3BR8A

Crystal structure of acylphosphatase from bacillus subtilis
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
90
structure length
90
Chain Sequence
b'MLQYRIIVDGRVQGVGFRYFVQMEADKRKLAGWVKNRDDGRVEILAEGPENALQSFVEAVKNGSPFSKVTDISVTESRSLEGHHRFSIVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable acylphosphatase
publication title Conformational Transitions Revealed by Structures of Acylphosphatase from Bacillus subtilis in Different States
rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 19
structure length 90
sequence length 90
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3br8A00
1Y0HA 2EW9A 5B0GA 4HI1A 2JDJA 1FE4A 5T7LA 4Q2MA 1AFIA 3HHLD 1X7VA 1TL5A 2L3MA 2RILA 1YJRA 1P6TA 2ZDPA 2QLWA 2XMMA 3HF5A 1SB6A 4EFAC 5B0DA 1Y9OA 4ZOSA 2IFXA 4Q2LA 5B0EA 1CC8A 2GGPB 4HI2A 3BB5A 4YEAA 1WD6A 2ASYA 3BF4A 4HH0A 4NL5A 4QOTA 1KVIA 2OD6A 2XMUA 1V3ZA 3K7RA 1OQ6A 1FVQA 2OFGX 2XMJA 2G9OA 2AW0A 3FMBA 4HL9A 1U7LA 4F67A 2OAUA 2ROPA 1CPZA 3I9ZA 2K2PA 3KG1A 2LQ9A 1S6OA 2XMKA 3KKFA 3T9NA 1X0PA 2OFHX 4OJHA 1CC7A 1QUPA 3UDCA 1YRXA 2FTRA 5B0FA 1R6YA 1OQ3A 2GV1A 2RSQA 3MCSA 1OPZA 1SI9A 2KYZA 4A48A 2AP6A 1MWZA 2BBEA 2BJDA 2KT2A 3BDEA 2OMOA 2PD1A 2GCFA 1N5QA 1VQSA 2HLUA 4A4JA 3LO3A 1KVJA 3DCAA 1KQKA 2GFFA 4OJGA 4DPOA 2BJEA 1RJJA 5B0CA 3LGNA 2QLXA 2RU9A 2N4CA 2BUNA 5F0WA 2AJ1A 4OIXA 2OP5A 1GXUA 2KT3A 4A47A 4ZA1A 1MWYA 3FRYA 3MZIA 2GGPA 3DXSX 3CJKB 2K7JA 2LDIA 4HH1A 1Q8LA 4Y2KA 2HLTA 2Q3PA 2ZDOA 2N4DA 2K1RB 3KG0A 2VV5A 4FNIA 4U9RA 1FVSA 5B09A 1FESA 3BN7A 1IUJA 5T7LB 3HHLB 1TR0A 1FEEA 2HIQA 2VH7A 3TRGA 4DL0C 2K7KA 2N7YA 3KNGA 3WDOA 3HDSA 1TUVA 2ROEA 1YJUA 2IYGA 1JK9B 2OKQA 2GO8A 3HFKA 2AJ0A 2BYCA 4FNHA 2QYCA 3VTIA 3BGUA 1YG0A 1TL4A 3QMQA 5IXUA 1K0VA 3TNVA 4YDXA 2HQIA 2GA7A 1N5VA 3BM7A 2XMTA 1Y3KA 2FB0A 1N5TA 1P8GA 2LQBA 4OJ1A 5KAKA 1Q4RA 2XMWA 3BR8A 3E8OA 5F0UA 4Y2IA 3CJKA 1AW0A 1JWWA 1SQEA 2HFOA 2K1RA 2ACYA 2QIFA 1APSA 4Y2MA 2LXFA 3HHLC 3HHLA 2CRLA 5B0AA 1XBWA 1TZ0A 3GZ7A 1OSDA 3FGVA 5B0BA 5B08A 2ROGA 3HX9A 1N5SA 1GXTA 4NPOA 4A46A 3LGMA 1Q53A 2FIUA 1AFJA 2W4DA 3QGPA 1LQ9A 1VQYA 2RMLA 4DN9A 5A6PA 1X8DA 3IWXA 1YJVA 1FD8A 2IYIA 1Q8BA 2OD4A 1S6UA 1ULRA 1Y3JA 2HFNA 1URRA 2PGCA 4OJ3A 5K9FA 5A6WA 1FE0A 2FHMA 2W4CA 3IWLA 2W4PA 3TOQA 1YJTA 1W2IA 3F44A 2XMVA 2KKHA
chains in the Genus database with same CATH superfamily
3PR4A 2GMJA 3EICA 3OJUA 3R7NB 5L46A 1TKTB 2DNYA 2PI5A 4OI1A 4IQXA 1XK8A 3DOMB 5KFQA 3BPSP 4F67A 2O1PA 2LQ9A 3ISZA 2XGQA 4ZCIA 2H51B 2A6MA 1WDTA 2GV1A 1VHFA 4Q8EA 3CCMS 3NXZA 3DCAA 2R7VA 1Q78A 4DSLA 2KT3A 3T6BA 1IKXB 3AD9C 4RO0A 2CXEA 1AYEA 2GZOA 3SZ2A 4NLWA 3HHKA 4ZDNA 1WOSA 2VODA 4HVZA 3FQLA 4AXJA 3DLEB 3IGVA 1EAYC 2YY3A 2MQ8A 2LP4A 2ZH6A 1IJEB 1UW9A 2OI2A 1F5BA 5H9FJ 2WOMB 5D6GA 2UU9J 4NASA 1C4AA 1JLGB 2E1AA 1B0PA 2RS8A 5HVFA 3MPVA 5L38A 2E7VA 2JOQA 3R2CJ 4NLXA 1SJQA 2XMVA 3OL6A 1FJEB 1KR4A 4OFZA 3KK2B 3TR5A 2VPWB 2OGUA 1UTAA 3Q89A 2QA4S 2XMUA 3SI8A 3MEDA 1KQSR 3KUGA 1VQSA 2V9WA 3TEGA 5ETLA 5KFKA 5ETTA 2VQEF 1NSAA 1XIQA 2CDRB 3S6EA 1RWXB 3IR6B 4YQWA 2AV5A 4X4VA 3FEXB 1UEUA 3H7HB 3VGVA 2XO7A 5KOXA 1Q8KA 2XLJA 1S0MA 1UP1A 4LMZA 4JI0F 3HCXA 4FBUA 4OV6A 1VJQA 4ZVGA 3LP0B 2CG4A 3OHBA 4PQAA 2CJAA 3CULA 2FC9A 1Q79A 1ZTWA 2AWZA 1RAHB 3HHLA 1O5JA 3EMTA 2QSFA 5KOWA 1HWUA 4A46A 4IKAA 2X3GA 2SXLA 3KK3B 3BH6B 3UPFA 3FCWA 1NK9A 3K5OA 2AMCB 1FRIA 8RUCA 3JAMY 2F8HA 4FDFA 4LUBA 1P6TA 4Q45A 3SV4A 3D66A 2GVDA 1HW8A 3O2IA 3PJ9A 1B0VA 3O6QA 4OYAA 2OFGX 5F8NA 4CI0B 1VQ5S 3ILIA 1XMOF 3BDPA 3T5KA 4I2PB 3AAWB 4DL7A 5C24A 2JEJA 4XPEA 2YX4A 2VQEJ 1RT4A 4USVA 2LDIA 4R5PB 2VV5A 4Y2AA 4RW8A 4M5LA 3PYDA 4CT8A 1NK7A 1VQPS 3MPUB 4L73A 4JI0J 2YPZA 2HQIA 3AOCA 4X62F 4LRDA 4Z2XA 2CQ0A 5KAKA 1PCAA 3CGIA 2CIMA 1ZETA 4DCJB 2K1RA 3KHRA 3QPIA 4JP8A 3UR3C 3GZ7A 3MEGB 3A4TA 4USWA 3EPIA 3PRVA 2VBWA 1U2CA 4ZHRB 1S9EA 5JUMA 1S77D 2VU5A 2AD9A 2HQ3A 3M9MB 5C2GA 4F0KA 5BR8J 3OFEA 3EXYA 3ENWA 4J9RA 2E7XA 1F5CA 3G8QA 1OYDA 1ZM9A 1UJ6A 3K7RA 2IVMA 4DFPA 4WK3A 4P6QA 2MSSA 2IAJA 5JXSA 4FS1A 1VBXA 3PJXA 4D3HA 1XMOJ 2MY7A 3BBCA 1RTDB 4RW4B 2ZC3A 5KFWA 2R2SA 4FVCA 5KFIA 2FJVA 4HEA9 4U9RA 3DLGA 2OSRA 3DLKA 4DX5A 3GV7B 4YR0A 1WC3A 1EB0A 4W98A 2KVQE 3C8YA 3HULA 4PG7A 1JLBB 3BEGB 1X60A 3SSSA 2B4VA 1P27B 3MF5A 3OVAA 1Q7LB 4X62J 2HG4A 1HNIA 2H48B 2ASDA 2AEJA 1YI2S 1LK5A 2DGVA 3EVMA 1VQMS 5D4LA 3CVKA 2RMLA 3TUIC 1T11A 5ETSA 5HROB 2ZH7A 4WIIA 3HKWA 4NCAA 2M2BA 1UZDA 5L1JA 1TL5A 4X4PA 5CCMA 3UCZP 2NZCA 2MKKA 2O01C 5BYSA 4I67A 5H9EJ 4ECSA 1WHYA 5B0FA 2AP6A 2ZJPQ 3HSZA 1D1UA 1UETA 3UO0A 4EWTA 3DXSX 2D3O1 4LRFA 3C19A 2P6SA 3ZTRA 1RADB 4K4XA 3HFKA 4ED0A 5EDWA 5C5JA 3BYRA 3W62A 4OLOA 2E9RX 2QLJB 4N77A 2GA7A 5A76A 3GG0A 1RWKB 5DGBA 1S7HA 2LECA 4NYZA 4ALZA 3JTNA 1K73T 2VG5B 4M5IA 3AOBA 4TYBA 4LF6F 1EQMA 4ZLNA 4M5KA 3MTJA 1HYSA 3BGRA 2EW9A 2C2MB 3NS5A 3BREA 2IFXA 4IYQA 1TVRA 1NZ8A 2PMWA 3M6VA 4KE5A 3EZUA 3FMBA 2ZD1A 1R43A 2OH2A 4F26A 2QT7A 3VHQA 4MKBA 1N5QA 2X3DA 4OZ3A 4CLKA 8AT1B 2KH9A 1QSYA 2AQ4A 5IS2A 2F8MA 3GSIA 1JLFB 1O51A 2UXDF 5D8HB 1UMJA 1TL1B 1VGYA 2MHEA 2WHOA 4FF2A 2G2YA 3I87A 4CLWA 2KZZA 3GFZA 1FXRA 4UUWA 2AT1B 3M2VA 2GX8A 3B4DA 2DNQA 2RUGA 4DL5A 4B08A 4OI6A 5HP1A 1EETB 2IJRA 2RNEA 3DDNA 4RWWA 5KT3A 3M2UA 5B08A 1OS5A 4JOUA 2XWYA 4IFYB 1RHUB 1V9OA 4LSZB 4LF6J 1U24A 3Q8UA 2MKYA 4EO6A 3KLIA 4RW9B 4C9DA 1X5PA 1S6QB 3TJ8A 4KJIA 4J9QA 4X65F 1CC8A 3GV8B 4HI2A 2YKOA 2C3MA 4RW7B 2GJIA 1OQ6A 3R7BB 4A8YA 1R6VA 1XR5A 1F9FA 1FFGB 2DGOA 2OPSB 5D0RA 2HW3A 4UT4A 1KLMB 3RRHA 1R89A 2MKSA 4J91A 1NK6A 3P3DA 2CJQA 2V2VA 4IRKA 2BE7D 1YWXA 1S4FA 4O0IA 5IFMA 2G13A 2UXDJ 3C46A 4WPAA 3A8EA 3MUVP 5J2NB 2QE5A 2F8EX 1YHQS 3EGVA 4K4ZA 1U47A 2QFJA 3NMAA 1S6PB 2IHR1 3OT9A 3FBEA 1RACB 4ES3A 2VC1A 4FF4A 3DHWC 4MIBA 4AYBD 1REVA 4DV7F 4ICLB 3MM7B 1IKWB 2DIUA 3TARA 2X1GA 3OR1B 1RK8A 3OV7A 4DLEA 2WVCA 3CIZA 2OD4A 4DX6A 1AT1B 3ZZPA 1C1CB 4KGKA 1TAQA 3D6TB 5DGAA 2J9DA 5RUBA 2R8IA 2HNZB 1GXLA 4OYXA 3I55S 3G6VA 1CLFA 4F4XA 4L3NA 1NHUA 1TL7A 3GYGA 4K4SA 3N5BA 1R0AA 1DQ8A 2HHHF 2IBKA 1TAUA 3UDLA 3ETMA 5HQMA 4B3OB 3US5A 1UFLA 1HQUB 4F2SA 1TP7A 2G0IA 4F4KA 5F9NA 1SKRA 5K14B 2DNHA 2R8GA 3PFEA 3V6DB 1Y7PA 3QBCA 4ZPWR 4PEOA 3FNNA 2XZTB 2FQQB 3Q83A 4EBDA 2GHVC 1YRUA 1S1XA 1RT7A 4WFNQ 4DV7J 3BKUA 3PKYA 4NMLA 3WC2A 3GE9A 1CJVA 3OFFA 2XNQA 3IWLA 1SKWA 3HSJA 2JDJA 2DH9A 2KHCA 1Y9OA 3VALA 2IA0A 5HMZA 3CCES 4TLQA 1R8HA 1RAFB 2QC3A 3L7OA 4C98A 4NLYA 2RSQA 2W2OP 1N33F 2VOPA 2HHHJ 4ZVRB 1J5OA 4MH8A 1XERA 1IKYA 4XPCA 1U4BA 1YJWS 4NRUA 2DK2A 3WX8A 3HKZD 3SXLA 2JH3A 2PI4A 2X7IA 1IVZA 4PPZA 1F2HA 4WCEQ 3K8WA 1SJRA 2UUBF 5L1IA 1KVKA 3D3BJ 3VQSA 2JFDA 4ATNA 4ECQA 2ROGA 3M8SA 2V67A 2YX7A 2M0GB 3MEDB 4X2BA 1Y3JA 3MPWA 3W60A 2RQMA 3JAMU 3JS9A 4H54A 4A8SA 4IOBA 1S1WA 4ZOSA 5L9XA 5C42A 4AT1B 2UVUA 3QRPA 3FVYA 2Q66A 3I5AA 3VAFA 2I38A 1RYSA 2BJDA 1N33J 3LQVA 2ZH4A 1HD1A 4DQQA 4RUCA 3PW0A 3TAQA 3HHLB 1VIOA 2R7QA 1S9GB 2XGPA 5KFXA 3KFWX 2WVBA 2VFTA 4EBEA 4XDCA 5LJ5Y 4MTPA 1UVMA 2MQOA 2NLWA 2UUBJ 1VCTA 2GVDB 4OLPA 1KFSA 3ZZYA 1F60B 1XNQF 4UQTA 1IXKA 4FVMA 2MZRA 3J80Y 1L3UA 1U02A 3PEJA 4C3KA 2OPPA 1NSKL 2G1DA 2CAJA 1H0HB 2D3OR 3FC9A 1EX8A 5C24B 2J0SD 1G1XA 1FRXA 1X31C 2B4OA 2I5JA 3CD7A 3VAIA 1RT4B 3KJQB 2KXHA 1S59A 3TQEA 1ITPA 4ZPDA 3MPYA 3RGIA 1FJ7A 1FDNA 1KC8T 2HWHA 3EZ5A 4RW8B 3KHGA 4PWDA 5IOLA 3QJJA 4KH0B 3N0VA 4DUZF 2LYVA 4I6AA 2KFZA 3KXDA 1EZZB 2K1RB 1KBRA 2YH1A 3HD2A 3OUYA 3VAGA 3LGHA 3K5MA 1BMQB 2BYCA 2YQ3A 1C2PA 3Q8YA 1S9EB 3MUMP 4CNZA 4MFBA 1JLAA 3SEOA 1T9XA 4U96A 3LP2A 1UVNA 2UUWA 1RI7A 4U67Q 3W5YA 1RA7A 2W25A 1ZBTA 3WBZA 2WW8A 1LQ9A 2IAJB 1XNQJ 1U6ZA 2FHMA 5H1SV 5EWFA 1U1LA 4CO1A 1TFYA 1M1HA 1WACA 3Q8SB 4V1Ak 1NJYA 2OELA 1A0OB 2WK4A 3N6MA 1FTRA 3JSBA 5E2QA 2ZNZA 1VQLS 2XTJP 3DLGB 4TY8B 4DF8A 2L41A 3DLKB 2DR8A 2KT2A 3IS9A 1M5VC 1EIYB 5KG7A 4IH7A 1AZSA 2DKOB 2OPQA 4KV8A 1IR2A 4DUZJ 1EARA 3VF0B 1UFKA 1HNIB 4C6AA 1S0OA 2CPFA 3K59A 4BDPA 2NXCA 3M32A 3IAM9 1F5AA 2AJ0A 3NLCA 3M8ZA 3ICLA 1PILA 4ZMMA 1K1QA 4C3MA 4X64F 5GMKa 3L3CA 2PFDA 3AQOA 3MM8A 3D67A 5CHCB 3E3XA 1T9VA 1TK0A 3GMGA 1GXTA 2EG1A 3UVJB 3K5NA 2XO6A 3Q8PB 2JLGA 5F9LA 1EHWA 4B17A 3UR0A 2QA4G 3QJPA 3DFEA 2BE9B 3GWCA 1Y0HA 1VR6A 2C2DA 3HZGA 2GIQA 1S99A 2LDYA 4PYDA 4PQUA 1WF2A 2LU2A 3M30A 2RU3A 5AE2A 4B9UA 3G96A 1RWNB 1N5YA 1BHNA 1XR6A 1YRXA 2AGOA 2EC0A 2KO1A 2W7PA 1RXOB 2GIFA 4RNMA 3GQCA 4N8OA 1D9AA 2CPDA 1N52B 1PC5A 4WJBA 2LVWA 3MECA 4LF2A 1UA0A 2X51A 2BDPA 3OLAA 1PO6A 3N5FA 4MK9A 2Q6BA 1VRUA 1F6TA 2B3TB 1WELA 3IWNC 4M95A 4U95A 3E01A 3NAHA 1S1UB 2IM1A 3NCPA 2ADCA 4RU9A 2KI2A 1N8RT 2OHDA 1HYSB 2F4FA 3BGRB 1X5SA 5ADZA 4ED8A 4X64J 4CM2A 2DGTA 1MW7A 1T94A 4A8OA 3I0RA 1TVRB 3PHTA 4C0HA 2ZD1B 4EZ9A 1X4CA 1AFJA 2XWXA 5E3PA 3DM2A 3DDKA 3PIOQ 2V9KA 1VBYA 5E3CA 3UD5A 4OV1A 2R4FA 2EI5A 3PX4A 2IY5B 2KKHA 1UKUA 1S12A 1TUWA 2M8DB 4DEZA 3JSRA 5C25A 4P10A 5IQQA 1Y5LB 4M5MA 3BF4A 4HH0A 2A2CA 2CJ9A 3ILJA 4KBIA 3I9V9 2XMKA 3PV8A 3T9NA 2MQLA 2DVIA 2RS2A 4OHWA 1BLUA 3AXKA 2Z2ZA 3W61A 2DPJA 3T19A 3T6JA 3M2VB 2RVJA 4UQGA 5I42A 2CFXA 3EXCX 5L1KA 2FYXA 1U45A 4OHZA 2G2ZA 4KIAA 2BOAA 3CE8A 2XCPA 3T1HF 2JLEA 4OI0A 1NKCA 2IDLA 5C2CA 4ZLPA 2FD2A 3HDSA 1LFPA 3J7YI 4IH5A 1FNXH 1ACMB 2VG6A 1MG7A 3QAEA 3HM9A 5FLXY 4NXMF 4GVLA 3HVAA 5GAGI 2YH0A 4F25A 1YK9A 2LXFA 2RD5C 3I5CA 3MFHA 3QIPA 3WZ0A 2HAIA 4JI5F 4KSEB 4ZPVR 4CTAB 4WU3A 1M5HA 4KB7A 1URRA 1DZ5A 4DU7A 5EHHA 1RGVA 1WEYA 4TKTA 2PO4A 2YQ1A 2H3EB 4P2FA 3A1YG 4K8RA 1NBEB 2R2RA 1L3SA 5GMEA 2HSEB 2V8GA 2Y0BB 3ENAA 2HS0A 4ZK7M 4HHJA 5EUHA 3G8SA 1LWEA 1OPZA 4ILRA 3S7RA 4K5SA 2DH8A 4YN3B 4AQYF 5HBMA 2HRTA 1WC5A 3ISNC 2MGZA 3IA0A 1SJ4P 1NDCA 3UCGA 1CQNA 3MWBA 4FNIA 3T1HJ 5DQIA 3TRGA 1GH8A 2QYCA 4ILLA 1TL4A 2MQNA 1K44A 4NXMJ 3W9JA 1AW0A 5KT2A 1HBNA 2HHUA 3C15A 1RT5B 1P1LA 2J6SA 1VK8A 3HX9A 1TUGB 3BSNA 1TL7B 3HVRA 1NH7A 1R0AB 4TNOA 4FN5A 5KG1A 4G3IA 4YR3A 5KFVA 3G71S 4CLLA 5D77A 4ZVSB 4DR2F 2AZ1A 3TP2A 1DFDA 1WF0A 3AD7C 2VA3A 4WFXA 2XLKA 2R2UA 1X0FA 2YWHA 2HLUA 1KVJA 4OJGA 2CQBA 2YPYA 3B8HA 5DG9A 4AQYJ 1FDBA 2AGQA 5EX0A 1A9NB 5D0GA 3TZYA 2V2KA 2ZHBA 1NPPA 3WDOA 1S1XB 1RT7B 3THVA 4GC7A 3PDNA 1R3NA 3K8VA 1LWCA 2EEYA 1CJVB 3FBBA 3JB9k 4IG3A 2C2ZB 1PAUB 3D54A 2YKMA 1N88A 3NNAA 4WIQA 2M5YA 3HVTA 3Q2TC 1LFWA 4DF4A 3ZZRA 3EYZA 1Z4UA 1Q5YA 1HBMB 2CQDA 3CSKA 2JLFA 1FHTA 5T7LA 1J5OB 2XYHB 3F41A 3TEHB 1IKYB 2RDIA 3ITHA 4DR2J 2MJNA 1REGX 2YNIB 4I0WA 1SL0A 1U1KA 2OAUA 4DQSA 3G6ES 1S6OA 2LQ5A 1RWOB 5CABA 2V0NA 4OX8A 3W63A 4A4JA 1SV5A 4J9KA 1ICEB 3H5UA 4LF1A 3KLHA 4I64A 2UUAF 4ILMA 1DQ9A 1VC6A 2DITA 4K4TA 5AXNA 1VYAA 4URQU 3OD2A 2KT5A 3LWMA 3IGNA 1RCOB 2OKQA 4UOCA 5M2PA 4MKAA 3D0GE 3RBDA 1JXLA 4QU6A 3J81j 1P8GA 3PYEA 2QG9B 2CJXB 4UZCA 3RBXA 1KHVA 1S1WB 4FPIA 4ZIWA 1Y4ZB 1NCLA 3IXQA 2CPZA 2IDEA 5C42B 1N32J 3ZFVA 3SQGA 3RB4A 1RAAB 4TLRA 2W4DA 4NLPA 4NLSA 2BX6A 3ETOA 1SQFA 3OXLA 3J80U 1X4FA 2W8KA 5B09A 2HBYB 2OLWA 5D3GA 4DUYF 1D9DA 2QLWA 1Y10A 4PKDB 2DO0A 9ATCB 4I69A 2J8AA 3TQ1A 2DISA 2VONA 4JI8F 5KG5A 2R2TA 1RDRA 2B0GA 3U1MA 4C11A 3ZC4A 2UUAJ 1SCJB 3M8PA 5CAAA 2XM3A 3U02A 2K06A 4ED4A 1G6BA 4ZN3A 4UY8T 1R0CB 1RP5A 5KFOA 4ENOA 5KG2A 2CNOB 4ZPTR 4ZP9A 4X4OA 8ATCB 2N7CA 4UY85 2DT9A 2XC9A 2ZUAA 5E7OB 3MCMA 2ZBIA 1SVDA 2LA4A 1FO1A 4IR1A 4J9PA 5B0AA 2I5JB 1U0HA 3RB0A 3PG9A 1U8SA 1JXEA 5JMNA 1HFEL 3CF5Q 4NLTA 5CYJA 2R7TA 4Z7YA 4PWDB 4PXDA 1YJTA 4G1QA 3RRGA 2OEJA 3RUBL 2QFIA 1NMEB 3PM9A 4M5NA 2E1RA 4DUYJ 4BWJA 4ZKAA 4Q2LA 1NDKA 4ZP6A 3NKYA 1U7LA 2HRUA 5E3QA 5T41A 3OUYB 2D41A 2R7XA 5IM0A 3DHXA 1VISA 2DNOA 1JLAB 2CZ9A 3LP2B 1NUEA 1VJWA 3OTCA 1KOOA 2C1EB 1SIZA 1RLDA 4EI2A 1ELOA 1YG0A 4BWMA 1HWLA 1PBUA 1JQGA 3MM9A 3EWGA 5HJXA 4I2QA 4B3TF 2DGQA 2X1AA 1SKUB 3HHLC 4PG8A 3EDRB 2V6AA 4OHVA 4QIGA 3DGPA 1HNWF 1RT6A 2B56A 3QGPA 3UNGC 2DPIA 2X1FA 4Y34A 3IS9B 2OIHA 1AZSB 4QQBA 2V94A 2OPQB 1HNVA 2FPHX 4KV8B 3AB4B 4RUHA 2J9DE 1UWBA 4DSEA 5IV4A 4A8KA 3M32B 4HYKA 2Z8QA 3DU5A 3DYAA 4DMZA 3TI0A 1WG1A 1H74A 1NJWA 3MM5A 3DKDA 3MM8B 4HKQA 4KGVB 3PW7A 4EMDA 1L3VA 3J7YU 3NNCA 1YJUA 3QGGA 1K0TA 2HZCA 2DBBA 1DTTA 1XMQF 1U25A 3BM7A 5GAGU 2W24A 3KUHA 5DDPC 4B3TJ 4DFJA 5FDLA 4A8MP 5J2MA 2DHGA 4PQUB 1KEKA 5HQ8A 3M30B 4ECVA 2CNNB 1H2UX 4GRSA 1N5YB 1HNWJ 2N3LA 3T3FA 2MLXA 1PYSB 2R9LA 1N0VC 1SIWB 4B02A 4NZ6A 1F0XA 2Y1IA 1MMDA 3BQ2A 1QUVA 2FJXA 1HHQA 4YR2A 4H4KA 1VRUB 4ID5A 1IBLF 3MOZA 4ED2A 1RHMB 3UWTA 1LXJA 1WC4A 4EGLA 3E01B 1KQKA 1H6KX 3LALA 3O3LA 4DPWA 3MCOA 3W5XA 2UXBF 5I3QA 4LFCF 1FESA 4NWBA 3KLEA 3I0RB 3DXBA 4N41A 4MT1A 4NE9C 4R8UA 5J1EB 2VBXA 4MK7A 3ONQA 3DM2B 3ZNJ1 2VZ9A 2BACA 5FLXU 1G2EA 1XMQJ 1DJ0A 3RB3A 2MQPA 4YY3F 2FLLA 4G65A 4HHUA 1LK7A 3TUJC 4KHMA 3HSGA 5C25B 3GP9A 2CWXA 1UCNA 4WTOB 2ZKUA 4J9NA 6FDRA 2FJAB 3WIVA 1SC6A 3OL8A 1ULRA 1WKJA 5AXKA 1T03A 1RT1A 1AFIA 5I42B 2FVCA 2C2OB 5B0DA 1NKEA 2DB1A 4FXDA 4ELVA 4B9NA 1NK4A 1T95A 3BSAA 4Q0BA 3EVOA 2J5AA 4ZPCA 2EWHA 2A1BA 4JI6F 5ETMA 4KT0C 4K4VA 2WVEA 4QPTA 1CC7A 1IBLJ 2EFPA 2LU1A 2PD1A 4E2FB 5T14A 3HHNB 2HVDA 2VASA 2UUCF 2VFRA 2GQQA 2LFVA 4KKOA 3FRYA 1FF2A 1GAOA 3QWPA 4NA2A 5KFLA 4E0DA 2UXBJ 3CEDA 2YNHA 3JTPA 4LFCJ 4NYPA 3QIPB 3Q8QB 2IM2A 1FKPA 1C0TA 2FHJD 3AH6A 3R6LB 4MMOA 2MMYA 2RRAA 5E33A 3NS6A 1RLCL 3GCXP 4Y2IA 1RU2A 1KWMA 1RTHA 4YY3J 1XEZA 1UPPA 1XBWA 3W8GA 4F2RA 4LF5F 1ROFA 3TA1A 1LWEB 2BKPA 2JRSA 2ZBCA 4ELTA 1RAGB 1QVGR 4WP3A 1HQEA 3V6HA 4C2MA 4YUDA 2EFVA 5HBMB 1XTZA 2MGZB 3W65A 3I82A 1WG5A 4NRTA 4OMFG 3J7AN 1T8EA 5KFYA 2XMJA 3M8QB 5LT5A 4JI6J 3BSOA 1QD1A 3SIPB 3SSRA 2DGWA 3CWJA 2ZJQQ 3M6WA 2WRMA 2V2ZA 1FRHA 2UUCJ 1SUQA 3ZTSA 1U0SA 1HBNB 3C15B 2Z2YB 1FVSA 1T05A 2V5HG 1RWUA 3VZHA 3LUYA 3AY0A 1U8WA 5KT4A 4RPFA 2IA6A 3M05A 2RQCA 1PJ7A 2XG8A 1KNZA 4J9SA 3AQPA 4YB7A 2C2RA 1VRQC 2DIVA 7AT1B 3BGLA 1BQMA 1WNEA 2J8SA 4JI1F 1QAYA 2V4QA 4P71A 1YJ9S 3U7JA 4S0MA 4I7FA 2E44A 3TVYA 4LF5J 2DXDA 4ID8A 1FJCA 1N4LA 2DNGA 3RG6A 4K4YA 2Z2MA 4M5JA 2R8KA 3CDEA 3RRKA 5EWGA 2BANA 3I9ZA 3PVXA 1HWIA 4F4ZA 1Q86T 5HLFA 3W1YC 2AEFA 4DV6F 4IFVA 2JHEA 1B0TA 4IG3B 2MZTA 3CDWA 4C8OA 2YKMB 2V4RA 2IRUA 3DN9A 1AXQA 3X3UA 3HVTB 5KT5A 4Q8FA 3MFIA 4V19J 1FERA 1SC4B 1Q8IA 2GMLA 2NUHA 1TK8A 1UVJA 1RWPB 1L3TA 4QR0A 3GLJA 3T41A 5LM7E 3AJ1A 3D0HE 5A0YA 5HMWA 1VLYA 4U7UD 4RLEA 1F1BB 2BW7A 3ITHB 3ZTQA 5CCLA 1FNOA 4DR3F 4JI1J 1VIXA 3KOAA 1GMVA 1CSJA 4KR0B 4P74A 3WX4A 2PGCA 4OYPA 4F3QA 3TAMA 1SV5B 2DHXA 4FYVB 3PY8A 3KLHB 2V50A 5E41A 1ZH5A 4IDKB 5G4DA 3BB5A 1VQOS 4CLPA 2PA3A 2O66A 1UVLA 2W9AA 3MCSA 4ECYA 2ZM6F 3ENQA 3BDEA 2HVEA 2AF6A 4WZQA 4DV6J 2C3PA 4K0KF 3DLBA 4BC9A 4NLUA 4F7VA 4CLUA 4DZ6A 5KFZA 2H5IB 1HHTP 2BRKA 3GR1A 1N34F 1W26A 3PYGA 3SQGB 3EX7B 3QMQA 3IAS9 1G3OA 1XC9A 4R0JA 4RX6A 4OYOA 1ZYQA 1Y3KA 2DGUA 1N5TA 3BR9A 2OTJS 5D3GB 2V8PA 2BABA 3FGVA 4GVBA 3CB4A 3RJMB 2O5DA 1Q53A 1AROP 4GO7X 3OXGA 4DR3J 5CZXA 3B82A 2D7SA 4DOZA 1NK8A 4QZVB 3DGVA 3F44A 3LTOA 4Z7CA 3LANA 2ZH2A 2KG0A 1P9QC 1JLEA 3BO4A 4DXLA 3SCKE 4ED5A 4LQ9A 1NJXA 5IQ6A 2MDAA 4DR1J 3IR5B 1H98A 2F3JA 1MMNA 2ZM6J 4A8WA 1XWLA 2MJUA 4AFFA 3M8RA 3PR5B 2MSTA 1YSJA 3D6MB 2GAGC 1LXNA 3KJNB 1TKDA 4OZJA 4K0KJ 4Q5VA 4QR2A 1RCXB 3A8KA 1U0HB 2CKWA 4NLDA 1SL1A 1NAQA 1N34J 1CULA 1CJKA 5AJ3F 4NYOA 3UDEA 2ZOGA 4RBTA 2LQBA 3IG1A 2QL5B 3UCUP 2M7SA 2RB7A 2WB1D 2CQ1A 4XTTA 1GX6A 5K8PA 4CP5A 2YKNA 4B3MF 4NA1A 5CD4A 1EP4B 4DQRA 1ZM4A 4L76A 3AJ2A 1U1QA 5A6WA 2KXFA 3QSIA 5IM0B 2NXNA 1ZA1B 2PFFB 3ILOA 2LCWA 3L09A 5MLCV 5C7PA 1LV5A 4P72A 4WFBQ 3EUNA 3AT1B 4FF1A 4OJHA 2E5GA 1YITS 1T3NA 3OQ2A 1WOPA 2C22A 1R0BG 3LO3A 2Y1RI 1H7WA 5G0RA 3P4UB 3MM9B 4F4YA 2FJDB 2ZHAA 5CYQB 3FEYB 2VPXB 2CG8A 1TR0A 2LQ8A 1WWHA 3GV5B 2Z2LA 5CYMA 3GFYA 4NLVA 4RL1A 3DGPB 2ABYA 2BXJA 3CJ3A 1X4BA 1RT6B 4ZS6A 1E6VB 2M88A 3ULHA 5AJ3J 2W1BA 4P75A 9RUBA 4ED6A 3P5BP 1HNVB 4C0OC 5ETKA 4IOCQ 1RZMA 3MEEB 4B3MJ 1RAJA 4O3SA 5KFCA 3DYAB 4DPYA 1WC0A 3MM5B 1NXIA 1SKSA 2I0XA 2CPXA 2UXCF 1X4GA 3NGKA 5M2RA 4LF7J 2UVWA 3UI3A 1FX2A 1WI8A 3HLUA 3KHLA 4AL5A 3SDEA 1H2VZ 3NWGA 1JB0C 1DTTB 4FF3A 3BO3A 5A8KB 3CJTA 4LR8A 3W8PA 2EK1A 3OTOJ 2GGPA 3QT6A 1RT2A 2BEFA 4RUAA 1T7PA 5J2MB 3V6JA 4FXWA 4GO5X 3PRDA 3CIMA 1HMVA 3IRXA 2MZ1A 2NZ4A 2B8QA 4QBUA 4DG1A 3FJ2A 1JLQA 4U8VA 1BC6A 1S10A 1MN9A 3OVBA 1RWWB 3HXMA 4IH6A 4LSNA 4ID5B 3LH2S 3MAQA 4Y00A 3V6KA 3G6XA 4DN0A 1M5SA 3L7UA 4M63A 5LL6d 3LF0A 2AJ4A 1YJRA 1U1PA 3SFGA 2QLBB 1L3KA 3D1OA 5SUHA 2UXCJ 3EGNA 3KLEB 4GC6A 2FJWA 3QATA 3CPWR 4R8UB 2IM0A 3R27A 2KN4A 4G6VB 5GAHU 5KFAA 1W7WA 5KT7A 3MOJB 3BZQA 1CJTA 4P2XA 1F3FA 4HDGA 1SPBP 4LBHA 3UD3P 1WI6A 1JK9B 4DX7A 3CCJS 3MR7A 3WQPA 5DLFA 5A2QY 3NBPA 2VPZB 1T03B 1JWWA 1RT1B 4DV3F 5BR8F 4YFUA 1Y11A 2CRLA 1OY6A 4KGMA 4Z37A 2A18A 3PKMA 4B9MA 4ZLJA 4JUZA 4J9MA 1O0PA 2LLZA 3I6PA 4RBVA 1S49A 2Y8WA 3MR2A 3DRYA 3K89A 1Q82T 3CO9A 4KKOB 4WXOA 5DQGA 2KZMA 2WVDA 2YNHB 4RW6A 4O3OA 2B6AA 1SC1B 4LRBA 3L7PA 2RJZA 1FKPB 1C0TB 3GIRA 2KHDA 1B70B 4DWIA 2E66A 2F7VA 2Q43A 5HMXA 1RHJB 2F9JA 1C0UA 3WC0A 4WP9A 4U7CA 4CDIA 4ITSA 4OHYA 1RTHB 4P7TA 3HHEA 1RAIB 4ZCKA 2V4JA 1NKBA 3AHPA 2ZWPA 1GK8A 1YBTA 5K8OA 1HQEB 3NMRA 2DO4A 4PG4A 4C8NA 3CJKA 2QIFA 2HFUA 3M8WA 6FD1A 1RUSA 4DV3J 3AOAA 2ADBA 4X4SA 1NPKA 1RB0A 3QNWB 3ZZZA 2PN6A 4FKXA 4ETZA 1X8DA 4JB8B 4FYDA 2WONA 3MMCA 3H90A 1HHSA 2Z57B 1HL6A 2HEKA 2DCLA 4EEYA 1DHMA 4Q2MA 4F3OA 1HNZF 4DV0F 3GJRB 4KQZA 4Q43A 1FKAF 2PEHA 3QGHA 3IR7B 2CJYB 2CQ4A 1WEXA 1T05B 2FZGB 2U2FA 2W2MP 2V8VA 2RDDA 1MWZA 3M8YA 3SMZA 1HIYA 2AKWB 4XIUA 2DRBA 2XCAA 1FRLA 3QZ8A 1YDLA 4EUVA 1V3SA 5F0WA 1S72S 2WOMA 2LXIA 3G87A 3KG4A 1NDPA 1RTJA 2YNFA 5K8MA 1FRMA 3M1VA 4UOGA 2HBZB 1JJ4A 1JKHA 1S0NA 4I7FB 1VQ7S 1N6QA 3P6YC 4PZVA 2EKYA 2DRDA 2FB0A 4O44A 3Q0AA 3D2WA 1M1KT 3T1AA 4FYWB 1BWEA 4YB1P 3D6FB 2HMIA 4ZVHA 1ZZNA 1QJHA 2J76E 2BANB 1YJVA 2DY9A 1RISA 2FVSA 2XZWA 1OO0B 4PUOA 2WW4A 4BHQA 3MUTP 1HNZJ 5DETA 4DV0J 4L6V3 1Q0NA 2E1PA 3G9CA 3HFVA 1TV6B 3A8IA 4QIFA 3QIDA 1VQ8S 4O3RA 2HHWA 4DV1F 2OMOA 4CZCA 3RR7A 1S57A 1NB2A 3SV3A 3GJTB 1KQFB 5A0YB 4Y28C 3IO1A 2YTCA 2NSCA 3QO9A 2EFNA 3VAMA 1H7XA 4USMA 2KDOA 1TTHB 4OZNA 1ZZFA 1QTMA 3VAHA 3TAMB 4WXWA 2HFOA 2GO9A 3Q2SC 2G2OA 2KFNA 1HR0J 1WKLA 2F1FA 2CZVC 1VS3A 4LSLA 1Q1KA 1BY9A 3BBFA 4FKYA 4UTGA 5DQHA 4R5PA 3RR8A 3QFHA 5I3UA 4LJMA 2MLZA 4YHHF 2FC8A 4KRWA 2XULA 1VDHA 2DR6A 1JJCB 4A48A 4DV1J 2BJ1A 4ZVUB 3UQSA 2GFFA 2W2QP 1SQGA 2YNGA 3N28A 3MEGA 4PAAA 3R8YA 4CCHA 5SZTA 2HHQA 1WHWA 1MWYA 3TUZC 3MCNA 4OZ1A 3AFGA 4QPXA 3JQKA 3HK2A 2V69A 2YKPA 1SC3B 2LKZA 3FDSA 1KQGB 2DRAA 4M5DA 2VH7A 4OYBA 4RNOA 1JJ2R 4CIOA 1W25A 5AE3A 3D9BA 5JVHQ 1VC0A 5D4OA 3TUPA 4Y6IA 2I2YA 4JBCA 4NI2A 1FWLA 5HMYA 3KLGA 2BW2A 4NCGA 3TJAA 2ATLA 3FEZA 1M0SA 2HQCA 4AXIA 3OFHA 4KH1B 1TMJA 3M9OB 2HGLA 2WTFA 3H5XA 2BVZA 3GJQB 2HZAA 1LOUA 1K1SA 6AT1B 1AUSL 4USIA 3HT3A 1K47A 2CQPA 2UZAA 4OYWA 1LKZA 4YHHJ 2QMXA 4DS5A 4B3RF 3EPGA 4NZ0A 5E5NA 5A8RA 4D3GA 2QZ8A 4C8ZA 3GILA 2F4VF 1CULB 3HT0A 1V6HA 1CJKB 4YOEA 3LGNA 1VBKA 3G2XA 3IG1B 3D1HA 1TELA 4CO4A 1ZOTA 3PW4A 1WDDA 1QTNB 4DL0C 2ILZA 4OZ5A 4WTYA 2D1CA 2YKNB 2NSBA 4UW2A 1OWXA 4FZVA 3UN5A 5KFSA 4DJBA 1VQ6S 3FCVA 2CPHA 1FDAA 4W90B 4TU8A 5HVGA 2C28A 1TKXA 2GIRA 3LGMA 2CQ2A 1DTQA 4DQIA 2Z30B 3I56S 1S1TA 3U1LA 1TK5A 3WIUA 1GTEA 1SJFA 3HPOA 3FMWA 4JI7F 3M7VA 1JLCA 2OEKA 3MPDA 1QDUB 1D8YA 5G0RB 5LSLA 2J6TA 3HF5A 4NZ7A 1MN7A 4WFAQ 2E29A 1B7YB 2ZITA 2AYMA 3DLLQ 4QW8A 5CYMB 4B3RJ 2AJFE 2F63A 3R1LA 1V5IB 3DRRA 4XO0A 2F4VJ 5KTQA 5KFUA 5F41A 2VG5A 2RU9A 4NA3A 4IUFA 2ZDOA 3PO4A 4I68A 3GG1A 5MAOA 5L39A 4LR9A 4IG0A 3UE2A 3KDNA 3ILLA 2HURA 3VTIA 2HVHA 3A12A 4FS2A 2MKHA 3I96A 3NG8A 1C1BA 3LP1A 3QSYB 4B9SA 4FP9A 3K58A 1Q81T 3JSMA 2ASJA 3EGZA 4FYYB 4EO8A 3L4BC 2ZJRQ 2IYIA 1Q8BA 1UEKA 1PGZA 2QMWA 1CQMA 4JI7J 3DI6A 3Q86A 1RAEB 4DPXA 1OPIA 2HNYA 1IBMF 1R27B 2GGPB 3DOLA 4P9SA 1KVIA 1RT2B 2OD6A 2IC3A 1IWGA 1HI8A 1HMVB 4A8QA 1GMUA 4DSFA 4YB5A 3IRXB 2FHJA 4DG1B 3CDBA 2CZ4A 1KSPA 4IRDA 2H5EA 2PEBA 1JLQB 2LEAA 4IFYA 2KJVA 2XSFA 1U1OA 4KGXB 3SSQA 3ZZUA 1KTQA 3EZOA 4LSNB 4NEZA 4PABA 2BA9A 5HL7Q 4JV5F 3ZZTA 4KAIA 3OL7A 1S1VA 1YRTA 2IVYA 3NL0A 5A2QU 4OJ1A 4QIVA 2E5HA 3I5BA 3GIKA 5LMUF 4MJKA 2E1CA 1PJ5A 4DR5F 4N56A 5HK4A 4L74A 4IO1A 3CMES 5K9FA 4OJ3A 1QSLA 3NGTA 2OUGA 2HK3A 1FE4A 5JJBA 1R8PA 2GNKA 2L3MA 3F73A 3PYFA 4JI2F 1CJTB 1IBMJ 5J2NA 4LQ3A 4KHRA 2BMBA 2DEJA 5DM7Q 3C66A 5THWA 1M5KC 2KYZA 4P2SA 1B7FA 1UPMB 1EJ7L 4DPUA 2QLXA 2OP5A 2XEXA 4ZA1A 3NBPB 2GJFA 4WWSA 4EZ6A 2O3DA 1FEEA 4QWBA 3NAIA 3H4BA 1C1CA 3A3NB 3RU0A 1X4EA 4JV5J 1FT8A 5DG7A 1XJWB 2HHPA 1FRKA 1RBAA 3ENVA 3FK4A 4DI6A 4BCAA 2ALZA 2A3JA 2MTLA 1RHKB 5LMUJ 3NY0A 2XYGB 4DR5J 4RW6B 3BN4A 3RB6A 4DDFA 2B6AB 2OTLS 1YZ7A 1YJNS 4ZP8A 3N01A 4U6PA 1RBLA 2IRYA 4PXCA 5K5MA 1NK0A 2PSZA 2XMMA 1HW9A 1FFSB 5HO4A 1T02A 4JI2J 4H4KC 1NRKA 5E3RA 3MI7X 3TVZA 4OZ2A 2EFGA 4P2MA 5D0EA 2V4JB 4ZPAA 2VFVA 3J7A1 2PIIA 4DPTA 1D3WA 1FK9A 1GQEA 3AA8A 3F0NA 3CJKB 2R8HA 2H54B 1KDNA 4WKYA 2CQ3A 3LPEA 2DD8S 2CWKA 2N7YA 2ZE2A 3PXGa 1PBAA 3H98A 4FNHA 3I4PA 3ET6A 4DSJA 3Q8RB 1ZAVA 3BPDA 2WONB 3MMCB 3W9HA 4KGZB 4C97A 4MYTA 3D0IE 2XSJA 2C2KB 4Y2CA 4CLZA 4RR5A 4R25A 2ZFHA 2VBYA 1T9YA 1XMBA 4F0HA 1RU1A 3PNIA 1S0VA 3T1YF 3MM6A 3O5TB 2DR9A 4HR2A 2UV8A 5GADI 2R7OA 2E5JA 2L9DA 5DM6Q 1F9EB 5EGYA 4CLTA 2P5VA 3T9ZA 3UDVA 2NR0A 1RTJB 3K0JA 2YNFB 2MHNA 1JX4A 4QYZK 3E51A 2BJ9A 4TYAA 3M1VB 1PG5B 1JKHB 1ZS6A 2VDHA 2G1HA 2CJKA 5D0HA 3V81A 3KYLA 1N6QB 4EU0A 2B9XA 5AT1B 1RYRA 4CH1A 4A47A 1NH8A 4O44B 4YMEA 2CJBA 3QGIA 3K17A 2HMIB 1DRZA 1JNZB 3DRXA 4OX6A 4J90A 2W9BA 2V68A 2D9OA 4I6YA 3TNVA 5HSPA 5F8HA 5ETRA 1Y5NB 4DU8A 3PX0A 4HHHA 2D74B 1X9SA 4USTA 1HARA 3C3LA 1BWVA 4PUOB 2FUG9 2IVFB 2H65B 2RAQA 3BKFA 4DHVA 2GQ2A 1HD0A 1MROA 5DRKA 5F3ZA 2K3IA 1VRTA 3W66A 4F36A 3EGWB 1XQIA 3T1YJ 5IC4B 4DLGA 4Q7AA 1RABB 5LSRA 4O4GA 3HMJG 3VAJA 3HVWA 1ZM3A 1UFWA 1S9GA 4C48A 1W2BR 4C3LA 4K59A 3W3SA 2JWNA 4OYMA 2E9ZA 1HWKA 2W2NP 2FGOA 2YWFA 2H9ZA 3QO9B 5CXTA 4W4MA 3QFWA 1BQNA 4MK8A 4DFKA 4N7TA 4U7UK 2GMHA 4ECWA 1X9WA 1P9YA 3PEHA 4DV4F 4RKUC 2IRXA 3U27A 2AJ1A 3N6NA 1FNMA 1MLAA 1Y00A 2HQDA 1F9HA 2Q1LA 4CWBA 2HQFA 1NNDA 3MTKA 2FGCA 4CO3A 1IN0A 1NB7A 3KJFB 1SH2A 4LSLB 1F2GA 3G4SS 1R8AA 3GFHA 4KFBA 2YQ0A 2IMOA 5I3UB 2ERRA 1YQHA 2KYXA 4LFBF 4OX9F 1S7IA 3OTBA 1FFWB 3DLJA 2XI3A 2R7WA 4NEYA 2C2EA 2EC2A 3ZXWA 1T9TA 2AYBA 2YNGB 1FXDA 1X4DA 2ZDPA 4OI4A 1SB6A 3JQMA 2ZH9A 1IR0A 2E5LF 4M5DB 2VPYB 5HP1B 3I31A 2HVZA 2VBZA 2OJ3A 3IRWP 2R7UA 1LNQA 3M2UB 2CNKB 3MAAA 4WP8A 5LSOA 2QV6A 3OW2R 4PXEA 1RJJA 1SH0A 1VI7A 1N48A 2LQJA 2P6TA 4NLOA 4DV4J 3KDOA 1KN6A 3G82A 3P96A 4NI2B 3KLIB 3RW6A 1IUJA 3KLGB 2EBEA 4NCGB 5HI7A 3CJ5A 4K7QA 3SYZA 2COLA 2IMWP 1B3TA 1N0UA 2QLFB 2LXUA 4ANCA 3NRBA 4CO0A 3JTOA 5IT9Y 3TA2A 1GMWD 1PC4A 1N5VA 3VQTA 2XS5A 4G1IA 5BXIA 3GFXA 4TY8A 2QSWA 1V5VA 1TZ0A 2QMUB 4TXSA 4CT9A 3TA0A 5DDRC 4LFBJ 4UZBA 4OX9J 2HYIB 2DNKA 1NK5A 3THTA 4USUA 3QLHA 5A8RB 5DG8A 2VJVA 1F3VA 1B4SA 1TMMA 4L72B 3SCJE 3BGOP 4FPRA 2ZH8A 3NS7B 2BJ7A 4NOHA 4K50A 4IRCA 2CPIA 3R3TA 3LAKA 1DY3A 1X0PA 2E5LJ 3CJ8A 3UDCA 1R6YA 2HBRB 3CD5A 4RWXA 2C3UA 1REVB 2JZ5A 2ZBQA 4C4WA 5HANA 2BBEA 3SBMA 4AL7A 3V2UC 3HHDA 4OIXA 2FLPA 3RTVA 3UVJA 1BUXA 3H20A 2EFQA 5K20B 2QA2A 1TKXB 1TU0B 1DTQB 5KFJA 3KJVA 1S1TB 4I4BA 4Y65A 1VQNS 1JLCB 2DY1A 4A8FA 2XYPB 2HHTA 4LIWA 2RIJA 2CQGA 3T5HA 4OYZA 1UJ5A 4DUTA 2KRBA 4CRJA 2D3ZA 1U2FA 4RJVA 2RUSA 4XK8C 3H5YA 2ZH3A 2FY1A 2CNLB 2FJBB 4F0MA 4CH0S 1U48A 4CO5A 3DRRB 3IFEA 3D3CJ 4AUKA 3C2PA 3H2LA 2VHGA 1FRJA 2VUGA 1S1UA 4ED7A 2WSFC 2G9OA 3MMJA 3PW2A 2BQ3A 4IG0B 2KG1A 3FSIA 3MEKA 3GIIA 2OO4A 2OPRA 3EM1A 3OSPA 1LEOA 1HKAA 2XHCA 1C1BB 2NXEA 4N47A 3LP1B 5LMNF 4O0NA 2Z56B 2RHQB 3P8BB 5I3PA 3LWLA 1I94F 4B9VA 1VLOA 5GAEI 4CLSA 2EVZA 3JSMB 1N32F 3B78A 1KP6A 3CDUA 4KHPF 3HP6A 3R5GA 3LW5C 4ED3A 5KG4A 3DI6B 2R7SA 2HNYB 2G0CA 4Y3CA 4PWWA 1U1NA 1QE1A 2R3VA 3DOLB 2ZUGA 4CYUA 5B0BA 3H42A 2IC3B 1WOOA 5J2PA 2RF2A 4OHXA 4EK2A 2WCXA 2MB0B 3ZTOA 3VVTA 5DS7A 4QWDA 3C16A 1U6BA 4KTQA 4GMKA 3CJSA 4F4WA 1M90T 3NP5A 4OYIA 5HN0A 3N79A 4FYXB 2YBVA 2OSQA 2ZHOA 1EKRA 1FDDA 2DNZA 5D4PA 3PIPQ 1E6YA 1OY8A 1S1VB 3MURP 1BGXT 3VWSA 4OZ0A 3FKBA 4WE1A 5LMNJ 1XR7A 3BN7A 1I94J 5BJRA 4CTAA 3BYPA 2XHWA 4W92B 3H2UB 5F8JA 4O4RA 3AA9A 2JX2A 3H5SA 4KHPJ 1QAIA 1APSA 2NCKL 2Y1LB 1V3RA 4C8MA 2NREA 4GKJF 1JMTA 4E8UA 3I4HX 3UD4P 2ASLA 1DLOA 3QWUA 4BS2A 3HI9A 3GTYX 2Y8YA 3MR6A 2PMZD 1GTHA 1I51B 5GADU 5KG6A 3MD1A 1NHVA 1T9UA 2AEMA 4RNHA 3HD1A 2CPYA 4MAKA 5F8LA 3W2VA 2RRBA 4RZRA 5KFHA 3K2YA 5KT6A 2Z4PA 2A0FB 2IJNA 4DSIA 3IP0A 4RBUA 2UVRA 1RT5A 3G8TA 3R6GB 3R9LA 1H3DA 4X65J 1RWVB 3MDFA 2OPPB 3T5LA 1LW0A 1U1RA 2GO8A 3BGUA 3CCZA 3UFCX 2RT3A 2FZCB 2Y1JA 5F0UA 1SQEA 1WEZA 5F8MA 1WSRA 3L95X 2JJ4D 1WHXA 3ZO7A 1RKIA 4K5RA 4GKJJ 2FY8A 2FIUA 3BBBA 3MR3A 1I5OB 4ZITA 4IR9A 2B4PA 3TOQA 1RHQB 3NGUA 2NXUA 2ACMA 4ZLLA 2KXNB 4MFBB 1DBDA 1FK9B 2DNRA 2F5GA 2KJWA 3PTWA 2H1YA 1V3ZA 3VGSA 2W8LA 2WSEC 5HJYA 3J81Y 4BBYA 3R5AA 2ZE2B 4N76A 3GYNA 3A13A 2HZVA 3ET6B 2VD3A 4DR4F 1FCAA 4ANEA 2RDJA 2GJ2A 5D15A 2DXFA 4Y0FA 3CJQA 2NXJA 2XSJB 4KO0A 1OSCA 3TZXA 2JL9A 1HBMA 2K7KA 1Q16B 1RT3A 4DV5F 2AJ2A 1M5OC 3JQJA 3MM6B 1QLNA 1LW2A 2YVSA 3ELHA 2G4BA 3I32A 4LT6A 2HS3A 2ZOFA 2YNIA 3MXHP 2XBPA 5AXLA 1HPZA 3PX6A 2I1RA 2F9DA 2W9CA 4AE5A 2XQCA 2W7OA 2E7WA 4DBQA 2MQMA 3FFIA 3SFUA 1HWJA 3SQOP 3BGFA 2KM8B 3V81B 3HJVA 2NS1B 4TN2A 2AJQA 2BZ2A 2HQGA 2XZDB 5IC6B 4XAKA 4OI2A 3IM8A 2W9BB 4DR6F 2XS2A 4V19X 2YWGA 3BJYA 4DR4J 3MZIA 2X1BA 4FXVA 1A7GE 3NOCA 1HBUA 1WTBA 1MROB 1NLKL 1VRTB 4ZN1A 4P7VA 3DU6A 2O67A 2FLOA 4DV5J 4CNYA 4I6WA 2J0WA 2MPUA 1QY7A 3Q23A 4O4GB 1KS2A 2UV8G 2DHSA 4F02A 3B54A 3MECB 1L5UA 3C6TA 2MY8A 1URNA 1WUUA 4KPCA 1RWMB 4QIWD 1KD1T 4C8KA 4FBTA 1BQNB 2AZ3A 1RTIA 4PYAA 3QZ7A 2VJUA 4TU9A 1KKHA 3M9NB 1D8ZA 2F65A 2HBQB 1K9MT 4NX9A 3LPYA 3DMJA 2UP1A 4ANDA 4ZJQA 4CQ1A 2MEWA 3V4IA 4YDDB 4ECTA 3DDIA 2KL8A 2RKIA 3RAMA 4LBPA 2OFHX 3BV8A 3GIMA 1U26A 1MU2A 3CCQS 3BKTA 3OXFA 1S9FA 1UJ4A 3G86A 1T3OA 4DR6J 1VOMA 2ALYB 3K5LA 2B9WA 1RSCA 5F8GA 3EVWA 3MMBA 2EFOA 4KFBB 1WSVA 3AB2B 3CXCR 2FZKB 1IQZA 2VA2A 5DLGA 2QL7B 1M5PC 3ISND 5IT9U 2XMTA 3P5TL 2BKOA 2AYGA 2HFVA 4GKKF 2DNNA 1OSDA 4WKRA 1LWXA 2DCUB 4JI4F 3UNYA 1YBUA 4YS2A 4UUXA 2KTQA 2QN6B 1QVFR 1FE0A 4K2XA 2M8HA 4J5OA 3MAAB 2J9CA 5AXMA 2VG6B 3QRQA 4E98A 2QL9B 3V4MA 2XLIA 2RQKA 1TKZA 3G82B 3NCQA 3MAHA 2FTRA 3CMAS 3CMQA 3OL9A 5L8RC 3FRZA 3FSXA 3CCRS 1VK3A 1MWQA 1QAJA 1BE4A 2CA9A 1QM9A 1VHIA 1NJIT 3AD8C 4EYHB 5E3AA 1KOHA 1P1TA 4LF9F 1EKSA 4R0EA 2IBOA 3DRSA 2FVQA 5GAEU 2MYFA 1ZPWX 5KG0A 1PYTA 2HIQA 4M5GA 2BV3A 1HNXF 5BYRA 3U1NA 1XN9A 3QLHB 2F40A 2L9WA 1UZHA 5ETVA 1X5OA 2J7WA 2D9PA 2YKQA 1GT8A 4WK1A 2CVEA 1NU4A 5F3TA 3TAPA 3MGJA 5J1NA 1H72C 2HAFA 4GKKJ 5IT0A 2LMIA 2HIYA 4JI4J 4JYAF 5KFGA 3RAQA 3CD6S 1MSWD 3OR2A 3SCIE 1OYEA 2VICA 5KFEA 1I3OB 1GEHA 5GAHI 3TX8A 4C7QA 4LBIA 5LJ3Y 2KVIA 2MKCA 3R97A 5J2QA 3GYXB 1VQKS 5ETNA 3K57A 4H4MA 3KJVB 1S97A 3W9IA 4QYZJ 5B0CA 4ZVOB 2AYEA 3CT9A 4X4RA 3H40A 2XY6A 4LF8F 1OJ4A 1WORA 4Q44A 5E0OA 2V8DA 2HLTA 2HWIA 1DAXA 2P9GA 1S79A 1A6LA 4LF9J 4LIRA 2DGXA 4ETXA 2I8EA 3QT5A 5DDOC 2RHSB 1RQ0A 2PC6A 3R5DA 3MR5A 2QYGA 4C0BA 1HNXJ 1WJ9A 4QYRA 5L9NA 2H4WB 4Y2MA 5KFMA 3FSYA 2MXYA 1SJ1A 2MLYA 2AX1A 3CJRA 2P8IA 2CQCA 3PFOA 4JYAJ 1PKUA 1FJGF 1WC6A 2VG7A 2OPRB 2ZBPA 1YTYA 4IQMA 2JEGA 1LWCB 1JJHA 3KNAA 1J5EF 2G0JA 5J1EA 2HK2A 2YWEA 1NO8A 4ZVFA 1GX5A 1KLNA 2GCFA 3H0PA 3A3PB 3FZBA 2B51A 3R5CA 2AGPA 4DFMA 2D3UA 4LF8J 3KK1A 3FQKA 5T7LB 1QE1B 2XI2A 3W5ZA 2RQ4A 4CYUB 1FXLA 2EK6A 4N5SA 4WBFA 3ADAC 1S4EA 4ZJOA 4MIAA 1QSSA 5J2PB 4EYIB 5KFBA 1WHVA 2RF2B 1X4AA 1CVJA 3QAUA 2BQUA 5IWAF 3C16B 4BLGA 5CD4H 3CC7S 2HS4A 4DL6A 2QEXS 2PT0A 2H4YB 2DJWA 3BS9A 3THPA 2CQHA 2AX0A 4HT5A 4ECRA 1D0EA 1VQ4S 2ZKTA 4DR1F 1VQYA 5B7WA 4QCLA 3CCWA 2IPOB 5F8IA 1FJGJ 2DNPA 3QT7A 1E6YB 3R1HA 1X7VA 3W2WA 1R31A 4C8YA 1N54B 3NGRA 1WG4A 3Q22A 4WE1B 3FBFA 1SBRA 4ECXA 1S5ZA 1PAEX 3C14A 2RH3A 4LR7A 3BSCA 1J5EJ 4CLFA 2JC0A 1RTZA 2W7AA 2QTWA 1SI9A 2V34A 2C2NA 2V63A 2FDNA 4G1PA 4AD6A 3NOGA 3KG0A 4I56A 4DL3A 1H73A 2PDAA 4ZP7A 1TUVA 1DLOB 2B5JA 3GJSB 1HI1A 4YDXA 2PE8A 2VL1A 2BJ8A 2GVZA 3E8OA 2EPIA 2FVPA 3M8QA 3G6YA 5IWAJ 2CYYA 4UF4A 4DSKA 3W2VB 4C11B 2Q79A 1Q5VA 3PHEA 5ETOA 3KMQA 2HRYA 2W01A 3M8PB 2CPJA 5A6PA 1X9MA 5AE1A 4DPOA 3NWRA 3PJWA 5IT4A 2LA6A 1ZAWA 1PYOB 2XNRA 3HHLD 5FJ4A 2N82B 3I0SA 3R7SB 1YLXA 1I1GA 4NLGA 3JYTA 5U47A 3D6HB 1FVQA 3SCLE 3C6UA 1Q95G 3J81U 4CH7A 2NPIA 3TO8A 4JI5J 3PO5A 1HI0P 1LW0B 2ZC4A 4M5HA 4ZVTB 3GU0A 2HHSA 3FZ2A 3TYTA 3PW5A 2BE2A 4CLYA 2Y9HA 4Y2KA 4G1QB 4J9UE 4ZIVA 3OTDA 3MHYA 1RE1B 3DOKA 1NDLA 3JXOA 5IXUA 3CDAA 4PG5A 1N36F 1U1MA 3EE3A 1Q4RA 3BR8A 3CCSS 4J9LA 3L9ZA 2WVFA 2D69A 2QJ3A 1HLWA 3CCLS 4XDDA 2JEFA 4LF7F 5KFNA 2DH7A 4QWCA 4USKA 4NXNF 1T9WA 4OL8A 5ITHA 2J7UA 2YKAA 2E9TA 2NYIA 1U2RA 4OZLA 4DL4A 3OTOF 2ZZTA 4QWAA 4I2QB 4KO0B 2AW0A 5EX3A 4ZVQB 4K2JA 4PR6A 1U6FA 2RE1A 3VZIA 2GS8A 1RT3B 2A6OA 2DXEA 1RHRB 4QJVA 4H4OA 3KLFA 5EN1A 2QRRA 1AA1B 4B3SF 3LA0A 4J37A 5DO2A 1LW2B 2BUNA 2P2CB 3P49B 3VR1A 1JIHA 1HPZB 4LRCA 3CCVS 2GHWA 2BOPA 1VBZA 1WKKA 3VV2B 2Y0SD 3KWMA 1PJ6A 1K8AT 1UWBB 2W9CB 2WZ1A 4RNFA 3UN3A 2ATCB 4IDKA 3FFIB 5H9FK 1N36J 4NMXA 3CD0A 3IN5A 3GR0A 1IBCB 4F4AA 4NPOA 1FWKA 4IO9Q 2NUUG 2FLNA 5DZ7A 2MKIA 3BQ1A 1PSDA 3D28A 5J1PA 4X4QA 2FJEB 2J6UA 4PG6A 4NXNJ 2JVOA 2ZOMA 3RAXA 1CEZA 5KFTA 2B4UA 2JSXA 4A8XA 1HBUB 5FDLB 3OSNA 2KB2A 2DYAA 2HVIA 2VKRA 4DR7F 2EG2A 4KC5A 4B3SJ 5HATA 3A8JA 1GMWA 1CS4A 1LWFA 1R7IA 2PMHA 1SJ3P 4F3MA 3C6TB 3IBFB 4DQPA 1KHWA 3KNGA 3IM9A 1GFWB 2IYGA 2ZH1A 1G4CA 2HNDA 1ZA2B 2K8GA 3HFZB 3KUEA 2B9EA 1K0VA 1Z1ZA 3NEKA 4TQRA 1RTIB 3FCHA 1YGYA 3LOUA 5HAOA 2POKA 1CJUA 4DS4A 4RUBA 1D9FA 5KFFA 3DMJB 5JVGQ 1S76D 3V4IB 2RKIB 2DR5A 4HACA 2Y3YA 1MU2B 5DJBA 4NLQA 3MD3A 3DRPA 4B9LA 2ZVIA 3QT8A 3IBCB 2M52A 2P9EA 4YP3A 1KTVA 4WFZA 4NCBA 3MMBB 1DARA 4J9VA 2J0QD 2WAQD 3QJLA 2QO3A 3OJSA 2ROPA 3D5MA 4HDHA 3M2RA 4URGA 2QX0A 3MMAA 3AJDA 2KM8C 1HBOA 4DR7J 3P45B 5A8WA 1KONA 2N4CA 2DR7A 5CZVA 3QQCD 2ZNYA 2N4DA 1EP4A 2EKNA 3TWZA 4ED1A 3H2VE 4Q0BB 4JI8J 3H59A 1FX4A 1B64A 3VCDA 2KRRA 4BC7A 1IKVA 4L75A 4LFAF 3KMSA 1TKZB 2CQIA 5KFRA 2VFSA 2R8JA 4P52A 2XS7A 3POTA 1AB8A 1H38A 4X66F 5CYQA 1FKOA 4JV1A 5B0GA 4CM0A 2RILA 3N6LA 5LXRA 4WYLA 1TL3A 4ZPBA 5IZHA 4QU7A 1SXLA 1DQAA 2ASYA 3DRSB 1E6VA 1UAWA 2HPUA 1YZ6A 4NLRA 3VVUA 3GSDA 1NEEA 4O23A 2LEPA 2RRNA 1TKTA 1RKJA 1SL2A 2JFKA 3S1TA 2BR0A 4DX8H 2UVVA 3MEEA 2VKZG 2ILYA 2FHKA 3DOMA 2IM3A 1OY9A 4KYZA 4LREA 5BYQA 2I6WA 4WU2A 2M3DA 2C42A 2MZSA 3AODA 4KY3A 5GVQA 5I4MA 3PCOB 1BD6A 2ZVSA 3M4XA 3GCWP 3OR2B 2L08A 4MYUA 2YWKA 5K8NA 4U8YA 1IKXA 5L1LA 2XY7A 1SUQB 3EJMA 4LFAJ 3GIJA 1N5SA 3R5BA 3DLEA 1CBKA 2ZBRA 3AXMA 1WTFA 5A8KA 3RZAA 1FD8A 3EDQB 2APOA 5J2QB 3TVKA 2BJ3A 1W2IA 4M94A 2EBGA 4H4MB 4X66J 5H9EK 3BQ0A 3RW7A 3X1LB 3W64A 2V2QA 2J7KA 1X5TA 4HL9A 3OHAA 1JLGA 1BQMB 3B4MA 4ECUA 1OQ3A 5GMDA 3A3OB 1ZPVA 5KG3A 2DNLA 1UEVA 2CDQA 2J0XA 3KK2A 3PRBA 2FHOB 7FD1A 3O8WA 4PRFA 2DTJA 4JI3F 4N8NA 4DCOB 1VMBA 2DHAA 3S8SA 1HR0F 4ECZA 4F04B 4UOHA 4EBCA 1IBKF 3OTEA 3LAMA 2VIHA 3M6UA 1UVKA 2HFSA 2VG7B 5HLFB 1FTCA 3RBZA 1NSPA 2QGFB 1FA0A 2MQQA 4IFVB 3VAKA 2B8PA 1NJZA 3ZZOA 2AHOB 4USJC 3CCTA 1YKWA 3LP0A 1VFJA 4O3QA 1I6JA 3D7SB 4UOFA 2M70A 3B6BA 5FD1A 4AL6A 3KK1B 3CJ2A 3KK3A 4DV2F 1GNKA 1UWAA 3CJ0A 1G7CB 1JXVA 1IQTA 2CADA 2MKJA 3VGTA 2K7JA 4HH1A 3W7BA 4JI3J 1BXNA 4I2PA 4ZJLA 4J9OA 2DGSA 2YWWA 4MIWA 4ZCLA 1IBKJ 3Q8VA 2U1AA 2WBRA 5FIIA 1RA6A 3TW0A 2PA8D 3W2WB 4PPDA 1NM2A 1YJ7A 3C14B 4F8RA 4P73A 2N3OA 2HFZA 4LF4F 1S6UA 2CUYA 4QWEA 4QR1A 4LRAA 3OPKA 4OX7A 3E2EA 2BRLA 5KFPA 4ERDA 2AU0A 2E1MC 4ES1A 5CQGA 3N9UC 2B7CB 1S48A 1Q7YT 2GHPA 1CPZA 4ZHRA 5HVHA 2M9KA 4HLBA 2A10A 4DV2J 3OFGA 1KFDA 4X4TA 4GVBB 2B5JB 2BJEA 4RNNA 2ZWOA 2K3KA 2GVZB 3J7ZT 2VB6A 2JEIA 1X4HA 3OBIA 3CC4S 1NSQA 3ZNUA 3CO0P 4ZVEA 2JNJA 4HT7A 1JLEB 3J7Z5 2ROEA 3F56A 2P9CA 3T5JA 2HGMA 2GQCA 1FD2A 4KPYA 3DC2A 1RTDA 2B7BB 4RW4A 1NHKL 3CC2S 4PWUA 1AUDA 1KRPA 2XMWA 2JVRA 1RBOB 5M2UA 3I0SB 3NGDA 4O3PA 4OI3A 4WFYA 4TQSA 3JYTB 3TX0A 2DHHA 2LEBA 4DZDA 1O8BA 3GB0A 3C6UB 4C8LA 4MKYA 1JLBA 2QA1A 2HFNA 4ES2A 1IR1A 1B99A 3K5PA 2W4PA 4LF4J 2Z0GA 4DCPB 1JNRB 5KFDA 3NGSA 2R42A 1DURA 2BE2B 4ELUA 3O1LA 1WD6A 3KG1A 3KKFA 1OMSA 4QIEA 1N56A 4USHA 5HROA 3DOKB 2AIRB 4RU2A 3ZZ0A 2DNMA 3GPAA 1UVIA 1T0TV 2I9SA 2UUTA 7FDRA 3ZTPA 1XNRF 2XB2D 1VC5A 2C3YA 5D78A 2BQRA 2NPFA 5LOQA 3HO1A 3VGUA 2HGNA 3RYLA 3S01A 3HSDA 1YBAA 2IIHA 3D4JA 1CG2A 3BH7B 1TV6A 2YX1A 4WZMA 4ER8A 4CO2A 2ZEJA 2ZH5A 2BM0A 4QW9A 1IWAA 2FVRA 4DN9A 3RBEA 2W4CA 4H4OB 3KLFB 2OMLA 4HI1A 4K4UA 2KFYA 2VF3A 4LVOP 4NL5A 1UL3A 3TZWA 2VOOA 1BQXA 2K2PA 1U09A 2H5JB 1Z2LA 3QRRA 3HZEA 4OQJA 3D1QA 1IM6A 2YXLA 1M1GA 2OEMA 2CVIA 3N4WA 2NYHA 4MKVA 1NZAA 4X84A 4B9TA 1SH3A 1FEHA 1YX2A 1XNRJ 3KTQA 2DEIA 3IC1A 3UN2A 1WF1A 3GONA 1WC1A 2Q6CA 2L48A 2MZJA 1JLFA 3SDEB 1D09B 3V5RA 3IBWA 1QAXA 4X4NA 1R8BA 2KU7A 1TL1A 1EQ0A 3CTRA 3M6XA 1R8CA 4ZVPB 1FWPA 5CH7B 1YIJS 2HKEA 2VDIA 2GW8A 1MNEA 1J2VA 4HTIA 1Y5IB 3OVSA 5HQLA 1EETA 4F50A 3Q24A 1CS4B 5B0EA 3NNHA 1LWFB 4JV2A 1ZM2A 1UA1A 3CJ4A 3JSYA 2NQPA 2IJFA 3TANA 2VQFF 3DLHA 2VC0A 4TVAB 2XMAA 1NPRA 2HNDB 4RW9A 1IJFB 1S6QA 1J27A 1GXUA 1CJUB 5DDQC 4RW7A 4URSA 2Q3PA 2WSCC 2MZQA 2B9YA 4ZCMA 4DL2A 5D4NA 3PACA 2OPSA 1H2TZ 1FI4A 1ZTTA 2WB4A 3H25A 1KLMA 4HACB 2W2PP 3QYYA 5CA5A 1UW4A 3BO2A 3H8YA 3DRPB 2ZZNA 1Z2ZA 3HJFA 3WHIA 3R2DJ 4YB6A 5DZ6A 2GC8A 1RAOA 3O44A 2EXUA 2HWTA 4J7CA 1TFWA 1YVFA 4L3KA 3IMQJ 4K4WA 3D68A 3FBCA 2BM1A 3IWXA 3M2RB 4WF9Q 2WBMA 2JC1A 3MMAB 3FUYA 2R7RA 2Z58B 1S6PA 1HBOB 3NCRA 1U49A 2BKNA 5A8WB 4EFAC 4PXBA 2C3OA 4ICLA 4YEAA 3MM7A 1IKWA 4QOTA 5EWEA 3PZPA 4WYWA 3OR1A 3DNCA 4PCQA 5IV3A 1QUPA 1MMLA 3CNQP 4HTJA 3KLVA 2VQFJ 1PIEA 4M1KA 2HHXA 3CUNA 1C4CA 3TZZA 1OIAA 2HNZA 1O6XA 2J9EA 2B43A 1Q8LA 1IKVB 5ETPA 1HA1A 3H4DA 2XY5A 3OLBA 5LXYA 3TJ9A 1IM4A 5ETQA 2V8HA 1VQ9S 4B3OA 3POTB 1HQUA 1FKOB 4LVNP 3CCUS 2L9NA 4M8LA 2ACYA 4TU7A 2UU9F 2ZZMA 1TL3B 4IOAQ 1C0UB 4X4UA 2HHVA 1TQLA 3CW2C 5K14A 2E5IA 2VFUA 4I1TA 3R5JB 4O3NA 2A2DA 4JV0A 1HQ2A 4TY9A 3V6DA 2CPEA 2M4MA 1ZAXA 2GAHC 3KHHA 3UW1A
chains in the Genus database with same CATH topology
3PR4A 2GMJA 2J9CA 1FHTA 5T7LA 5AXMA 2VG6B 3OJUA 5I3UA 4LJMA 1J5OB 1TKTB 3F41A 1IKYB 2RDIA 4E98A 2DNYA 3ITHA 2PI5A 4OI1A 2MJNA 3V4MA 2XLIA 4IQXA 4YHHF 2RQKA 1TKZA 2YNIB 1XK8A 5KFQA 3NCQA 2FC8A 4I0WA 4F67A 2O1PA 1U1KA 1SL0A 2OAUA 4DQSA 4KRWA 3G6ES 2LQ9A 1S6OA 3ISZA 2XGQA 2XULA 2LQ5A 3MAHA 4ZCIA 2FTRA 2V0NA 2GV1A 3CMAS 3OL9A 1VHFA 4OX8A 4A48A 4Q8EA 5L8RC 3FRZA 3CCMS 4A4JA 1SV5A 4J9KA 3FSXA 3CCRS 3DCAA 3UQSA 1VK3A 2GFFA 1QAJA 2R7VA 3H5UA 1Q78A 3KLHA 4DSLA 1QM9A 4I64A 2YNGA 2UUAF 4ILMA 1NJIT 1DQ9A 3N28A 3MEGA 1VC6A 5SZTA 4CCHA 4EYHB 2DITA 2HHQA 2KT3A 4K4TA 1WHWA 5E3AA 1MWYA 3TUZC 5AXNA 4OZ1A 3T6BA 1KOHA 1P1TA 4QPXA 4LF9F 4URQU 3HK2A 4R0EA 1IKXB 2IBOA 2YKPA 2LKZA 3DRSA 2FVQA 5GAEU 3FDSA 1KQGB 2MYFA 2DRAA 1ZPWX 4M5DA 5KG0A 2KT5A 3LWMA 2HIQA 2VH7A 3IGNA 3SZ2A 2BV3A 4NLWA 3HHKA 4RNOA 1JJ2R 4ZDNA 2OKQA 2VODA 4CIOA 4HVZA 3FQLA 1HNXF 5BYRA 4AXJA 3U1NA 3DLEB 1W25A 4UOCA 1XN9A 5M2PA 3QLHB 5EWGA 2F40A 5AE3A 3IGVA 4MKAA 3D0GE 3RBDA 1JXLA 2L9WA 5JVHQ 1VC0A 2YY3A 5D4OA 4QU6A 1X5OA 1P8GA 4Y6IA 2I2YA 2J7WA 4JBCA 2D9PA 2ZH6A 1IJEB 2YKQA 1GT8A 5HMYA 1F5BA 1KHVA 2BW2A 1S1WB 4NCGA 3KLGA 2ATLA 3FEZA 1M0SA 2CVEA 4WK1A 1NU4A 5F3TA 3TAPA 1Y4ZB 3MGJA 4AXIA 3IXQA 2WOMB 2CPZA 5H9FJ 5D6GA 5C42B 5J1NA 3OFHA 5IT0A 2LMIA 1C4AA 3SQGA 3ZFVA 2HGLA 3M9OB 3RB4A 4JYAF 1JLGB 2E1AA 2W4DA 4NLPA 4TLRA 1B0PA 5KFGA 4NLSA 2RS8A 3RAQA 3CD6S 3MPVA 2WTFA 3H5XA 2BVZA 3ETOA 5L38A 1MSWD 2JOQA 3OXLA 3OR2A 1X4FA 4NLXA 5B09A 1SJQA 2W8KA 2OLWA 2XMVA 3OL6A 3SCIE 1FJEB 1KR4A 4OFZA 3KK2B 5D3GA 3TR5A 4DUYF 2VPWB 1D9DA 1LOUA 1K1SA 2QLWA 5KFEA 4PKDB 2DO0A 4USIA 3HT3A 5GAHI 3TX8A 2CQPA 4C7QA 2UZAA 2QA4S 4I69A 2XMUA 3SI8A 1LKZA 5LJ3Y 2J8AA 2KVIA 2QMXA 4DS5A 4B3RF 2MKCA 3TQ1A 3EPGA 3MEDA 4NZ0A 5E5NA 5A8RA 4D3GA 1KQSR 2QZ8A 5J2QA 4C8ZA 2DISA 3GYXB 3GILA 2F4VF 1VQKS 2VONA 1VQSA 4JI8F 3K57A 2V9WA 1V6HA 4H4MA 5KFKA 3KJVB 1S97A 5KG5A 4QYZJ 5B0CA 3LGNA 4YOEA 2R2TA 2VQEF 2AYEA 3CT9A 1RDRA 2B0GA 3U1MA 4X4RA 3S6EA 3H40A 4Q44A 2XY6A 4C11A 4LF8F 3ZC4A 3IG1B 5E0OA 3IR6B 4YQWA 2V8DA 3D1HA 2HLTA 4CO4A 2HWIA 1ZOTA 1DAXA 2AV5A 3PW4A 3M8PA 2P9GA 4X4VA 1S79A 1A6LA 4LIRA 3FEXB 2DGXA 1UEUA 3U02A 4ETXA 2I8EA 4DL0C 2ILZA 4OZ5A 2XO7A 5KOXA 4WTYA 2D1CA 5DDOC 1G6BA 2YKNB 1RQ0A 4UY8T 2NSBA 2PC6A 4UW2A 1OWXA 1RP5A 2XLJA 1S0MA 1UP1A 4FZVA 5KFOA 4LMZA 5KFSA 3R5DA 3MR5A 4JI0F 4C0BA 5KG2A 4ZPTR 4ZP9A 4FBUA 4X4OA 4QYRA 5L9NA 4DJBA 2N7CA 4ZVGA 3LP0B 2CG4A 3OHBA 1VQ6S 4UY85 2DT9A 2XC9A 4PQAA 2CJAA 5E7OB 3CULA 2CPHA 2FC9A 2ZBIA 2LA4A 1Q79A 1FO1A 1FDAA 4IR1A 1ZTWA 4Y2MA 2AWZA 5KFMA 4J9PA 4TU8A 4W90B 3HHLA 1O5JA 5B0AA 3FSYA 2I5JB 2MXYA 1SJ1A 3RB0A 2QSFA 2C28A 1U8SA 1JXEA 1TKXA 5KOWA 2GIRA 1HFEL 1HWUA 3CF5Q 4A46A 2AX1A 4IKAA 2X3GA 3LGMA 2CQ2A 2SXLA 1DTQA 3KK3B 3UPFA 2CQCA 4DQIA 1NK9A 3I56S 1S1TA 3PFOA 4NLTA 3U1LA 5CYJA 1TK5A 1GTEA 1SJFA 2R7TA 1FJGF 3HPOA 3FMWA 3K5OA 4JI7F 4PWDB 1FRIA 4PXDA 1YJTA 3JAMY 1JLCA 4G1QA 2VG7A 3RRGA 2OPRB 1D8YA 2F8HA 1YTYA 4IQMA 2JEGA 1LWCB 5G0RB 3PM9A 4LUBA 5LSLA 2J6TA 1P6TA 3HF5A 1JJHA 4Q45A 2E1RA 4BWJA 3SV4A 4NZ7A 4ZKAA 3KNAA 4Q2LA 1HW8A 1J5EF 4WFAQ 3O2IA 5J1EA 1B0VA 2E29A 4ZP6A 3O6QA 2YWEA 2OFGX 3NKYA 1NO8A 2ZITA 2AYMA 1U7LA 4QW8A 4ZVFA 3DLLQ 2HRUA 5F8NA 5E3QA 5T41A 4CI0B 1VQ5S 1XMOF 3OUYB 2D41A 3BDPA 3T5KA 4I2PB 5CYMB 1GX5A 3AAWB 2AJFE 1KLNA 2R7XA 2GCFA 3R1LA 4DL7A 3DRRA 4XO0A 3FZBA 5KTQA 4GKJF 5IM0A 5C24A 5KFUA 3DHXA 5F41A 2VG5A 2B51A 2DNOA 2RU9A 3R5CA 2JEJA 1JLAB 4NA3A 2AGPA 4XPEA 2YX4A 4DFMA 1RT4A 2D3UA 2LDIA 3LP2B 1VJWA 4R5PB 4IUFA 2ZDOA 3KK1A 4I68A 3PO4A 2VV5A 4Y2AA 3GG1A 3FQKA 3OTCA 5T7LB 5L39A 5MAOA 1KOOA 1QE1B 1SIZA 2XI2A 4IG0A 3UE2A 4RW8A 2RQ4A 1FXLA 2EK6A 1ELOA 4N5SA 3VTIA 2HVHA 4CT8A 1YG0A 4WF9Q 1NK7A 4FS2A 1VQPS 4MIAA 1QSSA 5J2PB 4EYIB 5KFBA 4BWMA 1WHVA 2RF2B 1HWLA 2MKHA 1X4AA 2HQIA 3I96A 4X62F 1CVJA 3NG8A 1C1BA 3MM9A 3LP1A 4Z2XA 3QAUA 2CQ0A 5KAKA 4I2QA 2BQUA 4B3TF 3CGIA 2CIMA 5IWAF 2DGQA 5CD4H 3CC7S 2HS4A 4DL6A 2X1AA 2QEXS 2PT0A 1ZETA 2K1RA 3KHRA 3HHLC 3QPIA 4B9SA 4FP9A 3UR3C 2DJWA 4PG8A 3K58A 3GZ7A 3MEGB 4OHVA 4QIGA 1Q81T 3JSMA 2ASJA 3BS9A 3THPA 3DGPA 3EGZA 4EO8A 3EPIA 1HNWF 2CQHA 2AX0A 4HT5A 4ECRA 1D0EA 1VQ4S 2ZKTA 1RT6A 2VBWA 4DR1F 2B56A 3QGPA 1VQYA 4ZHRB 5B7WA 4QCLA 3CCWA 3UNGC 2ZJRQ 2DPIA 1S9EA 5JUMA 1S77D 2IYIA 1Q8BA 2X1FA 4Y34A 2AD9A 1PGZA 2HQ3A 5F8IA 3IS9B 3M9MB 2QMWA 1CQMA 2OIHA 2DNPA 1E6YB 4QQBA 2V94A 3R1HA 2OPQB 3DI6A 1HNVA 1X7VA 3W2WA 1R31A 2FPHX 1OPIA 4C8YA 2HNYA 3OFEA 4KV8B 1IBMF 1N54B 3AB4B 1WG4A 3Q22A 3EXYA 3ENWA 4RUHA 4WE1B 1SBRA 4J9RA 2E7XA 4ECXA 1R27B 1F5CA 2GGPB 2J9DE 3DOLA 1KVIA 2RH3A 3G8QA 1UWBA 1RT2B 1ZM9A 1UJ6A 2OD6A 2IC3A 3BSCA 4DSEA 3K7RA 2IVMA 4DFPA 1HI8A 4WK3A 4P6QA 2JC0A 2MSSA 2W7AA 4A8KA 2IAJA 5JXSA 3M32B 4HYKA 4FS1A 1VBXA 3PJXA 2Z8QA 4D3HA 1SI9A 1HMVB 4A8QA 4DSFA 2MY7A 4YB5A 3IRXB 3DU5A 2FDNA 2FHJA 4G1PA 1RTDB 3DYAA 4DMZA 4DG1B 4RW4B 3TI0A 2ZC3A 1WG1A 3CDBA 1NJWA 2CZ4A 3MM5A 5KFWA 2R2SA 4FVCA 1KSPA 4IRDA 5KFIA 2H5EA 1JLQB 2LEAA 2FJVA 4IFYA 3KG0A 3MM8B 4HEA9 4U9RA 3DLGA 4HKQA 2KJVA 2XSFA 1U1OA 4I56A 4DL3A 3PW7A 2OSRA 2PDAA 3SSQA 1L3VA 4ZP7A 3ZZUA 1KTQA 1TUVA 3DLKA 3J7YU 3GV7B 1YJUA 3NNCA 4YR0A 1DLOB 3QGGA 1K0TA 4LSNB 5HL7Q 2BA9A 4JV5F 2HZCA 2B5JA 2DBBA 3C8YA 4PG7A 3ZZTA 1JLBB 4KAIA 3OL7A 3BEGB 1DTTA 3SSSA 1XMQF 2B4VA 1S1VA 1HI1A 1U25A 4YDXA 1YRTA 2IVYA 3NL0A 1P27B 2PE8A 2VL1A 3BM7A 3MF5A 5GAGU 3OVAA 4OJ1A 4QIVA 1Q7LB 2E5HA 2HG4A 3E8OA 1HNIA 2EPIA 2W24A 3I5BA 2FVPA 5DDPC 3GIKA 3M8QA 3G6YA 5LMUF 4DFJA 2ASDA 4MJKA 5FDLA 2E1CA 2CYYA 4A8MP 1YI2S 4DR5F 5J2MA 4N56A 1LK5A 4DSKA 2DHGA 4PQUB 2DGVA 3W2VB 1KEKA 4C11B 5HQ8A 2Q79A 1VQMS 3M30B 3PHEA 4ECVA 3KMQA 4IO1A 5D4LA 2HRYA 3CVKA 3M8PB 1H2UX 2RMLA 1N5YB 2CPJA 5A6PA 3TUIC 1X9MA 3CMES 2N3LA 5AE1A 5K9FA 4DPOA 4OJ3A 3PJWA 5IT4A 5HROB 2ZH7A 4WIIA 3HKWA 1QSLA 4NCAA 2LA6A 3T3FA 1ZAWA 2M2BA 2XNRA 2R9LA 1N0VC 1FE4A 5JJBA 5L1JA 1R8PA 3HHLD 2GNKA 1SIWB 4B02A 1TL5A 2L3MA 4NZ6A 4X4PA 5FJ4A 1F0XA 2N82B 3F73A 5CCMA 2Y1IA 3I0SA 4JI2F 3UCZP 2MKKA 5J2NA 1I1GA 4NLGA 1MMDA 3JYTA 3BQ2A 1QUVA 5U47A 2FJXA 4YR2A 2O01C 4H4KA 5BYSA 4I67A 1FVQA 1VRUB 3SCLE 4ECSA 3C6UA 1WHYA 5H9EJ 4LQ3A 4KHRA 4ID5A 1IBLF 3MOZA 4ED2A 4CH7A 5DM7Q 2NPIA 3TO8A 5B0FA 3PO5A 3C66A 3UWTA 1HI0P 1LW0B 1LXJA 5THWA 1M5KC 2KYZA 2AP6A 2ZC4A 4EGLA 3E01B 2ZJPQ 4P2SA 1B7FA 1KQKA 1D1UA 1UETA 1H6KX 3LALA 3O3LA 2HHSA 2QLXA 3FZ2A 3TYTA 3PW5A 2BE2A 2OP5A 2UXBF 2XEXA 4ZA1A 4EWTA 3NBPB 3DXSX 5I3QA 4Y2KA 4G1QB 2P6SA 4EZ6A 4LFCF 1FESA 2O3DA 3OTDA 4NWBA 1FEEA 4QWBA 3MHYA 3KLEA 3I0RB 3DXBA 4N41A 4K4XA 3NAIA 3DOKA 3HFKA 1C1CA 3H4BA 4ED0A 4R8UA 5EDWA 5J1EB 2VBXA 4MK7A 5C5JA 3RU0A 5IXUA 1X4EA 3ONQA 3DM2B 4OLOA 2E9RX 3CDAA 1FT8A 2VZ9A 4N77A 4PG5A 5DG7A 2BACA 2HHPA 1FRKA 2GA7A 3GG0A 1N36F 1G2EA 1U1MA 3ENVA 1Q4RA 1DJ0A 3BR8A 3RB3A 2MQPA 4BCAA 5DGBA 4YY3F 3CCSS 2FLLA 4J9LA 1LK7A 1S7HA 3TUJC 2ALZA 2A3JA 2LECA 4NYZA 4ALZA 3JTNA 1K73T 4KHMA 2VG5B 5C25B 2ZKUA 4J9NA 6FDRA 3CCLS 4XDDA 4TYBA 2JEFA 4LF6F 4LF7F 2FJAB 4RW6B 3BN4A 5KFNA 2DH7A 1SC6A 3RB6A 4QWCA 4DDFA 2B6AB 3OL8A 2OTLS 1ULRA 3MTJA 4R5PA 1YJNS 1HYSA 4NXNF 4OL8A 4ZP8A 3BGRA 3N01A