1RHUB

Crystal structure of the complex of caspase-3 with a 5,6,7 tricyclic peptidomimetic inhibitor
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
91
structure length
91
Chain Sequence
KIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-3
publication title Reducing the Peptidyl Features of Caspase-3 Inhibitors: A Structural Analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 16
structure length 91
sequence length 91
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2003-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1rhuB00
1SC1B 1RWVB 3D6HB 4ZVRB 3KJNB 4DCJB 2CDRB 3NS7B 3R7NB 3D6MB 4DCOB 4LSZB 2C2OB 1RWXB 2QL7B 3GJQB 2HBRB 4DCPB 2QLBB 2H48B 3KJQB 4ZVSB 1SC4B 1RHMB 2XZTB 1ICEB 2CNLB 2H51B 5IC4B 4ZVOB 3EDRB 3R6LB 1QDUB 4ZVTB 1RHRB 1IBCB 1PAUB 2CNOB 2H65B 2XYPB 2C1EB 1RWWB 5IC6B 1RWKB 2P2CB 1RHUB 2XYHB 3IBCB 1I51B 3R7BB 2H5JB 3R7SB 3IBFB 1F9EB 2CJYB 3SIPB 1SC3B 3RJMB 3R6GB 3GJRB 2H4YB 1QTNB 2H5IB 4ZVQB 3QNWB 1RHKB 2QLJB 1RWNB 2C2MB 3EDQB 3P45B 2Y1LB 2CNNB 2CNKB 2Y0BB 2QLFB 2HBQB 2HBYB 1NMEB 2H54B 2XZDB 5K20B 1BMQB 3GJTB 1GFWB 1RWOB 3R5JB 2C2KB 3KJFB 2CJXB 1PYOB 3GJSB 1RWPB 1RWMB 3P4UB 2FQQB 2HBZB 2QL5B 1I3OB 4JB8B 2DKOB 2XYGB 4ZVPB 4ZVUB 2C2ZB 1RHQB 2QL9B 1RE1B 1RHJB 3D6FB 2H4WB
chains in the Genus database with same CATH superfamily
2QG9B 3T19A 4DSFA 1SV5A 4CRJA 4FBTA 4JUZA 2IPOB 5JVGQ 5HP1B 2GJ2A 1RTHB 3MMCA 2F8EX 4AYBD 2CQHA 4F0HA 1N33J 1LKZA 4L76A 4O3RA 1T9XA 2DHGA 4RL1A 1HWLA 2I2YA 3QIDA 4J90A 3HKWA 3CCZA 2HRYA 5KFMA 4DV3J 3FJ2A 5JXSA 3MR6A 1NLKL 2DGOA 3SZ2A 4M5NA 1TL7B 3A8IA 1S0NA 1NK5A 4AE5A 2H3EB 2E9RX 4A8FA 2M2BA 5BR8J 3PW2A 3M30B 4LRAA 4RW9B 1RTDB 3NKYA 1LK7A 1YKWA 2W9CB 1RKJA 4DV1F 1LWEB 3IN5A 1U0SA 5HO4A 2R4FA 5EWEA 3H2LA 1RA6A 3UO0A 5G0RA 7FD1A 4J9SA 1Q0NA 3J7A1 3KLGA 3FQLA 5K14A 2PDAA 3EZUA 1WKJA 4NZ6A 3K8WA 1X4GA 1S1XB 1LK5A 1U8WA 2CA9A 1SH3A 2G1HA 3L3CA 1RE1B 4ZPVR 2H4WB 1IWAA 1XBWA 3ILOA 1QUVA 2FJWA 3AB2B 3PCOB 3B4MA 5L1LA 1WTFA 5J2QB 2PC6A 3FVYA 1RTIB 3D66A 4ZP7A 2ASJA 2HW3A 3GV5B 2MY8A 1RHMB 2ROPA 5AE2A 4D3GA 3CCVS 4F4XA 2BOPA 1F5AA 3SSRA 4QYZK 1T9WA 1DAXA 2AEMA 4L73A 1BQNA 1SJ3P 1VBXA 4K0KF 1IBMJ 2VPXB 4PXDA 5KFTA 1MROB 4URSA 4IYQA 3R5AA 1JLBA 3BN4A 1HBOB 2C2MB 4HI1A 1ZZFA 3HHEA 3R97A 1WTBA 2KDOA 4B3SJ 1F6TA 4H4KC 2RT3A 4OYAA 5LMNF 4PUOB 3AXMA 2RMLA 4FKXA 3E51A 1DJ0A 2NXEA 3W63A 4ECXA 3G96A 1IKVB 3IGVA 3V81B 3QIPA 4USUA 4KIAA 4A4JA 4X65F 1YVFA 2C3MA 2JH3A 3AJ1A 3MCOA 5C5JA 4WTOB 4LIWA 3WQPA 2AX1A 3C15B 2VPWB 3KMQA 3NMRA 4DPTA 2MQLA 3J7YU 2KXNB 2BJ3A 3CD6S 4WCEQ 2KI2A 3D0IE 1P9YA 4K50A 1FRIA 3G82B 3EJMA 2ZH2A 2DXDA 2OPSA 2ZH9A 2OPPB 2RU9A 3R2DJ 2UUAJ 3Q89A 3L7PA 4NLOA 3W7BA 2ZZTA 4OJGA 4TU8A 1O8BA 1UVIA 4AD6A 2OPRA 4NLWA 2LVWA 1RT5A 3POTA 2DK2A 4NXNF 2AJ2A 1JJ4A 3OR2A 2CPHA 2DISA 1RDRA 2FHJA 2RHQB 1HI8A 1CJVB 1FNMA 3TAMB 2DNHA 4KGVB 5EWGA 2W25A 3MGJA 2DR7A 4CM2A 1HBNB 2JOQA 1TFWA 2DHAA 2DVIA 1R8AA 1TU0B 4JYAJ 4M5LA 4DPYA 1WORA 1WSVA 4ILRA 3T1YJ 1NAQA 3MUTP 4TLQA 3NNAA 1YX2A 4DQSA 2X1FA 3GCWP 3VCDA 1RADB 4D3HA 3TNVA 4DR7J 1M5HA 2E1CA 4WF9Q 1SC3B 3VHQA 2O5DA 2IRXA 3KKFA 1JK9B 4K4WA 4M5GA 4QYRA 5K8PA 3CD5A 1T9TA 4Z37A 1VCTA 1FJEB 1TL3A 5F0WA 4O0NA 1HBMA 1S9EA 4LQ9A 1KWMA 1R0CB 3EMTA 4DUZJ 3ZZTA 3V6HA 4ETZA 2QT7A 3K7RA 3GYNA 3BZQA 2MQQA 4Y6IA 2BJ9A 2RS8A 4YY3F 5KFSA 1V6HA 2J9DE 3NS7B 3SMZA 4LRDA 4IR9A 3HFVA 2ACYA 1ELOA 3N6LA 2MKSA 2YWHA 5GAHU 2Z56B 4ZVSB 1G7CB 2XG8A 3AD7C 3SQOP 2XZTB 2UXCF 1QUPA 3FBBA 2JDJA 2GGPB 1HLWA 5J2MA 1REVA 2UZAA 2DITA 1FE4A 5DDPC 1LW2B 2M52A 5F8NA 1TTHB 1RBLA 3L7UA 3MCSA 3FSIA 3FUYA 4KPCA 2ROGA 2ZH3A 3RRKA 1U49A 1QAJA 3BH7B 4O3QA 3MR5A 2QLJB 1XTZA 1IBKF 4J37A 2IAJA 1HPZB 2BQRA 2ZBIA 3R5JB 1BXNA 3UDVA 1N5YB 1S10A 2MB0B 1JLEB 1WC3A 2XNRA 5HMZA 2UUBF 4DR6F 4HLBA 2DNYA 3OVBA 4C8YA 2KZMA 5M2PA 3FBEA 5B0GA 1FK9B 1BWEA 2YKNB 4ED7A 2DNRA 4RBTA 3KJNB 4DV4F 4F2SA 1RUSA 1PJ6A 2OD6A 4B3MJ 1NNDA 1KQFB 4M1KA 3UCZP 2HWIA 5BYRA 3DMJA 2ZE2B 4XIUA 4F0MA 2V2VA 1IUJA 2R7OA 4A8OA 4A47A 2KG0A 2GV1A 3PEJA 1XMBA 2C3PA 3EZ5A 4FNIA 1CJKB 1WKKA 4NCGB 2YPYA 4OI4A 2GX8A 3QFWA 1M1GA 3NLCA 4AXJA 5M2UA 4P73A 2ZD1B 1WDTA 2F4FA 2Q6BA 3J7ZT 5HLFB 3NMAA 2RRNA 4ZCMA 2YWKA 3LF0A 4LVNP 3FMBA 2MKKA 1RT3B 3Q22A 4OHWA 5HJYA 3QSIA 2DPIA 2FVSA 3DC2A 3I31A 1K44A 3DRPB 1YRTA 3DGPB 5GMKa 4BDPA 5DG8A 3I82A 2W2PP 2HHHF 5K5MA 1EX8A 1S1VB 3JSMA 3KK3A 1U0HA 2GQ2A 4OYMA 4FS2A 1J2VA 2PE8A 4CT9A 2CVIA 1RT6A 3QLHB 5DZ7A 4FYYB 1NU4A 3GFZA 2W24A 2ERRA 1QVGR 5AXMA 2W7PA 4KJIA 4ED0A 5F8GA 4LQ3A 1UFLA 3L7OA 1C1BB 2VA3A 2FD2A 4PAAA 5KG4A 2CDQA 2Z2ZA 3T9ZA 3SIPB 5ETTA 3GONA 2E66A 3V6JA 4B9UA 4C4WA 3MPDA 2I0XA 5HQMA 7FDRA 4DXLA 1TL5A 4ZVFA 4YB5A 1X9MA 1N4LA 2VJUA 4DN9A 2DNGA 4WIQA 3W64A 2VL1A 4DLEA 3MM6B 4DWIA 1F9FA 1I5OB 4XDDA 4KGZB 4OFZA 3PG9A 4B9NA 4WTYA 5HROA 1SJ1A 2E1MC 3HHLB 1KRPA 3HHDA 1HMVA 4NYZA 3W2VA 4NLTA 4JI2F 1RKIA 1NH7A 1RT2A 2XULA 2XSJB 3VZIA 1SV5B 2MTLA 4C8MA 4JI5J 3ENWA 1FJCA 5A2QY 1TP7A 2FVCA 5D4PA 3D6TB 1JKHB 4N8NA 3MMCB 2V67A 2KG1A 2R8HA 4KFBB 4U96A 1DARA 4KR0B 3TJ8A 1VQ9S 1ZA2B 5KG3A 2AYMA 2VF3A 1WJ9A 2NPIA 5E41A 5KFHA 2R8KA 1ZS6A 5HMYA 1PIEA 3GIMA 3R27A 4CH0S 2YWEA 3ISZA 3CCWA 1X4HA 1B0PA 1A6LA 2RAQA 1AW0A 2FLNA 1FKPB 2KVQE 1BMQB 2NS1B 2DD8S 5H9EK 1W2BR 2GMHA 2AF6A 4ZLPA 2QYCA 3SBMA 5G0RB 4PG8A 3KLGB 5K14B 3Q24A 4JI1F 3HDSA 3ZZ0A 3NCQA 1RAJA 1NJXA 4LFAJ 4BBYA 1YI2S 1HNIB 4DV5F 1GNKA 3MOZA 2VD3A 4RO0A 2G13A 3KLEB 3EM1A 3SQGA 1D8YA 1WF1A 3NOGA 4DPUA 4I4BA 3K58A 4CP5A 3PIOQ 2HS3A 5A2QU 3MECA 4A8SA 3ITHA 3L9ZA 1GEHA 4L72B 2OFGX 1WNEA 2NXNA 1MW7A 4YMEA 4TKTA 4DN0A 2BYCA 1VDHA 3P3DA 2ZUAA 2HFZA 4EU0A 3OT9A 5IC6B 4LF4J 2XYHB 2MPUA 4UQTA 2EFOA 1FFSB 5CH7B 5KT6A 3C2PA 2X1BA 4ZCLA 5J2NB 1I6JA 2YH0A 2HZVA 1Y7PA 4QWEA 1JLBB 2KHCA 5J1EA 3MPYA 4YQWA 3OVSA 3KTQA 3LA0A 1QSSA 4U8YA 2J8AA 9ATCB 2XGQA 2AGPA 4KKOA 1ZM3A 3F44A 2XI2A 3DOMA 4DU7A 3V2UC 2AGOA 1IM4A 1XMOF 1TAUA 4FKYA 4N56A 3BGFA 2OI2A 1VBYA 2FDNA 1LFPA 3QIPB 5A8RB 2JLGA 1LNQA 3TANA 2EK6A 4DV7F 2C3UA 5ETVA 4GC7A 4BLGA 3H42A 3CEDA 1SC4B 4CT8A 2GHPA 4ZPTR 3THPA 1YJVA 3UVJB 1S99A 3IRWP 5J1NA 4UOGA 5F8JA 2M88A 3A8EA 5LJ5Y 2ZM6F 4FS1A 4C98A 3FCWA 1DBDA 1DQ8A 2CZ4A 5HAOA 3PKYA 4B17A 1Q81T 2V8GA 3OTBA 1FDDA 1PBUA 1WC6A 2RIJA 3TR5A 1YJ9S 2JLEA 4PYAA 2GVZA 2RNEA 2MJUA 2AIRB 2PMHA 3QZ8A 2B43A 2ZJQQ 3QO9B 1RAGB 1S48A 2OPRB 2Z2LA 3H5YA 2HSEB 2WONA 3E01A 5D0RA 2WW4A 3VGVA 3OR2B 3HLUA 1SCJB 2DR6A 3HX9A 3I0RA 4PR6A 4KV8A 5CYQB 2DR5A 3EYZA 1R6YA 2G0JA 2PGCA 4XPEA 1GAOA 3R7NB 4OL8A 2XM3A 3C14A 3QGGA 2VU5A 4G1IA 3TJ9A 3TEGA 4DUTA 2DH7A 3MTJA 1XMQJ 4UUXA 3NG8A 2ATLA 1KQSR 4O4GA 2JEJA 1IBCB 5I3UB 2EFNA 1JNRB 3JTPA 3BSOA 1RWKB 3D1HA 2YNFA 2KM8C 3NCRA 4PQUB 1FFWB 3EZOA 3HVWA 4DF8A 2LXFA 3KYLA 2VG7B 2BE9B 2OFHX 2CNNB 4NZ7A 2XMAA 1NMEB 5EN1A 1M5SA 2OJ3A 4LF6F 2IM1A 4ELUA 3CJ8A 4U8VA 2D7SA 3IP0A 5LMNJ 3NAIA 2HKEA 3H5SA 2KJVA 5FLXY 1ITPA 1TL3B 4YN3B 5L8RC 2UUTA 3TYTA 5F3ZA 1EP4B 4K4ZA 4X65J 1X31C 1SIWB 3E2EA 3Q8QB 5K8MA 3FRZA 3KWMA 1ZH5A 3MMAA 2HQCA 1OY9A 2DNOA 1QLNA 2LDYA 2A3JA 3FBFA 3TQEA 3TWZA 2DPJA 2UV8G 1UCNA 4FVMA 3TVYA 4C11B 4DSKA 4K4UA 4PABA 2LQBA 3U1MA 4NLVA 5L9XA 2VQFJ 9RUBA 4Q0BA 3MF5A 3QQCD 2MSSA 1U25A 4U67Q 2VKZG 5AJ3F 5LSOA 5J2MB 1REVB 2Y3YA 5KFIA 3KDNA 5CA5A 2F9DA 3M6VA 3HSZA 2VICA 1KS2A 1C0UA 2HBQB 3CCUS 1S4FA 4LRCA 2X7IA 3BGUA 5MAOA 2F7VA 3HD2A 4FVCA 2QFJA 3UQSA 4C3MA 5GMEA 2GAHC 5FLXU 1HNWF 1HQEA 1XN9A 4O3PA 4PG6A 4Q8FA 2HBZB 5D4NA 4F3QA 1HNXF 2HWHA 3OUYA 1MN9A 1SPBP 3KFWX 2MZRA 1OS5A 5EHHA 1FWKA 2UXDF 3OSNA 2UU9F 1DLOA 2ZH8A 3J81j 3ZO7A 3I96A 3J81Y 3AA8A 2J5AA 2GS8A 4AL5A 4Q5VA 1NPRA 3VAIA 3D54A 2RVJA 1NKCA 3HT0A 1LWFA 2H5EA 5KFFA 4JI0J 1DTQA 4ZMMA 2HIYA 1PSDA 1VQ7S 1S77D 2Z0GA 1UEVA 1UETA 3PJ9A 2YX7A 2MZSA 4ZN1A 2PIIA 1UVMA 2COLA 3AJ2A 1HI1A 3DRRB 4UW2A 4H4MB 2RDIA 1JLCA 1BHNA 2HLUA 2HNZA 1HNVA 3GTYX 1U2FA 1R8BA 4TY8B 3G6XA 4ZK7M 5A8KA 5KFGA 1WHYA 3OTOF 2AJQA 4B3RF 3FQKA 4I2PB 3CJKA 2QYGA 2C2OB 3UFCX 2HFUA 3JSMB 2C2EA 3KK3B 5HVGA 4CZCA 1U0HB 4CNYA 1WF2A 1WUUA 3K57A 3ISND 2RQCA 4OI2A 3I5CA 1RT6B 2K2PA 1QJHA 1RT4A 2UXCJ 1YG0A 1IXKA 2RUSA 4HHHA 3GLJA 3M8PA 2DNMA 2OPQB 1LV5A 4LF7J 1Q82T 2KJWA 1XQIA 1IKYA 1URNA 2AMCB 2IM2A 2DRBA 4W4MA 1U24A 2CQ3A 2Q66A 2YWFA 2BABA 4LRFA 2LA6A 2QTWA 5SUHA 3OBIA 3KUHA 1K9MT 2YNHA 2GJFA 3OFGA 3O6QA 1OWXA 4ZP8A 5E33A 1HYSB 2N3OA 1H3DA 1RXOB 3WIUA 5CQGA 3FBCA 3GCXP 6FD1A 3GG0A 1FDNA 3M2RB 2B5JA 1CULB 4DR6J 5DETA 3SI8A 1CQMA 2OIHA 4H4KA 4RJVA 3UI3A 2V50A 4A46A 3DI6B 3MEEA 2L9NA 5C2CA 4UQGA 1RT1B 4DV6F 3TAQA 1JJCB 4CWBA 4B3OA 4MKVA 3W2VB 2IBKA 3OXGA 3U1NA 4NCBA 5JUMA 3THTA 2KVIA 2L48A 1RT2B 3MAAA 1C0TB 4DUYJ 1FCAA 2LMIA 4DSJA 1H38A 3IGNA 3R6LB 3HHLC 2I5JA 3OXLA 4QW9A 2HAIA 4MYTA 1D1UA 1Q53A 4BC7A 2Z2YB 5DDOC 4F26A 4C7QA 2QMWA 4Q2LA 4ANDA 2VASA 2K7KA 4ZJQA 2HQ3A 3M2UB 3FGVA 2DY9A 3W9IA 1P6TA 1FO1A 3W5YA 4RPFA 3TW0A 4DDFA 3ETMA 5E3QA 2XCAA 3CB4A 3C3LA 1DRZA 1KLNA 1NKEA 3QT7A 2MZTA 1FEEA 3IG1A 3LO3A 1UVKA 1YLXA 1H0HB 5D78A 3DU6A 3EWGA 4R0JA 2R7WA 5GVQA 1HKAA 3V6KA 2HHHJ 2V68A 1YK9A 4LF9F 2LU2A 3SQGB 4EO8A 3W3SA 4DL0C 3HCXA 2ZITA 3NWGA 3ITHB 2ZEJA 3TUJC 4E98A 2G9OA 3PIPQ 2WZ1A 5L38A 3FCHA 3A3NB 2HHUA 4UF4A 1S0VA 5EUHA 3TRGA 3KG0A 1ULRA 2CQCA 5HL7Q 3HJFA 1TL1B 2O01C 3GWCA 3H20A 4XPCA 2HHVA 3BR8A 4OQJA 4WZQA 1L3UA 2QV6A 4RUBA 1SH2A 3R1LA 2EKYA 3ENAA 3ZTQA 4F4KA 3A1YG 3UD4P 1RT7B 2UXBF 1F0XA 4RWXA 3CO0P 2DKOB 4FPIA 4KKOB 4NYPA 2AX0A 2K3IA 3MM9A 4C8KA 3DOMB 4OYPA 2F9JA 1NK9A 1RAFB 2F3JA 3SCJE 3MAQA 4JI2J 4EBDA 1IKWA 5I3PA 5IM0A 3KJQB 2HVHA 1ZOTA 3HULA 3DYAB 4MK8A 2CNLB 3MEGB 3NGRA 1FTCA 4I2QA 4B9LA 4OLOA 2IA6A 4WU3A 4JOUA 3F0NA 2CVEA 1U2CA 1QAYA 5ETSA 4JV0A 3OD2A 1H74A 2H4YB 3RAXA 3FSXA 4ECSA 3P8BB 2BX6A 1D8ZA 2HZCA 4HI2A 4F04B 4C3KA 1R89A 3UCUP 2LA4A 3K5LA 3U7JA 3KNGA 1U6FA 2GVZB 2YQ3A 2M0GB 4DR3F 2QL5B 2IBOA 4R5PA 5ETNA 2OTLS 2MDAA 2R7SA 3D1OA 4JI1J 2YKMB 2AJ0A 3E01B 2YKPA 4OJHA 1H73A 3D4JA 2E7WA 4Q7AA 3D68A 4DV5J 4DX6A 1S79A 1UEKA 4U95A 2Y1IA 2DRDA 1TKZA 3I0RB 2M8HA 3R2CJ 1QM9A 1BQMA 1TMMA 3A8KA 4ZCKA 3C14B 1JLQA 2YVSA 4OZJA 1TFYA 2K8GA 2V4RA 5CD4H 3NNCA 4DQIA 1SXLA 4LT6A 3G9CA 2M5YA 2WB4A 4O4GB 4G3IA 4ANCA 4J9KA 1R0AB 4NA2A 1U6BA 4K7QA 1YJUA 4KHPF 3CVKA 3W60A 3ZZZA 4B9VA 4WE1A 2CAJA 4P72A 3M8SA 1SBRA 2BMBA 4USTA 4CO0A 1U1PA 3I5AA 3HF5A 2FHOB 5FIIA 1HR0J 4KO0B 5KFDA 4MMOA 2JEGA 5EX3A 2WSEC 2OO4A 3HVTA 3BGOP 1XMOJ 2V9KA 4DV3F 4X4UA 1TK0A 3D6HB 4PPZA 4TU9A 4HACA 4DPXA 1CJUA 4NEZA 1H72C 1ACMB 4DV7J 2D9PA 3EGZA 3TUZC 2KTQA 4ECZA 3PYFA 2YNGB 4ECQA 4ZHRB 1FNOA 3UDEA 1FT8A 8AT1B 5L1IA 3CW2C 2ZC3A 4K4YA 1IM6A 3US5A 2QJ3A 3EVOA 4Q0BB 5DG7A 1BD6A 2YX1A 2NUHA 3VGUA 1NSPA 1SKUB 3IC1A 4W92B 4NLDA 4IFVA 5DGAA 2XY6A 5K20B 4PG4A 1C0UB 3KLIA 4ZJOA 4A8YA 3DRSA 2HNYA 2J6TA 4H4OA 3QGIA 4Y34A 3T41A 2P6SA 2R2SA 1RHJB 3VGTA 3H4DA 2JHEA 3TX8A 1RAEB 2WVBA 2RDJA 3OUYB 2RH3A 3ZTOA 3DHXA 2L41A 1Q8BA 2KXHA 3MDFA 4WPAA 3VQTA 4UY8T 2N4CA 1SB6A 4URQU 2HIQA 4J9LA 4A8XA 1T94A 1K0TA 4B3SF 1S57A 3EX7B 1AB8A 2EC2A 4NI2A 3OL8A 2R7TA 4K5SA 2KFYA 1S6QB 1JLGA 3R6GB 3K8VA 3OHBA 4LREA 3C66A 4CO4A 1ZETA 3P45B 1TV6A 3M05A 3CC2S 2OGUA 1DTQB 3G6VA 2ZOFA 3TJAA 2CPEA 1CG2A 3PDNA 4YB1P 5HP1A 2JC0A 3RZAA 1ZAWA 3IMQJ 4RKUC 3SV4A 5D3GB 2HZAA 3R5CA 5EDWA 1VHFA 2QA1A 1FXLA 2QL9B 3HVRA 1SL1A 1JLCB 3RB6A 2C22A 4P2XA 1TL7A 3EPIA 1DTTA 3GYGA 2A2DA 2KZZA 3M30A 3Q8RB 4RW9A 1RTDA 2IJRA 2DRAA 1ZTTA 2W9CA 3J80U 5KFAA 3RTVA 1LWEA 1NSQA 3LUYA 4U7CA 2F65A 1JWWA 3MUMP 3IS9A 1SQFA 2GO8A 2AT1B 2LQ5A 2QLWA 5E5NA 5C7PA 5HMXA 2GFFA 4USVA 4DQQA 2XGPA 1S1XA 1RT4B 1T95A 2FY1A 3JQMA 1RWUA 4B3TF 2DO0A 1U2RA 5AJ3J 3RW6A 1ZZNA 3M8PB 4URGA 2Q43A 3CCMS 4F25A 2BRLA 2E5JA 3FEYB 3D9BA 5U47A 1IKYB 2E7VA 2GAGC 4DQRA 1U02A 1A9NB 4EUVA 5LXYA 4JYAF 3VF0B 5FD1A 2DH8A 3T1YF 4DPWA 3CCLS 5F3TA 1HNWJ 3VAMA 2J0QD 1GMWA 3MHYA 4J9NA 2U1AA 2MHNA 4ECTA 3M9MB 4DR7F 2O66A 1MROA 4OI0A 3TAPA 4WJBA 2QO3A 2UXDJ 3TI0A 1HBOA 4ES3A 2ZOMA 1Y00A 3BPDA 2CQ1A 2F63A 2H48B 3CIZA 1NDLA 5IC4B 3PVXA 2NZ4A 2IRUA 2K3KA 4DJBA 5ETPA 4EBEA 4PUOA 2ZFHA 1Q95G 3UN5A 1BE4A 1C4CA 1OPZA 3WIVA 1IKVA 2H5JB 3V81A 1AXQA 2IJNA 1J27A 1RQ0A 1UVNA 4HT5A 1OSCA 3X3UA 4ES1A 1S0MA 4WU2A 4FXWA 3IBWA 1DHMA 3IAS9 4DX7A 2E5HA 2BVZA 3GYXB 3VAFA 5KT5A 4OYWA 3CJ2A 3QT5A 1XC9A 1WG5A 1APSA 2MEWA 3QFHA 2FQQB 1GMUA 3G82A 1JQGA 1FERA 4ETXA 2OPPA 2XLKA 4TYBA 2HVZA 1S6OA 4A8WA 1NM2A 4IUFA 5F0UA 3IG1B 4CI0B 4CH7A 1M0SA 1PYTA 1N36F 4YOEA 3AH6A 4OZ1A 2C2NA 4EZ9A 3OTOJ 2MLZA 3NGUA 3CC4S 2B9EA 4JV1A 2H51B 1KONA 5KOWA 3CDWA 3RBDA 2RDDA 1WOPA 1F3FA 4YDDB 3VAJA 2HFVA 2A6OA 2ACMA 2DR9A 3KJVB 3CUNA 3KLFB 3ZXWA 3OJUA 5FDLA 2I9SA 3PKMA 1P8GA 2PI5A 1D9FA 4I6WA 2MZJA 2X3DA 4BS2A 4J9VA 3WHIA 2FJEB 3QMQA 1HBNA 3PW5A 2RQMA 1H98A 4ZLJA 3MR7A 2OEJA 4X2BA 3TA2A 1IJEB 1YRXA 4RWWA 3HSDA 1B7YB 3PO4A 3HT3A 3M4XA 1V5VA 1TELA 4X66J 1R8HA 1SUQA 5JVHQ 3BQ1A 2GIRA 4NLUA 5L39A 2AU0A 1R7IA 5M2RA 4CLUA 4IDKA 2HFOA 4DV6J 3IR5B 3DLHA 1L5UA 2CJQA 1FJ7A 1K0VA 3M7VA 3MXHP 4JI4J 4CNZA 1E6YB 4I68A 4DSIA 5IM0B 3JSRA 1GK8A 3ONQA 4QU7A 5F41A 4I2QB 2AP6A 3MFIA 1IJFB 1TVRA 2W2MP 1EAYC 1GXTA 2KL8A 1R43A 2CPJA 2B9WA 3OJSA 1BLUA 4LF5F 3PJWA 5DM6Q 1NK8A 1JMTA 4JI7J 1N8RT 3BKTA 2VBYA 2F8MA 3KMSA 4DX8H 2BJ7A 2CKWA 3HVAA 3IWNC 2IMOA 3LAMA 4IR1A 1FTRA 2GGPA 2RQ4A 4RNOA 2UUWA 1DY3A 1N6QA 2LKZA 2V2QA 5L9NA 1ZPWX 3N5BA 2K7JA 1HPZA 1WKLA 4LF9J 1U1OA 1PJ5A 1BQMB 3KHHA 2CADA 3UR0A 4LF1A 4O0IA 2MGZA 1JLQB 1N5YA 3AOBA 1JXVA 2CYYA 3W9HA 2ZZMA 1IR0A 3VR1A 1JLEA 2L9DA 1N5SA 4CDIA 3MEDB 1T3OA 4CTAB 2AJ4A 2VB6A 3CMQA 2DNLA 1XK8A 3MAHA 1H7XA 1TK8A 2APOA 1B3TA 2YKNA 4PPDA 2F4VF 5ETRA 2I38A 3RYLA 4I7FB 1HNZF 3T5JA 4MK9A 5ETMA 4UOFA 2B9YA 4EFAC 4DFKA 1VR6A 4M5JA 4M95A 4IH5A 1O0PA 3ELHA 1YITS 2UXBJ 4F7VA 2ZE2A 4TY9A 3J7Z5 1B99A 3I4PA 4DV2F 1U6ZA 4IRKA 2YKQA 1NZ8A 2BZ2A 4WFXA 3ZTSA 3QSYB 3O3LA 3M6XA 4NLQA 2XY5A 2X1GA 3BBCA 3D3BJ 1LWCA 1VGYA 1CJKA 4NCGA 3RB4A 3D0GE 2EG1A 3JYTB 2A2CA 2ZD1A 3MCMA 3DFEA 2N7CA 5HLFA 5LJ3Y 2H65B 1FKOB 1RWWB 1RISA 4YR3A 1RT3A 3E3XA 2R7QA 3DRPA 2XMUA 4CM0A 3GPAA 1M1HA 3G6YA 4ZVHA 3FEZA 3NCPA 1S1VA 2HFNA 1M1KT 4IFVB 2CJXB 4CYUA 4IG3B 3PY8A 2NXJA 4RNHA 5GMDA 2GCFA 3CWJA 4HHJA 3KLIB 2LEAA 4DR3J 2UVUA 2X51A 4FBUA 4H4OB 2QN6B 5T41A 3THVA 2NCKL 4AFFA 1UPPA 5D0GA 4LF4F 2M70A 3GFXA 1EARA 3TZWA 4NOHA 1UL3A 3CDEA 2HRTA 1U1RA 3AHPA 4DR5F 1IN0A 1N32F 2CPDA 4ZVOB 2KYZA 3PR5B 1RHRB 5CCLA 3HMJG 1SQGA 4O3SA 1TAQA 3CCSS 4Y3CA 2HK2A 3MM6A 1U26A 5D4LA 3MM7B 3S8SA 5KT7A 1JB0C 4OZ5A 4ID8A 2J7KA 4R25A 3LP1B 3HHLA 1JLGB 2Y0BB 4KHPJ 2RQKA 3KJFB 3SFUA 1TV6B 1JXLA 2HNDA 3DLLQ 2XSJA 4GRSA 2VZ9A 2V63A 1ZAXA 1JKHA 1WC0A 3OR1B 4KFBA 2QE5A 4JB8B 2YQ0A 5IQ6A 2WVDA 4YR2A 4QBUA 2EFGA 2HHSA 5HVHA 4EYIB 3TX0A 2EBEA 1F9HA 1X4EA 2BA9A 3E8OA 2DGVA 3AB4B 3RBEA 4X4VA 1Y3JA 2XNQA 4MAKA 2VUGA 2A10A 2XWXA 4DZDA 1RTJB 4RW7A 1DTTB 1NKBA 4DCPB 3DOLB 1YIJS 2VIHA 2HS4A 1FKPA 3OW2R 1GX5A 1S6PA 1NDCA 2EC0A 3NGSA 4OZ3A 2VA2A 1L3VA 3IS9B 1NK7A 1X5PA 4QIVA 2PT0A 4LR8A 2RU3A 3MCNA 4DS5A 2MLYA 1F60B 3AQPA 4LMZA 2ZBCA 1HNIA 3Q8YA 5C2GA 4FDFA 3LQVA 3AJDA 2DH9A 3KLEA 1Y5LB 4I1TA 5C24B 2WRMA 1FWLA 2E1RA 2B4UA 4HDHA 3AD9C 4DFPA 2LEBA 2LQJA 5EX0A 1XMQF 2JEIA 4N77A 1NZAA 2LU1A 5FJ4A 2E5GA 2V6AA 3EE3A 2GJIA 1S1UA 4KHMA 1FXDA 1Y5NB 4YB6A 5J2NA 1Q7YT 2DTJA 3PHTA 1YQHA 4ZA1A 3BO2A 3M32B 2VJVA 5KFQA 3CJSA 2VG5A 2PI4A 4LSLA 3EDRB 4ZVTB 3S7RA 1Z2ZA 2QRRA 4J9UE 1PGZA 2MYFA 2BJ1A 1RHUB 2DHSA 3CJTA 2XZWA 2B56A 2CJYB 1QAXA 2XQCA 4QWDA 3ET6B 3U02A 1D0EA 2Y1LB 4O23A 5A8RA 3BV8A 3JSBA 5L46A 1FDAA 3I0SB 1YJTA 4Q8EA 4LBHA 1H2UX 4B9TA 1N0VC 1VQ4S 1YJWS 1WHVA 1FNXH 1JJ2R 2XI3A 1SL0A 2XSFA 4X64J 1NSKL 4Y2AA 4P2FA 3CSKA 3ZFVA 1N54B 3UVJA 4BCAA 1T3NA 3C8YA 1NPPA 3DLEA 3B8HA 3Q8SB 2VQFF 1EKSA 5DG9A 2MQNA 1BWVA 3OL7A 3RAQA 1WG1A 3CTRA 4DCOB 1CS4B 4RNNA 4MIBA 4M94A 1F5BA 2ZC4A 4WP9A 1AFIA 5SZTA 1VQ5S 1Q7LB 1UA0A 3DXSX 5K8NA 1SQEA 4K2XA 4CLWA 3PR4A 1PJ7A 2YWWA 5F9NA 4FYVB 4LF8F 4CO5A 4PXCA 3QO9A 3ZNJ1 5LT5A 5HJXA 2EFPA 4OZ0A 4XK8C 1QTNB 3BO3A 3D3CJ 4B3TJ 2BBEA 3C19A 4NA3A 4FF3A 5CYQA 3B4DA 5FDLB 1YBAA 5D6GA 2BKOA 5DS7A 3DGVA 1RU2A 1V3ZA 4LJMA 4K4TA 1HHQA 3GJSB 1U7LA 4Y2MA 4ED1A 2HYIB 1LW0A 1ZM2A 2AJ1A 3GQCA 1CVJA 3BGLA 1UJ4A 3AAWB 1RZMA 1X0FA 5I3UA 3VV2B 4UZBA 2BJDA 3FDSA 2FC9A 4BWMA 1KVKA 4DMZA 3W8PA 4C8ZA 1CQNA 3SSSA 4PQUA 5IWAF 1SUQB 4JI0F 1UW9A 2VG7A 1XNRF 5CYMA 5B09A 1TQLA 4IDKB 4CLTA 3JTNA 3KXDA 4EMDA 1VK8A 4IH7A 4P7TA 1OSDA 3H4BA 4J91A 1CC8A 1VK3A 1DFDA 5A8WB 3Q86A 3NWRA 2VBWA 3D67A 4JI3F 2DIUA 4TLRA 3GMGA 1UTAA 3I87A 4J9QA 1EP4A 1TVRB 3LAKA 1NK4A 1QD1A 2EFVA 1LEOA 3OLBA 2G0IA 4JI8J 2V0NA 2MQ8A 2P9GA 1AROP 1O51A 8ATCB 2B8PA 1FF2A 3LPEA 4FZVA 2XMJA 3HSJA 4X4QA 4C11A 3Q0AA 5IOLA 2VFUA 3DLKA 5JJBA 2FLOA 2JFKA 1VIOA 1FI4A 5KFNA 3FSYA 2J0SD 2RKIB 4NZ0A 3PX0A 2V69A 3K5PA 4RUCA 2LECA 2G4BA 2SXLA 1N6QB 3JB9k 5KFJA 4LF7F 2R8GA 2C2RA 1N36J 3T5KA 2WBMA 4DR4J 4IQXA 3UW1A 1FEHA 3KG1A 2FLLA 2DGSA 4KE5A 5KT2A 5B7WA 2BM0A 4NYOA 2CG8A 1S1WB 2MGZB 1F9EB 4Y2CA 1FVQA 5AE1A 3ZZUA 5F8IA 2FHJD 4ZVQB 4IFYB 4QPTA 1VQLS 1SKRA 4LSNB 2E7XA 3K17A 2W7OA 2EPIA 4Z2XA 1HWIA 2V4QA 3ENQA 1HA1A 1Y9OA 3UD3P 3C6UB 1T11A 4WFZA 1IBLF 5KG7A 3PRBA 2DNQA 2GMLA 2YWGA 3I9V9 4DUYF 1YZ7A 1S1TA 3H25A 3G8TA 2HS0A 1NBEB 3UE2A 4UTGA 3FK4A 4W90B 2VC0A 4ZVRB 4DS4A 1JIHA 3MMBA 1X60A 5B0EA 4PG7A 2NPFA 1HBUB 3SFGA 2PO4A 1RBAA 4DBQA 4FPRA 4ELTA 2W8LA 3CIMA 1G4CA 1YWXA 2LYVA 4KRWA 2BJEA 1LWCB 1X4DA 2NYIA 2H9ZA 3LGNA 4LR9A 1ZAVA 1V5IB 2QA2A 2W4PA 5KFBA 3M8ZA 3EGWB 5H9FJ 1VBZA 5KTQA 3PX6A 1UP1A 3DRRA 1X9SA 4H4MA 2KT5A 2J6SA 5HVFA 2AZ1A 3UR3C 1WEYA 2RSQA 1GX6A 4I56A 2MQPA 4TY8A 4XO0A 3EUNA 5AXLA 3O2IA 2ZBRA 2VFRA 2XS2A 1PBAA 2GQCA 3GV7B 1UJ5A 1GFWB 4MJKA 4LF5J 3QT8A 4I2PA 2FZCB 2OLWA 1VQNS 2D69A 4CYUB 2HGMA 1S49A 2W4CA 3H0PA 1B70B 3D6FB 4RW4A 3KK2A 1FX4A 2M7SA 4ECWA 1FD2A 4F67A 4OYOA 4C8NA 3BM7A 2OPQA 2Q79A 2RD5C 2PFFB 4QR2A 3NXZA 1TKXB 4QR0A 4Z7YA 1G2EA 1J5OB 3F41A 1FRHA 3PRDA 4KHRA 2IVFB 1Z4UA 1OQ3A 2CIMA 4M5KA 4FYDA 1Y0HA 4GMKA 1HYSA 4V19X 1S72S 2LXIA 4UZCA 3M2RA 4F50A 1CULA 1VQMS 1T03A 1M5OC 3AD8C 2VQEF 3M8QA 3FMWA 2AZ3A 3DI6A 2HBYB 5E3PA 1RT1A 1IWGA 3IM9A 2F4VJ 3V4MA 2DR8A 5LSLA 5B0DA 1HNZJ 4DL7A 4HT7A 4IG0B 3QWPA 4YHHF 3TZZA 4KGKA 2HNDB 1C0TA 2BQ3A 4RNMA 3P5TL 2EEYA 2O67A 4ED5A 2O1PA 2JFDA 1NSAA 5E3AA 3GIRA 5KFRA 3FKBA 3PX4A 2FYXA 3CGIA 1VC6A 4DV2J 3TP2A 4OZ2A 1MWZA 2VOOA 2CUYA 3QBCA 4S0MA 3M2UA 4ER8A 1L3KA 4KSEB 4QW8A 4DOZA 2J76E 4RW7B 2IHR1 1FA0A 2HWTA 5H1SV 1GQEA 3DLJA 2AKWB 3PYEA 1S6PB 1Z1ZA 5E3RA 1MWQA 3IBCB 2RUGA 1MWYA 3AXKA 3O1LA 1CSJA 2QSFA 2VC1A 2H5IB 2XMVA 1QAIA 2QLXA 4DPOA 3VVUA 3SDEA 4OI1A 2XO7A 1NK0A 4GKJF 2H54B 2PMWA 4MT1A 4PCQA 4ZOSA 4K2JA 4CLPA 2POKA 4QWCA 3I55S 3O5TB 4G65A 2FJVA 1RWMB 3QT6A 4L74A 2OD4A 4QU6A 2J7WA 2A6MA 2KFNA 5KFXA 1TK5A 1X4BA 3PO5A 2ROEA 1DQ9A 2D3UA 2OSQA 4FF1A 1QE1B 1HW9A 1BGXT 1UVJA 2LXUA 4CIOA 4K4VA 4DCJB 3V4IA 4P10A 1TL1A 3KHLA 2V94A 1UPMB 1S1UB 1PC4A 3Q8UA 1RWXB 1PG5B 3W8GA 3ETOA 4PWUA 2R42A 2NXCA 1S97A 3A4TA 1RA7A 4DR5J 1XR5A 1JXEA 3AT1B 4XDCA 1N32J 4FF4A 4AT1B 2VG5B 4LSLB 1FESA 2MKIA 1RT7A 4ECVA 1O6XA 1UZDA 3D5MA 2IJFA 2PMZD 3RJMB 4L6V3 5KFPA 2ZKUA 2O3DA 1HR0F 2BEFA 1YSJA 3QJLA 3N4WA 2AWZA 3AY0A 2GVDA 2HRUA 1JX4A 3TVKA 3VQSA 5F8HA 2KO1A 2P6TA 1WHXA 4G6VB 5IQQA 1OYEA 3B78A 1N5VA 5BJRA 4USMA 3DYAA 3MEGA 2X3GA 2FVPA 1DURA 3BBFA 2PFDA 1RAHB 3FC9A 4F8RA 2IFXA 2NUUG 2DNPA 3M2VB 3DLEB 4WP8A 4KC5A 4RW8A 3RRGA 1Q4RA 3JAMY 3QAUA 2XHWA 1L3TA 4ZS6A 3ZNUA 2NSCA 2Z8QA 3RG6A 4WFNQ 2JEFA 2B0GA 3FFIB 4JV2A 1RCOB 2CRLA 2CQDA 1CJTB 2YKMA 3I56S 1S6UA 5BXIA 3DU5A 2CNKB 1QSLA 4ZPAA 3EVMA 2WSCC 1VS3A 1RWOB 4CCHA 4U7UD 2F5GA 1Q79A 1H6KX 2AYBA 4KT0C 4YEAA 1KTVA 3LWLA 2ZNYA 3RR7A 3BF4A 2DGQA 4ED4A 1FRMA 4USKA 2C2ZB 4RLEA 1LW0B 5CZXA 4F0KA 4ED2A 5E7OB 4GKKF 4L3NA 1NB7A 3UNYA 2VOPA 2ILYA 4P6QA 2HLTA 4X62J 1VHIA 3TA1A 2QX0A 3CDUA 2LP4A 4G1PA 4NXMJ 3JAMU 1R0AA 2MJNA 2RRBA 5B0CA 4ZDNA 2NXUA 1VQ8S 2KKHA 1YHQS 3PNIA 5CYMB 3DLBA 1NJWA 2B4VA 1REGX 2YY3A 2M8DB 2B3TB 1FRXA 1VISA 4TYAA 4R8UA 3HK2A 4KO0A 1EIYB 4XTTA 4DSEA 4DU8A 1HI0P 4K59A 4DV0J 4DQPA 5J1PA 1XR6A 4MFBB 2D3ZA 4TN2A 2FUG9 3B54A 3GG1A 1UMJA 1KDNA 1MMLA 1BQXA 1TUGB 4RX6A 2R7VA 5IFMA 5D0HA 4DI6A 5HMWA 4HKQA 4ERDA 5ADZA 1N0UA 2XHCA 2YNGA 3RW7A 4KGMA 4FF2A 4ZHRA 4WXWA 3NP5A 1YGYA 2FC8A 4I69A 2XMKA 1URRA 1RI7A 2FJXA 3QJJA 2PN6A 1ROFA 3DLKB 2G2YA 4PWDB 3LPYA 3TOQA 5ETOA 1LXNA 3DOKA 1T8EA 1SC6A 2CQGA 3HFZB 1H2TZ 1W25A 3LGHA 2FLPA 3DKDA 2CQIA 4WYLA 2XWYA 2B7CB 4FNHA 3N9UC 1RAAB 4F4ZA 3T1AA 4USWA 4OX6A 4UY85 2XY7A 1S59A 4ZPCA 4LF8J 1X8DA 2CZVC 4GVBB 1N56A 2E1AA 1UAWA 3QNWB 1LQ9A 1Q8LA 1DQAA 3MM8B 4F2RA 4YS2A 2J6UA 4MIAA 2OMOA 3LP0A 4MK7A 4KB7A 1FRKA 1NDPA 2CQ0A 3MR2A 3P4UB 4ILMA 3CE8A 2K06A 2GIQA 5MLCV 3QYYA 5HK4A 3EICA 3DRXA 4AQYF 5A76A 1K8AT 2OHDA 2WVEA 1S1TB 2HHWA 1MN7A 2WOMA 2CDRB 4ECYA 1S6QA 3PJXA 3G86A 3MMBB 2XC9A 3AOCA 1KSPA 1OQ6A 5IWAJ 3J7AN 2BM1A 1XNRJ 3DCAA 5D8HB 2JVRA 4KY3A 4IOAQ 4OX7A 1G3OA 2XEXA 3VVTA 4WKYA 1UJ6A 4CH1A 1FVSA 2L3MA 2C2DA 4ZJLA 1JLAA 4ED8A 2JRSA 5D3GA 2XBPA 3CULA 4JI3J 2WTFA 4B08A 3AOAA 4Q2MA 1GTHA 3GJTB 4ECRA 1L3SA 2XB2D 1CC7A 3U1LA 2IVYA 1VLOA 4RUHA 1KFDA 3FCVA 1F2HA 2DJWA 4DL4A 4X4TA 3ILJA 1S76D 1N34F 1NB2A 2DT9A 1X5OA 5E0OA 4LBIA 1KOHA 2JNJA 4QIWD 5B0BA 4RW4B 3KK2B 2HHXA 2W2OP 2WVCA 2ZHOA 4LFBJ 3NNHA 4I67A 4X4SA 5D0EA 1VC5A 4O3OA 2BKNA 1UEUA 3T5LA 1SJ4P 4M5HA 1VLYA 5CD4A 1WC5A 5KG2A 2KM8B 3G2XA 1N48A 3I5BA 4ZLNA 5ITHA 2KT3A 2MQOA 2JZ5A 4PKDB 4F3MA 2F8HA 3PFEA 5I42B 5CYJA 1WG4A 3LP2B 3BR9A 1R27B 4DR2J 2KYXA 4X66F 1T03B 3UNGC 2L9WA 2YNIB 2EBGA 4CLFA 5KFKA 1KTQA 4CO3A 3M8QB 2EXUA 3CMAS 4OV6A 4CQ1A 4CO2A 2ALYB 1VC0A 3TUIC 1VRTB 3T5HA 1BC6A 2QA4G 4NMLA 2Y8YA 4JI4F 4NLYA 2XLIA 1AT1B 4WYWA 1IBLJ 2RRAA 1FJGF 2BW2A 4C0HA 4HTJA 2FGCA 2Z58B 2CPFA 2VDHA 2E29A 3JSYA 3RUBL 3R9LA 3L4BC 2LFVA 4AL7A 1AUSL 1B0VA 1C1CB 4NASA 4B9MA 2F40A 2GC8A 2OH2A 4X84A 1KFSA 2HFSA 2FVQA 1AA1B 2GZOA 4JI7F 3UPFA 2CPXA 2NSBA 3KUEA 2BQUA 5I4MA 2G1DA 4M5DB 4DR1F 3OFEA 1NDKA 5A6WA 2P9EA 3GJRB 1KHWA 2CJKA 5DQHA 3AODA 1HWKA 1SH0A 2XLJA 1B4SA 3KOAA 2Y8WA 3CJ5A 4PXEA 3LALA 3SDEB 5HBMB 4USJC 3KLVA 4OJ1A 3QZ7A 2BXJA 1Y4ZB 4ES2A 5DLFA 4WFYA 1KBRA 2N3LA 5L1KA 1CBKA 3IR7B 5HQ8A 3VGSA 3CF5Q 2H1YA 2CQ2A 3IWLA 2BANB 2VHGA 5C42B 1OO0B 4DL6A 4YR0A 3KJVA 4KTQA 3FNNA 1VQSA 3KLFA 3BDPA 2E5IA 4GO7X 2RB7A 3OV7A 4J5OA 2CJAA 3V4IB 1T0TV 4C8LA 3BREA 1K1QA 3W65A 4NWBA 3GP9A 1N5QA 3MM5B 2AEFA 2E5LF 5KG5A 3FRYA 4MKBA 1VIXA 4CLSA 2VKRA 4P74A 4WWSA 3DN9A 3OFFA 3TQ1A 2CQBA 2ZZNA 3GFHA 2VPZB 1D9DA 5T7LB 5AXKA 4OHXA 3V6DA 3N6NA 4AXIA 2AYEA 2VODA 3S1TA 2HQDA 3BH6B 3VAKA 3BYPA 2W9BB 3N79A 2VQEJ 3HP6A 5LM7E 4K8RA 3GSIA 1PYOB 4A48A 1B7FA 3H2UB 2IRYA 1KLMB 2GVDB 1T05A 5GAGI 1B64A 3C6TB 2U2FA 1AZSB 2VG6A 3K5MA 1E6VA 3AA9A 2C28A 1WD6A 1E6YA 3NEKA 3QPIA 4YHHJ 3BYRA 1F5CA 3BSCA 2E9ZA 2ALZA 2B7BB 1KP6A 2DNZA 4WIIA 2DHHA 5E2QA 3GU0A 4EO6A 3MEKA 1NEEA 1S0OA 4ID5A 2DBBA 5KFEA 3HPOA 1WACA 3NGDA 1DZ5A 2ZHBA 4RW8B 5HSPA 1RLDA 1FXRA 3GZ7A 1T7PA 1GT8A 3SSQA 3RR8A 1ZM4A 4FXDA 3DM2B 4OX9F 3T1HJ 3IRXA 4IH6A 5DO2A 1UA1A 1EETA 1RU1A 4ENOA 4OYIA 3SCLE 1PILA 4EI2A 2HGNA 1R8PA 3M8RA 2GA7A 4QWBA 2RILA 3PW7A 1YZ6A 1NCLA 3ZZOA 3W66A 4OI6A 4GKJJ 3K89A 5HQLA 2YQ1A 3TVZA 2ZKTA 2XTJP 3CCQS 4J9PA 2HK3A 3B82A 4ZVUB 2AD9A 3UN2A 1D09B 1R8CA 3OFHA 2CPYA 4K5RA 2IY5B 1NRKA 3MEDA 1W26A 4N47A 2W7AA 2IYGA 2BE2B 4CTAA 4TU7A 4RNFA 4JV5J 4L3KA 1CEZA 4QIGA 4IKAA 1RBOB 4J9RA 4QYZJ 4I7FA 3D7SB 5KFVA 3N28A 4EWTA 1VOMA 3NGKA 4OV1A 2HVIA 4M5MA 3R7BB 1IR2A 4QQBA 3ZC4A 3BKUA 1RABB 4DF4A 1RYRA 4R8UB 1XNQF 2BR0A 4DFMA 3UDLA 3HZGA 2QLFB 4P2MA 3PEHA 3I4HX 2EK1A 4FP9A 4K4XA 2VDIA 2CWKA 1V3SA 3W5XA 3T6JA 3BSNA 2UVVA 2A0FB 3JYTA 1X5TA 1V3RA 1TZ0A 1YTYA 2M4MA 3H40A 5EWFA 1FKOA 4OHVA 1T02A 4N8OA 5A0YA 1PC5A 4V19J 3BS9A 1PAEX 4LUBA 2DHXA 4LSZB 4U9RA 4C6AA 2CQPA 3O44A 2J9CA 5IS2A 3LTOA 5IT0A 1BUXA 2J0XA 1TKTA 1X0PA 3DOKB 2D3O1 4CLZA 3PM9A 2ASYA 2V2ZA 2GNKA 2GHVC 3GE9A 2ZWOA 2UUCF 1H2VZ 1K73T 5C25A 3BSAA 4JI6F 3WBZA 1MU2A 1RP5A 4YFUA 4IG3A 3QRRA 3GIKA 1NPKA 1NXIA 2F1FA 4FYWB 1UVLA 3SV3A 1HFEL 3IBFB 3RRHA 1U1LA 5DLGA 2YX4A 3UD5A 1PCAA 2CFXA 1HW8A 2MY7A 3DHWC 5KG1A 4EK2A 2DB1A 2C3YA 3M8YA 4U7UK 1VYAA 5AE3A 2PD1A 1BQNB 4LRBA 5ETQA 3GIIA 3L95X 4RW6A 3LP0B 2M9KA 5LSRA 2BJ8A 2IC3A 3H7HB 2DNKA 1M5PC 3J80Y 1SC1B 1A0OB 2ZJRQ 1HARA 1RJJA 2V34A 4NLPA 2DEJA 2XS5A 4GKKJ 1TR0A 3EGNA 1P27B 3G8SA 4P9SA 3DDKA 4OLPA 4J9MA 3MM7A 4DSLA 3PZPA 3PACA 3HKZD 3DDIA 2FTRA 2WOMB 3LP1A 2CJ9A 2MLXA 2RS2A 3HO1A 1T9VA 2KRBA 3OL9A 3DDNA 4OI3A 3N0VA 2KRRA 2BKPA 1NJYA 3OR1A 4X64F 3H59A 5LXRA 2WSFC 1F1BB 3CMES 4FXVA 2R8IA 1JLAB 2DGTA 1KVJA 3FZ2A 3WZ0A 3ILLA 1CPZA 2P5VA 2OPSB 1Y11A 5KG0A 2XMTA 2KN4A 1RTJA 3BO4A 2HEKA 3DOLA 1U47A 2QEXS 2ATCB 3ICLA 3NS6A 3PHEA 4BHQA 1ZYQA 3MD1A 2Y1RI 4QPXA 4DV1J 3RB3A 1IQZA 3UCGA 3KUGA 2DY1A 2R7XA 1RT5B 1TMJA 3OTEA 5CXTA 3POTB 3QJPA 1Q5VA 4ZVGA 3H5XA 2DYAA 3TUPA 4PRFA 1HD1A 2XCPA 3M1VA 2M3DA 4J7CA 3KHRA 1HWUA 2V2KA 2QIFA 1M5KC 2IDLA 1VI7A 2XMWA 4I0WA 5C24A 2G0CA 1ZTWA 4EEYA 2HAFA 2XMMA 5CHCB 2FGOA 1YJ7A 4LFCF 3W9JA 2IA0A 1U1QA 5DGBA 1SKSA 2HHQA 3ZTPA 3RAMA 4HVZA 4DLGA 3TZYA 3JXOA 2CXEA 5KG6A 4NX9A 1EB0A 1WOSA 4F3OA 3HXMA 2D1CA 4WFAQ 2UV8A 4K0KJ 1IKXA 1FFGB 3D1QA 2V8DA 2CJBA 4UUWA 5BYQA 3H90A 1TUWA 3TA0A 3M32A 5F8MA 3Q83A 1CLFA 2DGWA 3W5ZA 2Q1LA 2JVOA 2Z4PA 3OTCA 4AQYJ 5LMUF 2B51A 4Y28C 2YBVA 2HG4A 1S12A 1OY8A 1SL2A 3ET6A 4RU9A 1HBMB 2LEPA 2NREA 1S9EB 4ATNA 4W98A 2HPUA 1S9GA 4QCLA 4ELVA 3MR3A 3I0SA 5GAGU 4QZVB 1WHWA 3OLAA 5D4OA 2XYPB 1HIYA 3M6WA 2P2CB 4JI8F 5DM7Q 3X1LB 1X4AA 2MKYA 1TUVA 3KG4A 1D3WA 2J0WA 3O8WA 3T6BA 4IO9Q 5HI7A 2XZDB 2Z57B 2LLZA 1CS4A 4NE9C 2QSWA 1VJQA 5J2PA 3EXCX 2A1BA 4ZITA 2UVRA 3OL6A 2OP5A 1NH8A 3MMJA 1SIZA 4DR4F 3S6EA 1HWJA 4F4YA 3P6YC 3GB0A 5KFCA 1N34J 2VONA 3G8QA 2ADBA 2IAJB 5KFZA 1KR4A 2HVDA 3P96A 4YB7A 3ULHA 3AQOA 1SKWA 1RAIB 2WW8A 4NXNJ 5A6PA 3K59A 3NBPA 2VBZA 3MFHA 3R3TA 4Q43A 3IO1A 2MQMA 2W9AA 3ZZPA 1RB0A 1NK6A 1TKDA 4EBCA 4J9OA 1RWNB 3JTOA 4QJVA 1GMWD 2JL9A 3DMJB 4DG1A 1ZM9A 4RBUA 4EZ6A 3V6DB 4BWJA 3CCJS 1Y3KA 3QRQA 1UFKA 4HTIA 5AXNA 4AUKA 1EHWA 1SVDA 1A7GE 4ECUA 3G87A 4NA1A 2FVRA 4M5IA 1T05B 1RGVA 1U8SA 2VG6B 1E6VB 4TXSA 4IQMA 2PA8D 1FJGJ 5A8WA 4KBIA 4OZLA 2IM0A 2BDPA 2BRKA 3LGMA 8RUCA 2ZHAA 2L08A 3VAGA 1QVFR 3HD1A 4RBVA 1GTEA 4K4SA 1FWPA 4TNOA 1NHVA 4CLYA 2Y9HA 1XR7A 4ID5B 2CQ4A 5DQGA 3QRPA 4A8KA 3V5RA 1WDDA 4YY3J 3C46A 4NEYA 3J81U 4NRUA 4DL5A 3CT9A 3IRXB 4DR1J 3A13A 1EETB 1OMSA 1RLCL 1P1TA 2RKIA 3HFKA 1WC1A 4N76A 3GR1A 2Y1JA 2GQQA 4NMXA 5H9EJ 2DGUA 1MG7A 3JS9A 3CCES 3SYZA 1HQUA 2ZH6A 1U4BA 2K1RA 2MMYA 1VQ6S 2W4DA 1IBKJ 1WSRA 1B0TA 2GMJA 5I3QA 3HI9A 1S1WA 4ZP9A 3R1HA 4C8OA 3QAEA 4X4PA 4IRDA 4ICLA 1ZBTA 4Y2IA 4IFYA 2QL7B 3GJQB 2UUBJ 1V9OA 4LSNA 3A12A 3Q2SC 2LDIA 1U1KA 3S01A 1U48A 4DX5A 4MTPA 4DL2A 2HQIA 3GV8B 1MMNA 5HROB 3HJVA 4A8QA 2E5LJ 3C6UA 4QIFA 1HMVB 1O5JA 3R5DA 4DV4J 3KLHA 2ZH7A 4EGLA 2DGXA 4IRCA 2QA4S 4Y65A 2UVWA 5DRKA 2V8HA 4HEA9 2WK4A 1Q8KA 7AT1B 4NL5A 5KFLA 3GILA 1EQ0A 2Q6CA 2KFZA 4C9DA 4RUAA 2EI5A 1HD0A 5DQIA 2V8PA 3B6BA 2ASDA 1HBUA 3OVAA 4Y2KA 3CCRS 1KVIA 1M5VC 3VWSA 3W61A 1RAOA 3D2WA 3W62A 1MLAA 4M8LA 5KAKA 1S5ZA 2FIUA 2RF2A 4P7VA 5B0AA 2IIHA 5L1JA 3NY0A 2I1RA 2PA3A 5KT3A 3IWXA 4KH1B 2DXFA 3EGVA 2Z2MA 3K5OA 4DZ6A 3K5NA 1D9AA 4F4AA 1Z2LA 1Y10A 5LOQA 4C0OC 4B9SA 1U09A 4TQSA 6FDRA 2Q3PA 1Q1KA 4PYDA 4OIXA 5A0YB 1AYEA 1MNEA 2ZDPA 4N41A 1KOOA 2V4JA 2PSZA 1FRLA 2JLFA 2YH1A 2DO4A 1AFJA 3M9OB 4UOHA 5D77A 1TKTB 4WZMA 1I94F 1S7HA 2YTCA 5DJBA 2WAQD 5C25B 4ED3A 4OX9J 1MU2B 2ZNZA 3Q23A 1VFJA 3LH2S 5B08A 3MECB 1NO8A 1T9UA 2B8QA 1SI9A 2YKOA 4HH1A 4IOCQ 1I1GA 3KDOA 4B02A 4QR1A 4N7TA 3NL0A 1KD1T 4WBFA 5GADI 3MPVA 2HVEA 1LWXA 4TVAB 3D28A 3G71S 1T9YA 1Q8IA 2OSRA 3FEXB 1TKXA 1J5OA 4RW6B 5BYSA 2GIFA 2XO6A 1FKAF 4NRTA 2BE7D 3QWUA 3Q8PB 2D3OR 3PXGa 2IC3B 5J1EB 3K0JA 1Y5IB 3I32A 3KK1A 3U27A 5HATA 2PEHA 1Q78A 4F36A 3TO8A 2HBRB 2QGFB 3I9ZA 3Q8VA 2HHTA 2D9OA 1VRQC 3MZIA 4F02A 6AT1B 2ZBQA 1R6VA 1UFWA 5H9FK 2J8SA 2HHPA 4IG0A 4FYXB 2X1AA 4ED6A 4OHYA 4ANEA 1K1SA 4P2SA 2AQ4A 1YBUA 3MD3A 1OIAA 2BW7A 4F4WA 1XNQJ 1FHTA 2OMLA 5JMNA 2VPYB 2FPHX 3CJQA 1U1MA 3OQ2A 2OEMA 1I3OB 2WCXA 2FJDB 2V8VA 2MZ1A 3PW4A 1VJWA 1F3VA 2AEJA 1WEZA 3IR6B 1OPIA 1KKHA 1X4CA 3EVWA 3A3PB 3WC0A 3PW0A 1YJRA 2WONB 4WXOA 4C48A 4P71A 4NLSA 1KQGB 3SCKE 1IQTA 1UKUA 1GH8A 3MOJB 3M1VB 1SJQA 3BKFA 1VMBA 4KV8B 1RACB 2UUCJ 3T9NA 4JI6J 4LIRA 1I51B 2QZ8A 3Q2TC 4X4OA 1J5EF 2ABYA 2RHSB 3L09A 3W2WA 1JLFA 3IFEA 3BDEA 4RR5A 1C2PA 1HL6A 1QE1A 3EPGA 3N6MA 2R7RA 3D0HE 4HHUA 2EWHA 3BGRA 4EYHB 2LQ8A 4X62F 1VRUA 2FY8A 2C3OA 1JJHA 3BQ0A 2HQFA 1F2GA 3CJ4A 3LW5C 4NXMF 2N82B 1GXLA 2YNFB 2WB1D 4P75A 1YRUA 4GO5X 4IO1A 1IKXB 2NQPA 4WP3A 2I6WA 4KPYA 2B9XA 4KYZA 2AJFE 5ETLA 1RWVB 1WI6A 2ZH4A 4YUDA 1N33F 3ILIA 3MUVP 3CDBA 4TQRA 2BACA 3CXCR 1WWHA 3OHAA 1UW4A 2PEBA 1FE0A 4DV0F 3HHLD 2CZ9A 1S9GB 1C4AA 1HHSA 2VFVA 3CPWR 5BR8F 1K47A 5KFWA 3PV8A 1SJRA 3MMAB 2B6AA 1FDBA 2KHDA 3CD0A 3ZTRA 4OX8A 3C16A 3M2VA 1Q5YA 2ZM6J 1GMVA 1EQMA 2EG2A 2OUGA 4M63A 4PG5A 5J2PB 1FX2A 4CO1A 4UT4A 1RHQB 2CPZA 2ZH1A 4V1Ak 3P5BP 2CWXA 1UWBA 3FFIA 3WC2A 3DLGA 3K2YA 1RYSA 2BV3A 4G1QA 2DCLA 2IVMA 1WF0A 3BQ2A 1KEKA 1HQEB 1IR1A 1CJTA 2QLBB 2VH7A 4OHZA 4L75A 1ICEB 3NBPB 1IBMF 1W7WA 1RK8A 3BB5A 1LFWA 1RTZA 2OELA 1X9WA 2WHOA 3CJ3A 1DLOB 2LQ9A 4LFCJ 4LR7A 4MYUA 4DEZA 2Z30B 5CABA 2JSXA 4ALZA 4O44A 1KN6A 5HN0A 5GAEI 2CPIA 1ZPVA 2C2KB 3MTKA 1QY7A 4DG1B 4OMFG 2HMIA 2R8JA 2KT2A 2MKJA 2VFTA 1LWFB 1VBKA 3G6ES 1NJZA 1G1XA 3HSGA 1RTHA 3MWBA 3GIJA 4LF6J 4OJ3A 4OYXA 5LMUJ 1VQKS 2N4DA 4CLLA 3CCTA 5IT4A 3PRVA 4E8UA 1OY6A 3H98A 2HNZB 1HNVB 4MFBA 1KQKA 3QGHA 4USHA 2AW0A 1EZZB 4NCAA 2UP1A 1ZA1B 2UUAF 5A8KB 2WVFA 3CJKB 4OYBA 1H7WA 2GW8A 4N5SA 1X5SA 4C3LA 1UZHA 2P8IA 2MXYA 2FJAB 4PWDA 4C97A 1XERA 4ILLA 4O4RA 5KOXA 1PKUA 4LFBF 2R7UA 3R5GA 1KC8T 4OYZA 3CO9A 2YPZA 1U45A 5J2QA 1HQUB 3F56A 1EKRA 1RTIA 2K1RB 3T3FA 5T14A 4ZVEA 3MURP 2WBRA 2FZKB 5F8LA 5IZHA 2XS7A 2YNHB 2QC3A 4GVBA 3QATA 2JC1A 5GADU 4I64A 3JQKA 1HNXJ 4ICLB 3MM8A 1SJFA 4DR2F 3SEOA 1KHVA 2B5JB 3IAM9 3CDAA 2OTJS 1FD8A 2UU9J 1RCXB 3MEEB 3OSPA 2FJBB 2ZWPA 5DDQC 3HM9A 5KT4A 4B3OB 5IV4A 2EKNA 4Q45A 3KLHB 4KAIA 4MIWA 3MAAB 4OZNA 1OYDA 3LWMA 1GXUA 2I5JB 3P49B 4FN5A 4KH0B 3HHNB 4XAKA 4DUZF 2BOAA 2OAUA 2W2NP 5THWA 1VQPS 4I6AA 3PFOA 2B4OA 2XYGB 2RF2B 2DIVA 3C15A 2ZVSA 3GFYA 3HZEA 2MHEA 3W1YC 3UDCA 2AGQA 1IVZA 1WEXA 3SXLA 3N5FA 2GHWA 5HANA 4Y0FA 3PYDA 2ZDOA 3BBBA 4NLGA 2E9TA 1W2IA 1HHTP 2J9DA 2W01A 2KU7A 2V4JB 5CAAA 4WKRA 2Y0SD 4ZPWR 4LBPA 4CLKA 4B3RJ 2V5HG 3JQJA 1BY9A 5KFUA 3NS5A 3UWTA 3R5BA 1VQYA 4PQAA 5IV3A 3TEHB 4KQZA 2GO9A 1XJWB 3WX8A 3VALA 3MI7X 1VQOS 3CNQP 2RE1A 5ETKA 3GSDA 4JP8A 2NLWA 2IDEA 4X4NA 2E44A 1CJVA 3TAMA 4P52A 2HURA 1UWAA 5D15A 1QTMA 2A18A 3IA0A 3ENVA 3BJYA 3H2VE 2ZBPA 2ZH5A 3WDOA 1G6BA 4B3MF 4QOTA 2OEKA 2J7UA 3ADAC 3CC7S 4ZIWA 2V9WA 4PWWA 1KNZA 1YJNS 2KXFA 5I42A 2YXLA 1P9QC 3VTIA 4MKYA 3KK1B 3LP2A 2W1BA 5IT9Y 3RBXA 1QDUB 5K9FA 2YNIA 3MM9B 2B4PA 4X4RA 2QFIA 3PTWA 3BN7A 3IXQA 1VRTA 2EW9A 4Y00A 3R7SB 3KHGA 4MKAA 4RZRA 1N5TA 3BEGB 1IKWB 4ZPDA 1NHKL 3PYGA 3CJRA 2MKHA 3H5UA 4I6YA 3RBZA 3WX4A 3J7YI 1AUDA 1PO6A 4HH0A 4PXBA 2DNNA 4LVOP 2FB0A 1C1CA 4WFBQ 1RWPB 5G4DA 4O3NA 4IOBA 1R31A 4NLXA 4ZVPB 3LANA 3IM8A 3EXYA 3RU0A 3VZHA 4HDGA 1XWLA 4WK3A 3TZXA 3T1HF 2FZGB 5K8OA 4M5DA 3D6MB 2QMXA 3QGPA 3AFGA 5KFOA 1FRJA 4ZP6A 2DCUB 3N01A 5IT9U 5KFYA 2ZUGA 3F73A 2OKQA 4R0EA 2R9LA 2AYGA 1LW2A 4R5PB 5DDRC 4DHVA 4GC6A 1NUEA 2VV5A 3RB0A 2YKAA 3NAHA 4UOCA 2IYIA 2RJZA 4HYKA 5HBMA 4MH8A 2DEIA 2JX2A 1HQ2A 2BUNA 4C0BA 3BPSP 5CCMA 4AL6A 1N52B 3TARA 4QIEA 1M90T 1I94J 2LCWA 4ZIVA 1WOOA 3M8WA 1TKZB 1WI8A 3VAHA 2ZOGA 3EDQB 2NR0A 4HL9A 2FHKA 2D41A 5CZVA 4NLRA 2R2RA 2EFQA 3UN3A 2BANA 3ZZYA 3W2WB 5C42A 2P9CA 2NYHA 1JLFB 2NZCA 3CD7A 1X4FA 3LOUA 3I6PA 3A3OB 5B0FA 2HGLA 4JV5F 3BGRB 1JNZB 1VRUB 2D74B 2IMWP 1FK9A 3MM5A 1WELA 4PEOA 3A8JA 4RU2A 2CG4A 1NJIT 4WE1B 4ITSA 4LF2A 2AV5A 3MPWA 5AT1B 4JI5F 2FHMA 3HHKA 2R2TA 1N88A 5T7LA 2AHOB 5DZ6A 5GAEU 1LOUA 3OTDA 3R8YA 2W9BA 3ZZRA 5IXUA 4QWAA 1QSYA 3M9NB 1Q16B 3HVTB 2ZVIA 1PAUB 2C1EB 1KLMA 1R0BG 4ZN3A 4YDXA 2MKCA 2I8EA 3C6TA 3KNAA 1U1NA 2VBXA 1AZSA 4HACB 3SCIE 1WC4A 2MSTA 1CJUB 1MMDA 3MPUB 1OJ4A 2ZJPQ 3DXBA 4NPOA 5LL6d 2ADCA 1MSWD 2R2UA 1YDLA 2B6AB 1XEZA 4USIA 4C2MA 5GAHI 1S7IA 4DFJA 3C16B 3DGPA 2IM3A 4ZPBA 4LFAF 2C42A 2KB2A 4KGXB 4YP3A 4Q44A 1PYSB 2N7YA 3DM2A 4E0DA 4U6PA 1X7VA 3ISNC 2MZQA 4Z7CA 3QLHA 5RUBA 1UWBB 2W8KA 3DLGB 3FZBA 1R3NA 4JBCA 1S4EA 4G1QB 3DRSB 2HNYB 4H54A 3NOCA 1RSCA 1C1BA 2VFSA 2ASLA 2CNOB 4E2FB 3OPKA 2EVZA 2JWNA 2W2QP 4PZVA 4ZKAA 3OXFA 3DNCA 3NRBA 4GVLA 1S9FA 4ZCIA 4DL3A 4HR2A 1NHUA 1J5EJ 1P1LA 4A8MP 2E1PA 1YBTA 1RHKB 5E3CA 4BC9A 2QMUB 2KH9A 3M6UA 2BE2A 3NGTA 5EGYA 5F9LA 3G4SS 4WK1A 4O44B 1EJ7L 4NI2B 2G2ZA 4ZLLA 2DXEA 3GR0A 1Q86T 2HQGA 3H8YA 2ILZA 3DRYA 2JJ4D 1XIQA 3CJ0A 3RGIA 2G2OA 1TL4A 2R3VA 2HMIB 1LXJA 2J9EA
chains in the Genus database with same CATH topology
1SC1B 1RWVB 3D6HB 4ZVRB 3KJNB 4DCJB 2CDRB 3NS7B 3R7NB 3D6MB 4DCOB 4LSZB 2C2OB 1RWXB 2QL7B 3GJQB 2HBRB 4DCPB 2QLBB 2H48B 3KJQB 4ZVSB 1SC4B 1RHMB 2XZTB 1ICEB 2CNLB 2H51B 5IC4B 4ZVOB 3EDRB 3R6LB 1QDUB 4ZVTB 1RHRB 1IBCB 1PAUB 2CNOB 2H65B 2XYPB 2C1EB 1RWWB 5IC6B 1RWKB 2P2CB 1RHUB 2XYHB 3IBCB 1I51B 3R7BB 2H5JB 3R7SB 3IBFB 1F9EB 2CJYB 3SIPB 1SC3B 3RJMB 3R6GB 3GJRB 2H4YB 1QTNB 2H5IB 4ZVQB 3QNWB 1RHKB 2QLJB 1RWNB 2C2MB 3EDQB 3P45B 2Y1LB 2CNNB 2CNKB 2Y0BB 2QLFB 2HBQB 2HBYB 1NMEB 2H54B 2XZDB 5K20B 1BMQB 3GJTB 1GFWB 1RWOB 3R5JB 2C2KB 3KJFB 2CJXB 1PYOB 3GJSB 1RWPB 1RWMB 3P4UB 2FQQB 2HBZB 2QL5B 1I3OB 4JB8B 2DKOB 2XYGB 4ZVPB 4ZVUB 2C2ZB 1RHQB 2QL9B 1RE1B 1RHJB 3D6FB 2H4WB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SC1 B;  1RWV B;  3D6H B;  4ZVR B;  3KJN B;  4DCJ B;  2CDR B;  3NS7 B;  3R7N B;  3D6M B;  4DCO B;  4LSZ B;  2C2O B;  1RWX B;  2QL7 B;  3GJQ B;  2HBR B;  4DCP B;  2QLB B;  2H48 B;  3KJQ B;  4ZVS B;  1SC4 B;  1RHM B;  2XZT B;  1ICE B;  2CNL B;  2H51 B;  5IC4 B;  4ZVO B;  3EDR B;  3R6L B;  1QDU B;  4ZVT B;  1RHR B;  1IBC B;  1PAU B;  2CNO B;  2H65 B;  2XYP B;  2C1E B;  1RWW B;  5IC6 B;  1RWK B;  2P2C B;  1RHU B;  2XYH B;  3IBC B;  1I51 B;  3R7B B;  2H5J B;  3R7S B;  3IBF B;  1F9E B;  2CJY B;  3SIP B;  1SC3 B;  3RJM B;  3R6G B;  3GJR B;  2H4Y B;  1QTN B;  2H5I B;  4ZVQ B;  3QNW B;  1RHK B;  2QLJ B;  1RWN B;  2C2M B;  3EDQ B;  3P45 B;  2Y1L B;  2CNN B;  2CNK B;  2Y0B B;  2QLF B;  2HBQ B;  2HBY B;  1NME B;  2H54 B;  2XZD B;  5K20 B;  1BMQ B;  3GJT B;  1GFW B;  1RWO B;  3R5J B;  2C2K B;  3KJF B;  2CJX B;  1PYO B;  3GJS B;  1RWP B;  1RWM B;  3P4U B;  2FQQ B;  2HBZ B;  2QL5 B;  1I3O B;  4JB8 B;  2DKO B;  2XYG B;  4ZVP B;  4ZVU B;  2C2Z B;  1RHQ B;  2QL9 B;  1RE1 B;  1RHJ B;  3D6F B;  2H4W B; 
#chains in the Genus database with same CATH topology
 2QG9 B;  3T19 A;  4DSF A;  1SV5 A;  4CRJ A;  4FBT A;  4JUZ A;  2IPO B;  5JVG Q;  5HP1 B;  2GJ2 A;  1RTH B;  3MMC A;  2F8E X;  4AYB D;  2CQH A;  4F0H A;  1N33 J;  1LKZ A;  4L76 A;  4O3R A;  1T9X A;  2DHG A;  4RL1 A;  1HWL A;  2I2Y A;  3QID A;  4J90 A;  3HKW A;  3CCZ A;  2HRY A;  5KFM A;  4DV3 J;  3FJ2 A;  5JXS A;  3MR6 A;  1NLK L;  2DGO A;  3SZ2 A;  4M5N A;  1TL7 B;  3A8I A;  1S0N A;  1NK5 A;  4AE5 A;  2H3E B;  2E9R X;  4A8F A;  2M2B A;  5BR8 J;  3PW2 A;  3M30 B;  4LRA A;  4RW9 B;  1RTD B;  3NKY A;  1LK7 A;  1YKW A;  2W9C B;  1RKJ A;  4DV1 F;  1LWE B;  3IN5 A;  1U0S A;  5HO4 A;  2R4F A;  5EWE A;  3H2L A;  1RA6 A;  3UO0 A;  5G0R A;  7FD1 A;  4J9S A;  1Q0N A;  3J7A 1;  3KLG A;  3FQL A;  5K14 A;  2PDA A;  3EZU A;  1WKJ A;  4NZ6 A;  3K8W A;  1X4G A;  1S1X B;  1LK5 A;  1U8W A;  2CA9 A;  1SH3 A;  2G1H A;  3L3C A;  1RE1 B;  4ZPV R;  2H4W B;  1IWA A;  1XBW A;  3ILO A;  1QUV A;  2FJW A;  3AB2 B;  3PCO B;  3B4M A;  5L1L A;  1WTF A;  5J2Q B;  2PC6 A;  3FVY A;  1RTI B;  3D66 A;  4ZP7 A;  2ASJ A;  2HW3 A;  3GV5 B;  2MY8 A;  1RHM B;  2ROP A;  5AE2 A;  4D3G A;  3CCV S;  4F4X A;  2BOP A;  1F5A A;  3SSR A;  4QYZ K;  1T9W A;  1DAX A;  2AEM A;  4L73 A;  1BQN A;  1SJ3 P;  1VBX A;  4K0K F;  1IBM J;  2VPX B;  4PXD A;  5KFT A;  1MRO B;  4URS A;  4IYQ A;  3R5A A;  1JLB A;  3BN4 A;  1HBO B;  2C2M B;  4HI1 A;  1ZZF A;  3HHE A;  3R97 A;  1WTB A;  2KDO A;  4B3S J;  1F6T A;  4H4K C;  2RT3 A;  4OYA A;  5LMN F;  4PUO B;  3AXM A;  2RML A;  4FKX A;  3E51 A;  1DJ0 A;  2NXE A;  3W63 A;  4ECX A;  3G96 A;  1IKV B;  3IGV A;  3V81 B;  3QIP A;  4USU A;  4KIA A;  4A4J A;  4X65 F;  1YVF A;  2C3M A;  2JH3 A;  3AJ1 A;  3MCO A;  5C5J A;  4WTO B;  4LIW A;  3WQP A;  2AX1 A;  3C15 B;  2VPW B;  3KMQ A;  3NMR A;  4DPT A;  2MQL A;  3J7Y U;  2KXN B;  2BJ3 A;  3CD6 S;  4WCE Q;  2KI2 A;  3D0I E;  1P9Y A;  4K50 A;  1FRI A;  3G82 B;  3EJM A;  2ZH2 A;  2DXD A;  2OPS A;  2ZH9 A;  2OPP B;  2RU9 A;  3R2D J;  2UUA J;  3Q89 A;  3L7P A;  4NLO A;  3W7B A;  2ZZT A;  4OJG A;  4TU8 A;  1O8B A;  1UVI A;  4AD6 A;  2OPR A;  4NLW A;  2LVW A;  1RT5 A;  3POT A;  2DK2 A;  4NXN F;  2AJ2 A;  1JJ4 A;  3OR2 A;  2CPH A;  2DIS A;  1RDR A;  2FHJ A;  2RHQ B;  1HI8 A;  1CJV B;  1FNM A;  3TAM B;  2DNH A;  4KGV B;  5EWG A;  2W25 A;  3MGJ A;  2DR7 A;  4CM2 A;  1HBN B;  2JOQ A;  1TFW A;  2DHA A;  2DVI A;  1R8A A;  1TU0 B;  4JYA J;  4M5L A;  4DPY A;  1WOR A;  1WSV A;  4ILR A;  3T1Y J;  1NAQ A;  3MUT P;  4TLQ A;  3NNA A;  1YX2 A;  4DQS A;  2X1F A;  3GCW P;  3VCD A;  1RAD B;  4D3H A;  3TNV A;  4DR7 J;  1M5H A;  2E1C A;  4WF9 Q;  1SC3 B;  3VHQ A;  2O5D A;  2IRX A;  3KKF A;  1JK9 B;  4K4W A;  4M5G A;  4QYR A;  5K8P A;  3CD5 A;  1T9T A;  4Z37 A;  1VCT A;  1FJE B;  1TL3 A;  5F0W A;  4O0N A;  1HBM A;  1S9E A;  4LQ9 A;  1KWM A;  1R0C B;  3EMT A;  4DUZ J;  3ZZT A;  3V6H A;  4ETZ A;  2QT7 A;  3K7R A;  3GYN A;  3BZQ A;  2MQQ A;  4Y6I A;  2BJ9 A;  2RS8 A;  4YY3 F;  5KFS A;  1V6H A;  2J9D E;  3NS7 B;  3SMZ A;  4LRD A;  4IR9 A;  3HFV A;  2ACY A;  1ELO A;  3N6L A;  2MKS A;  2YWH A;  5GAH U;  2Z56 B;  4ZVS B;  1G7C B;  2XG8 A;  3AD7 C;  3SQO P;  2XZT B;  2UXC F;  1QUP A;  3FBB A;  2JDJ A;  2GGP B;  1HLW A;  5J2M A;  1REV A;  2UZA A;  2DIT A;  1FE4 A;  5DDP C;  1LW2 B;  2M52 A;  5F8N A;  1TTH B;  1RBL A;  3L7U A;  3MCS A;  3FSI A;  3FUY A;  4KPC A;  2ROG A;  2ZH3 A;  3RRK A;  1U49 A;  1QAJ A;  3BH7 B;  4O3Q A;  3MR5 A;  2QLJ B;  1XTZ A;  1IBK F;  4J37 A;  2IAJ A;  1HPZ B;  2BQR A;  2ZBI A;  3R5J B;  1BXN A;  3UDV A;  1N5Y B;  1S10 A;  2MB0 B;  1JLE B;  1WC3 A;  2XNR A;  5HMZ A;  2UUB F;  4DR6 F;  4HLB A;  2DNY A;  3OVB A;  4C8Y A;  2KZM A;  5M2P A;  3FBE A;  5B0G A;  1FK9 B;  1BWE A;  2YKN B;  4ED7 A;  2DNR A;  4RBT A;  3KJN B;  4DV4 F;  4F2S A;  1RUS A;  1PJ6 A;  2OD6 A;  4B3M J;  1NND A;  1KQF B;  4M1K A;  3UCZ P;  2HWI A;  5BYR A;  3DMJ A;  2ZE2 B;  4XIU A;  4F0M A;  2V2V A;  1IUJ A;  2R7O A;  4A8O A;  4A47 A;  2KG0 A;  2GV1 A;  3PEJ A;  1XMB A;  2C3P A;  3EZ5 A;  4FNI A;  1CJK B;  1WKK A;  4NCG B;  2YPY A;  4OI4 A;  2GX8 A;  3QFW A;  1M1G A;  3NLC A;  4AXJ A;  5M2U A;  4P73 A;  2ZD1 B;  1WDT A;  2F4F A;  2Q6B A;  3J7Z T;  5HLF B;  3NMA A;  2RRN A;  4ZCM A;  2YWK A;  3LF0 A;  4LVN P;  3FMB A;  2MKK A;  1RT3 B;  3Q22 A;  4OHW A;  5HJY A;  3QSI A;  2DPI A;  2FVS A;  3DC2 A;  3I31 A;  1K44 A;  3DRP B;  1YRT A;  3DGP B;  5GMK a;  4BDP A;  5DG8 A;  3I82 A;  2W2P P;  2HHH F;  5K5M A;  1EX8 A;  1S1V B;  3JSM A;  3KK3 A;  1U0H A;  2GQ2 A;  4OYM A;  4FS2 A;  1J2V A;  2PE8 A;  4CT9 A;  2CVI A;  1RT6 A;  3QLH B;  5DZ7 A;  4FYY B;  1NU4 A;  3GFZ A;  2W24 A;  2ERR A;  1QVG R;  5AXM A;  2W7P A;  4KJI A;  4ED0 A;  5F8G A;  4LQ3 A;  1UFL A;  3L7O A;  1C1B B;  2VA3 A;  2FD2 A;  4PAA A;  5KG4 A;  2CDQ A;  2Z2Z A;  3T9Z A;  3SIP B;  5ETT A;  3GON A;  2E66 A;  3V6J A;  4B9U A;  4C4W A;  3MPD A;  2I0X A;  5HQM A;  7FDR A;  4DXL A;  1TL5 A;  4ZVF A;  4YB5 A;  1X9M A;  1N4L A;  2VJU A;  4DN9 A;  2DNG A;  4WIQ A;  3W64 A;  2VL1 A;  4DLE A;  3MM6 B;  4DWI A;  1F9F A;  1I5O B;  4XDD A;  4KGZ B;  4OFZ A;  3PG9 A;  4B9N A;  4WTY A;  5HRO A;  1SJ1 A;  2E1M C;  3HHL B;  1KRP A;  3HHD A;  1HMV A;  4NYZ A;  3W2V A;  4NLT A;  4JI2 F;  1RKI A;  1NH7 A;  1RT2 A;  2XUL A;  2XSJ B;  3VZI A;  1SV5 B;  2MTL A;  4C8M A;  4JI5 J;  3ENW A;  1FJC A;  5A2Q Y;  1TP7 A;  2FVC A;  5D4P A;  3D6T B;  1JKH B;  4N8N A;  3MMC B;  2V67 A;  2KG1 A;  2R8H A;  4KFB B;  4U96 A;  1DAR A;  4KR0 B;  3TJ8 A;  1VQ9 S;  1ZA2 B;  5KG3 A;  2AYM A;  2VF3 A;  1WJ9 A;  2NPI A;  5E41 A;  5KFH A;  2R8K A;  1ZS6 A;  5HMY A;  1PIE A;  3GIM A;  3R27 A;  4CH0 S;  2YWE A;  3ISZ A;  3CCW A;  1X4H A;  1B0P A;  1A6L A;  2RAQ A;  1AW0 A;  2FLN A;  1FKP B;  2KVQ E;  1BMQ B;  2NS1 B;  2DD8 S;  5H9E K;  1W2B R;  2GMH A;  2AF6 A;  4ZLP A;  2QYC A;  3SBM A;  5G0R B;  4PG8 A;  3KLG B;  5K14 B;  3Q24 A;  4JI1 F;  3HDS A;  3ZZ0 A;  3NCQ A;  1RAJ A;  1NJX A;  4LFA J;  4BBY A;  1YI2 S;  1HNI B;  4DV5 F;  1GNK A;  3MOZ A;  2VD3 A;  4RO0 A;  2G13 A;  3KLE B;  3EM1 A;  3SQG A;  1D8Y A;  1WF1 A;  3NOG A;  4DPU A;  4I4B A;  3K58 A;  4CP5 A;  3PIO Q;  2HS3 A;  5A2Q U;  3MEC A;  4A8S A;  3ITH A;  3L9Z A;  1GEH A;  4L72 B;  2OFG X;  1WNE A;  2NXN A;  1MW7 A;  4YME A;  4TKT A;  4DN0 A;  2BYC A;  1VDH A;  3P3D A;  2ZUA A;  2HFZ A;  4EU0 A;  3OT9 A;  5IC6 B;  4LF4 J;  2XYH B;  2MPU A;  4UQT A;  2EFO A;  1FFS B;  5CH7 B;  5KT6 A;  3C2P A;  2X1B A;  4ZCL A;  5J2N B;  1I6J A;  2YH0 A;  2HZV A;  1Y7P A;  4QWE A;  1JLB B;  2KHC A;  5J1E A;  3MPY A;  4YQW A;  3OVS A;  3KTQ A;  3LA0 A;  1QSS A;  4U8Y A;  2J8A A;  9ATC B;  2XGQ A;  2AGP A;  4KKO A;  1ZM3 A;  3F44 A;  2XI2 A;  3DOM A;  4DU7 A;  3V2U C;  2AGO A;  1IM4 A;  1XMO F;  1TAU A;  4FKY A;  4N56 A;  3BGF A;  2OI2 A;  1VBY A;  2FDN A;  1LFP A;  3QIP B;  5A8R B;  2JLG A;  1LNQ A;  3TAN A;  2EK6 A;  4DV7 F;  2C3U A;  5ETV A;  4GC7 A;  4BLG A;  3H42 A;  3CED A;  1SC4 B;  4CT8 A;  2GHP A;  4ZPT R;  3THP A;  1YJV A;  3UVJ B;  1S99 A;  3IRW P;  5J1N A;  4UOG A;  5F8J A;  2M88 A;  3A8E A;  5LJ5 Y;  2ZM6 F;  4FS1 A;  4C98 A;  3FCW A;  1DBD A;  1DQ8 A;  2CZ4 A;  5HAO A;  3PKY A;  4B17 A;  1Q81 T;  2V8G A;  3OTB A;  1FDD A;  1PBU A;  1WC6 A;  2RIJ A;  3TR5 A;  1YJ9 S;  2JLE A;  4PYA A;  2GVZ A;  2RNE A;  2MJU A;  2AIR B;  2PMH A;  3QZ8 A;  2B43 A;  2ZJQ Q;  3QO9 B;  1RAG B;  1S48 A;  2OPR B;  2Z2L A;  3H5Y A;  2HSE B;  2WON A;  3E01 A;  5D0R A;  2WW4 A;  3VGV A;  3OR2 B;  3HLU A;  1SCJ B;  2DR6 A;  3HX9 A;  3I0R A;  4PR6 A;  4KV8 A;  5CYQ B;  2DR5 A;  3EYZ A;  1R6Y A;  2G0J A;  2PGC A;  4XPE A;  1GAO A;  3R7N B;  4OL8 A;  2XM3 A;  3C14 A;  3QGG A;  2VU5 A;  4G1I A;  3TJ9 A;  3TEG A;  4DUT A;  2DH7 A;  3MTJ A;  1XMQ J;  4UUX A;  3NG8 A;  2ATL A;  1KQS R;  4O4G A;  2JEJ A;  1IBC B;  5I3U B;  2EFN A;  1JNR B;  3JTP A;  3BSO A;  1RWK B;  3D1H A;  2YNF A;  2KM8 C;  3NCR A;  4PQU B;  1FFW B;  3EZO A;  3HVW A;  4DF8 A;  2LXF A;  3KYL A;  2VG7 B;  2BE9 B;  2OFH X;  2CNN B;  4NZ7 A;  2XMA A;  1NME B;  5EN1 A;  1M5S A;  2OJ3 A;  4LF6 F;  2IM1 A;  4ELU A;  3CJ8 A;  4U8V A;  2D7S A;  3IP0 A;  5LMN J;  3NAI A;  2HKE A;  3H5S A;  2KJV A;  5FLX Y;  1ITP A;  1TL3 B;  4YN3 B;  5L8R C;  2UUT A;  3TYT A;  5F3Z A;  1EP4 B;  4K4Z A;  4X65 J;  1X31 C;  1SIW B;  3E2E A;  3Q8Q B;  5K8M A;  3FRZ A;  3KWM A;  1ZH5 A;  3MMA A;  2HQC A;  1OY9 A;  2DNO A;  1QLN A;  2LDY A;  2A3J A;  3FBF A;  3TQE A;  3TWZ A;  2DPJ A;  2UV8 G;  1UCN A;  4FVM A;  3TVY A;  4C11 B;  4DSK A;  4K4U A;  4PAB A;  2LQB A;  3U1M A;  4NLV A;  5L9X A;  2VQF J;  9RUB A;  4Q0B A;  3MF5 A;  3QQC D;  2MSS A;  1U25 A;  4U67 Q;  2VKZ G;  5AJ3 F;  5LSO A;  5J2M B;  1REV B;  2Y3Y A;  5KFI A;  3KDN A;  5CA5 A;  2F9D A;  3M6V A;  3HSZ A;  2VIC A;  1KS2 A;  1C0U A;  2HBQ B;  3CCU S;  1S4F A;  4LRC A;  2X7I A;  3BGU A;  5MAO A;  2F7V A;  3HD2 A;  4FVC A;  2QFJ A;  3UQS A;  4C3M A;  5GME A;  2GAH C;  5FLX U;  1HNW F;  1HQE A;  1XN9 A;  4O3P A;  4PG6 A;  4Q8F A;  2HBZ B;  5D4N A;  4F3Q A;  1HNX F;  2HWH A;  3OUY A;  1MN9 A;  1SPB P;  3KFW X;  2MZR A;  1OS5 A;  5EHH A;  1FWK A;  2UXD F;  3OSN A;  2UU9 F;  1DLO A;  2ZH8 A;  3J81 j;  3ZO7 A;  3I96 A;  3J81 Y;  3AA8 A;  2J5A A;  2GS8 A;  4AL5 A;  4Q5V A;  1NPR A;  3VAI A;  3D54 A;  2RVJ A;  1NKC A;  3HT0 A;  1LWF A;  2H5E A;  5KFF A;  4JI0 J;  1DTQ A;  4ZMM A;  2HIY A;  1PSD A;  1VQ7 S;  1S77 D;  2Z0G A;  1UEV A;  1UET A;  3PJ9 A;  2YX7 A;  2MZS A;  4ZN1 A;  2PII A;  1UVM A;  2COL A;  3AJ2 A;  1HI1 A;  3DRR B;  4UW2 A;  4H4M B;  2RDI A;  1JLC A;  1BHN A;  2HLU A;  2HNZ A;  1HNV A;  3GTY X;  1U2F A;  1R8B A;  4TY8 B;  3G6X A;  4ZK7 M;  5A8K A;  5KFG A;  1WHY A;  3OTO F;  2AJQ A;  4B3R F;  3FQK A;  4I2P B;  3CJK A;  2QYG A;  2C2O B;  3UFC X;  2HFU A;  3JSM B;  2C2E A;  3KK3 B;  5HVG A;  4CZC A;  1U0H B;  4CNY A;  1WF2 A;  1WUU A;  3K57 A;  3ISN D;  2RQC A;  4OI2 A;  3I5C A;  1RT6 B;  2K2P A;  1QJH A;  1RT4 A;  2UXC J;  1YG0 A;  1IXK A;  2RUS A;  4HHH A;  3GLJ A;  3M8P A;  2DNM A;  2OPQ B;  1LV5 A;  4LF7 J;  1Q82 T;  2KJW A;  1XQI A;  1IKY A;  1URN A;  2AMC B;  2IM2 A;  2DRB A;  4W4M A;  1U24 A;  2CQ3 A;  2Q66 A;  2YWF A;  2BAB A;  4LRF A;  2LA6 A;  2QTW A;  5SUH A;  3OBI A;  3KUH A;  1K9M T;  2YNH A;  2GJF A;  3OFG A;  3O6Q A;  1OWX A;  4ZP8 A;  5E33 A;  1HYS B;  2N3O A;  1H3D A;  1RXO B;  3WIU A;  5CQG A;  3FBC A;  3GCX P;  6FD1 A;  3GG0 A;  1FDN A;  3M2R B;  2B5J A;  1CUL B;  4DR6 J;  5DET A;  3SI8 A;  1CQM A;  2OIH A;  4H4K A;  4RJV A;  3UI3 A;  2V50 A;  4A46 A;  3DI6 B;  3MEE A;  2L9N A;  5C2C A;  4UQG A;  1RT1 B;  4DV6 F;  3TAQ A;  1JJC B;  4CWB A;  4B3O A;  4MKV A;  3W2V B;  2IBK A;  3OXG A;  3U1N A;  4NCB A;  5JUM A;  3THT A;  2KVI A;  2L48 A;  1RT2 B;  3MAA A;  1C0T B;  4DUY J;  1FCA A;  2LMI A;  4DSJ A;  1H38 A;  3IGN A;  3R6L B;  3HHL C;  2I5J A;  3OXL A;  4QW9 A;  2HAI A;  4MYT A;  1D1U A;  1Q53 A;  4BC7 A;  2Z2Y B;  5DDO C;  4F26 A;  4C7Q A;  2QMW A;  4Q2L A;  4AND A;  2VAS A;  2K7K A;  4ZJQ A;  2HQ3 A;  3M2U B;  3FGV A;  2DY9 A;  3W9I A;  1P6T A;  1FO1 A;  3W5Y A;  4RPF A;  3TW0 A;  4DDF A;  3ETM A;  5E3Q A;  2XCA A;  3CB4 A;  3C3L A;  1DRZ A;  1KLN A;  1NKE A;  3QT7 A;  2MZT A;  1FEE A;  3IG1 A;  3LO3 A;  1UVK A;  1YLX A;  1H0H B;  5D78 A;  3DU6 A;  3EWG A;  4R0J A;  2R7W A;  5GVQ A;  1HKA A;  3V6K A;  2HHH J;  2V68 A;  1YK9 A;  4LF9 F;  2LU2 A;  3SQG B;  4EO8 A;  3W3S A;  4DL0 C;  3HCX A;  2ZIT A;  3NWG A;  3ITH B;  2ZEJ A;  3TUJ C;  4E98 A;  2G9O A;  3PIP Q;  2WZ1 A;  5L38 A;  3FCH A;  3A3N B;  2HHU A;  4UF4 A;  1S0V A;  5EUH A;  3TRG A;  3KG0 A;  1ULR A;  2CQC A;  5HL7 Q;  3HJF A;  1TL1 B;  2O01 C;  3GWC A;  3H20 A;  4XPC A;  2HHV A;  3BR8 A;  4OQJ A;  4WZQ A;  1L3U A;  2QV6 A;  4RUB A;  1SH2 A;  3R1L A;  2EKY A;  3ENA A;  3ZTQ A;  4F4K A;  3A1Y G;  3UD4 P;  1RT7 B;  2UXB F;  1F0X A;  4RWX A;  3CO0 P;  2DKO B;  4FPI A;  4KKO B;  4NYP A;  2AX0 A;  2K3I A;  3MM9 A;  4C8K A;  3DOM B;  4OYP A;  2F9J A;  1NK9 A;  1RAF B;  2F3J A;  3SCJ E;  3MAQ A;  4JI2 J;  4EBD A;  1IKW A;  5I3P A;  5IM0 A;  3KJQ B;  2HVH A;  1ZOT A;  3HUL A;  3DYA B;  4MK8 A;  2CNL B;  3MEG B;  3NGR A;  1FTC A;  4I2Q A;  4B9L A;  4OLO A;  2IA6 A;  4WU3 A;  4JOU A;  3F0N A;  2CVE A;  1U2C A;  1QAY A;  5ETS A;  4JV0 A;  3OD2 A;  1H74 A;  2H4Y B;  3RAX A;  3FSX A;  4ECS A;  3P8B B;  2BX6 A;  1D8Z A;  2HZC A;  4HI2 A;  4F04 B;  4C3K A;  1R89 A;  3UCU P;  2LA4 A;  3K5L A;  3U7J A;  3KNG A;  1U6F A;  2GVZ B;  2YQ3 A;  2M0G B;  4DR3 F;  2QL5 B;  2IBO A;  4R5P A;  5ETN A;  2OTL S;  2MDA A;  2R7S A;  3D1O A;  4JI1 J;  2YKM B;  2AJ0 A;  3E01 B;  2YKP A;  4OJH A;  1H73 A;  3D4J A;  2E7W A;  4Q7A A;  3D68 A;  4DV5 J;  4DX6 A;  1S79 A;  1UEK A;  4U95 A;  2Y1I A;  2DRD A;  1TKZ A;  3I0R B;  2M8H A;  3R2C J;  1QM9 A;  1BQM A;  1TMM A;  3A8K A;  4ZCK A;  3C14 B;  1JLQ A;  2YVS A;  4OZJ A;  1TFY A;  2K8G A;  2V4R A;  5CD4 H;  3NNC A;  4DQI A;  1SXL A;  4LT6 A;  3G9C A;  2M5Y A;  2WB4 A;  4O4G B;  4G3I A;  4ANC A;  4J9K A;  1R0A B;  4NA2 A;  1U6B A;  4K7Q A;  1YJU A;  4KHP F;  3CVK A;  3W60 A;  3ZZZ A;  4B9V A;  4WE1 A;  2CAJ A;  4P72 A;  3M8S A;  1SBR A;  2BMB A;  4UST A;  4CO0 A;  1U1P A;  3I5A A;  3HF5 A;  2FHO B;  5FII A;  1HR0 J;  4KO0 B;  5KFD A;  4MMO A;  2JEG A;  5EX3 A;  2WSE C;  2OO4 A;  3HVT A;  3BGO P;  1XMO J;  2V9K A;  4DV3 F;  4X4U A;  1TK0 A;  3D6H B;  4PPZ A;  4TU9 A;  4HAC A;  4DPX A;  1CJU A;  4NEZ A;  1H72 C;  1ACM B;  4DV7 J;  2D9P A;  3EGZ A;  3TUZ C;  2KTQ A;  4ECZ A;  3PYF A;  2YNG B;  4ECQ A;  4ZHR B;  1FNO A;  3UDE A;  1FT8 A;  8AT1 B;  5L1I A;  3CW2 C;  2ZC3 A;  4K4Y A;  1IM6 A;  3US5 A;  2QJ3 A;  3EVO A;  4Q0B B;  5DG7 A;  1BD6 A;  2YX1 A;  2NUH A;  3VGU A;  1NSP A;  1SKU B;  3IC1 A;  4W92 B;  4NLD A;  4IFV A;  5DGA A;  2XY6 A;  5K20 B;  4PG4 A;  1C0U B;  3KLI A;  4ZJO A;  4A8Y A;  3DRS A;  2HNY A;  2J6T A;  4H4O A;  3QGI A;  4Y34 A;  3T41 A;  2P6S A;  2R2S A;  1RHJ B;  3VGT A;  3H4D A;  2JHE A;  3TX8 A;  1RAE B;  2WVB A;  2RDJ A;  3OUY B;  2RH3 A;  3ZTO A;  3DHX A;  2L41 A;  1Q8B A;  2KXH A;  3MDF A;  4WPA A;  3VQT A;  4UY8 T;  2N4C A;  1SB6 A;  4URQ U;  2HIQ A;  4J9L A;  4A8X A;  1T94 A;  1K0T A;  4B3S F;  1S57 A;  3EX7 B;  1AB8 A;  2EC2 A;  4NI2 A;  3OL8 A;  2R7T A;  4K5S A;  2KFY A;  1S6Q B;  1JLG A;  3R6G B;  3K8V A;  3OHB A;  4LRE A;  3C66 A;  4CO4 A;  1ZET A;  3P45 B;  1TV6 A;  3M05 A;  3CC2 S;  2OGU A;  1DTQ B;  3G6V A;  2ZOF A;  3TJA A;  2CPE A;  1CG2 A;  3PDN A;  4YB1 P;  5HP1 A;  2JC0 A;  3RZA A;  1ZAW A;  3IMQ J;  4RKU C;  3SV4 A;  5D3G B;  2HZA A;  3R5C A;  5EDW A;  1VHF A;  2QA1 A;  1FXL A;  2QL9 B;  3HVR A;  1SL1 A;  1JLC B;  3RB6 A;  2C22 A;  4P2X A;  1TL7 A;  3EPI A;  1DTT A;  3GYG A;  2A2D A;  2KZZ A;  3M30 A;  3Q8R B;  4RW9 A;  1RTD A;  2IJR A;  2DRA A;  1ZTT A;  2W9C A;  3J80 U;  5KFA A;  3RTV A;  1LWE A;  1NSQ A;  3LUY A;  4U7C A;  2F65 A;  1JWW A;  3MUM P;  3IS9 A;  1SQF A;  2GO8 A;  2AT1 B;  2LQ5 A;  2QLW A;  5E5N A;  5C7P A;  5HMX A;  2GFF A;  4USV A;  4DQQ A;  2XGP A;  1S1X A;  1RT4 B;  1T95 A;  2FY1 A;  3JQM A;  1RWU A;  4B3T F;  2DO0 A;  1U2R A;  5AJ3 J;  3RW6 A;  1ZZN A;  3M8P B;  4URG A;  2Q43 A;  3CCM S;  4F25 A;  2BRL A;  2E5J A;  3FEY B;  3D9B A;  5U47 A;  1IKY B;  2E7V A;  2GAG C;  4DQR A;  1U02 A;  1A9N B;  4EUV A;  5LXY A;  4JYA F;  3VF0 B;  5FD1 A;  2DH8 A;  3T1Y F;  4DPW A;  3CCL S;  5F3T A;  1HNW J;  3VAM A;  2J0Q D;  1GMW A;  3MHY A;  4J9N A;  2U1A A;  2MHN A;  4ECT A;  3M9M B;  4DR7 F;  2O66 A;  1MRO A;  4OI0 A;  3TAP A;  4WJB A;  2QO3 A;  2UXD J;  3TI0 A;  1HBO A;  4ES3 A;  2ZOM A;  1Y00 A;  3BPD A;  2CQ1 A;  2F63 A;  2H48 B;  3CIZ A;  1NDL A;  5IC4 B;  3PVX A;  2NZ4 A;  2IRU A;  2K3K A;  4DJB A;  5ETP A;  4EBE A;  4PUO A;  2ZFH A;  1Q95 G;  3UN5 A;  1BE4 A;  1C4C A;  1OPZ A;  3WIV A;  1IKV A;  2H5J B;  3V81 A;  1AXQ A;  2IJN A;  1J27 A;  1RQ0 A;  1UVN A;  4HT5 A;  1OSC A;  3X3U A;  4ES1 A;  1S0M A;  4WU2 A;  4FXW A;  3IBW A;  1DHM A;  3IAS 9;  4DX7 A;  2E5H A;  2BVZ A;  3GYX B;  3VAF A;  5KT5 A;  4OYW A;  3CJ2 A;  3QT5 A;  1XC9 A;  1WG5 A;  1APS A;  2MEW A;  3QFH A;  2FQQ B;  1GMU A;  3G82 A;  1JQG A;  1FER A;  4ETX A;  2OPP A;  2XLK A;  4TYB A;  2HVZ A;  1S6O A;  4A8W A;  1NM2 A;  4IUF A;  5F0U A;  3IG1 B;  4CI0 B;  4CH7 A;  1M0S A;  1PYT A;  1N36 F;  4YOE A;  3AH6 A;  4OZ1 A;  2C2N A;  4EZ9 A;  3OTO J;  2MLZ A;  3NGU A;  3CC4 S;  2B9E A;  4JV1 A;  2H51 B;  1KON A;  5KOW A;  3CDW A;  3RBD A;  2RDD A;  1WOP A;  1F3F A;  4YDD B;  3VAJ A;  2HFV A;  2A6O A;  2ACM A;  2DR9 A;  3KJV B;  3CUN A;  3KLF B;  3ZXW A;  3OJU A;  5FDL A;  2I9S A;  3PKM A;  1P8G A;  2PI5 A;  1D9F A;  4I6W A;  2MZJ A;  2X3D A;  4BS2 A;  4J9V A;  3WHI A;  2FJE B;  3QMQ A;  1HBN A;  3PW5 A;  2RQM A;  1H98 A;  4ZLJ A;  3MR7 A;  2OEJ A;  4X2B A;  3TA2 A;  1IJE B;  1YRX A;  4RWW A;  3HSD A;  1B7Y B;  3PO4 A;  3HT3 A;  3M4X A;  1V5V A;  1TEL A;  4X66 J;  1R8H A;  1SUQ A;  5JVH Q;  3BQ1 A;  2GIR A;  4NLU A;  5L39 A;  2AU0 A;  1R7I A;  5M2R A;  4CLU A;  4IDK A;  2HFO A;  4DV6 J;  3IR5 B;  3DLH A;  1L5U A;  2CJQ A;  1FJ7 A;  1K0V A;  3M7V A;  3MXH P;  4JI4 J;  4CNZ A;  1E6Y B;  4I68 A;  4DSI A;  5IM0 B;  3JSR A;  1GK8 A;  3ONQ A;  4QU7 A;  5F41 A;  4I2Q B;  2AP6 A;  3MFI A;  1IJF B;  1TVR A;  2W2M P;  1EAY C;  1GXT A;  2KL8 A;  1R43 A;  2CPJ A;  2B9W A;  3OJS A;  1BLU A;  4LF5 F;  3PJW A;  5DM6 Q;  1NK8 A;  1JMT A;  4JI7 J;  1N8R T;  3BKT A;  2VBY A;  2F8M A;  3KMS A;  4DX8 H;  2BJ7 A;  2CKW A;  3HVA A;  3IWN C;  2IMO A;  3LAM A;  4IR1 A;  1FTR A;  2GGP A;  2RQ4 A;  4RNO A;  2UUW A;  1DY3 A;  1N6Q A;  2LKZ A;  2V2Q A;  5L9N A;  1ZPW X;  3N5B A;  2K7J A;  1HPZ A;  1WKL A;  4LF9 J;  1U1O A;  1PJ5 A;  1BQM B;  3KHH A;  2CAD A;  3UR0 A;  4LF1 A;  4O0I A;  2MGZ A;  1JLQ B;  1N5Y A;  3AOB A;  1JXV A;  2CYY A;  3W9H A;  2ZZM A;  1IR0 A;  3VR1 A;  1JLE A;  2L9D A;  1N5S A;  4CDI A;  3MED B;  1T3O A;  4CTA B;  2AJ4 A;  2VB6 A;  3CMQ A;  2DNL A;  1XK8 A;  3MAH A;  1H7X A;  1TK8 A;  2APO A;  1B3T A;  2YKN A;  4PPD A;  2F4V F;  5ETR A;  2I38 A;  3RYL A;  4I7F B;  1HNZ F;  3T5J A;  4MK9 A;  5ETM A;  4UOF A;  2B9Y A;  4EFA C;  4DFK A;  1VR6 A;  4M5J A;  4M95 A;  4IH5 A;  1O0P A;  3ELH A;  1YIT S;  2UXB J;  4F7V A;  2ZE2 A;  4TY9 A;  3J7Z 5;  1B99 A;  3I4P A;  4DV2 F;  1U6Z A;  4IRK A;  2YKQ A;  1NZ8 A;  2BZ2 A;  4WFX A;  3ZTS A;  3QSY B;  3O3L A;  3M6X A;  4NLQ A;  2XY5 A;  2X1G A;  3BBC A;  3D3B J;  1LWC A;  1VGY A;  1CJK A;  4NCG A;  3RB4 A;  3D0G E;  2EG1 A;  3JYT B;  2A2C A;  2ZD1 A;  3MCM A;  3DFE A;  2N7C A;  5HLF A;  5LJ3 Y;  2H65 B;  1FKO B;  1RWW B;  1RIS A;  4YR3 A;  1RT3 A;  3E3X A;  2R7Q A;  3DRP A;  2XMU A;  4CM0 A;  3GPA A;  1M1H A;  3G6Y A;  4ZVH A;  3FEZ A;  3NCP A;  1S1V A;  2HFN A;  1M1K T;  4IFV B;  2CJX B;  4CYU A;  4IG3 B;  3PY8 A;  2NXJ A;  4RNH A;  5GMD A;  2GCF A;  3CWJ A;  4HHJ A;  3KLI B;  2LEA A;  4DR3 J;  2UVU A;  2X51 A;  4FBU A;  4H4O B;  2QN6 B;  5T41 A;  3THV A;  2NCK L;  4AFF A;  1UPP A;  5D0G A;  4LF4 F;  2M70 A;  3GFX A;  1EAR A;  3TZW A;  4NOH A;  1UL3 A;  3CDE A;  2HRT A;  1U1R A;  3AHP A;  4DR5 F;  1IN0 A;  1N32 F;  2CPD A;  4ZVO B;  2KYZ A;  3PR5 B;  1RHR B;  5CCL A;  3HMJ G;  1SQG A;  4O3S A;  1TAQ A;  3CCS S;  4Y3C A;  2HK2 A;  3MM6 A;  1U26 A;  5D4L A;  3MM7 B;  3S8S A;  5KT7 A;  1JB0 C;  4OZ5 A;  4ID8 A;  2J7K A;  4R25 A;  3LP1 B;  3HHL A;  1JLG B;  2Y0B B;  4KHP J;  2RQK A;  3KJF B;  3SFU A;  1TV6 B;  1JXL A;  2HND A;  3DLL Q;  2XSJ A;  4GRS A;  2VZ9 A;  2V63 A;  1ZAX A;  1JKH A;  1WC0 A;  3OR1 B;  4KFB A;  2QE5 A;  4JB8 B;  2YQ0 A;  5IQ6 A;  2WVD A;  4YR2 A;  4QBU A;  2EFG A;  2HHS A;  5HVH A;  4EYI B;  3TX0 A;  2EBE A;  1F9H A;  1X4E A;  2BA9 A;  3E8O A;  2DGV A;  3AB4 B;  3RBE A;  4X4V A;  1Y3J A;  2XNQ A;  4MAK A;  2VUG A;  2A10 A;  2XWX A;  4DZD A;  1RTJ B;  4RW7 A;  1DTT B;  1NKB A;  4DCP B;  3DOL B;  1YIJ S;  2VIH A;  2HS4 A;  1FKP A;  3OW2 R;  1GX5 A;  1S6P A;  1NDC A;  2EC0 A;  3NGS A;  4OZ3 A;  2VA2 A;  1L3V A;  3IS9 B;  1NK7 A;  1X5P A;  4QIV A;  2PT0 A;  4LR8 A;  2RU3 A;  3MCN A;  4DS5 A;  2MLY A;  1F60 B;  3AQP A;  4LMZ A;  2ZBC A;  1HNI A;  3Q8Y A;  5C2G A;  4FDF A;  3LQV A;  3AJD A;  2DH9 A;  3KLE A;  1Y5L B;  4I1T A;  5C24 B;  2WRM A;  1FWL A;  2E1R A;  2B4U A;  4HDH A;  3AD9 C;  4DFP A;  2LEB A;  2LQJ A;  5EX0 A;  1XMQ F;  2JEI A;  4N77 A;  1NZA A;  2LU1 A;  5FJ4 A;  2E5G A;  2V6A A;  3EE3 A;  2GJI A;  1S1U A;  4KHM A;  1FXD A;  1Y5N B;  4YB6 A;  5J2N A;  1Q7Y T;  2DTJ A;  3PHT A;  1YQH A;  4ZA1 A;  3BO2 A;  3M32 B;  2VJV A;  5KFQ A;  3CJS A;  2VG5 A;  2PI4 A;  4LSL A;  3EDR B;  4ZVT B;  3S7R A;  1Z2Z A;  2QRR A;  4J9U E;  1PGZ A;  2MYF A;  2BJ1 A;  1RHU B;  2DHS A;  3CJT A;  2XZW A;  2B56 A;  2CJY B;  1QAX A;  2XQC A;  4QWD A;  3ET6 B;  3U02 A;  1D0E A;  2Y1L B;  4O23 A;  5A8R A;  3BV8 A;  3JSB A;  5L46 A;  1FDA A;  3I0S B;  1YJT A;  4Q8E A;  4LBH A;  1H2U X;  4B9T A;  1N0V C;  1VQ4 S;  1YJW S;  1WHV A;  1FNX H;  1JJ2 R;  2XI3 A;  1SL0 A;  2XSF A;  4X64 J;  1NSK L;  4Y2A A;  4P2F A;  3CSK A;  3ZFV A;  1N54 B;  3UVJ A;  4BCA A;  1T3N A;  3C8Y A;  1NPP A;  3DLE A;  3B8H A;  3Q8S B;  2VQF F;  1EKS A;  5DG9 A;  2MQN A;  1BWV A;  3OL7 A;  3RAQ A;  1WG1 A;  3CTR A;  4DCO B;  1CS4 B;  4RNN A;  4MIB A;  4M94 A;  1F5B A;  2ZC4 A;  4WP9 A;  1AFI A;  5SZT A;  1VQ5 S;  1Q7L B;  1UA0 A;  3DXS X;  5K8N A;  1SQE A;  4K2X A;  4CLW A;  3PR4 A;  1PJ7 A;  2YWW A;  5F9N A;  4FYV B;  4LF8 F;  4CO5 A;  4PXC A;  3QO9 A;  3ZNJ 1;  5LT5 A;  5HJX A;  2EFP A;  4OZ0 A;  4XK8 C;  1QTN B;  3BO3 A;  3D3C J;  4B3T J;  2BBE A;  3C19 A;  4NA3 A;  4FF3 A;  5CYQ A;  3B4D A;  5FDL B;  1YBA A;  5D6G A;  2BKO A;  5DS7 A;  3DGV A;  1RU2 A;  1V3Z A;  4LJM A;  4K4T A;  1HHQ A;  3GJS B;  1U7L A;  4Y2M A;  4ED1 A;  2HYI B;  1LW0 A;  1ZM2 A;  2AJ1 A;  3GQC A;  1CVJ A;  3BGL A;  1UJ4 A;  3AAW B;  1RZM A;  1X0F A;  5I3U A;  3VV2 B;  4UZB A;  2BJD A;  3FDS A;  2FC9 A;  4BWM A;  1KVK A;  4DMZ A;  3W8P A;  4C8Z A;  1CQN A;  3SSS A;  4PQU A;  5IWA F;  1SUQ B;  4JI0 F;  1UW9 A;  2VG7 A;  1XNR F;  5CYM A;  5B09 A;  1TQL A;  4IDK B;  4CLT A;  3JTN A;  3KXD A;  4EMD A;  1VK8 A;  4IH7 A;  4P7T A;  1OSD A;  3H4B A;  4J91 A;  1CC8 A;  1VK3 A;  1DFD A;  5A8W B;  3Q86 A;  3NWR A;  2VBW A;  3D67 A;  4JI3 F;  2DIU A;  4TLR A;  3GMG A;  1UTA A;  3I87 A;  4J9Q A;  1EP4 A;  1TVR B;  3LAK A;  1NK4 A;  1QD1 A;  2EFV A;  1LEO A;  3OLB A;  2G0I A;  4JI8 J;  2V0N A;  2MQ8 A;  2P9G A;  1ARO P;  1O51 A;  8ATC B;  2B8P A;  1FF2 A;  3LPE A;  4FZV A;  2XMJ A;  3HSJ A;  4X4Q A;  4C11 A;  3Q0A A;  5IOL A;  2VFU A;  3DLK A;  5JJB A;  2FLO A;  2JFK A;  1VIO A;  1FI4 A;  5KFN A;  3FSY A;  2J0S D;  2RKI B;  4NZ0 A;  3PX0 A;  2V69 A;  3K5P A;  4RUC A;  2LEC A;  2G4B A;  2SXL A;  1N6Q B;  3JB9 k;  5KFJ A;  4LF7 F;  2R8G A;  2C2R A;  1N36 J;  3T5K A;  2WBM A;  4DR4 J;  4IQX A;  3UW1 A;  1FEH A;  3KG1 A;  2FLL A;  2DGS A;  4KE5 A;  5KT2 A;  5B7W A;  2BM0 A;  4NYO A;  2CG8 A;  1S1W B;  2MGZ B;  1F9E B;  4Y2C A;  1FVQ A;  5AE1 A;  3ZZU A;  5F8I A;  2FHJ D;  4ZVQ B;  4IFY B;  4QPT A;  1VQL S;  1SKR A;  4LSN B;  2E7X A;  3K17 A;  2W7O A;  2EPI A;  4Z2X A;  1HWI A;  2V4Q A;  3ENQ A;  1HA1 A;  1Y9O A;  3UD3 P;  3C6U B;  1T11 A;  4WFZ A;  1IBL F;  5KG7 A;  3PRB A;  2DNQ A;  2GML A;  2YWG A;  3I9V 9;  4DUY F;  1YZ7 A;  1S1T A;  3H25 A;  3G8T A;  2HS0 A;  1NBE B;  3UE2 A;  4UTG A;  3FK4 A;  4W90 B;  2VC0 A;  4ZVR B;  4DS4 A;  1JIH A;  3MMB A;  1X60 A;  5B0E A;  4PG7 A;  2NPF A;  1HBU B;  3SFG A;  2PO4 A;  1RBA A;  4DBQ A;  4FPR A;  4ELT A;  2W8L A;  3CIM A;  1G4C A;  1YWX A;  2LYV A;  4KRW A;  2BJE A;  1LWC B;  1X4D A;  2NYI A;  2H9Z A;  3LGN A;  4LR9 A;  1ZAV A;  1V5I B;  2QA2 A;  2W4P A;  5KFB A;  3M8Z A;  3EGW B;  5H9F J;  1VBZ A;  5KTQ A;  3PX6 A;  1UP1 A;  3DRR A;  1X9S A;  4H4M A;  2KT5 A;  2J6S A;  5HVF A;  2AZ1 A;  3UR3 C;  1WEY A;  2RSQ A;  1GX6 A;  4I56 A;  2MQP A;  4TY8 A;  4XO0 A;  3EUN A;  5AXL A;  3O2I A;  2ZBR A;  2VFR A;  2XS2 A;  1PBA A;  2GQC A;  3GV7 B;  1UJ5 A;  1GFW B;  4MJK A;  4LF5 J;  3QT8 A;  4I2P A;  2FZC B;  2OLW A;  1VQN S;  2D69 A;  4CYU B;  2HGM A;  1S49 A;  2W4C A;  3H0P A;  1B70 B;  3D6F B;  4RW4 A;  3KK2 A;  1FX4 A;  2M7S A;  4ECW A;  1FD2 A;  4F67 A;  4OYO A;  4C8N A;  3BM7 A;  2OPQ A;  2Q79 A;  2RD5 C;  2PFF B;  4QR2 A;  3NXZ A;  1TKX B;  4QR0 A;  4Z7Y A;  1G2E A;  1J5O B;  3F41 A;  1FRH A;  3PRD A;  4KHR A;  2IVF B;  1Z4U A;  1OQ3 A;  2CIM A;  4M5K A;  4FYD A;  1Y0H A;  4GMK A;  1HYS A;  4V19 X;  1S72 S;  2LXI A;  4UZC A;  3M2R A;  4F50 A;  1CUL A;  1VQM S;  1T03 A;  1M5O C;  3AD8 C;  2VQE F;  3M8Q A;  3FMW A;  2AZ3 A;  3DI6 A;  2HBY B;  5E3P A;  1RT1 A;  1IWG A;  3IM9 A;  2F4V J;  3V4M A;  2DR8 A;  5LSL A;  5B0D A;  1HNZ J;  4DL7 A;  4HT7 A;  4IG0 B;  3QWP A;  4YHH F;  3TZZ A;  4KGK A;  2HND B;  1C0T A;  2BQ3 A;  4RNM A;  3P5T L;  2EEY A;  2O67 A;  4ED5 A;  2O1P A;  2JFD A;  1NSA A;  5E3A A;  3GIR A;  5KFR A;  3FKB A;  3PX4 A;  2FYX A;  3CGI A;  1VC6 A;  4DV2 J;  3TP2 A;  4OZ2 A;  1MWZ A;  2VOO A;  2CUY A;  3QBC A;  4S0M A;  3M2U A;  4ER8 A;  1L3K A;  4KSE B;  4QW8 A;  4DOZ A;  2J76 E;  4RW7 B;  2IHR 1;  1FA0 A;  2HWT A;  5H1S V;  1GQE A;  3DLJ A;  2AKW B;  3PYE A;  1S6P B;  1Z1Z A;  5E3R A;  1MWQ A;  3IBC B;  2RUG A;  1MWY A;  3AXK A;  3O1L A;  1CSJ A;  2QSF A;  2VC1 A;  2H5I B;  2XMV A;  1QAI A;  2QLX A;  4DPO A;  3VVU A;  3SDE A;  4OI1 A;  2XO7 A;  1NK0 A;  4GKJ F;  2H54 B;  2PMW A;  4MT1 A;  4PCQ A;  4ZOS A;  4K2J A;  4CLP A;  2POK A;  4QWC A;  3I55 S;  3O5T B;  4G65 A;  2FJV A;  1RWM B;  3QT6 A;  4L74 A;  2OD4 A;  4QU6 A;  2J7W A;  2A6M A;  2KFN A;  5KFX A;  1TK5 A;  1X4B A;  3PO5 A;  2ROE A;  1DQ9 A;  2D3U A;  2OSQ A;  4FF1 A;  1QE1 B;  1HW9 A;  1BGX T;  1UVJ A;  2LXU A;  4CIO A;  4K4V A;  4DCJ B;  3V4I A;  4P10 A;  1TL1 A;  3KHL A;  2V94 A;  1UPM B;  1S1U B;  1PC4 A;  3Q8U A;  1RWX B;  1PG5 B;  3W8G A;  3ETO A;  4PWU A;  2R42 A;  2NXC A;  1S97 A;  3A4T A;  1RA7 A;  4DR5 J;  1XR5 A;  1JXE A;  3AT1 B;  4XDC A;  1N32 J;  4FF4 A;  4AT1 B;  2VG5 B;  4LSL B;  1FES A;  2MKI A;  1RT7 A;  4ECV A;  1O6X A;  1UZD A;  3D5M A;  2IJF A;  2PMZ D;  3RJM B;  4L6V 3;  5KFP A;  2ZKU A;  2O3D A;  1HR0 F;  2BEF A;  1YSJ A;  3QJL A;  3N4W A;  2AWZ A;  3AY0 A;  2GVD A;  2HRU A;  1JX4 A;  3TVK A;  3VQS A;  5F8H A;  2KO1 A;  2P6T A;  1WHX A;  4G6V B;  5IQQ A;  1OYE A;  3B78 A;  1N5V A;  5BJR A;  4USM A;  3DYA A;  3MEG A;  2X3G A;  2FVP A;  1DUR A;  3BBF A;  2PFD A;  1RAH B;  3FC9 A;  4F8R A;  2IFX A;  2NUU G;  2DNP A;  3M2V B;  3DLE B;  4WP8 A;  4KC5 A;  4RW8 A;  3RRG A;  1Q4R A;  3JAM Y;  3QAU A;  2XHW A;  1L3T A;  4ZS6 A;  3ZNU A;  2NSC A;  2Z8Q A;  3RG6 A;  4WFN Q;  2JEF A;  2B0G A;  3FFI B;  4JV2 A;  1RCO B;  2CRL A;  2CQD A;  1CJT B;  2YKM A;  3I56 S;  1S6U A;  5BXI A;  3DU5 A;  2CNK B;  1QSL A;  4ZPA A;  3EVM A;  2WSC C;  1VS3 A;  1RWO B;  4CCH A;  4U7U D;  2F5G A;  1Q79 A;  1H6K X;  2AYB A;  4KT0 C;  4YEA A;  1KTV A;  3LWL A;  2ZNY A;  3RR7 A;  3BF4 A;  2DGQ A;  4ED4 A;  1FRM A;  4USK A;  2C2Z B;  4RLE A;  1LW0 B;  5CZX A;  4F0K A;  4ED2 A;  5E7O B;  4GKK F;  4L3N A;  1NB7 A;  3UNY A;  2VOP A;  2ILY A;  4P6Q A;  2HLT A;  4X62 J;  1VHI A;  3TA1 A;  2QX0 A;  3CDU A;  2LP4 A;  4G1P A;  4NXM J;  3JAM U;  1R0A A;  2MJN A;  2RRB A;  5B0C A;  4ZDN A;  2NXU A;  1VQ8 S;  2KKH A;  1YHQ S;  3PNI A;  5CYM B;  3DLB A;  1NJW A;  2B4V A;  1REG X;  2YY3 A;  2M8D B;  2B3T B;  1FRX A;  1VIS A;  4TYA A;  4R8U A;  3HK2 A;  4KO0 A;  1EIY B;  4XTT A;  4DSE A;  4DU8 A;  1HI0 P;  4K59 A;  4DV0 J;  4DQP A;  5J1P A;  1XR6 A;  4MFB B;  2D3Z A;  4TN2 A;  2FUG 9;  3B54 A;  3GG1 A;  1UMJ A;  1KDN A;  1MML A;  1BQX A;  1TUG B;  4RX6 A;  2R7V A;  5IFM A;  5D0H A;  4DI6 A;  5HMW A;  4HKQ A;  4ERD A;  5ADZ A;  1N0U A;  2XHC A;  2YNG A;  3RW7 A;  4KGM A;  4FF2 A;  4ZHR A;  4WXW A;  3NP5 A;  1YGY A;  2FC8 A;  4I69 A;  2XMK A;  1URR A;  1RI7 A;  2FJX A;  3QJJ A;  2PN6 A;  1ROF A;  3DLK B;  2G2Y A;  4PWD B;  3LPY A;  3TOQ A;  5ETO A;  1LXN A;  3DOK A;  1T8E A;  1SC6 A;  2CQG A;  3HFZ B;  1H2T Z;  1W25 A;  3LGH A;  2FLP A;  3DKD A;  2CQI A;  4WYL A;  2XWY A;  2B7C B;  4FNH A;  3N9U C;  1RAA B;  4F4Z A;  3T1A A;  4USW A;  4OX6 A;  4UY8 5;  2XY7 A;  1S59 A;  4ZPC A;  4LF8 J;  1X8D A;  2CZV C;  4GVB B;  1N56 A;  2E1A A;  1UAW A;  3QNW B;  1LQ9 A;  1Q8L A;  1DQA A;  3MM8 B;  4F2R A;  4YS2 A;  2J6U A;  4MIA A;  2OMO A;  3LP0 A;  4MK7 A;  4KB7 A;  1FRK A;  1NDP A;  2CQ0 A;  3MR2 A;  3P4U B;  4ILM A;  3CE8 A;  2K06 A;  2GIQ A;  5MLC V;  3QYY A;  5HK4 A;  3EIC A;  3DRX A;  4AQY F;  5A76 A;  1K8A T;  2OHD A;  2WVE A;  1S1T B;  2HHW A;  1MN7 A;  2WOM A;  2CDR B;  4ECY A;  1S6Q A;  3PJX A;  3G86 A;  3MMB B;  2XC9 A;  3AOC A;  1KSP A;  1OQ6 A;  5IWA J;  3J7A N;  2BM1 A;  1XNR J;  3DCA A;  5D8H B;  2JVR A;  4KY3 A;  4IOA Q;  4OX7 A;  1G3O A;  2XEX A;  3VVT A;  4WKY A;  1UJ6 A;  4CH1 A;  1FVS A;  2L3M A;  2C2D A;  4ZJL A;  1JLA A;  4ED8 A;  2JRS A;  5D3G A;  2XBP A;  3CUL A;  4JI3 J;  2WTF A;  4B08 A;  3AOA A;  4Q2M A;  1GTH A;  3GJT B;  4ECR A;  1L3S A;  2XB2 D;  1CC7 A;  3U1L A;  2IVY A;  1VLO A;  4RUH A;  1KFD A;  3FCV A;  1F2H A;  2DJW A;  4DL4 A;  4X4T A;  3ILJ A;  1S76 D;  1N34 F;  1NB2 A;  2DT9 A;  1X5O A;  5E0O A;  4LBI A;  1KOH A;  2JNJ A;  4QIW D;  5B0B A;  4RW4 B;  3KK2 B;  2HHX A;  2W2O P;  2WVC A;  2ZHO A;  4LFB J;  3NNH A;  4I67 A;  4X4S A;  5D0E A;  1VC5 A;  4O3O A;  2BKN A;  1UEU A;  3T5L A;  1SJ4 P;  4M5H A;  1VLY A;  5CD4 A;  1WC5 A;  5KG2 A;  2KM8 B;  3G2X A;  1N48 A;  3I5B A;  4ZLN A;  5ITH A;  2KT3 A;  2MQO A;  2JZ5 A;  4PKD B;  4F3M A;  2F8H A;  3PFE A;  5I42 B;  5CYJ A;  1WG4 A;  3LP2 B;  3BR9 A;  1R27 B;  4DR2 J;  2KYX A;  4X66 F;  1T03 B;  3UNG C;  2L9W A;  2YNI B;  2EBG A;  4CLF A;  5KFK A;  1KTQ A;  4CO3 A;  3M8Q B;  2EXU A;  3CMA S;  4OV6 A;  4CQ1 A;  4CO2 A;  2ALY B;  1VC0 A;  3TUI C;  1VRT B;  3T5H A;  1BC6 A;  2QA4 G;  4NML A;  2Y8Y A;  4JI4 F;  4NLY A;  2XLI A;  1AT1 B;  4WYW A;  1IBL J;  2RRA A;  1FJG F;  2BW2 A;  4C0H A;  4HTJ A;  2FGC A;  2Z58 B;  2CPF A;  2VDH A;  2E29 A;  3JSY A;  3RUB L;  3R9L A;  3L4B C;  2LFV A;  4AL7 A;  1AUS L;  1B0V A;  1C1C B;  4NAS A;  4B9M A;  2F40 A;  2GC8 A;  2OH2 A;  4X84 A;  1KFS A;  2HFS A;  2FVQ A;  1AA1 B;  2GZO A;  4JI7 F;  3UPF A;  2CPX A;  2NSB A;  3KUE A;  2BQU A;  5I4M A;  2G1D A;  4M5D B;  4DR1 F;  3OFE A;  1NDK A;  5A6W A;  2P9E A;  3GJR B;  1KHW A;  2CJK A;  5DQH A;  3AOD A;  1HWK A;  1SH0 A;  2XLJ A;  1B4S A;  3KOA A;  2Y8W A;  3CJ5 A;  4PXE A;  3LAL A;  3SDE B;  5HBM B;  4USJ C;  3KLV A;  4OJ1 A;  3QZ7 A;  2BXJ A;  1Y4Z B;  4ES2 A;  5DLF A;  4WFY A;  1KBR A;  2N3L A;  5L1K A;  1CBK A;  3IR7 B;  5HQ8 A;  3VGS A;  3CF5 Q;  2H1Y A;  2CQ2 A;  3IWL A;  2BAN B;  2VHG A;  5C42 B;  1OO0 B;  4DL6 A;  4YR0 A;  3KJV A;  4KTQ A;  3FNN A;  1VQS A;  3KLF A;  3BDP A;  2E5I A;  4GO7 X;  2RB7 A;  3OV7 A;  4J5O A;  2CJA A;  3V4I B;  1T0T V;  4C8L A;  3BRE A;  1K1Q A;  3W65 A;  4NWB A;  3GP9 A;  1N5Q A;  3MM5 B;  2AEF A;  2E5L F;  5KG5 A;  3FRY A;  4MKB A;  1VIX A;  4CLS A;  2VKR A;  4P74 A;  4WWS A;  3DN9 A;  3OFF A;  3TQ1 A;  2CQB A;  2ZZN A;  3GFH A;  2VPZ B;  1D9D A;  5T7L B;  5AXK A;  4OHX A;  3V6D A;  3N6N A;  4AXI A;  2AYE A;  2VOD A;  3S1T A;  2HQD A;  3BH6 B;  3VAK A;  3BYP A;  2W9B B;  3N79 A;  2VQE J;  3HP6 A;  5LM7 E;  4K8R A;  3GSI A;  1PYO B;  4A48 A;  1B7F A;  3H2U B;  2IRY A;  1KLM B;  2GVD B;  1T05 A;  5GAG I;  1B64 A;  3C6T B;  2U2F A;  1AZS B;  2VG6 A;  3K5M A;  1E6V A;  3AA9 A;  2C28 A;  1WD6 A;  1E6Y A;  3NEK A;  3QPI A;  4YHH J;  3BYR A;  1F5C A;  3BSC A;  2E9Z A;  2ALZ A;  2B7B B;  1KP6 A;  2DNZ A;  4WII A;  2DHH A;  5E2Q A;  3GU0 A;  4EO6 A;  3MEK A;  1NEE A;  1S0O A;  4ID5 A;  2DBB A;  5KFE A;  3HPO A;  1WAC A;  3NGD A;  1DZ5 A;  2ZHB A;  4RW8 B;  5HSP A;  1RLD A;  1FXR A;  3GZ7 A;  1T7P A;  1GT8 A;  3SSQ A;  3RR8 A;  1ZM4 A;  4FXD A;  3DM2 B;  4OX9 F;  3T1H J;  3IRX A;  4IH6 A;  5DO2 A;  1UA1 A;  1EET A;  1RU1 A;  4ENO A;  4OYI A;  3SCL E;  1PIL A;  4EI2 A;  2HGN A;  1R8P A;  3M8R A;  2GA7 A;  4QWB A;  2RIL A;  3PW7 A;  1YZ6 A;  1NCL A;  3ZZO A;  3W66 A;  4OI6 A;  4GKJ J;  3K89 A;  5HQL A;  2YQ1 A;  3TVZ A;  2ZKT A;  2XTJ P;  3CCQ S;  4J9P A;  2HK3 A;  3B82 A;  4ZVU B;  2AD9 A;  3UN2 A;  1D09 B;  1R8C A;  3OFH A;  2CPY A;  4K5R A;  2IY5 B;  1NRK A;  3MED A;  1W26 A;  4N47 A;  2W7A A;  2IYG A;  2BE2 B;  4CTA A;  4TU7 A;  4RNF A;  4JV5 J;  4L3K A;  1CEZ A;  4QIG A;  4IKA A;  1RBO B;  4J9R A;  4QYZ J;  4I7F A;  3D7S B;  5KFV A;  3N28 A;  4EWT A;  1VOM A;  3NGK A;  4OV1 A;  2HVI A;  4M5M A;  3R7B B;  1IR2 A;  4QQB A;  3ZC4 A;  3BKU A;  1RAB B;  4DF4 A;  1RYR A;  4R8U B;  1XNQ F;  2BR0 A;  4DFM A;  3UDL A;  3HZG A;  2QLF B;  4P2M A;  3PEH A;  3I4H X;  2EK1 A;  4FP9 A;  4K4X A;  2VDI A;  2CWK A;  1V3S A;  3W5X A;  3T6J A;  3BSN A;  2UVV A;  2A0F B;  3JYT A;  1X5T A;  1V3R A;  1TZ0 A;  1YTY A;  2M4M A;  3H40 A;  5EWF A;  1FKO A;  4OHV A;  1T02 A;  4N8O A;  5A0Y A;  1PC5 A;  4V19 J;  3BS9 A;  1PAE X;  4LUB A;  2DHX A;  4LSZ B;  4U9R A;  4C6A A;  2CQP A;  3O44 A;  2J9C A;  5IS2 A;  3LTO A;  5IT0 A;  1BUX A;  2J0X A;  1TKT A;  1X0P A;  3DOK B;  2D3O 1;  4CLZ A;  3PM9 A;  2ASY A;  2V2Z A;  2GNK A;  2GHV C;  3GE9 A;  2ZWO A;  2UUC F;  1H2V Z;  1K73 T;  5C25 A;  3BSA A;  4JI6 F;  3WBZ A;  1MU2 A;  1RP5 A;  4YFU A;  4IG3 A;  3QRR A;  3GIK A;  1NPK A;  1NXI A;  2F1F A;  4FYW B;  1UVL A;  3SV3 A;  1HFE L;  3IBF B;  3RRH A;  1U1L A;  5DLG A;  2YX4 A;  3UD5 A;  1PCA A;  2CFX A;  1HW8 A;  2MY7 A;  3DHW C;  5KG1 A;  4EK2 A;  2DB1 A;  2C3Y A;  3M8Y A;  4U7U K;  1VYA A;  5AE3 A;  2PD1 A;  1BQN B;  4LRB A;  5ETQ A;  3GII A;  3L95 X;  4RW6 A;  3LP0 B;  2M9K A;  5LSR A;  2BJ8 A;  2IC3 A;  3H7H B;  2DNK A;  1M5P C;  3J80 Y;  1SC1 B;  1A0O B;  2ZJR Q;  1HAR A;  1RJJ A;  2V34 A;  4NLP A;  2DEJ A;  2XS5 A;  4GKK J;  1TR0 A;  3EGN A;  1P27 B;  3G8S A;  4P9S A;  3DDK A;  4OLP A;  4J9M A;  3MM7 A;  4DSL A;  3PZP A;  3PAC A;  3HKZ D;  3DDI A;  2FTR A;  2WOM B;  3LP1 A;  2CJ9 A;  2MLX A;  2RS2 A;  3HO1 A;  1T9V A;  2KRB A;  3OL9 A;  3DDN A;  4OI3 A;  3N0V A;  2KRR A;  2BKP A;  1NJY A;  3OR1 A;  4X64 F;  3H59 A;  5LXR A;  2WSF C;  1F1B B;  3CME S;  4FXV A;  2R8I A;  1JLA B;  2DGT A;  1KVJ A;  3FZ2 A;  3WZ0 A;  3ILL A;  1CPZ A;  2P5V A;  2OPS B;  1Y11 A;  5KG0 A;  2XMT A;  2KN4 A;  1RTJ A;  3BO4 A;  2HEK A;  3DOL A;  1U47 A;  2QEX S;  2ATC B;  3ICL A;  3NS6 A;  3PHE A;  4BHQ A;  1ZYQ A;  3MD1 A;  2Y1R I;  4QPX A;  4DV1 J;  3RB3 A;  1IQZ A;  3UCG A;  3KUG A;  2DY1 A;  2R7X A;  1RT5 B;  1TMJ A;  3OTE A;  5CXT A;  3POT B;  3QJP A;  1Q5V A;  4ZVG A;  3H5X A;  2DYA A;  3TUP A;  4PRF A;  1HD1 A;  2XCP A;  3M1V A;  2M3D A;  4J7C A;  3KHR A;  1HWU A;  2V2K A;  2QIF A;  1M5K C;  2IDL A;  1VI7 A;  2XMW A;  4I0W A;  5C24 A;  2G0C A;  1ZTW A;  4EEY A;  2HAF A;  2XMM A;  5CHC B;  2FGO A;  1YJ7 A;  4LFC F;  3W9J A;  2IA0 A;  1U1Q A;  5DGB A;  1SKS A;  2HHQ A;  3ZTP A;  3RAM A;  4HVZ A;  4DLG A;  3TZY A;  3JXO A;  2CXE A;  5KG6 A;  4NX9 A;  1EB0 A;  1WOS A;  4F3O A;  3HXM A;  2D1C A;  4WFA Q;  2UV8 A;  4K0K J;  1IKX A;  1FFG B;  3D1Q A;  2V8D A;  2CJB A;  4UUW A;  5BYQ A;  3H90 A;  1TUW A;  3TA0 A;  3M32 A;  5F8M A;  3Q83 A;  1CLF A;  2DGW A;  3W5Z A;  2Q1L A;  2JVO A;  2Z4P A;  3OTC A;  4AQY J;  5LMU F;  2B51 A;  4Y28 C;  2YBV A;  2HG4 A;  1S12 A;  1OY8 A;  1SL2 A;  3ET6 A;  4RU9 A;  1HBM B;  2LEP A;  2NRE A;  1S9E B;  4ATN A;  4W98 A;  2HPU A;  1S9G A;  4QCL A;  4ELV A;  3MR3 A;  3I0S A;  5GAG U;  4QZV B;  1WHW A;  3OLA A;  5D4O A;  2XYP B;  1HIY A;  3M6W A;  2P2C B;  4JI8 F;  5DM7 Q;  3X1L B;  1X4A A;  2MKY A;  1TUV A;  3KG4 A;  1D3W A;  2J0W A;  3O8W A;  3T6B A;  4IO9 Q;  5HI7 A;  2XZD B;  2Z57 B;  2LLZ A;  1CS4 A;  4NE9 C;  2QSW A;  1VJQ A;  5J2P A;  3EXC X;  2A1B A;  4ZIT A;  2UVR A;  3OL6 A;  2OP5 A;  1NH8 A;  3MMJ A;  1SIZ A;  4DR4 F;  3S6E A;  1HWJ A;  4F4Y A;  3P6Y C;  3GB0 A;  5KFC A;  1N34 J;  2VON A;  3G8Q A;  2ADB A;  2IAJ B;  5KFZ A;  1KR4 A;  2HVD A;  3P96 A;  4YB7 A;  3ULH A;  3AQO A;  1SKW A;  1RAI B;  2WW8 A;  4NXN J;  5A6P A;  3K59 A;  3NBP A;  2VBZ A;  3MFH A;  3R3T A;  4Q43 A;  3IO1 A;  2MQM A;  2W9A A;  3ZZP A;  1RB0 A;  1NK6 A;  1TKD A;  4EBC A;  4J9O A;  1RWN B;  3JTO A;  4QJV A;  1GMW D;  2JL9 A;  3DMJ B;  4DG1 A;  1ZM9 A;  4RBU A;  4EZ6 A;  3V6D B;  4BWJ A;  3CCJ S;  1Y3K A;  3QRQ A;  1UFK A;  4HTI A;  5AXN A;  4AUK A;  1EHW A;  1SVD A;  1A7G E;  4ECU A;  3G87 A;  4NA1 A;  2FVR A;  4M5I A;  1T05 B;  1RGV A;  1U8S A;  2VG6 B;  1E6V B;  4TXS A;  4IQM A;  2PA8 D;  1FJG J;  5A8W A;  4KBI A;  4OZL A;  2IM0 A;  2BDP A;  2BRK A;  3LGM A;  8RUC A;  2ZHA A;  2L08 A;  3VAG A;  1QVF R;  3HD1 A;  4RBV A;  1GTE A;  4K4S A;  1FWP A;  4TNO A;  1NHV A;  4CLY A;  2Y9H A;  1XR7 A;  4ID5 B;  2CQ4 A;  5DQG A;  3QRP A;  4A8K A;  3V5R A;  1WDD A;  4YY3 J;  3C46 A;  4NEY A;  3J81 U;  4NRU A;  4DL5 A;  3CT9 A;  3IRX B;  4DR1 J;  3A13 A;  1EET B;  1OMS A;  1RLC L;  1P1T A;  2RKI A;  3HFK A;  1WC1 A;  4N76 A;  3GR1 A;  2Y1J A;  2GQQ A;  4NMX A;  5H9E J;  2DGU A;  1MG7 A;  3JS9 A;  3CCE S;  3SYZ A;  1HQU A;  2ZH6 A;  1U4B A;  2K1R A;  2MMY A;  1VQ6 S;  2W4D A;  1IBK J;  1WSR A;  1B0T A;  2GMJ A;  5I3Q A;  3HI9 A;  1S1W A;  4ZP9 A;  3R1H A;  4C8O A;  3QAE A;  4X4P A;  4IRD A;  4ICL A;  1ZBT A;  4Y2I A;  4IFY A;  2QL7 B;  3GJQ B;  2UUB J;  1V9O A;  4LSN A;  3A12 A;  3Q2S C;  2LDI A;  1U1K A;  3S01 A;  1U48 A;  4DX5 A;  4MTP A;  4DL2 A;  2HQI A;  3GV8 B;  1MMN A;  5HRO B;  3HJV A;  4A8Q A;  2E5L J;  3C6U A;  4QIF A;  1HMV B;  1O5J A;  3R5D A;  4DV4 J;  3KLH A;  2ZH7 A;  4EGL A;  2DGX A;  4IRC A;  2QA4 S;  4Y65 A;  2UVW A;  5DRK A;  2V8H A;  4HEA 9;  2WK4 A;  1Q8K A;  7AT1 B;  4NL5 A;  5KFL A;  3GIL A;  1EQ0 A;  2Q6C A;  2KFZ A;  4C9D A;  4RUA A;  2EI5 A;  1HD0 A;  5DQI A;  2V8P A;  3B6B A;  2ASD A;  1HBU A;  3OVA A;  4Y2K A;  3CCR S;  1KVI A;  1M5V C;  3VWS A;  3W61 A;  1RAO A;  3D2W A;  3W62 A;  1MLA A;  4M8L A;  5KAK A;  1S5Z A;  2FIU A;  2RF2 A;  4P7V A;  5B0A A;  2IIH A;  5L1J A;  3NY0 A;  2I1R A;  2PA3 A;  5KT3 A;  3IWX A;  4KH1 B;  2DXF A;  3EGV A;  2Z2M A;  3K5O A;  4DZ6 A;  3K5N A;  1D9A A;  4F4A A;  1Z2L A;  1Y10 A;  5LOQ A;  4C0O C;  4B9S A;  1U09 A;  4TQS A;  6FDR A;  2Q3P A;  1Q1K A;  4PYD A;  4OIX A;  5A0Y B;  1AYE A;  1MNE A;  2ZDP A;  4N41 A;  1KOO A;  2V4J A;  2PSZ A;  1FRL A;  2JLF A;  2YH1 A;  2DO4 A;  1AFJ A;  3M9O B;  4UOH A;  5D77 A;  1TKT B;  4WZM A;  1I94 F;  1S7H A;  2YTC A;  5DJB A;  2WAQ D;  5C25 B;  4ED3 A;  4OX9 J;  1MU2 B;  2ZNZ A;  3Q23 A;  1VFJ A;  3LH2 S;  5B08 A;  3MEC B;  1NO8 A;  1T9U A;  2B8Q A;  1SI9 A;  2YKO A;  4HH1 A;  4IOC Q;  1I1G A;  3KDO A;  4B02 A;  4QR1 A;  4N7T A;  3NL0 A;  1KD1 T;  4WBF A;  5GAD I;  3MPV A;  2HVE A;  1LWX A;  4TVA B;  3D28 A;  3G71 S;  1T9Y A;  1Q8I A;  2OSR A;  3FEX B;  1TKX A;  1J5O A;  4RW6 B;  5BYS A;  2GIF A;  2XO6 A;  1FKA F;  4NRT A;  2BE7 D;  3QWU A;  3Q8P B;  2D3O R;  3PXG a;  2IC3 B;  5J1E B;  3K0J A;  1Y5I B;  3I32 A;  3KK1 A;  3U27 A;  5HAT A;  2PEH A;  1Q78 A;  4F36 A;  3TO8 A;  2HBR B;  2QGF B;  3I9Z A;  3Q8V A;  2HHT A;  2D9O A;  1VRQ C;  3MZI A;  4F02 A;  6AT1 B;  2ZBQ A;  1R6V A;  1UFW A;  5H9F K;  2J8S A;  2HHP A;  4IG0 A;  4FYX B;  2X1A A;  4ED6 A;  4OHY A;  4ANE A;  1K1S A;  4P2S A;  2AQ4 A;  1YBU A;  3MD3 A;  1OIA A;  2BW7 A;  4F4W A;  1XNQ J;  1FHT A;  2OML A;  5JMN A;  2VPY B;  2FPH X;  3CJQ A;  1U1M A;  3OQ2 A;  2OEM A;  1I3O B;  2WCX A;  2FJD B;  2V8V A;  2MZ1 A;  3PW4 A;  1VJW A;  1F3V A;  2AEJ A;  1WEZ A;  3IR6 B;  1OPI A;  1KKH A;  1X4C A;  3EVW A;  3A3P B;  3WC0 A;  3PW0 A;  1YJR A;  2WON B;  4WXO A;  4C48 A;  4P71 A;  4NLS A;  1KQG B;  3SCK E;  1IQT A;  1UKU A;  1GH8 A;  3MOJ B;  3M1V B;  1SJQ A;  3BKF A;  1VMB A;  4KV8 B;  1RAC B;  2UUC J;  3T9N A;  4JI6 J;  4LIR A;  1I51 B;  2QZ8 A;  3Q2T C;  4X4O A;  1J5E F;  2ABY A;  2RHS B;  3L09 A;  3W2W A;  1JLF A;  3IFE A;  3BDE A;  4RR5 A;  1C2P A;  1HL6 A;  1QE1 A;  3EPG A;  3N6M A;  2R7R A;  3D0H E;  4HHU A;  2EWH A;  3BGR A;  4EYH B;  2LQ8 A;  4X62 F;  1VRU A;  2FY8 A;  2C3O A;  1JJH A;  3BQ0 A;  2HQF A;  1F2G A;  3CJ4 A;  3LW5 C;  4NXM F;  2N82 B;  1GXL A;  2YNF B;  2WB1 D;  4P75 A;  1YRU A;  4GO5 X;  4IO1 A;  1IKX B;  2NQP A;  4WP3 A;  2I6W A;  4KPY A;  2B9X A;  4KYZ A;  2AJF E;  5ETL A;  1RWV B;  1WI6 A;  2ZH4 A;  4YUD A;  1N33 F;  3ILI A;  3MUV P;  3CDB A;  4TQR A;  2BAC A;  3CXC R;  1WWH A;  3OHA A;  1UW4 A;  2PEB A;  1FE0 A;  4DV0 F;  3HHL D;  2CZ9 A;  1S9G B;  1C4A A;  1HHS A;  2VFV A;  3CPW R;  5BR8 F;  1K47 A;  5KFW A;  3PV8 A;  1SJR A;  3MMA B;  2B6A A;  1FDB A;  2KHD A;  3CD0 A;  3ZTR A;  4OX8 A;  3C16 A;  3M2V A;  1Q5Y A;  2ZM6 J;  1GMV A;  1EQM A;  2EG2 A;  2OUG A;  4M63 A;  4PG5 A;  5J2P B;  1FX2 A;  4CO1 A;  4UT4 A;  1RHQ B;  2CPZ A;  2ZH1 A;  4V1A k;  3P5B P;  2CWX A;  1UWB A;  3FFI A;  3WC2 A;  3DLG A;  3K2Y A;  1RYS A;  2BV3 A;  4G1Q A;  2DCL A;  2IVM A;  1WF0 A;  3BQ2 A;  1KEK A;  1HQE B;  1IR1 A;  1CJT A;  2QLB B;  2VH7 A;  4OHZ A;  4L75 A;  1ICE B;  3NBP B;  1IBM F;  1W7W A;  1RK8 A;  3BB5 A;  1LFW A;  1RTZ A;  2OEL A;  1X9W A;  2WHO A;  3CJ3 A;  1DLO B;  2LQ9 A;  4LFC J;  4LR7 A;  4MYU A;  4DEZ A;  2Z30 B;  5CAB A;  2JSX A;  4ALZ A;  4O44 A;  1KN6 A;  5HN0 A;  5GAE I;  2CPI A;  1ZPV A;  2C2K B;  3MTK A;  1QY7 A;  4DG1 B;  4OMF G;  2HMI A;  2R8J A;  2KT2 A;  2MKJ A;  2VFT A;  1LWF B;  1VBK A;  3G6E S;  1NJZ A;  1G1X A;  3HSG A;  1RTH A;  3MWB A;  3GIJ A;  4LF6 J;  4OJ3 A;  4OYX A;  5LMU J;  1VQK S;  2N4D A;  4CLL A;  3CCT A;  5IT4 A;  3PRV A;  4E8U A;  1OY6 A;  3H98 A;  2HNZ B;  1HNV B;  4MFB A;  1KQK A;  3QGH A;  4USH A;  2AW0 A;  1EZZ B;  4NCA A;  2UP1 A;  1ZA1 B;  2UUA F;  5A8K B;  2WVF A;  3CJK B;  4OYB A;  1H7W A;  2GW8 A;  4N5S A;  1X5S A;  4C3L A;  1UZH A;  2P8I A;  2MXY A;  2FJA B;  4PWD A;  4C97 A;  1XER A;  4ILL A;  4O4R A;  5KOX A;  1PKU A;  4LFB F;  2R7U A;  3R5G A;  1KC8 T;  4OYZ A;  3CO9 A;  2YPZ A;  1U45 A;  5J2Q A;  1HQU B;  3F56 A;  1EKR A;  1RTI A;  2K1R B;  3T3F A;  5T14 A;  4ZVE A;  3MUR P;  2WBR A;  2FZK B;  5F8L A;  5IZH A;  2XS7 A;  2YNH B;  2QC3 A;  4GVB A;  3QAT A;  2JC1 A;  5GAD U;  4I64 A;  3JQK A;  1HNX J;  4ICL B;  3MM8 A;  1SJF A;  4DR2 F;  3SEO A;  1KHV A;  2B5J B;  3IAM 9;  3CDA A;  2OTJ S;  1FD8 A;  2UU9 J;  1RCX B;  3MEE B;  3OSP A;  2FJB B;  2ZWP A;  5DDQ C;  3HM9 A;  5KT4 A;  4B3O B;  5IV4 A;  2EKN A;  4Q45 A;  3KLH B;  4KAI A;  4MIW A;  3MAA B;  4OZN A;  1OYD A;  3LWM A;  1GXU A;  2I5J B;  3P49 B;  4FN5 A;  4KH0 B;  3HHN B;  4XAK A;  4DUZ F;  2BOA A;  2OAU A;  2W2N P;  5THW A;  1VQP S;  4I6A A;  3PFO A;  2B4O A;  2XYG B;  2RF2 B;  2DIV A;  3C15 A;  2ZVS A;  3GFY A;  3HZE A;  2MHE A;  3W1Y C;  3UDC A;  2AGQ A;  1IVZ A;  1WEX A;  3SXL A;  3N5F A;  2GHW A;  5HAN A;  4Y0F A;  3PYD A;  2ZDO A;  3BBB A;  4NLG A;  2E9T A;  1W2I A;  1HHT P;  2J9D A;  2W01 A;  2KU7 A;  2V4J B;  5CAA A;  4WKR A;  2Y0S D;  4ZPW R;  4LBP A;  4CLK A;  4B3R J;  2V5H G;  3JQJ A;  1BY9 A;  5KFU A;  3NS5 A;  3UWT A;  3R5B A;  1VQY A;  4PQA A;  5IV3 A;  3TEH B;  4KQZ A;  2GO9 A;  1XJW B;  3WX8 A;  3VAL A;  3MI7 X;  1VQO S;  3CNQ P;  2RE1 A;  5ETK A;  3GSD A;  4JP8 A;  2NLW A;  2IDE A;  4X4N A;  2E44 A;  1CJV A;  3TAM A;  4P52 A;  2HUR A;  1UWA A;  5D15 A;  1QTM A;  2A18 A;  3IA0 A;  3ENV A;  3BJY A;  3H2V E;  2ZBP A;  2ZH5 A;  3WDO A;  1G6B A;  4B3M F;  4QOT A;  2OEK A;  2J7U A;  3ADA C;  3CC7 S;  4ZIW A;  2V9W A;  4PWW A;  1KNZ A;  1YJN S;  2KXF A;  5I42 A;  2YXL A;  1P9Q C;  3VTI A;  4MKY A;  3KK1 B;  3LP2 A;  2W1B A;  5IT9 Y;  3RBX A;  1QDU B;  5K9F A;  2YNI A;  3MM9 B;  2B4P A;  4X4R A;  2QFI A;  3PTW A;  3BN7 A;  3IXQ A;  1VRT A;  2EW9 A;  4Y00 A;  3R7S B;  3KHG A;  4MKA A;  4RZR A;  1N5T A;  3BEG B;  1IKW B;  4ZPD A;  1NHK L;  3PYG A;  3CJR A;  2MKH A;  3H5U A;  4I6Y A;  3RBZ A;  3WX4 A;  3J7Y I;  1AUD A;  1PO6 A;  4HH0 A;  4PXB A;  2DNN A;  4LVO P;  2FB0 A;  1C1C A;  4WFB Q;  1RWP B;  5G4D A;  4O3N A;  4IOB A;  1R31 A;  4NLX A;  4ZVP B;  3LAN A;  3IM8 A;  3EXY A;  3RU0 A;  3VZH A;  4HDG A;  1XWL A;  4WK3 A;  3TZX A;  3T1H F;  2FZG B;  5K8O A;  4M5D A;  3D6M B;  2QMX A;  3QGP A;  3AFG A;  5KFO A;  1FRJ A;  4ZP6 A;  2DCU B;  3N01 A;  5IT9 U;  5KFY A;  2ZUG A;  3F73 A;  2OKQ A;  4R0E A;  2R9L A;  2AYG A;  1LW2 A;  4R5P B;  5DDR C;  4DHV A;  4GC6 A;  1NUE A;  2VV5 A;  3RB0 A;  2YKA A;  3NAH A;  4UOC A;  2IYI A;  2RJZ A;  4HYK A;  5HBM A;  4MH8 A;  2DEI A;  2JX2 A;  1HQ2 A;  2BUN A;  4C0B A;  3BPS P;  5CCM A;  4AL6 A;  1N52 B;  3TAR A;  4QIE A;  1M90 T;  1I94 J;  2LCW A;  4ZIV A;  1WOO A;  3M8W A;  1TKZ B;  1WI8 A;  3VAH A;  2ZOG A;  3EDQ B;  2NR0 A;  4HL9 A;  2FHK A;  2D41 A;  5CZV A;  4NLR A;  2R2R A;  2EFQ A;  3UN3 A;  2BAN A;  3ZZY A;  3W2W B;  5C42 A;  2P9C A;  2NYH A;  1JLF B;  2NZC A;  3CD7 A;  1X4F A;  3LOU A;  3I6P A;  3A3O B;  5B0F A;  2HGL A;  4JV5 F;  3BGR B;  1JNZ B;  1VRU B;  2D74 B;  2IMW P;  1FK9 A;  3MM5 A;  1WEL A;  4PEO A;  3A8J A;  4RU2 A;  2CG4 A;  1NJI T;  4WE1 B;  4ITS A;  4LF2 A;  2AV5 A;  3MPW A;  5AT1 B;  4JI5 F;  2FHM A;  3HHK A;  2R2T A;  1N88 A;  5T7L A;  2AHO B;  5DZ6 A;  5GAE U;  1LOU A;  3OTD A;  3R8Y A;  2W9B A;  3ZZR A;  5IXU A;  4QWA A;  1QSY A;  3M9N B;  1Q16 B;  3HVT B;  2ZVI A;  1PAU B;  2C1E B;  1KLM A;  1R0B G;  4ZN3 A;  4YDX A;  2MKC A;  2I8E A;  3C6T A;  3KNA A;  1U1N A;  2VBX A;  1AZS A;  4HAC B;  3SCI E;  1WC4 A;  2MST A;  1CJU B;  1MMD A;  3MPU B;  1OJ4 A;  2ZJP Q;  3DXB A;  4NPO A;  5LL6 d;  2ADC A;  1MSW D;  2R2U A;  1YDL A;  2B6A B;  1XEZ A;  4USI A;  4C2M A;  5GAH I;  1S7I A;  4DFJ A;  3C16 B;  3DGP A;  2IM3 A;  4ZPB A;  4LFA F;  2C42 A;  2KB2 A;  4KGX B;  4YP3 A;  4Q44 A;  1PYS B;  2N7Y A;  3DM2 A;  4E0D A;  4U6P A;  1X7V A;  3ISN C;  2MZQ A;  4Z7C A;  3QLH A;  5RUB A;  1UWB B;  2W8K A;  3DLG B;  3FZB A;  1R3N A;  4JBC A;  1S4E A;  4G1Q B;  3DRS B;  2HNY B;  4H54 A;  3NOC A;  1RSC A;  1C1B A;  2VFS A;  2ASL A;  2CNO B;  4E2F B;  3OPK A;  2EVZ A;  2JWN A;  2W2Q P;  4PZV A;  4ZKA A;  3OXF A;  3DNC A;  3NRB A;  4GVL A;  1S9F A;  4ZCI A;  4DL3 A;  4HR2 A;  1NHU A;  1J5E J;  1P1L A;  4A8M P;  2E1P A;  1YBT A;  1RHK B;  5E3C A;  4BC9 A;  2QMU B;  2KH9 A;  3M6U A;  2BE2 A;  3NGT A;  5EGY A;  5F9L A;  3G4S S;  4WK1 A;  4O44 B;  1EJ7 L;  4NI2 B;  2G2Z A;  4ZLL A;  2DXE A;  3GR0 A;  1Q86 T;  2HQG A;  3H8Y A;  2ILZ A;  3DRY A;  2JJ4 D;  1XIQ A;  3CJ0 A;  3RGI A;  2G2O A;  1TL4 A;  2R3V A;  2HMI B;  1LXJ A;  2J9E A; 
#chains in the Genus database with same CATH homology
 1SC1 B;  1RWV B;  3D6H B;  4ZVR B;  3KJN B;  4DCJ B;  2CDR B;  3NS7 B;  3R7N B;  3D6M B;  4DCO B;  4LSZ B;  2C2O B;  1RWX B;  2QL7 B;  3GJQ B;  2HBR B;  4DCP B;  2QLB B;  2H48 B;  3KJQ B;  4ZVS B;  1SC4 B;  1RHM B;  2XZT B;  1ICE B;  2CNL B;  2H51 B;  5IC4 B;  4ZVO B;  3EDR B;  3R6L B;  1QDU B;  4ZVT B;  1RHR B;  1IBC B;  1PAU B;  2CNO B;  2H65 B;  2XYP B;  2C1E B;  1RWW B;  5IC6 B;  1RWK B;  2P2C B;  1RHU B;  2XYH B;  3IBC B;  1I51 B;  3R7B B;  2H5J B;  3R7S B;  3IBF B;  1F9E B;  2CJY B;  3SIP B;  1SC3 B;  3RJM B;  3R6G B;  3GJR B;  2H4Y B;  1QTN B;  2H5I B;  4ZVQ B;  3QNW B;  1RHK B;  2QLJ B;  1RWN B;  2C2M B;  3EDQ B;  3P45 B;  2Y1L B;  2CNN B;  2CNK B;  2Y0B B;  2QLF B;  2HBQ B;  2HBY B;  1NME B;  2H54 B;  2XZD B;  5K20 B;  1BMQ B;  3GJT B;  1GFW B;  1RWO B;  3R5J B;  2C2K B;  3KJF B;  2CJX B;  1PYO B;  3GJS B;  1RWP B;  1RWM B;  3P4U B;  2FQQ B;  2HBZ B;  2QL5 B;  1I3O B;  4JB8 B;  2DKO B;  2XYG B;  4ZVP B;  4ZVU B;  2C2Z B;  1RHQ B;  2QL9 B;  1RE1 B;  1RHJ B;  3D6F B;  2H4W B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...