3BR8A

Crystal structure of acylphosphatase from bacillus subtilis
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
90
structure length
90
Chain Sequence
MLQYRIIVDGRVQGVGFRYFVQMEADKRKLAGWVKNRDDGRVEILAEGPENALQSFVEAVKNGSPFSKVTDISVTESRSLEGHHRFSIVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable acylphosphatase
publication title Conformational Transitions Revealed by Structures of Acylphosphatase from Bacillus subtilis in Different States
rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 19
structure length 90
sequence length 90
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3br8A00
5B0EA 4NPOA 1GXTA 1YJTA 3LGMA 1XBWA 4HI1A 2OD6A 1MWYA 4ZOSA 1Y3KA 1FVQA 2LQ9A 3KG0A 4OJGA 2AJ0A 2Q3PA 1JK9B 2KT3A 4FNHA 4HI2A 1N5QA 1VQYA 2W4CA 1GXUA 4Y2IA 4DL0C 1YRXA 2OP5A 3BGUA 2GA7A 4HL9A 2G9OA 3QGPA 2OD4A 1ULRA 2GGPA 1YJUA 3BF4A 2ROPA 2XMWA 5F0UA 1LQ9A 4Y2KA 1FEEA 1OSDA 1SB6A 2GCFA 2AW0A 3CJKB 2PGCA 1FE0A 3DXSX 3BN7A 1TZ0A 1WD6A 3QMQA 1X0PA 1P8GA 2K7JA 3TOQA 2BJEA 1N5TA 2PD1A 2CRLA 5B0BA 2HIQA 5B08A 2AJ1A 1MWZA 3TRGA 4A4JA 4NL5A 3HHLD 1S6UA 2L3MA 2BUNA 2XMTA 1APSA 2RILA 2BJDA 2W4DA 1TUVA 3HHLB 3KNGA 1CC8A 2XMVA 3BM7A 2XMKA 4HH0A 3HDSA 2N4DA 1P6TA 1SQEA 4A46A 2K1RB 2HFOA 2VV5A 2ACYA 4DN9A 2GFFA 2OKQA 1Q8LA 3LO3A 2XMUA 4EFAC 4ZA1A 2LXFA 2QLXA 3FMBA 2ZDOA 1U7LA 2ROGA 1TL5A 1URRA 1VQSA 1KVIA 1X7VA 1CC7A 1AFIA 2HLUA 4OJHA 2N7YA 3I9ZA 2QYCA 3MZIA 3VTIA 1QUPA 1V3ZA 2FTRA 2BBEA 2KYZA 4OJ1A 2FIUA 2KKHA 4QOTA 2GV1A 4U9RA 4OIXA 3BDEA 2ZDPA 3HHLC 2GO8A 1Y9OA 1SI9A 1N5SA 1R6YA 5T7LB 2AP6A 2LQBA 1Y3JA 4DPOA 2XMMA 3FGVA 5B0GA 3BR8A 3K7RA 1AW0A 2RMLA 1OPZA 1IUJA 1Q4RA 5A6WA 2IYGA 2QLWA 1KQKA 2OAUA 3T9NA 1Y0HA 3HHLA 1FE4A 2ASYA 4FNIA 4YEAA 3BB5A 1JWWA 5B0DA 2IYIA 5F0WA 5B0AA 2HQIA 2K1RA 4A47A 4F67A 2IFXA 2OFHX 4YDXA 5K9FA 1CPZA 2ROEA 1Q53A 1FD8A 3UDCA 1YJRA 5B0CA 2JDJA 1YG0A 2OMOA 2OFGX 2LDIA 5B0FA 2FHMA 1RJJA 3IWXA 3F44A 1FVSA 3HX9A 3KG1A 1N5VA 4Q2MA 4Y2MA 2HFNA 3CJKA 2GGPB 5IXUA 2HLTA 1TR0A 1Q8BA 1X8DA 3DCAA 2EW9A 2RU9A 2W4PA 3FRYA 4HH1A 1W2IA 1FESA 1YJVA 5A6PA 2XMJA 2K2PA 2RSQA 5T7LA 2QIFA 3TNVA 2BYCA 3LGNA 4A48A 3IWLA 3MCSA 1OQ3A 4OJ3A 1K0VA 2FB0A 2K7KA 1S6OA 5KAKA 1OQ6A 4Q2LA 1KVJA 3GZ7A 3HFKA 3WDOA 3KKFA 5B09A 2VH7A 1TL4A 3E8OA 3HF5A 2N4CA 1AFJA 2KT2A
chains in the Genus database with same CATH superfamily
2PDAA 4MIAA 1WHWA 2MZQA 4WIQA 2ASJA 3GFXA 3VZHA 1NKBA 3BN7A 1IBKJ 2R7QA 3M8PB 2ABYA 4F36A 1S10A 3J7Z5 3R9LA 1VHFA 3M2RA 1YBUA 3IC1A 1F60B 1U2FA 4DL4A 4NLWA 4PQUB 3AOAA 2BZ2A 1F3FA 4J5OA 3IFEA 4U9RA 3G6VA 2ZDPA 3G96A 4DSLA 1FEHA 2ZBQA 3T3FA 1HNVA 5M2RA 1CJTB 2CWXA 1CJVA 4TXSA 1NM2A 2E5HA 2B5JB 4LFBF 4XK8C 3M05A 2E7WA 2EBEA 4PEOA 2UXBJ 4PXBA 4LBPA 4OV1A 3GMGA 1UAWA 5KFMA 2RRNA 1RT7A 4EEYA 2HGMA 1IJEB 5H9EK 4NLVA 6AT1B 5LSLA 4H4KC 3QLHA 2KXHA 2G9OA 5HLFA 3GYNA 1HLWA 1X5TA 3FEYB 2M4MA 3LW5C 1WWHA 3NS5A 5AE2A 1VJWA 3WQPA 3J81j 3UN3A 5KFPA 1XMQF 1UVIA 3NS7B 2JLFA 4NLPA 1H2VZ 2JEJA 3DRSA 1RWPB 5LMNF 4DV7F 3MWBA 3N6LA 1H3DA 1PYSB 3FGVA 2WRMA 5D4NA 2X3GA 2HHHF 2B8QA 4FVMA 1AT1B 4ECTA 2LDIA 1QE1B 1R89A 4ZK7M 4BS2A 2EVZA 3D1HA 4PYAA 2YTCA 3QSYB 3TA1A 3FFIB 1CULA 1Q8KA 2DITA 4ED6A 3KJVB 2OHDA 4Y34A 3LOUA 3TX0A 1RAOA 3E3XA 1U09A 1EP4A 1RE1B 3AQOA 1PYTA 3CB4A 4UOFA 3UR3C 1JXVA 3J81Y 4CZCA 1XNRF 3W3SA 1KQGB 5A0YB 5F8LA 3IR7B 4HVZA 4LFAF 1SH0A 1HMVA 3DHWC 3TQEA 4RJVA 2F4FA 2IRXA 2LEPA 4OZ0A 2J7KA 3VTIA 3N0VA 5DG9A 4YMEA 3PFEA 1SI9A 2HZAA 3HSDA 2O3DA 4IRKA 3C6UA 3T9NA 1WSRA 3KLGA 2HQ3A 1TUGB 1WC4A 4PXEA 2DB1A 1VC6A 3P6YC 1RBAA 2KN4A 3R8YA 2BJ7A 3C14B 4DXLA 2V9KA 4FPIA 4UW2A 2UUCJ 2OIHA 1GXTA 1BC6A 3K5OA 4P74A 5J2QB 1Y4ZB 2OO4A 4KGKA 2DPJA 2L9DA 4KAIA 4GO7X 1NK9A 4K2JA 3NWRA 1W2BR 5THWA 4Y2AA 1VRQC 3OL8A 4RWXA 1M1HA 5IQ6A 4LSNB 1JKHB 1IR1A 3GSDA 2K1RB 3OL7A 1LV5A 4YB6A 3LO3A 3ILIA 3QWUA 5D4PA 2N7CA 5DM6Q 3CXCR 4DR7J 2KYZA 2VIHA 4G1QB 1KD1T 3KHLA 3OSPA 2OUGA 3UN2A 4KQZA 4B3SJ 1K73T 4F67A 1AB8A 4Y3CA 5SUHA 4K7QA 4LR9A 2P9GA 1N33J 1YJ7A 4LBIA 4DDFA 5KG7A 2YX1A 3OW2R 3FC9A 1CJKB 4WFBQ 1DLOA 2AMCB 2ZC4A 2V4JB 4ZP9A 4HACB 3AJ1A 2Q3PA 4NPOA 1HNIB 2HHTA 5CABA 4NYPA 2HNZB 1LW0B 1NK0A 2EFGA 5E3AA 1OSDA 3MCOA 3ENAA 3GV7B 1X60A 2CRLA 1K47A 4GC6A 2UUBJ 4QIWD 2HQFA 3TJ8A 2W7AA 3S6EA 3W9HA 3QIPA 1WC6A 1QSLA 3V6JA 2GNKA 2W25A 4OJHA 2Z4PA 2G0IA 2JEFA 3GV5B 2MQNA 2X7IA 4TU8A 1UCNA 2YKMB 4Q44A 1T9WA 1RT3B 4XO0A 2F63A 3MEEA 4ED7A 3FBFA 1R0AA 4C98A 4RUCA 3PACA 1S1WA 1NBEB 5BR8J 1NJWA 5CHCB 3KHGA 4MKAA 3RBXA 2DTJA 3G8TA 1GX5A 4P52A 4EU0A 1TKZB 2K3KA 1YQHA 3LPEA 5DZ6A 2W9AA 5U47A 3WDOA 3U7JA 2BOAA 4QR1A 4WXWA 4KKOB 4RX6A 2X3DA 3KUHA 4M5DA 1GMWA 1N5YB 2R2TA 4ZVQB 3SI8A 3CJ2A 4KPCA 1HHTP 1RCOB 3VAIA 2YKAA 3IRXB 2MXYA 4USIA 4IR1A 4H4MA 1RHUB 3L7PA 2GX8A 1JLQB 2R7WA 3U1LA 3NAIA 3P45B 5HROA 4O3SA 4KFBA 5HMYA 8AT1B 5HVGA 4OYOA 4X64J 1ZAVA 1BHNA 4PZVA 3CDWA 1JXEA 3PIPQ 4OIXA 3LP2A 4ECYA 3IS9A 5JXSA 4HT5A 1NLKL 3PFOA 1SQFA 1VLOA 3M32A 1T9XA 3CC4S 5CD4H 2C2NA 1HQ2A 2GAGC 3RJMB 1LXNA 1H98A 4K8RA 2KJWA 2QMXA 2VHGA 2YKOA 4OI0A 3O8WA 1S7HA 4TY9A 2AJFE 4DFKA 4F7VA 4TQRA 2EFNA 3FEZA 3GIIA 5KT4A 5EN1A 1HBNB 3ULHA 5DLGA 4ZJQA 3H8YA 2FVSA 3WC0A 3EDQB 4DL2A 4RO0A 4MFBB 1FX2A 3OXLA 2W1BA 3A8IA 1FWKA 5DQGA 4DU7A 3H5SA 1S5ZA 2J9CA 5DGAA 2FYXA 1DTTA 4IQMA 2FJEB 1XMBA 1FNXH 3TARA 2MMYA 5DS7A 4UQGA 3W61A 1SIZA 1XTZA 3H7HB 1FD2A 2RDJA 4B9MA 3MPYA 4DMZA 1FDAA 1U7LA 3M8QB 3JTOA 1PAEX 2L9WA 1VJQA 2DH9A 4OYMA 3TZYA 3H4BA 4ZPVR 4O3QA 2KKHA 1CS4B 1S1XB 2RQKA 2MZTA 3D4JA 2RRBA 1UPPA 2FLPA 2HGLA 3HVTB 5KT5A 1U2RA 2D3UA 3IR5B 3QT6A 2QMUB 3KTQA 1UWBA 1B4SA 4Q8FA 2ROEA 1WDDA 4NLGA 4UY85 4J9RA 1GAOA 1E6YA 4K4SA 2D69A 2LA6A 5K5MA 2Y1RI 2FLOA 4CLWA 2YNIB 4CH0S 1S1VA 4EUVA 2F7VA 2LQ9A 3NGUA 5HVHA 2O5DA 3SMZA 3CMES 3HHNB 2IM1A 4HR2A 2RF2B 1TVRA 4NI2A 3R97A 3PYEA 4ATNA 1UEVA 3A3PB 3DXSX 1IWGA 3DM2A 3TRGA 2MKIA 4WU3A 5FDLB 3J7AN 3JXOA 3BV8A 1J2VA 1RHJB 3KLHB 1IBKF 3CD6S 3UFCX 5KFWA 4GRSA 5L46A 3ZXWA 1YJNS 1S12A 5IWAJ 2RQMA 5T7LB 3BKUA 1MN7A 5JVHQ 1VBKA 3ZNUA 2NYIA 4WXOA 1LWFB 3TZWA 1WEYA 1RCXB 2OAUA 3QGIA 3MM8A 2LXIA 3DLLQ 2MQLA 3CF5Q 2MKJA 3L3CA 4DSKA 3CNQP 2VBWA 1FF2A 1C0TA 3H5UA 5GAEI 5HP1A 1KLMA 1VRUB 3MUMP 4A48A 3MCSA 4ZIWA 1UA1A 2DNNA 1RT6B 3IM8A 3CCVS 4TY8B 4I67A 3BBFA 4N41A 2KT2A 2PA8D 5C24A 1XBWA 3HLUA 2UXBF 4DL0C 1HPZA 4ZCIA 1P9QC 2MQQA 1SH2A 3DRPB 2B9XA 1T8EA 3GJQB 4UZCA 3TO8A 1VC5A 4I6YA 2Y8YA 2V67A 2RILA 1ZPVA 5HMXA 3T41A 3MUTP 1TFWA 2VV5A 4C3MA 4KV8B 3NGSA 1KQFB 4F4WA 3KK1B 2YH1A 2P8IA 4JI4J 3SSQA 5DM7Q 3MM7B 5HVFA 2F8HA 1RI7A 2LQ8A 2RS8A 3AOBA 1L5UA 1UVLA 2LQBA 3R7SB 3MM9B 1NJYA 2YPYA 2ZE2B 2ASYA 3ONQA 3QO9A 3AOCA 1U6BA 3RGIA 2MZSA 3MOJB 4FYDA 1FO1A 1RWWB 4KO0B 3AY0A 3SV3A 1HI0P 2BR0A 5A6PA 3HFZB 2MQPA 3LF0A 2VBZA 4LSLA 2RDIA 4Q2LA 3MEKA 4IDKA 2B4UA 1UVMA 4U6PA 4HHHA 4JB8B 4YN3B 3FDSA 2LMIA 3BN4A 2H9ZA 2D7SA 1L3SA 3HO1A 5IFMA 2M88A 2EFVA 1VQ6S 4Y65A 4PG8A 4B9UA 2IPOB 2VFVA 2MPUA 1YSJA 2GFFA 3AD9C 1G7CB 2J9DE 4IFYB 3A12A 3FVYA 1QM9A 1SJQA 1AFIA 1ZM3A 3AH6A 2CZVC 4QZVB 1FDBA 2HVZA 4EYIB 3H2UB 2F65A 2WVEA 1D3WA 2YQ1A 2HK3A 1RBOB 1KKHA 1QY7A 3AQPA 2I5JA 2E1AA 2CZ9A 1IKVB 2RIJA 2R8GA 4CCHA 1FNMA 1MU2A 5HJYA 4DZ6A 2CPYA 3P49B 4M5MA 2VFRA 1H7WA 3GWCA 1SJFA 2ILYA 4UZBA 2RU9A 3C15B 3R5JB 4GVBB 5J1EB 4KHPJ 2ZVSA 2HNDB 2C2EA 4QW8A 1ZM4A 1SC1B 3DOLA 4KH0B 2ZUGA 4WF9Q 2XHWA 4R5PB 3I0RA 2VASA 5ETNA 4C8OA 4HL9A 3TVYA 3LQVA 1S9EB 1H74A 2UUCF 4UUWA 3ITHB 2R7TA 4CLFA 1W25A 3TZXA 4PUOA 4DLEA 4F04B 2HBQB 4I56A 5EDWA 2BKPA 2XO7A 3CJ8A 3LAMA 4ZA1A 4F4ZA 3OVBA 3PYGA 1D09B 3BKFA 2N7YA 3PW0A 3C46A 2WCXA 2J7WA 2C3MA 2Z58B 4KR0B 1EQMA 2C2DA 2DGTA 5LT5A 2W9BA 4DR7F 2Z2ZA 3LUYA 1TL1B 2G2YA 3G86A 4B08A 3B8HA 4YR2A 2G13A 4QYRA 4B3OA 4B3SF 3P3DA 4K4UA 4C8LA 3J81U 3CDEA 2LXUA 5HK4A 1N33F 1HNZJ 3ZZOA 1TUWA 2XQCA 3DDIA 2DGSA 2QSFA 4W4MA 1RTIA 3MECB 3NAHA 1NEEA 4H4KA 4F8RA 3M1VB 2DGVA 3PYFA 4GKKF 1APSA 2KO1A 3KHHA 1Q8IA 2HFOA 2FZGB 3W5XA 4UOCA 3FMBA 2AYMA 2ZH3A 3RW6A 1UW4A 5KFQA 2UUBF 2F5GA 3EM1A 3NCQA 4J9VA 1DBDA 4LF4J 1QLNA 4N8OA 1KOOA 2YWFA 2H4YB 1MMLA 5F3TA 2OFHX 4I2PA 2CNNB 3HKWA 2VQEJ 4WE1B 1JLEA 2LFVA 2FVCA 1SH3A 2CPXA 4ZPBA 1Y5LB 1RHMB 5BR8F 3W65A 4Q45A 3I31A 4KGZB 4CO1A 4R0JA 2QA4G 2RKIB 1M1KT 1CVJA 5L1KA 4J9MA 5HANA 4NE9C 2CQDA 2Q43A 2HS0A 2YKPA 2MKSA 4Q43A 3T6JA 2BANA 4ZMMA 3UVJA 1Y00A 4HYKA 1RTJB 2V63A 1N36J 2CJ9A 5GMKa 1R8CA 2DNHA 1K0TA 1PIEA 3W5YA 2HAIA 1MMDA 4LF9J 2DHXA 2H4WB 3CJRA 1Y9OA 1MMNA 4NA3A 3S01A 3HSZA 4X64F 2E1RA 2XY6A 5E7OB 3HMJG 2HAFA 3HP6A 3JSMA 1B0TA 1CJUB 1OIAA 3THVA 5F8IA 2HFNA 2CNOB 3MI7X 3JSYA 3IP0A 4DV3F 2A6MA 2GMJA 1UTAA 1SKUB 1X5PA 2GHWA 2ZVIA 1FKPA 2DGUA 4JI0J 4WTYA 1DTQB 4ANEA 4QU7A 4ES1A 3ET6B 4ZVEA 3ZTQA 3CW2C 2VOOA 4Q0BB 4DPWA 4NASA 4ZP7A 2ZWPA 5ITHA 4PWWA 1VI7A 2FVPA 2EBGA 1FK9B 2QL7B 3ZC4A 2OPQA 4EI2A 1SJRA 4C8KA 4CO5A 3HVWA 2XMUA 4H54A 4ID5B 2DNMA 2NPFA 2RU3A 4ENOA 3BEGB 2AJ2A 2RHSB 4DR6J 1RSCA 4KC5A 2V34A 2ATCB 5M2UA 4EBCA 1PSDA 4IO9Q 1Y3JA 4AT1B 3VZIA 1ROFA 3T1HJ 3PR5B 2E5GA 3IG1B 4OV6A 3W63A 2YNHA 1BWEA 4PWDB 4AXJA 4RNNA 3QNWB 3Q8YA 2CADA 2E1PA 3MR7A 1B99A 3FCVA 1YX2A 3RZAA 3V81A 2W24A 2KYXA 2QFIA 3GJTB 2EK6A 3W2VA 1HBUA 3CIZA 1RAGB 3H2VE 1S99A 3OPKA 4OLPA 2G4BA 4CWBA 4J90A 3C19A 3ISND 4QYZK 1GQEA 4CH7A 5C42A 2HVEA 1XR6A 1RHRB 2G1HA 1CC8A 1RDRA 1UVKA 4OYXA 2OKQA 1FFGB 1KDNA 4ALZA 2QG9B 5ETOA 3POTA 3J7YI 2QV6A 3KHRA 5J2PA 3BDEA 5KFOA 3I96A 3CTRA 3MHYA 3DMJA 2U2FA 1C2PA 3P5BP 3QWPA 1UEKA 5ETVA 3GONA 2MKHA 3MR5A 5IWAF 3J7YU 2JDJA 3MXHP 2DCUB 4YB5A 1Z2LA 4N47A 1KTQA 5LL6d 5EGYA 1UMJA 3BH7B 3NXZA 3HHEA 2DKOB 4YUDA 4IR9A 1HKAA 3ZZYA 1YVFA 3KOAA 5HBMA 4H4OB 4MMOA 4ICLA 3U27A 3ZTSA 1YRXA 3KWMA 2W9CB 1A6LA 3UN5A 3CE8A 1M0SA 3CJQA 4FKYA 2HIQA 4CO4A 1HA1A 2XMTA 3WX4A 5HL7Q 2W4DA 1Z1ZA 3CJTA 5HO4A 1DQ9A 3I87A 1TL3A 1UJ6A 2HZVA 4B3TJ 3R5GA 2OSQA 4PG5A 1WSVA 4ZHRA 4EFAC 3DLKA 3DI6A 1PBAA 2VG7A 3RYLA 2IJFA 1S7IA 2H48B 3D67A 2AKWB 4V1Ak 2IRUA 2MGZB 3JYTA 4UF4A 1H0HB 3MTJA 3QJLA 4FS1A 4JI4F 2B7CB 3FSYA 2CQPA 4YB7A 3OFHA 4CLUA 2ADBA 1FD8A 3DYAA 1FRMA 4E98A 1RT1B 1RGVA 3CJKA 1NSQA 3PHEA 1YLXA 2DR9A 3DRYA 5GAGI 1GMVA 1Q79A 3M2UA 3M2VB 1QUVA 4CLKA 2DNRA 1NRKA 2KU7A 3CJ5A 2VB6A 3PRVA 1TV6B 4QWDA 3PO4A 3RB6A 2WONB 4B9NA 2DO4A 3Q24A 1XK8A 3TQ1A 1FXLA 1FJ7A 4AFFA 1RABB 3N5FA 4DCJB 5AXLA 2EEYA 5K8OA 2N4DA 2D3ZA 5CAAA 3UE2A 5ADZA 2J6TA 1C1CA 1VQ9S 2J76E 4QWEA 4OLOA 4ZLLA 3Q0AA 4OYWA 4C8NA 3GLJA 3M9OB 1T3NA 1YBAA 5KFDA 3BR8A 1ZA2B 2NXNA 1QDUB 1X4EA 2G0JA 1YK9A 2HRTA 3H98A 3CC7S 3ZZZA 4WFNQ 3DNCA 4C3LA 4X4PA 3EZOA 1EIYB 2X1AA 1TMJA 3MD3A 3K5PA 2YWEA 2CZ4A 3I82A 3DC2A 4HT7A 1N6QA 1OSCA 2IDLA 4JI5J 3KJNB 3VAHA 4XAKA 4KHPF 3L95X 4J9PA 3QZ7A 4DQIA 5DG7A 4B17A 4QWAA 4MAKA 1NMEB 4DSJA 4FF2A 2MJNA 3PKMA 3TJAA 2DVIA 4FYYB 4P9SA 1P6TA 5LMUJ 1S9GB 1S76D 3TUIC 5KFGA 2P9EA 4BWMA 3ZO7A 3NP5A 3C16A 2QN6B 2XI3A 1N5SA 2AP6A 3GR1A 2BMBA 2W2MP 4N77A 2ASLA 2NR0A 3SCJE 3ZZ0A 5K14A 4X4QA 5F0WA 2MY7A 3MAQA 1JMTA 1E6VA 2CQ1A 1WF1A 3TA2A 4NEZA 3JAMY 2ZC3A 2IHR1 4DCPB 1WG4A 5IT0A 1LWEA 2AGPA 3KDOA 3CCWA 5F8GA 3NL0A 2FPHX 2FGCA 2GAHC 3M2RB 3SCLE 3OUYA 2AX0A 3OTDA 3JB9k 2V2VA 4IRDA 1A9NB 1X4DA 3AXMA 3OTBA 2B3TB 2RRAA 1ZYQA 1H72C 1JNZB 1FRKA 1HNZF 5HSPA 3MURP 4O3RA 4P7VA 1HNVB 2XYHB 4E2FB 2XWYA 2ZH7A 3Q89A 4CLYA 3R6GB 5E2QA 2PMZD 1B0VA 4DUYJ 4LSZB 1FTCA 4CQ1A 1V9OA 1YKWA 3RBDA 1AXQA 2YVSA 1K8AT 5DRKA 1RT7B 2VBXA 4OZ2A 4OYPA 1RP5A 3KMSA 2CPIA 3CDAA 4F50A 2AJQA 1HWIA 4G1IA 5A8WA 1JLBA 1U0HA 3H5XA 1QVGR 2VDIA 4CTAA 4LF4F 3HK2A 5HLFB 2Y0SD 2YNFA 4CO3A 1NHKL 1RWVB 2RQ4A 2GQ2A 4CO0A 1HYSA 3EGWB 4OX8A 3TAPA 1WI8A 2VKRA 3UR0A 2VQEF 4ETZA 1SJ4P 3O5TB 4R25A 4MYUA 3TVKA 5IS2A 2OP5A 5A8KA 1SCJB 2YWGA 2ROPA 3DRSB 3PR4A 3J7A1 4NZ7A 2VUGA 1HBMA 2YQ0A 3OFEA 1G6BA 3KUGA 1IM6A 2P9CA 3OVSA 2PEHA 4A46A 2Y1IA 1LK5A 3BR9A 2QZ8A 2R7RA 3SSRA 5D77A 2W7PA 3I5CA 3D68A 2JC0A 1B64A 3MM6A 4JUZA 4F4KA 1SL0A 2PEBA 1CULB 1N36F 3BGRA 2EC0A 2IA0A 5BXIA 3C2PA 4LF9F 4A47A 3R3TA 1TKDA 3OR2A 3AB2B 5GVQA 1O0PA 1VIOA 3OXGA 3M8PA 5KG2A 2OMLA 5L9NA 1X9MA 2AT1B 1X9WA 1EAYC 1VOMA 3QGHA 1HMVB 1P1TA 3T6BA 4U96A 2HMIA 3MPVA 4OX6A 3N9UC 1HI8A 2EFQA 4X65J 5EWGA 3UW1A 2Y8WA 2BACA 3AJDA 2RQCA 3VGTA 5CYJA 3PV8A 3H40A 3R7NB 4PABA 2AF6A 3C6UB 1HD0A 4JI0F 4KYZA 4F26A 2R3VA 3KLGB 4LFBJ 4HH0A 1KN6A 3K89A 2CAJA 1SJ1A 4NXNJ 4OI1A 5JJBA 1GTEA 4DHVA 1KVIA 1LEOA 4C0BA 3WHIA 1U1QA 3I4PA 4DL6A 4WJBA 3S1TA 5CQGA 3ISZA 3VAJA 3M9NB 1IUJA 5ETKA 4FNIA 4DR6F 4ED8A 4DPXA 5K9FA 1GK8A 5CCLA 3SCIE 4CNYA 1FRXA 1FXRA 1U1NA 4DF8A 4AL5A 2DXFA 4RU2A 3BSCA 1G1XA 3T1HF 4HH1A 4I2QA 2FJWA 3H20A 3IO1A 2MZJA 4EMDA 2Z2YB 1KFSA 1VLYA 1WEZA 1EJ7L 2FJBB 3D6HB 3SYZA 1OY9A 1M5PC 1UW9A 1RT5A 3FEXB 2B6AB 2H5EA 2CWKA 3GYXB 1TK5A 1B7YB 2OH2A 1FEEA 2AW0A 2MHNA 2BJEA 1WUUA 1A0OB 1S1TA 1S6PA 2XMKA 2E44A 1IBLJ 2X1FA 2JEGA 3ENQA 5SZTA 2BBEA 2OEJA 1J5OA 3MPUB 3PJXA 2I38A 3I5BA 3PRBA 2FHJD 2CQBA 4W92B 1R6YA 3MEGB 1DLOB 1JJCB 1DRZA 3B82A 4DUZJ 3ZZTA 1S0OA 1CEZA 5BYSA 1D1UA 3HXMA 3J80Y 2OMOA 1FDDA 3ZTOA 4RLEA 3DCAA 2Q66A 2W4PA 2QLBB 3PKYA 3C6TA 4NCAA 3PW7A 5CH7B 2X1BA 1F1BB 2KZMA 1EZZB 3LALA 3QIPB 4FNHA 3OR1A 5KG6A 2VICA 4KB7A 2NXJA 4ELTA 3VAFA 4NLDA 4DSEA 2KG1A 5B7WA 3RBZA 2J9EA 1R0AB 3L7UA 4OYAA 5BJRA 3DRRA 2M0GB 2QL9B 1S1WB 3VAMA 3U1NA 2E9TA 1IBMJ 3ICLA 3LP1A 3M30B 4B3TF 3EPGA 5J2NA 1QTMA 3UD5A 4AL6A 1F2HA 4M5DB 1YJRA 3NBPA 2CPHA 4JBCA 3LH2S 2LVWA 1RAIB 1RU2A 1KR4A 5C25A 1TKXA 2ZH4A 1AUSL 1WG5A 1KVJA 3QGGA 1VGYA 5HROB 4KFBB 2UVRA 2XYGB 2U1AA 4CLPA 2BE2A 3CJSA 4G1QA 4LREA 2R7SA 1U1PA 3LP2B 3M32B 4IRCA 3GIMA 1I94J 2RD5C 3MAAA 2E29A 2GQCA 3PVXA 3W1YC 3PZPA 2R42A 4URQU 2AD9A 1LKZA 1XIQA 3UDLA 3NRBA 4M1KA 1HR0J 1K1SA 3K17A 3FK4A 3GCXP 3IBWA 2DY9A 1U45A 5H9FJ 1VQPS 3QQCD 5FJ4A 3G4SS 4NXMJ 1KOHA 3BPSP 3NNHA 3PG9A 3M6XA 4DV0J 4NRUA 1T03A 2HNZA 3IMQJ 1BQXA 5EHHA 4ZVFA 4WFAQ 3EJMA 2WB1D 4DV2J 3V4MA 1L3KA 3AB4B 2HVDA 4IFVB 2OPRA 1NXIA 3ADAC 1OS5A 2ZH5A 2CQCA 3U02A 3HZGA 3W5ZA 3V6DA 3FUYA 4BCAA 4ZVSB 1VQMS 1X4CA 3M9MB 4RW8A 1FVQA 3M8SA 1VRTB 2JX2A 1MLAA 2NS1B 3SBMA 1TQLA 2ZJRQ 2M8DB 4NLXA 2X51A 1N88A 1JLFA 1CBKA 2W2OP 2DR5A 3EUNA 2KG0A 4JI5F 2C2OB 1U6ZA 1UWBB 4X4RA 4TN2A 4N56A 3RR8A 1HFEL 3BSOA 2I8EA 2R7VA 1ITPA 1HNWJ 5AT1B 2WHOA 1E6YB 2NQPA 4FF4A 1YIJS 4CYUA 4OZ5A 5JVGQ 1KFDA 1TKZA 1T11A 3MMBB 5LMUF 2W7OA 4KKOA 2OSRA 1S1VB 1URNA 1BE4A 1VYAA 5CYMA 4TLQA 2WSEC 2J6UA 3TJ9A 3IRXA 4EK2A 1TVRB 4NI2B 3UWTA 4NLSA 4RR5A 1FRLA 3DM2B 2QA1A 1PG5B 1CG2A 2YH0A 4X66J 4U7UD 3KKFA 2OLWA 2ZM6J 2N4CA 2R8HA 2DR7A 3RG6A 4RUBA 4ZVUB 4M5LA 1ZPWX 4L72B 3Q2TC 2COLA 3OJUA 4C3KA 1RAFB 1Q81T 2M5YA 1RXOB 4EYHB 2B9EA 2QE5A 1WC0A 3EZ5A 4LUBA 4USKA 2BVZA 4WTOB 3MM8B 2XS2A 4KSEB 3RTVA 4WP3A 3MCMA 4FF3A 2XEXA 3UI3A 3DLGA 1C0TB 5KT2A 5HP1B 1KLMB 3HHLC 4V19X 1H2UX 2DIVA 2VC0A 1ZAWA 2F1FA 4MJKA 2IMWP 5D4OA 2Q79A 4MFBA 3EGVA 2GHVC 5C24B 2B4VA 4HKQA 1S49A 5B0CA 1FJCA 1NCLA 3MM5A 3EPIA 2XLIA 1HPZB 2KVQE 1YJWS 4KRWA 2ZITA 4QBUA 2BW2A 3M6UA 1UVJA 2R7UA 2CDRB 1REVA 1UWAA 3MGJA 3BBCA 4NYZA 4F0MA 3HFVA 2QO3A 3M8QA 3BQ0A 2F9JA 2ZOGA 1Q78A 2LCWA 4DUTA 1S1XA 4LT6A 2UXCJ 3TANA 1ULRA 3CMQA 4KPYA 2RB7A 2UVUA 4ZLPA 1KHWA 2PD1A 3CO0P 4CO2A 4I7FB 2AYGA 1R0CB 2MKCA 3QO9B 2CQHA 2ZHAA 3RRGA 2OELA 3MMCA 1WF2A 1OYEA 1VISA 1O5JA 3OTEA 4DSFA 1PJ6A 2ACMA 4J9OA 5KT3A 3W62A 3GSIA 4LR8A 4DEZA 1VQ4S 3R7BB 2J0XA 3JAMU 4LSLB 3AHPA 1BMQB 3W64A 4IDKB 3OLBA 1F9HA 2D3OR 1SL2A 1OY6A 3G6XA 1SC6A 2ATLA 3F44A 1WHVA 2OGUA 2IJNA 5KT6A 3DLEB 3TW0A 3DFEA 5KFJA 3IWLA 1K0VA 1IN0A 2DISA 2W8KA 2PMHA 2ZFHA 3KLHA 4YQWA 1VQ7S 1DHMA 2RJZA 2IM3A 2MYFA 2DGWA 1BQMA 1IQTA 1AYEA 2HZCA 2I5JB 4EO6A 2FVQA 4NCBA 4X65F 1JJ4A 2VA3A 5H9EJ 4DS4A 5KT7A 4RW7A 1MU2B 4YDDB 1JLAB 2DEJA 1UFLA 4MTPA 5IM0B 1URRA 4WYWA 4N5SA 1V5IB 2A2DA 1SC3B 2FTRA 3G8SA 4C8ZA 3PJ9A 2YKNA 1X4HA 1RT6A 3BKTA 4NXNF 1OPZA 3DOLB 3GCWP 4MYTA 2NZCA 2DPIA 2OTJS 1WDTA 1Q86T 3BPDA 1LWCA 2HHQA 3I0RB 2JFDA 2VBYA 1S79A 4IUFA 2DEIA 1R43A 1Q8BA 4RWWA 2HEKA 2HFUA 4A8FA 4PUOB 3UD4P 4HTIA 3CD7A 3T19A 5L1IA 3HT3A 2ZWOA 3LGMA 1IKYA 1ZS6A 1WOOA 1BD6A 1KEKA 4X4VA 4OZNA 5E0OA 3UO0A 1C0UA 4DFMA 3LAKA 2DNGA 3MMAA 2IDEA 3DKDA 1EETA 2W2QP 4O0NA 2ZE2A 5DQHA 1S6QA 2WSCC 1I1GA 4PWUA 2OPSA 2W9BB 2XTJP 3N28A 4J9LA 2GIQA 1D8YA 3P5TL 1M5OC 2B4OA 2EKNA 1DURA 4ZP6A 3QRRA 1T0TV 4B9VA 1Q0NA 1BQNA 3EGZA 4I6WA 2HK2A 1PC4A 4B3OB 1R8HA 1NDCA 3FQKA 5HMWA 2C3UA 5T14A 3Q83A 1OY8A 1IBLF 2IIHA 2MJUA 2RMLA 4HHJA 4DU8A 5HQLA 3NOGA 1XQIA 3HD1A 3AJ2A 3NGKA 5FLXY 2M52A 5KFSA 3HM9A 2HS4A 3DDNA 1MWQA 4UQTA 4DUZF 2HRYA 2AGQA 1BUXA 4JV1A 2J6SA 2XM3A 2PA3A 3CCRS 2FHKA 2HHXA 1AFJA 4V19J 4XDDA 1YJTA 1DJ0A 1FCAA 2B0GA 4DQQA 3S7RA 2C1EB 1LW2A 2XO6A 3TP2A 3T1AA 4LQ3A 3TWZA 1IKVA 1UFKA 1VQLS 4M5JA 4CLZA 3CD5A 2NUUG 2W01A 3C8YA 5F8NA 2ZZMA 2VF3A 3JQMA 4I2PB 4G3IA 5I3UB 2QMWA 3MEDA 3ZZRA 2J7UA 2BKNA 1JLEB 5EX3A 5J1EA 5ETPA 1RBLA 1L3TA 1TELA 4GMKA 2V94A 2MB0B 3GJSB 1JIHA 2PO4A 4ETXA 3SCKE 3OL6A 2L48A 5IZHA 2HPUA 3LP0A 1IBMF 2DNZA 2DRAA 3MMJA 1RU1A 3TUPA 3BGFA 4C0HA 4YOEA 3SZ2A 5EUHA 3TNVA 4LFCJ 4R0EA 1GFWB 4JV5J 2JSXA 4BC9A 3UVJB 2ZD1A 4IOAQ 2KRBA 1OO0B 2HFSA 4X62J 2DNLA 1TZ0A 2B9WA 1S1UA 5E3RA 1JNRB 3B4MA 1NZAA 4OMFG 5KFXA 2R2UA 2N3OA 3JSMB 4X84A 2ZNZA 1IKWA 4LF2A 4O3OA 2JLGA 2HHWA 4DN0A 2O67A 2CQ4A 1I94F 2HRUA 3J80U 4QOTA 1NK8A 1FWLA 3B6BA 3D28A 2HQDA 4FS2A 4NX9A 4DPOA 3AFGA 1HWKA 4ED0A 3IAS9 4YR0A 3W9IA 1FKPB 4P71A 1N0UA 1HR0F 2HURA 3H0PA 3IWXA 3KG1A 3MECA 4NXMF 4GKKJ 2IJRA 3M1VA 1ZM9A 1VQOS 2CA9A 7FD1A 4DV0F 4F3MA 2KTQA 2XSFA 5IC4B 5AXMA 4DV2F 2OPQB 2DH7A 2DHGA 5B09A 1TK0A 1Y5IB 1QSYA 4LIRA 3D54A 3RR7A 3P8BB 5E41A 1GTHA 3ILLA 2EXUA 5CZVA 4NMXA 3BQ2A 3PTWA 4ILLA 3D0GE 2GVZB 1T3OA 4Z7YA 2OI2A 2K7JA 1NO8A 1N52B 3K59A 3SXLA 1HBOA 4NLRA 4D3GA 2YNHB 2DYAA 5CYQA 1NB7A 2VG5B 4WE1A 2KFYA 1WKJA 3JQKA 2A2CA 4Q7AA 3V81B 2P2CB 1PAUB 3DDKA 4QJVA 3QBCA 4L73A 2LA4A 3W2VB 3M8WA 5LOQA 2YWHA 1HBUB 4ZPDA 1HNWF 3H90A 2M9KA 2QT7A 1SJ3P 4FN5A 5IT9Y 2QC3A 1NJZA 4RNOA 2XZWA 1WC1A 3OTOJ 2BE9B 3NOCA 4U8VA 4DX8H 4JI3J 5C42B 1S72S 4HEA9 3TVZA 2CXEA 3KXDA 4U67Q 2KH9A 4Q8EA 2ALZA 2HNYA 2AJ0A 3POTB 4XPEA 5HATA 1LXJA 2HBYB 2BV3A 1RWXB 4LF5J 3AD7C 4X66F 3RUBL 5J2PB 3IWNC 4HDHA 2XZDB 2ZM6F 3QMQA 2AWZA 4IQXA 5KTQA 2AGOA 2AV5A 1U2CA 5A8RB 1H38A 1VK8A 3DMJB 3GFYA 2BJDA 1X9SA 4WFZA 1WC5A 2XS5A 2EG2A 2DXDA 4X4TA 2O01C 4DV3J 3H5YA 5AJ3J 3I9ZA 1UETA 3CSKA 3DOKA 3PYDA 2F3JA 2E9ZA 2C2MB 1S9FA 4JI1J 5BYQA 1DTQA 1X31C 4YDXA 2YQ3A 1R8BA 3UDCA 4ICLB 2VJVA 1FVSA 4ERDA 4CIOA 4Q0BA 2MQMA 3FRYA 3CCZA 5JMNA 2BJ8A 1HNXJ 3M6WA 3KLVA 4B9SA 4AXIA 2B4PA 1FHTA 3G2XA 3TEHB 4EBDA 1R8PA 1YWXA 1TL3B 3E8OA 4HI1A 4ZHRB 3DLKB 2VOPA 3DLJA 3DI6B 2VG7B 2L41A 3OFFA 1RAJA 4QPXA 1S97A 2KFNA 3JYTB 5FD1A 3Q86A 1MW7A 2UXCF 3QFWA 1NJIT 1NPRA 1HQUA 3DYAB 2VKZG 3DXBA 2QLXA 1X5OA 3UCGA 3THTA 1XR5A 1PYOB 2QYCA 1ZZFA 3M2UB 4Y0FA 4O4GB 1RADB 3PJWA 2BKOA 4ECRA 2H3EB 4WCEQ 3KYLA 4MIBA 4ER8A 5I42A 4O4RA 4RBVA 3BQ1A 4A8SA 2YXLA 3KLIA 2RUGA 4NLQA 2OFGX 1RWMB 2FHMA 3VWSA 2EFPA 4TU9A 2EW9A 3TA0A 2IY5B 4FZVA 1FNOA 1XN9A 3V6HA 3NNAA 2JFKA 1TL4A 1R7IA 2XYPB 2R8IA 4AE5A 2W4CA 3N79A 4A8OA 3FRZA 2FHJA 4X4SA 4NYOA 1BY9A 2BXJA 2IM0A 1I51B 3WZ0A 1Q95G 5D8HB 1NKCA 3CJ3A 2DRBA 3W2WA 4QW9A 2ASDA 1F5CA 1NUEA 2B51A 3R5AA 3NS6A 4LRFA 3EGNA 2VPYB 3W8PA 2OPPA 2VZ9A 4JI6J 1NH7A 4ID8A 3NEKA 5H9FK 1N6QB 2CJXB 2BABA 1S4FA 2IFXA 2W9CA 5I3QA 4ECSA 4IG3A 2I1RA 3HX9A 5F41A 1Y5NB 1IQZA 5GAEU 1KLNA 3NNCA 2DK2A 1UL3A 1JLGA 3H42A 2JLEA 2G1DA 4JV0A 3HHDA 2V2QA 5AE1A 1VQYA 1WKKA 4B3MJ 2HBZB 4Y2KA 2J9DA 2JEIA 4E8UA 3QT8A 2IVFB 4CNZA 5B08A 2ILZA 2NSCA 3KNGA 5K14B 4FXVA 2UVVA 3T9ZA 1E6VB 2J8SA 3HI9A 5D0HA 5LJ3Y 2UUWA 5C2CA 4NOHA 4PCQA 4NMLA 5KG3A 3UD3P 4OJ1A 2CPZA 3FKBA 1LWEB 3US5A 2DHHA 1RYRA 1RTHA 2Q6CA 4WKRA 1BLUA 5A6WA 3HHLA 1MROA 2YNGA 5A2QY 5L1JA 1JJ2R 4OZ3A 2OJ3A 1IR0A 2HSEB 3BSNA 1U4BA 5CCMA 3HJVA 3E01A 2I2YA 4ZVHA 3WC2A 1RWUA 4B9TA 3OQ2A 3HFKA 3D0HE 1KVKA 4CLTA 1Y3KA 1UPMB 3MPWA 2IC3A 2NCKL 4ITSA 5DO2A 1Q1KA 2V68A 1WD6A 3FMWA 4RW6A 4RW4A 1NK4A 2GIRA 4URGA 1QJHA 3V4IA 2FJXA 3KG4A 4WP8A 5IC6B 2GHPA 4CTAB 4RZRA 2LEBA 3PXGa 2GIFA 2E9RX 2YNFB 1NPPA 4K59A 1NKEA 2AZ3A 2PI4A 2KRRA 1AW0A 1T05A 1PGZA 1S48A 4DBQA 1JLCA 3FBEA 2I0XA 2V69A 3Q8VA 5A8KB 1S0MA 3K5LA 2VG6A 4RNFA 1HBMB 4YR3A 1RTDA 5AXNA 4OQJA 2PFDA 3PNIA 3JSBA 2CJKA 2YBVA 3I0SB 1SV5A 1MWYA 3R27A 4G65A 3FCWA 4LFCF 3MM6B 4JV5F 1JXLA 2W2PP 1UA0A 4QIEA 1WEXA 4HLBA 4ANDA 3BGRB 4B9LA 5L1LA 4Y00A 1FWPA 4GC7A 3OR2B 3W60A 4HHUA 4X62F 6FDRA 4ZVPB 2CDQA 3DRXA 1VFJA 3OT9A 5FLXU 2G2ZA 1RA7A 3HD2A 2C2RA 3VAGA 3D6TB 1R3NA 3OXFA 1J27A 4I1TA 5ETLA 2FLLA 4OI6A 2HMIB 2G0CA 3I56S 4W90B 2C22A 3V5RA 1NZ8A 5K8MA 1RACB 3NG8A 1BWVA 4MIWA 1M5VC 1U1KA 3BH6B 1S77D 3KLFA 4RW9A 4F3QA 3R5DA 4EO8A 4M94A 1FKOA 3FSIA 1QSSA 5J2MA 1UZDA 2GVDB 3WIUA 2R2SA 2AIRB 2IAJA 1TKTA 1HQEA 2XSJB 2GCFA 2CG4A 1IKXB 1R31A 2M70A 1N4LA 2YX4A 4DV1J 2Z56B 5ETTA 5K8PA 4ZVGA 4UTGA 2ZH1A 4OYIA 2QJ3A 4TYAA 1Y11A 1F5AA 3VALA 4WZQA 2FY1A 1U1RA 1RUSA 1KS2A 3MTKA 2HLUA 2YKQA 5BYRA 3AA9A 3AA8A 1RZMA 5ETSA 4I2QB 3PM9A 4P73A 1JB0C 2KHDA 2IYGA 2R8KA 4NLYA 2DIUA 3BB5A 1ZETA 5KOXA 4O44A 3D5MA 1RT5B 2NSBA 2I6WA 2LU2A 3UPFA 2APOA 2FJVA 1SIWB 2ZH9A 4RUAA 3EXCX 4OZLA 4DPTA 3CMAS 1H2TZ 3OHAA 2PI5A 4USHA 2M8HA 1GNKA 2VDHA 1FESA 1M5SA 1FJGJ 1M1GA 2FC8A 1S1TB 2K06A 4DSIA 5AE3A 2HVHA 1S6PB 1V5VA 3GZ7A 3CCMS 5A76A 2MY8A 2GW8A 1ZTTA 3OTOF 3UNGC 2P6TA 4TQSA 1SKSA 1NK7A 4JI3F 2PC6A 5DGBA 1XC9A 5EWFA 4PG7A 1XNQJ 4B3RJ 1J5OB 4C48A 1DARA 2OTLS 1FX4A 3N01A 3ETOA 1D9DA 4LF5F 2OEMA 1UJ5A 4F0KA 1Y10A 2ZNYA 3ZTPA 4M8LA 4WYLA 2DNOA 2CIMA 1U1MA 4I6AA 1N32J 5DLFA 1O51A 3CWJA 4L3NA 4ZPWR 3C6TB 4LVOP 2VC1A 5DZ7A 1TP7A 1GEHA 3QATA 1Q4RA 5AJ3F 2BJ9A 1M5KC 1T94A 3OR1B 4NLTA 4JI1F 3I5AA 3PX4A 3BGOP 1V3RA 4Z2XA 4IKAA 4QR0A 2M2BA 2V8GA 4USUA 3NGTA 5KAKA 5L8RC 5D3GB 2PE8A 2FZCB 4ES3A 4L76A 3DRRB 3OV7A 1HNXF 1RQ0A 3G82A 4O0IA 5C5JA 1YJUA 2SXLA 2DHSA 4OX7A 4YB1P 3LP1B 2H1YA 1PCAA 5J2NB 2IM2A 2RS2A 3K0JA 1TTHB 1V3SA 1G3OA 4OYBA 5F9LA 3RAQA 2E1CA 2ACYA 1VIXA 2L9NA 1O6XA 4C4WA 2ZBCA 2EC2A 3NBPB 4C11A 2RUSA 3HULA 1VK3A 4QYZJ 2CVEA 5C25B 1TKXB 3X3UA 5IT9U 2EPIA 1UZHA 1FRJA 2NXCA 1WG1A 4IG0A 5T41A 1Z4UA 1S59A 1HARA 2QFJA 5E33A 1RT2B 2B6AA 2BE2B 1CPZA 2A6OA 2JC1A 3Q8PB 1VQ8S 2NZ4A 4DR4J 3O3LA 4KGVB 3Q22A 1UKUA 1DQAA 4USWA 3EDRB 2AHOB 1J5EJ 1U02A 4DV5J 4ED4A 3SDEB 3MAAB 4LIWA 4FBUA 5D78A 2LEAA 2CQ3A 4WFXA 5KFIA 1P9YA 3MD1A 1FT8A 3CIMA 2HQCA 2IMOA 3GFHA 3MEGA 3BYPA 3UQSA 2J0QD 5M2PA 5B0BA 1WHYA 3QRQA 3D0IE 4KY3A 2IVYA 5MLCV 2UP1A 1T03B 4F4AA 2FZKB 4RUHA 4U8YA 5KFFA 4LF1A 2ZH2A 2OPRB 3SFUA 3DGPA 3F73A 4ZLNA 2KM8C 3V6DB 2CPJA 2LQJA 1SUQA 2DNYA 1UVNA 4OI2A 1JWWA 3CCES 3CJ0A 4JI6F 5LXRA 4RW8B 4J9KA 3CC2S 4PXDA 5F8HA 2VQFJ 2XY7A 4WKYA 4O3NA 1JLFB 2JZ5A 4PG6A 5G0RB 1U49A 2O1PA 3C3LA 2Y1JA 3CD0A 4CM0A 4J9SA 4ECXA 2XULA 2AQ4A 1S6OA 2V2KA 4ED3A 3OBIA 1FRIA 3LA0A 3O6QA 3PX0A 4XPCA 3KDNA 2MZRA 4ECQA 4QWCA 9RUBA 4URSA 3M30A 3F0NA 4CYUB 4X2BA 1SB6A 4JI2J 4ZVRB 4KGXB 2F9DA 1RWNB 2CVIA 4E0DA 3D7SB 3I55S 4DX7A 2XNQA 5CYMB 4B3MF 3NGRA 4M95A 3NCRA 4A8YA 2ZOFA 2WB4A 2BM1A 4MKVA 4FYWB 2LQ5A 1RB0A 1D9AA 1C1BA 1HWUA 4DR2J 1Z2ZA 4QWBA 2KM8B 1Q7YT 4I0WA 2EFOA 4UOGA 4P75A 5LM7E 3DGVA 5D6GA 1VHIA 4I68A 3EMTA 1SL1A 4ECWA 1IBCB 4LRAA 5H1SV 1VBZA 3PW2A 2Z8QA 4IYQA 2XC9A 5GAGU 4ZITA 3WIVA 4P2XA 3D6FB 2E5LJ 3N6NA 1KWMA 2MKKA 1WC3A 1R27B 5L39A 1U24A 4ZDNA 3HCXA 4J7CA 3KG0A 2YX7A 3PY8A 2OEKA 2ZHBA 3BGUA 1KRPA 3DLGB 1WTBA 3SQGA 1U48A 1F6TA 3KK2A 2GQQA 3TOQA 2XB2D 4NLOA 1S6UA 2F8EX 4DG1A 3OHBA 3M8YA 5ETQA 2Q6BA 2IA6A 2MLZA 2XWXA 3L09A 2B56A 1IVZA 4O3PA 4IFVA 2LXFA 3ISNC 1HHQA 3MM5B 5KFAA 2DNPA 1X7VA 2PIIA 1YZ6A 4KT0C 1U1LA 2GV1A 3ETMA 2WBRA 2AEJA 1REVB 3CULA 4O23A 5HQ8A 1KQKA 4BWJA 3KK3A 3G6ES 3HPOA 1VRTA 2AJ4A 2BRLA 4ZCMA 2F4VJ 2VJUA 2HLTA 2WOMB 4NA2A 5K20B 2QX0A 3ILOA 1IJFB 3DU5A 5ETMA 4EBEA 3A13A 2R7OA 3AODA 3NY0A 1EB0A 1ZBTA 3VHQA 3VCDA 2GS8A 4Z37A 3GIRA 3MMCB 1YITS 1A7GE 2HS3A 4F25A 1F2GA 2AZ1A 2GGPA 2E7VA 3A4TA 3MMBA 2R8JA 4L74A 3UDVA 3LGHA 3G87A 3BDPA 4P2SA 3MF5A 3D2WA 2ALYB 2RDDA 4I69A 3MR2A 4C97A 5A2QU 3LTOA 3FBCA 3AT1B 1MSWD 2CJQA 4K4YA 4R8UA 1FJEB 5L38A 1OYDA 1TFYA 1PKUA 3UCZP 1YG0A 4WIIA 1RT4A 3JQJA 3EYZA 4LRBA 2E66A 2DY1A 1EKRA 5D4LA 3BYRA 2JNJA 1NK6A 1BQMB 3ENWA 3Q2SC 1TK8A 2FHOB 4K50A 4UOHA 2Z30B 2IBOA 4RW7B 3FSXA 2OD6A 5D15A 4OYZA 1NU4A 3JS9A 3SV4A 5KFLA 3RB4A 1JK9B 1CJVB 2GO9A 4CM2A 2CJAA 2UV8G 2CPEA 4GO5X 2YKNB 2PGCA 1FE0A 1NDLA 2UVWA 4C6AA 5IOLA 2J5AA 1N5TA 1YRTA 4JI7J 2FQQB 2LP4A 3VVUA 4RNMA 1TL7A 3KLEA 3K5NA 1AZSA 1W7WA 3DOMA 2WW4A 1LWCB 2HHVA 1Q8LA 1T9UA 1Y7PA 3CO9A 4DV1F 1CC7A 2DH8A 2GJFA 2ZH6A 2MTLA 2XLJA 4JYAJ 5GMEA 3QLHB 3GJRB 4LMZA 1Q16B 3EVOA 5L9XA 3S8SA 1WORA 3ELHA 2J8AA 4NCGA 4PKDB 3B78A 3T1YJ 2YWWA 1T9TA 1FE4A 1H6KX 4ZLJA 2XLKA 3W66A 4DV6J 3TAMA 1IKYB 4KE5A 3VGVA 2B43A 1C0UB 5KFTA 3RBEA 3MMAB 1EETB 2MLYA 2CQ0A 1KC8T 2HHUA 1RHQB 4I7FA 1S6QB 2WVDA 2OPSB 1S0NA 2VH7A 2Y1LB 1AA1B 1FJGF 4FXWA 1BQNB 2AU0A 5F3ZA 2CQIA 2W8LA 2XMWA 3T5KA 4AD6A 3TUJC 3VGSA 1RYSA 4Y6IA 1XNQF 4B3RF 2DR6A 4CI0B 2CQ2A 3GU0A 2ROGA 1TL5A 3VF0B 4QU6A 4XIUA 1EP4B 3DLEA 2V6AA 4ZJOA 3GIJA 1D0EA 2EKYA 2NYHA 3W7BA 2WAQD 2AEMA 3Q8SB 4YEAA 1FXDA 4C7QA 1N32F 3WBZA 5KG5A 2VPWB 2MEWA 1LW2B 4PQUA 2HYIB 2I9SA 2QLJB 2AYEA 3D66A 3QIDA 2YY3A 1HW9A 3VVTA 4ZVOB 1Q5YA 1XERA 1JLAA 2MLXA 3QT7A 1CJTA 5IM0A 1L3VA 3J7ZT 2O66A 1U25A 3MEDB 5KFNA 3BJYA 2LECA 2B5JA 4TNOA 3IBCB 1BGXT 2ZBIA 1TMMA 2C28A 5HMZA 1VC0A 3TI0A 2L08A 4K0KJ 4A4JA 1KONA 2L3MA 3UNYA 1SQEA 3LP0B 1GMUA 3GG0A 1RAEB 5LSRA 4FP9A 3R2DJ 4F0HA 2BJ3A 2P5VA 3CUNA 1X5SA 1KBRA 1NDPA 3O2IA 2H51B 3VQTA 5CD4A 1VQKS 2IYIA 4TKTA 5B0AA 2ZD1B 4RNHA 2R7XA 2XS7A 1AUDA 2CPDA 2XBPA 2BJ1A 3K2YA 2BQRA 2HKEA 1RLCL 1T02A 4K5RA 1S1UB 1V6HA 4KHMA 2VPXB 4DX6A 4F02A 4DR4F 5B0EA 4X4OA 1IKWB 2VA2A 4G1PA 2XY5A 1Q5VA 3CCSS 1J5EF 4DV5F 1QE1A 1G2EA 3OFGA 3CJ4A 4DR5J 5KFZA 2DJWA 1ZTWA 3K8VA 3FFIA 1NK5A 2A1BA 1NHVA 1B70B 3KJVA 2A3JA 2BRKA 3N4WA 2FY8A 2VODA 2FIUA 5A0YA 2XI2A 5FIIA 3NMAA 5K8NA 4CT8A 2HIYA 2ZBPA 2RT3A 2XGQA 4NA1A 2RVJA 2N3LA 3OVAA 1I3OB 3EX7B 2D74B 1PILA 2FJDB 1I5OB 2ZOMA 1SKRA 4M5HA 3BO2A 5E3CA 2NREA 1DFDA 1TR0A 5LXYA 3MOZA 4CT9A 4P10A 5HAOA 4KIAA 2JH3A 1HBOB 2B9YA 4OX9J 2VQFF 1NB2A 3LPYA 3GPAA 1XMOJ 3MEEB 4MT1A 2E5JA 5I3UA 3VV2B 2DBBA 2V8PA 1K9MT 4LBHA 5GADI 5CYQB 5F9NA 2A10A 2HW3A 3B54A 4Y2IA 1PBUA 4PR6A 2OD4A 4DR1J 4HTJA 2ZKUA 1X0PA 3SEOA 3C14A 1F9FA 3BM7A 3K57A 3QJPA 2EI5A 5GADU 4QIFA 4JI2F 5J2QA 2DHAA 3L4BC 1SC4B 1RKIA 5IQQA 4MKYA 2V8DA 3ZNJ1 5DDOC 3K8WA 3MAHA 4ZKAA 2MQOA 4H4MB 3H59A 2Y0BB 2QLWA 3HT0A 3D3CJ 4CP5A 4LQ9A 4LSNA 1JKHA 4U7UK 4A8MP 2K1RA 2HNYB 3U1MA 2JJ4D 1PJ5A 4DPUA 4FYXB 8ATCB 4DR2F 1U1OA 3CDUA 4FYVB 5HI7A 3RU0A 2K2PA 1GX6A 3IS9B 5RUBA 2IBKA 4ZN3A 4BDPA 5HJXA 1N56A 2HFVA 2ZUAA 3GG1A 3M8RA 4OHXA 2UUAJ 2DCLA 1KSPA 4OJGA 4ILRA 3DOKB 2E5LF 4D3HA 7AT1B 3OSNA 5D0EA 1CJKA 4DZDA 2V4JA 4NEYA 4HACA 4A8QA 1HNIA 3KJQB 4WU2A 4C2MA 2IVMA 1TAQA 1LW0A 1V3ZA 2XHCA 2D9OA 1M90T 4FVCA 5LSOA 2KXFA 1DTTB 5MAOA 3MR3A 4XTTA 2XMAA 1IXKA 4ZJLA 3CPWR 3GQCA 2Q1LA 4P6QA 3OJSA 3PEHA 4DJBA 5ETRA 1VS3A 2QLFB 2BM0A 1N8RT 2GVZA 2KHCA 5KFVA 1RTZA 4C9DA 3KJFB 1O8BA 4DL7A 1N34J 2YKMA 2RSQA 1RT3A 2JVOA 2NXEA 2JOQA 4MK7A 2F4VF 4DFPA 4ECVA 1HQUB 5KFBA 1ZAXA 4KH1B 2VG5A 3E2EA 4C0OC 4BLGA 3CCQS 2LU1A 2VL1A 2V4RA 2CQGA 4ECZA 3TZZA 3LANA 2AEFA 1MWZA 2MHEA 3BSAA 5KG0A 4M5IA 5I42B 3H4DA 3HDSA 2K3IA 3KUEA 4X4UA 3KLIB 2PMWA 2DGXA 4OHWA 1N5YA 3K58A 1P1LA 2KFZA 3FZBA 4DPYA 4CDIA 3I9V9 3LWLA 2XCAA 1KP6A 1KTVA 2DGQA 4DR3J 1JLQA 3A8JA 4HDGA 3R1LA 3OL9A 4X4NA 4IH6A 2FJAB 2IRYA 4GKJJ 2DGOA 4M5GA 1RJJA 4AL7A 5KG4A 1W26A 3EVWA 1FERA 2XCPA 2QGFB 3D1QA 5KFRA 3TUZC 4AUKA 4ANCA 5A8RA 4DQSA 4IH5A 3HHKA 3FQLA 4ED2A 4C8YA 4OJ3A 2FGOA 1LOUA 3W2WB 1UEUA 1WKLA 3EE3A 1U47A 2UU9J 2Y3YA 2RAQA 2AX1A 5D0RA 3TX8A 4B02A 2OPPB 4A8WA 2A0FB 3V6KA 3CCLS 1P8GA 1CLFA 1HBNA 2B7BB 3RAMA 3QAUA 2VONA 4ZPCA 3VAKA 1D8ZA 4TVAB 4IG3B 2XGPA 4MK9A 3Q8UA 4JI7F 3F41A 2KI2A 3ENVA 4LF6J 4DFJA 4BBYA 3GR0A 4LF8J 3R2CJ 3AXKA 1JLGB 1UJ4A 3DN9A 1N48A 4JYAF 3CEDA 2DXEA 2P6SA 2Z2LA 3GTYX 5DQIA 1LFWA 3A3OB 1NDKA 4YY3J 4Y2MA 3T1YF 3HSGA 9ATCB 2FD2A 8RUCA 1X8DA 1HD1A 2VD3A 1CS4A 2F8MA 4DV6F 4LR7A 4PQAA 2ZKTA 2WVFA 3TAQA 3HVTA 3G6YA 2POKA 4NLUA 2FC9A 1ACMB 2BW7A 2VFSA 2QYGA 4QIVA 5KFEA 4DV4J 2H5JB 2CKWA 4J37A 2GMHA 3ZFVA 1KQSR 1GXUA 4QIGA 4ZCLA 4MK8A 1WHXA 2V0NA 4MKBA 4O4GA 4ZP8A 1X0FA 1RTHB 5IT4A 2AJ1A 3D6MB 2C42A 3HHLB 1TUVA 4BC7A 2YNIA 1MROB 3BREA 2YNGB 4F3OA 4JI8J 2VPZB 2VU5A 3O44A 3IM9A 4DL5A 1L3UA 4YS2A 2RF2A 3I6PA 3E01B 2CUYA 3TR5A 1K44A 4UY8T 4NWBA 3QPIA 5DDQC 1K1QA 5FDLA 5B0DA 4USTA 2J0SD 2EWHA 1I6JA 4DF4A 2CJYB 1HWLA 3RW7A 2GC8A 2IC3B 2DD8S 2J0WA 1GT8A 1N5VA 3IBFB 1YZ7A 3MFHA 4GVLA 1F9EB 5T7LA 1IR2A 4W98A 4RW6B 2A18A 1ICEB 2UXDJ 4RW4B 1LWFA 1QAYA 3D3BJ 3BS9A 4WPAA 1NH8A 1LNQA 3V4IB 3R6LB 3QSIA 2HVIA 4KGMA 1WNEA 2HWIA 3L7OA 5IV3A 4K4WA 3H25A 1GH8A 1RLDA 3KFWX 1LQ9A 1DQ8A 3M6VA 1QAJA 3C66A 1VRUA 3PW4A 4LF7J 1T05B 1NJXA 1NHUA 3FZ2A 3M8ZA 3DHXA 4TY8A 1OPIA 4ED1A 4P2MA 1ZOTA 1JLCB 4DX5A 2ZDOA 2KT5A 3IN5A 4K0KF 1QAIA 4FF1A 2VG6B 2XNRA 3DRPA 1WTFA 2D3O1 1RTDB 2XMMA 2E7XA 3K7RA 4ZPAA 3R5BA 4DCOB 2N82B 3PHTA 2MKYA 2D9PA 1SV5B 1FKAF 4KV8A 2Z57B 3KK1A 1NAQA 3OD2A 3Q8QB 1YJ9S 3MM7A 3L9ZA 2F40A 1NSAA 3IA0A 5IV4A 5JUMA 3MM9A 1OQ3A 1ZM2A 2QA4S 1OQ6A 2VFUA 5KFYA 1YHQS 4P2FA 4P72A 2PSZA 1H7XA 1PO6A 1NPKA 3NCPA 3JTNA 4IOBA 4KO0A 4PG4A 2B8PA 2C3YA 3R5CA 1FRHA 3RAXA 4DI6A 4USMA 3M4XA 2K8GA 4OHVA 2JHEA 3CCJS 2JWNA 4K4VA 4DR5F 1SXLA 1SKWA 3IXQA 3ZTRA 4OL8A 1QUPA 4A8KA 3GILA 2E5IA 1RTIB 2GJIA 5KFHA 3KLFB 1JQGA 4RW9B 2AYBA 1T9VA 5F8JA 2NXUA 1RAHB 1IWAA 1FKOB 2HFZA 4ZVTB 5J2MB 1R0BG 3D1OA 3F56A 4IFYA 1VQNS 6FD1A 2IAJB 1TKTB 1HQEB 3ZZPA 3QYYA 2G2OA 1FI4A 1REGX 1U8WA 1UP1A 2C2KB 4USVA 3KNAA 1WACA 3HF5A 2UV8A 4PYDA 3TYTA 4ZOSA 1U0SA 5F8MA 3DU6A 5G4DA 4K4XA 3EWGA 3HVAA 4OX9F 2BOPA 1GXLA 4RU9A 1XMOF 3C15A 2BQUA 4GVBA 4FDFA 3PDNA 7FDRA 2DR8A 2ZJQQ 4AQYJ 3FJ2A 2HNDA 1T7PA 1DAXA 1R8AA 4DR1F 2RHQB 4YHHJ 1XJWB 4DOZA 4O44B 4AYBD 4R5PA 1GMWD 1S9EA 1ZZNA 3ITHA 1X4AA 2MDAA 1F0XA 4J9NA 2DO0A 4TU7A 3IGNA 3I0SA 4RL1A 3N6MA 1N54B 5KFCA 3AD8C 2BANB 3D9BA 3SQOP 2PN6A 2LDYA 4MH8A 4PAAA 4CLLA 3QAEA 2V5HG 4FPRA 1WOSA 3THPA 4OFZA 2KDOA 2MSTA 1YI2S 2W2NP 2ZZTA 3Q23A 3W9JA 1EARA 3NWGA 1U6FA 4N7TA 3EICA 2DRDA 2ZHOA 3VQSA 4M5NA 1X4FA 2HWTA 1TL1A 2KB2A 3FCHA 2XZTB 1UFWA 4KJIA 3MR6A 2NLWA 3GE9A 4ILMA 1M5HA 1P27B 3GFZA 3GB0A 1WI6A 2UUAF 1TU0B 2QRRA 2V50A 5I3PA 4WK3A 4PRFA 4UUXA 1QAXA 1X4BA 1B7FA 4DN9A 1C4CA 2QA2A 2V2ZA 5C2GA 2CNLB 1FFWB 3CCTA 3AAWB 4N8NA 1QD1A 4OI4A 3T5HA 2GVDA 1RKJA 4Y2CA 1Q53A 1OWXA 3G82B 2XSJA 4OHZA 1IKXA 1ELOA 1ZA1B 4BHQA 3QT5A 1W2IA 4QR2A 4YP3A 3ILJA 2FB0A 1OJ4A 3I4HX 3IGVA 3PW5A 4ZS6A 3NGDA 2WSFC 3MPDA 3VGUA 1N34F 4C11B 1RAAB 2QSWA 4NZ0A 3G8QA 5AXKA 2WVBA 2RE1A 5KFKA 1XMQJ 4IG0B 2HHPA 1B0PA 2EK1A 2RNEA 3PX6A 3GP9A 2C3OA 4QQBA 2GJ2A 1VQ5S 1T95A 2HQGA 5LMNJ 4DV7J 2GZOA 3BBBA 2FVRA 3BO4A 2RKIA 3GIKA 3QRPA 4DS5A 4LJMA 2HHHJ 2H65B 2XG8A 2QL5B 2EG1A 2DNQA 3DLHA 4IOCQ 1DZ5A 1JJHA 2HWHA 5CA5A 3UCUP 2C2ZB 2DNKA 4WBFA 5B0GA 5J1NA 4I64A 2HHSA 1RHKB 3IRWP 5DJBA 3HZEA 1RTJA 5B0FA 4DLGA 1OMSA 4DR3F 1NSPA 1VDHA 1HI1A 1QTNB 3BZQA 4CLSA 2XMJA 2YPZA 2V8VA 2QIFA 4NRTA 4GKJF 1XNRJ 1RK8A 3FNNA 4K5SA 1HIYA 2CNKB 2HGNA 2KVIA 4HI2A 4C8MA 4LFAJ 2QEXS 1CJUA 4JV2A 2KL8A 1PC5A 5F0UA 3WX8A 2BE7D 4ZPTR 2X1GA 3DGPB 4ED5A 4Z7CA 4QCLA 2JVRA 3RRHA 3EXYA 2UU9F 1SUQB 4EZ9A 1VBYA 4LVNP 2FLNA 3BGLA 3X1LB 1H73A 5I4MA 4FBTA 4KHRA 1NSKL 1KHVA 4RBTA 4PPDA 5HBMB 4F2RA 3Q8RB 3MZIA 4J9UE 4KBIA 3DLBA 5DDPC 1G4CA 2BDPA 2D1CA 3ET6A 1VBXA 3OLAA 5DDRC 2WZ1A 5D3GA 3K5MA 5GMDA 2LYVA 1FK9A 4ZIVA 2WK4A 3HKZD 1YBTA 4LF6F 5DG8A 4ID5A 1N0VC 4LF8F 3IAM9 2BX6A 3A1YG 4TYBA 4EGLA 1YJVA 4G6VB 2RH3A 1NNDA 2FUG9 2BYCA 3LGNA 3G9CA 2K7KA 4OZJA 4NZ6A 4YY3F 2V4QA 3QZ8A 1LFPA 3SIPB 3IG1A 1VCTA 5GAHI 4PWDA 4N76A 2ZZNA 1U8SA 5E3QA 3JTPA 1SBRA 1WELA 1HWJA 2GA7A 4LRCA 1LWXA 4DQRA 1YTYA 2ADCA 3CJKB 3KMQA 1U26A 5C7PA 5KOWA 4M63A 1C1BB 1D9FA 1FTRA 2LKZA 1VMBA 4DV4F 3HHLD 4K4ZA 2Z2MA 5D0GA 1RT2A 1YDLA 5GAHU 2UZAA 3CDBA 1CQMA 2R9LA 1HHSA 1VQSA 2KXNB 3HJFA 4TLRA 3PIOQ 2MSSA 3B4DA 4ECUA 2V9WA 4CH1A 4WFYA 2GO8A 3SDEA 4S0MA 3I32A 1Q82T 4JI8F 2YWKA 1R6VA 5KFUA 1Y0HA 4ZN1A 2VFTA 3PEJA 2H5IB 4F2SA 3A8KA 1S4EA 3GV8B 2CG8A 3SQGB 2MZ1A 3CT9A 4ES2A 1C1CB 3KK2B 4UT4A 4OZ1A 4QPTA 4WK1A 2ZEJA 1EQ0A 4DG1B 1MG7A 1HL6A 4ELUA 4KTQA 2H54B 4FXDA 4ZCKA 3PRDA 2V8HA 2KT3A 2BQ3A 1EKSA 3RB0A 1B3TA 3QGPA 2UXDF 1TAUA 3A8EA 3NLCA 2PFFB 1VR6A 1MNEA 3JSRA 2LLZA 2XMVA 3KK3B 2ZBRA 2WVCA 3CGIA 3NKYA 2D41A 4WZMA 2Y9HA 1C4AA 5E5NA 3CCUS 3E51A 1WF0A 4H4OA 4LF7F 5G0RA 1SVDA 4U95A 4F4YA 1CSJA 4L75A 1Q7LB 1YRUA 3GYGA 4J91A 4K4TA 2C3PA 1S57A 3LWMA 3RB3A 4JOUA 1BXNA 2ZJPQ 2KZZA 2WTFA 4DQPA 1CQNA 3MCNA 4F4XA 2BA9A 4Q5VA 1QVFR 3CVKA 2GGPB 4EZ6A 2CYYA 1WJ9A 4L3KA 3MUVP 5KG1A 5LJ5Y 2HG4A 1ZH5A 3C16B 3SFGA 1EHWA 2M7SA 3N5BA 2M3DA 2MGZA 2PT0A 1HW8A 1RWOB 2WBMA 3RRKA 5EX0A 3MFIA 2E1MC 4YFUA 4EWTA 4RKUC 2ERRA 4ELVA 1RT1A 5HQMA 3PO5A 3HSJA 3PCOB 3H2LA 3M2VA 5DETA 2CFXA 4I4BA 4R8UB 3SSSA 3P4UB 2BUNA 4U7CA 1RWKB 1RA6A 3EZUA 1TV6A 1XWLA 1FFSB 2R4FA 3OUYB 2GMLA 3R1HA 1RT4B 1SQGA 1PJ7A 4RBUA 2WONA 3VR1A 4PPZA 3A3NB 5E3PA 4Y28C 1LK7A 4P7TA 3NMRA 1YGYA 2HQIA 5EWEA 2KJVA 4FKXA 1AROP 3QFHA 4Q2MA 2NPIA 3O1LA 1WOPA 3V2UC 3UDEA 1FA0A 2NUHA 5HN0A 4WWSA 2MQ8A 1EX8A 2CPFA 1TL7B 3KLEB 5J1PA 1AZSB 3DOMB 4DUYF 3BO3A 3FBBA 1JX4A 3G71S 1XR7A 1N5QA 5A8WB 4J9QA 1JLBB 1U0HB 4DWIA 1IM4A 4A8XA 2R2RA 3ZZUA 3BF4A 4DL3A 2JRSA 1SPBP 4NCGB 4XDCA 1FDNA 2ZH8A 4PXCA 4NL5A 4IH7A 4OI3A 1HYSB 2QTWA 3W8GA 2DT9A 4JP8A 3TAMB 1S0VA 4RPFA 1MN9A 2BEFA 3P96A 4K2XA 2CJBA 1F5BA 1X4GA 4AQYF 2WOMA 4USJC 2WW8A 4WP9A 3EVMA 3TEGA 3MDFA 4YHHF 3OTCA 4M5KA 1XEZA 2FDNA 3QJJA 3T5JA 3IR6B 4LRDA 3M7VA 1KNZA 2Z0GA 2JL9A 3HVRA 1F3VA 1S9GA 5CXTA 2UUTA 3T5LA 2HBRB 5IXUA 4OHYA 1RISA 1DY3A 4CRJA 4L6V3 5CZXA 1T9YA 4IO1A
chains in the Genus database with same CATH topology
5B0EA 4Q8EA 4X4OA 1IKWB 1TV6B 2VA2A 4G1PA 4QWDA 2XY5A 2ALZA 3CCSS 2PDAA 2HNYA 4MIAA 1J5EF 2AJ0A 3POTB 1WHWA 2MZQA 4XPEA 3PO4A 1LXJA 4DV5F 3RB6A 2BV3A 2ASJA 1QE1A 2WONB 4B9NA 1G2EA 3GFXA 3VZHA 3OFGA 3CJ4A 4X66F 1NKBA 2DO4A 5J2PB 3Q24A 1XK8A 3IWNC 4HDHA 5KFZA 3TQ1A 1FXLA 2ZM6F 1FJ7A 3BN7A 3QMQA 2AWZA 4AFFA 4IQXA 2DJWA 5KTQA 1ZTWA 2AGOA 3N5FA 2R7QA 3K8VA 3FFIA 5AXLA 2AV5A 5A8RB 5K8OA 1VK8A 3DMJB 1NK5A 3M8PB 1H38A 2ABYA 2A1BA 1NHVA 3GFYA 2BJDA 1X9SA 1S10A 3J7Z5 4WFZA 3KJVA 2N4DA 1VHFA 2A3JA 2D3ZA 3M2RA 2BRKA 3N4WA 3IC1A 1F60B 1U2FA 4DL4A 2XS5A 4NLWA 3UE2A 2EG2A 5ADZA 4PQUB 4X4TA 2J6TA 2BZ2A 2O01C 3H5YA 1C1CA 1VQ9S 2J76E 4QWEA 2VODA 3I9ZA 4J5OA 1UETA 4OLOA 3CSKA 3DOKA 3Q0AA 2FIUA 4C8NA 3IFEA 4U9RA 2F3JA 3G6VA 5A0YA 3M9OB 2ZDPA 1T3NA 2E9ZA 2XI2A 1YBAA 5FIIA 3G96A 3NMAA 5K8NA 4CT8A 5KFDA 1S9FA 4DSLA 3BR8A 1FEHA 1X4EA 3T3FA 5BYQA 2RT3A 2XGQA 4NA1A 1HNVA 5M2RA 2RVJA 2N3LA 1DTQA 3OVAA 4YDXA 3EX7B 4TXSA 2YQ3A 1R8BA 2E5HA 3UDCA 2D74B 3H98A 4ICLB 3CC7S 3ZZZA 1PILA 3DNCA 4C3LA 2FJDB 4WFNQ 4X4PA 1FVSA 2B5JB 4ERDA 4LFBF 4CIOA 4XK8C 2ZOMA 1SKRA 3BO2A 4Q0BA 5E3CA 3M05A 2X1AA 2NREA 1DFDA 1TR0A 2MQMA 5LXYA 2E7WA 3MOZA 2EBEA 3FRYA 3CCZA 3MD3A 4CT9A 4PXBA 3K5PA 3M6WA 2YWEA 3KLVA 2CZ4A 4OV1A 3GMGA 3I82A 1UAWA 4B9SA 4AXIA 4KIAA 2JH3A 5KFMA 2B4PA 3DC2A 4HT7A 1FHTA 1N6QA 1HBOB 2RRNA 2B9YA 2VQFF 4EBDA 1OSCA 1R8PA 1RT7A 1YWXA 1TL3B 3LPYA 3E8OA 4EEYA 3MEEB 2HGMA 2E5JA 5I3UA 1IJEB 4HI1A 4ZHRB 2DBBA 1K9MT 3DLKB 5GADI 3VAHA 4NLVA 4XAKA 5CYQB 5F9NA 4KHPF 2A10A 5LSLA 3L95X 4H4KC 2VOPA 3QLHA 4Y2IA 2HW3A 2KXHA 3DLJA 4J9PA 3DI6B 3QZ7A 4DQIA 2G9OA 4PR6A 5HLFA 2OD4A 3GYNA 4HTJA 2VG7B 2L41A 5DG7A 1X5TA 3FEYB 3OFFA 4B17A 1RAJA 4QWAA 4MAKA 4QPXA 2ZKUA 1X0PA 2M4MA 3SEOA 1S97A 1F9FA 3LW5C 1WWHA 4DSJA 2KFNA 3JYTB 3NS5A 4FF2A 2MJNA 3PKMA 2DVIA 5FD1A 3BM7A 1MW7A 5AE2A 1VJWA 3K57A 2UXCF 1NJIT 1P6TA 3QJPA 2EI5A 5GADU 1HQUA 4QIFA 4JI2F 5J2QA 3DYAB 2VKZG 3DXBA 1S9GB 2QLXA 2DHAA 5KFPA 1X5OA 3TUIC 1XMQF 5KFGA 1UVIA 1S76D 2P9EA 3THTA 3UCGA 4BWMA 1RKIA 5IQQA 1XR5A 2JLFA 4NLPA 2QYCA 4MKYA 1H2VZ 3NP5A 2JEJA 1ZZFA 2V8DA 3DRSA 5LMNF 4DV7F 3MWBA 3M2UB 4Y0FA 2XI3A 5DDOC 3N6LA 1N5SA 1H3DA 2AP6A 3K8WA 4O4GB 3MAHA 3GR1A 3PJWA 4ZKAA 3FGVA 2MQOA 4H4MB 4N77A 2ASLA 2WRMA 3H59A 4ECRA 4WCEQ 3SCJE 2NR0A 2QLWA 3KYLA 5D4NA 3ZZ0A 4MIBA 4LQ9A 2X3GA 5I42A 4LSNA 4O4RA 4RBVA 5K14A 3BQ1A 1JKHA 4X4QA 4A8SA 2HHHF 4U7UK 4FVMA 2MY7A 5F0WA 3MAQA 4A8MP 2K1RA 2HNYB 3U1MA 4ECTA 3KLIA 1JMTA 1E6VA 2CQ1A 2JJ4D 2RUGA 1WF1A 3TA2A 4NLQA 2OFGX 2LDIA 1QE1B 2FHMA 1R89A 4ZK7M 4BS2A 4DR2F 3JAMY 3VWSA 5F8NA 1U1OA 2ZC3A 2EVZA 2IHR1 1WG4A 2EFPA 5IT0A 3D1HA 3CDUA 4TU9A 2EW9A 3TA0A 2YTCA 5HI7A 1LWEA 3RU0A 3TA1A 2AGPA 2K2PA 3FFIB 4FZVA 1GX6A 3CCWA 5F8GA 3IS9B 2IBKA 1FNOA 1XN9A 3V6HA 2DITA 3NNAA 3NL0A 4ED6A 4BDPA 3KJVB 2FPHX 1N56A 2FGCA 2JFKA 1TL4A 1R7IA 4Y34A 3GG1A 3M2RB 3SCLE 3OUYA 3LOUA 3M8RA 4OHXA 2DCLA 2AX0A 3E3XA 1U09A 1EP4A 2R8IA 1KSPA 4OJGA 3AQOA 3OTDA 4ILRA 3JB9k 3CB4A 4AE5A 4IRDA 1A9NB 1X4DA 3OTBA 2W4CA 3UR3C 2B3TB 2RRAA 3N79A 1ZYQA 4A8OA 3J81Y 4CZCA 3DOKB 1XNRF 3FRZA 2FHJA 2E5LF 1JNZB 4X4SA 3W3SA 4NYOA 1BY9A 1KQGB 5A0YB 5F8LA 4D3HA 1FRKA 3OSNA 3IR7B 1HNZF 2BXJA 2IM0A 4HVZA 3WZ0A 3MURP 4O3RA 4LFAF 5D8HB 1SH0A 4P7VA 1HNVB 3CJ3A 2V4JA 1NKCA 2DRBA 1HMVA 3W2WA 4QW9A 4A8QA 2ASDA 1F5CA 2XWYA 2ZH7A 3DHWC 1HNIA 2B51A 4WU2A 2IRXA 3R5AA 4C2MA 3NS6A 2LEPA 5E2QA 2IVMA 1TAQA 3EGNA 2VPYB 4OZ0A 1LW0A 2OPPA 2J7KA 2VZ9A 3VTIA 1V3ZA 1NH7A 4ID8A 2PMZD 3N0VA 1B0VA 2D9OA 5DG9A 4YMEA 1M90T 1FTCA 4FVCA 3PFEA 1SI9A 5LSOA 4CQ1A 1V9OA 2O3DA 4IRKA 3C6UA 2KXFA 3RBDA 1DTTB 1AXQA 2YVSA 1N6QB 1K8AT 5DRKA 3T9NA 1RT7B 2VBXA 5MAOA 3MR3A 3KLGA 1RP5A 2HQ3A 3KMSA 1IXKA 2CPIA 2BABA 3CPWR 3CDAA 3GQCA 2Q1LA 1S4FA 4F50A 2IFXA 2AJQA 1HWIA 4G1IA 4P6QA 5A8WA 3OJSA 2W9CA 3PEHA 1JLBA 3H5XA 5I3QA 1QVGR 4ECSA 4IG3A 4PXEA 4DJBA 2I1RA 4CTAA 2DB1A 1VC6A 1VS3A 3P6YC 3HX9A 1N8RT 2BM0A 4LF4F 5F41A 3HK2A 2KHCA 5HLFB 2Y0SD 5KFVA 4C9DA 2YNFA 4CO3A 1Y5NB 4DL7A 1O8BA 2RQ4A 2KN4A 1IQZA 5GAEU 1KLNA 2GQ2A 2YKMA 3NNCA 4CO0A 1HYSA 2DK2A 1RT3A 2RSQA 2JVOA 3EGWB 2V9KA 2JOQA 4OX8A 4MK7A 4UW2A 1UL3A 1JLGA 3TAPA 1WI8A 2VKRA 3UR0A 2OIHA 2JLEA 2VQEF 4DFPA 4ETZA 4ECVA 2F4VF 1HQUB 2G1DA 5KFBA 1GXTA 1ZAXA 1BC6A 3K5OA 1SJ4P 4JV0A 5J2QB 2VG5A 3HHDA 1Y4ZB 2OO4A 3O5TB 5AE1A 3E2EA 4R25A 4KGKA 4C0OC 2DPJA 1VQYA 2L9DA 4KAIA 4MYUA 3TVKA 5IS2A 2OP5A 5A8KA 3CCQS 2YWGA 2ROPA 3DRSB 2LU1A 2VL1A 4GO7X 3PR4A 4Y2KA 1NK9A 4NZ7A 2J9DA 1W2BR 3J7A1 2V4RA 2VUGA 2JEIA 4E8UA 1HBMA 5THWA 3OFEA 4Y2AA 1G6BA 2IVFB 2CQGA 4ECZA 4CNZA 3LANA 5B08A 2ILZA 1MWZA 2NSCA 3OL8A 2MHEA 2P9CA 4RWXA 3BSAA 3KNGA 3OVSA 5KG0A 5IQ6A 5I42B 4LSNB 5K14B 4FXVA 1JKHB 3H4DA 2PEHA 3HDSA 2UVVA 3GSDA 2K3IA 3T9ZA 4A46A 2K1RB 2Y1IA 3OL7A 4X4UA 1LV5A 4YB6A 3KLIB 1E6VB 1LK5A 3LO3A 3BR9A 2QZ8A 3QWUA 5D4PA 3SSRA 3HI9A 5DM6Q 2N7CA 5D77A 2R7RA 2W7PA 5LJ3Y 3CXCR 3I5CA 2DGXA 4OHWA 1N5YA 2UUWA 3K58A 2JC0A 1B64A 1P1LA 2KFZA 3FZBA 4NOHA 4NMLA 3I9V9 3MM6A 4PCQA 5KG3A 3LWLA 3UD3P 2KYZA 2XCAA 4OJ1A 2CPZA 4G1QB 1KD1T 1KTVA 4JUZA 1LWEB 3US5A 3KHLA 2DGQA 1SL0A 4F4KA 1RYRA 1N5YB 1RTHA 3OSPA 2Q6CA 1JLQA 4HDGA 3R1LA 1N36F 4WKRA 1BLUA 3BGRA 5A6WA 3OL9A 4X4NA 2EC0A 3HHLA 4KQZA 1K73T 1MROA 2IA0A 4IH6A 2YNGA 3C2PA 2FJAB 4LF9F 4A47A 4F67A 4Y3CA 2IRYA 5A2QY 3R3TA 1TKDA 5L1JA 3OR2A 5SUHA 1JJ2R 2DGOA 2OJ3A 1IR0A 1RJJA 3AB2B 3BSNA 4AL7A 2P9GA 5KG4A 1FERA 5GVQA 1U4BA 2XCPA 5CCMA 1O0PA 3D1QA 3E01A 5KFRA 3TUZC 1VIOA 4AUKA 3OXGA 2I2YA 5A8RA 4ZVHA 4DDFA 4DQSA 3M8PA 4IH5A 2YX1A 5KG7A 5KG2A 3WC2A 3OW2R 2OMLA 4WFBQ 3HHKA 5L9NA 3FQLA 1X9MA 4ED2A 1DLOA 4C8YA 1X9WA 4OJ3A 1VOMA 2ZC4A 1RWUA 3QGHA 4B9TA 2V4JB 3OQ2A 4ZP9A 1HMVB 2FGOA 1LOUA 1P1TA 3HFKA 3W2WB 3T6BA 3AJ1A 1UEUA 2HMIA 2Q3PA 3D0HE 4NPOA 3MPVA 1HNIB 4OX6A 1U47A 3N9UC 1Y3KA 2HHTA 1HI8A 2EFQA 2AX1A 3MPWA 2IC3A 4NYPA 2HNZB 5EWGA 3TX8A 1LW0B 2OPPB 4ITSA 3UW1A 4B02A 5DO2A 2BACA 1NK0A 2EFGA 2RQCA 5E3AA 4A8WA 1Q1KA 5CYJA 1OSDA 3PV8A 3H40A 3V6KA 1WD6A 3CCLS 2AF6A 1P8GA 3C6UB 1CLFA 1HD0A 3FMWA 4JI0F 3GV7B 2CRLA 1HBNA 2B7BB 3RAMA 3QAUA 4F26A 4RW6A 2VONA 4GC6A 4ZPCA 4RW4A 3KLGB 3VAKA 1D8ZA 1NK4A 2GIRA 4QIWD 2W7AA 4HH0A 3S6EA 1KN6A 4URGA 1QJHA 3V4IA 2FJXA 3KG4A 1SJ1A 3QIPA 4OI1A 4IG3B 1GTEA 2GHPA 4DHVA 4CTAB 5JJBA 4RZRA 2XGPA 2GNKA 3PXGa 3V6JA 2LEBA 2W25A 1KVIA 4MK9A 4OJHA 4C0BA 4JI7F 2E9RX 2Z4PA 1U1QA 2YNFB 3F41A 3I4PA 2JEFA 4DL6A 4WJBA 2KI2A 3S1TA 5CQGA 3GV5B 3ENVA 2MQNA 4DFJA 4TU8A 4BBYA 2YKMB 4Q44A 3ISZA 4K59A 3VAJA 1NKEA 1RT3B 4XO0A 3GR0A 3M9NB 2PI4A 2KRRA 1AW0A 1IUJA 1JLGB 3MEEA 4ED7A 1T05A 1PGZA 1UJ4A 1S48A 3DN9A 4FNIA 1N48A 4DR6F 4JYAF 4ED8A 3CEDA 1R0AA 2P6SA 2Z2LA 4C98A 5DQIA 4RUCA 1LFWA 5K9FA 4DBQA 1JLCA 2I0XA 3PACA 5CCLA 3SCIE 4CNYA 1S1WA 1NJWA 1FRXA 5A8KB 4Y2MA 5CHCB 1FXRA 3KHGA 3T1YF 1U1NA 1S0MA 4DF8A 3K5LA 2VG6A 4AL5A 2FD2A 4RNFA 1X8DA 3BSCA 4RU2A 1G1XA 1HD1A 3T1HF 2VD3A 1HBMB 2F8MA 4HH1A 4I2QA 4YR3A 4DV6F 2FJWA 3H20A 4PQAA 4MKAA 2DTJA 2ZKTA 3TAQA 1RTDA 3HVTA 3IO1A 3G8TA 3G6YA 2MZJA 1GX5A 4EU0A 5AXNA 1TKZB 2K3KA 2POKA 4OQJA 1YQHA 4NLUA 1KFSA 1VLYA 3PNIA 3JSBA 5U47A