1RHUB

Crystal structure of the complex of caspase-3 with a 5,6,7 tricyclic peptidomimetic inhibitor
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
91
structure length
91
Chain Sequence
KIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Caspase-3
publication title Reducing the Peptidyl Features of Caspase-3 Inhibitors: A Structural Analysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 91
sequence length 91
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2003-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1rhuB00
4LSZB 3P4UB 2QL7B 3RJMB 3GJQB 3R6LB 2C2KB 2QL5B 2Y1LB 2HBQB 3R6GB 3NS7B 3D6HB 2XZDB 3R7SB 1QTNB 2XZTB 2C2OB 2H4WB 1SC4B 3QNWB 4JB8B 2C1EB 2XYPB 1RWMB 1RWVB 3D6MB 2CNLB 2CNOB 2QLBB 3KJFB 1I51B 1GFWB 1RHQB 2HBZB 1I3OB 2HBRB 1RWWB 1RWNB 4DCJB 4ZVTB 3SIPB 3GJTB 3IBCB 1RE1B 3R5JB 2CNNB 2H5JB 2HBYB 2FQQB 1RWKB 2DKOB 3P45B 3GJRB 4ZVOB 2CJXB 5IC4B 3IBFB 2XYHB 1RHRB 4ZVQB 1SC3B 2CDRB 2C2MB 2H54B 2CJYB 2QLJB 4ZVUB 2P2CB 1RHUB 3EDRB 4ZVRB 2QLFB 3R7NB 3R7BB 3KJNB 2H65B 1SC1B 2H5IB 3GJSB 4DCPB 1F9EB 3KJQB 1RWXB 1BMQB 2XYGB 3D6FB 1RWOB 5IC6B 1RHJB 5K20B 4DCOB 1NMEB 2CNKB 4ZVPB 1IBCB 1RHKB 2C2ZB 2QL9B 2H48B 1RHMB 2Y0BB 1PYOB 4ZVSB 1RWPB 2H4YB 1PAUB 2H51B 1QDUB 1ICEB 3EDQB
chains in the Genus database with same CATH superfamily
4OHWA 2P8IA 2K7KA 3RBDA 4RL1A 3EM1A 2CQ2A 3V4IA 1DRZA 3ZZUA 1OQ3A 4U95A 1U7LA 3NEKA 3LP1A 1N6QA 2BM0A 4AL5A 4FF2A 2ZNZA 3QNWB 1UVNA 2OMOA 2CZ9A 2BJEA 1NLKL 3MPYA 3I32A 4YHHF 5CQGA 1DURA 3SBMA 3W62A 4DX7A 1FWPA 2HG4A 5I4MA 4E8UA 4QU6A 4IH6A 1SVDA 4ZMMA 4LQ3A 3QT7A 3A1YG 1RAGB 5F8GA 2Q79A 1FA0A 4N76A 3J81U 1R3NA 2QA2A 2WB4A 2ZBCA 2AGQA 2VV5A 2DJWA 3EXYA 2XY5A 1YITS 1HBMA 4LRCA 1RT3A 1YG0A 3HHDA 5C42A 4PWUA 5K8MA 3NMRA 4MKBA 3GIIA 2DR7A 3TAQA 4JI1F 1FK9B 4PRFA 3KHGA 4OYBA 4KH1B 5I3PA 2XM3A 2W4DA 3IGVA 4USTA 2CJAA 2UUTA 3GCXP 2GA7A 2R7TA 1JJCB 1IXKA 3PHEA 1NK6A 3H40A 2W01A 2JRSA 3FKBA 3AT1B 1I3OB 1NKEA 1X7VA 3CNQP 1J27A 2B9EA 3QYYA 4RNHA 4CO0A 2IFXA 1YZ6A 3HVTB 2I5JB 3LANA 5D4OA 1TK0A 4JI1J 3UPFA 1B64A 2Q3PA 3QIPA 1RQ0A 5M2UA 1UPMB 5HANA 5F0WA 3R1HA 3BF4A 2J6TA 1BGXT 4Q44A 3U7JA 1CVJA 4LRBA 3VAIA 2GJ2A 4NPOA 2ALYB 1IVZA 4YFUA 4F7VA 3RAQA 4LIRA 4HEA9 2Z58B 1QAJA 4KIAA 1F9FA 4F36A 4H4OA 4IG0A 2Q1LA 2AEJA 1RADB 4JI2F 2HVEA 5L38A 4R5PB 4ZVHA 2W2MP 2A10A 3J7ZT 4DBQA 2K1RA 1DTTB 3BV8A 4Y0FA 1C1BB 2B51A 2GMHA 5IM0A 4IO1A 1S1VB 1V3SA 2OPRB 3U1NA 2V63A 2NUUG 5KG7A 4JV1A 1Y3JA 2F9JA 2HVHA 1YJUA 3PX6A 1R27B 1D0EA 5J2QA 2C2EA 2GMLA 4P7TA 3GQCA 3BR8A 5GAGU 3TUJC 5B0CA 4B3OB 2J7WA 4JI2J 2RHSB 3ZTSA 2AX0A 1YJNS 2FHJD 3D2WA 3QSIA 5KFBA 4N7TA 2HHWA 4YDXA 2V2QA 6AT1B 1YI2S 1N54B 2BE2B 1X5PA 1G1XA 4O4GB 4EK2A 1N4LA 4DS4A 1SJFA 1S72S 4LBHA 1SUQA 1CJVB 1S0VA 3N01A 3MCNA 4CH0S 4RX6A 1TKZA 3QJLA 1FKOA 2KJWA 2B4UA 4LF8F 1RSCA 1UPPA 3WC2A 3DGPB 4CDIA 4Q8EA 3IM9A 1BE4A 3VAMA 2HZCA 2OPQA 4NCGA 2LP4A 3OTOF 2UU9F 2I6WA 3LP2A 4TNOA 5D78A 2MQ8A 2V4JA 2B8QA 2J9CA 2MKCA 4C98A 4DCJB 2HWHA 1ZYQA 3LH2S 4RW6A 1FEEA 1SBRA 3K5NA 1R43A 4K4YA 3D68A 2W4PA 5E3QA 2EXUA 4FKYA 3P49B 1N33J 5D4PA 4Q7AA 2E5LJ 2K8GA 1FWKA 4P2FA 4ZVUB 2N82B 4OYPA 4KT0C 4OHXA 4LF8J 2B3TB 3R7NB 3EICA 3M2VA 4B3SF 2MTLA 1O5JA 1OWXA 1OQ6A 3KLVA 3PFEA 1XMBA 3OTOJ 2UU9J 1HWJA 1DZ5A 1JB0C 4DL3A 2XSJA 1QDUB 2BJ9A 1S1XA 4Q0BA 1B0VA 2ZBPA 3TQ1A 3RAXA 3VHQA 1B7YB 1U6ZA 3UDEA 2MGZB 2GVZA 1RT1B 3KLFB 2YKOA 1WI8A 2YNHA 1M5KC 3KG4A 2O3DA 4KPYA 5HBMA 3DOKA 2HHPA 3GB0A 1KVKA 5T14A 4JB8B 1IKVB 3OLBA 3EVOA 1C0TB 4OV6A 3K58A 4QR0A 3MD3A 2MKYA 1GMUA 3CDBA 3CCQS 1WEZA 2W7PA 1RT6A 1NU4A 2HNDB 3T5LA 4TLRA 3M6VA 1FD8A 2IDLA 1BQXA 1K9MT 1YKWA 1RU1A 2LXIA 5L8RC 4OZLA 4DV0F 1U1KA 5IC4B 4B9MA 4QJVA 3IM8A 4ZS6A 1GXTA 3ZNJ1 2HHSA 3IAM9 1U2CA 3GONA 2ZD1B 4HL9A 4PWWA 4IH7A 3CF5Q 2MHEA 4DPTA 3T1AA 2EFPA 3RBEA 3EGNA 2HIQA 2VA3A 2UV8A 1ULRA 3OR2B 4RW9A 1N5YA 2JLFA 3RBZA 2Z2LA 1YJRA 2GAGC 1WOSA 3PV8A 2HBQB 3Q8VA 3OW2R 1RCOB 1F2HA 2ACYA 4A8XA 3J81j 4AD6A 4CWBA 3JYTB 1H2UX 1HNZF 1BWEA 3QMQA 3M8WA 1FFSB 3ILOA 3OTDA 2DY1A 4MK7A 4LF6F 2CNLB 1IKWB 1RWUA 2OSQA 3K8VA 4WK1A 3QRQA 5DGAA 1L5UA 4NA1A 2KT3A 3ISND 5F0UA 1RAHB 1U2RA 3HLUA 4DSFA 4DL6A 4MFBB 4N47A 2RD5C 3QZ8A 1MNEA 4KGMA 3I5CA 3M2RB 1RA7A 2CWKA 3Q2SC 2AYGA 4ZVOB 1Q5YA 1Y4ZB 1RTHB 3IBWA 1N32F 3TUPA 2A6MA 4A8KA 5JJBA 2ZWOA 3R7BB 4Q2LA 4DZ6A 3CC7S 4ZOSA 2GIRA 3KHHA 4LF6J 1N5VA 3QFWA 2XI3A 1V6HA 3CJTA 2MEWA 4NLPA 1YJ7A 3LAMA 4RUBA 2YWKA 2JEFA 2YNIB 3RRKA 3PW0A 4Y3CA 4FVMA 1V3RA 2NSBA 2V2ZA 1KOHA 4MKAA 1OSDA 1KWMA 4RBUA 1MN9A 5B09A 4DOZA 1NK7A 5GAHI 4BDPA 4LVNP 1N5QA 4N8OA 4ECRA 5ETVA 1S9EA 1AUDA 3WBZA 3CJKB 2ZM6J 4DHVA 5KG0A 2WVDA 4KTQA 5GADU 4HHJA 1APSA 1JLBA 3DYAA 1I94F 2CADA 4NL5A 2A1BA 2OJ3A 1T9UA 3OSPA 1WC5A 2MQMA 1EHWA 1NKBA 4DX6A 2KM8C 1SJ4P 3G82B 3GR1A 1JXLA 2VG7A 2AT1B 3RR8A 2R3VA 3M8PB 1VJQA 1S1TA 4DR4J 5MAOA 4ZCIA 4H54A 1G7CB 5ETPA 1OY6A 1VLYA 4LSLA 2F1FA 1PJ6A 5L9NA 1ZM4A 3ZC4A 3ILJA 2BJ8A 1X9MA 2OI2A 4PPDA 2CXEA 4HHUA 1JLEB 3V6DB 3C6TA 4DSIA 1PJ5A 4EWTA 4LF7F 2DVIA 4WWSA 4M5LA 1WOOA 3LF0A 4Q45A 4J90A 2XO6A 3CGIA 2BX6A 4DR5F 4N8NA 3G6VA 1RTIA 3TVKA 4WTOB 4WFYA 2XMJA 4O4RA 1YRUA 2W7AA 1PG5B 3BYRA 5G0RB 4EYHB 2C2OB 2H4WB 5KT7A 2YNFA 4LT6A 1ZAXA 2IIHA 1UEKA 2ZBIA 3QRRA 1RHQB 1JLGA 3FCVA 4RW7A 2HKEA 1GTHA 5KFOA 1SV5A 2LECA 5J2PB 3VV2B 4FS2A 3BR9A 4MIBA 4C97A 4LF7J 3W3SA 4USWA 1S99A 5M2RA 4A47A 1R6VA 5HK4A 4TN2A 2CPYA 2WTFA 3KFWX 3SCLE 2BJ7A 3HX9A 2MJUA 3PR4A 3GIKA 3OHAA 1WWHA 2EFQA 2W2NP 3A8KA 3HVRA 3CJ5A 4DR1F 3AH6A 2DNQA 3MF5A 2MQOA 3M9OB 3KHLA 4DG1B 1NHUA 1PBUA 1FJ7A 3D1HA 3EXCX 3THVA 2GX8A 4Z7YA 3D6HB 1IR2A 4ED5A 6FDRA 4U9RA 1OYEA 1LWCA 1V9OA 4RW4A 1D9DA 3MXHP 4NI2A 3TW0A 4I64A 4MK8A 1RLCL 3X1LB 3MEGA 5BR8J 2Z4PA 2CPFA 4DR1J 3AJDA 2NSCA 2VPZB 2AHOB 3LA0A 4KGVB 1Q53A 3X3UA 2GGPA 1R0AA 2KFNA 2COLA 2V9KA 4LBPA 2P9CA 4ECVA 3V2UC 1RB0A 1IWGA 1MWYA 4JI8F 1YJWS 2ZOMA 4DV6F 3Q24A 4A8YA 3EVMA 2YY3A 4P2SA 5IC6B 3DLLQ 1NMEB 5K9FA 2A0FB 3T9ZA 5C24A 2Z2MA 4F8RA 1S1UA 4MJKA 1Q8KA 4YOEA 3W8GA 2CQ3A 2G2YA 2HQIA 3W2VB 1TL3B 2FVQA 1T9VA 2Y1LB 1VBZA 4YP3A 1HNVA 4I2PA 5HLFB 1IWAA 3PKYA 4DV6J 4Z2XA 2I2YA 2XQCA 2XLKA 3DXSX 5ETOA 5JVHQ 3GWCA 2R7WA 5KG6A 3S01A 3DGVA 5ITHA 1FVSA 2DEIA 2OFGX 2HHQA 5SUHA 2YPZA 4WZMA 2C3OA 1X60A 2OUGA 4USJC 3TJ8A 4L6V3 4ALZA 1S9FA 1R8PA 2QSWA 4PG8A 1EJ7L 1D09B 3ZZYA 2JLGA 4X4UA 4DL0C 3G6YA 2QX0A 1JJHA 3JSMB 4M5DA 2DYAA 3HP6A 3PZPA 5C2GA 1HI1A 2AJ4A 3G8TA 5AE3A 4M5GA 3BKFA 4UUWA 2J0XA 2F7VA 5K5MA 3LP0B 2QN6B 4ED8A 1SQEA 1SB6A 1RU2A 1RA6A 3CCZA 4CT8A 3CCMS 3KJFB 4E0DA 2XCAA 3B4DA 1RT2B 5A8KA 4OZ0A 2ZOFA 2R2SA 3OJUA 2VJUA 5F9LA 3DDKA 3OL8A 4PYDA 4O0NA 2QLXA 1RT5A 5A76A 2QG9B 4JI7J 4ZKAA 3MM6A 2E29A 4ZLLA 2LEPA 2PFFB 2V94A 3CCRS 4PXBA 1HNWF 3FRYA 3C46A 2EBEA 2DB1A 1UTAA 2YWHA 4J37A 3H5UA 3L7PA 4DUYJ 4DV5F 2QE5A 4MIAA 2FYXA 2FJAB 1M0SA 5E3PA 2J7UA 2Y1JA 2HSEB 3AB4B 3A3PB 2MSTA 3DOLB 1W2BR 3TZZA 3WZ0A 3I55S 3MMCA 3TVYA 4R8UA 3T41A 2IA6A 5B7WA 2XNQA 5KAKA 3D5MA 1NHVA 5CZXA 1HNWJ 3MMBA 2DNPA 4WU2A 1WSRA 4QWBA 3OFEA 3RRHA 1JKHB 3ZZTA 2H5JB 3OR1B 4K2XA 4A8FA 4DQIA 2WOMB 3B8HA 1R6YA 4NMXA 1NK4A 4IDKB 3Q22A 3IBFB 5L1IA 1VBXA 1RHRB 4ZN3A 3H5XA 4IQXA 3E01B 5HATA 4C9DA 4FXDA 3SSQA 4DFPA 4ECXA 1HQ2A 2GO8A 3ZTRA 2ZHAA 4CNYA 2A18A 5H9FJ 3M8QA 1CJKB 1WJ9A 4NYZA 3PO4A 2CVEA 3I82A 1VQOS 2KXFA 4ICLB 3QGHA 3BGRB 2E1MC 5KFSA 4NLSA 5ETLA 5GAHU 2OIHA 1JLFB 1YDLA 3PX4A 1ZH5A 1HBOB 1TKTB 1H38A 3HSJA 3D6MB 1WHXA 1LWEA 4B08A 2QLBB 3I31A 3BN7A 1FDBA 2DIVA 2HNZB 3PM9A 2RU3A 2MKSA 1FRMA 4WBFA 1HHQA 4B17A 3MMAA 1LK7A 4DMZA 2RRNA 2M88A 1NH8A 3P45B 5KFYA 1DARA 3M6UA 3EVWA 4B9LA 4JOUA 3DLKB 5JMNA 2Q66A 2B5JB 4K50A 3HXMA 3Q2TC 2EC2A 2J9DA 1FNMA 4P72A 3POTA 5LSLA 3ITHA 4K4XA 4CH7A 1BWVA 2AIRB 1WACA 3CCVS 1UJ6A 2E5JA 1KBRA 1HI8A 1IJFB 1SI9A 2NYIA 3IWNC 4BWJA 3VZHA 4DL7A 4F0MA 2QFJA 2OD6A 1S4EA 2W8KA 4K4ZA 4CO5A 3L9ZA 1H72C 3O6QA 3IG1A 2MLZA 1R8BA 1RLDA 1HHSA 3KLHB 2Q6CA 4CLTA 3OTBA 2RHQB 2RDDA 2R7QA 2FQQB 2MYFA 1SH3A 5HMYA 3LWMA 1UZDA 5C42B 3FCHA 3JS9A 2ZZTA 5L46A 3GZ7A 1NJYA 3JSRA 2DPJA 5HMXA 3NKYA 1VYAA 2ZC4A 4IKAA 3JSBA 3KG1A 2OH2A 2IC3A 1L3UA 1ZOTA 2OLWA 5FIIA 2MLXA 1VRUB 1RBAA 2IPOB 3HHLD 1NPKA 2H4YB 3M32B 3W65A 3FCWA 3K5PA 1XBWA 1Q8BA 2B8PA 1N36J 1O8BA 3AA9A 3MM5B 4KGZB 1KQSR 2XBPA 3GCWP 4QYZJ 3MOJB 3OVSA 3WHIA 4PYAA 3M8SA 2DD8S 4MMOA 3CJQA 2Z2ZA 2VZ9A 3QIDA 2DH8A 3J7YI 3DRPB 2D3UA 1S6PB 1D9AA 2CQBA 2DNKA 5DQIA 4EUVA 1CJUB 4C8LA 4CP5A 7AT1B 1UL3A 3CCTA 5HSPA 3Q8SB 4YEAA 1OY8A 5F41A 4FPIA 3C14B 5B0GA 3ENVA 4M5KA 1AZSB 4YQWA 4H4OB 4YR3A 3TX0A 3AQOA 3JXOA 3BGLA 3DRRB 4FVCA 5HJYA 3ILIA 1FFWB 3A8JA 1NXIA 5EWGA 1HMVA 2V8PA 3AXKA 3LGHA 3KLIB 3M9NB 2RIJA 3IRXB 1N8RT 2QMWA 2QL7B 1NM2A 3IRWP 1NK0A 1EIYB 2UP1A 1IKXB 4BC9A 2KHCA 2BRLA 1DBDA 3I56S 5LM7E 2CIMA 3EYZA 2I1RA 5FDLB 2QEXS 5KFWA 2AX1A 2KZZA 1VGYA 1RTDA 1W7WA 1YVFA 3I0SB 2OSRA 3MEEA 3MM8A 3FMBA 4NX9A 1D8YA 2VQFJ 2UUAF 2QIFA 1KDNA 1OJ4A 4TYAA 3NCRA 1S6QA 2PI4A 4PAAA 1WKJA 2GQCA 4ID5A 4LBIA 5J2MB 1FI4A 1REVB 2FLNA 4Z7CA 2B4OA 3HHLC 5ETTA 1FHTA 3H7HB 3LUYA 2FDNA 1T3OA 2HS0A 2MKHA 4IRCA 3MR2A 2YH1A 1DQAA 3FBCA 3MM7B 1FVQA 1B4SA 2B6AB 3NGUA 4JI4F 3IR5B 2UUAJ 5KFKA 3I9ZA 4NE9C 2XMVA 3PJXA 1HBNA 1RAEB 5CABA 3DU6A 1UW9A 4IFYA 3FEYB 1UWBB 2YKMA 2IJNA 3LAKA 2CPXA 1D9FA 5KT2A 4BWMA 3TA0A 5KT6A 4B02A 1U1QA 2XY6A 2JEIA 3TJ9A 2BKPA 4J9NA 1RK8A 4DR2J 4ZN1A 2MZ1A 3M2VB 5EHHA 1A9NB 5J2NB 4JI4J 3Q23A 2BUNA 3EPGA 5EN1A 2V2KA 1BC6A 1F1BB 2KJVA 5AE1A 2PDAA 1IQZA 1X31C 3KK2A 5E3CA 4XO0A 4HLBA 4JUZA 4F4ZA 1VQPS 2KN4A 2QLWA 4I2QB 3VAFA 2D1CA 4AFFA 4KFBB 5EDWA 2DCUB 1XJWB 4ZVGA 4F4KA 1WEXA 1LWXA 3BO2A 3AA8A 3VQTA 5T41A 1MROB 5FJ4A 3G87A 4WYLA 1HLWA 4OI1A 1LFPA 1KONA 4X64F 2Z0GA 4FNHA 2E44A 3PW4A 4V19X 2ZH9A 1E6YA 4CYUA 2MY7A 1YBAA 4DR3F 5F8MA 5CYMA 1FXLA 3HULA 2XMUA 4A4JA 1T8EA 1WD6A 1BLUA 1F0XA 1C1CA 1OIAA 2R7XA 2XTJP 3EPIA 1AYEA 1Y5LB 3Q83A 2EVZA 4FYXB 3A8IA 4OLPA 3QT8A 3UN2A 1S57A 2UVUA 2M70A 3PW2A 3G71S 4ED7A 1RTJB 4DQQA 4OYZA 3UR0A 3S6EA 2DNRA 4C8NA 3TZYA 2RU9A 4DR3J 4X65F 1T95A 1WC6A 3CCJS 4LF2A 3C6UB 4A48A 4Y2AA 4O23A 2ZZNA 1T11A 5DQGA 4EGLA 4RBVA 4ATNA 3VGSA 3GLJA 3SCJE 1VS3A 2GQ2A 2I8EA 2IM0A 4LFAF 4AYBD 2F8MA 2Y1RI 1HYSA 3HZEA 2CNOB 1C0UA 5D0GA 4B3TJ 4RJVA 3NGRA 1AFJA 2VF3A 4E98A 4NCAA 4DX5A 1T94A 3OXFA 5E7OB 1EQ0A 4U8VA 3UDVA 5CCLA 2HYIB 2R8IA 4FP9A 2ZH6A 1TV6B 3GV5B 3VWSA 3AQPA 2HZAA 4CLZA 1Q79A 1NDKA 2RQKA 1YK9A 4ES1A 4K8RA 1M1GA 4ZP7A 2OEKA 4GKJJ 2JVOA 4DDFA 3IR7B 3GJSB 2VH7A 1U1PA 4LFAJ 4DL5A 2KI2A 1HD1A 4H4MB 3JQKA 4ZPAA 4TU8A 3ZZPA 4OHZA 4PXCA 2F5GA 1CG2A 1VQ5S 3BKTA 4A46A 2IMOA 3T5KA 3DYAB 3MCOA 3GIJA 1HPZA 3K5MA 1FERA 1F5AA 4UZCA 1QUVA 1NH7A 5KFXA 3EE3A 3JAMY 3BSCA 1AA1B 1YQHA 2VG7B 4U6PA 2BANB 1RDRA 4CLYA 4JBCA 1DTQB 4CO1A 4FF1A 3H5YA 1F3VA 4DLGA 4LSLB 2K7JA 2FLOA 3CD0A 4CTAB 1SKRA 1T03A 3EWGA 1X4HA 3RW7A 2EI5A 3CJ2A 3UCUP 1QE1B 5LSOA 4ZIVA 2R8GA 2VKRA 1RAFB 2PSZA 1Q7YT 5DLGA 3FVYA 3QRPA 2ROEA 2HK2A 2YWWA 2K2PA 2YKNB 4KJIA 4DV3F 1VQMS 3D1OA 3R27A 1JLAB 4JV5F 2DISA 3GPAA 3DLEA 2IAJB 2VOOA 5C5JA 2NXNA 3SQGB 4G1IA 5B0EA 2FHMA 2MZRA 4FYVB 3UFCX 1TFWA 5B08A 1VRTA 2RMLA 1IQTA 1M5OC 1PIEA 1QSYA 1EP4A 4HACA 4Y28C 4C6AA 3GFXA 2W8LA 1O0PA 5GAEI 4QW9A 2RT3A 2HBZB 3CUNA 4M5JA 4GC6A 2BEFA 2DO4A 2RKIA 3GJTB 4CLUA 4DV3J 1RISA 2FHOB 4JV5J 2N3LA 4F0HA 4X4QA 4K4UA 2ZH2A 3VAHA 1N0UA 2IM1A 2ROPA 1S48A 2DEJA 5JVGQ 2RRAA 5K14B 2DNZA 1SC1B 1OPIA 3ZO7A 1M90T 1E6VA 3C16B 3LTOA 4IR1A 4NWBA 5I42A 2W7OA 3HD1A 4GC7A 2HPUA 3GMGA 1LNQA 1NCLA 1PYOB 2BJ1A 4LREA 4QBUA 3D67A 2PEHA 3UR3C 1S1WA 2DR9A 5FLXU 3ZZRA 4L76A 4I0WA 2J6SA 1DQ8A 4O3SA 1U1OA 2ZH3A 5CHCB 3KLEA 3H2LA 2HLTA 2VODA 2EG2A 2KYZA 2OTLS 2ABYA 5E0OA 1KKHA 3UVJA 3MPWA 3OUYA 1HQUB 2YWFA 1WI6A 3MR3A 1WKLA 2FZKB 5LSRA 5KFRA 5KOWA 1FKPA 1LW0B 4MTPA 4J9SA 4J9RA 1NK5A 4LMZA 5EWFA 4F04B 4HH0A 4YB5A 4C2MA 4ANEA 4R0EA 1Q1KA 2DRDA 2VFSA 2AYMA 1XIQA 3AXMA 1KVIA 4P6QA 1HNIA 3BQ0A 2NQPA 2IDEA 3BDEA 2V68A 1IKYA 2DGXA 4MKYA 1HNVB 4EBEA 1XEZA 4AXJA 3QJJA 4KO0B 4KV8A 1T02A 3V81B 1U6FA 5A8RB 3QAEA 5I3UB 4QIEA 3FBEA 1U26A 4F50A 1RT4A 2DGUA 3ZTPA 3VAJA 3M2UA 4DWIA 3GG0A 2J9DE 2VFVA 4DR6F 3CT9A 3AOAA 3E2EA 5IT9U 4RW8A 4C3LA 5A8WA 3BBFA 1TKDA 3LW5C 2Z2YB 4MH8A 2F65A 3MR7A 2QA4S 2AU0A 5HVGA 4OI2A 1YSJA 5IWAF 3JB9k 3QLHA 5KFLA 2JWNA 1HARA 2NR0A 4PUOA 4W98A 2NXUA 1IJEB 5KFEA 4WP9A 1G2EA 1X4AA 2HFOA 4Y00A 1Q4RA 1RBLA 4ED2A 4IOBA 3ET6A 4CIOA 2X51A 2B9YA 5GMKa 2V69A 2M4MA 2GVDB 3NRBA 4ZJOA 1OSCA 4DR6J 1SKSA 3QPIA 3TJAA 3R5GA 5ETRA 2UXBF 5IWAJ 1S76D 3GG1A 5IV3A 3DRSB 2VG5B 3MUVP 4PWDB 2RVJA 1RT7A 3RJMB 6FD1A 1TAUA 4FN5A 3JAMU 4LR8A 4PXDA 1BUXA 1RP5A 2HMIB 1DAXA 2CKWA 3KLGB 2JJ4D 4E2FB 1RT5B 4JI5F 4GVBA 4A8QA 2VPXB 4NEZA 4EMDA 3MM6B 3SFGA 3IAS9 1IBKF 2HRUA 4I6AA 1TAQA 1FTRA 2RILA 2C3PA 5HP1B 4QOTA 2C3YA 1JQGA 3DN9A 3ZZZA 2E1CA 4QWAA 3PG9A 2UXBJ 2VFRA 5HROB 4ED0A 3V6HA 1MU2B 5JXSA 3OBIA 3J81Y 1S0OA 1UVIA 1KR4A 1RYSA 4I6WA 3ZTOA 4UZBA 3CMAS 3UCZP 3JTOA 5J1EB 2CJYB 1PC4A 4AQYF 2IJRA 4HDGA 2P2CB 2X3GA 3DMJB 4ZPTR 4I1TA 1MWQA 2M9KA 4JI5J 2V34A 4OFZA 1RHJB 4UQTA 2JH3A 2F9DA 1YJTA 3MMCB 1TMJA 4USMA 1IBKJ 1UEUA 1R89A 1VR6A 2VG6A 4IO9Q 2ASLA 3CJRA 1KQKA 4FF3A 1S4FA 3TUZC 2QTWA 2VQEF 4F3OA 4IQMA 2KT2A 5F8JA 1W25A 1TQLA 2QMXA 2B9WA 2PE8A 2V4QA 1Q5VA 2BKOA 1WG1A 1LW2A 2N7YA 2RUGA 2VJVA 4J5OA 3WC0A 4AQYJ 3TAMB 1KLNA 3DHWC 2O01C 4YB7A 4G65A 2X1BA 4I67A 2YVSA 3CIMA 2BOAA 1D8ZA 2J8AA 4URSA 1TELA 4U96A 2QJ3A 4NEYA 2EG1A 4NXNF 1ZA1B 1CJTB 3D6TB 3LQVA 3AY0A 3VGUA 2N7CA 1XR7A 3Q0AA 3B54A 1OS5A 3E3XA 1XC9A 2CWXA 2KFYA 4UY85 2YX1A 1SIZA 3C66A 1YJ9S 1Z1ZA 4IFVB 3MD1A 4G1PA 1JX4A 1ZA2B 4C11B 3H2UB 3GILA 1VI7A 3WQPA 4ZDNA 2EK6A 3H8YA 3SEOA 4NXNJ 4DSJA 4ES3A 5EUHA 5KT5A 1F5CA 4QYZK 2KXNB 2E7WA 4GMKA 1F6TA 2IRUA 4WFAQ 1BXNA 5IS2A 3F44A 3A3NB 5HAOA 2SXLA 1XNRF 2BW7A 2WCXA 2MLYA 4AE5A 2HGMA 1B7FA 3IXQA 1LKZA 2L3MA 3Q8RB 2CQIA 2Y0SD 2ZH4A 4IG3B 4ZCKA 2BYCA 1AW0A 3NL0A 2OTJS 1GX6A 3KJQB 1SH0A 5A2QY 4RBTA 2AEFA 3CULA 3AB2B 4JI3F 5LOQA 4KAIA 3CCUS 3Q8YA 2NXEA 1HIYA 1XNRJ 1WELA 1NHKL 2FGCA 2XWYA 3HVTA 2I5JA 1JIHA 2AGPA 4HT7A 1WDDA 5ETQA 1Z2LA 4WKRA 1SJ3P 5DS7A 4XK8C 2CQGA 1QTNB 1J5EF 4B9SA 3CDWA 1WSVA 2W9BB 4NASA 1BY9A 4B9VA 1DLOB 3H59A 2R8JA 4O3QA 1HNXJ 3OTEA 5HVFA 2NUHA 2DCLA 1CLFA 2ZH5A 1H2TZ 1D1UA 1GXLA 1CC8A 3GYGA 3IS9B 1FXRA 4KRWA 1RABB 2RF2B 3DM2B 2YQ3A 1F9HA 4R5PA 3SV3A 5HN0A 4IYQA 3CIZA 4AL7A 2E1AA 2HNYA 4NZ0A 1GMWA 1J5EJ 1DTTA 1Y0HA 3H5SA 2WSFC 3N4WA 1C1BA 1NB7A 4ENOA 3HFVA 5C2CA 1S5ZA 3ENQA 3PW7A 1S1VA 3RUBL 2OPRA 4C8YA 1EQMA 1FDDA 1X4FA 4TXSA 2VUGA 2RE1A 4NLRA 2R7RA 5MLCV 1M1KT 3F73A 1S97A 2LU2A 3OFFA 4OIXA 1SJQA 1I1GA 3SSRA 3QT6A 1CQNA 1UCNA 4B3OA 2ILZA 5CD4A 1UFKA 2G13A 2E66A 1ZM2A 4C3KA 3D0HE 3CW2C 3NBPB 1M5SA 1SQFA 4KGKA 2XLJA 4DR7J 2LEBA 2BE2A 2VBWA 2DNOA 1AFIA 2DBBA 1VOMA 4TU7A 4O4GA 2LA6A 3BDPA 2J9EA 4A8MP 1T05B 2CYYA 1NJWA 1TUWA 1RBOB 2NZCA 1JXVA 1CJVA 2HVDA 4MT1A 4PCQA 4F3QA 1RAAB 3MECB 3DGPA 3UQSA 2NREA 1P6TA 3MPUB 3HMJG 3P8BB 2AWZA 3DDNA 1LWFB 1G4CA 4F0KA 4USUA 4B9UA 5FD1A 1X8DA 3MEEB 3MM8B 1R8HA 4DF4A 4RU9A 4DFJA 1KFDA 3Q89A 1J5OB 2D74B 2X1FA 3KK3B 2FPHX 4N77A 3TX8A 2JC0A 3RTVA 5SZTA 3WX8A 4OI0A 4YMEA 1TVRB 4DQSA 1VJWA 4TQRA 4C48A 4OZ5A 2ZBQA 2WSCC 2IY5B 3N6NA 2ERRA 4ED6A 1G3OA 3FGVA 5DZ6A 4K4VA 5KFNA 2R42A 4LVOP 2Y8WA 4ILMA 1L3VA 2MGZA 3MAAB 1RT1A 2QSFA 3TA2A 3KLFA 1PBAA 2AJ1A 2Z56B 4UW2A 2FJWA 2MY8A 2QLFB 4KKOB 3KJVB 1HR0J 1U2FA 1IKVA 3MFIA 1WNEA 4M5MA 4K5SA 1C0TA 2YKMB 2JEGA 3HZGA 1JMTA 4NXMF 5EX3A 2HNDA 1OYDA 5D0HA 4X66J 3AOCA 3FUYA 4XIUA 2QL5B 4K2JA 4FYWB 4D3HA 2JVRA 3NCPA 4ZK7M 4OHVA 1H3DA 3BM7A 3M8YA 4A8OA 4M94A 3US5A 1R31A 2ZD1A 3DLHA 4L74A 4N56A 4FBTA 1UEVA 2WHOA 3SIPB 4TKTA 3DFEA 2HBYB 3OR2A 3LOUA 1K0TA 4NXMJ 2I38A 1F3FA 3M30B 3HCXA 3EZ5A 4O44B 1TMMA 2DT9A 4I6YA 5A2QU 2H9ZA 2LEAA 3VGVA 2QT7A 3EDRB 4JP8A 1U09A 3JYTA 1N33F 2E5LF 1IKWA 1O51A 2OPPB 4KBIA 1TL5A 3KG0A 1RAIB 5KFHA 2VFUA 1HL6A 4CH1A 1WF2A 4F4AA 2WVBA 3G2XA 3BJYA 4MFBA 3NNCA 2AJ2A 1Y5IB 4RNNA 1CS4B 4U7UK 4WU3A 3HSGA 1RTHA 3AJ1A 2DHXA 1L3SA 5D77A 2JOQA 3B78A 5CCMA 4QWEA 4DLEA 5KFMA 2YNIA 2XG8A 4K4TA 5DQHA 2CJBA 3PJWA 1YRTA 4PPZA 2HFZA 4Y65A 3IC1A 9RUBA 1IN0A 2R2RA 2OHDA 2XWXA 4OZ1A 2VC0A 3O3LA 1FESA 2NPIA 3PNIA 3TUIC 3CJKA 1F2GA 2J0QD 2HVZA 5JUMA 3DKDA 4CO4A 1YIJS 4RO0A 4YUDA 3KUGA 1LOUA 4WXWA 3CD7A 3ZZ0A 5L1LA 2HRYA 4S0MA 1WHWA 2ZBRA 3G82A 2W2QP 3O44A 5DRKA 2RUSA 3W9HA 2L08A 1QSSA 4XPCA 2YNGB 1V5IB 2ZH8A 4ZCLA 4BHQA 1I6JA 1WHYA 2CQ1A 2HFSA 4FS1A 1B99A 3QGIA 1SCJB 4NLDA 4TYBA 3FK4A 1D3WA 3CMQA 1N5TA 1LXNA 2XZWA 3R3TA 2FY8A 1RE1B 2GNKA 5D4NA 4PG7A 1JLEA 1U1MA 3MFHA 3NS6A 1KSPA 4P10A 4HVZA 2BQRA 3EMTA 3MM9B 5F3TA 2E5GA 4OYMA 4ZVRB 3BZQA 4H4KC 2FZCB 2QYCA 4WFNQ 5G0RA 1RKJA 3EZUA 1FE4A 2HW3A 4NLOA 3W66A 1N34F 1HWLA 4DV7F 4MYTA 3QWUA 4M5NA 1EB0A 1XR5A 2JSXA 5E5NA 5CA5A 1RZMA 1RXOB 5J2PA 1U8SA 4ER8A 2CA9A 2D3O1 3G6ES 1TL1A 3CE8A 3HHLB 1BQNB 2YTCA 2PMZD 4AL6A 1KC8T 2XMAA 1AB8A 4NLQA 1YX2A 1MMNA 1KN6A 2XGPA 4Q2MA 1FEHA 2ZJPQ 5D3GB 4NLXA 2ZM6F 1N34J 3TWZA 2KRBA 4DV7J 4C0OC 4DG1A 1PC5A 5B0BA 4LRAA 2CJXB 2WK4A 3T6JA 4ED4A 2FVRA 2H54B 2W9CB 3CJ8A 2R8KA 2CDQA 1QM9A 3KJNB 4D3GA 4X4TA 4F4WA 3BBBA 2ZITA 2CPEA 4MK9A 4DR4F 2RJZA 4X4NA 2CQCA 3NOGA 1BQMB 1N0VC 2Q6BA 1NJIT 2WONA 4HDHA 3L3CA 5BXIA 1Q8IA 2UV8G 1EP4B 3O5TB 2FC9A 2CG8A 5J1NA 2UUBJ 5DDRC 4ZP9A 5CYQB 3RU0A 1JJ4A 2VB6A 2DXFA 3M8ZA 2CJ9A 3NNHA 1FX2A 4ILLA 2AKWB 1FRHA 1UW4A 1RWVB 3D4JA 4NMLA 5AXLA 3RB0A 1WTFA 1EX8A 2JLEA 4ZHRB 1JXEA 4W4MA 3M1VB 1UA1A 1ZBTA 2V8HA 4HTIA 2M3DA 3W2VA 1HBUB 2PT0A 1TL3A 4MKVA 4WE1B 2E9RX 2VU5A 4JV0A 5HLFA 3QGPA 3GU0A 5C7PA 1NDLA 1Q81T 3MMJA 4X4OA 2PEBA 3AODA 1TK5A 2HIYA 3W5YA 1R8CA 2EPIA 2VONA 3ISNC 2HLUA 4PEOA 1EETB 4EZ9A 3D0GE 4AUKA 1TUGB 2DHHA 1Q78A 2BVZA 3ONQA 3ZNUA 1Y7PA 3EZOA 3IP0A 2N4DA 3OL7A 1UKUA 3N5FA 2FVPA 3KUEA 2FY1A 1VQ7S 4PQAA 3W9IA 3NLCA 1KFSA 5T7LB 1XWLA 4AT1B 1WG4A 4YB1P 2KG0A 1VQLS 4TLQA 4ZPDA 2HQGA 1MMDA 2DGTA 3QATA 2MB0B 3MPDA 3JSMA 5BR8F 3CJ3A 2XYHB 3NOCA 5DZ7A 4QIVA 4PQUB 1K44A 4J9PA 5KFIA 2VASA 2Z8QA 3MURP 3LP0A 7FD1A 4IRKA 1HWIA 3MHYA 2KFZA 3LALA 4CO2A 1TKXB 4DPXA 1RHKB 2UVWA 2KZMA 4ZVSB 1PAEX 5LJ3Y 2BJDA 4XAKA 2AZ3A 2D41A 1XMOF 5HMWA 1KLMB 4EI2A 1TZ0A 4UOHA 3DI6B 1S9GB 4QWCA 3CJ4A 5HQ8A 3SYZA 1O6XA 3I0RA 3FSXA 1SXLA 2NXJA 1EKRA 1T0TV 2RQCA 4UUXA 1YTYA 1S6OA 2AZ1A 1NDCA 5AT1B 5KG2A 1U1LA 4UOFA 4WF9Q 2AYBA 3D9BA 4RUAA 2IVYA 3D3BJ 3FMWA 2GIFA 3GIRA 4G3IA 3IBCB 2AJQA 1U1RA 2VHGA 1RKIA 4TY8B 1NNDA 3NP5A 2GJFA 1P27B 3VTIA 1XMOJ 4QIFA 1JWWA 2FJEB 2J6UA 3DOLA 2OPSB 2M7SA 3OJSA 2PIIA 4FYDA 2JNJA 3PHTA 1U8WA 3D6FB 3W2WB 4CZCA 4F2SA 1S12A 1FNXH 1LFWA 4M5HA 2HQCA 5CAAA 2ZOGA 2BDPA 3OR1A 5L1JA 2WOMA 3R6LB 3PW5A 1N48A 3PEHA 5DM6Q 4IDKA 1VQ9S 3AD9C 3GV7B 1H0HB 3FC9A 3FFIA 3ZTQA 4XPEA 4OQJA 3D3CJ 2X3DA 5B0AA 5E41A 1UA0A 2YKPA 1RAJA 4LQ9A 3E01A 4WK3A 3E8OA 4DQRA 3QAUA 1T7PA 2X7IA 3Q8UA 4CLWA 1FXDA 1ZTWA 4Q43A 2C28A 1CJKA 3SZ2A 1JLCB 2XHCA 4XDDA 1I5OB 2JDJA 1UMJA 2KT5A 3DLGB 2GIQA 2LQBA 3BGRA 5KG3A 2DTJA 1JLFA 1X4CA 4O3OA 3KK1B 3CXCR 1HBOA 1OO0B 4JI7F 1TKTA 2DR6A 1UVKA 4C8ZA 2OO4A 3P5TL 4K7QA 3GE9A 1KOOA 5DG9A 4CM2A 1N88A 4KY3A 1Y5NB 2CFXA 5H1SV 4CT9A 2QZ8A 2HNZA 1A7GE 1K8AT 4DF8A 1Q8LA 3J7Z5 2ZE2B 3MPVA 2ALZA 1QUPA 4DUYF 2ADCA 3PRDA 3K8WA 2HQDA 5C25B 1X4DA 2RB7A 4CI0B 1SC6A 2ZC3A 4O0IA 3DLKA 3PDNA 1GNKA 1JNZB 4Z37A 3FSYA 2Y1IA 3KTQA 2B5JA 3H20A 4IOAQ 4EEYA 2V8DA 3HVAA 4EZ6A 4RNMA 2KU7A 3N79A 4G1QA 5D8HB 1C4AA 2GJIA 3NG8A 4DU7A 3R5AA 1PYTA 3BKUA 2JL9A 2GCFA 4CLPA 4I7FB 5BYQA 2EEYA 5LMUF 2J7KA 3U1LA 2FJDB 2HFVA 1WORA 3WIUA 4JYAF 3GV8B 4NLGA 2I0XA 1U48A 2KVIA 5KFTA 5GADI 3CC4S 2V67A 3KXDA 2YWEA 3AD8C 3DCAA 4KSEB 4OHYA 2XS2A 2R7VA 1G6BA 2EFOA 5K20B 2DH7A 4Y2MA 1VK8A 5IXUA 2OELA 1UETA 1UZHA 2JFKA 1U0HB 3N6LA 1VHFA 3DU5A 2DHSA 3KLHA 4ANDA 1ICEB 4EO8A 1B70B 3CDUA 5LMUJ 3M05A 4EO6A 4LRFA 1MSWD 4JYAJ 1UVLA 3JQMA 3GP9A 2VKZG 4LSNB 1FJGF 4WXOA 4YHHJ 1TL7B 5L1KA 3OXGA 5A0YB 4P7VA 1ACMB 1VLOA 2LQ9A 1WTBA 3MEDB 2J0SD 4W90B 3TEHB 3DOMB 2E9ZA 2PN6A 3IO1A 3UCGA 2LYVA 1T3NA 1SQGA 1VRUA 2NXCA 1SL1A 1ROFA 3M32A 4OYIA 4NLTA 4KGXB 5AXNA 3Q86A 2V4RA 4ED1A 3OXLA 3FQLA 3MM5A 2WVCA 2RQ4A 2C2MB 1GK8A 5HJXA 1FJGJ 3W8PA 1Q0NA 1NEEA 3W60A 5DLFA 1UVMA 2B4VA 3D66A 2D7SA 3MR6A 2ZHBA 1Q95G 4V1Ak 2U2FA 1Z2ZA 3FZ2A 3ZXWA 1N52B 3RR7A 3DRPA 2CAJA 1S6PA 4LSZB 1HQEB 5U47A 3D28A 1CJUA 2LMIA 4J9LA 4L3KA 4RR5A 4WIIA 3PIPQ 3VZIA 2MSSA 3LO3A 2NLWA 1R7IA 2XY7A 3V6JA 2WSEC 3HFZB 3C14A 4OI4A 3QGGA 1AZSA 2M8HA 1FJCA 1DY3A 3HHKA 3OVBA 5H9EK 2C2NA 2W9AA 4DL2A 3DRRA 2JZ5A 2HNYB 3R5JB 3RB6A 1H7WA 2AEMA 1LV5A 3V4IB 4QCLA 4A8WA 1VIXA 1YZ7A 4C3MA 5DGBA 3KLIA 2HK3A 3UW1A 3VF0B 1TFYA 3IRXA 2QO3A 3RRGA 4YN3B 3LP1B 2G0JA 1N6QB 1K1QA 1IKXA 1FDNA 1CBKA 3FEZA 3NCQA 2C2RA 5FDLA 2HAIA 1S77D 3K5OA 3T1YF 1YBTA 3I0SA 4YY3F 2EBGA 2C3MA 1RUSA 1WF0A 4CNZA 5J2MA 2CG4A 5K8OA 5GVQA 1REVA 3SQOP 2IHR1 4P2XA 3OTCA 3QO9A 5EX0A 1N36F 4OI6A 1HBMB 1Q7LB 2P9EA 2HS4A 1RT3B 2O67A 3O8WA 3MM7A 3T1YJ 4NYOA 3THPA 3I4PA 1UP1A 2HQ3A 3TYTA 2B6AA 1AXQA 1NUEA 4YY3J 3PCOB 4Q5VA 3M8RA 2KTQA 1X0PA 3HO1A 1MG7A 2RSQA 1NZ8A 3M9MB 5HL7Q 1ZPWX 1U49A 2BV3A 1VQNS 3R8YA 1A0OB 4ECYA 4ECZA 2LA4A 1UWBA 2V6AA 3KWMA 3R97A 1U45A 3MR5A 1MWZA 1R0CB 2FZGB 1J2VA 3HVWA 3CCWA 4QYRA 3LPYA 5IQQA 5J2NA 4ZJLA 4N5SA 1X0FA 4RNOA 2APOA 3QIPB 1NRKA 5DO2A 5KTQA 5BYSA 3K0JA 3NMAA 1QD1A 4WZQA 4Y2CA 2AJ0A 3WDOA 4EYIB 2JX2A 2Y8YA 4I2QA 2XNRA 2ADBA 4OMFG 3P5BP 4WP3A 1DHMA 3PX0A 4NA2A 5M2PA 4IG0B 3CJ0A 3PRBA 4KFBA 1RWKB 3PIOQ 3DRYA 3TARA 4B3SJ 2DITA 3F41A 2VQFF 4GRSA 4Y2IA 2IJFA 1T9XA 3L7UA 2K1RB 1ELOA 5DDPC 4DU8A 1MROA 1M1HA 2WB1D 4PABA 1V5VA 3VGTA 5IM0B 4RUCA 4C8KA 3FSIA 2LQ5A 3VR1A 3GYXB 3QQCD 3BH6B 3K57A 1WC0A 5J2QB 1WOPA 4NZ6A 5ETKA 3SMZA 2MKKA 4U67Q 1VQSA 3UWTA 1TK8A 4OZNA 2VA2A 2ZVSA 3GFZA 2YKAA 4PXEA 2DGVA 1ZM3A 3E51A 4BLGA 3ILLA 1RTJA 4FF4A 5L39A 1FTCA 4JI0F 4DV0J 2XCPA 2O1PA 3QFHA 4OJ3A 1FE0A 4UF4A 1SUQB 3IMQJ 3QT5A 2A3JA 2CPJA 2O66A 1WEYA 3D1QA 1TKZB 4DR2F 1FKOB 2G9OA 3C6UA 4K4WA 1ZZNA 4CQ1A 3BO4A 2EW9A 4F4XA 2E9TA 1YRXA 2CDRB 2KRRA 5HQLA 2OPQB 4NCGB 4R0JA 2X1AA 3LP2B 1RACB 1FJEB 1T9YA 2R9LA 1ZZFA 2KKHA 4Y6IA 2BKNA 2AYEA 2POKA 2V4JB 3QWPA 2M0GB 1WHVA 3F0NA 4RW6B 4OX9F 4KHPF 4JI0J 2BBEA 1FNOA 4BCAA 1BHNA 3DDIA 4WFXA 1FD2A 2YBVA 1HNZJ 2GMJA 3FNNA 1HW8A 3HF5A 3UN5A 1TV6A 4WFBQ 3G4SS 1F5BA 3V4MA 1UAWA 3FZBA 3L7OA 1NPRA 4DS5A 4F26A 4LR7A 1Y9OA 4RLEA 2XSJB 4USIA 1K73T 2Z57B 4Y2KA 1S1XB 2WBRA 4H4MA 4OX9J 4Q0BB 1GTEA 2VPYB 4GKKF 4KHPJ 2EFGA 3MCMA 1N32J 2GVZB 2MQNA 4ETZA 2XI2A 3VVTA 2WW4A 4NZ7A 2V0NA 1ZTTA 1U02A 2YNHB 2HHHF 5HBMB 3DOKB 4QR2A 1P8GA 3GYNA 2N4CA 2E1PA 5B0FA 1RI7A 2W1BA 3KNGA 1JJ2R 2F4VF 2IVMA 3TEGA 1ZPVA 1VQ8S 3G8SA 3UI3A 2BANA 1RT6B 3ENWA 1KRPA 4QPXA 3GSIA 5FLXY 1DTQA 4OYAA 3FEXB 3THTA 2OEMA 3ULHA 1X5SA 2ZZMA 4GKKJ 3MGJA 4CTAA 4DX8H 4OZ2A 3C19A 1PCAA 2C2KB 1W26A 2V9WA 3A3OB 1KTVA 5CD4H 4ELVA 2W2OP 2HHHJ 1I94J 3R5BA 1QE1A 3L95X 3HJVA 1M5VC 2PO4A 5I3QA 5AJ3F 2RS8A 2HFUA 2IBOA 2F4VJ 4RW9B 1N5YB 3C3LA 3T6BA 4NYPA 1Y11A 4U7UD 1F60B 2YKNA 3N5BA 1KHWA 1JLAA 4B3TF 2IAJA 2RRBA 4J9QA 3SQGA 4P52A 3CJSA 3OVAA 2UUCF 1IM6A 3KKFA 3W63A 1UWAA 5ETNA 1NSPA 2W2PP 1RWOB 5AJ3J 1N5SA 2BZ2A 1KS2A 1IBCB 3C15A 4DR5J 4GKJF 1GH8A 1U4BA 2QRRA 2MDAA 3NS5A 1TL1B 4TQSA 3I5AA 2KL8A 3UO0A 3R9LA 2YXLA 1UFWA 4RWWA 2CPDA 3ETMA 5IT9Y 2EKYA 3UD5A 1H98A 4ECWA 4LUBA 2UUCJ 3R5DA 5K14A 3UNGC 2R8HA 1U47A 2XGQA 2MQLA 2MZTA 2YX7A 3UD4P 1FRJA 3IWLA 3C16A 4X4PA 5CZVA 5F8LA 2PGCA 3BH7B 4DSKA 1N56A 2HRTA 3ENAA 2HS3A 5LJ5Y 4FZVA 2GFFA 4I69A 3T3FA 2IM2A 2CUYA 3W5XA 2WONB 2ZJQQ 4ZVQB 1SC3B 1S9EB 2CZVC 2FHJA 1CEZA 3BN4A 2BR0A 2P6TA 1FF2A 1JLBB 2LU1A 4HYKA 3CEDA 3BGOP 1BMQB 3DLJA 3I4HX 1L3KA 3WX4A 1HQUA 2CNKB 4MAKA 4ZPVR 4DSEA 1PSDA 1RWPB 4LF9F 1GMVA 1LW0A 4DJBA 3KUHA 3B6BA 3PKMA 4TVAB 1SPBP 1S1TB 4DUTA 4EFAC 3UE2A 2BMBA 2NCKL 4H4KA 3CB4A 4DEZA 4URQU 1U24A 5GMDA 1IR1A 1GEHA 2VPWB 2HBRB 1GXUA 7FDRA 4KO0A 2ZDOA 2XMMA 1NK8A 3C6TB 2QFIA 3V81A 2GO9A 5A8RA 4HR2A 5IZHA 4JI8J 1X4EA 1WC4A 4LF9J 2QA4G 1RTIB 3FRZA 1HHTP 2H3EB 1P1TA 3N6MA 5I3UA 3J80Y 4RUHA 3MTKA 4W92B 2W25A 4PG4A 4F67A 5F8NA 2YNFB 3SI8A 1GX5A 2H5IB 4DCPB 1UJ5A 3OSNA 4ZVEA 1JLGB 5F3ZA 4RW7B 2R2TA 4HI1A 1S0MA 2OP5A 3MOZA 3RZAA 2B9XA 1SV5B 2D9PA 1XQIA 2L48A 1C2PA 3AJ2A 3CWJA 1IBMF 2BABA 4KR0B 4HT5A 3CCES 4L72B 1CQMA 1EAYC 3J7YU 2CVIA 1Y00A 2DGSA 2YQ1A 4IH5A 2QC3A 4F4YA 2WRMA 5KG1A 3P96A 2C1EB 3S7RA 2L9WA 1UVJA 4DFKA 3BSNA 2AGOA 2GVDA 1VDHA 5IOLA 2GC8A 3RB3A 5KFPA 3I96A 4NCBA 5KFGA 4HI2A 3G8QA 4CRJA 5DJBA 2P9GA 1Q16B 1GAOA 1H7XA 3DRSA 2VG5A 3CD5A 1IBMJ 4PWDA 1HI0P 3RAMA 1HFEL 2N3OA 1VFJA 2FJBB 4ZPBA 2UXCF 2C2DA 1NSQA 2KVQE 3FJ2A 1X5OA 4YR2A 4P75A 1LWCB 2DNGA 3OHBA 2V2VA 1ITPA 4RW4B 1CULA 4NI2B 2HMIA 8ATCB 1B0PA 3KLGA 3MEGB 3BYPA 1Y10A 3I0RB 1GMWD 3T5JA 2YKQA 1TP7A 2DXEA 1ZS6A 3CTRA 5HP1A 4QIWD 4CM0A 2PI5A 3PYGA 2B7BB 2BE7D 2GGPB 3AFGA 2WVEA 4B9TA 1V3ZA 1R0AB 1KEKA 1MMLA 2FLLA 2FC8A 5HROA 3OPKA 1IBLF 1MU2A 2G4BA 4OYOA 4XTTA 4GO5X 3W9JA 1T9WA 2CRLA 2UXCJ 5KFQA 5J1EA 2I9SA 2KG1A 1C4CA 3DMJA 2MZJA 1JLQA 2BACA 3NGDA 2HHTA 3MAQA 5C24B 5ETMA 1S1UB 1RWWB 4OZ3A 3GIMA 3KHRA 2HWTA 5AE2A 2E5HA 1AT1B 3K59A 2FJXA 4ZP8A 3MCSA 2DNYA 2V50A 1RCXB 3FBBA 4I2PB 1VIOA 2BA9A 4CLFA 1XN9A 2ZDPA 4KH0B 4QWDA 1IBLJ 2YWGA 4BS2A 4RNFA 3DRXA 3BB5A 1CPZA 1VMBA 4DV5J 5IV4A 4CO3A 3MUMP 1RWXB 3TAMA 5HO4A 2XYGB 1B3TA 2DPIA 1RJJA 3FFIB 2H48B 2E7XA 1SJ1A 1U1NA 2M5YA 2A2CA 2KHDA 2MJNA 4C8OA 1QY7A 1YLXA 1FDAA 3S8SA 3NS7B 1CJTA 1NJXA 5IFMA 3H4BA 1NO8A 3CPWR 4QZVB 3CSKA 2ZNYA 2MZSA 4LF4F 5F8IA 5E2QA 2LDYA 4M5DB 4ZVTB 3KDNA 4IFVA 1QVGR 4C11A 1S7HA 3TZWA 4CLLA 2OFHX 1HA1A 3BSOA 4ZIWA 3CO0P 2P5VA 2QV6A 3N28A 9ATCB 2DR5A 2DGOA 5A8KB 3HSZA 3W1YC 2DNNA 2HEKA 2DO0A 4LF4J 4BC7A 1PGZA 2UZAA 3RGIA 2ROGA 2CPIA 2P6SA 3IFEA 3NGSA 4I4BA 3DC2A 3MDFA 1Y3KA 1KD1T 1PO6A 3B4MA 1OMSA 2ZHOA 4O3PA 3P4UB 2DGQA 4G1QB 3O2IA 1NSKL 5CYJA 3HHNB 2G2OA 3EJMA 2IVFB 2G0IA 4OJGA 2W4CA 4IG3A 3KYLA 4DN9A 1AROP 2KXHA 4ERDA 3SDEA 5IQ6A 3HM9A 1NB2A 2HHVA 2AP6A 4NRTA 3KMQA 3J80U 5F8HA 2XHWA 3MTJA 1P9QC 2B43A 1JK9B 1VQ4S 3CCSS 4R8UB 2NPFA 4N41A 4DZDA 3SCKE 3PTWA 4EBDA 3J7A1 3MMBB 3TO8A 1NAQA 2W9BA 2R7OA 5CH7B 3PY8A 3M6XA 1A6LA 1XMQF 2IYGA 1KP6A 1DLOA 3W61A 3HK2A 2D69A 1EZZB 3CDEA 5RUBA 4X4RA 1VQKS 4MIWA 4K4SA 2A6OA 4ZPCA 3G86A 3DHXA 3IS9A 4UT4A 1WUUA 2RF2A 3DM2A 3HDSA 4ZA1A 3M8QB 3IN5A 3HI9A 2XS5A 4ECSA 3RB4A 3UN3A 1XMQJ 2CZ4A 4ZCMA 2MQPA 4IUFA 3PRVA 3OQ2A 3TQEA 2RS2A 3TA1A 2HWIA 2WAQD 1LXJA 1NJZA 1LQ9A 2FVSA 1LWEB 4Y34A 4DUZF 5IT0A 3NBPA 4DPOA 2ATCB 1DQ9A 3MMAB 4OYXA 3CCLS 4RZRA 3TAPA 3EX7B 3CD6S 2HAFA 1QVFR 4KHRA 1MLAA 2LCWA 3D54A 1QSLA 1T05A 1TU0B 3OD2A 1FRLA 1K0VA 3POTB 5LXRA 5THWA 3SV4A 2R7SA 4NA3A 3ITHB 1H73A 3GFYA 1P9YA 1FK9A 4ZLJA 1YGYA 2V5HG 3MECA 1I51B 3RW6A 2VIHA 1TTHB 4DUZJ 3ISZA 2U1AA 4X4SA 3QSYB 2DXDA 1UFLA 1NPPA 5DDOC 2OGUA 4DV4F 1IR0A 2GHVC 4IOCQ 1LWFA 1PILA 4KHMA 3V5RA 4DN0A 1QAXA 1HNXF 2ACMA 4M63A 1J5OA 5ADZA 2QLJB 3PXGa 4ZJQA 2Y9HA 2EC0A 1NKCA 3IG1B 3KK3A 5D4LA 2UVVA 3NGKA 3BQ2A 2HURA 4HH1A 3DLBA 4FBUA 1TVRA 3A13A 5E3RA 2DR8A 3BPDA 4NLWA 5HMZA 2JC1A 2BQ3A 3QO9B 2H51B 1XK8A 5HVHA 3PVXA 3SXLA 1RAOA 4DV4J 5GAEU 2DH9A 4X84A 5E3AA 1CC7A 4IRDA 2GW8A 3CMES 2AW0A 4F25A 4O3NA 2LXFA 3SSSA 3K5LA 4GO7X 2OMLA 3MAAA 4J9VA 2IC3B 2ZVIA 2RNEA 1R0BG 3K89A 1TL4A 4KKOA 3KJVA 1GFWB 3MAHA 2C3UA 4WTYA 4ECTA 4USVA 4QIGA 2JHEA 3QBCA 4ID8A 3TP2A 2MKIA 2MMYA 4OI3A 2FLPA 4X62F 2CQHA 1FKAF 2DHAA 2CQ4A 2ASJA 4DR7F 1QTMA 5KFCA 3NWGA 3B82A 1VHIA 1XERA 3T5HA 4PR6A 2BXJA 3MI7X 4UOGA 3A4TA 3IWXA 3ETOA 4USKA 1S49A 3HT3A 3D7SB 5KT4A 2BOPA 2FUG9 3RG6A 5J1PA 1X9WA 3R2DJ 3M4XA 4HTJA 4DQPA 3JTNA 4UY8T 2XC9A 4M1KA 1RYRA 1SKWA 2YPYA 2GS8A 4X62J 3C2PA 4R25A 2IYIA 3AD7C 3BGUA 3HT0A 4L75A 2BE9B 3TOQA 4LFBF 3CO9A 3M30A 2CJKA 4O44A 5BYRA 2CPHA 3R1LA 4UTGA 2J8SA 3MZIA 4LIWA 3RYLA 2HGNA 1UJ4A 4P9SA 3SFUA 4LFCF 1H74A 4LJMA 1SKUB 2HFNA 2HHXA 5KG4A 1HMVB 1XTZA 4OYWA 4C7QA 2OPPA 2FVCA 2PA3A 2OD4A 3G96A 4RU2A 2RDIA 4EBCA 3UDCA 3W64A 1NK9A 2HHUA 2AJFE 3H4DA 5DDQC 4K59A 4LFBJ 1RTDB 2H65B 3BREA 1CS4A 3T19A 1F9EB 1PJ7A 4PG5A 3VQSA 2AMCB 1HD0A 3ZZOA 3U02A 2LFVA 4LFCJ 5H9EJ 1OY9A 1S6QB 2IRXA 4KPCA 1HWUA 1VC6A 1HR0F 2FHKA 4ID5B 1WDTA 3M7VA 1X5TA 4X64J 2D9OA 2V8VA 2BM1A 3I87A 1KQFB 2D3ZA 4OX7A 2EFNA 2PMHA 2FD2A 3PR5B 1QAIA 1S59A 4X66F 3V6KA 2BQUA 1SC4B 2ZKUA 3OL6A 3PYDA 3T9NA 2RQMA 3OV7A 3KMSA 2DRBA 1BD6A 1VRQC 3RBXA 4OX6A 1Q82T 2XLIA 2DNHA 4WP8A 4GVLA 4OJHA 4DPYA 3GTYX 2J76E 4NLVA 3GR0A 1HBNB 4ZVFA 2DKOB 5KOXA 2BRKA 4IFYB 4FXWA 3OT9A 3OL9A 3P6YC 4DV2F 2G0CA 4ELTA 4U7CA 2XO7A 5K8PA 4B3RF 3CVKA 4ED3A 2PMWA 1RGVA 2MHNA 3SCIE 2YNGA 2CPZA 4USHA 2MXYA 1Q86T 2J0WA 3TNVA 1NDPA 1YWXA 1VISA 3PYFA 3HKWA 5GMEA 4X65J 5AXMA 4ANCA 4OLOA 5D15A 2YQ0A 3G9CA 5AXKA 4OX8A 2QL9B 2ZUGA 3EGVA 2QGFB 4F02A 2R7UA 1SL2A 3BO3A 4CLSA 2UVRA 4FDFA 3TZXA 4URGA 4YR0A 5LXYA 2CQ0A 4PKDB 2ASYA 5BJRA 3KK2B 5DG8A 1XNQF 1OPZA 4DV2J 4C0HA 2XZDB 1X9SA 1WC3A 2F8HA 2XZTB 4KB7A 4B3RJ 1DJ0A 3MM9A 1SL0A 2Q43A 1URNA 3D0IE 3KDOA 2XB2D 2MQQA 5DM7Q 3BEGB 2JFDA 1KNZA 4B9NA 2M2BA 4RPFA 2FIUA 4QQBA 3L09A 4UQGA 1PYSB 5D6GA 2FB0A 2AD9A 2G1DA 3EGWB 2GAHC 1XNQJ 2VBXA 1LK5A 1RHUB 2ZH7A 3LGMA 1E6YB 2VC1A 4DL4A 4CYUB 1URRA 1FCAA 2IM3A 3R5CA 4EU0A 1AUSL 4PZVA 3HHLA 1BQNA 5KT3A 5A6PA 5CYMB 3M2RA 3ADAC 2XMTA 4FXVA 1H6KX 5D3GA 1C1CB 2K3KA 2W24A 3EDQB 3OFHA 4L73A 3P3DA 3BS9A 3NNAA 1TUVA 1VBKA 3HPOA 3VALA 5KFAA 1KQGB 1NSAA 5E33A 3EGZA 1KTQA 3VCDA 4ES2A 2W9CA 1VC0A 3GSDA 2GV1A 4UOCA 1FWLA 2ZKTA 2XMWA 2LQ8A 4I56A 1T9TA 2DHGA 4L3NA 3M6WA 1B0TA 1RWNB 4WJBA 1BQMA 2LXUA 1H2VZ 2CNNB 3NXZA 4OJ1A 5LL6d 2KO1A 4J7CA 1P1LA 4ECQA 3W7BA 2Z30B 2VBYA 2GQQA 3JTPA 2OKQA 1K1SA 3C15B 1S7IA 2NZ4A 2G1HA 5CYQA 4P71A 1U25A 2L9NA 2NS1B 1HYSB 3NAHA 1C0UB 4ZPWR 3H98A 4FNIA 4C4WA 3TR5A 2DIUA 1W2IA 3HKZD 3DNCA 4PG6A 3L4BC 5EGYA 2C2ZB 3M8PA 2Y0BB 3MWBA 2QA1A 2VDHA 8RUCA 3HD2A 5B0DA 2BJ3A 4KE5A 1CSJA 2ATLA 4ZHRA 4LF1A 3CDAA 2AV5A 2KB2A 3M1VA 5IT4A 3MEKA 4I68A 1HBUA 3OFGA 4MYUA 2F63A 4WE1A 2ZJRQ 3W5ZA 4FKXA 3Q8QB 1NZAA 4KC5A 4NRUA 3V6DA 3S1TA 2LKZA 1VCTA 4DPUA 4C0BA 2V8GA 5KFVA 3TANA 2B56A 5EWEA 1U0SA 2HGLA 2EKNA 1HPZB 3QJPA 2QMUB 1EETA 1WKKA 4ZP6A 1FX4A 2QYGA 3H2VE 2VOPA 3N9UC 3NY0A 5DETA 4QPTA 2WZ1A 2HVIA 4A8SA 2MPUA 5L9XA 1JNRB 2B7CB 1X4BA 2HZVA 1WG5A 2JEJA 4C8MA 1M5PC 2RH3A 5T7LA 2RAQA 4ZVPB 2YH0A 4LR9A 4CLKA 1PKUA 1TR0A 1S6UA 3NGTA 1T03B 4DFMA 3H25A 5CXTA 2OEJA 3QZ7A 2OAUA 3VAGA 1FFGB 2ZH1A 4HKQA 1VBYA 3VAKA 3KNAA 4PQUA 5ETSA 4J91A 2IA0A 2VL1A 3H42A 2UUBF 1HKAA 2ZWPA 2EK1A 2XULA 3BGFA 3IGNA 5A6WA 3LGNA 2O5DA 1TKXA 1GQEA 3DLEB 2R2UA 4WFZA 3MUTP 2D3OR 5HQMA 1FRKA 3GJRB 1KLMA 3PYEA 4OZJA 2VFTA 3DI6A 1S9GA 4DI6A 4OL8A 3AAWB 4OV1A 2A2DA 1VRTB 4DPWA 3T1HF 2IBKA 4HACB 1U6BA 4QU7A 2ZUAA 2FTRA 4WCEQ 4DSLA 2DNMA 2RDJA 3J7AN 4RKUC 4DCOB 2RKIB 2X1GA 2AQ4A 3HJFA 1ZETA 2FGOA 1QLNA 2UUWA 2GHPA 2XSFA 2WBMA 1RTZA 1XR6A 4V19J 4LF5F 3BPSP 3PEJA 1ZM9A 4TY8A 4M5IA 3GJQB 2F4FA 1R8AA 4IR9A 2CQPA 3F56A 4KYZA 3PFOA 1E6VB 2MZQA 2OPSA 3K17A 4FPRA 4P74A 1FRIA 5I42B 3T1HJ 5H9FK 4J9KA 3WIVA 2KM8B 2IRYA 3U27A 2M8DB 4WIQA 1IUJA 3W2WA 1VQ6S 5K8NA 4NLYA 3HSDA 1CULB 1S1WB 1WC1A 2DK2A 1YBUA 4CCHA 2DRAA 4WKYA 4LF5J 4DXLA 3KLEB 3IA0A 5GAGI 4WPAA 3UDLA 4HHHA 3UVJB 2IMWP 2H5EA 3OUYB 2ZFHA 4AXIA 2VBZA 4NLUA 3HFKA 1VK3A 1GT8A 2KYXA 2ZEJA 4NOHA 1FKPB 4FYYB 4ZITA 2K06A 4ELUA 3GFHA 2R4FA 2KDOA 2LLZA 4P2MA 4M95A 1SH2A 2F8EX 2M52A 1JLQB 4K0KF 5HI7A 1JLCA 2L9DA 4TU9A 1REGX 4J9MA 5DG7A 2NYHA 3HHEA 3R6GB 3DLGA 1HNIB 2H1YA 3R7SB 3TRGA 1IKYB 4ILRA 4KQZA 3BBCA 2LVWA 3KOAA 3KK1A 1X4GA 4KV8B 3AHPA 2ASDA 3DXBA 3H0PA 1KHVA 8AT1B 5KFDA 1RT4B 1S0NA 2PC6A 4YS2A 4K0KJ 3H90A 3BQ1A 2XS7A 1EKSA 2ZE2A 4YB6A 3K2YA 3M2UB 4QR1A 1KVJA 1RT2A 3OLAA 5C25A 2LDIA 5G4DA 4RW8B 5A8WB 3A12A 2F40A 3QLHB 4ZLPA 3TVZA 3O1LA 1LEOA 1NBEB 2CJQA 3I9V9 2EWHA 2VQEJ 1SJRA 3I6PA 4PUOB 1RHMB 1MW7A 1PAUB 2B4PA 2UXDF 4I7FA 1IM4A 3FDSA 3UNYA 1YJVA 3ET6B 1L3TA 1M5HA 4ETXA 5KFFA 2KH9A 4M8LA 4ZLNA 3I5BA 5KFUA 4RWXA 4X4VA 2DY9A 4LRDA 2XYPB 3CC2S 1RWMB 5D0RA 3AOBA 3A8EA 2DGWA 4YDDB 1QAYA 4JI6F 3K7RA 5KFZA 3IR6B 2EFVA 5D0EA 4K5RA 1K47A 3JSYA 3FQKA 3C8YA 1RT7B 1U0HA 3PO5A 2F3JA 1HW9A 4TY9A 1ZAWA 3NWRA 2UXDJ 4U8YA 2DNLA 2XEXA 1WF1A 2GZOA 3BSAA 3ZFVA 2C42A 5KFJA 3TI0A 4GVBB 4LSNA 1VC5A 1JKHA 4XDCA 3PJ9A 2E7VA 1TL7A 4B3MF 1FO1A 5A0YA 3Q8PB 2MKJA 2PFDA 3VVUA 5F9NA 3ICLA 3R2CJ 3MEDA 1S79A 1QJHA 2LQJA 4JI6J 1Z4UA 3DOMA 2XMKA 4DV1F 3PACA 3UD3P 2E1RA 2VDIA 3LWLA 5LMNF 2PA8D 4WYWA 3JQJA 2L41A 2WW8A 3SDEB 2CQDA 1SIWB 2YX4A 4F3MA 4X2BA 2GHWA 1DFDA 2PD1A 4JV2A 1FT8A 4QW8A 3NAIA 2BW2A 1S10A 4B3MJ 2B0GA 4F2RA 4ICLA 3G6XA 1HWKA 2ILYA 4ECUA 2VG6B 2WVFA 2K3IA 2VD3A 2AF6A 4DV1J 4G6VB 1VQYA 2C22A 1MN7A 3EUNA 5LMNJ 1HQEA 2E5IA 1LW2B 5LT5A 2VICA 2HQFA 4P73A 4Q8FA 4ITSA 4JI3J 4BBYA 3ELHA 2FJVA 1YHQS 2Y3YA 3U1MA 1FRXA 4J9UE 4J9OA 1EARA 4O3RA 3N0VA 5KG5A 2J5AA 1ZAVA 3LPEA 3FBFA 2G2ZA
chains in the Genus database with same CATH topology
4LSZB 3P4UB 2QL7B 3RJMB 3GJQB 3R6LB 2C2KB 2QL5B 2Y1LB 2HBQB 3R6GB 3NS7B 3D6HB 2XZDB 3R7SB 1QTNB 2XZTB 2C2OB 2H4WB 1SC4B 3QNWB 4JB8B 2C1EB 2XYPB 1RWMB 1RWVB 3D6MB 2CNLB 2CNOB 2QLBB 3KJFB 1I51B 1GFWB 1RHQB 2HBZB 1I3OB 2HBRB 1RWWB 1RWNB 4DCJB 4ZVTB 3SIPB 3GJTB 3IBCB 1RE1B 3R5JB 2CNNB 2H5JB 2HBYB 2FQQB 1RWKB 2DKOB 3P45B 3GJRB 4ZVOB 2CJXB 5IC4B 3IBFB 2XYHB 1RHRB 4ZVQB 1SC3B 2CDRB 2C2MB 2H54B 2CJYB 2QLJB 4ZVUB 2P2CB 1RHUB 3EDRB 4ZVRB 2QLFB 3R7NB 3R7BB 3KJNB 2H65B 1SC1B 2H5IB 3GJSB 4DCPB 1F9EB 3KJQB 1RWXB 1BMQB 2XYGB 3D6FB 1RWOB 5IC6B 1RHJB 5K20B 4DCOB 1NMEB 2CNKB 4ZVPB 1IBCB 1RHKB 2C2ZB 2QL9B 2H48B 1RHMB 2Y0BB 1PYOB 4ZVSB 1RWPB 2H4YB 1PAUB 2H51B 1QDUB 1ICEB 3EDQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LSZ B;  3P4U B;  2QL7 B;  3RJM B;  3GJQ B;  3R6L B;  2C2K B;  2QL5 B;  2Y1L B;  2HBQ B;  3R6G B;  3NS7 B;  3D6H B;  2XZD B;  3R7S B;  1QTN B;  2XZT B;  2C2O B;  2H4W B;  1SC4 B;  3QNW B;  4JB8 B;  2C1E B;  2XYP B;  1RWM B;  1RWV B;  3D6M B;  2CNL B;  2CNO B;  2QLB B;  3KJF B;  1I51 B;  1GFW B;  1RHQ B;  2HBZ B;  1I3O B;  2HBR B;  1RWW B;  1RWN B;  4DCJ B;  4ZVT B;  3SIP B;  3GJT B;  3IBC B;  1RE1 B;  3R5J B;  2CNN B;  2H5J B;  2HBY B;  2FQQ B;  1RWK B;  2DKO B;  3P45 B;  3GJR B;  4ZVO B;  2CJX B;  5IC4 B;  3IBF B;  2XYH B;  1RHR B;  4ZVQ B;  1SC3 B;  2CDR B;  2C2M B;  2H54 B;  2CJY B;  2QLJ B;  4ZVU B;  2P2C B;  1RHU B;  3EDR B;  4ZVR B;  2QLF B;  3R7N B;  3R7B B;  3KJN B;  2H65 B;  1SC1 B;  2H5I B;  3GJS B;  4DCP B;  1F9E B;  3KJQ B;  1RWX B;  1BMQ B;  2XYG B;  3D6F B;  1RWO B;  5IC6 B;  1RHJ B;  5K20 B;  4DCO B;  1NME B;  2CNK B;  4ZVP B;  1IBC B;  1RHK B;  2C2Z B;  2QL9 B;  2H48 B;  1RHM B;  2Y0B B;  1PYO B;  4ZVS B;  1RWP B;  2H4Y B;  1PAU B;  2H51 B;  1QDU B;  1ICE B;  3EDQ B; 
#chains in the Genus database with same CATH topology
 4OHW A;  2P8I A;  2K7K A;  3RBD A;  4RL1 A;  3EM1 A;  2CQ2 A;  3V4I A;  1DRZ A;  3ZZU A;  1OQ3 A;  4U95 A;  1U7L A;  3NEK A;  3LP1 A;  1N6Q A;  2BM0 A;  4AL5 A;  4FF2 A;  2ZNZ A;  3QNW B;  1UVN A;  2OMO A;  2CZ9 A;  2BJE A;  1NLK L;  3MPY A;  3I32 A;  4YHH F;  5CQG A;  1DUR A;  3SBM A;  3W62 A;  4DX7 A;  1FWP A;  2HG4 A;  5I4M A;  4E8U A;  4QU6 A;  4IH6 A;  1SVD A;  4ZMM A;  4LQ3 A;  3QT7 A;  3A1Y G;  1RAG B;  5F8G A;  2Q79 A;  1FA0 A;  4N76 A;  3J81 U;  1R3N A;  2QA2 A;  2WB4 A;  2ZBC A;  2AGQ A;  2VV5 A;  2DJW A;  3EXY A;  2XY5 A;  1YIT S;  1HBM A;  4LRC A;  1RT3 A;  1YG0 A;  3HHD A;  5C42 A;  4PWU A;  5K8M A;  3NMR A;  4MKB A;  3GII A;  2DR7 A;  3TAQ A;  4JI1 F;  1FK9 B;  4PRF A;  3KHG A;  4OYB A;  4KH1 B;  5I3P A;  2XM3 A;  2W4D A;  3IGV A;  4UST A;  2CJA A;  2UUT A;  3GCX P;  2GA7 A;  2R7T A;  1JJC B;  1IXK A;  3PHE A;  1NK6 A;  3H40 A;  2W01 A;  2JRS A;  3FKB A;  3AT1 B;  1I3O B;  1NKE A;  1X7V A;  3CNQ P;  1J27 A;  2B9E A;  3QYY A;  4RNH A;  4CO0 A;  2IFX A;  1YZ6 A;  3HVT B;  2I5J B;  3LAN A;  5D4O A;  1TK0 A;  4JI1 J;  3UPF A;  1B64 A;  2Q3P A;  3QIP A;  1RQ0 A;  5M2U A;  1UPM B;  5HAN A;  5F0W A;  3R1H A;  3BF4 A;  2J6T A;  1BGX T;  4Q44 A;  3U7J A;  1CVJ A;  4LRB A;  3VAI A;  2GJ2 A;  4NPO A;  2ALY B;  1IVZ A;  4YFU A;  4F7V A;  3RAQ A;  4LIR A;  4HEA 9;  2Z58 B;  1QAJ A;  4KIA A;  1F9F A;  4F36 A;  4H4O A;  4IG0 A;  2Q1L A;  2AEJ A;  1RAD B;  4JI2 F;  2HVE A;  5L38 A;  4R5P B;  4ZVH A;  2W2M P;  2A10 A;  3J7Z T;  4DBQ A;  2K1R A;  1DTT B;  3BV8 A;  4Y0F A;  1C1B B;  2B51 A;  2GMH A;  5IM0 A;  4IO1 A;  1S1V B;  1V3S A;  2OPR B;  3U1N A;  2V63 A;  2NUU G;  5KG7 A;  4JV1 A;  1Y3J A;  2F9J A;  2HVH A;  1YJU A;  3PX6 A;  1R27 B;  1D0E A;  5J2Q A;  2C2E A;  2GML A;  4P7T A;  3GQC A;  3BR8 A;  5GAG U;  3TUJ C;  5B0C A;  4B3O B;  2J7W A;  4JI2 J;  2RHS B;  3ZTS A;  2AX0 A;  1YJN S;  2FHJ D;  3D2W A;  3QSI A;  5KFB A;  4N7T A;  2HHW A;  4YDX A;  2V2Q A;  6AT1 B;  1YI2 S;  1N54 B;  2BE2 B;  1X5P A;  1G1X A;  4O4G B;  4EK2 A;  1N4L A;  4DS4 A;  1SJF A;  1S72 S;  4LBH A;  1SUQ A;  1CJV B;  1S0V A;  3N01 A;  3MCN A;  4CH0 S;  4RX6 A;  1TKZ A;  3QJL A;  1FKO A;  2KJW A;  2B4U A;  4LF8 F;  1RSC A;  1UPP A;  3WC2 A;  3DGP B;  4CDI A;  4Q8E A;  3IM9 A;  1BE4 A;  3VAM A;  2HZC A;  2OPQ A;  4NCG A;  2LP4 A;  3OTO F;  2UU9 F;  2I6W A;  3LP2 A;  4TNO A;  5D78 A;  2MQ8 A;  2V4J A;  2B8Q A;  2J9C A;  2MKC A;  4C98 A;  4DCJ B;  2HWH A;  1ZYQ A;  3LH2 S;  4RW6 A;  1FEE A;  1SBR A;  3K5N A;  1R43 A;  4K4Y A;  3D68 A;  2W4P A;  5E3Q A;  2EXU A;  4FKY A;  3P49 B;  1N33 J;  5D4P A;  4Q7A A;  2E5L J;  2K8G A;  1FWK A;  4P2F A;  4ZVU B;  2N82 B;  4OYP A;  4KT0 C;  4OHX A;  4LF8 J;  2B3T B;  3R7N B;  3EIC A;  3M2V A;  4B3S F;  2MTL A;  1O5J A;  1OWX A;  1OQ6 A;  3KLV A;  3PFE A;  1XMB A;  3OTO J;  2UU9 J;  1HWJ A;  1DZ5 A;  1JB0 C;  4DL3 A;  2XSJ A;  1QDU B;  2BJ9 A;  1S1X A;  4Q0B A;  1B0V A;  2ZBP A;  3TQ1 A;  3RAX A;  3VHQ A;  1B7Y B;  1U6Z A;  3UDE A;  2MGZ B;  2GVZ A;  1RT1 B;  3KLF B;  2YKO A;  1WI8 A;  2YNH A;  1M5K C;  3KG4 A;  2O3D A;  4KPY A;  5HBM A;  3DOK A;  2HHP A;  3GB0 A;  1KVK A;  5T14 A;  4JB8 B;  1IKV B;  3OLB A;  3EVO A;  1C0T B;  4OV6 A;  3K58 A;  4QR0 A;  3MD3 A;  2MKY A;  1GMU A;  3CDB A;  3CCQ S;  1WEZ A;  2W7P A;  1RT6 A;  1NU4 A;  2HND B;  3T5L A;  4TLR A;  3M6V A;  1FD8 A;  2IDL A;  1BQX A;  1K9M T;  1YKW A;  1RU1 A;  2LXI A;  5L8R C;  4OZL A;  4DV0 F;  1U1K A;  5IC4 B;  4B9M A;  4QJV A;  3IM8 A;  4ZS6 A;  1GXT A;  3ZNJ 1;  2HHS A;  3IAM 9;  1U2C A;  3GON A;  2ZD1 B;  4HL9 A;  4PWW A;  4IH7 A;  3CF5 Q;  2MHE A;  4DPT A;  3T1A A;  2EFP A;  3RBE A;  3EGN A;  2HIQ A;  2VA3 A;  2UV8 A;  1ULR A;  3OR2 B;  4RW9 A;  1N5Y A;  2JLF A;  3RBZ A;  2Z2L A;  1YJR A;  2GAG C;  1WOS A;  3PV8 A;  2HBQ B;  3Q8V A;  3OW2 R;  1RCO B;  1F2H A;  2ACY A;  4A8X A;  3J81 j;  4AD6 A;  4CWB A;  3JYT B;  1H2U X;  1HNZ F;  1BWE A;  3QMQ A;  3M8W A;  1FFS B;  3ILO A;  3OTD A;  2DY1 A;  4MK7 A;  4LF6 F;  2CNL B;  1IKW B;  1RWU A;  2OSQ A;  3K8V A;  4WK1 A;  3QRQ A;  5DGA A;  1L5U A;  4NA1 A;  2KT3 A;  3ISN D;  5F0U A;  1RAH B;  1U2R A;  3HLU A;  4DSF A;  4DL6 A;  4MFB B;  4N47 A;  2RD5 C;  3QZ8 A;  1MNE A;  4KGM A;  3I5C A;  3M2R B;  1RA7 A;  2CWK A;  3Q2S C;  2AYG A;  4ZVO B;  1Q5Y A;  1Y4Z B;  1RTH B;  3IBW A;  1N32 F;  3TUP A;  2A6M A;  4A8K A;  5JJB A;  2ZWO A;  3R7B B;  4Q2L A;  4DZ6 A;  3CC7 S;  4ZOS A;  2GIR A;  3KHH A;  4LF6 J;  1N5V A;  3QFW A;  2XI3 A;  1V6H A;  3CJT A;  2MEW A;  4NLP A;  1YJ7 A;  3LAM A;  4RUB A;  2YWK A;  2JEF A;  2YNI B;  3RRK A;  3PW0 A;  4Y3C A;  4FVM A;  1V3R A;  2NSB A;  2V2Z A;  1KOH A;  4MKA A;  1OSD A;  1KWM A;  4RBU A;  1MN9 A;  5B09 A;  4DOZ A;  1NK7 A;  5GAH I;  4BDP A;  4LVN P;  1N5Q A;  4N8O A;  4ECR A;  5ETV A;  1S9E A;  1AUD A;  3WBZ A;  3CJK B;  2ZM6 J;  4DHV A;  5KG0 A;  2WVD A;  4KTQ A;  5GAD U;  4HHJ A;  1APS A;  1JLB A;  3DYA A;  1I94 F;  2CAD A;  4NL5 A;  2A1B A;  2OJ3 A;  1T9U A;  3OSP A;  1WC5 A;  2MQM A;  1EHW A;  1NKB A;  4DX6 A;  2KM8 C;  1SJ4 P;  3G82 B;  3GR1 A;  1JXL A;  2VG7 A;  2AT1 B;  3RR8 A;  2R3V A;  3M8P B;  1VJQ A;  1S1T A;  4DR4 J;  5MAO A;  4ZCI A;  4H54 A;  1G7C B;  5ETP A;  1OY6 A;  1VLY A;  4LSL A;  2F1F A;  1PJ6 A;  5L9N A;  1ZM4 A;  3ZC4 A;  3ILJ A;  2BJ8 A;  1X9M A;  2OI2 A;  4PPD A;  2CXE A;  4HHU A;  1JLE B;  3V6D B;  3C6T A;  4DSI A;  1PJ5 A;  4EWT A;  4LF7 F;  2DVI A;  4WWS A;  4M5L A;  1WOO A;  3LF0 A;  4Q45 A;  4J90 A;  2XO6 A;  3CGI A;  2BX6 A;  4DR5 F;  4N8N A;  3G6V A;  1RTI A;  3TVK A;  4WTO B;  4WFY A;  2XMJ A;  4O4R A;  1YRU A;  2W7A A;  1PG5 B;  3BYR A;  5G0R B;  4EYH B;  2C2O B;  2H4W B;  5KT7 A;  2YNF A;  4LT6 A;  1ZAX A;  2IIH A;  1UEK A;  2ZBI A;  3QRR A;  1RHQ B;  1JLG A;  3FCV A;  4RW7 A;  2HKE A;  1GTH A;  5KFO A;  1SV5 A;  2LEC A;  5J2P B;  3VV2 B;  4FS2 A;  3BR9 A;  4MIB A;  4C97 A;  4LF7 J;  3W3S A;  4USW A;  1S99 A;  5M2R A;  4A47 A;  1R6V A;  5HK4 A;  4TN2 A;  2CPY A;  2WTF A;  3KFW X;  3SCL E;  2BJ7 A;  3HX9 A;  2MJU A;  3PR4 A;  3GIK A;  3OHA A;  1WWH A;  2EFQ A;  2W2N P;  3A8K A;  3HVR A;  3CJ5 A;  4DR1 F;  3AH6 A;  2DNQ A;  3MF5 A;  2MQO A;  3M9O B;  3KHL A;  4DG1 B;  1NHU A;  1PBU A;  1FJ7 A;  3D1H A;  3EXC X;  3THV A;  2GX8 A;  4Z7Y A;  3D6H B;  1IR2 A;  4ED5 A;  6FDR A;  4U9R A;  1OYE A;  1LWC A;  1V9O A;  4RW4 A;  1D9D A;  3MXH P;  4NI2 A;  3TW0 A;  4I64 A;  4MK8 A;  1RLC L;  3X1L B;  3MEG A;  5BR8 J;  2Z4P A;  2CPF A;  4DR1 J;  3AJD A;  2NSC A;  2VPZ B;  2AHO B;  3LA0 A;  4KGV B;  1Q53 A;  3X3U A;  2GGP A;  1R0A A;  2KFN A;  2COL A;  2V9K A;  4LBP A;  2P9C A;  4ECV A;  3V2U C;  1RB0 A;  1IWG A;  1MWY A;  4JI8 F;  1YJW S;  2ZOM A;  4DV6 F;  3Q24 A;  4A8Y A;  3EVM A;  2YY3 A;  4P2S A;  5IC6 B;  3DLL Q;  1NME B;  5K9F A;  2A0F B;  3T9Z A;  5C24 A;  2Z2M A;  4F8R A;  1S1U A;  4MJK A;  1Q8K A;  4YOE A;  3W8G A;  2CQ3 A;  2G2Y A;  2HQI A;  3W2V B;  1TL3 B;  2FVQ A;  1T9V A;  2Y1L B;  1VBZ A;  4YP3 A;  1HNV A;  4I2P A;  5HLF B;  1IWA A;  3PKY A;  4DV6 J;  4Z2X A;  2I2Y A;  2XQC A;  2XLK A;  3DXS X;  5ETO A;  5JVH Q;  3GWC A;  2R7W A;  5KG6 A;  3S01 A;  3DGV A;  5ITH A;  1FVS A;  2DEI A;  2OFG X;  2HHQ A;  5SUH A;  2YPZ A;  4WZM A;  2C3O A;  1X60 A;  2OUG A;  4USJ C;  3TJ8 A;  4L6V 3;  4ALZ A;  1S9F A;  1R8P A;  2QSW A;  4PG8 A;  1EJ7 L;  1D09 B;  3ZZY A;  2JLG A;  4X4U A;  4DL0 C;  3G6Y A;  2QX0 A;  1JJH A;  3JSM B;  4M5D A;  2DYA A;  3HP6 A;  3PZP A;  5C2G A;  1HI1 A;  2AJ4 A;  3G8T A;  5AE3 A;  4M5G A;  3BKF A;  4UUW A;  2J0X A;  2F7V A;  5K5M A;  3LP0 B;  2QN6 B;  4ED8 A;  1SQE A;  1SB6 A;  1RU2 A;  1RA6 A;  3CCZ A;  4CT8 A;  3CCM S;  3KJF B;  4E0D A;  2XCA A;  3B4D A;  1RT2 B;  5A8K A;  4OZ0 A;  2ZOF A;  2R2S A;  3OJU A;  2VJU A;  5F9L A;  3DDK A;  3OL8 A;  4PYD A;  4O0N A;  2QLX A;  1RT5 A;  5A76 A;  2QG9 B;  4JI7 J;  4ZKA A;  3MM6 A;  2E29 A;  4ZLL A;  2LEP A;  2PFF B;  2V94 A;  3CCR S;  4PXB A;  1HNW F;  3FRY A;  3C46 A;  2EBE A;  2DB1 A;  1UTA A;  2YWH A;  4J37 A;  3H5U A;  3L7P A;  4DUY J;  4DV5 F;  2QE5 A;  4MIA A;  2FYX A;  2FJA B;  1M0S A;  5E3P A;  2J7U A;  2Y1J A;  2HSE B;  3AB4 B;  3A3P B;  2MST A;  3DOL B;  1W2B R;  3TZZ A;  3WZ0 A;  3I55 S;  3MMC A;  3TVY A;  4R8U A;  3T41 A;  2IA6 A;  5B7W A;  2XNQ A;  5KAK A;  3D5M A;  1NHV A;  5CZX A;  1HNW J;  3MMB A;  2DNP A;  4WU2 A;  1WSR A;  4QWB A;  3OFE A;  3RRH A;  1JKH B;  3ZZT A;  2H5J B;  3OR1 B;  4K2X A;  4A8F A;  4DQI A;  2WOM B;  3B8H A;  1R6Y A;  4NMX A;  1NK4 A;  4IDK B;  3Q22 A;  3IBF B;  5L1I A;  1VBX A;  1RHR B;  4ZN3 A;  3H5X A;  4IQX A;  3E01 B;  5HAT A;  4C9D A;  4FXD A;  3SSQ A;  4DFP A;  4ECX A;  1HQ2 A;  2GO8 A;  3ZTR A;  2ZHA A;  4CNY A;  2A18 A;  5H9F J;  3M8Q A;  1CJK B;  1WJ9 A;  4NYZ A;  3PO4 A;  2CVE A;  3I82 A;  1VQO S;  2KXF A;  4ICL B;  3QGH A;  3BGR B;  2E1M C;  5KFS A;  4NLS A;  5ETL A;  5GAH U;  2OIH A;  1JLF B;  1YDL A;  3PX4 A;  1ZH5 A;  1HBO B;  1TKT B;  1H38 A;  3HSJ A;  3D6M B;  1WHX A;  1LWE A;  4B08 A;  2QLB B;  3I31 A;  3BN7 A;  1FDB A;  2DIV A;  2HNZ B;  3PM9 A;  2RU3 A;  2MKS A;  1FRM A;  4WBF A;  1HHQ A;  4B17 A;  3MMA A;  1LK7 A;  4DMZ A;  2RRN A;  2M88 A;  1NH8 A;  3P45 B;  5KFY A;  1DAR A;  3M6U A;  3EVW A;  4B9L A;  4JOU A;  3DLK B;  5JMN A;  2Q66 A;  2B5J B;  4K50 A;  3HXM A;  3Q2T C;  2EC2 A;  2J9D A;  1FNM A;  4P72 A;  3POT A;  5LSL A;  3ITH A;  4K4X A;  4CH7 A;  1BWV A;  2AIR B;  1WAC A;  3CCV S;  1UJ6 A;  2E5J A;  1KBR A;  1HI8 A;  1IJF B;  1SI9 A;  2NYI A;  3IWN C;  4BWJ A;  3VZH A;  4DL7 A;  4F0M A;  2QFJ A;  2OD6 A;  1S4E A;  2W8K A;  4K4Z A;  4CO5 A;  3L9Z A;  1H72 C;  3O6Q A;  3IG1 A;  2MLZ A;  1R8B A;  1RLD A;  1HHS A;  3KLH B;  2Q6C A;  4CLT A;  3OTB A;  2RHQ B;  2RDD A;  2R7Q A;  2FQQ B;  2MYF A;  1SH3 A;  5HMY A;  3LWM A;  1UZD A;  5C42 B;  3FCH A;  3JS9 A;  2ZZT A;  5L46 A;  3GZ7 A;  1NJY A;  3JSR A;  2DPJ A;  5HMX A;  3NKY A;  1VYA A;  2ZC4 A;  4IKA A;  3JSB A;  3KG1 A;  2OH2 A;  2IC3 A;  1L3U A;  1ZOT A;  2OLW A;  5FII A;  2MLX A;  1VRU B;  1RBA A;  2IPO B;  3HHL D;  1NPK A;  2H4Y B;  3M32 B;  3W65 A;  3FCW A;  3K5P A;  1XBW A;  1Q8B A;  2B8P A;  1N36 J;  1O8B A;  3AA9 A;  3MM5 B;  4KGZ B;  1KQS R;  2XBP A;  3GCW P;  4QYZ J;  3MOJ B;  3OVS A;  3WHI A;  4PYA A;  3M8S A;  2DD8 S;  4MMO A;  3CJQ A;  2Z2Z A;  2VZ9 A;  3QID A;  2DH8 A;  3J7Y I;  3DRP B;  2D3U A;  1S6P B;  1D9A A;  2CQB A;  2DNK A;  5DQI A;  4EUV A;  1CJU B;  4C8L A;  4CP5 A;  7AT1 B;  1UL3 A;  3CCT A;  5HSP A;  3Q8S B;  4YEA A;  1OY8 A;  5F41 A;  4FPI A;  3C14 B;  5B0G A;  3ENV A;  4M5K A;  1AZS B;  4YQW A;  4H4O B;  4YR3 A;  3TX0 A;  3AQO A;  3JXO A;  3BGL A;  3DRR B;  4FVC A;  5HJY A;  3ILI A;  1FFW B;  3A8J A;  1NXI A;  5EWG A;  1HMV A;  2V8P A;  3AXK A;  3LGH A;  3KLI B;  3M9N B;  2RIJ A;  3IRX B;  1N8R T;  2QMW A;  2QL7 B;  1NM2 A;  3IRW P;  1NK0 A;  1EIY B;  2UP1 A;  1IKX B;  4BC9 A;  2KHC A;  2BRL A;  1DBD A;  3I56 S;  5LM7 E;  2CIM A;  3EYZ A;  2I1R A;  5FDL B;  2QEX S;  5KFW A;  2AX1 A;  2KZZ A;  1VGY A;  1RTD A;  1W7W A;  1YVF A;  3I0S B;  2OSR A;  3MEE A;  3MM8 A;  3FMB A;  4NX9 A;  1D8Y A;  2VQF J;  2UUA F;  2QIF A;  1KDN A;  1OJ4 A;  4TYA A;  3NCR A;  1S6Q A;  2PI4 A;  4PAA A;  1WKJ A;  2GQC A;  4ID5 A;  4LBI A;  5J2M B;  1FI4 A;  1REV B;  2FLN A;  4Z7C A;  2B4O A;  3HHL C;  5ETT A;  1FHT A;  3H7H B;  3LUY A;  2FDN A;  1T3O A;  2HS0 A;  2MKH A;  4IRC A;  3MR2 A;  2YH1 A;  1DQA A;  3FBC A;  3MM7 B;  1FVQ A;  1B4S A;  2B6A B;  3NGU A;  4JI4 F;  3IR5 B;  2UUA J;  5KFK A;  3I9Z A;  4NE9 C;  2XMV A;  3PJX A;  1HBN A;  1RAE B;  5CAB A;  3DU6 A;  1UW9 A;  4IFY A;  3FEY B;  1UWB B;  2YKM A;  2IJN A;  3LAK A;  2CPX A;  1D9F A;  5KT2 A;  4BWM A;  3TA0 A;  5KT6 A;  4B02 A;  1U1Q A;  2XY6 A;  2JEI A;  3TJ9 A;  2BKP A;  4J9N A;  1RK8 A;  4DR2 J;  4ZN1 A;  2MZ1 A;  3M2V B;  5EHH A;  1A9N B;  5J2N B;  4JI4 J;  3Q23 A;  2BUN A;  3EPG A;  5EN1 A;  2V2K A;  1BC6 A;  1F1B B;  2KJV A;  5AE1 A;  2PDA A;  1IQZ A;  1X31 C;  3KK2 A;  5E3C A;  4XO0 A;  4HLB A;  4JUZ A;  4F4Z A;  1VQP S;  2KN4 A;  2QLW A;  4I2Q B;  3VAF A;  2D1C A;  4AFF A;  4KFB B;  5EDW A;  2DCU B;  1XJW B;  4ZVG A;  4F4K A;  1WEX A;  1LWX A;  3BO2 A;  3AA8 A;  3VQT A;  5T41 A;  1MRO B;  5FJ4 A;  3G87 A;  4WYL A;  1HLW A;  4OI1 A;  1LFP A;  1KON A;  4X64 F;  2Z0G A;  4FNH A;  2E44 A;  3PW4 A;  4V19 X;  2ZH9 A;  1E6Y A;  4CYU A;  2MY7 A;  1YBA A;  4DR3 F;  5F8M A;  5CYM A;  1FXL A;  3HUL A;  2XMU A;  4A4J A;  1T8E A;  1WD6 A;  1BLU A;  1F0X A;  1C1C A;  1OIA A;  2R7X A;  2XTJ P;  3EPI A;  1AYE A;  1Y5L B;  3Q83 A;  2EVZ A;  4FYX B;  3A8I A;  4OLP A;  3QT8 A;  3UN2 A;  1S57 A;  2UVU A;  2M70 A;  3PW2 A;  3G71 S;  4ED7 A;  1RTJ B;  4DQQ A;  4OYZ A;  3UR0 A;  3S6E A;  2DNR A;  4C8N A;  3TZY A;  2RU9 A;  4DR3 J;  4X65 F;  1T95 A;  1WC6 A;  3CCJ S;  4LF2 A;  3C6U B;  4A48 A;  4Y2A A;  4O23 A;  2ZZN A;  1T11 A;  5DQG A;  4EGL A;  4RBV A;  4ATN A;  3VGS A;  3GLJ A;  3SCJ E;  1VS3 A;  2GQ2 A;  2I8E A;  2IM0 A;  4LFA F;  4AYB D;  2F8M A;  2Y1R I;  1HYS A;  3HZE A;  2CNO B;  1C0U A;  5D0G A;  4B3T J;  4RJV A;  3NGR A;  1AFJ A;  2VF3 A;  4E98 A;  4NCA A;  4DX5 A;  1T94 A;  3OXF A;  5E7O B;  1EQ0 A;  4U8V A;  3UDV A;  5CCL A;  2HYI B;  2R8I A;  4FP9 A;  2ZH6 A;  1TV6 B;  3GV5 B;  3VWS A;  3AQP A;  2HZA A;  4CLZ A;  1Q79 A;  1NDK A;  2RQK A;  1YK9 A;  4ES1 A;  4K8R A;  1M1G A;  4ZP7 A;  2OEK A;  4GKJ J;  2JVO A;  4DDF A;  3IR7 B;  3GJS B;  2VH7 A;  1U1P A;  4LFA J;  4DL5 A;  2KI2 A;  1HD1 A;  4H4M B;  3JQK A;  4ZPA A;  4TU8 A;  3ZZP A;  4OHZ A;  4PXC A;  2F5G A;  1CG2 A;  1VQ5 S;  3BKT A;  4A46 A;  2IMO A;  3T5K A;  3DYA B;  3MCO A;  3GIJ A;  1HPZ A;  3K5M A;  1FER A;  1F5A A;  4UZC A;  1QUV A;  1NH7 A;  5KFX A;  3EE3 A;  3JAM Y;  3BSC A;  1AA1 B;  1YQH A;  2VG7 B;  4U6P A;  2BAN B;  1RDR A;  4CLY A;  4JBC A;  1DTQ B;  4CO1 A;  4FF1 A;  3H5Y A;  1F3V A;  4DLG A;  4LSL B;  2K7J A;  2FLO A;  3CD0 A;  4CTA B;  1SKR A;  1T03 A;  3EWG A;  1X4H A;  3RW7 A;  2EI5 A;  3CJ2 A;  3UCU P;  1QE1 B;  5LSO A;  4ZIV A;  2R8G A;  2VKR A;  1RAF B;  2PSZ A;  1Q7Y T;  5DLG A;  3FVY A;  3QRP A;  2ROE A;  2HK2 A;  2YWW A;  2K2P A;  2YKN B;  4KJI A;  4DV3 F;  1VQM S;  3D1O A;  3R27 A;  1JLA B;  4JV5 F;  2DIS A;  3GPA A;  3DLE A;  2IAJ B;  2VOO A;  5C5J A;  2NXN A;  3SQG B;  4G1I A;  5B0E A;  2FHM A;  2MZR A;  4FYV B;  3UFC X;  1TFW A;  5B08 A;  1VRT A;  2RML A;  1IQT A;  1M5O C;  1PIE A;  1QSY A;  1EP4 A;  4HAC A;  4Y28 C;  4C6A A;  3GFX A;  2W8L A;  1O0P A;  5GAE I;  4QW9 A;  2RT3 A;  2HBZ B;  3CUN A;  4M5J A;  4GC6 A;  2BEF A;  2DO4 A;  2RKI A;  3GJT B;  4CLU A;  4DV3 J;  1RIS A;  2FHO B;  4JV5 J;  2N3L A;  4F0H A;  4X4Q A;  4K4U A;  2ZH2 A;  3VAH A;  1N0U A;  2IM1 A;  2ROP A;  1S48 A;  2DEJ A;  5JVG Q;  2RRA A;  5K14 B;  2DNZ A;  1SC1 B;  1OPI A;  3ZO7 A;  1M90 T;  1E6V A;  3C16 B;  3LTO A;  4IR1 A;  4NWB A;  5I42 A;  2W7O A;  3HD1 A;  4GC7 A;  2HPU A;  3GMG A;  1LNQ A;  1NCL A;  1PYO B;  2BJ1 A;  4LRE A;  4QBU A;  3D67 A;  2PEH A;  3UR3 C;  1S1W A;  2DR9 A;  5FLX U;  3ZZR A;  4L76 A;  4I0W A;  2J6S A;  1DQ8 A;  4O3S A;  1U1O A;  2ZH3 A;  5CHC B;  3KLE A;  3H2L A;  2HLT A;  2VOD A;  2EG2 A;  2KYZ A;  2OTL S;  2ABY A;  5E0O A;  1KKH A;  3UVJ A;  3MPW A;  3OUY A;  1HQU B;  2YWF A;  1WI6 A;  3MR3 A;  1WKL A;  2FZK B;  5LSR A;  5KFR A;  5KOW A;  1FKP A;  1LW0 B;  4MTP A;  4J9S A;  4J9R A;  1NK5 A;  4LMZ A;  5EWF A;  4F04 B;  4HH0 A;  4YB5 A;  4C2M A;  4ANE A;  4R0E A;  1Q1K A;  2DRD A;  2VFS A;  2AYM A;  1XIQ A;  3AXM A;  1KVI A;  4P6Q A;  1HNI A;  3BQ0 A;  2NQP A;  2IDE A;  3BDE A;  2V68 A;  1IKY A;  2DGX A;  4MKY A;  1HNV B;  4EBE A;  1XEZ A;  4AXJ A;  3QJJ A;  4KO0 B;  4KV8 A;  1T02 A;  3V81 B;  1U6F A;  5A8R B;  3QAE A;  5I3U B;  4QIE A;  3FBE A;  1U26 A;  4F50 A;  1RT4 A;  2DGU A;  3ZTP A;  3VAJ A;  3M2U A;  4DWI A;  3GG0 A;  2J9D E;  2VFV A;  4DR6 F;  3CT9 A;  3AOA A;  3E2E A;  5IT9 U;  4RW8 A;  4C3L A;  5A8W A;  3BBF A;  1TKD A;  3LW5 C;  2Z2Y B;  4MH8 A;  2F65 A;  3MR7 A;  2QA4 S;  2AU0 A;  5HVG A;  4OI2 A;  1YSJ A;  5IWA F;  3JB9 k;  3QLH A;  5KFL A;  2JWN A;  1HAR A;  2NR0 A;  4PUO A;  4W98 A;  2NXU A;  1IJE B;  5KFE A;  4WP9 A;  1G2E A;  1X4A A;  2HFO A;  4Y00 A;  1Q4R A;  1RBL A;  4ED2 A;  4IOB A;  3ET6 A;  4CIO A;  2X51 A;  2B9Y A;  5GMK a;  2V69 A;  2M4M A;  2GVD B;  3NRB A;  4ZJO A;  1OSC A;  4DR6 J;  1SKS A;  3QPI A;  3TJA A;  3R5G A;  5ETR A;  2UXB F;  5IWA J;  1S76 D;  3GG1 A;  5IV3 A;  3DRS B;  2VG5 B;  3MUV P;  4PWD B;  2RVJ A;  1RT7 A;  3RJM B;  6FD1 A;  1TAU A;  4FN5 A;  3JAM U;  4LR8 A;  4PXD A;  1BUX A;  1RP5 A;  2HMI B;  1DAX A;  2CKW A;  3KLG B;  2JJ4 D;  4E2F B;  1RT5 B;  4JI5 F;  4GVB A;  4A8Q A;  2VPX B;  4NEZ A;  4EMD A;  3MM6 B;  3SFG A;  3IAS 9;  1IBK F;  2HRU A;  4I6A A;  1TAQ A;  1FTR A;  2RIL A;  2C3P A;  5HP1 B;  4QOT A;  2C3Y A;  1JQG A;  3DN9 A;  3ZZZ A;  2E1C A;  4QWA A;  3PG9 A;  2UXB J;  2VFR A;  5HRO B;  4ED0 A;  3V6H A;  1MU2 B;  5JXS A;  3OBI A;  3J81 Y;  1S0O A;  1UVI A;  1KR4 A;  1RYS A;  4I6W A;  3ZTO A;  4UZB A;  3CMA S;  3UCZ P;  3JTO A;  5J1E B;  2CJY B;  1PC4 A;  4AQY F;  2IJR A;  4HDG A;  2P2C B;  2X3G A;  3DMJ B;  4ZPT R;  4I1T A;  1MWQ A;  2M9K A;  4JI5 J;  2V34 A;  4OFZ A;  1RHJ B;  4UQT A;  2JH3 A;  2F9D A;  1YJT A;  3MMC B;  1TMJ A;  4USM A;  1IBK J;  1UEU A;  1R89 A;  1VR6 A;  2VG6 A;  4IO9 Q;  2ASL A;  3CJR A;  1KQK A;  4FF3 A;  1S4F A;  3TUZ C;  2QTW A;  2VQE F;  4F3O A;  4IQM A;  2KT2 A;  5F8J A;  1W25 A;  1TQL A;  2QMX A;  2B9W A;  2PE8 A;  2V4Q A;  1Q5V A;  2BKO A;  1WG1 A;  1LW2 A;  2N7Y A;  2RUG A;  2VJV A;  4J5O A;  3WC0 A;  4AQY J;  3TAM B;  1KLN A;  3DHW C;  2O01 C;  4YB7 A;  4G65 A;  2X1B A;  4I67 A;  2YVS A;  3CIM A;  2BOA A;  1D8Z A;  2J8A A;  4URS A;  1TEL A;  4U96 A;  2QJ3 A;  4NEY A;  2EG1 A;  4NXN F;  1ZA1 B;  1CJT B;  3D6T B;  3LQV A;  3AY0 A;  3VGU A;  2N7C A;  1XR7 A;  3Q0A A;  3B54 A;  1OS5 A;  3E3X A;  1XC9 A;  2CWX A;  2KFY A;  4UY8 5;  2YX1 A;  1SIZ A;  3C66 A;  1YJ9 S;  1Z1Z A;  4IFV B;  3MD1 A;  4G1P A;  1JX4 A;  1ZA2 B;  4C11 B;  3H2U B;  3GIL A;  1VI7 A;  3WQP A;  4ZDN A;  2EK6 A;  3H8Y A;  3SEO A;  4NXN J;  4DSJ A;  4ES3 A;  5EUH A;  5KT5 A;  1F5C A;  4QYZ K;  2KXN B;  2E7W A;  4GMK A;  1F6T A;  2IRU A;  4WFA Q;  1BXN A;  5IS2 A;  3F44 A;  3A3N B;  5HAO A;  2SXL A;  1XNR F;  2BW7 A;  2WCX A;  2MLY A;  4AE5 A;  2HGM A;  1B7F A;  3IXQ A;  1LKZ A;  2L3M A;  3Q8R B;  2CQI A;  2Y0S D;  2ZH4 A;  4IG3 B;  4ZCK A;  2BYC A;  1AW0 A;  3NL0 A;  2OTJ S;  1GX6 A;  3KJQ B;  1SH0 A;  5A2Q Y;  4RBT A;  2AEF A;  3CUL A;  3AB2 B;  4JI3 F;  5LOQ A;  4KAI A;  3CCU S;  3Q8Y A;  2NXE A;  1HIY A;  1XNR J;  1WEL A;  1NHK L;  2FGC A;  2XWY A;  3HVT A;  2I5J A;  1JIH A;  2AGP A;  4HT7 A;  1WDD A;  5ETQ A;  1Z2L A;  4WKR A;  1SJ3 P;  5DS7 A;  4XK8 C;  2CQG A;  1QTN B;  1J5E F;  4B9S A;  3CDW A;  1WSV A;  2W9B B;  4NAS A;  1BY9 A;  4B9V A;  1DLO B;  3H59 A;  2R8J A;  4O3Q A;  1HNX J;  3OTE A;  5HVF A;  2NUH A;  2DCL A;  1CLF A;  2ZH5 A;  1H2T Z;  1D1U A;  1GXL A;  1CC8 A;  3GYG A;  3IS9 B;  1FXR A;  4KRW A;  1RAB B;  2RF2 B;  3DM2 B;  2YQ3 A;  1F9H A;  4R5P A;  3SV3 A;  5HN0 A;  4IYQ A;  3CIZ A;  4AL7 A;  2E1A A;  2HNY A;  4NZ0 A;  1GMW A;  1J5E J;  1DTT A;  1Y0H A;  3H5S A;  2WSF C;  3N4W A;  1C1B A;  1NB7 A;  4ENO A;  3HFV A;  5C2C A;  1S5Z A;  3ENQ A;  3PW7 A;  1S1V A;  3RUB L;  2OPR A;  4C8Y A;  1EQM A;  1FDD A;  1X4F A;  4TXS A;  2VUG A;  2RE1 A;  4NLR A;  2R7R A;  5MLC V;  1M1K T;  3F73 A;  1S97 A;  2LU2 A;  3OFF A;  4OIX A;  1SJQ A;  1I1G A;  3SSR A;  3QT6 A;  1CQN A;  1UCN A;  4B3O A;  2ILZ A;  5CD4 A;  1UFK A;  2G13 A;  2E66 A;  1ZM2 A;  4C3K A;  3D0H E;  3CW2 C;  3NBP B;  1M5S A;  1SQF A;  4KGK A;  2XLJ A;  4DR7 J;  2LEB A;  2BE2 A;  2VBW A;  2DNO A;  1AFI A;  2DBB A;  1VOM A;  4TU7 A;  4O4G A;  2LA6 A;  3BDP A;  2J9E A;  4A8M P;  1T05 B;  2CYY A;  1NJW A;  1TUW A;  1RBO B;  2NZC A;  1JXV A;  1CJV A;  2HVD A;  4MT1 A;  4PCQ A;  4F3Q A;  1RAA B;  3MEC B;  3DGP A;  3UQS A;  2NRE A;  1P6T A;  3MPU B;  3HMJ G;  3P8B B;  2AWZ A;  3DDN A;  1LWF B;  1G4C A;  4F0K A;  4USU A;  4B9U A;  5FD1 A;  1X8D A;  3MEE B;  3MM8 B;  1R8H A;  4DF4 A;  4RU9 A;  4DFJ A;  1KFD A;  3Q89 A;  1J5O B;  2D74 B;  2X1F A;  3KK3 B;  2FPH X;  4N77 A;  3TX8 A;  2JC0 A;  3RTV A;  5SZT A;  3WX8 A;  4OI0 A;  4YME A;  1TVR B;  4DQS A;  1VJW A;  4TQR A;  4C48 A;  4OZ5 A;  2ZBQ A;  2WSC C;  2IY5 B;  3N6N A;  2ERR A;  4ED6 A;  1G3O A;  3FGV A;  5DZ6 A;  4K4V A;  5KFN A;  2R42 A;  4LVO P;  2Y8W A;  4ILM A;  1L3V A;  2MGZ A;  3MAA B;  1RT1 A;  2QSF A;  3TA2 A;  3KLF A;  1PBA A;  2AJ1 A;  2Z56 B;  4UW2 A;  2FJW A;  2MY8 A;  2QLF B;  4KKO B;  3KJV B;  1HR0 J;  1U2F A;  1IKV A;  3MFI A;  1WNE A;  4M5M A;  4K5S A;  1C0T A;  2YKM B;  2JEG A;  3HZG A;  1JMT A;  4NXM F;  5EX3 A;  2HND A;  1OYD A;  5D0H A;  4X66 J;  3AOC A;  3FUY A;  4XIU A;  2QL5 B;  4K2J A;  4FYW B;  4D3H A;  2JVR A;  3NCP A;  4ZK7 M;  4OHV A;  1H3D A;  3BM7 A;  3M8Y A;  4A8O A;  4M94 A;  3US5 A;  1R31 A;  2ZD1 A;  3DLH A;  4L74 A;  4N56 A;  4FBT A;  1UEV A;  2WHO A;  3SIP B;  4TKT A;  3DFE A;  2HBY B;  3OR2 A;  3LOU A;  1K0T A;  4NXM J;  2I38 A;  1F3F A;  3M30 B;  3HCX A;  3EZ5 A;  4O44 B;  1TMM A;  2DT9 A;  4I6Y A;  5A2Q U;  2H9Z A;  2LEA A;  3VGV A;  2QT7 A;  3EDR B;  4JP8 A;  1U09 A;  3JYT A;  1N33 F;  2E5L F;  1IKW A;  1O51 A;  2OPP B;  4KBI A;  1TL5 A;  3KG0 A;  1RAI B;  5KFH A;  2VFU A;  1HL6 A;  4CH1 A;  1WF2 A;  4F4A A;  2WVB A;  3G2X A;  3BJY A;  4MFB A;  3NNC A;  2AJ2 A;  1Y5I B;  4RNN A;  1CS4 B;  4U7U K;  4WU3 A;  3HSG A;  1RTH A;  3AJ1 A;  2DHX A;  1L3S A;  5D77 A;  2JOQ A;  3B78 A;  5CCM A;  4QWE A;  4DLE A;  5KFM A;  2YNI A;  2XG8 A;  4K4T A;  5DQH A;  2CJB A;  3PJW A;  1YRT A;  4PPZ A;  2HFZ A;  4Y65 A;  3IC1 A;  9RUB A;  1IN0 A;  2R2R A;  2OHD A;  2XWX A;  4OZ1 A;  2VC0 A;  3O3L A;  1FES A;  2NPI A;  3PNI A;  3TUI C;  3CJK A;  1F2G A;  2J0Q D;  2HVZ A;  5JUM A;  3DKD A;  4CO4 A;  1YIJ S;  4RO0 A;  4YUD A;  3KUG A;  1LOU A;  4WXW A;  3CD7 A;  3ZZ0 A;  5L1L A;  2HRY A;  4S0M A;  1WHW A;  2ZBR A;  3G82 A;  2W2Q P;  3O44 A;  5DRK A;  2RUS A;  3W9H A;  2L08 A;  1QSS A;  4XPC A;  2YNG B;  1V5I B;  2ZH8 A;  4ZCL A;  4BHQ A;  1I6J A;  1WHY A;  2CQ1 A;  2HFS A;  4FS1 A;  1B99 A;  3QGI A;  1SCJ B;  4NLD A;  4TYB A;  3FK4 A;  1D3W A;  3CMQ A;  1N5T A;  1LXN A;  2XZW A;  3R3T A;  2FY8 A;  1RE1 B;  2GNK A;  5D4N A;  4PG7 A;  1JLE A;  1U1M A;  3MFH A;  3NS6 A;  1KSP A;  4P10 A;  4HVZ A;  2BQR A;  3EMT A;  3MM9 B;  5F3T A;  2E5G A;  4OYM A;  4ZVR B;  3BZQ A;  4H4K C;  2FZC B;  2QYC A;  4WFN Q;  5G0R A;  1RKJ A;  3EZU A;  1FE4 A;  2HW3 A;  4NLO A;  3W66 A;  1N34 F;  1HWL A;  4DV7 F;  4MYT A;  3QWU A;  4M5N A;  1EB0 A;  1XR5 A;  2JSX A;  5E5N A;  5CA5 A;  1RZM A;  1RXO B;  5J2P A;  1U8S A;  4ER8 A;  2CA9 A;  2D3O 1;  3G6E S;  1TL1 A;  3CE8 A;  3HHL B;  1BQN B;  2YTC A;  2PMZ D;  4AL6 A;  1KC8 T;  2XMA A;  1AB8 A;  4NLQ A;  1YX2 A;  1MMN A;  1KN6 A;  2XGP A;  4Q2M A;  1FEH A;  2ZJP Q;  5D3G B;  4NLX A;  2ZM6 F;  1N34 J;  3TWZ A;  2KRB A;  4DV7 J;  4C0O C;  4DG1 A;  1PC5 A;  5B0B A;  4LRA A;  2CJX B;  2WK4 A;  3T6J A;  4ED4 A;  2FVR A;  2H54 B;  2W9C B;  3CJ8 A;  2R8K A;  2CDQ A;  1QM9 A;  3KJN B;  4D3G A;  4X4T A;  4F4W A;  3BBB A;  2ZIT A;  2CPE A;  4MK9 A;  4DR4 F;  2RJZ A;  4X4N A;  2CQC A;  3NOG A;  1BQM B;  1N0V C;  2Q6B A;  1NJI T;  2WON A;  4HDH A;  3L3C A;  5BXI A;  1Q8I A;  2UV8 G;  1EP4 B;  3O5T B;  2FC9 A;  2CG8 A;  5J1N A;  2UUB J;  5DDR C;  4ZP9 A;  5CYQ B;  3RU0 A;  1JJ4 A;  2VB6 A;  2DXF A;  3M8Z A;  2CJ9 A;  3NNH A;  1FX2 A;  4ILL A;  2AKW B;  1FRH A;  1UW4 A;  1RWV B;  3D4J A;  4NML A;  5AXL A;  3RB0 A;  1WTF A;  1EX8 A;  2JLE A;  4ZHR B;  1JXE A;  4W4M A;  3M1V B;  1UA1 A;  1ZBT A;  2V8H A;  4HTI A;  2M3D A;  3W2V A;  1HBU B;  2PT0 A;  1TL3 A;  4MKV A;  4WE1 B;  2E9R X;  2VU5 A;  4JV0 A;  5HLF A;  3QGP A;  3GU0 A;  5C7P A;  1NDL A;  1Q81 T;  3MMJ A;  4X4O A;  2PEB A;  3AOD A;  1TK5 A;  2HIY A;  3W5Y A;  1R8C A;  2EPI A;  2VON A;  3ISN C;  2HLU A;  4PEO A;  1EET B;  4EZ9 A;  3D0G E;  4AUK A;  1TUG B;  2DHH A;  1Q78 A;  2BVZ A;  3ONQ A;  3ZNU A;  1Y7P A;  3EZO A;  3IP0 A;  2N4D A;  3OL7 A;  1UKU A;  3N5F A;  2FVP A;  3KUE A;  2FY1 A;  1VQ7 S;  4PQA A;  3W9I A;  3NLC A;  1KFS A;  5T7L B;  1XWL A;  4AT1 B;  1WG4 A;  4YB1 P;  2KG0 A;  1VQL S;  4TLQ A;  4ZPD A;  2HQG A;  1MMD A;  2DGT A;  3QAT A;  2MB0 B;  3MPD A;  3JSM A;  5BR8 F;  3CJ3 A;  2XYH B;  3NOC A;  5DZ7 A;  4QIV A;  4PQU B;  1K44 A;  4J9P A;  5KFI A;  2VAS A;  2Z8Q A;  3MUR P;  3LP0 A;  7FD1 A;  4IRK A;  1HWI A;  3MHY A;  2KFZ A;  3LAL A;  4CO2 A;  1TKX B;  4DPX A;  1RHK B;  2UVW A;  2KZM A;  4ZVS B;  1PAE X;  5LJ3 Y;  2BJD A;  4XAK A;  2AZ3 A;  2D41 A;  1XMO F;  5HMW A;  1KLM B;  4EI2 A;  1TZ0 A;  4UOH A;  3DI6 B;  1S9G B;  4QWC A;  3CJ4 A;  5HQ8 A;  3SYZ A;  1O6X A;  3I0R A;  3FSX A;  1SXL A;  2NXJ A;  1EKR A;  1T0T V;  2RQC A;  4UUX A;  1YTY A;  1S6O A;  2AZ1 A;  1NDC A;  5AT1 B;  5KG2 A;  1U1L A;  4UOF A;  4WF9 Q;  2AYB A;  3D9B A;  4RUA A;  2IVY A;  3D3B J;  3FMW A;  2GIF A;  3GIR A;  4G3I A;  3IBC B;  2AJQ A;  1U1R A;  2VHG A;  1RKI A;  4TY8 B;  1NND A;  3NP5 A;  2GJF A;  1P27 B;  3VTI A;  1XMO J;  4QIF A;  1JWW A;  2FJE B;  2J6U A;  3DOL A;  2OPS B;  2M7S A;  3OJS A;  2PII A;  4FYD A;  2JNJ A;  3PHT A;  1U8W A;  3D6F B;  3W2W B;  4CZC A;  4F2S A;  1S12 A;  1FNX H;  1LFW A;  4M5H A;  2HQC A;  5CAA A;  2ZOG A;  2BDP A;  3OR1 A;  5L1J A;  2WOM A;  3R6L B;  3PW5 A;  1N48 A;  3PEH A;  5DM6 Q;  4IDK A;  1VQ9 S;  3AD9 C;  3GV7 B;  1H0H B;  3FC9 A;  3FFI A;  3ZTQ A;  4XPE A;  4OQJ A;  3D3C J;  2X3D A;  5B0A A;  5E41 A;  1UA0 A;  2YKP A;  1RAJ A;  4LQ9 A;  3E01 A;  4WK3 A;  3E8O A;  4DQR A;  3QAU A;  1T7P A;  2X7I A;  3Q8U A;  4CLW A;  1FXD A;  1ZTW A;  4Q43 A;  2C28 A;  1CJK A;  3SZ2 A;  1JLC B;  2XHC A;  4XDD A;  1I5O B;  2JDJ A;  1UMJ A;  2KT5 A;  3DLG B;  2GIQ A;  2LQB A;  3BGR A;  5KG3 A;  2DTJ A;  1JLF A;  1X4C A;  4O3O A;  3KK1 B;  3CXC R;  1HBO A;  1OO0 B;  4JI7 F;  1TKT A;  2DR6 A;  1UVK A;  4C8Z A;  2OO4 A;  3P5T L;  4K7Q A;  3GE9 A;  1KOO A;  5DG9 A;  4CM2 A;  1N88 A;  4KY3 A;  1Y5N B;  2CFX A;  5H1S V;  4CT9 A;  2QZ8 A;  2HNZ A;  1A7G E;  1K8A T;  4DF8 A;  1Q8L A;  3J7Z 5;  2ZE2 B;  3MPV A;  2ALZ A;  1QUP A;  4DUY F;  2ADC A;  3PRD A;  3K8W A;  2HQD A;  5C25 B;  1X4D A;  2RB7 A;  4CI0 B;  1SC6 A;  2ZC3 A;  4O0I A;  3DLK A;  3PDN A;  1GNK A;  1JNZ B;  4Z37 A;  3FSY A;  2Y1I A;  3KTQ A;  2B5J A;  3H20 A;  4IOA Q;  4EEY A;  2V8D A;  3HVA A;  4EZ6 A;  4RNM A;  2KU7 A;  3N79 A;  4G1Q A;  5D8H B;  1C4A A;  2GJI A;  3NG8 A;  4DU7 A;  3R5A A;  1PYT A;  3BKU A;  2JL9 A;  2GCF A;  4CLP A;  4I7F B;  5BYQ A;  2EEY A;  5LMU F;  2J7K A;  3U1L A;  2FJD B;  2HFV A;  1WOR A;  3WIU A;  4JYA F;  3GV8 B;  4NLG A;  2I0X A;  1U48 A;  2KVI A;  5KFT A;  5GAD I;  3CC4 S;  2V67 A;  3KXD A;  2YWE A;  3AD8 C;  3DCA A;  4KSE B;  4OHY A;  2XS2 A;  2R7V A;  1G6B A;  2EFO A;  5K20 B;  2DH7 A;  4Y2M A;  1VK8 A;  5IXU A;  2OEL A;  1UET A;  1UZH A;  2JFK A;  1U0H B;  3N6L A;  1VHF A;  3DU5 A;  2DHS A;  3KLH A;  4AND A;  1ICE B;  4EO8 A;  1B70 B;  3CDU A;  5LMU J;  3M05 A;  4EO6 A;  4LRF A;  1MSW D;  4JYA J;  1UVL A;  3JQM A;  3GP9 A;  2VKZ G;  4LSN B;  1FJG F;  4WXO A;  4YHH J;  1TL7 B;  5L1K A;  3OXG A;  5A0Y B;  4P7V A;  1ACM B;  1VLO A;  2LQ9 A;  1WTB A;  3MED B;  2J0S D;  4W90 B;  3TEH B;  3DOM B;  2E9Z A;  2PN6 A;  3IO1 A;  3UCG A;  2LYV A;  1T3N A;  1SQG A;  1VRU A;  2NXC A;  1SL1 A;  1ROF A;  3M32 A;  4OYI A;  4NLT A;  4KGX B;  5AXN A;  3Q86 A;  2V4R A;  4ED1 A;  3OXL A;  3FQL A;  3MM5 A;  2WVC A;  2RQ4 A;  2C2M B;  1GK8 A;  5HJX A;  1FJG J;  3W8P A;  1Q0N A;  1NEE A;  3W60 A;  5DLF A;  1UVM A;  2B4V A;  3D66 A;  2D7S A;  3MR6 A;  2ZHB A;  1Q95 G;  4V1A k;  2U2F A;  1Z2Z A;  3FZ2 A;  3ZXW A;  1N52 B;  3RR7 A;  3DRP A;  2CAJ A;  1S6P A;  4LSZ B;  1HQE B;  5U47 A;  3D28 A;  1CJU A;  2LMI A;  4J9L A;  4L3K A;  4RR5 A;  4WII A;  3PIP Q;  3VZI A;  2MSS A;  3LO3 A;  2NLW A;  1R7I A;  2XY7 A;  3V6J A;  2WSE C;  3HFZ B;  3C14 A;  4OI4 A;  3QGG A;  1AZS A;  2M8H A;  1FJC A;  1DY3 A;  3HHK A;  3OVB A;  5H9E K;  2C2N A;  2W9A A;  4DL2 A;  3DRR A;  2JZ5 A;  2HNY B;  3R5J B;  3RB6 A;  1H7W A;  2AEM A;  1LV5 A;  3V4I B;  4QCL A;  4A8W A;  1VIX A;  1YZ7 A;  4C3M A;  5DGB A;  3KLI A;  2HK3 A;  3UW1 A;  3VF0 B;  1TFY A;  3IRX A;  2QO3 A;  3RRG A;  4YN3 B;  3LP1 B;  2G0J A;  1N6Q B;  1K1Q A;  1IKX A;  1FDN A;  1CBK A;  3FEZ A;  3NCQ A;  2C2R A;  5FDL A;  2HAI A;  1S77 D;  3K5O A;  3T1Y F;  1YBT A;  3I0S A;  4YY3 F;  2EBG A;  2C3M A;  1RUS A;  1WF0 A;  4CNZ A;  5J2M A;  2CG4 A;  5K8O A;  5GVQ A;  1REV A;  3SQO P;  2IHR 1;  4P2X A;  3OTC A;  3QO9 A;  5EX0 A;  1N36 F;  4OI6 A;  1HBM B;  1Q7L B;  2P9E A;  2HS4 A;  1RT3 B;  2O67 A;  3O8W A;  3MM7 A;  3T1Y J;  4NYO A;  3THP A;  3I4P A;  1UP1 A;  2HQ3 A;  3TYT A;  2B6A A;  1AXQ A;  1NUE A;  4YY3 J;  3PCO B;  4Q5V A;  3M8R A;  2KTQ A;  1X0P A;  3HO1 A;  1MG7 A;  2RSQ A;  1NZ8 A;  3M9M B;  5HL7 Q;  1ZPW X;  1U49 A;  2BV3 A;  1VQN S;  3R8Y A;  1A0O B;  4ECY A;  4ECZ A;  2LA4 A;  1UWB A;  2V6A A;  3KWM A;  3R97 A;  1U45 A;  3MR5 A;  1MWZ A;  1R0C B;  2FZG B;  1J2V A;  3HVW A;  3CCW A;  4QYR A;  3LPY A;  5IQQ A;  5J2N A;  4ZJL A;  4N5S A;  1X0F A;  4RNO A;  2APO A;  3QIP B;  1NRK A;  5DO2 A;  5KTQ A;  5BYS A;  3K0J A;  3NMA A;  1QD1 A;  4WZQ A;  4Y2C A;  2AJ0 A;  3WDO A;  4EYI B;  2JX2 A;  2Y8Y A;  4I2Q A;  2XNR A;  2ADB A;  4OMF G;  3P5B P;  4WP3 A;  1DHM A;  3PX0 A;  4NA2 A;  5M2P A;  4IG0 B;  3CJ0 A;  3PRB A;  4KFB A;  1RWK B;  3PIO Q;  3DRY A;  3TAR A;  4B3S J;  2DIT A;  3F41 A;  2VQF F;  4GRS A;  4Y2I A;  2IJF A;  1T9X A;  3L7U A;  2K1R B;  1ELO A;  5DDP C;  4DU8 A;  1MRO A;  1M1H A;  2WB1 D;  4PAB A;  1V5V A;  3VGT A;  5IM0 B;  4RUC A;  4C8K A;  3FSI A;  2LQ5 A;  3VR1 A;  3GYX B;  3QQC D;  3BH6 B;  3K57 A;  1WC0 A;  5J2Q B;  1WOP A;  4NZ6 A;  5ETK A;  3SMZ A;  2MKK A;  4U67 Q;  1VQS A;  3UWT A;  1TK8 A;  4OZN A;  2VA2 A;  2ZVS A;  3GFZ A;  2YKA A;  4PXE A;  2DGV A;  1ZM3 A;  3E51 A;  4BLG A;  3ILL A;  1RTJ A;  4FF4 A;  5L39 A;  1FTC A;  4JI0 F;  4DV0 J;  2XCP A;  2O1P A;  3QFH A;  4OJ3 A;  1FE0 A;  4UF4 A;  1SUQ B;  3IMQ J;  3QT5 A;  2A3J A;  2CPJ A;  2O66 A;  1WEY A;  3D1Q A;  1TKZ B;  4DR2 F;  1FKO B;  2G9O A;  3C6U A;  4K4W A;  1ZZN A;  4CQ1 A;  3BO4 A;  2EW9 A;  4F4X A;  2E9T A;  1YRX A;  2CDR B;  2KRR A;  5HQL A;  2OPQ B;  4NCG B;  4R0J A;  2X1A A;  3LP2 B;  1RAC B;  1FJE B;  1T9Y A;  2R9L A;  1ZZF A;  2KKH A;  4Y6I A;  2BKN A;  2AYE A;  2POK A;  2V4J B;  3QWP A;  2M0G B;  1WHV A;  3F0N A;  4RW6 B;  4OX9 F;  4KHP F;  4JI0 J;  2BBE A;  1FNO A;  4BCA A;  1BHN A;  3DDI A;  4WFX A;  1FD2 A;  2YBV A;  1HNZ J;  2GMJ A;  3FNN A;  1HW8 A;  3HF5 A;  3UN5 A;  1TV6 A;  4WFB Q;  3G4S S;  1F5B A;  3V4M A;  1UAW A;  3FZB A;  3L7O A;  1NPR A;  4DS5 A;  4F26 A;  4LR7 A;  1Y9O A;  4RLE A;  2XSJ B;  4USI A;  1K73 T;  2Z57 B;  4Y2K A;  1S1X B;  2WBR A;  4H4M A;  4OX9 J;  4Q0B B;  1GTE A;  2VPY B;  4GKK F;  4KHP J;  2EFG A;  3MCM A;  1N32 J;  2GVZ B;  2MQN A;  4ETZ A;  2XI2 A;  3VVT A;  2WW4 A;  4NZ7 A;  2V0N A;  1ZTT A;  1U02 A;  2YNH B;  2HHH F;  5HBM B;  3DOK B;  4QR2 A;  1P8G A;  3GYN A;  2N4C A;  2E1P A;  5B0F A;  1RI7 A;  2W1B A;  3KNG A;  1JJ2 R;  2F4V F;  2IVM A;  3TEG A;  1ZPV A;  1VQ8 S;  3G8S A;  3UI3 A;  2BAN A;  1RT6 B;  3ENW A;  1KRP A;  4QPX A;  3GSI A;  5FLX Y;  1DTQ A;  4OYA A;  3FEX B;  3THT A;  2OEM A;  3ULH A;  1X5S A;  2ZZM A;  4GKK J;  3MGJ A;  4CTA A;  4DX8 H;  4OZ2 A;  3C19 A;  1PCA A;  2C2K B;  1W26 A;  2V9W A;  3A3O B;  1KTV A;  5CD4 H;  4ELV A;  2W2O P;  2HHH J;  1I94 J;  3R5B A;  1QE1 A;  3L95 X;  3HJV A;  1M5V C;  2PO4 A;  5I3Q A;  5AJ3 F;  2RS8 A;  2HFU A;  2IBO A;  2F4V J;  4RW9 B;  1N5Y B;  3C3L A;  3T6B A;  4NYP A;  1Y11 A;  4U7U D;  1F60 B;  2YKN A;  3N5B A;  1KHW A;  1JLA A;  4B3T F;  2IAJ A;  2RRB A;  4J9Q A;  3SQG A;  4P52 A;  3CJS A;  3OVA A;  2UUC F;  1IM6 A;  3KKF A;  3W63 A;  1UWA A;  5ETN A;  1NSP A;  2W2P P;  1RWO B;  5AJ3 J;  1N5S A;  2BZ2 A;  1KS2 A;  1IBC B;  3C15 A;  4DR5 J;  4GKJ F;  1GH8 A;  1U4B A;  2QRR A;  2MDA A;  3NS5 A;  1TL1 B;  4TQS A;  3I5A A;  2KL8 A;  3UO0 A;  3R9L A;  2YXL A;  1UFW A;  4RWW A;  2CPD A;  3ETM A;  5IT9 Y;  2EKY A;  3UD5 A;  1H98 A;  4ECW A;  4LUB A;  2UUC J;  3R5D A;  5K14 A;  3UNG C;  2R8H A;  1U47 A;  2XGQ A;  2MQL A;  2MZT A;  2YX7 A;  3UD4 P;  1FRJ A;  3IWL A;  3C16 A;  4X4P A;  5CZV A;  5F8L A;  2PGC A;  3BH7 B;  4DSK A;  1N56 A;  2HRT A;  3ENA A;  2HS3 A;  5LJ5 Y;  4FZV A;  2GFF A;  4I69 A;  3T3F A;  2IM2 A;  2CUY A;  3W5X A;  2WON B;  2ZJQ Q;  4ZVQ B;  1SC3 B;  1S9E B;  2CZV C;  2FHJ A;  1CEZ A;  3BN4 A;  2BR0 A;  2P6T A;  1FF2 A;  1JLB B;  2LU1 A;  4HYK A;  3CED A;  3BGO P;  1BMQ B;  3DLJ A;  3I4H X;  1L3K A;  3WX4 A;  1HQU A;  2CNK B;  4MAK A;  4ZPV R;  4DSE A;  1PSD A;  1RWP B;  4LF9 F;  1GMV A;  1LW0 A;  4DJB A;  3KUH A;  3B6B A;  3PKM A;  4TVA B;  1SPB P;  1S1T B;  4DUT A;  4EFA C;  3UE2 A;  2BMB A;  2NCK L;  4H4K A;  3CB4 A;  4DEZ A;  4URQ U;  1U24 A;  5GMD A;  1IR1 A;  1GEH A;  2VPW B;  2HBR B;  1GXU A;  7FDR A;  4KO0 A;  2ZDO A;  2XMM A;  1NK8 A;  3C6T B;  2QFI A;  3V81 A;  2GO9 A;  5A8R A;  4HR2 A;  5IZH A;  4JI8 J;  1X4E A;  1WC4 A;  4LF9 J;  2QA4 G;  1RTI B;  3FRZ A;  1HHT P;  2H3E B;  1P1T A;  3N6M A;  5I3U A;  3J80 Y;  4RUH A;  3MTK A;  4W92 B;  2W25 A;  4PG4 A;  4F67 A;  5F8N A;  2YNF B;  3SI8 A;  1GX5 A;  2H5I B;  4DCP B;  1UJ5 A;  3OSN A;  4ZVE A;  1JLG B;  5F3Z A;  4RW7 B;  2R2T A;  4HI1 A;  1S0M A;  2OP5 A;  3MOZ A;  3RZA A;  2B9X A;  1SV5 B;  2D9P A;  1XQI A;  2L48 A;  1C2P A;  3AJ2 A;  3CWJ A;  1IBM F;  2BAB A;  4KR0 B;  4HT5 A;  3CCE S;  4L72 B;  1CQM A;  1EAY C;  3J7Y U;  2CVI A;  1Y00 A;  2DGS A;  2YQ1 A;  4IH5 A;  2QC3 A;  4F4Y A;  2WRM A;  5KG1 A;  3P96 A;  2C1E B;  3S7R A;  2L9W A;  1UVJ A;  4DFK A;  3BSN A;  2AGO A;  2GVD A;  1VDH A;  5IOL A;  2GC8 A;  3RB3 A;  5KFP A;  3I96 A;  4NCB A;  5KFG A;  4HI2 A;  3G8Q A;  4CRJ A;  5DJB A;  2P9G A;  1Q16 B;  1GAO A;  1H7X A;  3DRS A;  2VG5 A;  3CD5 A;  1IBM J;  4PWD A;  1HI0 P;  3RAM A;  1HFE L;  2N3O A;  1VFJ A;  2FJB B;  4ZPB A;  2UXC F;  2C2D A;  1NSQ A;  2KVQ E;  3FJ2 A;  1X5O A;  4YR2 A;  4P75 A;  1LWC B;  2DNG A;  3OHB A;  2V2V A;  1ITP A;  4RW4 B;  1CUL A;  4NI2 B;  2HMI A;  8ATC B;  1B0P A;  3KLG A;  3MEG B;  3BYP A;  1Y10 A;  3I0R B;  1GMW D;  3T5J A;  2YKQ A;  1TP7 A;  2DXE A;  1ZS6 A;  3CTR A;  5HP1 A;  4QIW D;  4CM0 A;  2PI5 A;  3PYG A;  2B7B B;  2BE7 D;  2GGP B;  3AFG A;  2WVE A;  4B9T A;  1V3Z A;  1R0A B;  1KEK A;  1MML A;  2FLL A;  2FC8 A;  5HRO A;  3OPK A;  1IBL F;  1MU2 A;  2G4B A;  4OYO A;  4XTT A;  4GO5 X;  3W9J A;  1T9W A;  2CRL A;  2UXC J;  5KFQ A;  5J1E A;  2I9S A;  2KG1 A;  1C4C A;  3DMJ A;  2MZJ A;  1JLQ A;  2BAC A;  3NGD A;  2HHT A;  3MAQ A;  5C24 B;  5ETM A;  1S1U B;  1RWW B;  4OZ3 A;  3GIM A;  3KHR A;  2HWT A;  5AE2 A;  2E5H A;  1AT1 B;  3K59 A;  2FJX A;  4ZP8 A;  3MCS A;  2DNY A;  2V50 A;  1RCX B;  3FBB A;  4I2P B;  1VIO A;  2BA9 A;  4CLF A;  1XN9 A;  2ZDP A;  4KH0 B;  4QWD A;  1IBL J;  2YWG A;  4BS2 A;  4RNF A;  3DRX A;  3BB5 A;  1CPZ A;  1VMB A;  4DV5 J;  5IV4 A;  4CO3 A;  3MUM P;  1RWX B;  3TAM A;  5HO4 A;  2XYG B;  1B3T A;  2DPI A;  1RJJ A;  3FFI B;  2H48 B;  2E7X A;  1SJ1 A;  1U1N A;  2M5Y A;  2A2C A;  2KHD A;  2MJN A;  4C8O A;  1QY7 A;  1YLX A;  1FDA A;  3S8S A;  3NS7 B;  1CJT A;  1NJX A;  5IFM A;  3H4B A;  1NO8 A;  3CPW R;  4QZV B;  3CSK A;  2ZNY A;  2MZS A;  4LF4 F;  5F8I A;  5E2Q A;  2LDY A;  4M5D B;  4ZVT B;  3KDN A;  4IFV A;  1QVG R;  4C11 A;  1S7H A;  3TZW A;  4CLL A;  2OFH X;  1HA1 A;  3BSO A;  4ZIW A;  3CO0 P;  2P5V A;  2QV6 A;  3N28 A;  9ATC B;  2DR5 A;  2DGO A;  5A8K B;  3HSZ A;  3W1Y C;  2DNN A;  2HEK A;  2DO0 A;  4LF4 J;  4BC7 A;  1PGZ A;  2UZA A;  3RGI A;  2ROG A;  2CPI A;  2P6S A;  3IFE A;  3NGS A;  4I4B A;  3DC2 A;  3MDF A;  1Y3K A;  1KD1 T;  1PO6 A;  3B4M A;  1OMS A;  2ZHO A;  4O3P A;  3P4U B;  2DGQ A;  4G1Q B;  3O2I A;  1NSK L;  5CYJ A;  3HHN B;  2G2O A;  3EJM A;  2IVF B;  2G0I A;  4OJG A;  2W4C A;  4IG3 A;  3KYL A;  4DN9 A;  1ARO P;  2KXH A;  4ERD A;  3SDE A;  5IQ6 A;  3HM9 A;  1NB2 A;  2HHV A;  2AP6 A;  4NRT A;  3KMQ A;  3J80 U;  5F8H A;  2XHW A;  3MTJ A;  1P9Q C;  2B43 A;  1JK9 B;  1VQ4 S;  3CCS S;  4R8U B;  2NPF A;  4N41 A;  4DZD A;  3SCK E;  3PTW A;  4EBD A;  3J7A 1;  3MMB B;  3TO8 A;  1NAQ A;  2W9B A;  2R7O A;  5CH7 B;  3PY8 A;  3M6X A;  1A6L A;  1XMQ F;  2IYG A;  1KP6 A;  1DLO A;  3W61 A;  3HK2 A;  2D69 A;  1EZZ B;  3CDE A;  5RUB A;  4X4R A;  1VQK S;  4MIW A;  4K4S A;  2A6O A;  4ZPC A;  3G86 A;  3DHX A;  3IS9 A;  4UT4 A;  1WUU A;  2RF2 A;  3DM2 A;  3HDS A;  4ZA1 A;  3M8Q B;  3IN5 A;  3HI9 A;  2XS5 A;  4ECS A;  3RB4 A;  3UN3 A;  1XMQ J;  2CZ4 A;  4ZCM A;  2MQP A;  4IUF A;  3PRV A;  3OQ2 A;  3TQE A;  2RS2 A;  3TA1 A;  2HWI A;  2WAQ D;  1LXJ A;  1NJZ A;  1LQ9 A;  2FVS A;  1LWE B;  4Y34 A;  4DUZ F;  5IT0 A;  3NBP A;  4DPO A;  2ATC B;  1DQ9 A;  3MMA B;  4OYX A;  3CCL S;  4RZR A;  3TAP A;  3EX7 B;  3CD6 S;  2HAF A;  1QVF R;  4KHR A;  1MLA A;  2LCW A;  3D54 A;  1QSL A;  1T05 A;  1TU0 B;  3OD2 A;  1FRL A;  1K0V A;  3POT B;  5LXR A;  5THW A;  3SV4 A;  2R7S A;  4NA3 A;  3ITH B;  1H73 A;  3GFY A;  1P9Y A;  1FK9 A;  4ZLJ A;  1YGY A;  2V5H G;  3MEC A;  1I51 B;  3RW6 A;  2VIH A;  1TTH B;  4DUZ J;  3ISZ A;  2U1A A;  4X4S A;  3QSY B;  2DXD A;  1UFL A;  1NPP A;  5DDO C;  2OGU A;  4DV4 F;  1IR0 A;  2GHV C;  4IOC Q;  1LWF A;  1PIL A;  4KHM A;  3V5R A;  4DN0 A;  1QAX A;  1HNX F;  2ACM A;  4M63 A;  1J5O A;  5ADZ A;  2QLJ B;  3PXG a;  4ZJQ A;  2Y9H A;  2EC0 A;  1NKC A;  3IG1 B;  3KK3 A;  5D4L A;  2UVV A;  3NGK A;  3BQ2 A;  2HUR A;  4HH1 A;  3DLB A;  4FBU A;  1TVR A;  3A13 A;  5E3R A;  2DR8 A;  3BPD A;  4NLW A;  5HMZ A;  2JC1 A;  2BQ3 A;  3QO9 B;  2H51 B;  1XK8 A;  5HVH A;  3PVX A;  3SXL A;  1RAO A;  4DV4 J;  5GAE U;  2DH9 A;  4X84 A;  5E3A A;  1CC7 A;  4IRD A;  2GW8 A;  3CME S;  2AW0 A;  4F25 A;  4O3N A;  2LXF A;  3SSS A;  3K5L A;  4GO7 X;  2OML A;  3MAA A;  4J9V A;  2IC3 B;  2ZVI A;  2RNE A;  1R0B G;  3K89 A;  1TL4 A;  4KKO A;  3KJV A;  1GFW B;  3MAH A;  2C3U A;  4WTY A;  4ECT A;  4USV A;  4QIG A;  2JHE A;  3QBC A;  4ID8 A;  3TP2 A;  2MKI A;  2MMY A;  4OI3 A;  2FLP A;  4X62 F;  2CQH A;  1FKA F;  2DHA A;  2CQ4 A;  2ASJ A;  4DR7 F;  1QTM A;  5KFC A;  3NWG A;  3B82 A;  1VHI A;  1XER A;  3T5H A;  4PR6 A;  2BXJ A;  3MI7 X;  4UOG A;  3A4T A;  3IWX A;  3ETO A;  4USK A;  1S49 A;  3HT3 A;  3D7S B;  5KT4 A;  2BOP A;  2FUG 9;  3RG6 A;  5J1P A;  1X9W A;  3R2D J;  3M4X A;  4HTJ A;  4DQP A;  3JTN A;  4UY8 T;  2XC9 A;  4M1K A;  1RYR A;  1SKW A;  2YPY A;  2GS8 A;  4X62 J;  3C2P A;  4R25 A;  2IYI A;  3AD7 C;  3BGU A;  3HT0 A;  4L75 A;  2BE9 B;  3TOQ A;  4LFB F;  3CO9 A;  3M30 A;  2CJK A;  4O44 A;  5BYR A;  2CPH A;  3R1L A;  4UTG A;  2J8S A;  3MZI A;  4LIW A;  3RYL A;  2HGN A;  1UJ4 A;  4P9S A;  3SFU A;  4LFC F;  1H74 A;  4LJM A;  1SKU B;  2HFN A;  2HHX A;  5KG4 A;  1HMV B;  1XTZ A;  4OYW A;  4C7Q A;  2OPP A;  2FVC A;  2PA3 A;  2OD4 A;  3G96 A;  4RU2 A;  2RDI A;  4EBC A;  3UDC A;  3W64 A;  1NK9 A;  2HHU A;  2AJF E;  3H4D A;  5DDQ C;  4K59 A;  4LFB J;  1RTD B;  2H65 B;  3BRE A;  1CS4 A;  3T19 A;  1F9E B;  1PJ7 A;  4PG5 A;  3VQS A;  2AMC B;  1HD0 A;  3ZZO A;  3U02 A;  2LFV A;  4LFC J;  5H9E J;  1OY9 A;  1S6Q B;  2IRX A;  4KPC A;  1HWU A;  1VC6 A;  1HR0 F;  2FHK A;  4ID5 B;  1WDT A;  3M7V A;  1X5T A;  4X64 J;  2D9O A;  2V8V A;  2BM1 A;  3I87 A;  1KQF B;  2D3Z A;  4OX7 A;  2EFN A;  2PMH A;  2FD2 A;  3PR5 B;  1QAI A;  1S59 A;  4X66 F;  3V6K A;  2BQU A;  1SC4 B;  2ZKU A;  3OL6 A;  3PYD A;  3T9N A;  2RQM A;  3OV7 A;  3KMS A;  2DRB A;  1BD6 A;  1VRQ C;  3RBX A;  4OX6 A;  1Q82 T;  2XLI A;  2DNH A;  4WP8 A;  4GVL A;  4OJH A;  4DPY A;  3GTY X;  2J76 E;  4NLV A;  3GR0 A;  1HBN B;  4ZVF A;  2DKO B;  5KOX A;  2BRK A;  4IFY B;  4FXW A;  3OT9 A;  3OL9 A;  3P6Y C;  4DV2 F;  2G0C A;  4ELT A;  4U7C A;  2XO7 A;  5K8P A;  4B3R F;  3CVK A;  4ED3 A;  2PMW A;  1RGV A;  2MHN A;  3SCI E;  2YNG A;  2CPZ A;  4USH A;  2MXY A;  1Q86 T;  2J0W A;  3TNV A;  1NDP A;  1YWX A;  1VIS A;  3PYF A;  3HKW A;  5GME A;  4X65 J;  5AXM A;  4ANC A;  4OLO A;  5D15 A;  2YQ0 A;  3G9C A;  5AXK A;  4OX8 A;  2QL9 B;  2ZUG A;  3EGV A;  2QGF B;  4F02 A;  2R7U A;  1SL2 A;  3BO3 A;  4CLS A;  2UVR A;  4FDF A;  3TZX A;  4URG A;  4YR0 A;  5LXY A;  2CQ0 A;  4PKD B;  2ASY A;  5BJR A;  3KK2 B;  5DG8 A;  1XNQ F;  1OPZ A;  4DV2 J;  4C0H A;  2XZD B;  1X9S A;  1WC3 A;  2F8H A;  2XZT B;  4KB7 A;  4B3R J;  1DJ0 A;  3MM9 A;  1SL0 A;  2Q43 A;  1URN A;  3D0I E;  3KDO A;  2XB2 D;  2MQQ A;  5DM7 Q;  3BEG B;  2JFD A;  1KNZ A;  4B9N A;  2M2B A;  4RPF A;  2FIU A;  4QQB A;  3L09 A;  4UQG A;  1PYS B;  5D6G A;  2FB0 A;  2AD9 A;  2G1D A;  3EGW B;  2GAH C;  1XNQ J;  2VBX A;  1LK5 A;  1RHU B;  2ZH7 A;  3LGM A;  1E6Y B;  2VC1 A;  4DL4 A;  4CYU B;  1URR A;  1FCA A;  2IM3 A;  3R5C A;  4EU0 A;  1AUS L;  4PZV A;  3HHL A;  1BQN A;  5KT3 A;  5A6P A;  5CYM B;  3M2R A;  3ADA C;  2XMT A;  4FXV A;  1H6K X;  5D3G A;  1C1C B;  2K3K A;  2W24 A;  3EDQ B;  3OFH A;  4L73 A;  3P3D A;  3BS9 A;  3NNA A;  1TUV A;  1VBK A;  3HPO A;  3VAL A;  5KFA A;  1KQG B;  1NSA A;  5E33 A;  3EGZ A;  1KTQ A;  3VCD A;  4ES2 A;  2W9C A;  1VC0 A;  3GSD A;  2GV1 A;  4UOC A;  1FWL A;  2ZKT A;  2XMW A;  2LQ8 A;  4I56 A;  1T9T A;  2DHG A;  4L3N A;  3M6W A;  1B0T A;  1RWN B;  4WJB A;  1BQM A;  2LXU A;  1H2V Z;  2CNN B;  3NXZ A;  4OJ1 A;  5LL6 d;  2KO1 A;  4J7C A;  1P1L A;  4ECQ A;  3W7B A;  2Z30 B;  2VBY A;  2GQQ A;  3JTP A;  2OKQ A;  1K1S A;  3C15 B;  1S7I A;  2NZ4 A;  2G1H A;  5CYQ A;  4P71 A;  1U25 A;  2L9N A;  2NS1 B;  1HYS B;  3NAH A;  1C0U B;  4ZPW R;  3H98 A;  4FNI A;  4C4W A;  3TR5 A;  2DIU A;  1W2I A;  3HKZ D;  3DNC A;  4PG6 A;  3L4B C;  5EGY A;  2C2Z B;  3M8P A;  2Y0B B;  3MWB A;  2QA1 A;  2VDH A;  8RUC A;  3HD2 A;  5B0D A;  2BJ3 A;  4KE5 A;  1CSJ A;  2ATL A;  4ZHR A;  4LF1 A;  3CDA A;  2AV5 A;  2KB2 A;  3M1V A;  5IT4 A;  3MEK A;  4I68 A;  1HBU A;  3OFG A;  4MYU A;  2F63 A;  4WE1 A;  2ZJR Q;  3W5Z A;  4FKX A;  3Q8Q B;  1NZA A;  4KC5 A;  4NRU A;  3V6D A;  3S1T A;  2LKZ A;  1VCT A;  4DPU A;  4C0B A;  2V8G A;  5KFV A;  3TAN A;  2B56 A;  5EWE A;  1U0S A;  2HGL A;  2EKN A;  1HPZ B;  3QJP A;  2QMU B;  1EET A;  1WKK A;  4ZP6 A;  1FX4 A;  2QYG A;  3H2V E;  2VOP A;  3N9U C;  3NY0 A;  5DET A;  4QPT A;  2WZ1 A;  2HVI A;  4A8S A;  2MPU A;  5L9X A;  1JNR B;  2B7C B;  1X4B A;  2HZV A;  1WG5 A;  2JEJ A;  4C8M A;  1M5P C;  2RH3 A;  5T7L A;  2RAQ A;  4ZVP B;  2YH0 A;  4LR9 A;  4CLK A;  1PKU A;  1TR0 A;  1S6U A;  3NGT A;  1T03 B;  4DFM A;  3H25 A;  5CXT A;  2OEJ A;  3QZ7 A;  2OAU A;  3VAG A;  1FFG B;  2ZH1 A;  4HKQ A;  1VBY A;  3VAK A;  3KNA A;  4PQU A;  5ETS A;  4J91 A;  2IA0 A;  2VL1 A;  3H42 A;  2UUB F;  1HKA A;  2ZWP A;  2EK1 A;  2XUL A;  3BGF A;  3IGN A;  5A6W A;  3LGN A;  2O5D A;  1TKX A;  1GQE A;  3DLE B;  2R2U A;  4WFZ A;  3MUT P;  2D3O R;  5HQM A;  1FRK A;  3GJR B;  1KLM A;  3PYE A;  4OZJ A;  2VFT A;  3DI6 A;  1S9G A;  4DI6 A;  4OL8 A;  3AAW B;  4OV1 A;  2A2D A;  1VRT B;  4DPW A;  3T1H F;  2IBK A;  4HAC B;  1U6B A;  4QU7 A;  2ZUA A;  2FTR A;  4WCE Q;  4DSL A;  2DNM A;  2RDJ A;  3J7A N;  4RKU C;  4DCO B;  2RKI B;  2X1G A;  2AQ4 A;  3HJF A;  1ZET A;  2FGO A;  1QLN A;  2UUW A;  2GHP A;  2XSF A;  2WBM A;  1RTZ A;  1XR6 A;  4V19 J;  4LF5 F;  3BPS P;  3PEJ A;  1ZM9 A;  4TY8 A;  4M5I A;  3GJQ B;  2F4F A;  1R8A A;  4IR9 A;  2CQP A;  3F56 A;  4KYZ A;  3PFO A;  1E6V B;  2MZQ A;  2OPS A;  3K17 A;  4FPR A;  4P74 A;  1FRI A;  5I42 B;  3T1H J;  5H9F K;  4J9K A;  3WIV A;  2KM8 B;  2IRY A;  3U27 A;  2M8D B;  4WIQ A;  1IUJ A;  3W2W A;  1VQ6 S;  5K8N A;  4NLY A;  3HSD A;  1CUL B;  1S1W B;  1WC1 A;  2DK2 A;  1YBU A;  4CCH A;  2DRA A;  4WKY A;  4LF5 J;  4DXL A;  3KLE B;  3IA0 A;  5GAG I;  4WPA A;  3UDL A;  4HHH A;  3UVJ B;  2IMW P;  2H5E A;  3OUY B;  2ZFH A;  4AXI A;  2VBZ A;  4NLU A;  3HFK A;  1VK3 A;  1GT8 A;  2KYX A;  2ZEJ A;  4NOH A;  1FKP B;  4FYY B;  4ZIT A;  2K06 A;  4ELU A;  3GFH A;  2R4F A;  2KDO A;  2LLZ A;  4P2M A;  4M95 A;  1SH2 A;  2F8E X;  2M52 A;  1JLQ B;  4K0K F;  5HI7 A;  1JLC A;  2L9D A;  4TU9 A;  1REG X;  4J9M A;  5DG7 A;  2NYH A;  3HHE A;  3R6G B;  3DLG A;  1HNI B;  2H1Y A;  3R7S B;  3TRG A;  1IKY B;  4ILR A;  4KQZ A;  3BBC A;  2LVW A;  3KOA A;  3KK1 A;  1X4G A;  4KV8 B;  3AHP A;  2ASD A;  3DXB A;  3H0P A;  1KHV A;  8AT1 B;  5KFD A;  1RT4 B;  1S0N A;  2PC6 A;  4YS2 A;  4K0K J;  3H90 A;  3BQ1 A;  2XS7 A;  1EKS A;  2ZE2 A;  4YB6 A;  3K2Y A;  3M2U B;  4QR1 A;  1KVJ A;  1RT2 A;  3OLA A;  5C25 A;  2LDI A;  5G4D A;  4RW8 B;  5A8W B;  3A12 A;  2F40 A;  3QLH B;  4ZLP A;  3TVZ A;  3O1L A;  1LEO A;  1NBE B;  2CJQ A;  3I9V 9;  2EWH A;  2VQE J;  1SJR A;  3I6P A;  4PUO B;  1RHM B;  1MW7 A;  1PAU B;  2B4P A;  2UXD F;  4I7F A;  1IM4 A;  3FDS A;  3UNY A;  1YJV A;  3ET6 B;  1L3T A;  1M5H A;  4ETX A;  5KFF A;  2KH9 A;  4M8L A;  4ZLN A;  3I5B A;  5KFU A;  4RWX A;  4X4V A;  2DY9 A;  4LRD A;  2XYP B;  3CC2 S;  1RWM B;  5D0R A;  3AOB A;  3A8E A;  2DGW A;  4YDD B;  1QAY A;  4JI6 F;  3K7R A;  5KFZ A;  3IR6 B;  2EFV A;  5D0E A;  4K5R A;  1K47 A;  3JSY A;  3FQK A;  3C8Y A;  1RT7 B;  1U0H A;  3PO5 A;  2F3J A;  1HW9 A;  4TY9 A;  1ZAW A;  3NWR A;  2UXD J;  4U8Y A;  2DNL A;  2XEX A;  1WF1 A;  2GZO A;  3BSA A;  3ZFV A;  2C42 A;  5KFJ A;  3TI0 A;  4GVB B;  4LSN A;  1VC5 A;  1JKH A;  4XDC A;  3PJ9 A;  2E7V A;  1TL7 A;  4B3M F;  1FO1 A;  5A0Y A;  3Q8P B;  2MKJ A;  2PFD A;  3VVU A;  5F9N A;  3ICL A;  3R2C J;  3MED A;  1S79 A;  1QJH A;  2LQJ A;  4JI6 J;  1Z4U A;  3DOM A;  2XMK A;  4DV1 F;  3PAC A;  3UD3 P;  2E1R A;  2VDI A;  3LWL A;  5LMN F;  2PA8 D;  4WYW A;  3JQJ A;  2L41 A;  2WW8 A;  3SDE B;  2CQD A;  1SIW B;  2YX4 A;  4F3M A;  4X2B A;  2GHW A;  1DFD A;  2PD1 A;  4JV2 A;  1FT8 A;  4QW8 A;  3NAI A;  2BW2 A;  1S10 A;  4B3M J;  2B0G A;  4F2R A;  4ICL A;  3G6X A;  1HWK A;  2ILY A;  4ECU A;  2VG6 B;  2WVF A;  2K3I A;  2VD3 A;  2AF6 A;  4DV1 J;  4G6V B;  1VQY A;  2C22 A;  1MN7 A;  3EUN A;  5LMN J;  1HQE A;  2E5I A;  1LW2 B;  5LT5 A;  2VIC A;  2HQF A;  4P73 A;  4Q8F A;  4ITS A;  4JI3 J;  4BBY A;  3ELH A;  2FJV A;  1YHQ S;  2Y3Y A;  3U1M A;  1FRX A;  4J9U E;  4J9O A;  1EAR A;  4O3R A;  3N0V A;  5KG5 A;  2J5A A;  1ZAV A;  3LPE A;  3FBF A;  2G2Z A; 
#chains in the Genus database with same CATH homology
 4LSZ B;  3P4U B;  2QL7 B;  3RJM B;  3GJQ B;  3R6L B;  2C2K B;  2QL5 B;  2Y1L B;  2HBQ B;  3R6G B;  3NS7 B;  3D6H B;  2XZD B;  3R7S B;  1QTN B;  2XZT B;  2C2O B;  2H4W B;  1SC4 B;  3QNW B;  4JB8 B;  2C1E B;  2XYP B;  1RWM B;  1RWV B;  3D6M B;  2CNL B;  2CNO B;  2QLB B;  3KJF B;  1I51 B;  1GFW B;  1RHQ B;  2HBZ B;  1I3O B;  2HBR B;  1RWW B;  1RWN B;  4DCJ B;  4ZVT B;  3SIP B;  3GJT B;  3IBC B;  1RE1 B;  3R5J B;  2CNN B;  2H5J B;  2HBY B;  2FQQ B;  1RWK B;  2DKO B;  3P45 B;  3GJR B;  4ZVO B;  2CJX B;  5IC4 B;  3IBF B;  2XYH B;  1RHR B;  4ZVQ B;  1SC3 B;  2CDR B;  2C2M B;  2H54 B;  2CJY B;  2QLJ B;  4ZVU B;  2P2C B;  1RHU B;  3EDR B;  4ZVR B;  2QLF B;  3R7N B;  3R7B B;  3KJN B;  2H65 B;  1SC1 B;  2H5I B;  3GJS B;  4DCP B;  1F9E B;  3KJQ B;  1RWX B;  1BMQ B;  2XYG B;  3D6F B;  1RWO B;  5IC6 B;  1RHJ B;  5K20 B;  4DCO B;  1NME B;  2CNK B;  4ZVP B;  1IBC B;  1RHK B;  2C2Z B;  2QL9 B;  2H48 B;  1RHM B;  2Y0B B;  1PYO B;  4ZVS B;  1RWP B;  2H4Y B;  1PAU B;  2H51 B;  1QDU B;  1ICE B;  3EDQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...