1KS2A 1TKXB 5T7LB 3DOLA 3PW4A 3CDBA 4Z2XA 1U1KA 3K57A 3Q22A 2EPIA 3I0SB 5A8RB 2UUTA 4CTAB 4YB6A 2QA1A 4JV5F 1XN9A 2V94A 4EEYA 2DNGA 3L7PA 4E98A 2PD1A 2VA3A 5B09A 3CC7S 2UXBF 2YNHA 5BR8F 4Y2MA 4K4XA 3MF5A 4FP9A 5M2RA 3IRWP 1REVB 3CD5A 4DS5A 4QW9A 3W3SA 2DHAA 4BWMA 1GTEA 5A2QY 2V5HG 4X4RA 2ZH8A 1IQTA 1FDNA 2IJFA 2RKIA 2RU3A 1YJRA 2YWHA 2VC0A 3G6ES 2VG6A 2R2SA 3LO3A 4JV1A 4XAKA 4OLOA 3MGJA 6FDRA 1NJYA 3AY0A 2DNMA 5DM6Q 5D4PA 3IRXA 4WFYA 2E1AA 1HQEA 4BC7A 4TY9A 5J2NB 3CMES 2IMOA 2PN6A 1N48A 4CH7A 3CJKB 3LPYA 1J2VA 1FVQA 2XBPA 1F2GA 3FQKA 4J9RA 1BD6A 1QY7A 5C24B 2W9BB 1H38A 5HQ8A 4IOCQ 2VONA 2OMLA 3NAIA 3HVTB 1M5PC 1SIWB 1SBRA 3RU0A 2VG7A 4IFVA 2VV5A 4OJ1A 4ZPTR 1JJ4A 2W25A 1OQ3A 2WRMA 4RBUA 1PGZA 5AXNA 3ZZUA 4HI1A 4ICLA 1WEZA 2ROEA 2FD2A 3DU5A 4I68A 4WU2A 4ZVHA 1N6QA 1QLNA 4YP3A 3VWSA 1B64A 1YWXA 3M6WA 3D54A 2PT0A 5KG5A 3IAM9 2OKQA 2I8EA 5KFRA 4CQ1A 2RSQA 4NLPA 3V6KA 2KYXA 1NU4A 4H4KC 2XLIA 5J2MA 5HLFA 3KK1B 2KRRA 1N5YB 4K4SA 2YWGA 2OFHX 2V9KA 1VQNS 1GNKA 4A8MP 2R7UA 4LFCF 2ZH6A 4QIGA 2IAJA 5E3PA 2HNDB 3BO3A 4OI0A 4IOAQ 1Z1ZA 1KSPA 4KT0C 1WELA 5B7WA 3TUJC 5JVHQ 1JNZB 3OBIA 4DG1B 3MZIA 2ZH7A 2X1FA 3LP0A 3PJWA 2KB2A 1CC7A 2JDJA 5M2UA 3PO4A 1VGYA 1RTHB 1QAXA 1RK8A 3R5DA 5A0YA 2U1AA 4B9NA 1NK7A 2AGPA 3KLEB 1TAQA 4NLYA 4D3HA 4ZK7M 2OP5A 3NBPB 4NA3A 2QFJA 4M8LA 1YJTA 4C8MA 4F4XA 5HP1B 4TQSA 4DQPA 3MM5B 2DGUA 5IT4A 4QPTA 4B3RF 2HNDA 2A18A 4O4RA 2KFNA 4IG0B 4IRKA 1JLGA 2DGQA 3DLGA 4UOCA 4O3NA 2V4QA 2R8HA 4BDPA 3MAHA 1M1KT 5I3UB 3GIMA 1D3WA 1ZETA 2FHJA 2GGPB 4WIIA 3LP2A 4A8FA 3Q8QB 3VAIA 1FE4A 3E01B 1RT1B 1SXLA 3DOKA 4LF5F 4M95A 1X5OA 3G6YA 1C1CA 4C11B 4F3OA 2C2DA 1K0VA 4ZVGA 1WEYA 2CRLA 2KVIA 3GG1A 4YR0A 1UWBB 2A1BA 2R2UA 3ONQA 2DISA 4C4WA 2F8EX 3N79A 2M2BA 2WW8A 5GAGU 3BO2A 1CQMA 2D3OR 1NK4A 2FC9A 4OZ5A 4IUFA 3PX6A 3N0VA 5EX3A 5KFWA 2DNOA 3BN7A 4A47A 2F8MA 4X4VA 3CIMA 2IHR1 1YTYA 4DN9A 1L3VA 3J7YI 2J6SA 1GXTA 1Y00A 2FJWA 4FBTA 5JXSA 2FGCA 1H0HB 2YX4A 2VQFF 2CPYA 5E3AA 3SV4A 3MMBB 1S76D 4H4MA 4HTIA 5KFVA 1RT6A 4TY8B 1N4LA 2H9ZA 2IJNA 5K14B 1TL4A 3HHNB 3T3FA 1LK7A 1XR7A 2OIHA 4ED3A 1QVFR 5AE1A 2ADBA 3JB9k 3M30A 2YKMA 2BACA 2FC8A 2DT9A 5AJ3F 2RD5C 4C3LA 4IH5A 2J9DE 3D5MA 2LXUA 4EZ6A 1RA7A 4OZJA 2F7VA 3UD4P 1NJWA 3LUYA 5J2QA 4NYOA 1FKAF 1HI8A 5B0BA 3TI0A 3QGIA 4WXOA 5J2PA 2DNLA 4G6VB 2ZC4A 4CTAA 1Q53A 1HBNA 4DQRA 1TKXA 5FD1A 4AYBD 1CQNA 4MAKA 2MQMA 1FXDA 3R1HA 1D0EA 2N4DA 3OXGA 2QSFA 5DLFA 2WSEC 3PVXA 1V6HA 5F3ZA 1N56A 5DDPC 4V19J 2FPHX 3NNCA 2MKCA 1U6FA 3HHLB 2E9ZA 1FJGF 4A8YA 1JLBA 3OV7A 4R25A 4ED5A 2W7AA 2XS5A 2FHKA 2QO3A 3O6QA 1JLAA 2PDAA 2ZD1A 4DV1F 2CJBA 1TUVA 2CG4A 1N34F 4RW7A 3B82A 5KG1A 2MGZB 3VAGA 1M5VC 1QSYA 2MQQA 3R5AA 4M5DB 4ECUA 3JAMY 2R7RA 1K8AT 5LSOA 5LJ5Y 4FZVA 3H2LA 1OS5A 2AJFE 4WFAQ 4DV7F 1S72S 3EX7B 4M1KA 2MQPA 2OSRA 3IRXB 3NNAA 1ZPVA 2EW9A 3DLKB 3PJXA 4WTYA 4EU0A 3MFIA 3U1MA 1NKCA 1KNZA 2KXNB 3MI7X 2B5JA 4HEA9 1TL1B 2DCUB 5IM0B 3QIDA 4DV6F 3N6MA 5F8JA 4DV0F 5FDLB 2FTRA 3UWTA 1UA0A 1RTDB 3M32A 1DAXA 1HNIB 2DGTA 1S1WA 2HS0A 4G1QA 2WSCC 5IFMA 1UVLA 3DLEA 2EFGA 1RTIA 2F40A 4JI3F 1X9MA 1TK5A 4MKAA 2MDAA 3ISZA 4Q2MA 1IUJA 2XCAA 5CD4H 3HJFA 1R8CA 2D7SA 1BGXT 1UJ6A 5DDRC 3KLGB 2Q6BA 4ERDA 2W9AA 1U09A 1KRPA 4IR9A 4DSLA 5J2MB 5F0UA 3EPGA 3TOQA 4ETZA 3I5BA 1R6YA 4FXVA 4PQAA 5CZXA 2QV6A 1S1XA 2RRBA 3H98A 5KFOA 3KMQA 2B0GA 4ICLB 4J9SA 3M8SA 3G6XA 5DDOC 4FF2A 4IH6A 3TW0A 1DHMA 3NWGA 2W4DA 2FHJD 2XHWA 5C5JA 1UETA 2AV5A 2HHPA 3OHBA 2B9WA 1BQMB 2GCFA 2OPRA 2UZAA 3LAMA 1QUPA 4RX6A 4EFAC 3GE9A 3MCSA 4PXBA 3V6JA 4NX9A 5DQGA 3I9ZA 3OVAA 3I5CA 1IKVB 4NYZA 1UFWA 4KQZA 3DXSX 3MWBA 3W7BA 1T7PA 4AXIA 1DJ0A 2PA3A 3I55S 3AJ2A 3ENQA 4F26A 4X64F 2MSSA 3GFYA 3T5LA 4DS4A 4I56A 4UW2A 4Z37A 2HWTA 2CZ4A 2DITA 5IZHA 5KT7A 4K4TA 4B3TF 2IFXA 2K7KA 2R2TA 5IS2A 4KHRA 4Q45A 1HBMB 3ITHB 5IQ6A 4C2MA 2KHDA 3US5A 1QAJA 2LDIA 4PKDB 1CVJA 1RT1A 2AJ1A 4R0JA 2Y1IA 1SJ4P 2ZKTA 3DLGB 1SL1A 3HFKA 2D74B 2OPSB 3C6TB 1OO0B 2J9EA 3P5TL 3N28A 2RU9A 3PW7A 2ROGA 5F8GA 4MK8A 3IR6B 3M9MB 5HMXA 1ZTWA 3LGNA 1S99A 3N01A 5L1IA 1KEKA 1RT4B 1AUDA 2HHTA 2ADCA 2XMUA 4GO7X 1P9QC 4ZPWR 3M4XA 2A10A 1Q8BA 3DFEA 4EO6A 4QIFA 1RT6B 4N41A 1PSDA 3I0RB 4DFJA 3U27A 2IAJB 1CC8A 3MMBA 3K5LA 3CT9A 2JLFA 1IKXA 1DARA 4MK9A 2EBGA 4KB7A 2BANA 3ZZRA 2EFVA 1FXLA 3VAHA 3THVA 1VK3A 4TQRA 2GX8A 5FIIA 4WFNQ 1VQOS 4X4SA 4PWDB 2NPFA 3CD6S 4IFYA 2B4VA 2V8HA 1TVRA 4H4MB 2D3UA 1U6BA 4KAIA 1KR4A 2XMJA 1URRA 4IO9Q 4TU9A 2KXFA 1H98A 3MMAB 4U67Q 3AH6A 3V2UC 4ELVA 4LMZA 1Q86T 2QT7A 3MURP 3Q23A 3ZZZA 5DO2A 4K2XA 4XDDA 1VIOA 5KAKA 5IT0A 5D3GB 2QLXA 3E51A 4BS2A 4LF9F 1S6PB 3M2UA 2RMLA 1BWEA 2JLEA 3LQVA 1VJWA 1JB0C 4IG0A 2R8IA 1X0PA 2XMTA 4MIAA 2E5IA 3QIPA 4URQU 3U1NA 2KM8C 2I2YA 3CCES 4F8RA 2B4OA 2B4UA 3O2IA 2IVYA 1IKWB 1TL3A 1TVRB 4N47A 3RYLA 3MHYA 5KFDA 2RUGA 2GHPA 3H4DA 1E6VA 2E7WA 4G1IA 2ZD1B 4IQXA 1TKTA 4OI2A 1HW9A 2CPXA 2CQ3A 3DRSB 4WYWA 4YFUA 4Y65A 1DBDA 1FDAA 1O8BA 2E1RA 3T9ZA 2RVJA 4A8KA 3SDEB 2RDJA 3GFHA 3DHXA 4IFVB