1RHUB

Crystal structure of the complex of caspase-3 with a 5,6,7 tricyclic peptidomimetic inhibitor
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
91
structure length
91
Chain Sequence
KIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Reducing the Peptidyl Features of Caspase-3 Inhibitors: A Structural Analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Caspase-3
total genus 16
structure length 91
sequence length 91
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2003-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1rhuB00
2CJXB 2H5IB 4JB8B 4ZVOB 2XZDB 2Y1LB 2P2CB 3R6LB 2DKOB 1I51B 1SC4B 2H4YB 3D6HB 1IBCB 1RE1B 2HBYB 2C2KB 2H54B 3RJMB 2CNKB 3R6GB 3QNWB 1RHQB 1RHMB 1BMQB 3KJFB 4DCJB 3R7SB 2HBRB 4ZVQB 3IBCB 2XZTB 1QTNB 4ZVSB 3D6MB 2CNLB 1QDUB 1RWVB 3P45B 2QLJB 2H5JB 2FQQB 2C1EB 2C2ZB 3R7BB 1GFWB 2XYPB 1RWMB 1RWNB 4ZVUB 1RWKB 3GJRB 4DCPB 3R7NB 4ZVTB 1PYOB 1RWOB 2H48B 3R5JB 3GJTB 2CNNB 5IC4B 2CJYB 2CNOB 5IC6B 2QLBB 4LSZB 2QLFB 1RWXB 2C2OB 3IBFB 2XYGB 2QL7B 3GJQB 2HBQB 3P4UB 1RHUB 4ZVRB 2HBZB 3EDRB 3NS7B 1ICEB 3KJNB 5K20B 1NMEB 3EDQB 2QL5B 1SC3B 2H4WB 2H51B 1PAUB 1RHJB 1RWWB 1SC1B 3SIPB 1I3OB 2CDRB 1RWPB 3D6FB 2H65B 1F9EB 2QL9B 4ZVPB 3GJSB 1RHKB 2XYHB 4DCOB 1RHRB 2Y0BB 3KJQB 2C2MB
chains in the Genus database with same CATH superfamily
1W25A 2BW2A 3CJKA 4EGLA 1WF0A 1BGXT 1H2VZ 3GIJA 1H0HB 1X4CA 1VCTA 3TAMA 2HLTA 4QR0A 2HLUA 4CO0A 1TKZA 2NZCA 2ILYA 2R7VA 2ZJRQ 2M0GB 2DR8A 1Y0HA 2OJ3A 1FFSB 3R1HA 4DV1F 3PV8A 2E5GA 3I9V9 2AU0A 1JLQA 2WVFA 5KFIA 5HP1A 4JV5F 5H9EK 2VQEF 2LQ9A 5CH7B 1WG4A 1YGYA 2WONB 1FNOA 3QPIA 2OMLA 2HZCA 3K0JA 3KJFB 1IM4A 1WC0A 2WVEA 4KGKA 4WFNQ 1KD1T 2FLOA 4UZBA 2W8KA 3G82A 4RW8B 4ER8A 1HLWA 3IWNC 4K4VA 3MEGB 3AY0A 2VG6B 5B0CA 4B9VA 4WE1B 2MJUA 1VQNS 1KRPA 4GKJJ 1REVA 4KSEB 3DYAA 4B3RJ 2VBWA 1UFWA 2CJQA 2OLWA 1Y3KA 2IJFA 4O3OA 4X4UA 1NJYA 5ETPA 1S76D 1RWVB 4RW4A 1RBAA 1RT2A 2YKMB 2DNRA 1EETB 5AXMA 3D4JA 1FKOB 3NMRA 4F04B 5F8MA 3JTPA 1DARA 1HWIA 1QAYA 2WZ1A 5CYMB 3W5XA 4N5SA 2Y9HA 1DZ5A 2CQPA 1U1PA 1QUVA 1IKVA 3C3LA 1GMUA 3IA0A 5F3TA 4ZN3A 5LJ5Y 2ZH8A 3KLIB 3QGPA 1U4BA 1MWZA 4IO1A 3D67A 5D0HA 5DDPC 2Z58B 3CJQA 1RWNB 3J7AN 1PSDA 2M8HA 2VPWB 4U7CA 2V68A 5BR8F 2ZM6J 1S57A 1VRUB 2LMIA 2BE2A 4YB6A 3H5XA 2IIHA 4DS4A 1R8PA 4Y65A 1WORA 3W66A 2MQQA 1L3VA 2AF6A 1YBUA 3D3BJ 1RT5B 2G0IA 3B4DA 5K14B 4C3KA 2IA6A 4ED5A 3S6EA 3NNAA 1BQNB 4QPTA 1R0CB 4FYVB 3TWZA 1LWCB 2KKHA 2UP1A 2E1CA 5J2MB 4Q45A 3BGRA 3MPUB 1D8YA 2DNOA 2WRMA 3MM8B 4HT5A 4ANEA 2NUHA 5KG3A 4ZJQA 2YNGB 3ILOA 3J7YI 1S48A 2WCXA 2P5VA 5IV3A 1FD8A 3H42A 4J9PA 3OPKA 2CAJA 1N5YA 4FPRA 1B64A 3DNCA 4DPXA 4Y34A 2IAJB 5L1KA 4OZLA 4X66F 2VD3A 1PJ7A 1XQIA 1C0TA 3HPOA 5J2PA 4HTIA 4C8KA 4IQMA 2YVSA 5HMZA 1DTTA 2VC0A 4DV0J 2C3OA 3RBXA 4CTAA 1HD0A 2XTJP 4Z37A 3CCMS 3IRWP 3A1YG 2VOPA 1BD6A 2IFXA 3TRGA 1YJTA 1RAFB 2Z30B 2QYGA 1SJ1A 3ELHA 4KY3A 4KQZA 1HYSB 3CCUS 2ZBIA 3THVA 4OZ1A 2ZVIA 1KTQA 2Z2LA 1S4FA 3B78A 2PMZD 1ZS6A 2CQ2A 2IA0A 2A2DA 2QTWA 4QOTA 4CLSA 2YNHB 1VQYA 2CZ9A 3SXLA 1JJHA 5CYMA 4CT8A 1UVLA 1HQ2A 5ITHA 1N54B 2JFKA 1FWLA 3NY0A 5C24A 1S6UA 4R8UA 2MKKA 2LCWA 2X1GA 4EFAC 5CD4A 1MN7A 2W7OA 5A6PA 1RWUA 3LP1B 1VRTB 2Z2ZA 4KV8B 1NSPA 2NXCA 4XIUA 2RILA 1GXLA 1REGX 2ADBA 3HHLA 4YOEA 2NPIA 1CEZA 2CQ1A 1S6PA 5GAGU 3MR3A 2F63A 4ZLPA 1UTAA 1HNXF 1CC7A 1HARA 3FBBA 1ZA1B 5KG2A 1RI7A 1FJ7A 5DETA 3UDCA 1IKXB 3H5SA 3H5YA 1RT5A 4QYZK 1S1XB 1UZDA 4ZPTR 2VUGA 2HHHF 1XR5A 2PA3A 3JYTA 3PO4A 4LF4F 3TA2A 2DJWA 4LBPA 2V4JA 4HT7A 2DEIA 1LWCA 1X8DA 1Y9OA 2H54B 4NI2A 4XDCA 2LXFA 3N6NA 1CJTA 1JLQB 2IRUA 3I31A 3R6GB 3QT6A 3VAMA 1K0VA 2HNDA 4YB7A 2CJBA 2WONA 4NXMF 3MXHP 3K2YA 3EM1A 3GYGA 3HSGA 4PYAA 4U7UK 2PFDA 4G1IA 3ZZTA 2BANB 2DGWA 4RW8A 2I5JA 4MKAA 5IQQA 3OJSA 1YHQS 1RAJA 4KYZA 4WYLA 2CJKA 4IRCA 5LSOA 2DTJA 3MEGA 1IWAA 3PW5A 4PRFA 1TMMA 2CJ9A 5F0UA 3OJUA 2VA3A 3IR6B 2CQBA 3CD7A 8AT1B 1R8HA 2NSCA 3FEZA 4MKBA 3A8KA 1SKRA 3HSDA 2DISA 4G65A 1F6TA 1T94A 3PIOQ 3FC9A 2FVPA 1VS3A 4O3SA 2RHSB 4R5PA 4JI8F 1LK5A 1T02A 2GA7A 3AD8C 1B7YB 5LL6d 1S1TA 3MR5A 2V6AA 4WYWA 4O4GB 2BQRA 1FNXH 3RBEA 2IHR1 4O0NA 5E0OA 2HHWA 5GAEI 3AJ1A 3DLEB 2GO9A 2KHCA 1C4AA 3M6VA 4C8ZA 2V9WA 4I67A 1SH3A 4K7QA 3TJAA 2BE2B 1HQEB 2MSTA 4H4OB 2HHHJ 4IFYA 1RTJB 3PNIA 2ZJPQ 3DXSX 2EG2A 1NSAA 4LIRA 1XMQF 2GAGC 3GR1A 1FX4A 4HEA9 3HHLC 1WNEA 4CH7A 5HBMB 2VG5B 6FDRA 4YP3A 1HBNB 4OZ2A 1IVZA 1FA0A 1EX8A 3NGUA 4OZNA 3AFGA 3IAM9 3I5AA 1NK4A 2H48B 3N28A 3VGTA 3UNGC 5JVHQ 2KRBA 1UEKA 2RUGA 2DGTA 1HL6A 1RTIA 3W61A 1WG5A 1Y10A 4BWMA 3W9JA 4KJIA 1KNZA 5L1LA 1JLEA 3W7BA 2XLJA 2GMJA 1N0VC 1PGZA 4DQIA 2XMAA 2UV8A 1C1BB 4DF8A 3FZ2A 4MYUA 4Q8FA 2IAJA 2HHSA 2L3MA 2CVIA 1IR2A 1N36F 2OFHX 1ZH5A 4A8WA 1RHUB 1CSJA 3Q8RB 2XMUA 2VQEJ 3RRGA 8ATCB 2I6WA 2VPZB 4NASA 2MKIA 3NS7B 2GJFA 1FXRA 3BQ2A 1N36J 4IOAQ 1QSLA 3C15B 3RB0A 1EETA 1F3VA 3J81U 4TU9A 3PYDA 4AL6A 1SC3B 2JEJA 3PYFA 1N0UA 2DPJA 3HJVA 3QLHB 2Q1LA 4A8FA 4K50A 4KFBB 4X66J 2EFQA 2W7AA 4ZVGA 2AKWB 3EXYA 3U02A 5B0DA 5K8NA 1UW9A 5DS7A 3FQLA 3MM7B 3Q0AA 2E5LF 2DGOA 2HRUA 3DDIA 4QWAA 3I5CA 4IOCQ 1VRTA 2EKYA 2RAQA 4TNOA 2XB2D 3ULHA 3G8TA 1AUDA 1RADB 2GMLA 3HVWA 4IFYB 4WK1A 3WDOA 2FVSA 2VHGA 2HHVA 3R8YA 2HW3A 1FHTA 1LOUA 1RXOB 3PY8A 1X9WA 3JSYA 2DNHA 1N32J 2WOMA 3TUIC 3QWPA 2B7BB 1MWQA 3MMCB 2CPYA 2W9BA 3I56S 1YITS 2B9XA 3F41A 1VQOS 3G86A 3NP5A 3CF5Q 2E1MC 4ENOA 1H38A 4ZPAA 2D3O1 3UFCX 2DRDA 4OZ3A 2CNKB 2HK3A 3JS9A 3CXCR 3BM7A 4OI0A 1HQUA 3LW5C 2ZZMA 3ZNUA 4QU6A 3PX0A 3SQGA 4Q5VA 3OTDA 1XERA 3HVTA 1RHMB 2I5JB 1BMQB 5IFMA 3BPDA 5B09A 2X3GA 3H2LA 4BC7A 5KFPA 3EZOA 4OZJA 5LSRA 2R7SA 1JKHA 4DCJB 4DV4F 4IG0A 2HBRB 1RTHA 2K7KA 2OHDA 2QE5A 3ILJA 5KFAA 4CLPA 4I4BA 3GIIA 3PX6A 4FYWB 2DXFA 3AOAA 3OFFA 1NPPA 4LR8A 5K8OA 4ES2A 4XO0A 4DR3F 1HNWF 2CJAA 3VZHA 2KFNA 2KTQA 1WG1A 3WZ0A 2YH1A 3MECA 1CLFA 1M1HA 3C15A 4PPDA 5IXUA 4JI7F 1LW0B 2MJNA 4USKA 5BR8J 3PHEA 3T1AA 2JRSA 2KU7A 2RNEA 2YNHA 3BH7B 3GYXB 1VISA 3UNYA 3M8RA 3RBDA 4PR6A 1DFDA 5BYSA 4OV6A 1AYEA 2C1EB 1T9YA 4X62F 3DU6A 2CQHA 3AD9C 1EJ7L 2C3YA 2J7UA 5JJBA 3KHGA 3AJDA 1M5SA 4LF9J 5HVGA 1NH8A 4I2PB 4OMFG 4CLFA 4B08A 1RKJA 5EN1A 2NPFA 3H0PA 3A4TA 4I6WA 3ETOA 2FZCB 2W2QP 5HBMA 1Q8IA 4X84A 2IYGA 2J5AA 3AXMA 2FZKB 2ZNZA 1TKTB 3IRXA 3PTWA 3CDBA 3BQ0A 4M5HA 1YI2S 4LF9F 1FK9B 2E9ZA 1VGYA 4ZS6A 4X4VA 2ASJA 4CZCA 2MQPA 2JEGA 2ZH7A 4ZHRB 3C46A 1WI8A 1FKAF 4B3RF 3UI3A 2N3LA 1NK8A 4PWUA 5IC4B 2XWYA 3GE9A 3JSBA 1SC6A 5F8JA 1HMVB 1AFJA 3HZGA 1KS2A 4LSZB 4NX9A 3HHNB 3L09A 2BKNA 2C3UA 2QT7A 4LREA 3H5UA 3SBMA 3RBZA 3UDVA 3CMAS 1UWBB 1TKDA 3DRYA 3M8PB 2FHJD 2R2TA 3MGJA 3CNQP 4M5LA 1YJ9S 5FLXU 2AGOA 5LSLA 2DGSA 1XN9A 3W8PA 4PYDA 1X0PA 4NXMJ 3DOKA 3TQ1A 1RT6B 1BXNA 4I6YA 3HO1A 4ERDA 2Y8YA 5K8PA 2E9TA 3CDWA 5DQHA 3R2DJ 4DR2F 1S0OA 3QO9A 4FKYA 2YY3A 4EMDA 3M6XA 1U1LA 3L4BC 3FCWA 3OXLA 4DX7A 4USJC 3UVJB 5A8KA 4YB1P 2ZH3A 3T5KA 1MLAA 5LT5A 4DV5F 1TL4A 2HVIA 4LSLB 1ZOTA 1VI7A 2HZAA 3T1HJ 2V67A 3TOQA 1IR0A 1I3OB 4WJBA 5GMEA 4MK7A 5KT4A 2ZH9A 4O3RA 5D0RA 3V4IA 1D0EA 4K4YA 2GIQA 2N7YA 2XMVA 4CO1A 3CPWR 4YY3J 1UA1A 3NOGA 3EZUA 5SZTA 3QJLA 3KDOA 2UUBJ 2DR6A 3TI0A 3CULA 3NL0A 4DCOB 2Y0BB 4XK8C 2MQOA 3SDEB 3VAFA 2ZZNA 3QJPA 4RBVA 4KGXB 4WU3A 2GIRA 1J5OB 2GHPA 4YUDA 2A1BA 3DLJA 4ZVOB 5CYQA 1KFSA 1VLYA 1Q7YT 1KBRA 4DPTA 4BWJA 4HH1A 3T5JA 1DJ0A 1YRTA 2HWTA 4DI6A 3BV8A 1HD1A 1U1OA 3TAMB 3E8OA 1HR0J 4FP9A 3ZTQA 2EC0A 3LF0A 4EBEA 4ED0A 3IWXA 4I1TA 1Y3JA 3MUTP 2AX1A 4ECZA 1R7IA 4ICLB 5L9NA 1PO6A 3SQGB 4OI2A 2D3OR 1QVGR 4LQ3A 4CLYA 2LA6A 1W26A 3HULA 3E3XA 5A8WB 4CLKA 3BDPA 2FC9A 3MD3A 2JJ4D 4N47A 1WOOA 4TYAA 4BLGA 5D6GA 2VQFF 1TV6A 1YJRA 3DFEA 2ZE2A 2CZ4A 2ZWPA 1WTBA 2E66A 3KFWX 2YX4A 1S7IA 3FSIA 4BCAA 1L5UA 3HCXA 4NL5A 4ZVEA 5KFDA 2OKQA 3BKTA 3ILLA 3I32A 3RYLA 2VQFJ 2B4VA 2NR0A 1KQKA 2GQQA 4CP5A 1QAJA 3MTKA 1SCJB 4JI1F 1X4DA 2I1RA 1IBKF 4X4QA 3KJVB 1R0AA 5L39A 1S12A 1V5VA 2B4PA 3FUYA 3F44A 4TXSA 1HNXJ 4DSKA 4PG4A 1HW8A 1TL3B 5IT9U 4DF4A 3UN5A 3MMBB 1IKVB 4RNHA 2FQQB 1UCNA 1QLNA 1SUQA 1T9XA 1KWMA 4USHA 2UVVA 4URQU 3KLEA 3VAJA 1QUPA 2UUAF 2R2RA 4CT9A 1S72S 3BN4A 4FZVA 1XR7A 1NHKL 1ZM2A 1RT7A 1Q95G 2XULA 4PQAA 2VB6A 4P73A 2ZOGA 1ZAVA 2DNGA 4ZP7A 2R7XA 2CVEA 4ZJOA 2FTRA 4DSEA 1F0XA 1I5OB 3I0RB 2MDAA 3TJ8A 3EYZA 1RT1B 4QJVA 5J2QA 1J5OA 1QAIA 1KQGB 4XPCA 1CULB 2ZDOA 3CB4A 1BQNA 4F4KA 3W1YC 4DZDA 4LF6F 4UF4A 4W98A 4YY3F 3LO3A 2M4MA 2Z57B 2AX0A 3CJ0A 1R3NA 1UVMA 4OJHA 1F1BB 5KFJA 1RP5A 1U0SA 1RWXB 4NMLA 3TA0A 3CCLS 3CJ2A 3G4SS 3CE8A 3MM6A 1RBOB 3U27A 1F5BA 3MR7A 4ZKAA 2G13A 2XYGB 5J2PB 2QL7B 4O0IA 2XS7A 1RTHB 5DQIA 1KHWA 2ZE2B 4JYAF 3DOKB 2HBZB 1ROFA 1Y5NB 2ASYA 3GV5B 1FKPB 3OL9A 4PXCA 4GO5X 2MLXA 2NCKL 2B9EA 2Q6CA 3A3PB 5CCLA 3A8JA 1X60A 1FWPA 1ICEB 3BKUA 5K20B 1HBOA 4YHHF 4I2QB 1VK3A 4ILMA 1HYSA 3KMSA 4OYZA 1U1QA 5AJ3J 1Y7PA 2BV3A 3MCMA 2BQ3A 4JI5F 5KG5A 3N5FA 2OAUA 5I3UB 2RKIA 7AT1B 3M8WA 1VJWA 1K9MT 2GX8A 3H90A 4ZVPB 3ZZUA 2R8HA 2RB7A 3EGWB 3RW7A 5I4MA 4A8YA 2DHSA 1FT8A 2K3IA 2UXCJ 2MKJA 3LWLA 4OI6A 2YNFB 1Q5VA 3IS9A 2W2NP 1X7VA 3POTB 2GJ2A 4PXBA 1T9UA 1TUVA 3TZZA 2RT3A 1YBTA 2ZDPA 5D4PA 3M32B 4KHPJ 4PQUB 1G6BA 2W2OP 5DZ6A 1U1MA 9ATCB 3M30B 2AEMA 3N6LA 2WBMA 4J37A 1O6XA 4ECWA 3MHYA 1S0NA 2W4DA 3R6LB 3EPIA 4RUCA 2PDAA 4U95A 1NK9A 3D28A 3JQMA 3KK1A 1D1UA 2IVYA 3RUBL 2MKCA 4UOFA 4B9LA 2J76E 4KAIA 2XS5A 1D9AA 3DOLA 1JNZB 2V4JB 3CGIA 4DV4J 1AXQA 3WQPA 4GC7A 4BC9A 4F8RA 2Q3PA 4W4MA 5A8WA 4ED2A 2HGMA 1RHQB 3VGUA 2P9EA 3NRBA 3CUNA 3P49B 3OVBA 1O0PA 1VHIA 2YKNA 4GVLA 2RU3A 4QWBA 4U96A 1O51A 4YN3B 2KL8A 4TVAB 5DDRC 5CXTA 4OJGA 1GXTA 4EBDA 1NJZA 3LA0A 4DR1F 4ZLNA 2NUUG 1R31A 4P74A 5KT2A 4JI0J 4RNFA 2OH2A 3FEYB 1EQMA 1WEZA 4P7VA 4LF5F 3D6MB 3HT0A 1VYAA 4Y2KA 1GK8A 4X4PA 1FKPA 4B9MA 1N56A 4ED8A 4P6QA 4ZP9A 5HI7A 1S1TB 1LXJA 3B82A 1LKZA 2DNNA 3QGHA 1HI1A 2HK2A 2U1AA 1JMTA 3ZZ0A 5HN0A 3QT7A 5IT9Y 2VPYB 2RQ4A 1HWLA 4RNMA 1HQEA 2DXEA 2RKIB 2KRRA 3TZWA 3MCSA 1S9FA 2UUCF 1CVJA 3TQEA 3SCKE 1JJCB 4KO0A 5KFTA 1LEOA 4IOBA 4DCPB 3KLFB 3K5MA 2VBYA 1RTJA 3PYGA 2CPHA 5L8RC 4A46A 2NZ4A 2H9ZA 1R6YA 3HLUA 2C2DA 1NLKL 3DGPA 4ZP6A 4N41A 1NDPA 1F2HA 1SQEA 4GRSA 3ILIA 4ZITA 2C22A 5KG1A 1HBNA 1NDLA 5L38A 4J90A 4QIEA 1DLOB 3AXKA 4QW8A 1VQLS 5D8HB 5HJYA 4UOHA 2BABA 4LF8J 3TX8A 1TL7B 2V8VA 3ICLA 2OPQA 1AROP 3HF5A 3DOLB 2CJYB 2FHOB 1UJ4A 4JI0F 1X9MA 8RUCA 2FVQA 1JLEB 2R2UA 1OSDA 3LPYA 2MQ8A 1KOOA 3GZ7A 2HFZA 2MEWA 3ET6B 3NGTA 1ULRA 3GV7B 2PGCA 3SSRA 4HH0A 3OTOF 1Q53A 2OMOA 2PC6A 3P4UB 3G82B 4F4XA 3W2VB 4URGA 2MZ1A 3FGVA 4JOUA 3LQVA 3MFHA 5BJRA 4IUFA 2YWGA 1YVFA 4Y0FA 2KHDA 2XHCA 1RLDA 1YZ6A 3MPDA 2HMIB 5GMDA 2CQ0A 3CCWA 4Y2CA 1KKHA 4TY8B 3FNNA 5KFZA 3GCXP 2UUCJ 3Q2TC 3DRRA 3QAUA 4ZPWR 4EI2A 3V6HA 3OQ2A 4DQPA 2R7TA 4LF7J 1MROB 3AB4B 2D7SA 1SC1B 2VL1A 4JYAJ 1YSJA 1YRXA 4CCHA 5HQLA 3KLEB 3AA8A 2CWXA 3W5ZA 3I6PA 1N5QA 1IJEB 3ZFVA 4NA2A 4NXNF 2HNZA 3ITHB 1VK8A 1RT7B 2D9PA 2NLWA 2XMKA 3PEHA 2RHQB 1NUEA 3GU0A 1X4BA 4H4KC 1U1RA 2HWHA 3BKFA 2HPUA 4RU9A 2B5JA 4ECRA 1PJ6A 3AOBA 4LRCA 3N0VA 4PG6A 4DR7F 2CJXB 4WIQA 3S8SA 1E6YB 2EFOA 2H5IB 4IFVA 3ENVA 5KFUA 4OYPA 3J7Z5 2ZM6F 4CLUA 4AQYF 1GMVA 3AJ2A 4S0MA 4FNIA 4M1KA 1NSKL 1DLOA 2YQ0A 1SJQA 2HKEA 2MLYA 3FDSA 4DR2J 2FGCA 5M2RA 3HD1A 3AH6A 3S1TA 1SIZA 4C3LA 3QZ8A 3ISND 5LMUF 4EZ9A 3NBPA 3FFIA 3TUJC 2QFJA 3HVTB 3HJFA 1FF2A 2HHXA 2OPSA 1HQUB 2GO8A 2WSCC 4N8OA 2EC2A 2IBKA 2MQLA 4EWTA 2PA8D 3K89A 2D9OA 1ZTTA 4EYIB 1LWEB 4C48A 3RRHA 3GIKA 4ECYA 1BHNA 4B3TF 2SXLA 4Y6IA 2WSEC 1L3TA 1KLMA 1MN9A 1XR6A 3PVXA 1M90T 3M2UA 2V2KA 1R27B 1SJRA 2D74B 2HVZA 2OGUA 2QC3A 3BYPA 4LR9A 1HBOB 3IM8A 5E5NA 4OHZA 4JI2J 4OIXA 4DL3A 3IR5B 4DUTA 1M5VC 3Q83A 4DN9A 4F67A 5E33A 1NKCA 4ELUA 2RQKA 4HLBA 4ZCKA 3DRRB 4HI1A 3M8SA 3PW4A 3NEKA 1U24A 2YXLA 5LXYA 4TQSA 3PO5A 1X5PA 2W8LA 2AYEA 2A2CA 5EWGA 4K4WA 4F50A 4WP9A 4DN0A 2C42A 4B3OA 2L9DA 2V4QA 2FLLA 3T3FA 1T95A 3EGNA 1RWMB 2ZOFA 1Q78A 4J91A 4WXOA 5CZXA 2YNFA 2BR0A 2KDOA 2KYZA 2WVBA 4ED4A 3PX4A 1S10A 2DHGA 3ZTOA 5JXSA 5KG6A 1WUUA 1RU1A 3HMJG 2FHJA 3NAIA 2YBVA 1JLGA 1S6PB 2HVDA 3CSKA 3QQCD 1OQ3A 3R5BA 3ZNJ1 1U6BA 4HTJA 2GNKA 3OHBA 2DR9A 1OQ6A 4IFVB 1R0BG 4DJBA 1S1XA 2JLEA 1ZPWX 1C0UA 2OPQB 2VPXB 2UXBJ 4E2FB 2VG7B 2NYIA 2CDQA 2YKAA 4IH6A 2GMHA 2UU9J 3O2IA 3PIPQ 2CFXA 4MIAA 1IBKJ 2Y0SD 1HMVA 4G6VB 2IRYA 1SV5B 4ZMMA 3AAWB 2HNDB 4MKYA 2B6AA 2RMLA 3DHWC 2AV5A 2MSSA 1SL2A 1S9GA 2I9SA 2W2MP 4B3MF 3QZ7A 3HHLD 2DNPA 2D41A 2EVZA 5EWFA 2AJ1A 3CMES 1LWEA 3DLGB 4WE1A 4IO9Q 4LUBA 3SSQA 2J0SD 4MTPA 4F02A 5J1NA 5IQ6A 5DDQC 4NLRA 3I4PA 3OL8A 2VZ9A 3M8QB 5HMXA 5ADZA 2DD8S 1PIEA 2W2PP 3FK4A 5AE2A 4LFBJ 4X4SA 3EUNA 5HSPA 3GPAA 3CDUA 3W8GA 3VTIA 2HHQA 3MMAB 1HIYA 5DZ7A 4Q7AA 4OLPA 2DT9A 3MAAB 3CCTA 2ZKUA 3OTEA 2W4CA 5B0FA 4KHRA 4F7VA 2J8SA 2XBPA 2Z2MA 2F3JA 1NPRA 3VHQA 5KFEA 4ECSA 3ITHA 3VF0B 2UXDF 1FJEB 4C0HA 4X64F 1RK8A 3GJSB 1GAOA 1RHKB 2W25A 4KB7A 4DU8A 3KUEA 2HSEB 1FEEA 4DG1B 3FSYA 2CIMA 2M2BA 3FBCA 2R7RA 1VC6A 2UUWA 2Z56B 2ZVSA 3NS5A 3OFGA 2IBOA 5GADU 5DLFA 3ZTSA 4PG7A 4B9UA 5HANA 2OEJA 2DNYA 5KFFA 1HBMB 2HAFA 4KC5A 5DDOC 2BQUA 4FS1A 3ZO7A 3UO0A 4DOZA 2CPFA 1RE1B 2GCFA 2VFTA 2RF2A 1U09A 4Z2XA 1NB2A 1VIXA 2BXJA 5HROA 1F2GA 1NXIA 2GVDA 4J9RA 3PR5B 2AGPA 2GHVC 1XBWA 2NXEA 4E0DA 3KMQA 2HEKA 2BJ3A 3P5TL 2KM8B 1TK0A 4H4MB 2B56A 4J9KA 2DXDA 4AE5A 4AXIA 4JI7J 1UFKA 2BYCA 1FERA 2HIQA 2CYYA 1CQNA 2UUTA 3N5BA 3T6BA 1J5EF 1KLNA 1FRKA 2WVDA 2XG8A 2RS2A 2KZZA 3EGVA 3F0NA 4FPIA 2OPPA 3LAMA 4J9MA 2F9DA 4ZVSB 4F2RA 2GAHC 3MUMP 1HNIB 2R8KA 4K59A 3CCJS 2J9DA 1FFGB 2EWHA 2IM0A 1KP6A 4ALZA 2CPDA 2WBRA 3SI8A 1WC4A 5D3GB 1QTMA 4N76A 1OMSA 3FZBA 2AW0A 2AJ2A 4TQRA 4PG5A 3MMBA 4UQTA 3KJVA 2QRRA 3WBZA 5GAHI 3TANA 1S77D 3EGZA 3TZXA 2RRBA 3DC2A 1UEUA 1XNRF 1M1GA 3MAAA 2BEFA 1Z4UA 3V5RA 3NG8A 1GH8A 5U47A 3VVTA 4LVNP 4Y2AA 3I55S 4C8LA 3LP1A 1OYEA 1HFEL 3OFHA 5KT7A 3GIMA 2DB1A 4QR2A 5KOWA 1XNQJ 3GJRB 3SCJE 4C9DA 1XK8A 3GONA 2AIRB 2V2ZA 1RCXB 2OO4A 3L95X 4KR0B 3UCGA 4PXDA 4CYUA 4YR3A 4CDIA 4Q2LA 4ZIVA 3DMJB 4YMEA 3A8EA 4ZPBA 1S1VB 2RDDA 2HQFA 4KKOA 1C4CA 2L08A 1PG5B 1RAAB 4A47A 3OR1A 4R25A 1ZZNA 4LFCF 1GTEA 4LRAA 4DX8H 1LFPA 4LFBF 2AJ0A 2W9BB 1R43A 2CNNB 1CULA 4ID8A 2VJVA 5CHCB 1EZZB 3KNAA 1FESA 3EXCX 3LH2S 5C7PA 3S7RA 2FJEB 2P8IA 2ROGA 5K5MA 1JJ4A 4MMOA 3RR8A 2ZJQQ 3O44A 4TKTA 2J6SA 1LQ9A 2ZUGA 5BYQA 1N6QA 4NEYA 2E1AA 1KLMB 4NLUA 2E9RX 3ADAC 2BUNA 1H2TZ 2F8EX 3LOUA 1U45A 2XS2A 2F7VA 3LALA 3M2UB 4I56A 4GVBA 4FXVA 2P6TA 4ED3A 4M5GA 4N8NA 2OP5A 1WD6A 2ZBCA 4ZP8A 2CG8A 3D0GE 1E6VB 1T03B 1RABB 4I2QA 2F5GA 1KVKA 4PUOA 2HFOA 3BEGB 2VFVA 4RBTA 4HDGA 3MECB 4ED6A 1VJQA 3I87A 1O5JA 4JI4J 3IG1A 4ZK7M 2H51B 2OTJS 1IN0A 3M05A 2LQJA 2XQCA 1B99A 4CH0S 1YTYA 2OUGA 3CIZA 2ZBQA 3T6JA 1VQ4S 2P6SA 1B4SA 4I7FB 4KGZB 4NYPA 1EKRA 3CCZA 4H4OA 5T41A 4LF8F 3TEGA 3W62A 3PDNA 4DPUA 2B0GA 3TVKA 3POTA 1KONA 4ZPCA 4XPEA 1PBUA 4YQWA 2J9DE 3M32A 5KFWA 2XMWA 2C3MA 3I96A 2U2FA 1MW7A 5ETLA 3Q2SC 1H7XA 2O67A 3Q8UA 5L1JA 1NHUA 2W01A 4FXDA 1BWEA 4ZLLA 2WSFC 4A48A 3OLBA 4WFZA 1P1LA 2H1YA 2WAQD 5ETTA 3G9CA 3RB6A 1D8ZA 5HMYA 2RIJA 3C16A 3GFYA 3DXBA 2V2QA 3BGLA 1AA1B 2MKYA 4A8XA 3PG9A 4CM0A 2OELA 1OSCA 4EYHB 1RA7A 4NLTA 1F5AA 4Y00A 4GKJF 4WZMA 3W2WB 1QE1B 2HQCA 5FJ4A 2O5DA 2LVWA 3H7HB 1YJUA 4UUXA 2VIHA 4ZCMA 4DV3J 1NJWA 4B3SJ 1WEYA 3AOCA 2COLA 1KTVA 3NOCA 2CPXA 4OZ0A 1Q5YA 4Q2MA 4DR5J 1VBZA 3K58A 4V19X 4NLPA 1SVDA 1VQKS 4ANDA 1N6QB 1T8EA 4CWBA 2DH7A 2D69A 2BMBA 1REVB 4OYIA 2ZH5A 1QSYA 4G1PA 1WSVA 3OW2R 4LMZA 4R0EA 2HNYA 1XC9A 1RU2A 1TQLA 3CJ3A 1N5VA 2KVQE 1JXEA 3D1HA 4O4RA 3BJYA 1VRQC 1WKLA 3PM9A 1LNQA 2V8DA 3P45B 4LVOP 5IM0B 5DRKA 3T9ZA 5KFVA 1GX5A 2QLJB 5IWAF 3VZIA 3HP6A 1NBEB 4A8QA 4O23A 5ETOA 3R27A 2XWXA 1YIJS 1U6FA 1T9WA 3VV2B 4A8MP 1ZETA 1DY3A 1JLCB 2J8AA 3SV3A 1SQFA 1LV5A 2E5JA 3QIDA 4X4RA 4UT4A 3BGUA 3FRZA 3UPFA 2AD9A 1UETA 3KDNA 2OTLS 1JNRB 1T7PA 2VONA 4KO0B 4H4KA 4Y2IA 1TVRB 2Y8WA 2XO7A 3V6KA 1GMWD 3BB5A 3QT5A 1RAIB 3RZAA 4U6PA 2KG0A 4E8UA 5LMUJ 4RJVA 1PKUA 2AP6A 4CM2A 3EVMA 4DV6F 1W7WA 3TVYA 1PJ5A 4B17A 4BS2A 1U7LA 2EW9A 2ZH2A 1VQ5S 2PE8A 2X1FA 3TAQA 3L9ZA 3OR1B 2ATCB 2MY8A 3M2RB 1HHQA 4FVCA 3SZ2A 2G2OA 1UAWA 5CYQB 1K0TA 3UWTA 4QW9A 4IR9A 1X4EA 3MM8A 1JLBA 4MFBA 5D78A 3US5A 1QVFR 3BBCA 2N4DA 3ENAA 4OYOA 1JLFB 1RA6A 3ZZRA 3QGIA 5C2GA 4KHMA 4J9LA 3WHIA 2RJZA 5A0YA 4CLLA 3MFIA 5A8RB 2VFUA 4WZQA 2RD5C 1RKIA 3BS9A 3PW2A 5DG7A 2BVZA 2F4VF 2LLZA 5CD4H 2UVUA 1Q8BA 3UE2A 1QE1A 3BN7A 1OY9A 1UZHA 2JLFA 1C0TB 3CJTA 4PCQA 1TV6B 1J27A 2HBQB 4I68A 5GVQA 1OY8A 4ZVRB 2VDHA 4AT1B 1EAYC 1HNIA 1NM2A 5HQ8A 5DQGA 2P9CA 4X62J 4JV5J 5F8NA 4PPZA 4RPFA 4B9SA 1U1NA 3HDSA 2CUYA 1GX6A 4LRFA 4IYQA 3BGOP 4RUAA 3RTVA 2OEMA 3BO4A 2DEJA 2XY5A 2QGFB 4U67Q 1ZM9A 2XCPA 3SIPB 3H2VE 1Q79A 4HACB 1LWXA 2VC1A 1UVJA 3LP2B 4MIWA 3QIPB 4PAAA 1U1KA 1PC4A 2HGLA 4NWBA 4OYXA 3PXGa 1NK7A 3DLHA 2YWWA 1VLOA 3K5PA 4LF4J 4IRDA 3CJRA 3QYYA 4DDFA 2FJXA 4I2PA 4UQGA 2A6MA 3NGDA 2DRAA 3RW6A 5D77A 1U47A 2DHXA 1IJFB 2GQCA 1A6LA 2PO4A 4YDXA 3CCES 2ATLA 3CD5A 1RTDB 5C5JA 3ZC4A 2DGVA 3DMJA 1FK9A 1WI6A 1E6YA 4P7TA 4KKOB 5ETSA 2EXUA 4F26A 2NS1B 1TK5A 1IM6A 4DR5F 1N5SA 5AT1B 2M7SA 1X4GA 2XCAA 3DLKB 2W9CA 1PBAA 1Y4ZB 1FTCA 4P52A 4WFXA 2W7PA 2FY1A 2ZZTA 4K4SA 3EWGA 2PEBA 3UDEA 4WFAQ 4MT1A 2FJWA 2ABYA 3MMJA 1TAUA 3MEEA 4URSA 1IKYB 1LWFA 2F40A 3QRPA 1PILA 1KHVA 2DNQA 1W2IA 1JLAB 3B6BA 1R6VA 4ZVFA 1VMBA 2LYVA 2KN4A 2QO3A 2R4FA 2OPSB 3NMAA 3OFEA 5IV4A 3NNHA 2ZD1B 3EPGA 2RSQA 2UZAA 4WKRA 3I5BA 4KPCA 1QTNB 4PWWA 1JB0C 2E7XA 5KOXA 2BE7D 5H1SV 2KT2A 4A4JA 5IM0A 3QATA 2N4CA 3KG1A 2XSFA 4R5PB 5BXIA 3R9LA 3U1NA 4RU2A 3H59A 2DITA 4LSLA 5KFSA 5J1PA 2QSWA 4DL2A 3UN3A 2KI2A 3G8SA 3AT1B 4NLYA 1YWXA 2XY7A 1D09B 4C3MA 4J5OA 1Y5LB 4MK9A 5HMWA 2G9OA 3R5DA 5HVFA 2MKSA 1FVQA 3ISZA 4CNZA 3BPSP 3VCDA 1T3OA 1P9YA 3X1LB 1AUSL 1HNVB 3OXGA 2OSRA 1HR0F 3Q23A 5A6WA 1UVNA 1U2FA 5E7OB 1FE0A 4P10A 3D68A 2B9WA 3M9OB 2VG5A 4UUWA 5KFYA 2EI5A 2QA2A 4RW7A 5D0GA 3BSCA 5E41A 2FZGB 3DDNA 4LR7A 4DFKA 2R7QA 3HM9A 2DH8A 3PRVA 2WTFA 1Z2LA 3Q8YA 3T1HF 1JLGB 4DS5A 2DK2A 1U49A 4ELTA 2UXCF 1IKWB 1GXUA 4LBIA 1SB6A 3HD2A 2J0WA 1KN6A 1SL1A 3DLKA 1JLFA 3VAKA 1SH0A 4RLEA 1WACA 2R42A 4ICLA 1XTZA 2YKQA 5DJBA 4E98A 2LEBA 2DPIA 3BGFA 3K17A 1FE4A 4DSJA 4ZCLA 1OPZA 3QWUA 4OLOA 2IMWP 3IM9A 2MZTA 2QLFB 4PXEA 1FD2A 4F3QA 1BE4A 2E1PA 5IZHA 1S9GB 4FS2A 2LQ5A 2ALYB 1HNWJ 2V69A 3O8WA 2B6AB 2JEFA 3F73A 4ZA1A 3R2CJ 4KHPF 1DQ8A 1MNEA 1GT8A 2BJ8A 2HQIA 3BO2A 4FF2A 3NGSA 4DXLA 1NKBA 2ZD1A 1HHTP 2IY5B 4Q44A 3M1VA 2QZ8A 3G6XA 1K44A 2O1PA 4WIIA 1A0OB 3HKZD 3MUVP 4NLSA 2JC0A 3IXQA 2X1BA 5KFNA 2ZHAA 3Q89A 1K73T 1S0VA 3MURP 1KVJA 2DHHA 5KFHA 2VBXA 1MSWD 3SQOP 3QLHA 2QL5B 5KT3A 4M5NA 4OJ3A 2H4WB 4HACA 4F3OA 1PAUB 2GHWA 2E29A 4FN5A 1V6HA 1JK9B 2EFNA 2CPIA 1CG2A 3CJ5A 2FIUA 3VALA 2K8GA 4D3GA 3ETMA 3V81A 2QL9B 1TVRA 3PFEA 1N32F 1H98A 3W9IA 3GCWP 1OJ4A 4C98A 1HNVA 4IKAA 1VDHA 1AZSB 1IQZA 1OO0B 2NREA 3D1OA 3IC1A 2X1AA 1T05B 4EEYA 3GFHA 1C1CA 2NXJA 5J2NA 2J0XA 4NZ0A 2BJDA 5KTQA 2IM3A 3FQKA 4LRBA 4DV2F 1VC0A 2DVIA 1AW0A 2C28A 4JI6J 2DYAA 2VH7A 2KT3A 4Y28C 5D4LA 2RQMA 2BJ9A 3IR7B 2R7WA 4OI1A 1DHMA 2ACYA 2VBZA 4F0KA 2MPUA 4DV0F 2GVDB 3GYNA 1HPZA 4PEOA 1ZM3A 1NRKA 4OL8A 4ANCA 2HS3A 1YBAA 3K5OA 2E5IA 3OSNA 4KH0B 3Q8VA 2X3DA 4H4MA 1X9SA 3EVWA 4CNYA 3ET6A 2QEXS 4IG0B 2OSQA 2BKPA 5DO2A 4M63A 2PD1A 2V4RA 2OIHA 2XLIA 2YWFA 2MZSA 1KVIA 4DPWA 5MAOA 2RUSA 4X4TA 2JNJA 2AGQA 2G1DA 1A7GE 3D1QA 3PJ9A 3HHDA 2IPOB 2LXUA 3GSIA 3TEHB 3P5BP 1G2EA 2LXIA 2XI3A 4ILLA 2HMIA 2GVZB 2JL9A 3JTOA 3QT8A 1YRUA 4I64A 1OIAA 1RTZA 2H5JB 1VQPS 5CABA 3CCRS 3G87A 4DL4A 4DV7F 1ZYQA 4OYBA 3FRYA 2FY8A 1U26A 1H3DA 2ZWOA 3I82A 3QIPA 2KH9A 3BO3A 4OQJA 5I3UA 1RZMA 1GFWB 2QV6A 2XYPB 2AYMA 2CQIA 1KQFB 3DI6A 4ZIWA 5CCMA 2AWZA 4IRKA 2HNZB 3HHEA 3LGHA 3NCQA 4MH8A 4RR5A 4WTYA 3U1LA 1K8AT 1VRUA 2A3JA 3N01A 4NLWA 5GAGI 4DFJA 3MZIA 3M30A 4Q8EA 2E7WA 2R2SA 2R9LA 2B5JB 2DNKA 2FLPA 4TLQA 1IKWA 4DWIA 4JI5J 3JSMB 1XIQA 1H73A 3H8YA 4K8RA 2N7CA 3KK1B 1VQ6S 2RVJA 1XMQJ 1S1VA 3MTJA 4ECXA 3WC0A 1S1WA 2CQ4A 1TL1B 1IBLJ 1U2CA 2B8QA 3KWMA 2RRAA 2A18A 3P96A 2AEJA 1WDTA 3DKDA 3N6MA 5T7LA 1PYTA 2ZUAA 3CC2S 4ED1A 1TK8A 3U7JA 2FD2A 4NZ7A 4RW9A 2FUG9 5F8LA 2HRYA 1V3SA 3M8PA 3GV8B 2E44A 5HL7Q 4TU7A 4OV1A 2I38A 2L48A 3NNCA 4ZPDA 1FEHA 1CJVB 1SQGA 2HG4A 1H6KX 4DLGA 3OL6A 2KZMA 2OI2A 4M8LA 1I1GA 2D3ZA 5T14A 1WHXA 2JWNA 3SV4A 1TTHB 2MHNA 4AL5A 3DDKA 3EDRB 3RRKA 1MMLA 1SJ3P 2AMCB 4J9SA 4XAKA 2IMOA 4M5KA 5A2QU 4PUOB 3KHRA 4LQ9A 1T03A 3CVKA 3UDLA 4DL0C 2I2YA 3LGNA 5JMNA 1FVSA 2GVZA 4B3SF 2CQDA 2B43A 1RHJB 3FCVA 1KFDA 3CO9A 5F9LA 4RO0A 3CW2C 3IG1B 2C2RA 2YKPA 3D0HE 4RWWA 2J7WA 5KG0A 3K8WA 4NLQA 1ZBTA 2DGQA 2MZQA 3L3CA 4HVZA 4HHHA 1IBLF 1NZ8A 3OV7A 4L72B 3V6DB 1QY7A 5ETKA 3WC2A 2XMTA 1NDKA 3OR2A 4AXJA 1WOSA 3DM2B 4NA1A 1C1CB 1G3OA 1YZ7A 3HHLB 4P75A 2OFGX 4C8OA 2EBEA 3OXFA 1BUXA 3VGSA 1FNMA 2AZ1A 2XZDB 4MKVA 4F4AA 2G4BA 1FDBA 3R1LA 3DOMA 1I51B 3C16B 1IBCB 3KK3B 2HBYB 2C3PA 3HVAA 3KNGA 1LXNA 2DIVA 3MI7X 1TL1A 2FYXA 3GLJA 1C0UB 4WP3A 2ZITA 2FJVA 3OBIA 3NKYA 3KOAA 1FX2A 2IM1A 2AEFA 2A6OA 2BDPA 4OYWA 5KFMA 2QIFA 1UPMB 4WK3A 2HVHA 3HVRA 1M5KC 5EGYA 1W2BR 1CJUA 1X5SA 4F4ZA 2W1BA 5H9EJ 2VF3A 3MAHA 5F0WA 2KXFA 4OFZA 3UR0A 3CCQS 1VBYA 2MGZA 1CJVA 4RW6B 3NGKA 1S49A 1WEXA 5GAHU 2IJNA 2DY9A 5D0EA 3A13A 1FRLA 3I0SA 2AJQA 1OY6A 2JEIA 3OTCA 3LUYA 4OHXA 1T9TA 4PWDB 1S97A 5F8GA 5C42B 1ZAWA 1ZM4A 4MAKA 4YDDB 2KFYA 4G1QA 2VICA 3AA9A 3PEJA 3SYZA 4M5DB 1QDUB 3LGMA 1S4EA 3UD3P 1D3WA 1UPPA 1X4AA 2V34A 3FBFA 2DNZA 1U02A 2K3KA 1WSRA 3R5GA 4QIWD 4U9RA 5HQMA 3TZYA 3JAMU 3PW0A 1I6JA 1DRZA 1R89A 3P8BB 1XWLA 2YQ3A 1J2VA 6AT1B 5JVGQ 4DR6F 4O4GA 5DLGA 3DI6B 2XNQA 1TZ0A 3KK2B 4V1Ak 1SKSA 2NSBA 1QJHA 3EZ5A 2E7VA 1R8BA 1SKWA 1UP1A 1MG7A 1Q8LA 4ECVA 5J2MA 4PABA 2EG1A 4M5MA 4FDFA 4ZLJA 3KKFA 5C25B 1BQMB 5I3PA 1T05A 1B70B 3DM2A 2V8PA 1RAHB 1IUJA 4C97A 3K5NA 3UD5A 2WW8A 4DV7J 4CLWA 3UCUP 4GO7X 2G0JA 2JSXA 3ISNC 3R5CA 4K5RA 4ETXA 3OTOJ 5FIIA 2UUBF 3L7PA 1JLBB 3HX9A 3GSDA 1K47A 4MFBB 1HBMA 2QMUB 2V5HG 2BE9B 2LEPA 2W4PA 2ZHOA 2HAIA 2GQ2A 4FNHA 1TKZB 4F25A 3VAGA 5J1EA 3NBPB 1SBRA 2Q79A 3SMZA 4DR4F 3W5YA 4HKQA 4ECQA 5ETNA 3JQJA 4WF9Q 2R3VA 4QIFA 4P71A 4DR1J 4K4TA 1D9DA 5JUMA 2Z2YB 4Q0BA 1NK0A 4QYZJ 3GFXA 3OTBA 5KFQA 4HYKA 3J80U 5THWA 3CEDA 4BHQA 4C2MA 2MGZB 2FJBB 2XSJA 3TO8A 2PMWA 4X65F 2GV1A 2XHWA 3J81j 1L3UA 3QSIA 1VQMS 4USIA 1S1UA 5LOQA 1YX2A 3DYAB 3KJNB 4EZ6A 2MTLA 1M0SA 1NMEB 2I8EA 2G2ZA 3ENWA 5C42A 1Q82T 5D3GA 5KFCA 2BJ1A 3OHAA 4ATNA 1PYSB 3D5MA 1RJJA 1GQEA 1KOHA 2WB1D 2X7IA 1RWWB 3CDEA 3JXOA 5KFGA 1R8CA 2J7KA 5D4NA 1FJCA 2Z8QA 4KFBA 3NXZA 2DGXA 2VOOA 2GIFA 3VAHA 2YWHA 1N34F 1RACB 2CRLA 4LSNA 1IWGA 1V3ZA 4F0HA 2L9NA 1UEVA 1WOPA 4XDDA 2L41A 1DTQB 4KBIA 1RTDA 4YR2A 4ECTA 1Z1ZA 3TP2A 3C6UA 1Y5IB 2KJWA 1YKWA 4KRWA 5KFLA 1OPIA 2O3DA 4RX6A 3M4XA 3OL7A 3M9MB 4PQUA 3RAMA 2G2YA 4YFUA 2W9CB 3IFEA 1WC3A 1UJ5A 4QCLA 1B0VA 1HHSA 2Y1LB 3KLGB 3H4DA 3JB9k 2WOMB 3D6HB 3KUGA 4YS2A 5EDWA 1EP4B 2WW4A 3P3DA 3AQPA 4RZRA 3KHLA 3V6JA 3C14A 3MEEB 5EX3A 1VBXA 4ID5A 4DR7J 3QNWB 4Y2MA 1JLAA 3QJJA 4YHHJ 3PCOB 1IKYA 1CJUB 1LWFB 1U6ZA 3ZZOA 5B0BA 4USVA 2CZVC 4OX9J 3DN9A 5AJ3F 1KDNA 1YK9A 3N4WA 2B4UA 1Q16B 2RDIA 3EJMA 1F9HA 3H2UB 3VQSA 5E3RA 2C2EA 2GFFA 2F1FA 4O44B 4JI3F 4JI8J 3M7VA 2VASA 2BOAA 3M8QA 1M5OC 4B9TA 2FVRA 4PWDA 2FGOA 1OYDA 3IGNA 1IR1A 3W3SA 4G1QB 4DHVA 2CNLB 3KLHA 1WKKA 2IYIA 3G96A 3KYLA 4J9QA 5DG9A 3RAQA 1WC1A 3B8HA 1S1UB 3MMAA 1E6VA 1IBMF 1DAXA 3DLBA 3I9ZA 1B0PA 4OHWA 2CQ3A 5GMKa 2PMHA 3HI9A 3T5HA 2GZOA 1LW0A 1U8SA 4OYMA 4WBFA 1JWWA 2UVRA 1QAXA 5B0GA 2ASLA 1ZZFA 2CQGA 5E3PA 4QPXA 3VWSA 3JSRA 1VQ8S 2QX0A 3RB3A 2KFZA 4ZVHA 5C24B 2PFFB 1RT3A 4QZVB 2YNIA 3W2VA 2M52A 3FBEA 5C25A 5CA5A 3R7NB 2DCLA 2J6TA 4J9UE 1YQHA 1UFLA 2XM3A 4AD6A 3D9BA 3C6UB 3IP0A 2DO4A 4C7QA 1S0MA 4LF2A 2NYHA 1FTRA 4DPOA 3DRSB 2MLZA 2CXEA 1NAQA 3KK3A 2ZC3A 1YDLA 3G71S 4F3MA 3KLGA 3VQTA 5ETVA 1FXLA 1RAOA 4MJKA 1FFWB 1P27B 2K1RB 2LQBA 2K06A 2POKA 3HFVA 4ZDNA 1S59A 2EFVA 3J81Y 4X64J 4LF5J 1Q1KA 2B7CB 4QWCA 4NI2B 2VJUA 5HP1B 1TUGB 4FBUA 4NLGA 4WXWA 1VC5A 1CJTB 2YH0A 1CJKB 4Z7CA 2WK4A 4QWDA 4Q0BB 5E2QA 3QRRA 4K4XA 1NK6A 1P6TA 3W2WA 3CJ8A 3MDFA 3O1LA 5CQGA 4ES3A 1G1XA 3NCPA 1F9FA 1UWBA 1CS4A 4NLXA 4CO5A 3C66A 2OPPB 3U1MA 2UXDJ 4DR4J 2KO1A 4U8YA 2MQMA 3QGGA 3I0SB 4FYXB 4TYBA 3ZXWA 4P2XA 2F8HA 4OHVA 1YJNS 2AYGA 1MU2A 3PJWA 3F56A 2R7OA 3KXDA 4P2SA 3IMQJ 3T1YJ 2UV8G 1WHVA 1Q7LB 2IDLA 3NAHA 4P9SA 4USTA 1S9EB 1RT2B 1SIWB 2F9JA 2GGPB 3KLHB 4DFPA 4B3MJ 3EDQB 1WC6A 1MROA 2UUAJ 1FRXA 6FD1A 2EFGA 5LJ3Y 4ITSA 4JP8A 1M1KT 3MOZA 4NPOA 3KK2A 4DL5A 1TP7A 2DIUA 3D6TB 1RWPB 2M9KA 3V81B 2CG4A 2JDJA 2MY7A 1WTFA 3V4IB 2Z0GA 4U8VA 4C6AA 3H40A 1SKUB 3OVAA 1IXKA 4LIWA 4QIGA 3THTA 4OX7A 2FVCA 3M2VA 4DZ6A 3QMQA 4CYUB 3KJQB 2RQCA 3CIMA 5J2NB 5K14A 2DRBA 1EIYB 1HKAA 4PG8A 5F41A 1TELA 3Q8SB 3L7UA 2M88A 1RGVA 3GTYX 1WJ9A 3ZZZA 1LW2B 3OT9A 3ZTRA 2P2CB 3DRPA 2DKOB 2OPRA 1EP4A 2QFIA 2PI4A 3DGVA 1VQ9S 3CMQA 1MMNA 1PC5A 3UQSA 1B0TA 1T9VA 2F8MA 2V50A 3SCLE 4RNOA 1BQXA 4RNNA 4M95A 2HHUA 4RWXA 4CLZA 4NE9C 1L3SA 3FFIB 1I94F 1SJ4P 1FRMA 4DMZA 1O8BA 3A3OB 4IQXA 1DURA 2CPZA 3GMGA 4DL6A 2ZC4A 1N5YB 4X4NA 1GEHA 4NLOA 1HPZB 2BKOA 4UW2A 4EUVA 1CJKA 1VOMA 2XZWA 5A8RA 5IS2A 1S6QB 5DGAA 3W63A 1KC8T 5H9FJ 4NCBA 1FRHA 3QFHA 4KH1B 3E01B 7FD1A 2LECA 1SPBP 3FVYA 2DR7A 3A3NB 3HFZB 3GG0A 2FJDB 3D0IE 2DO0A 4EU0A 2JLGA 4L73A 1VR6A 1UJ6A 2Q43A 5FDLB 2ERRA 5M2UA 2HVEA 2XC9A 1NEEA 1ELOA 2BZ2A 2ZHBA 2XMMA 4F4YA 1J5EJ 1F5CA 2FDNA 4N77A 1NZAA 3MM9B 4OX9F 9RUBA 2WHOA 5G4DA 3K59A 3OSPA 3NWRA 1Q81T 2MB0B 1R0AB 2KM8C 2LDIA 1NU4A 2ZEJA 2C2ZB 5MLCV 2GJIA 4LRDA 2EPIA 3LP2A 1SUQB 3IGVA 1WELA 1SXLA 4IH7A 4LJMA 1DTQA 3SEOA 2KXHA 3RB4A 2VODA 4C4WA 4ELVA 1WHYA 5EHHA 1VHFA 4JI6F 4DFMA 5ETQA 2DR5A 4FF4A 5IT0A 4NRTA 2EK1A 4KGVB 2HQDA 1I94J 2Y3YA 4J7CA 1TKXB 1UMJA 3RU0A 4AUKA 2VA2A 4I69A 4C8NA 1QM9A 1N34J 1XNRJ 2HGNA 3D2WA 1AB8A 4KTQA 2HZVA 3TJ9A 4Y3CA 2MZJA 3KTQA 3TX0A 3P6YC 1T0TV 4A8OA 4ZN1A 1LW2A 3D7SB 4ZOSA 1G7CB 3JTNA 3I0RA 4G3IA 4NXNJ 2XY6A 3DRPB 3C14B 1DQAA 1BWVA 2VG7A 3GJTB 5KAKA 1S1WB 1U2RA 4NCAA 2LDYA 2BBEA 4M5IA 4FYDA 4QWEA 2QA4S 1NNDA 3T5LA 1X31C 2HFVA 2VFRA 5IT4A 4ILRA 3PW7A 4JI3J 2DNLA 1Q4RA 2HIYA 4UY8T 4RW9B 3GQCA 4DQSA 4ES1A 4DSFA 3V2UC 4K4UA 1YJWS 3MM6B 2MZRA 5LM7E 1K1SA 1PAEX 2BA9A 3DLGA 2CA9A 3GJQB 5ETRA 3MF5A 1QD1A 1P8GA 5EX0A 1NSQA 3THPA 2MXYA 2PEHA 2HNYB 3DLLQ 3CDAA 3OLAA 4HL9A 3MEKA 2W9AA 3AODA 1S9EA 2GGPA 2YWKA 4L76A 3TW0A 3KLVA 2IVMA 4AFFA 3VGVA 1YJVA 3OUYB 1N8RT 4PZVA 2AQ4A 2M8DB 1GTHA 4ZPVR 3LANA 4JV0A 4DQQA 3MM9A 4F4WA 3SCIE 1RAEB 1XMBA 3BYRA 3QFWA 1JLCA 3D3CJ 5SUHA 4IR1A 4DEZA 2X51A 2QYCA 2CDRB 2JFDA 4NCGA 1TFWA 1TFYA 3D6FB 1URRA 3T9NA 5EUHA 4L75A 1JX4A 4HR2A 2XI2A 1RT3B 1KSPA 1FJGF 5D15A 2APOA 3M2VB 3OR2B 5AE3A 1NPKA 5K9FA 2ZH4A 5LMNJ 3BR9A 4I6AA 1ITPA 2Z4PA 3MPWA 1RHRB 3CCVS 4A8KA 3BBFA 1UKUA 1HWJA 2LP4A 1UVKA 5D4OA 1VIOA 2DH9A 3C2PA 3E2EA 4UOCA 1FDNA 1YLXA 2DY1A 2GW8A 2KYXA 2XO6A 4DV5J 2NQPA 3W65A 5LMNF 4OI3A 4RW7B 3DOMB 1XNQF 3MM5B 3MOJB 2IC3A 2QMWA 3N79A 3BF4A 3NLCA 4O3NA 2RF2B 4TLRA 1TMJA 1FWKA 2BOPA 4U7UD 1U48A 1NKEA 4WFYA 2J9CA 3I4HX 5KG4A 2R7UA 1FI4A 1H7WA 1P1TA 3RJMB 4CLTA 3L7OA 3WX4A 1Q86T 1WWHA 1P9QC 3R97A 1CC8A 1C1BA 1FRJA 1S6QA 3QSYB 3CC7S 3Q86A 3R5AA 4O3QA 2FHKA 2M70A 4Z7YA 1Z2ZA 2MYFA 3GB0A 3T1YF 4J9OA 5KG7A 2EEYA 2BM1A 1IBMJ 2LU1A 2ZH6A 2AHOB 3DCAA 3A8IA 3IAS9 5FDLA 1SI9A 2VG6A 3O6QA 2XZTB 4NOHA 5AE1A 2VU5A 5AXNA 2JZ5A 3NGRA 5F3ZA 4UZCA 2VKZG 1RUSA 3M1VB 4CI0B 5H9FK 2MKHA 4OX8A 1NJXA 2B4OA 2V8HA 4LT6A 3CT9A 2YQ1A 3Q22A 3TUPA 3PRDA 2A0FB 5C2CA 2V9KA 2QG9B 5KFOA 1GMWA 3OUYA 1DQ9A 5E3CA 3GP9A 3UVJA 5A2QY 2JHEA 4DX5A 3PKMA 3O5TB 2LQ8A 3TNVA 3MM7A 2M3DA 1QSSA 3TARA 3MAQA 3KUHA 3EMTA 4C8YA 4P2FA 1JQGA 2FPHX 3OVSA 2YTCA 1FO1A 4LFAF 4AQYJ 1N33F 4OJ1A 4QU7A 4ZVUB 1NK5A 2RE1A 1RWKB 4UY85 1G4CA 3PRBA 2HQGA 5KFXA 2ZFHA 4NYZA 5HATA 1N48A 2ZH1A 5GADI 3HSJA 2AJ4A 2FJAB 2O01C 5EWEA 1BLUA 4RUBA 3MCOA 4USWA 5FLXY 1HA1A 3MM5A 3UW1A 3T41A 4P72A 3BQ1A 2EK6A 4KIAA 2R8GA 4B3TJ 2HFSA 2PIIA 5J1EB 4MK8A 4DSIA 3J7ZT 3UN2A 3DU5A 4CO4A 1RCOB 5E3AA 5IC6B 1UL3A 5DM7Q 3FMBA 2J0QD 2XNRA 3VR1A 1RT4B 3VVUA 4AYBD 5I3QA 2YNGA 2QSFA 5HJXA 4WTOB 2C2OB 2LEAA 4LF7F 4WCEQ 4YEAA 5KT5A 3TR5A 1XMOJ 2IVFB 2OEKA 2D1CA 2XMJA 3TUZC 3BBBA 5K8MA 4K2JA 3X3UA 1H72C 1VBKA 2N3OA 3M8ZA 2HRTA 3J7YU 1HWUA 4DV3F 1DTTB 1ZA2B 2V8GA 4NZ6A 4OZ5A 5HVHA 2BM0A 1PCAA 3HZEA 2OD6A 3FSXA 4FF3A 1N33J 3ZZPA 2HHTA 4K0KF 4C11B 1EARA 1HNZJ 4IG3A 2R8JA 2YWEA 3HKWA 2KVIA 3JQKA 3CO0P 4IH5A 1OS5A 3QAEA 3RR7A 3TVZA 2NXNA 5HK4A 4N56A 2GS8A 3BDEA 4LF6J 4TY9A 5IWAJ 3TYTA 3JAMY 2RU9A 4LSNB 1KEKA 1T11A 5B08A 4FKXA 1TKXA 3LAKA 5AXKA 3QBCA 3SSSA 2CWKA 1X4FA 2IJRA 2ZNYA 3ENQA 1NO8A 3GILA 2BRKA 1CQMA 2Y1RI 3PACA 1NJIT 2ACMA 3RG6A 3RGIA 4X4OA 4GKKJ 3M8YA 2IC3B 4DL7A 2VDIA 3JYTB 3AB2B 4JB8B 4D3HA 4DV6J 4W90B 2XGQA 1IKXA 2F4FA 3FJ2A 3JSMA 1WF1A 1RT1A 4R0JA 5J2QB 4RL1A 3UD4P 3IN5A 2C2KB 4LFAJ 5G0RB 3CJ4A 5L9XA 4N7TA 2AYBA 3K5LA 1HBUB 2P9GA 4X65J 4ID5B 3HFKA 3OD2A 4GC6A 1V9OA 2J9EA 3T19A 2BANA 3KHHA 1RT4A 2HURA 3CD0A 4DUYJ 1HWKA 3ONQA 4WPAA 5DG8A 4FXWA 1SJFA 3MR2A 2QLWA 3MWBA 4F36A 1M5PC 4JI1J 1D9FA 3R7SB 3BR8A 4ZVQB 3IBCB 3NWGA 3PZPA 3CJSA 3B4MA 4DUYF 2MHEA 1N88A 2JOQA 2YX1A 4CQ1A 2UXBF 1WHWA 2VKRA 2R8IA 1CBKA 4X2BA 4C0OC 4IDKB 5CYJA 3BSAA 4NLDA 1Y11A 2V63A 3RAXA 4W92B 1VFJA 1MMDA 2EFPA 4NYOA 3H25A 3CC4S 1GNKA 5CAAA 1FJGJ 2MQNA 3UCZP 1NH7A 1EQ0A 4MYTA 1HW9A 1U0HA 4P2MA 3TAPA 3PJXA 4IG3B 2Y1IA 1URNA 3PKYA 2UVWA 4TU8A 3R7BB 3A12A 2IM2A 4USMA 2ZBPA 3G6YA 5HLFB 4GKKF 4BDPA 4B3OB 5ETMA 3ZTPA 3W64A 2ZOMA 4DU7A 2V2VA 1K1QA 2CQCA 2XLKA 3M6WA 5IOLA 2HFUA 2V94A 2YKOA 2W24A 1KQSR 1C2PA 4ED7A 2B9YA 3PFOA 1M5HA 1WC5A 3SDEA 3TA1A 5I42B 4Q43A 3V6DA 1ZTWA 1SL0A 4CRJA 2LU2A 5GAEU 2CKWA 2ILZA 1VQ7S 1X5TA 3EE3A 2HFNA 2VV5A 3M2RA 1JJ2R 5F8HA 2E5LJ 2PT0A 1NB7A 1PYOB 3MR6A 3UR3C 1RWOB 4K5SA 3B54A 3R5JB 3DRSA 4CO2A 1RLCL 2K1RA 5B0AA 3Q8QB 4GMKA 1UW4A 4WWSA 1EHWA 2QA4G 4DUZJ 1RTIB 2K7JA 5RUBA 2HYIB 4XTTA 5A0YB 4A8SA 2JVOA 1N4LA 1V3RA 2CNOB 2EBGA 4ZJLA 2QLBB 3BREA 3GFZA 4FVMA 4HHUA 4QR1A 4B02A 3PR4A 4M94A 4BBYA 1X0FA 1S6OA 3H20A 4DSLA 3LTOA 2QN6B 5M2PA 3M9NB 4EBCA 4K0KJ 4ECUA 1CS4B 1SV5A 1X4HA 2RRNA 2ASDA 4JI2F 2K2PA 2CPJA 2BX6A 1YG0A 2VFSA 3MD1A 1U8WA 3G6ES 4LF1A 4NEZA 3CCSS 1S7HA 1S5ZA 3H4BA 2UU9F 3LWMA 3CWJA 3G8QA 1VQSA 4RW6A 3O3LA 4L3NA 5E3QA 4WFBQ 4FBTA 5L1IA 5AXLA 5DM6Q 2PI5A 2BACA 2IDEA 1MU2B 1OWXA 2DHAA 3MPVA 1WF2A 2E1RA 1RDRA 1XMOF 2WVCA 4IDKA 5CZVA 4C11A 4L74A 3Q24A 4C8MA 4V19J 1TL3A 4RW4B 4AL7A 2F4VJ 4HHJA 1BY9A 4UOGA 2ALZA 4QBUA 5A76A 1TL5A 4M5JA 3SFGA 1JIHA 1FKOA 1WDDA 1U0HB 3EICA 4HDHA 5B0EA 3C6TB 3MCNA 5L46A 2LFVA 3K8VA 2ROPA 2DGUA 2H3EB 2MMYA 4DUZF 2G1HA 2XYHB 5HAOA 2B51A 4DX6A 1ACMB 4EO6A 1APSA 2FHMA 4NMXA 1MWYA 3FKBA 5B7WA 3EX7B 2HQ3A 1HNZF 1KR4A 1EB0A 2AJFE 3S01A 1Q8KA 4KPYA 3CD6S 4DG1A 1FDAA 2ADCA 4ZCIA 4EK2A 2C2MB 3C8YA 3D54A 1LK7A 5I42A 3WIUA 3J7A1 1L3KA 2JH3A 2ZBRA 2EKNA 4J9VA 1H74A 4L6V3 3CJKB 3N9UC 3NCRA 1SC4B 2H4YB 3BH6B 3GIRA 4YB5A 3MMCA 3ZZYA 2OPRB 5G0RA 3R3TA 3HK2A 3DRXA 1JXVA 2QLXA 2QMXA 5T7LB 2CADA 1HBUA 4L3KA 3M6UA 4PKDB 5HROB 1LFWA 4JV2A 1TL7A 1A9NB 1Y00A 1AT1B 1TAQA 4KE5A 4CH1A 2HWIA 2IRXA 5FD1A 4QQBA 3VAIA 1V5IB 4F0MA 1NDCA 1FCAA 3IBWA 2D3UA 1S79A 1JKHB 3BZQA 1ZAXA 2XGPA 1HI0P 1RAGB 3E01A 1NCLA 7FDRA 3MEDA 4OX6A 2XSJB 2YX7A 3GR0A 3GWCA 3BSNA 4CTAB 3LP0B 2ROEA 3AHPA 4C0BA 4DPYA 1JXLA 1XJWB 4NRUA 2ZKTA 3MPYA 3HT3A 2RDJA 1RYRA 4TY8A 2BJ7A 4CO3A 3H98A 3QRQA 2DCUB 4OHYA 1N5TA 3GG1A 2BRLA 2YKMA 2GC8A 4OI4A 1B3TA 4MIBA 1RSCA 2E5HA 2Q66A 5HLFA 4FF1A 2LA4A 5HO4A 2V0NA 3G2XA 1TUWA 4DLEA 2J6UA 2KXNB 1DBDA 1WKJA 2A10A 2QA1A 1FXDA 3AQOA 3KLIA 4J9NA 1HI8A 3BSOA 4QYRA 2F65A 3IS9B 4DV2J 1FRIA 1U25A 2XEXA 1S99A 4H54A 2I0XA 4DR6J 5BYRA 1NHVA 1TKTA 2B3TB 2JC1A 2WB4A 3EVOA 3IRXB 4NA3A 3K57A 1BC6A 4TN2A 4ZVTB 1SH2A 1EKSA 3D66A 2CPEA 4O3PA 2YPZA 4EO8A 4CIOA 1RYSA 4KT0C 4ZHRA 4FYYB 2FC8A 2HS4A 1UA0A 1X5OA 1RBLA 3IWLA 3PHTA 1TR0A 3SFUA 3G6VA 1B7FA 1RISA 1TU0B 3BGRB 2JVRA 2BJEA 2RS8A 3FEXB 4DR3J 3V4MA 2AT1B 1FDDA 5KFRA 3WIVA 3W9HA 2YKNB 5KT6A 3HHKA 2FLNA 1ZPVA 2JX2A 3IBFB 1YJ7A 1H2UX 3C19A 4RBUA 2O66A 3AD7C 2G0CA 4LBHA 4NLVA 3W60A 2KG1A 2FB0A 4F2SA 4RUHA 1AFIA 1T3NA 2PN6A 3E51A 2OD4A 2M5YA 1RT6A 2DNMA 4DV1J 3HSZA 4WU2A 3KG0A 4DQRA 1UWAA 1F60B 1R8AA 3PYEA 4O44A 2RH3A 3MEDB 3Q8PB 2KT5A 3WX8A 4GVBB 4RKUC 4JV1A 1CPZA 1F3FA 4YR0A 4M5DA 4USUA 4B9NA 4WP8A 1IQTA 3FCHA 2C2NA 2DBBA 3LP0A 3KLFA 3QO9B 2N82B 2Y1JA 2LKZA 2AZ3A 1RQ0A 1Q0NA 2Q6BA 4UTGA 2NXUA 2L9WA 4I0WA 4K2XA 5A8KB 2QJ3A 2KB2A 2PSZA 3C6TA 2HHPA 3NS6A 5KFBA 2BW7A 4WKYA 3J80Y 2KJVA 3FMWA 3HXMA 2YPYA 1UVIA 5LXRA 4K4ZA 4NCGB 1XEZA 1F9EB 2H65B 3DLEA 1N52B 3IO1A 4HI2A 4KGMA 4QIVA 4DBQA 3CTRA 4I7FA 1AZSA 4JUZA 4ETZA 4R8UB 5F9NA 5F8IA 5DGBA 4JI4F 3K7RA 1BQMA 3LPEA 4LFCJ 2HS0A 1RB0A 3DHXA 2YNIB 4OYAA 3KG4A 5KFKA 2B8PA 4KV8A 3DGPB 2H5EA 4JBCA
chains in the Genus database with same CATH topology
2CJXB 2H5IB 4JB8B 4ZVOB 2XZDB 2Y1LB 2P2CB 3R6LB 2DKOB 1I51B 1SC4B 2H4YB 3D6HB 1IBCB 1RE1B 2HBYB 2C2KB 2H54B 3RJMB 2CNKB 3R6GB 3QNWB 1RHQB 1RHMB 1BMQB 3KJFB 4DCJB 3R7SB 2HBRB 4ZVQB 3IBCB 2XZTB 1QTNB 4ZVSB 3D6MB 2CNLB 1QDUB 1RWVB 3P45B 2QLJB 2H5JB 2FQQB 2C1EB 2C2ZB 3R7BB 1GFWB 2XYPB 1RWMB 1RWNB 4ZVUB 1RWKB 3GJRB 4DCPB 3R7NB 4ZVTB 1PYOB 1RWOB 2H48B 3R5JB 3GJTB 2CNNB 5IC4B 2CJYB 2CNOB 5IC6B 2QLBB 4LSZB 2QLFB 1RWXB 2C2OB 3IBFB 2XYGB 2QL7B 3GJQB 2HBQB 3P4UB 1RHUB 4ZVRB 2HBZB 3EDRB 3NS7B 1ICEB 3KJNB 5K20B 1NMEB 3EDQB 2QL5B 1SC3B 2H4WB 2H51B 1PAUB 1RHJB 1RWWB 1SC1B 3SIPB 1I3OB 2CDRB 1RWPB 3D6FB 2H65B 1F9EB 2QL9B 4ZVPB 3GJSB 1RHKB 2XYHB 4DCOB 1RHRB 2Y0BB 3KJQB 2C2MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CJX B;  2H5I B;  4JB8 B;  4ZVO B;  2XZD B;  2Y1L B;  2P2C B;  3R6L B;  2DKO B;  1I51 B;  1SC4 B;  2H4Y B;  3D6H B;  1IBC B;  1RE1 B;  2HBY B;  2C2K B;  2H54 B;  3RJM B;  2CNK B;  3R6G B;  3QNW B;  1RHQ B;  1RHM B;  1BMQ B;  3KJF B;  4DCJ B;  3R7S B;  2HBR B;  4ZVQ B;  3IBC B;  2XZT B;  1QTN B;  4ZVS B;  3D6M B;  2CNL B;  1QDU B;  1RWV B;  3P45 B;  2QLJ B;  2H5J B;  2FQQ B;  2C1E B;  2C2Z B;  3R7B B;  1GFW B;  2XYP B;  1RWM B;  1RWN B;  4ZVU B;  1RWK B;  3GJR B;  4DCP B;  3R7N B;  4ZVT B;  1PYO B;  1RWO B;  2H48 B;  3R5J B;  3GJT B;  2CNN B;  5IC4 B;  2CJY B;  2CNO B;  5IC6 B;  2QLB B;  4LSZ B;  2QLF B;  1RWX B;  2C2O B;  3IBF B;  2XYG B;  2QL7 B;  3GJQ B;  2HBQ B;  3P4U B;  1RHU B;  4ZVR B;  2HBZ B;  3EDR B;  3NS7 B;  1ICE B;  3KJN B;  5K20 B;  1NME B;  3EDQ B;  2QL5 B;  1SC3 B;  2H4W B;  2H51 B;  1PAU B;  1RHJ B;  1RWW B;  1SC1 B;  3SIP B;  1I3O B;  2CDR B;  1RWP B;  3D6F B;  2H65 B;  1F9E B;  2QL9 B;  4ZVP B;  3GJS B;  1RHK B;  2XYH B;  4DCO B;  1RHR B;  2Y0B B;  3KJQ B;  2C2M B; 
#chains in the Genus database with same CATH topology
 1W25 A;  2BW2 A;  3CJK A;  4EGL A;  1WF0 A;  1BGX T;  1H2V Z;  3GIJ A;  1H0H B;  1X4C A;  1VCT A;  3TAM A;  2HLT A;  4QR0 A;  2HLU A;  4CO0 A;  1TKZ A;  2NZC A;  2ILY A;  2R7V A;  2ZJR Q;  2M0G B;  2DR8 A;  1Y0H A;  2OJ3 A;  1FFS B;  3R1H A;  4DV1 F;  3PV8 A;  2E5G A;  3I9V 9;  2AU0 A;  1JLQ A;  2WVF A;  5KFI A;  5HP1 A;  4JV5 F;  5H9E K;  2VQE F;  2LQ9 A;  5CH7 B;  1WG4 A;  1YGY A;  2WON B;  1FNO A;  3QPI A;  2OML A;  2HZC A;  3K0J A;  3KJF B;  1IM4 A;  1WC0 A;  2WVE A;  4KGK A;  4WFN Q;  1KD1 T;  2FLO A;  4UZB A;  2W8K A;  3G82 A;  4RW8 B;  4ER8 A;  1HLW A;  3IWN C;  4K4V A;  3MEG B;  3AY0 A;  2VG6 B;  5B0C A;  4B9V A;  4WE1 B;  2MJU A;  1VQN S;  1KRP A;  4GKJ J;  1REV A;  4KSE B;  3DYA A;  4B3R J;  2VBW A;  1UFW A;  2CJQ A;  2OLW A;  1Y3K A;  2IJF A;  4O3O A;  4X4U A;  1NJY A;  5ETP A;  1S76 D;  1RWV B;  4RW4 A;  1RBA A;  1RT2 A;  2YKM B;  2DNR A;  1EET B;  5AXM A;  3D4J A;  1FKO B;  3NMR A;  4F04 B;  5F8M A;  3JTP A;  1DAR A;  1HWI A;  1QAY A;  2WZ1 A;  5CYM B;  3W5X A;  4N5S A;  2Y9H A;  1DZ5 A;  2CQP A;  1U1P A;  1QUV A;  1IKV A;  3C3L A;  1GMU A;  3IA0 A;  5F3T A;  4ZN3 A;  5LJ5 Y;  2ZH8 A;  3KLI B;  3QGP A;  1U4B A;  1MWZ A;  4IO1 A;  3D67 A;  5D0H A;  5DDP C;  2Z58 B;  3CJQ A;  1RWN B;  3J7A N;  1PSD A;  2M8H A;  2VPW B;  4U7C A;  2V68 A;  5BR8 F;  2ZM6 J;  1S57 A;  1VRU B;  2LMI A;  2BE2 A;  4YB6 A;  3H5X A;  2IIH A;  4DS4 A;  1R8P A;  4Y65 A;  1WOR A;  3W66 A;  2MQQ A;  1L3V A;  2AF6 A;  1YBU A;  3D3B J;  1RT5 B;  2G0I A;  3B4D A;  5K14 B;  4C3K A;  2IA6 A;  4ED5 A;  3S6E A;  3NNA A;  1BQN B;  4QPT A;  1R0C B;  4FYV B;  3TWZ A;  1LWC B;  2KKH A;  2UP1 A;  2E1C A;  5J2M B;  4Q45 A;  3BGR A;  3MPU B;  1D8Y A;  2DNO A;  2WRM A;  3MM8 B;  4HT5 A;  4ANE A;  2NUH A;  5KG3 A;  4ZJQ A;  2YNG B;  3ILO A;  3J7Y I;  1S48 A;  2WCX A;  2P5V A;  5IV3 A;  1FD8 A;  3H42 A;  4J9P A;  3OPK A;  2CAJ A;  1N5Y A;  4FPR A;  1B64 A;  3DNC A;  4DPX A;  4Y34 A;  2IAJ B;  5L1K A;  4OZL A;  4X66 F;  2VD3 A;  1PJ7 A;  1XQI A;  1C0T A;  3HPO A;  5J2P A;  4HTI A;  4C8K A;  4IQM A;  2YVS A;  5HMZ A;  1DTT A;  2VC0 A;  4DV0 J;  2C3O A;  3RBX A;  4CTA A;  1HD0 A;  2XTJ P;  4Z37 A;  3CCM S;  3IRW P;  3A1Y G;  2VOP A;  1BD6 A;  2IFX A;  3TRG A;  1YJT A;  1RAF B;  2Z30 B;  2QYG A;  1SJ1 A;  3ELH A;  4KY3 A;  4KQZ A;  1HYS B;  3CCU S;  2ZBI A;  3THV A;  4OZ1 A;  2ZVI A;  1KTQ A;  2Z2L A;  1S4F A;  3B78 A;  2PMZ D;  1ZS6 A;  2CQ2 A;  2IA0 A;  2A2D A;  2QTW A;  4QOT A;  4CLS A;  2YNH B;  1VQY A;  2CZ9 A;  3SXL A;  1JJH A;  5CYM A;  4CT8 A;  1UVL A;  1HQ2 A;  5ITH A;  1N54 B;  2JFK A;  1FWL A;  3NY0 A;  5C24 A;  1S6U A;  4R8U A;  2MKK A;  2LCW A;  2X1G A;  4EFA C;  5CD4 A;  1MN7 A;  2W7O A;  5A6P A;  1RWU A;  3LP1 B;  1VRT B;  2Z2Z A;  4KV8 B;  1NSP A;  2NXC A;  4XIU A;  2RIL A;  1GXL A;  1REG X;  2ADB A;  3HHL A;  4YOE A;  2NPI A;  1CEZ A;  2CQ1 A;  1S6P A;  5GAG U;  3MR3 A;  2F63 A;  4ZLP A;  1UTA A;  1HNX F;  1CC7 A;  1HAR A;  3FBB A;  1ZA1 B;  5KG2 A;  1RI7 A;  1FJ7 A;  5DET A;  3UDC A;  1IKX B;  3H5S A;  3H5Y A;  1RT5 A;  4QYZ K;  1S1X B;  1UZD A;  4ZPT R;  2VUG A;  2HHH F;  1XR5 A;  2PA3 A;  3JYT A;  3PO4 A;  4LF4 F;  3TA2 A;  2DJW A;  4LBP A;  2V4J A;  4HT7 A;  2DEI A;  1LWC A;  1X8D A;  1Y9O A;  2H54 B;  4NI2 A;  4XDC A;  2LXF A;  3N6N A;  1CJT A;  1JLQ B;  2IRU A;  3I31 A;  3R6G B;  3QT6 A;  3VAM A;  1K0V A;  2HND A;  4YB7 A;  2CJB A;  2WON A;  4NXM F;  3MXH P;  3K2Y A;  3EM1 A;  3GYG A;  3HSG A;  4PYA A;  4U7U K;  2PFD A;  4G1I A;  3ZZT A;  2BAN B;  2DGW A;  4RW8 A;  2I5J A;  4MKA A;  5IQQ A;  3OJS A;  1YHQ S;  1RAJ A;  4KYZ A;  4WYL A;  2CJK A;  4IRC A;  5LSO A;  2DTJ A;  3MEG A;  1IWA A;  3PW5 A;  4PRF A;  1TMM A;  2CJ9 A;  5F0U A;  3OJU A;  2VA3 A;  3IR6 B;  2CQB A;  3CD7 A;  8AT1 B;  1R8H A;  2NSC A;  3FEZ A;  4MKB A;  3A8K A;  1SKR A;  3HSD A;  2DIS A;  4G65 A;  1F6T A;  1T94 A;  3PIO Q;  3FC9 A;  2FVP A;  1VS3 A;  4O3S A;  2RHS B;  4R5P A;  4JI8 F;  1LK5 A;  1T02 A;  2GA7 A;  3AD8 C;  1B7Y B;  5LL6 d;  1S1T A;  3MR5 A;  2V6A A;  4WYW A;  4O4G B;  2BQR A;  1FNX H;  3RBE A;  2IHR 1;  4O0N A;  5E0O A;  2HHW A;  5GAE I;  3AJ1 A;  3DLE B;  2GO9 A;  2KHC A;  1C4A A;  3M6V A;  4C8Z A;  2V9W A;  4I67 A;  1SH3 A;  4K7Q A;  3TJA A;  2BE2 B;  1HQE B;  2MST A;  4H4O B;  2HHH J;  4IFY A;  1RTJ B;  3PNI A;  2ZJP Q;  3DXS X;  2EG2 A;  1NSA A;  4LIR A;  1XMQ F;  2GAG C;  3GR1 A;  1FX4 A;  4HEA 9;  3HHL C;  1WNE A;  4CH7 A;  5HBM B;  2VG5 B;  6FDR A;  4YP3 A;  1HBN B;  4OZ2 A;  1IVZ A;  1FA0 A;  1EX8 A;  3NGU A;  4OZN A;  3AFG A;  3IAM 9;  3I5A A;  1NK4 A;  2H48 B;  3N28 A;  3VGT A;  3UNG C;  5JVH Q;  2KRB A;  1UEK A;  2RUG A;  2DGT A;  1HL6 A;  1RTI A;  3W61 A;  1WG5 A;  1Y10 A;  4BWM A;  3W9J A;  4KJI A;  1KNZ A;  5L1L A;  1JLE A;  3W7B A;  2XLJ A;  2GMJ A;  1N0V C;  1PGZ A;  4DQI A;  2XMA A;  2UV8 A;  1C1B B;  4DF8 A;  3FZ2 A;  4MYU A;  4Q8F A;  2IAJ A;  2HHS A;  2L3M A;  2CVI A;  1IR2 A;  1N36 F;  2OFH X;  1ZH5 A;  4A8W A;  1RHU B;  1CSJ A;  3Q8R B;  2XMU A;  2VQE J;  3RRG A;  8ATC B;  2I6W A;  2VPZ B;  4NAS A;  2MKI A;  3NS7 B;  2GJF A;  1FXR A;  3BQ2 A;  1N36 J;  4IOA Q;  1QSL A;  3C15 B;  3RB0 A;  1EET A;  1F3V A;  3J81 U;  4TU9 A;  3PYD A;  4AL6 A;  1SC3 B;  2JEJ A;  3PYF A;  1N0U A;  2DPJ A;  3HJV A;  3QLH B;  2Q1L A;  4A8F A;  4K50 A;  4KFB B;  4X66 J;  2EFQ A;  2W7A A;  4ZVG A;  2AKW B;  3EXY A;  3U02 A;  5B0D A;  5K8N A;  1UW9 A;  5DS7 A;  3FQL A;  3MM7 B;  3Q0A A;  2E5L F;  2DGO A;  2HRU A;  3DDI A;  4QWA A;  3I5C A;  4IOC Q;  1VRT A;  2EKY A;  2RAQ A;  4TNO A;  2XB2 D;  3ULH A;  3G8T A;  1AUD A;  1RAD B;  2GML A;  3HVW A;  4IFY B;  4WK1 A;  3WDO A;  2FVS A;  2VHG A;  2HHV A;  3R8Y A;  2HW3 A;  1FHT A;  1LOU A;  1RXO B;  3PY8 A;  1X9W A;  3JSY A;  2DNH A;  1N32 J;  2WOM A;  3TUI C;  3QWP A;  2B7B B;  1MWQ A;  3MMC B;  2CPY A;  2W9B A;  3I56 S;  1YIT S;  2B9X A;  3F41 A;  1VQO S;  3G86 A;  3NP5 A;  3CF5 Q;  2E1M C;  4ENO A;  1H38 A;  4ZPA A;  2D3O 1;  3UFC X;  2DRD A;  4OZ3 A;  2CNK B;  2HK3 A;  3JS9 A;  3CXC R;  3BM7 A;  4OI0 A;  1HQU A;  3LW5 C;  2ZZM A;  3ZNU A;  4QU6 A;  3PX0 A;  3SQG A;  4Q5V A;  3OTD A;  1XER A;  3HVT A;  1RHM B;  2I5J B;  1BMQ B;  5IFM A;  3BPD A;  5B09 A;  2X3G A;  3H2L A;  4BC7 A;  5KFP A;  3EZO A;  4OZJ A;  5LSR A;  2R7S A;  1JKH A;  4DCJ B;  4DV4 F;  4IG0 A;  2HBR B;  1RTH A;  2K7K A;  2OHD A;  2QE5 A;  3ILJ A;  5KFA A;  4CLP A;  4I4B A;  3GII A;  3PX6 A;  4FYW B;  2DXF A;  3AOA A;  3OFF A;  1NPP A;  4LR8 A;  5K8O A;  4ES2 A;  4XO0 A;  4DR3 F;  1HNW F;  2CJA A;  3VZH A;  2KFN A;  2KTQ A;  1WG1 A;  3WZ0 A;  2YH1 A;  3MEC A;  1CLF A;  1M1H A;  3C15 A;  4PPD A;  5IXU A;  4JI7 F;  1LW0 B;  2MJN A;  4USK A;  5BR8 J;  3PHE A;  3T1A A;  2JRS A;  2KU7 A;  2RNE A;  2YNH A;  3BH7 B;  3GYX B;  1VIS A;  3UNY A;  3M8R A;  3RBD A;  4PR6 A;  1DFD A;  5BYS A;  4OV6 A;  1AYE A;  2C1E B;  1T9Y A;  4X62 F;  3DU6 A;  2CQH A;  3AD9 C;  1EJ7 L;  2C3Y A;  2J7U A;  5JJB A;  3KHG A;  3AJD A;  1M5S A;  4LF9 J;  5HVG A;  1NH8 A;  4I2P B;  4OMF G;  4CLF A;  4B08 A;  1RKJ A;  5EN1 A;  2NPF A;  3H0P A;  3A4T A;  4I6W A;  3ETO A;  2FZC B;  2W2Q P;  5HBM A;  1Q8I A;  4X84 A;  2IYG A;  2J5A A;  3AXM A;  2FZK B;  2ZNZ A;  1TKT B;  3IRX A;  3PTW A;  3CDB A;  3BQ0 A;  4M5H A;  1YI2 S;  4LF9 F;  1FK9 B;  2E9Z A;  1VGY A;  4ZS6 A;  4X4V A;  2ASJ A;  4CZC A;  2MQP A;  2JEG A;  2ZH7 A;  4ZHR B;  3C46 A;  1WI8 A;  1FKA F;  4B3R F;  3UI3 A;  2N3L A;  1NK8 A;  4PWU A;  5IC4 B;  2XWY A;  3GE9 A;  3JSB A;  1SC6 A;  5F8J A;  1HMV B;  1AFJ A;  3HZG A;  1KS2 A;  4LSZ B;  4NX9 A;  3HHN B;  3L09 A;  2BKN A;  2C3U A;  2QT7 A;  4LRE A;  3H5U A;  3SBM A;  3RBZ A;  3UDV A;  3CMA S;  1UWB B;  1TKD A;  3DRY A;  3M8P B;  2FHJ D;  2R2T A;  3MGJ A;  3CNQ P;  4M5L A;  1YJ9 S;  5FLX U;  2AGO A;  5LSL A;  2DGS A;  1XN9 A;  3W8P A;  4PYD A;  1X0P A;  4NXM J;  3DOK A;  3TQ1 A;  1RT6 B;  1BXN A;  4I6Y A;  3HO1 A;  4ERD A;  2Y8Y A;  5K8P A;  2E9T A;  3CDW A;  5DQH A;  3R2D J;  4DR2 F;  1S0O A;  3QO9 A;  4FKY A;  2YY3 A;  4EMD A;  3M6X A;  1U1L A;  3L4B C;  3FCW A;  3OXL A;  4DX7 A;  4USJ C;  3UVJ B;  5A8K A;  4YB1 P;  2ZH3 A;  3T5K A;  1MLA A;  5LT5 A;  4DV5 F;  1TL4 A;  2HVI A;  4LSL B;  1ZOT A;  1VI7 A;  2HZA A;  3T1H J;  2V67 A;  3TOQ A;  1IR0 A;  1I3O B;  4WJB A;  5GME A;  4MK7 A;  5KT4 A;  2ZH9 A;  4O3R A;  5D0R A;  3V4I A;  1D0E A;  4K4Y A;  2GIQ A;  2N7Y A;  2XMV A;  4CO1 A;  3CPW R;  4YY3 J;  1UA1 A;  3NOG A;  3EZU A;  5SZT A;  3QJL A;  3KDO A;  2UUB J;  2DR6 A;  3TI0 A;  3CUL A;  3NL0 A;  4DCO B;  2Y0B B;  4XK8 C;  2MQO A;  3SDE B;  3VAF A;  2ZZN A;  3QJP A;  4RBV A;  4KGX B;  4WU3 A;  2GIR A;  1J5O B;  2GHP A;  4YUD A;  2A1B A;  3DLJ A;  4ZVO B;  5CYQ A;  1KFS A;  1VLY A;  1Q7Y T;  1KBR A;  4DPT A;  4BWJ A;  4HH1 A;  3T5J A;  1DJ0 A;  1YRT A;  2HWT A;  4DI6 A;  3BV8 A;  1HD1 A;  1U1O A;  3TAM B;  3E8O A;  1HR0 J;  4FP9 A;  3ZTQ A;  2EC0 A;  3LF0 A;  4EBE A;  4ED0 A;  3IWX A;  4I1T A;  1Y3J A;  3MUT P;  2AX1 A;  4ECZ A;  1R7I A;  4ICL B;  5L9N A;  1PO6 A;  3SQG B;  4OI2 A;  2D3O R;  1QVG R;  4LQ3 A;  4CLY A;  2LA6 A;  1W26 A;  3HUL A;  3E3X A;  5A8W B;  4CLK A;  3BDP A;  2FC9 A;  3MD3 A;  2JJ4 D;  4N47 A;  1WOO A;  4TYA A;  4BLG A;  5D6G A;  2VQF F;  1TV6 A;  1YJR A;  3DFE A;  2ZE2 A;  2CZ4 A;  2ZWP A;  1WTB A;  2E66 A;  3KFW X;  2YX4 A;  1S7I A;  3FSI A;  4BCA A;  1L5U A;  3HCX A;  4NL5 A;  4ZVE A;  5KFD A;  2OKQ A;  3BKT A;  3ILL A;  3I32 A;  3RYL A;  2VQF J;  2B4V A;  2NR0 A;  1KQK A;  2GQQ A;  4CP5 A;  1QAJ A;  3MTK A;  1SCJ B;  4JI1 F;  1X4D A;  2I1R A;  1IBK F;  4X4Q A;  3KJV B;  1R0A A;  5L39 A;  1S12 A;  1V5V A;  2B4P A;  3FUY A;  3F44 A;  4TXS A;  1HNX J;  4DSK A;  4PG4 A;  1HW8 A;  1TL3 B;  5IT9 U;  4DF4 A;  3UN5 A;  3MMB B;  1IKV B;  4RNH A;  2FQQ B;  1UCN A;  1QLN A;  1SUQ A;  1T9X A;  1KWM A;  4USH A;  2UVV A;  4URQ U;  3KLE A;  3VAJ A;  1QUP A;  2UUA F;  2R2R A;  4CT9 A;  1S72 S;  3BN4 A;  4FZV A;  1XR7 A;  1NHK L;  1ZM2 A;  1RT7 A;  1Q95 G;  2XUL A;  4PQA A;  2VB6 A;  4P73 A;  2ZOG A;  1ZAV A;  2DNG A;  4ZP7 A;  2R7X A;  2CVE A;  4ZJO A;  2FTR A;  4DSE A;  1F0X A;  1I5O B;  3I0R B;  2MDA A;  3TJ8 A;  3EYZ A;  1RT1 B;  4QJV A;  5J2Q A;  1J5O A;  1QAI A;  1KQG B;  4XPC A;  1CUL B;  2ZDO A;  3CB4 A;  1BQN A;  4F4K A;  3W1Y C;  4DZD A;  4LF6 F;  4UF4 A;  4W98 A;  4YY3 F;  3LO3 A;  2M4M A;  2Z57 B;  2AX0 A;  3CJ0 A;  1R3N A;  1UVM A;  4OJH A;  1F1B B;  5KFJ A;  1RP5 A;  1U0S A;  1RWX B;  4NML A;  3TA0 A;  3CCL S;  3CJ2 A;  3G4S S;  3CE8 A;  3MM6 A;  1RBO B;  3U27 A;  1F5B A;  3MR7 A;  4ZKA A;  2G13 A;  2XYG B;  5J2P B;  2QL7 B;  4O0I A;  2XS7 A;  1RTH B;  5DQI A;  1KHW A;  2ZE2 B;  4JYA F;  3DOK B;  2HBZ B;  1ROF A;  1Y5N B;  2ASY A;  3GV5 B;  1FKP B;  3OL9 A;  4PXC A;  4GO5 X;  2MLX A;  2NCK L;  2B9E A;  2Q6C A;  3A3P B;  5CCL A;  3A8J A;  1X60 A;  1FWP A;  1ICE B;  3BKU A;  5K20 B;  1HBO A;  4YHH F;  4I2Q B;  1VK3 A;  4ILM A;  1HYS A;  3KMS A;  4OYZ A;  1U1Q A;  5AJ3 J;  1Y7P A;  2BV3 A;  3MCM A;  2BQ3 A;  4JI5 F;  5KG5 A;  3N5F A;  2OAU A;  5I3U B;  2RKI A;  7AT1 B;  3M8W A;  1VJW A;  1K9M T;  2GX8 A;  3H90 A;  4ZVP B;  3ZZU A;  2R8H A;  2RB7 A;  3EGW B;  3RW7 A;  5I4M A;  4A8Y A;  2DHS A;  1FT8 A;  2K3I A;  2UXC J;  2MKJ A;  3LWL A;  4OI6 A;  2YNF B;  1Q5V A;  3IS9 A;  2W2N P;  1X7V A;  3POT B;  2GJ2 A;  4PXB A;  1T9U A;  1TUV A;  3TZZ A;  2RT3 A;  1YBT A;  2ZDP A;  5D4P A;  3M32 B;  4KHP J;  4PQU B;  1G6B A;  2W2O P;  5DZ6 A;  1U1M A;  9ATC B;  3M30 B;  2AEM A;  3N6L A;  2WBM A;  4J37 A;  1O6X A;  4ECW A;  3MHY A;  1S0N A;  2W4D A;  3R6L B;  3EPI A;  4RUC A;  2PDA A;  4U95 A;  1NK9 A;  3D28 A;  3JQM A;  3KK1 A;  1D1U A;  2IVY A;  3RUB L;  2MKC A;  4UOF A;  4B9L A;  2J76 E;  4KAI A;  2XS5 A;  1D9A A;  3DOL A;  1JNZ B;  2V4J B;  3CGI A;  4DV4 J;  1AXQ A;  3WQP A;  4GC7 A;  4BC9 A;  4F8R A;  2Q3P A;  4W4M A;  5A8W A;  4ED2 A;  2HGM A;  1RHQ B;  3VGU A;  2P9E A;  3NRB A;  3CUN A;  3P49 B;  3OVB A;  1O0P A;  1VHI A;  2YKN A;  4GVL A;  2RU3 A;  4QWB A;  4U96 A;  1O51 A;  4YN3 B;  2KL8 A;  4TVA B;  5DDR C;  5CXT A;  4OJG A;  1GXT A;  4EBD A;  1NJZ A;  3LA0 A;  4DR1 F;  4ZLN A;  2NUU G;  1R31 A;  4P74 A;  5KT2 A;  4JI0 J;  4RNF A;  2OH2 A;  3FEY B;  1EQM A;  1WEZ A;  4P7V A;  4LF5 F;  3D6M B;  3HT0 A;  1VYA A;  4Y2K A;  1GK8 A;  4X4P A;  1FKP A;  4B9M A;  1N56 A;  4ED8 A;  4P6Q A;  4ZP9 A;  5HI7 A;  1S1T B;  1LXJ A;  3B82 A;  1LKZ A;  2DNN A;  3QGH A;  1HI1 A;  2HK2 A;  2U1A A;  1JMT A;  3ZZ0 A;  5HN0 A;  3QT7 A;  5IT9 Y;  2VPY B;  2RQ4 A;  1HWL A;  4RNM A;  1HQE A;  2DXE A;  2RKI B;  2KRR A;  3TZW A;  3MCS A;  1S9F A;  2UUC F;  1CVJ A;  3TQE A;  3SCK E;  1JJC B;  4KO0 A;  5KFT A;  1LEO A;  4IOB A;  4DCP B;  3KLF B;  3K5M A;  2VBY A;  1RTJ A;  3PYG A;  2CPH A;  5L8R C;  4A46 A;  2NZ4 A;  2H9Z A;  1R6Y A;  3HLU A;  2C2D A;  1NLK L;  3DGP A;  4ZP6 A;  4N41 A;  1NDP A;  1F2H A;  1SQE A;  4GRS A;  3ILI A;  4ZIT A;  2C22 A;  5KG1 A;  1HBN A;  1NDL A;  5L38 A;  4J90 A;  4QIE A;  1DLO B;  3AXK A;  4QW8 A;  1VQL S;  5D8H B;  5HJY A;  4UOH A;  2BAB A;  4LF8 J;  3TX8 A;  1TL7 B;  2V8V A;  3ICL A;  2OPQ A;  1ARO P;  3HF5 A;  3DOL B;  2CJY B;  2FHO B;  1UJ4 A;  4JI0 F;  1X9M A;  8RUC A;  2FVQ A;  1JLE B;  2R2U A;  1OSD A;  3LPY A;  2MQ8 A;  1KOO A;  3GZ7 A;  2HFZ A;  2MEW A;  3ET6 B;  3NGT A;  1ULR A;  3GV7 B;  2PGC A;  3SSR A;  4HH0 A;  3OTO F;  1Q53 A;  2OMO A;  2PC6 A;  3P4U B;  3G82 B;  4F4X A;  3W2V B;  4URG A;  2MZ1 A;  3FGV A;  4JOU A;  3LQV A;  3MFH A;  5BJR A;  4IUF A;  2YWG A;  1YVF A;  4Y0F A;  2KHD A;  2XHC A;  1RLD A;  1YZ6 A;  3MPD A;  2HMI B;  5GMD A;  2CQ0 A;  3CCW A;  4Y2C A;  1KKH A;  4TY8 B;  3FNN A;  5KFZ A;  3GCX P;  2UUC J;  3Q2T C;  3DRR A;  3QAU A;  4ZPW R;  4EI2 A;  3V6H A;  3OQ2 A;  4DQP A;  2R7T A;  4LF7 J;  1MRO B;  3AB4 B;  2D7S A;  1SC1 B;  2VL1 A;  4JYA J;  1YSJ A;  1YRX A;  4CCH A;  5HQL A;  3KLE B;  3AA8 A;  2CWX A;  3W5Z A;  3I6P A;  1N5Q A;  1IJE B;  3ZFV A;  4NA2 A;  4NXN F;  2HNZ A;  3ITH B;  1VK8 A;  1RT7 B;  2D9P A;  2NLW A;  2XMK A;  3PEH A;  2RHQ B;  1NUE A;  3GU0 A;  1X4B A;  4H4K C;  1U1R A;  2HWH A;  3BKF A;  2HPU A;  4RU9 A;  2B5J A;  4ECR A;  1PJ6 A;  3AOB A;  4LRC A;  3N0V A;  4PG6 A;  4DR7 F;  2CJX B;  4WIQ A;  3S8S A;  1E6Y B;  2EFO A;  2H5I B;  4IFV A;  3ENV A;  5KFU A;  4OYP A;  3J7Z 5;  2ZM6 F;  4CLU A;  4AQY F;  1GMV A;  3AJ2 A;  4S0M A;  4FNI A;  4M1K A;  1NSK L;  1DLO A;  2YQ0 A;  1SJQ A;  2HKE A;  2MLY A;  3FDS A;  4DR2 J;  2FGC A;  5M2R A;  3HD1 A;  3AH6 A;  3S1T A;  1SIZ A;  4C3L A;  3QZ8 A;  3ISN D;  5LMU F;  4EZ9 A;  3NBP A;  3FFI A;  3TUJ C;  2QFJ A;  3HVT B;  3HJF A;  1FF2 A;  2HHX A;  2OPS A;  1HQU B;  2GO8 A;  2WSC C;  4N8O A;  2EC2 A;  2IBK A;  2MQL A;  4EWT A;  2PA8 D;  3K89 A;  2D9O A;  1ZTT A;  4EYI B;  1LWE B;  4C48 A;  3RRH A;  3GIK A;  4ECY A;  1BHN A;  4B3T F;  2SXL A;  4Y6I A;  2WSE C;  1L3T A;  1KLM A;  1MN9 A;  1XR6 A;  3PVX A;  1M90 T;  3M2U A;  2V2K A;  1R27 B;  1SJR A;  2D74 B;  2HVZ A;  2OGU A;  2QC3 A;  3BYP A;  4LR9 A;  1HBO B;  3IM8 A;  5E5N A;  4OHZ A;  4JI2 J;  4OIX A;  4DL3 A;  3IR5 B;  4DUT A;  1M5V C;  3Q83 A;  4DN9 A;  4F67 A;  5E33 A;  1NKC A;  4ELU A;  2RQK A;  4HLB A;  4ZCK A;  3DRR B;  4HI1 A;  3M8S A;  3PW4 A;  3NEK A;  1U24 A;  2YXL A;  5LXY A;  4TQS A;  3PO5 A;  1X5P A;  2W8L A;  2AYE A;  2A2C A;  5EWG A;  4K4W A;  4F50 A;  4WP9 A;  4DN0 A;  2C42 A;  4B3O A;  2L9D A;  2V4Q A;  2FLL A;  3T3F A;  1T95 A;  3EGN A;  1RWM B;  2ZOF A;  1Q78 A;  4J91 A;  4WXO A;  5CZX A;  2YNF A;  2BR0 A;  2KDO A;  2KYZ A;  2WVB A;  4ED4 A;  3PX4 A;  1S10 A;  2DHG A;  3ZTO A;  5JXS A;  5KG6 A;  1WUU A;  1RU1 A;  3HMJ G;  2FHJ A;  3NAI A;  2YBV A;  1JLG A;  1S6P B;  2HVD A;  3CSK A;  3QQC D;  1OQ3 A;  3R5B A;  3ZNJ 1;  1U6B A;  4HTJ A;  2GNK A;  3OHB A;  2DR9 A;  1OQ6 A;  4IFV B;  1R0B G;  4DJB A;  1S1X A;  2JLE A;  1ZPW X;  1C0U A;  2OPQ B;  2VPX B;  2UXB J;  4E2F B;  2VG7 B;  2NYI A;  2CDQ A;  2YKA A;  4IH6 A;  2GMH A;  2UU9 J;  3O2I A;  3PIP Q;  2CFX A;  4MIA A;  1IBK J;  2Y0S D;  1HMV A;  4G6V B;  2IRY A;  1SV5 B;  4ZMM A;  3AAW B;  2HND B;  4MKY A;  2B6A A;  2RML A;  3DHW C;  2AV5 A;  2MSS A;  1SL2 A;  1S9G A;  2I9S A;  2W2M P;  4B3M F;  3QZ7 A;  3HHL D;  2DNP A;  2D41 A;  2EVZ A;  5EWF A;  2AJ1 A;  3CME S;  1LWE A;  3DLG B;  4WE1 A;  4IO9 Q;  4LUB A;  3SSQ A;  2J0S D;  4MTP A;  4F02 A;  5J1N A;  5IQ6 A;  5DDQ C;  4NLR A;  3I4P A;  3OL8 A;  2VZ9 A;  3M8Q B;  5HMX A;  5ADZ A;  2DD8 S;  1PIE A;  2W2P P;  3FK4 A;  5AE2 A;  4LFB J;  4X4S A;  3EUN A;  5HSP A;  3GPA A;  3CDU A;  3W8G A;  3VTI A;  2HHQ A;  3MMA B;  1HIY A;  5DZ7 A;  4Q7A A;  4OLP A;  2DT9 A;  3MAA B;  3CCT A;  2ZKU A;  3OTE A;  2W4C A;  5B0F A;  4KHR A;  4F7V A;  2J8S A;  2XBP A;  2Z2M A;  2F3J A;  1NPR A;  3VHQ A;  5KFE A;  4ECS A;  3ITH A;  3VF0 B;  2UXD F;  1FJE B;  4C0H A;  4X64 F;  1RK8 A;  3GJS B;  1GAO A;  1RHK B;  2W25 A;  4KB7 A;  4DU8 A;  3KUE A;  2HSE B;  1FEE A;  4DG1 B;  3FSY A;  2CIM A;  2M2B A;  3FBC A;  2R7R A;  1VC6 A;  2UUW A;  2Z56 B;  2ZVS A;  3NS5 A;  3OFG A;  2IBO A;  5GAD U;  5DLF A;  3ZTS A;  4PG7 A;  4B9U A;  5HAN A;  2OEJ A;  2DNY A;  5KFF A;  1HBM B;  2HAF A;  4KC5 A;  5DDO C;  2BQU A;  4FS1 A;  3ZO7 A;  3UO0 A;  4DOZ A;  2CPF A;  1RE1 B;  2GCF A;  2VFT A;  2RF2 A;  1U09 A;  4Z2X A;  1NB2 A;  1VIX A;  2BXJ A;  5HRO A;  1F2G A;  1NXI A;  2GVD A;  4J9R A;  3PR5 B;  2AGP A;  2GHV C;  1XBW A;  2NXE A;  4E0D A;  3KMQ A;  2HEK A;  2BJ3 A;  3P5T L;  2KM8 B;  1TK0 A;  4H4M B;  2B56 A;  4J9K A;  2DXD A;  4AE5 A;  4AXI A;  4JI7 J;  1UFK A;  2BYC A;  1FER A;  2HIQ A;  2CYY A;  1CQN A;  2UUT A;  3N5B A;  3T6B A;  1J5E F;  1KLN A;  1FRK A;  2WVD A;  2XG8 A;  2RS2 A;  2KZZ A;  3EGV A;  3F0N A;  4FPI A;  2OPP A;  3LAM A;  4J9M A;  2F9D A;  4ZVS B;  4F2R A;  2GAH C;  3MUM P;  1HNI B;  2R8K A;  4K59 A;  3CCJ S;  2J9D A;  1FFG B;  2EWH A;  2IM0 A;  1KP6 A;  4ALZ A;  2CPD A;  2WBR A;  3SI8 A;  1WC4 A;  5D3G B;  1QTM A;  4N76 A;  1OMS A;  3FZB A;  2AW0 A;  2AJ2 A;  4TQR A;  4PG5 A;  3MMB A;  4UQT A;  3KJV A;  2QRR A;  3WBZ A;  5GAH I;  3TAN A;  1S77 D;  3EGZ A;  3TZX A;  2RRB A;  3DC2 A;  1UEU A;  1XNR F;  1M1G A;  3MAA A;  2BEF A;  1Z4U A;  3V5R A;  3NG8 A;  1GH8 A;  5U47 A;  3VVT A;  4LVN P;  4Y2A A;  3I55 S;  4C8L A;  3LP1 A;  1OYE A;  1HFE L;  3OFH A;  5KT7 A;  3GIM A;  2DB1 A;  4QR2 A;  5KOW A;  1XNQ J;  3GJR B;  3SCJ E;  4C9D A;  1XK8 A;  3GON A;  2AIR B;  2V2Z A;  1RCX B;  2OO4 A;  3L95 X;  4KR0 B;  3UCG A;  4PXD A;  4CYU A;  4YR3 A;  4CDI A;  4Q2L A;  4ZIV A;  3DMJ B;  4YME A;  3A8E A;  4ZPB A;  1S1V B;  2RDD A;  2HQF A;  4KKO A;  1C4C A;  2L08 A;  1PG5 B;  1RAA B;  4A47 A;  3OR1 A;  4R25 A;  1ZZN A;  4LFC F;  1GTE A;  4LRA A;  4DX8 H;  1LFP A;  4LFB F;  2AJ0 A;  2W9B B;  1R43 A;  2CNN B;  1CUL A;  4ID8 A;  2VJV A;  5CHC B;  1EZZ B;  3KNA A;  1FES A;  3EXC X;  3LH2 S;  5C7P A;  3S7R A;  2FJE B;  2P8I A;  2ROG A;  5K5M A;  1JJ4 A;  4MMO A;  3RR8 A;  2ZJQ Q;  3O44 A;  4TKT A;  2J6S A;  1LQ9 A;  2ZUG A;  5BYQ A;  1N6Q A;  4NEY A;  2E1A A;  1KLM B;  4NLU A;  2E9R X;  3ADA C;  2BUN A;  1H2T Z;  2F8E X;  3LOU A;  1U45 A;  2XS2 A;  2F7V A;  3LAL A;  3M2U B;  4I56 A;  4GVB A;  4FXV A;  2P6T A;  4ED3 A;  4M5G A;  4N8N A;  2OP5 A;  1WD6 A;  2ZBC A;  4ZP8 A;  2CG8 A;  3D0G E;  1E6V B;  1T03 B;  1RAB B;  4I2Q A;  2F5G A;  1KVK A;  4PUO A;  2HFO A;  3BEG B;  2VFV A;  4RBT A;  4HDG A;  3MEC B;  4ED6 A;  1VJQ A;  3I87 A;  1O5J A;  4JI4 J;  3IG1 A;  4ZK7 M;  2H51 B;  2OTJ S;  1IN0 A;  3M05 A;  2LQJ A;  2XQC A;  1B99 A;  4CH0 S;  1YTY A;  2OUG A;  3CIZ A;  2ZBQ A;  3T6J A;  1VQ4 S;  2P6S A;  1B4S A;  4I7F B;  4KGZ B;  4NYP A;  1EKR A;  3CCZ A;  4H4O A;  5T41 A;  4LF8 F;  3TEG A;  3W62 A;  3PDN A;  4DPU A;  2B0G A;  3TVK A;  3POT A;  1KON A;  4ZPC A;  4XPE A;  1PBU A;  4YQW A;  2J9D E;  3M32 A;  5KFW A;  2XMW A;  2C3M A;  3I96 A;  2U2F A;  1MW7 A;  5ETL A;  3Q2S C;  1H7X A;  2O67 A;  3Q8U A;  5L1J A;  1NHU A;  2W01 A;  4FXD A;  1BWE A;  4ZLL A;  2WSF C;  4A48 A;  3OLB A;  4WFZ A;  1P1L A;  2H1Y A;  2WAQ D;  5ETT A;  3G9C A;  3RB6 A;  1D8Z A;  5HMY A;  2RIJ A;  3C16 A;  3GFY A;  3DXB A;  2V2Q A;  3BGL A;  1AA1 B;  2MKY A;  4A8X A;  3PG9 A;  4CM0 A;  2OEL A;  1OSC A;  4EYH B;  1RA7 A;  4NLT A;  1F5A A;  4Y00 A;  4GKJ F;  4WZM A;  3W2W B;  1QE1 B;  2HQC A;  5FJ4 A;  2O5D A;  2LVW A;  3H7H B;  1YJU A;  4UUX A;  2VIH A;  4ZCM A;  4DV3 J;  1NJW A;  4B3S J;  1WEY A;  3AOC A;  2COL A;  1KTV A;  3NOC A;  2CPX A;  4OZ0 A;  1Q5Y A;  4Q2M A;  4DR5 J;  1VBZ A;  3K58 A;  4V19 X;  4NLP A;  1SVD A;  1VQK S;  4AND A;  1N6Q B;  1T8E A;  4CWB A;  2DH7 A;  2D69 A;  2BMB A;  1REV B;  4OYI A;  2ZH5 A;  1QSY A;  4G1P A;  1WSV A;  3OW2 R;  4LMZ A;  4R0E A;  2HNY A;  1XC9 A;  1RU2 A;  1TQL A;  3CJ3 A;  1N5V A;  2KVQ E;  1JXE A;  3D1H A;  4O4R A;  3BJY A;  1VRQ C;  1WKL A;  3PM9 A;  1LNQ A;  2V8D A;  3P45 B;  4LVO P;  5IM0 B;  5DRK A;  3T9Z A;  5KFV A;  1GX5 A;  2QLJ B;  5IWA F;  3VZI A;  3HP6 A;  1NBE B;  4A8Q A;  4O23 A;  5ETO A;  3R27 A;  2XWX A;  1YIJ S;  1U6F A;  1T9W A;  3VV2 B;  4A8M P;  1ZET A;  1DY3 A;  1JLC B;  2J8A A;  3SV3 A;  1SQF A;  1LV5 A;  2E5J A;  3QID A;  4X4R A;  4UT4 A;  3BGU A;  3FRZ A;  3UPF A;  2AD9 A;  1UET A;  3KDN A;  2OTL S;  1JNR B;  1T7P A;  2VON A;  4KO0 B;  4H4K A;  4Y2I A;  1TVR B;  2Y8W A;  2XO7 A;  3V6K A;  1GMW D;  3BB5 A;  3QT5 A;  1RAI B;  3RZA A;  4U6P A;  2KG0 A;  4E8U A;  5LMU J;  4RJV A;  1PKU A;  2AP6 A;  4CM2 A;  3EVM A;  4DV6 F;  1W7W A;  3TVY A;  1PJ5 A;  4B17 A;  4BS2 A;  1U7L A;  2EW9 A;  2ZH2 A;  1VQ5 S;  2PE8 A;  2X1F A;  3TAQ A;  3L9Z A;  3OR1 B;  2ATC B;  2MY8 A;  3M2R B;  1HHQ A;  4FVC A;  3SZ2 A;  2G2O A;  1UAW A;  5CYQ B;  1K0T A;  3UWT A;  4QW9 A;  4IR9 A;  1X4E A;  3MM8 A;  1JLB A;  4MFB A;  5D78 A;  3US5 A;  1QVF R;  3BBC A;  2N4D A;  3ENA A;  4OYO A;  1JLF B;  1RA6 A;  3ZZR A;  3QGI A;  5C2G A;  4KHM A;  4J9L A;  3WHI A;  2RJZ A;  5A0Y A;  4CLL A;  3MFI A;  5A8R B;  2VFU A;  4WZQ A;  2RD5 C;  1RKI A;  3BS9 A;  3PW2 A;  5DG7 A;  2BVZ A;  2F4V F;  2LLZ A;  5CD4 H;  2UVU A;  1Q8B A;  3UE2 A;  1QE1 A;  3BN7 A;  1OY9 A;  1UZH A;  2JLF A;  1C0T B;  3CJT A;  4PCQ A;  1TV6 B;  1J27 A;  2HBQ B;  4I68 A;  5GVQ A;  1OY8 A;  4ZVR B;  2VDH A;  4AT1 B;  1EAY C;  1HNI A;  1NM2 A;  5HQ8 A;  5DQG A;  2P9C A;  4X62 J;  4JV5 J;  5F8N A;  4PPZ A;  4RPF A;  4B9S A;  1U1N A;  3HDS A;  2CUY A;  1GX6 A;  4LRF A;  4IYQ A;  3BGO P;  4RUA A;  3RTV A;  2OEM A;  3BO4 A;  2DEJ A;  2XY5 A;  2QGF B;  4U67 Q;  1ZM9 A;  2XCP A;  3SIP B;  3H2V E;  1Q79 A;  4HAC B;  1LWX A;  2VC1 A;  1UVJ A;  3LP2 B;  4MIW A;  3QIP B;  4PAA A;  1U1K A;  1PC4 A;  2HGL A;  4NWB A;  4OYX A;  3PXG a;  1NK7 A;  3DLH A;  2YWW A;  1VLO A;  3K5P A;  4LF4 J;  4IRD A;  3CJR A;  3QYY A;  4DDF A;  2FJX A;  4I2P A;  4UQG A;  2A6M A;  3NGD A;  2DRA A;  3RW6 A;  5D77 A;  1U47 A;  2DHX A;  1IJF B;  2GQC A;  1A6L A;  2PO4 A;  4YDX A;  3CCE S;  2ATL A;  3CD5 A;  1RTD B;  5C5J A;  3ZC4 A;  2DGV A;  3DMJ A;  1FK9 A;  1WI6 A;  1E6Y A;  4P7T A;  4KKO B;  5ETS A;  2EXU A;  4F26 A;  2NS1 B;  1TK5 A;  1IM6 A;  4DR5 F;  1N5S A;  5AT1 B;  2M7S A;  1X4G A;  2XCA A;  3DLK B;  2W9C A;  1PBA A;  1Y4Z B;  1FTC A;  4P52 A;  4WFX A;  2W7P A;  2FY1 A;  2ZZT A;  4K4S A;  3EWG A;  2PEB A;  3UDE A;  4WFA Q;  4MT1 A;  2FJW A;  2ABY A;  3MMJ A;  1TAU A;  3MEE A;  4URS A;  1IKY B;  1LWF A;  2F40 A;  3QRP A;  1PIL A;  1KHV A;  2DNQ A;  1W2I A;  1JLA B;  3B6B A;  1R6V A;  4ZVF A;  1VMB A;  2LYV A;  2KN4 A;  2QO3 A;  2R4F A;  2OPS B;  3NMA A;  3OFE A;  5IV4 A;  3NNH A;  2ZD1 B;  3EPG A;  2RSQ A;  2UZA A;  4WKR A;  3I5B A;  4KPC A;  1QTN B;  4PWW A;  1JB0 C;  2E7X A;  5KOX A;  2BE7 D;  5H1S V;  2KT2 A;  4A4J A;  5IM0 A;  3QAT A;  2N4C A;  3KG1 A;  2XSF A;  4R5P B;  5BXI A;  3R9L A;  3U1N A;  4RU2 A;  3H59 A;  2DIT A;  4LSL A;  5KFS A;  5J1P A;  2QSW A;  4DL2 A;  3UN3 A;  2KI2 A;  3G8S A;  3AT1 B;  4NLY A;  1YWX A;  2XY7 A;  1D09 B;  4C3M A;  4J5O A;  1Y5L B;  4MK9 A;  5HMW A;  2G9O A;  3R5D A;  5HVF A;  2MKS A;  1FVQ A;  3ISZ A;  4CNZ A;  3BPS P;  3VCD A;  1T3O A;  1P9Y A;  3X1L B;  1AUS L;  1HNV B;  3OXG A;  2OSR A;  1HR0 F;  3Q23 A;  5A6W A;  1UVN A;  1U2F A;  5E7O B;  1FE0 A;  4P10 A;  3D68 A;  2B9W A;  3M9O B;  2VG5 A;  4UUW A;  5KFY A;  2EI5 A;  2QA2 A;  4RW7 A;  5D0G A;  3BSC A;  5E41 A;  2FZG B;  3DDN A;  4LR7 A;  4DFK A;  2R7Q A;  3HM9 A;  2DH8 A;  3PRV A;  2WTF A;  1Z2L A;  3Q8Y A;  3T1H F;  1JLG B;  4DS5 A;  2DK2 A;  1U49 A;  4ELT A;  2UXC F;  1IKW B;  1GXU A;  4LBI A;  1SB6 A;  3HD2 A;  2J0W A;  1KN6 A;  1SL1 A;  3DLK A;  1JLF A;  3VAK A;  1SH0 A;  4RLE A;  1WAC A;  2R42 A;  4ICL A;  1XTZ A;  2YKQ A;  5DJB A;  4E98 A;  2LEB A;  2DPI A;  3BGF A;  3K17 A;  1FE4 A;  4DSJ A;  4ZCL A;  1OPZ A;  3QWU A;  4OLO A;  2IMW P;  3IM9 A;  2MZT A;  2QLF B;  4PXE A;  1FD2 A;  4F3Q A;  1BE4 A;  2E1P A;  5IZH A;  1S9G B;  4FS2 A;  2LQ5 A;  2ALY B;  1HNW J;  2V69 A;  3O8W A;  2B6A B;  2JEF A;  3F73 A;  4ZA1 A;  3R2C J;  4KHP F;  1DQ8 A;  1MNE A;  1GT8 A;  2BJ8 A;  2HQI A;  3BO2 A;  4FF2 A;  3NGS A;  4DXL A;  1NKB A;  2ZD1 A;  1HHT P;  2IY5 B;  4Q44 A;  3M1V A;  2QZ8 A;  3G6X A;  1K44 A;  2O1P A;  4WII A;  1A0O B;  3HKZ D;  3MUV P;  4NLS A;  2JC0 A;  3IXQ A;  2X1B A;  5KFN A;  2ZHA A;  3Q89 A;  1K73 T;  1S0V A;  3MUR P;  1KVJ A;  2DHH A;  5KFH A;  2VBX A;  1MSW D;  3SQO P;  3QLH A;  2QL5 B;  5KT3 A;  4M5N A;  4OJ3 A;  2H4W B;  4HAC A;  4F3O A;  1PAU B;  2GHW A;  2E29 A;  4FN5 A;  1V6H A;  1JK9 B;  2EFN A;  2CPI A;  1CG2 A;  3CJ5 A;  2FIU A;  3VAL A;  2K8G A;  4D3G A;  3ETM A;  3V81 A;  2QL9 B;  1TVR A;  3PFE A;  1N32 F;  1H98 A;  3W9I A;  3GCW P;  1OJ4 A;  4C98 A;  1HNV A;  4IKA A;  1VDH A;  1AZS B;  1IQZ A;  1OO0 B;  2NRE A;  3D1O A;  3IC1 A;  2X1A A;  1T05 B;  4EEY A;  3GFH A;  1C1C A;  2NXJ A;  5J2N A;  2J0X A;  4NZ0 A;  2BJD A;  5KTQ A;  2IM3 A;  3FQK A;  4LRB A;  4DV2 F;  1VC0 A;  2DVI A;  1AW0 A;  2C28 A;  4JI6 J;  2DYA A;  2VH7 A;  2KT3 A;  4Y28 C;  5D4L A;  2RQM A;  2BJ9 A;  3IR7 B;  2R7W A;  4OI1 A;  1DHM A;  2ACY A;  2VBZ A;  4F0K A;  2MPU A;  4DV0 F;  2GVD B;  3GYN A;  1HPZ A;  4PEO A;  1ZM3 A;  1NRK A;  4OL8 A;  4ANC A;  2HS3 A;  1YBA A;  3K5O A;  2E5I A;  3OSN A;  4KH0 B;  3Q8V A;  2X3D A;  4H4M A;  1X9S A;  3EVW A;  4CNY A;  3ET6 A;  2QEX S;  4IG0 B;  2OSQ A;  2BKP A;  5DO2 A;  4M63 A;  2PD1 A;  2V4R A;  2OIH A;  2XLI A;  2YWF A;  2MZS A;  1KVI A;  4DPW A;  5MAO A;  2RUS A;  4X4T A;  2JNJ A;  2AGQ A;  2G1D A;  1A7G E;  3D1Q A;  3PJ9 A;  3HHD A;  2IPO B;  2LXU A;  3GSI A;  3TEH B;  3P5B P;  1G2E A;  2LXI A;  2XI3 A;  4ILL A;  2HMI A;  2GVZ B;  2JL9 A;  3JTO A;  3QT8 A;  1YRU A;  4I64 A;  1OIA A;  1RTZ A;  2H5J B;  1VQP S;  5CAB A;  3CCR S;  3G87 A;  4DL4 A;  4DV7 F;  1ZYQ A;  4OYB A;  3FRY A;  2FY8 A;  1U26 A;  1H3D A;  2ZWO A;  3I82 A;  3QIP A;  2KH9 A;  3BO3 A;  4OQJ A;  5I3U A;  1RZM A;  1GFW B;  2QV6 A;  2XYP B;  2AYM A;  2CQI A;  1KQF B;  3DI6 A;  4ZIW A;  5CCM A;  2AWZ A;  4IRK A;  2HNZ B;  3HHE A;  3LGH A;  3NCQ A;  4MH8 A;  4RR5 A;  4WTY A;  3U1L A;  1K8A T;  1VRU A;  2A3J A;  3N01 A;  4NLW A;  5GAG I;  4DFJ A;  3MZI A;  3M30 A;  4Q8E A;  2E7W A;  2R2S A;  2R9L A;  2B5J B;  2DNK A;  2FLP A;  4TLQ A;  1IKW A;  4DWI A;  4JI5 J;  3JSM B;  1XIQ A;  1H73 A;  3H8Y A;  4K8R A;  2N7C A;  3KK1 B;  1VQ6 S;  2RVJ A;  1XMQ J;  1S1V A;  3MTJ A;  4ECX A;  3WC0 A;  1S1W A;  2CQ4 A;  1TL1 B;  1IBL J;  1U2C A;  2B8Q A;  3KWM A;  2RRA A;  2A18 A;  3P96 A;  2AEJ A;  1WDT A;  3DKD A;  3N6M A;  5T7L A;  1PYT A;  2ZUA A;  3CC2 S;  4ED1 A;  1TK8 A;  3U7J A;  2FD2 A;  4NZ7 A;  4RW9 A;  2FUG 9;  5F8L A;  2HRY A;  1V3S A;  3M8P A;  3GV8 B;  2E44 A;  5HL7 Q;  4TU7 A;  4OV1 A;  2I38 A;  2L48 A;  3NNC A;  4ZPD A;  1FEH A;  1CJV B;  1SQG A;  2HG4 A;  1H6K X;  4DLG A;  3OL6 A;  2KZM A;  2OI2 A;  4M8L A;  1I1G A;  2D3Z A;  5T14 A;  1WHX A;  2JWN A;  3SV4 A;  1TTH B;  2MHN A;  4AL5 A;  3DDK A;  3EDR B;  3RRK A;  1MML A;  1SJ3 P;  2AMC B;  4J9S A;  4XAK A;  2IMO A;  4M5K A;  5A2Q U;  4PUO B;  3KHR A;  4LQ9 A;  1T03 A;  3CVK A;  3UDL A;  4DL0 C;  2I2Y A;  3LGN A;  5JMN A;  1FVS A;  2GVZ A;  4B3S F;  2CQD A;  2B43 A;  1RHJ B;  3FCV A;  1KFD A;  3CO9 A;  5F9L A;  4RO0 A;  3CW2 C;  3IG1 B;  2C2R A;  2YKP A;  3D0H E;  4RWW A;  2J7W A;  5KG0 A;  3K8W A;  4NLQ A;  1ZBT A;  2DGQ A;  2MZQ A;  3L3C A;  4HVZ A;  4HHH A;  1IBL F;  1NZ8 A;  3OV7 A;  4L72 B;  3V6D B;  1QY7 A;  5ETK A;  3WC2 A;  2XMT A;  1NDK A;  3OR2 A;  4AXJ A;  1WOS A;  3DM2 B;  4NA1 A;  1C1C B;  1G3O A;  1YZ7 A;  3HHL B;  4P75 A;  2OFG X;  4C8O A;  2EBE A;  3OXF A;  1BUX A;  3VGS A;  1FNM A;  2AZ1 A;  2XZD B;  4MKV A;  4F4A A;  2G4B A;  1FDB A;  3R1L A;  3DOM A;  1I51 B;  3C16 B;  1IBC B;  3KK3 B;  2HBY B;  2C3P A;  3HVA A;  3KNG A;  1LXN A;  2DIV A;  3MI7 X;  1TL1 A;  2FYX A;  3GLJ A;  1C0U B;  4WP3 A;  2ZIT A;  2FJV A;  3OBI A;  3NKY A;  3KOA A;  1FX2 A;  2IM1 A;  2AEF A;  2A6O A;  2BDP A;  4OYW A;  5KFM A;  2QIF A;  1UPM B;  4WK3 A;  2HVH A;  3HVR A;  1M5K C;  5EGY A;  1W2B R;  1CJU A;  1X5S A;  4F4Z A;  2W1B A;  5H9E J;  2VF3 A;  3MAH A;  5F0W A;  2KXF A;  4OFZ A;  3UR0 A;  3CCQ S;  1VBY A;  2MGZ A;  1CJV A;  4RW6 B;  3NGK A;  1S49 A;  1WEX A;  5GAH U;  2IJN A;  2DY9 A;  5D0E A;  3A13 A;  1FRL A;  3I0S A;  2AJQ A;  1OY6 A;  2JEI A;  3OTC A;  3LUY A;  4OHX A;  1T9T A;  4PWD B;  1S97 A;  5F8G A;  5C42 B;  1ZAW A;  1ZM4 A;  4MAK A;  4YDD B;  2KFY A;  4G1Q A;  2VIC A;  3AA9 A;  3PEJ A;  3SYZ A;  4M5D B;  1QDU B;  3LGM A;  1S4E A;  3UD3 P;  1D3W A;  1UPP A;  1X4A A;  2V34 A;  3FBF A;  2DNZ A;  1U02 A;  2K3K A;  1WSR A;  3R5G A;  4QIW D;  4U9R A;  5HQM A;  3TZY A;  3JAM U;  3PW0 A;  1I6J A;  1DRZ A;  1R89 A;  3P8B B;  1XWL A;  2YQ3 A;  1J2V A;  6AT1 B;  5JVG Q;  4DR6 F;  4O4G A;  5DLG A;  3DI6 B;  2XNQ A;  1TZ0 A;  3KK2 B;  4V1A k;  1SKS A;  2NSB A;  1QJH A;  3EZ5 A;  2E7V A;  1R8B A;  1SKW A;  1UP1 A;  1MG7 A;  1Q8L A;  4ECV A;  5J2M A;  4PAB A;  2EG1 A;  4M5M A;  4FDF A;  4ZLJ A;  3KKF A;  5C25 B;  1BQM B;  5I3P A;  1T05 A;  1B70 B;  3DM2 A;  2V8P A;  1RAH B;  1IUJ A;  4C97 A;  3K5N A;  3UD5 A;  2WW8 A;  4DV7 J;  4CLW A;  3UCU P;  4GO7 X;  2G0J A;  2JSX A;  3ISN C;  3R5C A;  4K5R A;  4ETX A;  3OTO J;  5FII A;  2UUB F;  3L7P A;  1JLB B;  3HX9 A;  3GSD A;  1K47 A;  4MFB B;  1HBM A;  2QMU B;  2V5H G;  2BE9 B;  2LEP A;  2W4P A;  2ZHO A;  2HAI A;  2GQ2 A;  4FNH A;  1TKZ B;  4F25 A;  3VAG A;  5J1E A;  3NBP B;  1SBR A;  2Q79 A;  3SMZ A;  4DR4 F;  3W5Y A;  4HKQ A;  4ECQ A;  5ETN A;  3JQJ A;  4WF9 Q;  2R3V A;  4QIF A;  4P71 A;  4DR1 J;  4K4T A;  1D9D A;  5JUM A;  2Z2Y B;  4Q0B A;  1NK0 A;  4QYZ J;  3GFX A;  3OTB A;  5KFQ A;  4HYK A;  3J80 U;  5THW A;  3CED A;  4BHQ A;  4C2M A;  2MGZ B;  2FJB B;  2XSJ A;  3TO8 A;  2PMW A;  4X65 F;  2GV1 A;  2XHW A;  3J81 j;  1L3U A;  3QSI A;  1VQM S;  4USI A;  1S1U A;  5LOQ A;  1YX2 A;  3DYA B;  3KJN B;  4EZ6 A;  2MTL A;  1M0S A;  1NME B;  2I8E A;  2G2Z A;  3ENW A;  5C42 A;  1Q82 T;  5D3G A;  5KFC A;  2BJ1 A;  3OHA A;  4ATN A;  1PYS B;  3D5M A;  1RJJ A;  1GQE A;  1KOH A;  2WB1 D;  2X7I A;  1RWW B;  3CDE A;  3JXO A;  5KFG A;  1R8C A;  2J7K A;  5D4N A;  1FJC A;  2Z8Q A;  4KFB A;  3NXZ A;  2DGX A;  2VOO A;  2GIF A;  3VAH A;  2YWH A;  1N34 F;  1RAC B;  2CRL A;  4LSN A;  1IWG A;  1V3Z A;  4F0H A;  2L9N A;  1UEV A;  1WOP A;  4XDD A;  2L41 A;  1DTQ B;  4KBI A;  1RTD A;  4YR2 A;  4ECT A;  1Z1Z A;  3TP2 A;  3C6U A;  1Y5I B;  2KJW A;  1YKW A;  4KRW A;  5KFL A;  1OPI A;  2O3D A;  4RX6 A;  3M4X A;  3OL7 A;  3M9M B;  4PQU A;  3RAM A;  2G2Y A;  4YFU A;  2W9C B;  3IFE A;  1WC3 A;  1UJ5 A;  4QCL A;  1B0V A;  1HHS A;  2Y1L B;  3KLG B;  3H4D A;  3JB9 k;  2WOM B;  3D6H B;  3KUG A;  4YS2 A;  5EDW A;  1EP4 B;  2WW4 A;  3P3D A;  3AQP A;  4RZR A;  3KHL A;  3V6J A;  3C14 A;  3MEE B;  5EX3 A;  1VBX A;  4ID5 A;  4DR7 J;  3QNW B;  4Y2M A;  1JLA A;  3QJJ A;  4YHH J;  3PCO B;  1IKY A;  1CJU B;  1LWF B;  1U6Z A;  3ZZO A;  5B0B A;  4USV A;  2CZV C;  4OX9 J;  3DN9 A;  5AJ3 F;  1KDN A;  1YK9 A;  3N4W A;  2B4U A;  1Q16 B;  2RDI A;  3EJM A;  1F9H A;  3H2U B;  3VQS A;  5E3R A;  2C2E A;  2GFF A;  2F1F A;  4O44 B;  4JI3 F;  4JI8 J;  3M7V A;  2VAS A;  2BOA A;  3M8Q A;  1M5O C;  4B9T A;  2FVR A;  4PWD A;  2FGO A;  1OYD A;  3IGN A;  1IR1 A;  3W3S A;  4G1Q B;  4DHV A;  2CNL B;  3KLH A;  1WKK A;  2IYI A;  3G96 A;  3KYL A;  4J9Q A;  5DG9 A;  3RAQ A;  1WC1 A;  3B8H A;  1S1U B;  3MMA A;  1E6V A;  1IBM F;  1DAX A;  3DLB A;  3I9Z A;  1B0P A;  4OHW A;  2CQ3 A;  5GMK a;  2PMH A;  3HI9 A;  3T5H A;  2GZO A;  1LW0 A;  1U8S A;  4OYM A;  4WBF A;  1JWW A;  2UVR A;  1QAX A;  5B0G A;  2ASL A;  1ZZF A;  2CQG A;  5E3P A;  4QPX A;  3VWS A;  3JSR A;  1VQ8 S;  2QX0 A;  3RB3 A;  2KFZ A;  4ZVH A;  5C24 B;  2PFF B;  1RT3 A;  4QZV B;  2YNI A;  3W2V A;  2M52 A;  3FBE A;  5C25 A;  5CA5 A;  3R7N B;  2DCL A;  2J6T A;  4J9U E;  1YQH A;  1UFL A;  2XM3 A;  4AD6 A;  3D9B A;  3C6U B;  3IP0 A;  2DO4 A;  4C7Q A;  1S0M A;  4LF2 A;  2NYH A;  1FTR A;  4DPO A;  3DRS B;  2MLZ A;  2CXE A;  1NAQ A;  3KK3 A;  2ZC3 A;  1YDL A;  3G71 S;  4F3M A;  3KLG A;  3VQT A;  5ETV A;  1FXL A;  1RAO A;  4MJK A;  1FFW B;  1P27 B;  2K1R B;  2LQB A;  2K06 A;  2POK A;  3HFV A;  4ZDN A;  1S59 A;  2EFV A;  3J81 Y;  4X64 J;  4LF5 J;  1Q1K A;  2B7C B;  4QWC A;  4NI2 B;  2VJU A;  5HP1 B;  1TUG B;  4FBU A;  4NLG A;  4WXW A;  1VC5 A;  1CJT B;  2YH0 A;  1CJK B;  4Z7C A;  2WK4 A;  4QWD A;  4Q0B B;  5E2Q A;  3QRR A;  4K4X A;  1NK6 A;  1P6T A;  3W2W A;  3CJ8 A;  3MDF A;  3O1L A;  5CQG A;  4ES3 A;  1G1X A;  3NCP A;  1F9F A;  1UWB A;  1CS4 A;  4NLX A;  4CO5 A;  3C66 A;  2OPP B;  3U1M A;  2UXD J;  4DR4 J;  2KO1 A;  4U8Y A;  2MQM A;  3QGG A;  3I0S B;  4FYX B;  4TYB A;  3ZXW A;  4P2X A;  2F8H A;  4OHV A;  1YJN S;  2AYG A;  1MU2 A;  3PJW A;  3F56 A;  2R7O A;  3KXD A;  4P2S A;  3IMQ J;  3T1Y J;  2UV8 G;  1WHV A;  1Q7L B;  2IDL A;  3NAH A;  4P9S A;  4UST A;  1S9E B;  1RT2 B;  1SIW B;  2F9J A;  2GGP B;  3KLH B;  4DFP A;  4B3M J;  3EDQ B;  1WC6 A;  1MRO A;  2UUA J;  1FRX A;  6FD1 A;  2EFG A;  5LJ3 Y;  4ITS A;  4JP8 A;  1M1K T;  3MOZ A;  4NPO A;  3KK2 A;  4DL5 A;  1TP7 A;  2DIU A;  3D6T B;  1RWP B;  2M9K A;  3V81 B;  2CG4 A;  2JDJ A;  2MY7 A;  1WTF A;  3V4I B;  2Z0G A;  4U8V A;  4C6A A;  3H40 A;  1SKU B;  3OVA A;  1IXK A;  4LIW A;  4QIG A;  3THT A;  4OX7 A;  2FVC A;  3M2V A;  4DZ6 A;  3QMQ A;  4CYU B;  3KJQ B;  2RQC A;  3CIM A;  5J2N B;  5K14 A;  2DRB A;  1EIY B;  1HKA A;  4PG8 A;  5F41 A;  1TEL A;  3Q8S B;  3L7U A;  2M88 A;  1RGV A;  3GTY X;  1WJ9 A;  3ZZZ A;  1LW2 B;  3OT9 A;  3ZTR A;  2P2C B;  3DRP A;  2DKO B;  2OPR A;  1EP4 A;  2QFI A;  2PI4 A;  3DGV A;  1VQ9 S;  3CMQ A;  1MMN A;  1PC5 A;  3UQS A;  1B0T A;  1T9V A;  2F8M A;  2V50 A;  3SCL E;  4RNO A;  1BQX A;  4RNN A;  4M95 A;  2HHU A;  4RWX A;  4CLZ A;  4NE9 C;  1L3S A;  3FFI B;  1I94 F;  1SJ4 P;  1FRM A;  4DMZ A;  1O8B A;  3A3O B;  4IQX A;  1DUR A;  2CPZ A;  3GMG A;  4DL6 A;  2ZC4 A;  1N5Y B;  4X4N A;  1GEH A;  4NLO A;  1HPZ B;  2BKO A;  4UW2 A;  4EUV A;  1CJK A;  1VOM A;  2XZW A;  5A8R A;  5IS2 A;  1S6Q B;  5DGA A;  3W63 A;  1KC8 T;  5H9F J;  4NCB A;  1FRH A;  3QFH A;  4KH1 B;  3E01 B;  7FD1 A;  2LEC A;  1SPB P;  3FVY A;  2DR7 A;  3A3N B;  3HFZ B;  3GG0 A;  2FJD B;  3D0I E;  2DO0 A;  4EU0 A;  2JLG A;  4L73 A;  1VR6 A;  1UJ6 A;  2Q43 A;  5FDL B;  2ERR A;  5M2U A;  2HVE A;  2XC9 A;  1NEE A;  1ELO A;  2BZ2 A;  2ZHB A;  2XMM A;  4F4Y A;  1J5E J;  1F5C A;  2FDN A;  4N77 A;  1NZA A;  3MM9 B;  4OX9 F;  9RUB A;  2WHO A;  5G4D A;  3K59 A;  3OSP A;  3NWR A;  1Q81 T;  2MB0 B;  1R0A B;  2KM8 C;  2LDI A;  1NU4 A;  2ZEJ A;  2C2Z B;  5MLC V;  2GJI A;  4LRD A;  2EPI A;  3LP2 A;  1SUQ B;  3IGV A;  1WEL A;  1SXL A;  4IH7 A;  4LJM A;  1DTQ A;  3SEO A;  2KXH A;  3RB4 A;  2VOD A;  4C4W A;  4ELV A;  1WHY A;  5EHH A;  1VHF A;  4JI6 F;  4DFM A;  5ETQ A;  2DR5 A;  4FF4 A;  5IT0 A;  4NRT A;  2EK1 A;  4KGV B;  2HQD A;  1I94 J;  2Y3Y A;  4J7C A;  1TKX B;  1UMJ A;  3RU0 A;  4AUK A;  2VA2 A;  4I69 A;  4C8N A;  1QM9 A;  1N34 J;  1XNR J;  2HGN A;  3D2W A;  1AB8 A;  4KTQ A;  2HZV A;  3TJ9 A;  4Y3C A;  2MZJ A;  3KTQ A;  3TX0 A;  3P6Y C;  1T0T V;  4A8O A;  4ZN1 A;  1LW2 A;  3D7S B;  4ZOS A;  1G7C B;  3JTN A;  3I0R A;  4G3I A;  4NXN J;  2XY6 A;  3DRP B;  3C14 B;  1DQA A;  1BWV A;  2VG7 A;  3GJT B;  5KAK A;  1S1W B;  1U2R A;  4NCA A;  2LDY A;  2BBE A;  4M5I A;  4FYD A;  4QWE A;  2QA4 S;  1NND A;  3T5L A;  1X31 C;  2HFV A;  2VFR A;  5IT4 A;  4ILR A;  3PW7 A;  4JI3 J;  2DNL A;  1Q4R A;  2HIY A;  4UY8 T;  4RW9 B;  3GQC A;  4DQS A;  4ES1 A;  4DSF A;  3V2U C;  4K4U A;  1YJW S;  3MM6 B;  2MZR A;  5LM7 E;  1K1S A;  1PAE X;  2BA9 A;  3DLG A;  2CA9 A;  3GJQ B;  5ETR A;  3MF5 A;  1QD1 A;  1P8G A;  5EX0 A;  1NSQ A;  3THP A;  2MXY A;  2PEH A;  2HNY B;  3DLL Q;  3CDA A;  3OLA A;  4HL9 A;  3MEK A;  2W9A A;  3AOD A;  1S9E A;  2GGP A;  2YWK A;  4L76 A;  3TW0 A;  3KLV A;  2IVM A;  4AFF A;  3VGV A;  1YJV A;  3OUY B;  1N8R T;  4PZV A;  2AQ4 A;  2M8D B;  1GTH A;  4ZPV R;  3LAN A;  4JV0 A;  4DQQ A;  3MM9 A;  4F4W A;  3SCI E;  1RAE B;  1XMB A;  3BYR A;  3QFW A;  1JLC A;  3D3C J;  5SUH A;  4IR1 A;  4DEZ A;  2X51 A;  2QYC A;  2CDR B;  2JFD A;  4NCG A;  1TFW A;  1TFY A;  3D6F B;  1URR A;  3T9N A;  5EUH A;  4L75 A;  1JX4 A;  4HR2 A;  2XI2 A;  1RT3 B;  1KSP A;  1FJG F;  5D15 A;  2APO A;  3M2V B;  3OR2 B;  5AE3 A;  1NPK A;  5K9F A;  2ZH4 A;  5LMN J;  3BR9 A;  4I6A A;  1ITP A;  2Z4P A;  3MPW A;  1RHR B;  3CCV S;  4A8K A;  3BBF A;  1UKU A;  1HWJ A;  2LP4 A;  1UVK A;  5D4O A;  1VIO A;  2DH9 A;  3C2P A;  3E2E A;  4UOC A;  1FDN A;  1YLX A;  2DY1 A;  2GW8 A;  2KYX A;  2XO6 A;  4DV5 J;  2NQP A;  3W65 A;  5LMN F;  4OI3 A;  4RW7 B;  3DOM B;  1XNQ F;  3MM5 B;  3MOJ B;  2IC3 A;  2QMW A;  3N79 A;  3BF4 A;  3NLC A;  4O3N A;  2RF2 B;  4TLR A;  1TMJ A;  1FWK A;  2BOP A;  4U7U D;  1U48 A;  1NKE A;  4WFY A;  2J9C A;  3I4H X;  5KG4 A;  2R7U A;  1FI4 A;  1H7W A;  1P1T A;  3RJM B;  4CLT A;  3L7O A;  3WX4 A;  1Q86 T;  1WWH A;  1P9Q C;  3R97 A;  1CC8 A;  1C1B A;  1FRJ A;  1S6Q A;  3QSY B;  3CC7 S;  3Q86 A;  3R5A A;  4O3Q A;  2FHK A;  2M70 A;  4Z7Y A;  1Z2Z A;  2MYF A;  3GB0 A;  3T1Y F;  4J9O A;  5KG7 A;  2EEY A;  2BM1 A;  1IBM J;  2LU1 A;  2ZH6 A;  2AHO B;  3DCA A;  3A8I A;  3IAS 9;  5FDL A;  1SI9 A;  2VG6 A;  3O6Q A;  2XZT B;  4NOH A;  5AE1 A;  2VU5 A;  5AXN A;  2JZ5 A;  3NGR A;  5F3Z A;  4UZC A;  2VKZ G;  1RUS A;  3M1V B;  4CI0 B;  5H9F K;  2MKH A;  4OX8 A;  1NJX A;  2B4O A;  2V8H A;  4LT6 A;  3CT9 A;  2YQ1 A;  3Q22 A;  3TUP A;  3PRD A;  2A0F B;  5C2C A;  2V9K A;  2QG9 B;  5KFO A;  1GMW A;  3OUY A;  1DQ9 A;  5E3C A;  3GP9 A;  3UVJ A;  5A2Q Y;  2JHE A;  4DX5 A;  3PKM A;  3O5T B;  2LQ8 A;  3TNV A;  3MM7 A;  2M3D A;  1QSS A;  3TAR A;  3MAQ A;  3KUH A;  3EMT A;  4C8Y A;  4P2F A;  1JQG A;  2FPH X;  3OVS A;  2YTC A;  1FO1 A;  4LFA F;  4AQY J;  1N33 F;  4OJ1 A;  4QU7 A;  4ZVU B;  1NK5 A;  2RE1 A;  1RWK B;  4UY8 5;  1G4C A;  3PRB A;  2HQG A;  5KFX A;  2ZFH A;  4NYZ A;  5HAT A;  1N48 A;  2ZH1 A;  5GAD I;  3HSJ A;  2AJ4 A;  2FJA B;  2O01 C;  5EWE A;  1BLU A;  4RUB A;  3MCO A;  4USW A;  5FLX Y;  1HA1 A;  3MM5 A;  3UW1 A;  3T41 A;  4P72 A;  3BQ1 A;  2EK6 A;  4KIA A;  2R8G A;  4B3T J;  2HFS A;  2PII A;  5J1E B;  4MK8 A;  4DSI A;  3J7Z T;  3UN2 A;  3DU5 A;  4CO4 A;  1RCO B;  5E3A A;  5IC6 B;  1UL3 A;  5DM7 Q;  3FMB A;  2J0Q D;  2XNR A;  3VR1 A;  1RT4 B;  3VVU A;  4AYB D;  5I3Q A;  2YNG A;  2QSF A;  5HJX A;  4WTO B;  2C2O B;  2LEA A;  4LF7 F;  4WCE Q;  4YEA A;  5KT5 A;  3TR5 A;  1XMO J;  2IVF B;  2OEK A;  2D1C A;  2XMJ A;  3TUZ C;  3BBB A;  5K8M A;  4K2J A;  3X3U A;  1H72 C;  1VBK A;  2N3O A;  3M8Z A;  2HRT A;  3J7Y U;  1HWU A;  4DV3 F;  1DTT B;  1ZA2 B;  2V8G A;  4NZ6 A;  4OZ5 A;  5HVH A;  2BM0 A;  1PCA A;  3HZE A;  2OD6 A;  3FSX A;  4FF3 A;  1N33 J;  3ZZP A;  2HHT A;  4K0K F;  4C11 B;  1EAR A;  1HNZ J;  4IG3 A;  2R8J A;  2YWE A;  3HKW A;  2KVI A;  3JQK A;  3CO0 P;  4IH5 A;  1OS5 A;  3QAE A;  3RR7 A;  3TVZ A;  2NXN A;  5HK4 A;  4N56 A;  2GS8 A;  3BDE A;  4LF6 J;  4TY9 A;  5IWA J;  3TYT A;  3JAM Y;  2RU9 A;  4LSN B;  1KEK A;  1T11 A;  5B08 A;  4FKX A;  1TKX A;  3LAK A;  5AXK A;  3QBC A;  3SSS A;  2CWK A;  1X4F A;  2IJR A;  2ZNY A;  3ENQ A;  1NO8 A;  3GIL A;  2BRK A;  1CQM A;  2Y1R I;  3PAC A;  1NJI T;  2ACM A;  3RG6 A;  3RGI A;  4X4O A;  4GKK J;  3M8Y A;  2IC3 B;  4DL7 A;  2VDI A;  3JYT B;  3AB2 B;  4JB8 B;  4D3H A;  4DV6 J;  4W90 B;  2XGQ A;  1IKX A;  2F4F A;  3FJ2 A;  3JSM A;  1WF1 A;  1RT1 A;  4R0J A;  5J2Q B;  4RL1 A;  3UD4 P;  3IN5 A;  2C2K B;  4LFA J;  5G0R B;  3CJ4 A;  5L9X A;  4N7T A;  2AYB A;  3K5L A;  1HBU B;  2P9G A;  4X65 J;  4ID5 B;  3HFK A;  3OD2 A;  4GC6 A;  1V9O A;  2J9E A;  3T19 A;  2BAN A;  3KHH A;  1RT4 A;  2HUR A;  3CD0 A;  4DUY J;  1HWK A;  3ONQ A;  4WPA A;  5DG8 A;  4FXW A;  1SJF A;  3MR2 A;  2QLW A;  3MWB A;  4F36 A;  1M5P C;  4JI1 J;  1D9F A;  3R7S B;  3BR8 A;  4ZVQ B;  3IBC B;  3NWG A;  3PZP A;  3CJS A;  3B4M A;  4DUY F;  2MHE A;  1N88 A;  2JOQ A;  2YX1 A;  4CQ1 A;  2UXB F;  1WHW A;  2VKR A;  2R8I A;  1CBK A;  4X2B A;  4C0O C;  4IDK B;  5CYJ A;  3BSA A;  4NLD A;  1Y11 A;  2V63 A;  3RAX A;  4W92 B;  1VFJ A;  1MMD A;  2EFP A;  4NYO A;  3H25 A;  3CC4 S;  1GNK A;  5CAA A;  1FJG J;  2MQN A;  3UCZ P;  1NH7 A;  1EQ0 A;  4MYT A;  1HW9 A;  1U0H A;  4P2M A;  3TAP A;  3PJX A;  4IG3 B;  2Y1I A;  1URN A;  3PKY A;  2UVW A;  4TU8 A;  3R7B B;  3A12 A;  2IM2 A;  4USM A;  2ZBP A;  3G6Y A;  5HLF B;  4GKK F;  4BDP A;  4B3O B;  5ETM A;  3ZTP A;  3W64 A;  2ZOM A;  4DU7 A;  2V2V A;  1K1Q A;  2CQC A;  2XLK A;  3M6W A;  5IOL A;  2HFU A;  2V94 A;  2YKO A;  2W24 A;  1KQS R;  1C2P A;  4ED7 A;  2B9Y A;  3PFO A;  1M5H A;  1WC5 A;  3SDE A;  3TA1 A;  5I42 B;  4Q43 A;  3V6D A;  1ZTW A;  1SL0 A;  4CRJ A;  2LU2 A;  5GAE U;  2CKW A;  2ILZ A;  1VQ7 S;  1X5T A;  3EE3 A;  2HFN A;  2VV5 A;  3M2R A;  1JJ2 R;  5F8H A;  2E5L J;  2PT0 A;  1NB7 A;  1PYO B;  3MR6 A;  3UR3 C;  1RWO B;  4K5S A;  3B54 A;  3R5J B;  3DRS A;  4CO2 A;  1RLC L;  2K1R A;  5B0A A;  3Q8Q B;  4GMK A;  1UW4 A;  4WWS A;  1EHW A;  2QA4 G;  4DUZ J;  1RTI B;  2K7J A;  5RUB A;  2HYI B;  4XTT A;  5A0Y B;  4A8S A;  2JVO A;  1N4L A;  1V3R A;  2CNO B;  2EBG A;  4ZJL A;  2QLB B;  3BRE A;  3GFZ A;  4FVM A;  4HHU A;  4QR1 A;  4B02 A;  3PR4 A;  4M94 A;  4BBY A;  1X0F A;  1S6O A;  3H20 A;  4DSL A;  3LTO A;  2QN6 B;  5M2P A;  3M9N B;  4EBC A;  4K0K J;  4ECU A;  1CS4 B;  1SV5 A;  1X4H A;  2RRN A;  2ASD A;  4JI2 F;  2K2P A;  2CPJ A;  2BX6 A;  1YG0 A;  2VFS A;  3MD1 A;  1U8W A;  3G6E S;  4LF1 A;  4NEZ A;  3CCS S;  1S7H A;  1S5Z A;  3H4B A;  2UU9 F;  3LWM A;  3CWJ A;  3G8Q A;  1VQS A;  4RW6 A;  3O3L A;  4L3N A;  5E3Q A;  4WFB Q;  4FBT A;  5L1I A;  5AXL A;  5DM6 Q;  2PI5 A;  2BAC A;  2IDE A;  1MU2 B;  1OWX A;  2DHA A;  3MPV A;  1WF2 A;  2E1R A;  1RDR A;  1XMO F;  2WVC A;  4IDK A;  5CZV A;  4C11 A;  4L74 A;  3Q24 A;  4C8M A;  4V19 J;  1TL3 A;  4RW4 B;  4AL7 A;  2F4V J;  4HHJ A;  1BY9 A;  4UOG A;  2ALZ A;  4QBU A;  5A76 A;  1TL5 A;  4M5J A;  3SFG A;  1JIH A;  1FKO A;  1WDD A;  1U0H B;  3EIC A;  4HDH A;  5B0E A;  3C6T B;  3MCN A;  5L46 A;  2LFV A;  3K8V A;  2ROP A;  2DGU A;  2H3E B;  2MMY A;  4DUZ F;  2G1H A;  2XYH B;  5HAO A;  2B51 A;  4DX6 A;  1ACM B;  4EO6 A;  1APS A;  2FHM A;  4NMX A;  1MWY A;  3FKB A;  5B7W A;  3EX7 B;  2HQ3 A;  1HNZ F;  1KR4 A;  1EB0 A;  2AJF E;  3S01 A;  1Q8K A;  4KPY A;  3CD6 S;  4DG1 A;  1FDA A;  2ADC A;  4ZCI A;  4EK2 A;  2C2M B;  3C8Y A;  3D54 A;  1LK7 A;  5I42 A;  3WIU A;  3J7A 1;  1L3K A;  2JH3 A;  2ZBR A;  2EKN A;  4J9V A;  1H74 A;  4L6V 3;  3CJK B;  3N9U C;  3NCR A;  1SC4 B;  2H4Y B;  3BH6 B;  3GIR A;  4YB5 A;  3MMC A;  3ZZY A;  2OPR B;  5G0R A;  3R3T A;  3HK2 A;  3DRX A;  1JXV A;  2QLX A;  2QMX A;  5T7L B;  2CAD A;  1HBU A;  4L3K A;  3M6U A;  4PKD B;  5HRO B;  1LFW A;  4JV2 A;  1TL7 A;  1A9N B;  1Y00 A;  1AT1 B;  1TAQ A;  4KE5 A;  4CH1 A;  2HWI A;  2IRX A;  5FD1 A;  4QQB A;  3VAI A;  1V5I B;  4F0M A;  1NDC A;  1FCA A;  3IBW A;  2D3U A;  1S79 A;  1JKH B;  3BZQ A;  1ZAX A;  2XGP A;  1HI0 P;  1RAG B;  3E01 A;  1NCL A;  7FDR A;  3MED A;  4OX6 A;  2XSJ B;  2YX7 A;  3GR0 A;  3GWC A;  3BSN A;  4CTA B;  3LP0 B;  2ROE A;  3AHP A;  4C0B A;  4DPY A;  1JXL A;  1XJW B;  4NRU A;  2ZKT A;  3MPY A;  3HT3 A;  2RDJ A;  1RYR A;  4TY8 A;  2BJ7 A;  4CO3 A;  3H98 A;  3QRQ A;  2DCU B;  4OHY A;  1N5T A;  3GG1 A;  2BRL A;  2YKM A;  2GC8 A;  4OI4 A;  1B3T A;  4MIB A;  1RSC A;  2E5H A;  2Q66 A;  5HLF A;  4FF1 A;  2LA4 A;  5HO4 A;  2V0N A;  3G2X A;  1TUW A;  4DLE A;  2J6U A;  2KXN B;  1DBD A;  1WKJ A;  2A10 A;  2QA1 A;  1FXD A;  3AQO A;  3KLI A;  4J9N A;  1HI8 A;  3BSO A;  4QYR A;  2F65 A;  3IS9 B;  4DV2 J;  1FRI A;  1U25 A;  2XEX A;  1S99 A;  4H54 A;  2I0X A;  4DR6 J;  5BYR A;  1NHV A;  1TKT A;  2B3T B;  2JC1 A;  2WB4 A;  3EVO A;  3IRX B;  4NA3 A;  3K57 A;  1BC6 A;  4TN2 A;  4ZVT B;  1SH2 A;  1EKS A;  3D66 A;  2CPE A;  4O3P A;  2YPZ A;  4EO8 A;  4CIO A;  1RYS A;  4KT0 C;  4ZHR A;  4FYY B;  2FC8 A;  2HS4 A;  1UA0 A;  1X5O A;  1RBL A;  3IWL A;  3PHT A;  1TR0 A;  3SFU A;  3G6V A;  1B7F A;  1RIS A;  1TU0 B;  3BGR B;  2JVR A;  2BJE A;  2RS8 A;  3FEX B;  4DR3 J;  3V4M A;  2AT1 B;  1FDD A;  5KFR A;  3WIV A;  3W9H A;  2YKN B;  5KT6 A;  3HHK A;  2FLN A;  1ZPV A;  2JX2 A;  3IBF B;  1YJ7 A;  1H2U X;  3C19 A;  4RBU A;  2O66 A;  3AD7 C;  2G0C A;  4LBH A;  4NLV A;  3W60 A;  2KG1 A;  2FB0 A;  4F2S A;  4RUH A;  1AFI A;  1T3N A;  2PN6 A;  3E51 A;  2OD4 A;  2M5Y A;  1RT6 A;  2DNM A;  4DV1 J;  3HSZ A;  4WU2 A;  3KG0 A;  4DQR A;  1UWA A;  1F60 B;  1R8A A;  3PYE A;  4O44 A;  2RH3 A;  3MED B;  3Q8P B;  2KT5 A;  3WX8 A;  4GVB B;  4RKU C;  4JV1 A;  1CPZ A;  1F3F A;  4YR0 A;  4M5D A;  4USU A;  4B9N A;  4WP8 A;  1IQT A;  3FCH A;  2C2N A;  2DBB A;  3LP0 A;  3KLF A;  3QO9 B;  2N82 B;  2Y1J A;  2LKZ A;  2AZ3 A;  1RQ0 A;  1Q0N A;  2Q6B A;  4UTG A;  2NXU A;  2L9W A;  4I0W A;  4K2X A;  5A8K B;  2QJ3 A;  2KB2 A;  2PSZ A;  3C6T A;  2HHP A;  3NS6 A;  5KFB A;  2BW7 A;  4WKY A;  3J80 Y;  2KJV A;  3FMW A;  3HXM A;  2YPY A;  1UVI A;  5LXR A;  4K4Z A;  4NCG B;  1XEZ A;  1F9E B;  2H65 B;  3DLE A;  1N52 B;  3IO1 A;  4HI2 A;  4KGM A;  4QIV A;  4DBQ A;  3CTR A;  4I7F A;  1AZS A;  4JUZ A;  4ETZ A;  4R8U B;  5F9N A;  5F8I A;  5DGB A;  4JI4 F;  3K7R A;  1BQM A;  3LPE A;  4LFC J;  2HS0 A;  1RB0 A;  3DHX A;  2YNI B;  4OYA A;  3KG4 A;  5KFK A;  2B8P A;  4KV8 A;  3DGP B;  2H5E A;  4JBC A; 
#chains in the Genus database with same CATH homology
 2CJX B;  2H5I B;  4JB8 B;  4ZVO B;  2XZD B;  2Y1L B;  2P2C B;  3R6L B;  2DKO B;  1I51 B;  1SC4 B;  2H4Y B;  3D6H B;  1IBC B;  1RE1 B;  2HBY B;  2C2K B;  2H54 B;  3RJM B;  2CNK B;  3R6G B;  3QNW B;  1RHQ B;  1RHM B;  1BMQ B;  3KJF B;  4DCJ B;  3R7S B;  2HBR B;  4ZVQ B;  3IBC B;  2XZT B;  1QTN B;  4ZVS B;  3D6M B;  2CNL B;  1QDU B;  1RWV B;  3P45 B;  2QLJ B;  2H5J B;  2FQQ B;  2C1E B;  2C2Z B;  3R7B B;  1GFW B;  2XYP B;  1RWM B;  1RWN B;  4ZVU B;  1RWK B;  3GJR B;  4DCP B;  3R7N B;  4ZVT B;  1PYO B;  1RWO B;  2H48 B;  3R5J B;  3GJT B;  2CNN B;  5IC4 B;  2CJY B;  2CNO B;  5IC6 B;  2QLB B;  4LSZ B;  2QLF B;  1RWX B;  2C2O B;  3IBF B;  2XYG B;  2QL7 B;  3GJQ B;  2HBQ B;  3P4U B;  1RHU B;  4ZVR B;  2HBZ B;  3EDR B;  3NS7 B;  1ICE B;  3KJN B;  5K20 B;  1NME B;  3EDQ B;  2QL5 B;  1SC3 B;  2H4W B;  2H51 B;  1PAU B;  1RHJ B;  1RWW B;  1SC1 B;  3SIP B;  1I3O B;  2CDR B;  1RWP B;  3D6F B;  2H65 B;  1F9E B;  2QL9 B;  4ZVP B;  3GJS B;  1RHK B;  2XYH B;  4DCO B;  1RHR B;  2Y0B B;  3KJQ B;  2C2M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...