2N7CA

Solution structure of plasmodium falciparum sr1-rrm1 in complex with acauca rna
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
89
structure length
89
Chain Sequence
GSHMVIRESVSRIYVGNLPSHVSSRDVENEFRKYGNILKCDVKKTVSGAAFAFIEFEDARDAADAIKEKDGCDFEGNKLRVEVPFNARE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords putative splicing factor
publication title The N-terminal RNA Recognition Motif of PfSR1 Confers Semi-specificity for Pyrimidines during RNA Recognition.
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
total genus 10
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2015-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2n7cA00
1ZH5A 1X4EA 3UE2A 1ZZFA 4YOEA 3I55S 3SMZA 1HA1A 2HGLA 2NLWA 1U1PA 3G96A 5GMKa 4LMZA 3PIPQ 2MQOA 1SJ4P 1VBXA 2DIUA 1YJWS 1VQ4S 2OSRA 3CCLS 2EK6A 4WKRA 1N52B 1CVJA 1FO1A 2DNGA 3G8TA 3G4SS 2AYMA 3MUTP 2KM8C 1JJ2R 2MKHA 2JWNA 2DNHA 2LECA 1OIAA 2ADCA 5MLCV 1VQ8S 1N88A 2CQPA 3VAKA 4W92B 3CCQS 1R8HA 1WTBA 2MQQA 2MY7A 2MHNA 2DB1A 2MZTA 2XNQA 5GADU 1WF0A 3CD6S 2G4BA 3BO2A 2DGUA 2DH7A 4BS2A 2I38A 1DZ5A 2NZ4A 1WEYA 4WIIA 2DNRA 4PR6A 1UAWA 2DGQA 2ZJPQ 1QVFR 2LXIA 1X5SA 2MKIA 2KHCA 3U1MA 3U1LA 2ZJRQ 1PGZA 1OO0B 2RNEA 1WG4A 3UD3P 3BO4A 2DK2A 1AUDA 2OTLS 3FEYB 2CQIA 4Z2XA 1VQ6S 5LJ3Y 3RW7A 2RU3A 5D77A 2LQ5A 1X4DA 3P3DA 4TU9A 3SDEA 3CCES 2A3JA 2KM8B 2KG1A 2RS2A 2FY1A 3V4MA 2DGXA 5LXYA 2XNRA 2DNNA 4IOCQ 1L3KA 4QPTA 1FHTA 1O0PA 3R1HA 2OIHA 2LCWA 3CCMS 4IOAQ 2LA6A 5JVHQ 2ERRA 3UCGA 1FJCA 1KQSR 3US5A 4C4WA 1X4FA 4PRFA 4Y00A 3CXCR 2YWKA 2XB2D 2CPXA 1K73T 4TLQA 3Q2SC 3THTA 5LSLA 2LKZA 1UP1A 2DNQA 2FC8A 1G2EA 2CPYA 2E5HA 1Q86T 1U1QA 1P27B 3MI7X 1DRZA 4PKDB 1YIJS 2DNZA 1Q81T 5IM0B 2J8AA 1X5TA 3CULA 1X0FA 2CQGA 3LPYA 1PO6A 4F02A 2CQ2A 2DNLA 2E5GA 3R27A 2X1BA 1VBYA 1S72S 2CPFA 2FHOB 3DLLQ 1X4GA 3VAIA 2XS5A 1WI6A 1F9FA 2JRSA 2E5IA 4F26A 2MQMA 2JVRA 1VQNS 2B0GA 2M2BA 2MGZA 1M1KT 2MSSA 1HD1A 1OWXA 2GHPA 3EGNA 3P49B 2KU7A 2MXYA 4J5OA 2MKSA 2MZJA 1H2UX 1YHQS 3S8SA 1Q7YT 2AYBA 5GVQA 2KI2A 2M8DB 2GO9A 1W2BR 2HYIB 1X4AA 2DNPA 2VODA 3NMRA 1FT8A 3CCRS 2DGOA 3G71S 2G0CA 1S79A 2LYVA 3NS6A 3G6ES 2F3JA 3TP2A 2KXNB 4EGLA 2AYEA 4OZ1A 3ZZZA 3PIOQ 4ERDA 1ZZNA 3EGZA 4WFAQ 2VOPA 3P5TL 1SJ3P 2XS2A 3CC4S 2F9DA 5D78A 4WFNQ 5EN1A 4V19X 3VAFA 4LJMA 4C7QA 2MSTA 1IQTA 3CC7S 2X1GA 2DISA 1WF1A 1Q82T 4Y0FA 1WG5A 2KFYA 2MPUA 2KT5A 2V94A 2CQCA 2JVOA 2DGTA 1YWXA 5HO4A 2MKJA 4OZ0A 1H2VZ 2N3LA 2CPJA 1U1MA 1URNA 1JMTA 3VAGA 2VOOA 2M7SA 2DNMA 3BO3A 4WCEQ 1SXLA 2SXLA 3UCZP 1NJIT 1M90T 5H1SV 4QU6A 1FXLA 1KOHA 3J7YU 1H2TZ 3MUVP 1WEZA 1KD1T 1VC5A 4YUDA 3D2WA 2HGMA 2WBRA 1KOOA 2X1AA 2U2FA 2XS7A 2L41A 4QU7A 3H2UB 2OJ3A 5GAGU 1JJHA 2CQ4A 3RW6A 1M5VC 2M4MA 1DHMA 2CQDA 2CJKA 3NNAA 4ED5A 2YH0A 5BJRA 1D8ZA 4YB1P 2ADBA 1VQMS 3CCUS 4RU2A 1K9MT 1B7FA 1WF2A 2DHSA 3FEXB 2LA4A 1YJNS 2O3DA 1VC0A 3MDFA 2LXUA 2DH9A 1WHXA 2EK1A 2DNYA 2HGNA 2L9WA 3HI9A 5DETA 1VQKS 3ULHA 2MB0B 2MZ1A 1DBDA 5CA5A 3BS9A 1D9AA 2KH9A 2KRBA 2DNOA 4FXWA 1WEXA 2YKAA 3SDEB 3VALA 1U1NA 3UWTA 2J76E 1X4HA 5ITHA 1OPIA 1RK8A 1VQ9S 2M88A 4CIOA 2RQCA 2RRAA 4LIRA 4WFBQ 2QA4S 4IUFA 3IRWP 1WELA 2MQPA 5DM7Q 1VQ7S 2MKCA 3TO8A 1VQOS 2KYXA 2RVJA 1H6KX 2M70A 1U2FA 2U1AA 2OSQA 3NNCA 4M5DB 2E44A 5IFMA 1X5OA 2DO0A 3MD3A 1UW4A 4CQ1A 3G9CA 2N3OA 3DXBA 1X4CA 1WHVA 2D3OR 2CPHA 4FXVA 2E5JA 2MYFA 3VAJA 2RRBA 2UP1A 1SJRA 1X4BA 2G1DA 2BOPA 3HHNB 4UY8T 5GAHU 1VBZA 3G8SA 3CTRA 2DHGA 2MKKA 1M5OC 2CPDA 1U1KA 1X5PA 2F9JA 2N7CA 1FJEB 3MD1A 1FNXH 2M52A 4CH1A 2I2YA 2CPIA 2MGZB 2Q79A 1VQPS 1WI8A 1YJ9S 1RKJA 3Q2TC 1WHYA 2DNKA 2JX2A 2DHAA 1VC6A 1VQLS 3H2VE 3THPA 4IO9Q 1K8AT 2N82B 1U1RA 2J0QD 2KRRA 3CPWR 2YTCA 1WHWA 3OW2R 1HD0A 1N8RT 3NNHA 2CQ1A 1U6BA 3CCSS 1SJFA 2K8GA 2MMYA 3S6EA 4TU8A 2DITA 4U67Q 5CXTA 2CQ0A 2L08A 2RT3A 3I56S 4ZKAA 2D9PA 3B4MA 2LEBA 1WG1A 2BZ2A 2MJNA 1QM9A 1U1OA 3EX7B 2RQ4A 2DGVA 4WF9Q 2M8HA 1SJQA 4UQTA 1YITS 2J0SD 4QQBA 5GAEU 1KC8T 2X1FA 2CPEA 5HL7Q 2MZSA 5DDRC 2QEXS 3SXLA 5DDPC 5IM0A 3CC2S 5CYJA 3JB9k 3S01A 2KN4A 1A7GE 1VQ5S 3IWNC 3BEGB 3CCVS 1M5KC 3MXHP 3CUNA 2MY8A 2DH8A 2DGSA 2MQLA 2EVZA 3ZZYA 4CH0S 4A8XA 2HVZA 2DIVA 3CF5Q 5JVGQ 2YH1A 3LQVA 2AYGA 5IQQA 3CCJS 2MZRA 5DDOC 3CMAS 2FC9A 3UD4P 2XSFA 2KXFA 3R1LA 2LMIA 1JJ4A 2VONA 4W90B 2DGWA 2CQHA 4TU7A 2OTJS 1WWHA 1A9NB 2ZJQQ 1N54B 2M0GB 4P6QA 3B4DA 1M5PC 5LJ5Y 1NU4A 2QFJA 1HL6A 2KVIA 1BY9A 2DO4A 3TYTA 2FPHX 5LSOA 1NO8A 3NS5A 5LXRA 5DDQC 1FJ7A 5DM6Q 3MURP 3VAMA 3N9UC 1YTYA 3P6YC 2KXHA 2CQ3A 2PE8A 4C0OC 2DHXA 4F25A 2KG0A 2CQBA 2D9OA 2LEAA 2AD9A 1U1LA 1UFWA 2M9KA 2RS8A 1U6FA 3L3CA 2MZQA 1XN9A 3J7ZT 3VF0B 3S7RA 3CMES 1P1TA 3MUMP 2HZCA 2MJUA 3K0JA 2CPZA 2MQNA 3UCUP 5FJ4A 2PEHA 1QVGR 1R8PA 1YI2S 2K3KA 2RUGA 3MOJB 3VAHA
chains in the Genus database with same CATH superfamily
3HDSA 4LR7A 2J9DE 1HA1A 3G96A 5GMKa 2VHGA 4JI4J 3BKFA 3JAMY 2WB1D 3DC2A 4QYRA 2OP5A 1N52B 3G4SS 4M5LA 2XSJB 3AB2B 5DS7A 2R3VA 3FNNA 4MT1A 3ZZPA 3LGNA 1D9DA 2CRLA 4KB7A 4ED3A 2CWKA 2XMMA 2RKIB 1FRIA 5DQGA 4JI1F 3GFZA 4MYTA 1UAWA 4KR0B 2Z8QA 4FPRA 1XNQJ 1WG4A 1UVLA 2KYZA 1AUDA 2DVIA 1TL4A 3OLBA 3RRKA 1IR2A 2JLEA 3IM8A 2HNDB 2F65A 3L09A 3TA2A 2DXEA 3CCMS 4HEA9 2IJRA 4DQPA 1VCTA 3PFEA 3L95X 4Q8FA 1K73T 2EFNA 2LKZA 4RNOA 5F8HA 2RDDA 3E01B 1P27B 4F3QA 1S57A 2E5GA 1T9WA 2JEIA 1UTAA 2QJ3A 1JLBA 4GRSA 1EETA 4QWDA 3PR4A 1DQ9A 2JVRA 3GLJA 4DUZJ 1RTDA 1JLFB 2QGFB 1AT1B 4X64J 1O51A 2LVWA 3IAS9 4M5NA 2KFZA 3NWGA 1S10A 3V6DB 4NLXA 4JI0F 2ZH2A 5AE2A 2KXNB 4I1TA 1C1BB 1XK8A 3I87A 2GNKA 4AQYF 2EWHA 2IM3A 2APOA 4DLGA 2EKNA 1R43A 1G4CA 2A2CA 3NP5A 3BDEA 1WF1A 2AHOB 1U49A 2MPUA 4RW6A 4OZ0A 5B0AA 2HMIA 4DR7F 4XK8C 1UWBB 2G0IA 4GKJJ 1DTTB 3D2WA 2VBXA 2X3DA 3Q23A 4UY85 2N4CA 3RRGA 2Q43A 4Q2LA 2WONA 5E2QA 3H2UB 3ETOA 2XQCA 2LP4A 3RW6A 2PO4A 3DRSA 2NREA 1JXVA 4P7TA 3FMBA 1I5OB 5KG7A 2BQRA 4YB1P 1S6PA 3TA0A 4RU2A 1YJNS 3H8YA 4ED1A 2IRXA 2K7KA 2HZVA 1HBNB 2DT9A 5HVFA 4FXWA 3LGHA 2YKAA 2HBRB 5ITHA 3GV7B 3NWRA 3KMSA 2P2CB 3QRPA 1KHVA 4NE9C 2GVZB 1NKEA 4CIOA 4F0HA 4UQGA 3SSSA 3TOQA 4DOZA 1TL3B 2P9EA 5HN0A 1WELA 2XSJA 5IFMA 1X5OA 4DZ6A 2IA0A 2RKIA 2QT7A 4ZN1A 5EWEA 2CJQA 2UP1A 1RAJA 1SJRA 4AXIA 4CLWA 2C2RA 2DEIA 2VPWB 4KQZA 4LF7F 5T41A 5THWA 4LUBA 3NCPA 3K17A 1CBKA 3EXYA 1FNXH 2RAQA 2FUG9 3RJMB 2HNDA 4IO9Q 3GE9A 3MR7A 5J2PB 2YTCA 1WHWA 3KHHA 1N32F 1C2PA 1DQ8A 3GCXP 1UETA 1SH3A 1QM9A 2V9KA 2RQ4A 5KFGA 4K4VA 2C1EB 2X1FA 3E01A 4XTTA 2XMTA 1GXLA 5CYJA 3G6VA 3BEGB 2UVRA 3PHEA 2KKHA 2B3TB 2MY8A 4JI4F 2OPQB 3KHGA 4M5IA 3OL9A 2VQEF 2AX0A 1UJ5A 1JLFA 2WB4A 2F8HA 2MZRA 3M8RA 1FCAA 3FFIB 2K2PA 3V6DA 2C3MA 1PYSB 3SI8A 1NU4A 4Z7CA 3SIPB 3M8SA 1C1BA 3WQPA 1TFYA 2HQCA 2V50A 2D3UA 5LXRA 1FJ7A 4FNHA 1CJTB 4ELUA 1U1LA 4ZITA 1LK7A 1UFWA 2M9KA 2CUYA 3OL7A 3IO1A 2PEHA 2R2RA 4I0WA 3N6NA 4PWDA 1JLGB 3J81Y 3W9HA 4YOEA 2W8KA 3K5LA 3JS9A 2JDJA 1FWKA 1VBXA 2HQ3A 2ATCB 5J2NB 4GO5X 2DNGA 1UWBA 4TN2A 4OX9F 4YN3B 1SB6A 3QT5A 4TQRA 2KM8C 1DTTA 2LLZA 3MEKA 4RUAA 2MQQA 2NXEA 5AXKA 4ZVTB 2P5VA 2PGCA 3D0GE 1HI1A 4ZCMA 2DNRA 2JNJA 8RUCA 1T3OA 3HKWA 4B02A 5FDLB 3U1LA 3PYFA 3UD3P 4LF9J 1RWOB 2XCAA 3QGGA 3RW7A 3PKYA 4DUZF 4P75A 2VF3A 1HBNA 3HD2A 3IR5B 4X64F 3FCWA 1U02A 1ICEB 2GVZA 3FC9A 4XPEA 1SI9A 1VFJA 3CB4A 5J2MB 5KFOA 1HWKA 1TL3A 1Q95G 3UCGA 3CD0A 4OYMA 4F4ZA 5IT0A 1FK9B 5KFSA 4FVCA 4KHPF 1FNMA 3I0RB 1FE0A 2B9YA 2HHPA 1SL2A 2PD1A 3PO5A 2G2ZA 4NYOA 3GSDA 3HJVA 5T14A 3ZNUA 5FLXY 4XDCA 3OSPA 1RAOA 1NJWA 2HS0A 3GMGA 4CP5A 4OLPA 4JV5F 3A13A 1VQNS 2KZZA 3CD7A 1EAYC 3WDOA 3BF4A 3FBCA 4BBYA 3D6HB 3KK2B 4GKJF 3VGVA 4Y6IA 4NZ0A 3RU0A 2KI2A 1IBLJ 5J2PA 2F3JA 2QL9B 1IQZA 3PIOQ 3LWMA 2F4VJ 4OJGA 3D1HA 1ZZNA 3MF5A 1REVB 4HR2A 5KFEA 4ED2A 3EZUA 3CJTA 2ASDA 1CQNA 2GA7A 2VICA 2IHR1 3D6MB 4A8MP 1PSDA 1ZA2B 4JI7J 2EFGA 4C11B 3IC1A 2DGTA 1YWXA 4LF8J 2ACYA 3CVKA 5KFRA 4LIWA 4L3NA 2AMCB 2OPQA 1ZPWX 1IXKA 1HR0J 1BWVA 2VC1A 1AA1B 1SPBP 2EFOA 4IH7A 4OX6A 4OJHA 3PJXA 3TZZA 2V63A 2F4FA 3FFIA 1U09A 4DEZA 4GO7X 2C2MB 1DFDA 5KG4A 4KH1B 4DCOB 2ZFHA 1CJTA 2ZWOA 1KEKA 4DV2F 4I2PB 1VQMS 3C6TB 3CCUS 1B7FA 1VDHA 4B9NA 5F9LA 1WHXA 1SQGA 3BR9A 2MKYA 3MM8B 1JLGA 2AWZA 3MPYA 3PW2A 3OJUA 4HL9A 4CI0B 4UW2A 2M88A 2AF6A 4H4MB 5J2NA 2NZCA 3FSXA 1MU2B 2FHJA 2QA4S 4A8OA 4IUFA 3AY0A 1RQ0A 1NZ8A 4RKUC 2RHSB 4X4UA 2ZH4A 2B9EA 3PCOB 3DOKB 4Q2MA 4TLRA 4ZIWA 3ZZ0A 4OL8A 3LUYA 1NDPA 4RUBA 1C0TB 4N47A 2N3OA 4LRAA 2YKQA 2JJ4D 4R0EA 5ETSA 3EVWA 2Z2MA 3DRRB 2WSCC 5CQGA 5FDLA 1RAGB 3IRXB 1U47A 4LBPA 1S99A 2AV5A 3DU6A 5DG8A 2CPIA 2BM1A 2CKWA 2Q79A 4LT6A 2HBQB 2KRRA 1VOMA 5KFJA 3J7AN 1ZAWA 5J2MA 2VG6B 1ZETA 2Q3PA 4OYXA 3G6XA 3TJ8A 2BRKA 3UR0A 1FK9A 1LW2B 3D3BJ 5B0GA 2AGOA 3I0RA 5GAEU 1EIYB 2CPEA 1FVSA 3MR2A 2QEXS 5SUHA 1MWQA 2IM1A 2ZBRA 3S01A 4OV6A 3IWNC 1D8YA 3KHRA 5MAOA 3NS7B 3U02A 2MLXA 2PSZA 4ZN3A 3W2VB 1U6ZA 3S1TA 3KK2A 2BKPA 1F2GA 1FXRA 1APSA 4P10A 3R97A 2AP6A 5IQ6A 3H40A 4HI1A 2W24A 1REVA 4EUVA 4KH0B 2ZNZA 2HK2A 5F8MA 1R89A 4A48A 4YB5A 2MJUA 2CPZA 4LF9F 1VMBA 1HPZB 3OTOJ 4C11A 1EKRA 1YZ6A 1PJ5A 4OYZA 3BN4A 2XLIA 2W1BA 4A8WA 1V9OA 2B5JB 2GHWA 5D4OA 1HNWJ 3V4IB 5A2QY 1H38A 2AYMA 3IA0A 1YJTA 2WVDA 2R8IA 4AL7A 3TUJC 3CCQS 4G3IA 3I9ZA 3OFFA 1PC5A 1BMQB 4K4YA 3RR7A 2DH7A 1Y00A 1Q5VA 1JWWA 4I2PA 3C6TA 4DN0A 1G1XA 1UMJA 2Y1RI 5KFYA 3KWMA 2V8PA 1IR1A 3EWGA 3MM8A 4LR9A 2VFUA 1X4DA 2XWXA 3SQOP 3QT7A 1NHKL 2BM0A 4H4MA 1IBLF 5K8MA 3M1VB 3UDEA 1MU2A 4OX7A 2UXCJ 4AUKA 2F4VF 1KQSR 4PRFA 1YQHA 3GR0A 3BPSP 3DOKA 3PR5B 3R5DA 2ZVSA 1C0TA 2QL5B 3UVJB 1UP1A 5F8NA 3DRRA 1N36F 4JI7F 2RQMA 1TL5A 3H4DA 3R27A 3OFEA 2ROGA 3H4BA 4LF8F 2V34A 3M7VA 3DLLQ 2V68A 3IRXA 1LK5A 1S1WB 2OELA 3K8VA 2IM0A 2MSSA 2E1MC 1QTMA 5IT4A 2QO3A 1HR0F 4J5OA 2M8DB 4C3LA 3G6ES 2VG6A 4L6V3 1XR6A 3NGDA 2AYEA 1F6TA 1Q1KA 2BJ8A 1F2HA 4RUCA 1LW2A 3BGFA 2OI2A 4WBFA 5KFFA 3TRGA 2HHHJ 3VAFA 3OQ2A 3UQSA 2IIHA 3GJSB 4NYZA 4QR1A 5HMXA 3EDQB 2R7XA 4PG6A 3KNAA 3W2VA 3HFZB 3PW7A 3KJVB 4OI4A 3DHWC 4WFZA 2WBRA 1KOOA 4B9MA 2U2FA 4PUOB 3I82A 2W7PA 4CO2A 3GU0A 1BQXA 3VQTA 3HHLB 2HRUA 1NSAA 2YKOA 2LA4A 2O3DA 5DO2A 2W4PA 4ES1A 4ZVPB 3J81j 4WP9A 5T7LB 4ZLJA 4ILLA 4OIXA 1HPZA 4M5GA 4IYQA 1BGXT 1HYSB 4KGVB 1WEXA 1KFDA 2HVIA 3A1YG 4YDXA 2B5JA 1GX6A 3HVAA 5I3UB 4URSA 1GTEA 3V4IA 2Y1IA 5HLFB 1Z4UA 2R7OA 5EGYA 2XO6A 3TO8A 2KYXA 5CYMB 4ECZA 9RUBA 4ZOSA 1FWPA 1X4CA 2OPSB 4B3SJ 2MYFA 1OY6A 1R6VA 2G1DA 3H98A 3CSKA 2WVEA 3SCLE 2FJVA 4MMOA 2JSXA 4HVZA 1LOUA 1BUXA 3CW2C 2MGZB 1FFGB 1VQPS 2ZC4A 1XEZA 5D15A 3UD5A 3DNCA 3THPA 1HHTP 4OZ2A 3HHDA 3JQKA 2UUTA 5M2UA 1AUSL 3M1VA 1G3OA 1HQ2A 4F50A 2ZZTA 3E51A 5A8KB 1E6VB 2QG9B 1DLOB 3I56S 3DLEB 3B4MA 2R9LA 4KIAA 4DV5J 3EPGA 2VFTA 1X9WA 3UVJA 3G6YA 3O8WA 4NEYA 2BR0A 2VD3A 3JB9k 5L9XA 1RAEB 4PG4A 3W60A 3K59A 2R7RA 4EBEA 3RZAA 3RAXA 1S1WA 3KNGA 1RA6A 3NKYA 3VVTA 1HNWF 3CDBA 4NLUA 3MZIA 4DXLA 2FC9A 3UO0A 3CDAA 3R1LA 2ASYA 4F7VA 1Q8IA 2BE9B 1BY9A 5ETMA 2MHEA 3C8YA 4P7VA 5DJBA 3QGIA 3MURP 1YTYA 3TVZA 4ITSA 4GVBB 1URRA 4DG1B 1NNDA 1I94F 2HRTA 4P2MA 1T11A 3R5AA 5K5MA 3I96A 4ZP8A 3ZC4A 3MOJB 1PKUA 3MMAB 4YP3A 1KFSA 4N56A 1U0HB 2V8VA 2GVDB 1M5HA 4LSNB 5KG5A 2NQPA 3KJVA 2XHCA 2UXCF 2I5JB 3MUTP 1YX2A 3BN7A 4PUOA 2CNNB 3H5YA 2DCUB 1Y5LB 1WTBA 2RMLA 2CG8A 1Q16B 4A8SA 1DZ5A 3QZ8A 1WEYA 4ANEA 2ZDOA 3W3SA 3HHLA 4F4AA 3Q8YA 1ELOA 2MKIA 3NMAA 1RHQB 4ZP6A 4IDKB 2ZJRQ 5T7LA 1DY3A 4DR4J 2J7WA 5KFTA 5H9EJ 4N41A 4U7CA 1HYSA 1SV5B 4URGA 2I8EA 2KM8B 2A10A 1VQSA 3X3UA 3T1AA 5I3UA 3OSNA 5HLFA 5HMWA 2AEFA 1Q8BA 3R7BB 3C15B 4P9SA 5CYMA 4OYIA 1O8BA 3D66A 4ZVFA 4H4KA 3L7OA 1S0MA 2HHHF 2OPSA 2DRDA 1RTJB 4WWSA 5AJ3J 3EZ5A 1SC6A 3AOCA 3LPEA 4RW8B 1X4GA 1YBAA 2D74B 2JRSA 3DLKB 3EMTA 4LQ9A 1W26A 2MGZA 4CDIA 5J2QB 4R5PA 1FI4A 4ZPCA 2RD5C 2MXYA 3T5LA 2MKSA 4EMDA 3DDKA 2J6UA 3ET6B 2HYIB 3NMRA 3K5OA 2GQ2A 3TP2A 3WX8A 5A8KA 1E6VA 2J7UA 1DLOA 3DLEA 3AXMA 1UEVA 3T1HF 3RUBL 1VRTB 2FJEB 3BBCA 5DG7A 2B4UA 1X9MA 4K8RA 3Q8UA 2Q1LA 4V19X 1JLAB 1CSJA 4DR6J 6FDRA 1NXIA 4Y0FA 2EC2A 4HH1A 1HWLA 2MKJA 3QO9B 5BR8J 2N3LA 1Y3KA 2M7SA 2Q66A 1H73A 4YQWA 1P1LA 4WCEQ 3KLGB 1G6BA 2EFVA 1RBAA 1RA7A 4UT4A 4YUDA 5G0RB 4J9SA 1XQIA 3CJ5A 4NLYA 2XS7A 2CNLB 2HLUA 2OJ3A 1M5VC 3VWSA 4B3SF 4KC5A 2AGQA 1D8ZA 5KG0A 4QOTA 4GVBA 4DG1A 1LV5A 3T9NA 3EPIA 5KFZA 3CJ4A 4OI1A 4RL1A 3LGMA 2X7IA 2KRBA 3MMAA 1SKWA 1LWCB 2J76E 1D9FA 5LSRA 1VQ9S 1U0HA 3ILIA 5KFKA 2GVDA 2FJXA 1GFWB 4LSNA 4WFBQ 1RTZA 2I5JA 3RG6A 4DV5F 3ELHA 2WZ1A 4V19J 2V8HA 4LREA 1NSQA 5GAHI 3B82A 4FNIA 4IDKA 4NMLA 2CADA 1FJEB 2BE7D 1CLFA 7AT1B 1RSCA 1SV5A 1RI7A 2CJYB 4DV7F 5D0HA 5LMNJ 1QAXA 2DHAA 2UV8G 2C2EA 2G9OA 4I64A 3M30B 1U1RA 3SEOA 4DBQA 1FDDA 3G8QA 4QZVB 4U8VA 5E3AA 5IWAF 3S6EA 2ZUGA 3C15A 1NK8A 3FCVA 3KDNA 2AJFE 4QCLA 4WF9Q 1JLCB 2HW3A 4ZJQA 4DV4J 5EDWA 2YNIB 2RF2B 1RTJA 2XTJP 4DV0J 4ANDA 1J5OB 2FQQB 2FZKB 4IRDA 2J0WA 4RW8A 4YDDB 3DLKA 4J9OA 1UA1A 3HXMA 3IAM9 1S6OA 3JSBA 5B0EA 5J2QA 2CFXA 2KXFA 4ZPDA 4AT1B 1WWHA 3ET6A 2M0GB 2HAIA 3HHEA 5LSOA 3MFHA 4G1IA 1NSPA 2YWFA 4NRTA 2KG0A 1VRTA 3RBXA 3TEGA 1P9QC 2WVFA 3L3CA 3AD7C 1NDLA 1JLAA 2IRUA 2UUWA 3MUMP 2UV8A 3GV5B 2PI4A 5E0OA 4ECVA 4WYLA 2XM3A 1N5YB 2FVCA 3QO9A 3TVYA 2R4FA 4PG8A 3CWJA 1HFEL 1T9VA 1Q78A 3KLGA 2LDYA 3H25A 1MLAA 4I67A 3KHLA 4MK7A 2HIYA 5G0RA 1FD8A 1OIAA 3VAKA 4JI6J 2RB7A 3PEHA 3RGIA 2ZWPA 4PG7A 2R8GA 2XNQA 1WF0A 4L73A 4J9PA 5F8JA 1UPMB 3MCMA 1S1TB 1AZSA 5AJ3F 4K0KF 2RQKA 1N33J 1B0VA 1XR7A 2Y1JA 3U1MA 4J91A 1PGZA 3O5TB 1NHVA 5KT2A 1KP6A 2FJDB 4O44B 3GZ7A 4FP9A 2H4WB 3Q8SB 3PZPA 4I69A 4HT5A 1LWCA 1KTQA 1YK9A 3QJLA 5LXYA 4GC7A 1SC3B 3BYRA 3T6BA 4WZQA 2EC0A 4QIGA 3HO1A 3T9ZA 2UUBJ 1U8WA 1UVNA 3THTA 5I4MA 1S0OA 1ZM4A 2V2KA 1Q81T 2CQGA 2WOMB 2CPFA 4ZP9A 2O5DA 2H48B 4NA2A 1LXJA 1W7WA 2X3GA 4YHHJ 3FRYA 1S1VB 3AOAA 3H7HB 5CABA 1TVRB 3FJ2A 1H2UX 4I68A 1S5ZA 1ZM2A 3M30A 3EDRB 2NXCA 3KDOA 3M9OB 1TQLA 1ACMB 4YS2A 5KFWA 2IBOA 2GW8A 2AJQA 1JLCA 2XS2A 1RGVA 1UPPA 2YNIA 2RF2A 1QAIA 3CDWA 1RP5A 3EXCX 4LJMA 4CWBA 4UUWA 4X4SA 2R7TA 2FJBB 3D28A 1J5OA 4B3RF 3L7PA 3QLHB 2KFYA 5B0CA 3K89A 2WBMA 1SKUB 1MMDA 2N7YA 3G86A 4RO0A 1RBOB 3FEZA 2KB2A 1T94A 2OH2A 2HFUA 2BJ9A 3K58A 1KD1T 4C3KA 1F3VA 3QBCA 2L41A 3QAEA 2WHOA 2XZTB 3FSYA 4OMFG 4YMEA 1R0CB 2PMZD 4DCJB 1S9EB 4HHJA 1UFKA 1YJUA 2H3EB 1VIOA 1TMJA 3HI9A 4AL6A 2QZ8A 4CTAB 2ATLA 1KRPA 3B78A 1N5YA 5LMNF 4ZHRB 2A18A 3CNQP 3BQ2A 1REGX 4I6WA 2VJUA 1UA0A 1H7WA 3PM9A 2FJAB 3J7A1 1ULRA 4DL0C 3MAAB 4QWCA 1UFLA 3G9CA 4ZVHA 1HBMB 2D3OR 1S1TA 2VA3A 1MMNA 2IA6A 2WTFA 3GILA 2FJWA 3G87A 4O44A 2PIIA 3ISZA 1PYTA 1R0BG 2JX2A 1VQLS 4FKXA 2CJXB 1R0AB 1IVZA 4ZP7A 1DAXA 2JFDA 1QLNA 2XULA 1U1OA 4DSIA 4DX5A 3EM1A 5FIIA 4UQTA 3N79A 4FYVB 4IH5A 1X8DA 1KC8T 3O2IA 4OZ3A 3CC2S 1A7GE 4IFVB 3W7BA 3IM9A 2WOMA 2ZITA 4TXSA 5IOLA 3IP0A 5C2CA 2MQLA 1S1VA 3AODA 2HHUA 2AYGA 1TVRA 1YRXA 3EZOA 1L3TA 1WC5A 4DL6A 1A9NB 2ZJQQ 2QYCA 1O5JA 1RWUA 4JI6F 3CJ0A 1TUVA 2ZZNA 4U95A 2AT1B 2PE8A 2CQBA 2XYGB 4LF6J 1N33F 1V3ZA 2RS8A 5KTQA 3J7ZT 1S0VA 3CMES 4ETZA 1N0UA 3OD2A 3QLHA 2AEMA 2JOQA 2DJWA 4MTPA 4USHA 3DLJA 2V4QA 4ELVA 1ZTWA 5IZHA 1K1QA 2LECA 2UUBF 5ETKA 1VQ8S 1N6QB 1N5TA 2MY7A 3WC2A 3L4BC 3LAMA 5GADI 4XO0A 1Q7LB 1S9EA 2QL7B 1TKZB 2KHCA 2CZ9A 4YHHF 1RUSA 3FEYB 5C7PA 2CQIA 1NKBA 4CTAA 4XAKA 3F44A 4FKYA 2Y8YA 3IFEA 2XMKA 3M05A 4ZHRA 3HKZD 3IMQJ 2FY1A 1RACB 4F0KA 1I1GA 3GG1A 2OMOA 2XBPA 2DNNA 3FMWA 4HH0A 1H0HB 2XO7A 4OQJA 4MYUA 4ZS6A 4CH7A 3US5A 1X31C 2F8MA 3MAAA 2XB2D 1RLCL 4JUZA 2F5GA 1HBMA 4ZPWR 1U1QA 2R7SA 1NEEA 1F5AA 2J8AA 1JKHB 2BRLA 1T7PA 2QA4G 4ID8A 2XS5A 1H74A 3PNIA 2YBVA 1NPKA 1HD1A 1VJQA 5B7WA 3S8SA 3IGVA 1Q7YT 5D4LA 5EUHA 1RT4B 2NUUG 1X4AA 1R0AA 3G71S 5E3QA 2BABA 2ASJA 1DURA 1RT1B 3UFCX 3R2DJ 1IKYB 2IAJB 5C42B 2E9ZA 3LA0A 5J1EB 2DPJA 1SKSA 3DMJB 2MSTA 1RT6B 5GMEA 4DZDA 2KT3A 4IFVA 4N5SA 4NLGA 3KK3B 2KT5A 2V94A 3BKTA 4AYBD 2DRAA 2CPJA 2UUCJ 1IUJA 3VAGA 4EYHB 1JLQB 2LQ8A 3M4XA 2GIFA 2QLXA 4FYWB 4QIFA 4NYPA 4NCAA 1RXOB 4O4GB 1KQGB 4ICLB 1NLKL 3T5JA 3R7NB 1FX2A 1B0PA 1VHIA 2JHEA 4ER8A 2Y9HA 4DQIA 3IN5A 1LWXA 4XIUA 4YY3J 4JP8A 3MDFA 3Q86A 1DARA 3OPKA 3P45B 2GAGC 1RWPB 2KH9A 1S6QB 2DNOA 3HF5A 3SDEB 1U1NA 2F1FA 5D0GA 3OT9A 3TEHB 5KFUA 4Z37A 2J7KA 4WK3A 4LIRA 4D3HA 1VI7A 2ZOFA 2CA9A 1AB8A 3RYLA 1N6QA 3FVYA 1HNXJ 2PFFB 2GX8A 2ZKUA 3BBBA 1WHVA 4J9MA 2RRBA 3P96A 4JOUA 2R2TA 1TKZA 1PILA 1S7HA 3R2CJ 1XMQJ 3BKUA 1LKZA 1RKJA 1TZ0A 1NK6A 2CNOB 3EJMA 1OJ4A 1XNRJ 3W63A 1BD6A 1F9HA 5DG9A 2OO4A 4DFMA 4K50A 3TR5A 4LF6F 3UNYA 4KGKA 3IBWA 2CJ9A 1JKHA 4J37A 5M2RA 3CCVS 4DF8A 1YJRA 4Y34A 3DRPB 4EI2A 3HP6A 2HNZB 1KVKA 3CGIA 3WIUA 3PEJA 5JVGQ 2Y8WA 5A6PA 5IV4A 3CDUA 5JXSA 2OTJS 1RT4A 5LJ5Y 2KVIA 4B3MJ 2FPHX 2BUNA 1KHWA 1NO8A 1PYOB 2FHMA 2WRMA 4TY9A 5D0RA 1RT1A 1RE1B 1IWGA 3IWLA 1IKYA 2GMJA 2IAJA 3CJKB 1U6FA 5C42A 5J1EA 1FJGJ 2DY9A 3DMJA 1P1TA 1RT6A 3F41A 1R8PA 3TNVA 3HZEA 3KK3A 1TTHB 5CHCB 3J80U 2W9CB 2E1RA 4X65J 4F67A 3PIPQ 2DIUA 4KTQA 1JLQA 2PMHA 3HSJA 3H42A 1GK8A 2OAUA 2GQQA 2OEMA 4QWBA 4O4GA 4W92B 1U45A 3N6LA 4ICLA 2G13A 3CD6S 4L75A 5CD4H 1FVQA 1YJ7A 3TZXA 1NK9A 4HI2A 5H9EK 5HVHA 2DGQA 1AXQA 3CEDA 5I42B 1YBUA 3SCKE 3NGKA 2DK2A 3I0SB 3KJQB 1FKPB 1YGYA 4ENOA 2GFFA 3BZQA 1S6QA 4DV1J 3DKDA 3SDEA 2XNRA 4L72B 3R1HA 4DSLA 2H51B 4Q5VA 3V81B 1UJ6A 1FJCA 4OI2A 4CLTA 1Q79A 3LANA 1NKCA 5EWGA 4O3OA 4OJ3A 4J9RA 4HKQA 2IY5B 4TKTA 5I3PA 1SQFA 1TUWA 2W8LA 3PW5A 4PKDB 5IM0B 3BH6B 3LPYA 1VBYA 4ZPTR 4USMA 3RR8A 1V6HA 1KQFB 2M2BA 4WP8A 1XBWA 3R6LB 2B4PA 2E5LJ 1YHQS 2GIQA 1TKTB 1PAUB 2VU5A 1FT8A 3CCRS 2HLTA 4EGLA 4OZ1A 2C3UA 4KHMA 1B64A 3M6WA 2B8PA 4WFAQ 3AFGA 4YY3F 1HQUB 4Y2CA 1XWLA 2HQFA 2F9DA 2KVQE 4WFNQ 1UEKA 1F1BB 2UVVA 1JX4A 1RU2A 5F0WA 2JVOA 3PRVA 5KOXA 3DRPA 2HNZA 3W5XA 4C6AA 2XY6A 1Q8KA 1X7VA 2OHDA 2YVSA 4JI8J 3LH2S 5E33A 4N8NA 4WZMA 5G4DA 1K44A 2C3PA 1HNXF 4USUA 2CQDA 2CJKA 1RWNB 2P9GA 4NLSA 1N4LA 2JFKA 4CM2A 5KFNA 3GFYA 3JAMU 3CJKA 3MM5B 2CJAA 4F8RA 4YR2A 5HQMA 3V2UC 5KFLA 1Y7PA 3DLHA 2H9ZA 2V8GA 3T19A 3DOLB 1P8GA 2W9CA 1WKLA 2Z4PA 4K7QA 5F41A 4WTOB 1KBRA 1TR0A 2IVFB 2XY5A 3N5BA 1XNRF 4YB7A 4J7CA 2OSQA 2XZWA 2NS1B 3DDNA 5D8HB 3I31A 1LFWA 1UW4A 2VV5A 2D3O1 3PXGa 2P6SA 1S59A 4C8KA 3LAKA 4DS4A 3AT1B 3KMQA 5I42A 1U1KA 3QQCD 3I0SA 1X5PA 1U48A 2NUHA 1FKPA 5DLFA 4CO1A 2NSCA 3N4WA 1FEHA 1QY7A 4LRFA 1K8AT 3ZO7A 2QMWA 4B3MF 1M1GA 3VCDA 3ENWA 2HK3A 4N8OA 1LWEB 3OTDA 2LEPA 4DV3J 1JJCB 3V81A 2H4YB 3GB0A 1JXLA 4DQQA 2JH3A 1L3UA 3GG0A 4DPXA 1QDUB 4NLDA 3A8JA 4EFAC 4FYXB 2A1BA 3AQPA 3MWBA 3Q83A 5IM0A 2KN4A 3QT8A 2NPFA 1M5KC 3MXHP 4GKKF 4X65F 2BDPA 2HVZA 3LQVA 4NA1A 1ZPVA 1RDRA 2LMIA 2VC0A 4TU7A 1Y0HA 1TKTA 3HSZA 4P6QA 2V4JB 2D3ZA 2ZUAA 2HURA 2M5YA 2Q6BA 4C0HA 4F25A 1HQUA 3DHXA 1T9TA 4RU9A 4JI3J 4YR3A 4FBUA 4W4MA 3TARA 1IM4A 4X4OA 3KLHB 1JQGA 4H54A 1SCJB 3H59A 4GMKA 1M5SA 3VAHA 4JV2A 4DV1F 5E41A 2HSEB 4C8YA 4JI2F 3A8IA 3AJ2A 4N7TA 1SJ4P 4WKRA 4PQUB 2V5HG 1WKKA 3MHYA 2CQPA 5CZVA 5HMZA 4DWIA 3BO2A 4MIWA 5DZ7A 4EZ6A 3MM5A 3BGRB 4ZCKA 2RNEA 3TZWA 1LWFB 2K1RB 5HROB 1VQ6S 1OQ3A 4OZ5A 3MAQA 3DOLA 4TU9A 3SFUA 3UN5A 2EPIA 2A0FB 3KJFB 1XJWB 3H90A 5L38A 4HHUA 4IR9A 2GCFA 1NB7A 4WFXA 1X4FA 4Y00A 4ZCLA 2HFOA 1OMSA 4PWWA 2L3MA 2C2DA 3O3LA 3BSOA 4DQSA 4J90A 2MDAA 2X1BA 3QFHA 4YB6A 1WC0A 4Q7AA 7FDRA 1F0XA 3R5GA 1VK8A 1N34J 2EKYA 1FWLA 4CT8A 4JI8F 3Q89A 1NJYA 4UZBA 3IR7B 2C2NA 2DNPA 3FBEA 5HMYA 4V1Ak 1S79A 1IBKF 1K47A 1LWEA 4C8LA 3NRBA 4ERDA 3A12A 3MPDA 4TYAA 1B99A 5KFVA 3DGPB 1FX4A 2ZBIA 4IFYB 1NM2A 4FF4A 5D78A 2C2KB 5L9NA 5KFBA 4X4QA 4Y2IA 1T0TV 5AXLA 4JV0A 1WG5A 4LFBJ 1NUEA 1YVFA 1C0UB 3NGUA 4M1KA 4Y28C 2HEKA 3R9LA 2HWTA 2CXEA 1TAQA 4ED8A 4HLBA 3W8GA 1WEZA 2PDAA 4F4KA 2VBZA 2L48A 2V4JA 4OYWA 3MMJA 3SSRA 1D1UA 3J81U 5GAGI 4G1PA 2FGOA 5BJRA 4B08A 4BWJA 4B3TJ 2ZH6A 2XHWA 1UWAA 3KLHA 1S77D 2L9WA 2KT2A 5JUMA 2QLFB 4RLEA 1FEEA 3F56A 2C42A 3EGWB 4B9VA 3R7SB 4WK1A 2M3DA 4PQUA 4O0NA 3Q8PB 3JYTB 1HWIA 1VHFA 3CIZA 2CDRB 2DYAA 2IRYA 4KRWA 5BYSA 4YEAA 1XNQF 3MCNA 4OHVA 3QSIA 1V3SA 1TFWA 1RT7B 2QMUB 4FXVA 4Q44A 4FBTA 4EU0A 2HQDA 2VBWA 3BGRA 2CPDA 1LWFA 2K1RA 2QE5A 5HROA 3HCXA 1YLXA 3BREA 1UZDA 5DQIA 3IWXA 4Y65A 3KG0A 1JNZB 3GTYX 3OTBA 2GV1A 3TQEA 3NNHA 3QGHA 1RB0A 3QRQA 2K8GA 3J7Z5 5FLXU 2DHHA 4DSJA 3C16B 1LXNA 3TZYA 4DPOA 5HL7Q 4LF5J 5A6WA 3W65A 3H20A 1UCNA 1Q5YA 5F9NA 2DH8A 3BJYA 4DMZA 2DIVA 3G2XA 1XIQA 3CO0P 1NHUA 2G2YA 3K2YA 1KVJA 5KT7A 2VB6A 2YKPA 4OJ1A 1NK7A 3MPUB 3MECB 5DDQC 5A8WB 2BANB 3VAMA 2N4DA 2LQBA 3DGPA 4J9QA 4LRDA 3O1LA 1FTCA 1K0TA 2DR8A 4IFYA 2J6SA 4ED4A 3S7RA 4Q0BB 4KGXB 2MQNA 3BPDA 4IR1A 3D7SB 1U26A 5A76A 2BJ1A 5HI7A 1C0UA 2NLWA 3MOZA 1KQKA 1U8SA 3CCLS 4XPCA 2JEFA 3DU5A 4C8NA 2BXJA 4PAAA 1HNIB 5MLCV 1MMLA 4I6YA 2W9AA 3M9NB 3VVUA 4ZVOB 1R8HA 2FY8A 2AJ2A 4DV6J 3HZGA 4CNYA 4NLOA 6FD1A 1QVFR 2POKA 2WW8A 1X5SA 2ZOMA 4NLVA 1Z2ZA 1LW0B 3PX0A 2YNGB 3K7RA 2OTLS 4X62J 2J9DA 2FYXA 3P3DA 5IXUA 1N34F 1BWEA 4I2QB 2KG1A 2RS2A 3DLGB 3PACA 2DGXA 4DSKA 4EBDA 2XGPA 2LXFA 1RKIA 4IOAQ 3FZBA 2BYCA 4LSZB 3JYTA 5EWFA 3CXCR 3PJ9A 2L9DA 1IJFB 3PYDA 3Q2SC 3T41A 5L1IA 3JSMB 4NXNJ 5HVGA 1RT7A 1YIJS 5KOWA 5EX3A 4NZ7A 1X0FA 2GMLA 2ILYA 1PO6A 2DNLA 4DS5A 4LFCJ 4LFBF 4OLOA 4A46A 1HW9A 2F7VA 2ZBQA 1WSVA 3X1LB 1YJVA 1OWXA 2KJVA 3C19A 2KU7A 4DLEA 5IC4B 2AYBA 4U9RA 1IBCB 3KXDA 3NL0A 1T05B 1SL1A 4ES2A 3C16A 1I51B 3L9ZA 2H54B 5IT9Y 3AAWB 1WC4A 1B0TA 3CO9A 5E7OB 1FNOA 3M2VB 3SYZA 4B3TF 1U2CA 3HM9A 4C7QA 1IQTA 1SH2A 2X1GA 1FDNA 2W4CA 2AJ4A 3M8PB 4NLPA 3QWUA 2VA2A 1U1MA 2VOOA 3OLAA 5HSPA 2SXLA 4QU6A 1FXLA 3ADAC 4FS2A 3P8BB 2KTQA 4DHVA 2HBZB 4DL7A 4DUYJ 3LP2B 1T9XA 1KVIA 3MECA 5ETVA 1JJHA 3O6QA 2M4MA 4NPOA 5KFXA 5A8WA 2BANA 5D4NA 3NNAA 2YH0A 3GYXB 3KJNB 2VPZB 2YNFB 1WF2A 3FEXB 5A2QU 1JB0C 3KG1A 4Q0BA 1VC0A 1VQKS 4JI1J 2HGNA 2XZDB 1NZAA 2CYYA 1GEHA 1D3WA 2R8JA 1D9AA 3GIMA 3C66A 4U7UK 2Z57B 1NMEB 4KFBB 4UOGA 2B8QA 5CD4A 3ISNC 1PJ6A 4USIA 3GYGA 2UUAJ 5K9FA 1FD2A 1NK4A 4PXBA 1HNIA 4M94A 1RT5B 4O4RA 1DTQB 4M5DB 3JSYA 4QJVA 3WX4A 1M1HA 5KG6A 1FFSB 4LF5F 2IMOA 1SJ1A 1R31A 1BQNB 3BGOP 4AD6A 3MCSA 2YNHB 4ZK7M 5CAAA 3AB4B 4DU8A 1M5OC 1LW0A 2VFRA 2YNGA 2I2YA 3PO4A 1HBUB 1LEOA 1HNVB 2HS4A 4I2QA 4HTIA 3DLGA 3H2VE 3PG9A 3OW2R 3R5JB 2BBEA 3CD5A 5JJBA 2LDIA 2YKMB 2PA3A 4U67Q 5CXTA 2PMWA 3A3PB 3A3NB 1QUVA 1R3NA 4JI0J 3LWLA 2XWYA 3JSMA 2H5EA 4A47A 4EWTA 1F5BA 2A6MA 4P2FA 3HX9A 4CZCA 4JBCA 1VQ5S 1RAFB 1M0SA 3QT6A 4M5MA 2HFSA 2H5JB 3GJRB 4PXEA 1EP4B 3ZZYA 5K20B 5ETTA 4DPUA 2HS3A 5IQQA 5C2GA 4O23A 3MEDB 2VONA 1CJKB 1SC1B 4CLUA 2FVPA 2QFJA 3V5RA 2RIJA 4C48A 2JLFA 1T05A 5JMNA 4Q8EA 2CJBA 2I6WA 5DM6Q 4CT9A 1OY8A 4C0OC 3M2VA 2OPRB 1RHMB 7FD1A 5IS2A 3FQLA 4ILMA 2AW0A 2CDQA 5FJ4A 4X62F 2RUGA 4NZ6A 3UE2A 2BW2A 3I55S 1FDBA 4DFJA 5KFIA 1IKVB 2EK6A 3EUNA 4OX8A 4L3KA 2UVWA 2VPXB 4DFKA 2W25A 2YX4A 3LP2A 3AD8C 3TX8A 4QWEA 4JI5J 4NXNF 3UI3A 2DGUA 4RW7B 2UU9J 2QX0A 3CDEA 4OYBA 3QIDA 4N76A 2CVEA 2XEXA 4WJBA 3ZZTA 3M6XA 2YNFA 4LFCF 3QATA 3ZFVA 2LU2A 2KDOA 5KFDA 4F2SA 4LF7J 4FF3A 4KFBA 4C2MA 2BOAA 2AJ0A 2ZC3A 3QIPB 4Q43A 4X4RA 2YWKA 4DN9A 2CPXA 1UVKA 1RT5A 1DTQA 4M5DA 1N32J 1VLYA 1H3DA 2IJNA 2EXUA 2CVIA 3VZIA 4FDFA 5C24B 1BQNA 2GJIA 2CQ2A 2B43A 2YNHA 4BWMA 4ZJLA 1S72S 3Q24A 4QWAA 1Y3JA 4Y2AA 1HBUA 8AT1B 4M95A 3P49B 1HNVA 2MZJA 2XI2A 3OXLA 3SQGB 4I4BA 2GO9A 4G6VB 4DUYF 2DGOA 2G0CA 2QYGA 1H7XA 2VQEJ 1TMMA 1R7IA 2CNKB 4DF4A 4O3PA 4FYDA 2YKMA 4USJC 4DR2J 5CH7B 2FDNA 3OR1B 1CJUB 3P5TL 2ZD1B 1NB2A 4CO3A 4ZPVR 3CC7S 2ZZMA 1Q82T 1HMVB 1URNA 1EP4A 3AHPA 4TY8B 3W5ZA 3BO3A 1SXLA 2VL1A 1M90T 5FD1A 1KOHA 3MEDA 2UUAF 1CJKA 2OGUA 4WU2A 5KFAA 1HLWA 1WJ9A 4LF2A 5DGAA 2HGMA 3UNGC 1N5SA 2FIUA 2YKNB 1MW7A 1RT3B 4NLTA 4A4JA 2J8SA 4AXJA 2NYIA 4OX9J 2F8EX 3M2UB 2FB0A 4WP3A 2XG8A 2DY1A 3OHAA 4IRKA 3OTOF 2ADBA 1GMWD 4NMXA 2O67A 4A8KA 2HBYB 5E3CA 1ZBTA 4PG5A 4ELTA 2OPRA 5LM7E 4P2SA 1IJEB 3M8ZA 5DETA 3D4JA 2QMXA 1S48A 2JEGA 4MKBA 3VALA 2G1HA 2QTWA 1IKVA 4FXDA 1RWXB 2Z56B 2VPYB 4ZA1A 4QW9A 4U96A 5HJYA 2MKCA 1FRMA 3QSYB 3HFKA 1HARA 4OZJA 3N6MA 3UDLA 2XLJA 5K8PA 3DM2B 3UR3C 4RW7A 4RJVA 4K5SA 2E29A 2BOPA 3K5PA 3D5MA 2EI5A 1RAHB 4OHWA 2HKEA 4KHPJ 4M63A 3PRBA 3ONQA 4KPYA 3MD1A 2HHSA 4DL3A 1WD6A 1NRKA 3LF0A 3HHLC 3LTOA 2OKQA 4PWDB 3OUYB 1VIXA 3ILJA 1VLOA 2J0QD 4JV5J 4K4XA 3QIPA 2YXLA 4TU8A 2R7QA 2L08A 1YKWA 4CO0A 1WG1A 2MJNA 3UDVA 1TL1B 1N48A 5E5NA 4MIAA 4RPFA 2J0SD 5ETQA 2V2VA 4UTGA 3KKFA 5GAEI 5DDRC 3QJJA 5C24A 1RHJB 1W25A 2VZ9A 3RAQA 3Q8QB 1KNZA 1AW0A 4DL5A 4H4KC 2FVSA 2ACMA 3CUNA 3HFVA 3I5CA 3RTVA 1NK5A 2QFIA 3E3XA 3I5BA 1JJ4A 4B9TA 3PKMA 4B17A 1KSPA 3I4HX 2R42A 3SQGA 1Y5NB 2XI3A 5D6GA 2AIRB 4JI5F 4QYZJ 4RNFA 2MQ8A 2V9WA 2UU9F 4RWWA 1RZMA 3QPIA 3OR1A 1CJUA 3V6KA 2DHXA 2LEAA 2ZD1A 2MZQA 4AE5A 1NJZA 3MM9B 1T03B 2XMUA 1EQ0A 1VBKA 3OBIA 3ENQA 4DV2J 2YQ3A 1HMVA 4BHQA 2AKWB 1NJXA 3SMZA 1U1PA 4P73A 3CT9A 2VJVA 2MQOA 4TY8A 1YJWS 2LQJA 1AFJA 4USKA 2NSBA 5H9FJ 1EQMA 2MTLA 3M8YA 2AU0A 5HANA 2CZVC 4GC6A 3VZHA 2I0XA 2YKNA 1RT3A 2GC8A 1ZAVA 4NLQA 4CM0A 3M9MB 3M2UA 3PFOA 4KGZB 3KUGA 1TP7A 3AA8A 3VQSA 2XMJA 4ES3A 4CLKA 4F3OA 3ZZRA 1S12A 2LQ5A 1JXEA 1V3RA 3FSIA 1L3KA 5BYRA 4QPTA 4K4UA 2R7UA 3DGVA 5AE3A 1U25A 4DR2F 2ILZA 2HHXA 1S49A 5LSLA 1MNEA 4U8YA 2V4RA 4CLZA 2DBBA 3DM2A 1X9SA 5LMUJ 1K0VA 2K3IA 4HDGA 2CG4A 1HIYA 3GIJA 2G0JA 1S0NA 2MQMA 1M1KT 2NCKL 3OXFA 2HHWA 3OUYA 3QYYA 4OHZA 5F8LA 2B7CB 5GVQA 3KOAA 4DUTA 2OD6A 2UXBJ 2B6AB 1ZYQA 4MFBB 1QJHA 1TL1A 4FYYB 1SJ3P 2C28A 1SQEA 5EN1A 2ZNYA 3EE3A 2R2UA 2LFVA 4L74A 2VG5B 9ATCB 3OL6A 2J9CA 1AFIA 3LW5C 3D0HE 1NJIT 3BGUA 2RUSA 1QSSA 3W1YC 2X1AA 1NPRA 2PEBA 2ZHAA 4DX7A 2JLGA 2B4OA 2FTRA 1PBAA 1TELA 2XCPA 1BLUA 2UVUA 2ZHBA 4K59A 2DH9A 3MM9A 4WYWA 1T03A 2DNYA 2HAFA 3IBFB 1DBDA 4RWXA 4KKOB 2RH3A 4EBCA 1UVJA 1T8EA 3IG1B 4ECUA 1N5VA 1UVIA 5E3RA 1JLEB 4HHHA 3IRWP 3H5SA 2EFQA 1OYEA 4DJBA 3B54A 4DR4F 2Z2ZA 3VAJA 3GR1A 4MH8A 2KO1A 4IOBA 1FTRA 3IS9B 2W9BB 3UPFA 3VV2B 2N7CA 1NDKA 4XDDA 1N36J 3GWCA 1F3FA 4F4WA 2GJ2A 4WIQA 3RB6A 2PN6A 4ZLLA 3CPWR 1HD0A 1N8RT 2CQ1A 3PY8A 4UF4A 3CCSS 1SJFA 4DPWA 2MMYA 3CJSA 2CQ0A 2ZHOA 3WIVA 2JZ5A 1SJQA 4NLRA 1YITS 3BR8A 1HI8A 3NCRA 1MROB 1MN7A 4RR5A 2MZSA 1HQEB 2Y1LB 2ZKTA 3MMBB 3C46A 2OPPB 2C3YA 3HSDA 3KLVA 4DL4A 1OS5A 4ZVQB 4YR0A 2YH1A 1HHQA 3CCJS 1JIHA 1VISA 3CMAS 2XSFA 2DGWA 1T9UA 4WXWA 3JQMA 1QAYA 3OR2B 5HJXA 2LU1A 2VKZG 3MAHA 1L5UA 1IBMJ 2ZH7A 3CCZA 4X4TA 2B4VA 2V69A 5KT4A 3CJ2A 2XY7A 4DR6F 1RU1A 3OHBA 2B6AA 3C6UB 2BEFA 4K5RA 4MFBA 2HVEA 5BR8F 2E7VA 2XC9A 3VF0B 2RILA 4C9DA 3GPAA 4ETXA 1NH7A 5HQLA 1QVGR 1LNQA 2IDLA 2VG5A 3H5UA 2Q6CA 3NY0A 3QMQA 1SIWB 4B9LA 4LMZA 3NOGA 2OSRA 2C3OA 3R5CA 1CVJA 4K4WA 1GAOA 3FK4A 5KFHA 1JJ2R 2ROEA 2YWWA 4KY3A 4MK9A 3TW0A 2JWNA 2DNHA 1UW9A 4RW4B 2FLOA 2JC0A 1WSRA 4ZVGA 1GH8A 5LMUF 3OL8A 5HQ8A 1WNEA 3PYEA 2BMBA 2B7BB 4J9KA 4DCPB 3C3LA 1GT8A 2O1PA 3M8WA 2GGPB 4RX6A 4Z2XA 4OYAA 5LJ3Y 4NEZA 4KKOA 3CCES 4X4PA 2Z2LA 3W5YA 2BKNA 3IG1A 2LCWA 1DQAA 1JLEA 3PX6A 5JVHQ 2R8HA 4C4WA 3K8WA 2UXBF 1FDAA 4LQ3A 1V5VA 4TLQA 2YQ0A 3UW1A 5C25B 1FKOB 4BCAA 2FC8A 1AYEA 4LBIA 3DDIA 3MI7X 3CCTA 2ZM6J 1XR5A 3IS9A 3UN3A 2AZ3A 4NRUA 2W9BA 1KKHA 1WI6A 1Y4ZB 5KT3A 2BKOA 1D09B 4CRJA 1FF2A 5AXNA 4RNHA 3OVBA 4O3SA 4F4XA 1J5EJ 3TUZC 4DV4F 1EX8A 4OZLA 3KFWX 5EHHA 3IXQA 1E6YB 3PRDA 3ZZZA 1CJVB 4DV0F 3E8OA 3D6FB 3VHQA 4CLPA 1WUUA 2VOPA 4EK2A 4LVNP 4HTJA 4OZNA 1FRJA 4ECXA 1MROA 3KYLA 1C4AA 4J9NA 3MPVA 1HQEA 2HFNA 3H0PA 3MMBA 3I9V9 2OPPA 4PYDA 1I94J 1CG2A 4K2XA 1C4CA 4DR5J 2YX7A 3FCHA 3PVXA 1Y10A 4ATNA 1N5QA 2YY3A 5H1SV 5AXMA 3J7YU 1H2TZ 2DTJA 2PFDA 3OR2A 1IN0A 1VGYA 2ZE2B 2RU9A 2OMLA 1ZOTA 4Z7YA 3FDSA 3EYZA 4DI6A 4F4YA 1HWUA 3C6UA 5A8RB 2W7OA 2Y0SD 3A4TA 2WSFC 1VR6A 2DHSA 1ZS6A 2GS8A 2Z30B 3I6PA 2CAJA 5L8RC 3MM7B 3IGNA 4Q45A 4UOCA 3QAUA 2IC3B 4PCQA 4UUXA 5J1PA 2XYHB 2IBKA 2MQPA 4KYZA 4F2RA 4P74A 3K5NA 6AT1B 2QC3A 4RW4A 2JC1A 2E44A 3MM6B 4QIEA 1HHSA 2CPHA 4R8UB 2W01A 3DXSX 1FRHA 1X4BA 4TYBA 2HQIA 4QR0A 5GAHU 3HJFA 4OHXA 3CTRA 3I32A 2DHGA 3ZTRA 3NXZA 2GGPA 5L1LA 3RAMA 3P5BP 4EO8A 4ZDNA 4PPZA 2DNKA 2W7AA 5CCMA 3L7UA 1QSLA 3TA1A 2QV6A 5B09A 1IBMF 2IMWP 3JTPA 1Y11A 2RJZA 2DITA 3DRYA 2RT3A 2AQ4A 4ZKAA 2DXDA 2RRNA 4FF2A 5K8NA 4PQAA 3H5XA 3P4UB 5C25A 2BQUA 1FKOA 1VRUB 2EG2A 3K57A 1S9FA 3SXLA 5DDPC 4DR1J 3PTWA 3VGTA 4A8FA 1UVMA 3T1HJ 3V6HA 1TK5A 3EGVA 3AJDA 4EZ9A 2ZVIA 4A8XA 4ZIVA 1O6XA 2BE2B 3B4DA 3GONA 4NWBA 1J27A 1JK9B 2DO4A 2OUGA 3TYTA 1E6YA 1CJVA 3NS5A 1P9YA 2Y3YA 2C2ZB 3NCQA 1WOSA 2MEWA 3P6YC 4ED0A 3HT0A 3HT3A 2HIQA 1Q8LA 2Z58B 1X0PA 2YWHA 1HWJA 1KLNA 1FXDA 3QZ7A 1T02A 2HZCA 2RSQA 1L3SA 2DEJA 3TJAA 1YI2S 3EVMA 1T3NA 4FN5A 1ZH5A 2VKRA 4BDPA 1X4EA 1S7IA 1ZZFA 3BSAA 1KLMB 1Q4RA 4PYAA 1FO1A 1GXUA 2XMWA 4C97A 2IVYA 2OFGX 3MMCB 4R5PB 4HYKA 4M5KA 5KG2A 2YX1A 1CS4B 2ZE2A 2ADCA 1N88A 4OHYA 3T5KA 2MHNA 3KLFB 3MR5A 2NZ4A 2RE1A 3QNWB 5A8RA 2BX6A 2ZM6F 4DDFA 2LXIA 1BHNA 3D0IE 1KR4A 5DLGA 2HVHA 3UN2A 5K8OA 3SCJE 3GV8B 4CNZA 4KE5A 3MM7A 4WFYA 5ETLA 3OTEA 2A3JA 3V4MA 2GHVC 2GZOA 2IC3A 3OVSA 4NLWA 3CJ3A 3NG8A 1J5EF 3SZ2A 2OIHA 1EB0A 2XMVA 4LBHA 2I1RA 1NBEB 1FKAF 2AJ1A 4EYIB 4K4TA 1H98A 4DV7J 2KL8A 2HQGA 2FGCA 2GO8A 1B7YB 1Q0NA 4PABA 3DLBA 5IC6B 3HVTB 2UZAA 4PPDA 3MM6A 1U7LA 1HBOB 2L9NA 3GJQB 5IWAJ 4R8UA 4DPTA 4RBUA 4RZRA 4USTA 2DXFA 1QE1B 2NPIA 2KFNA 3CULA 1TU0B 2GAHC 3GP9A 4YFUA 2WAQD 3CIMA 2FHOB 2E1AA 4DR5F 2V67A 4ED7A 3TJ9A 3VAIA 2NYHA 4QBUA 2ROPA 4X84A 5KAKA 1ROFA 1S9GB 2PC6A 1QD1A 3T5HA 3OFGA 3GIKA 3R8YA 4BLGA 1UL3A 2VODA 3NS6A 2WSEC 3BYPA 4UOFA 2NXUA 3EGZA 2W2QP 1KTVA 2DCLA 2R7VA 5AT1B 3CC4S 1VRUA 3D68A 4C0BA 4QR2A 2K7JA 3MTJA 2DISA 4KGMA 3OXGA 2JEJA 1S4FA 2WCXA 2FLPA 3BB5A 2PT0A 1R8AA 3HVWA 4X4NA 4ZCIA 1B70B 2BE2A 1T95A 4ZMMA 1NPPA 4WKYA 4P71A 4O3RA 5ETPA 1DHMA 3D9BA 2QA1A 4DSFA 1RHRB 4JV1A 3ICLA 2P6TA 5ADZA 1NDCA 3ITHB 4ID5B 1RJJA 3SBMA 5HP1B 3ULHA 2MB0B 2WVBA 2BJDA 4K0KJ 1UKUA 3WHIA 1NH8A 5DRKA 3TVKA 1X60A 1S6UA 2VASA 2YPZA 1KLMA 4W98A 2YQ1A 1XMOJ 1CC7A 4FZVA 1VQ7S 3HSGA 3MMCA 2IPOB 1CS4A 1LQ9A 3VGSA 2GJFA 3NNCA 4E98A 4J9VA 3QRRA 2BACA 2QSWA 3A8KA 4PZVA 3KLFA 4ECRA 4NA3A 3GFXA 4LFAJ 1RYRA 4DR1F 2H5IB 1YRUA 4DPYA 3B8HA 4ZVUB 1WC1A 3KTQA 2MKKA 4TNOA 3M8QB 4LRCA 1FE4A 2F9JA 4E2FB 4Y2MA 4G1QB 1YJ9S 1YG0A 3C14B 1Z2LA 4CO5A 3BDPA 4OI0A 5D4PA 5L1KA 3WZ0A 5DZ6A 3RB3A 2D1CA 3PX4A 4WU3A 3NAIA 8ATCB 2D9PA 2H1YA 3J7YI 2BZ2A 4ZJOA 3HHKA 3EX7B 1RWWB 2UXDJ 3HVTA 3D6TB 2DR6A 1HBOA 4QQBA 3MR3A 3TUIC 4USVA 1QE1A 1YZ7A 3FZ2A 1AZSB 3D54A 1U2RA 4KHRA 1FFWB 4OI6A 2YWEA 3BH7B 2XLKA 2EVZA 1NAQA 2EBEA 4B3RJ 1MWZA 4QYZK 4OYPA 3BSNA 4W90B 1RAAB 1S9GA 3W64A 3D67A 1N54B 1OSCA 2CIMA 2E7WA 2IM2A 3MEEB 4Y3CA 2D7SA 2ALZA 1FESA 2D41A 4ZVSB 2OFHX 1IKXB 3OTCA 3GCWP 2HHVA 1U4BA 3FGVA 4CO4A 5D0EA 2V6AA 2AEJA 4DL2A 4E8UA 4DSEA 1UEUA 2AD9A 2VBYA 2W2NP 1FRKA 2UUCF 2C22A 3KK1B 1HNZJ 2HHQA 5H9FK 5BYQA 2FZGB 1T9YA 5CCLA 2ZH5A 3BV8A 1S1UB 1BE4A 4K2JA 2AX1A 2VFSA 2ZH3A 4CLYA 2YWGA 4Y2KA 4F04B 1OSDA 3TQ1A 3MFIA 3CE8A 3TWZA 1S76D 4DU7A 1RWVB 2VH7A 1YSJA 2VDHA 3U7JA 1I6JA 5GADU 3M2RB 4BS2A 1FRXA 5L46A 1SBRA 1RYSA 4CLSA 1K1SA 3R3TA 3ITHA 4ID5A 1OO0B 5HP1A 1F60B 4ALZA 4O3NA 1GNKA 2P9CA 3MTKA 1S4EA 1WC6A 1NSKL 3FBFA 4N77A 4ED6A 5RUBA 4DFPA 4IOCQ 1WC3A 4M5JA 2X51A 2Y0BB 4UZCA 1W2IA 4LVOP 3NOCA 2PI5A 2EEYA 1BQMB 4P2XA 1XMQF 2W2PP 3V6JA 4IQXA 3D3CJ 3TX0A 2CPYA 3BM7A 2KJWA 1DRZA 2DNZA 1WORA 1NCLA 3DI6B 4F02A 4OFZA 1SKRA 4RNNA 3M8QA 2J9EA 4G1QA 2MLZA 1XTZA 5ETOA 3C14A 2VQFJ 3VTIA 5DQHA 1W2BR 2DR9A 2DKOB 1ZAXA 4KPCA 2EG1A 2FHJD 1YBTA 3N0VA 4LF4J 3T1YJ 2RDIA 3U1NA 4L76A 4U7UD 2FLNA 1HKAA 1V5IB 3CJRA 3TAPA 1R8CA 2K06A 2DD8S 5KFMA 4ZPAA 5CYQB 4OV1A 1F5CA 1SUQB 1KS2A 3OFHA 1H2VZ 3IBCB 2DNMA 1PJ7A 1PBUA 2YPYA 1IWAA 4KO0B 3G82B 1XMOF 5A0YB 3ENAA 3MUVP 3OV7A 5KFQA 4MJKA 3BGLA 3MEGB 3MEEA 5B0DA 4JB8B 3RBEA 1IKXA 1FJGF 1PIEA 3B6BA 1WDDA 1MSWD 4LFAF 4B9UA 2QRRA 3R5BA 2HHTA 5U47A 2CWXA 3I4PA 4KAIA 5KFPA 3FQKA 4MK8A 2P8IA 1MWYA 1BXNA 1HI0P 2HWIA 3RBDA 3KK1A 2EK1A 1GTHA 3QJPA 2IDEA 5CA5A 4P72A 2R8KA 1S1UA 2O66A 2C2OB 1RK8A 4RBVA 4ZLPA 2RQCA 3GSIA 3TI0A 4LF1A 3TAQA 2W4DA 3ETMA 4X66J 1VQOS 3E2EA 4ZPBA 1H6KX 4C8MA 2M70A 1U2FA 2UXDF 1G7CB 3MD3A 4CQ1A 3M2RA 2HWHA 3DXBA 3BQ0A 2A6OA 3SSQA 2RDJA 4UY8T 1VBZA 3G8SA 2R2SA 1CEZA 4EEYA 3ISND 3MPWA 5IV3A 2JL9A 3FUYA 4FVMA 3ZTOA 1L3VA 1S1XB 3CCWA 3RRHA 2AGPA 1WOOA 2ABYA 3OVAA 5ETRA 4PEOA 3AOBA 2VDIA 3KLIB 2COLA 1WTFA 2DPIA 1BQMA 4CCHA 3VR1A 1GMWA 1RISA 5J1NA 1IM6A 1ZM9A 3ZNJ1 2J6TA 1HW8A 2EFPA 3SV3A 5BXIA 1HNZF 3DI6A 3EICA 4J9LA 3ILLA 2WK4A 2LQ9A 2E5LF 3N01A 4WE1B 5F0UA 2HNYB 2F63A 5KG3A 2Z2YB 2EW9A 2MLYA 1GMVA 1TKDA 2KXHA 2CQ3A 4IQMA 3HMJG 1CULB 4NASA 1XN9A 2KHDA 3Q8VA 4B3OB 3HD1A 5CYQA 1N56A 1SUQA 3O44A 3ZZUA 4KV8B 4TQSA 3JTOA 5HAOA 3NLCA 4WXOA 3KG4A 4KO0A 3G82A 1VRQC 1EKSA 5A0YA 2PA8D 5M2PA 3LALA 2MKHA 3MEGA 4F36A 3D1OA 3GQCA 3JSRA 1RCOB 2OEJA 2HPUA 2DB1A 1DJ0A 4WIIA 3FKBA 1XC9A 3A3OB 3HPOA 1C1CB 3GJTB 4KJIA 3PYGA 1R27B 4C8ZA 2RU3A 5D77A 2IYGA 3AH6A 3T6JA 2VQFF 1VQYA 2VIHA 3BBFA 4ECYA 5D3GB 3NAHA 5B0BA 1O0PA 2E66A 2LA6A 3PW4A 3CJ8A 1GQEA 1CQMA 4LF4F 3T1YF 4FPIA 4NXMJ 4QIVA 2DNQA 2NXJA 1Q86T 1TAUA 4PWUA 3M6VA 4IG0B 1TV6B 4O3QA 5CZXA 3PDNA 3IR6B 3W2WB 3QFWA 3BQ1A 3TANA 4DV3F 2GHPA 3EGNA 4FS1A 1S1XA 2VFVA 1RHUB 4X2BA 5B0FA 1SL0A 3AD9C 3RB0A 4MIBA 1QTNB 2LYVA 4WPAA 4CLLA 2V0NA 3RB4A 4CYUB 3KLIA 1KONA 2CZ4A 4H4OB 3MCOA 1RABB 1PG5B 4F0MA 3PW0A 4RBTA 4MKYA 3I5AA 3NEKA 1EARA 1TL7B 5HK4A 2ZOGA 3DOMB 1YDLA 3AA9A 4RNMA 5KFCA 5HO4A 4WE1A 2GIRA 2HNYA 3AQOA 4QPXA 1WOPA 3ZTPA 1U0SA 4USWA 1J2VA 5KT5A 3UCZP 4IH6A 1ZM3A 2BJ7A 4X66F 3SFGA 4ECSA 2ZBPA 4JI3F 1TKXB 2VG7B 2QLWA 2CQ4A 1R8BA 4KT0C 3W66A 1OQ6A 1K9MT 1RLDA 3DCAA 1CULA 4NCGB 3JQJA 3NGTA 2E9TA 5LOQA 1JNRB 1IKWB 2LXUA 3NGRA 4HACB 4B3OA 4O0IA 3Q22A 4I56A 1RCXB 1U24A 3LP1B 2WVCA 1SIZA 4MAKA 4KV8A 1NK0A 2IYIA 3UWTA 1OPIA 2XGQA 3THVA 3FRZA 4ILRA 1VS3A 1RWMB 2EBGA 2RRAA 3CMQA 4G65A 4BC9A 1FERA 2BW7A 3AJ1A 2ZBCA 1AROP 2ZH8A 2RVJA 4K4SA 2ALYB 2U1AA 1XMBA 3NGSA 2DO0A 3A8EA 1QUPA 3HHNB 1C1CA 4IG3B 4ECTA 3DRXA 2DR5A 3ILOA 4JYAJ 3U27A 1QAJA 5F8IA 1WHYA 2QA2A 4CLFA 1I3OB 4I7FB 3CJQA 4NX9A 5K14B 4M5HA 1PCAA 1PC4A 2N82B 4B9SA 5D3GA 2DRBA 3POTB 2FHKA 1SVDA 4URQU 4UOHA 2HG4A 3R6GB 4NOHA 4A8QA 3KUEA 2BJEA 2M8HA 3NBPB 4QIWD 2J0XA 3EVOA 1EJ7L 4NL5A 3PHTA 2OLWA 1TK0A 3HHLD 4F3MA 4IG0A 4OYOA 1TV6A 1ITPA 4DR3J 5KT6A 2DGSA 3W2WA 3H2LA 5LL6d 2HFVA 3HULA 3UDCA 3JXOA 5DDOC 3UD4P 5KG1A 5IT9U 3Q8RB 4K4ZA 1CPZA 1RT2B 1P6TA 2I9SA 3LP0B 4IRCA 3DFEA 4MKVA 3ZTSA 4DX8H 1H72C 4CYUA 1VK3A 3MR6A 3M6UA 2XMAA 4DQRA 4H4OA 3ZTQA 1SC4B 3OJSA 3LO3A 3HVRA 4BC7A 1ZA1B 1TL7A 3K0JA 1KN6A 3GFHA 3DOMA 2K3KA 3HK2A 1Z1ZA 1A0OB 2HGLA 5B08A 1VQ4S 1GX5A 2B56A 3G8TA 1R6YA 2E1CA 2QLBB 1QSYA 3W61A 2D69A 5F3ZA 5LT5A 2QN6B 4IO1A 2QSFA 1TKXA 4NXMF 2VG7A 5EX0A 3N28A 2MZTA 2G4BA 2I38A 1CC8A 4AFFA 4PR6A 2G2OA 1F9EB 1UJ4A 3W9JA 2ZJPQ 1MN9A 2BQ3A 1RWKB 2OD4A 5E3PA 4NCGA 4HACA 1IKWA 3BO4A 4ECWA 3LP1A 3RBZA 1TUGB 4GVLA 3GIRA 4D3GA 3M32B 4LRBA 4J9UE 2HFZA 1FHTA 2FVQA 1BC6A 2ERRA 2E7XA 4S0MA 1RTHB 5DGBA 4RW9B 3F0NA 5AE1A 3DYAB 2IFXA 1G2EA 2E5HA 3T3FA 3KLEB 2BJ3A 5HBMB 1X5TA 1GMUA 4LSLB 3HLUA 1XERA 1FRLA 2O01C 4NI2B 2V2ZA 4IG3A 1F9FA 3FBBA 1A6LA 4KBIA 2E5IA 4F26A 2KZMA 2B0GA 1B4SA 4I7FA 5K14A 2AZ1A 4ZVRB 4GKKJ 2VUGA 2GQCA 3POTA 5L39A 4KSEB 2HZAA 2HRYA 1S97A 3W9IA 4A8YA 1RTIB 3PJWA 5GMDA 3BSCA 3ZXWA 2F40A 3TAMB 2Z0GA 3NBPA 1VYAA 3JTNA 3W8PA 2BV3A 2FZCB 1Y5IB 1EZZB 2CQCA 3Q0AA 1WACA 1WKJA 2QLJB 4AL5A 1JMTA 4ZLNA 2W2MP 4IKAA 4M8LA 3QWPA 4DX6A 2R7WA 4P52A 1RT2A 2V8DA 1VC5A 2A2DA 4ZVEA 1KDNA 3LP0A 4JI2J 3J80Y 1YRTA 4QU7A 2HVDA 4WTYA 2J5AA 5GAGU 2WW4A 4AQYJ 4ED5A 3D1QA 4R0JA 1RADB 4I6AA 4PXCA 1FA0A 3LOUA 2E9RX 4E0DA 2FD2A 2DR7A 2ZDPA 1B3TA 2MZ1A 4JYAF 5HATA 3F73A 4C3MA 3BS9A 3VGUA 3W62A 4PXDA 1X4HA 2ZH1A 2B51A 4DR7J 2QIFA 4OI3A 4EO6A 4DV6F 2E1PA 4FF1A 2BVZA 5DM7Q 4MKAA 1SH0A 4LR8A 4X4VA 4ANCA 2E5JA 1KWMA 5SZTA 3M8PA 4C8OA 1D0EA 3KUHA 1RHKB 4DR3F 1Y9OA 2FVRA 1JLBB 5C5JA 1OY9A 1EETB 2V2QA 2M52A 2RHQB 4CH1A 1RTDB 1WI8A 3Q2TC 1OYDA 5L1JA 3M32A 1VC6A 2XYPB 3QGPA 1U6BA 2NXNA 1VJWA 4U6PA 1UZHA 4HDHA 2H65B 3DN9A 2LEBA 1RTHA 4R25A 3ZZOA 3ENVA 2DGVA 1MG7A 4RW9A 1IBKJ 3DYAA 3N5FA 2GMHA 3KLEA 5HBMA 2W2OP 5F8GA 3TUPA 3WBZA 4LSLA 4RW6B 3SCIE 3GYNA 3SV4A 3MGJA 3K5MA 2OEKA 4NI2A 4RUHA 1N0VC 5ETNA 5I3QA 4QW8A 2HMIB 4CH0S 3CF5Q 1RAIB 2BA9A 1TK8A 3GIIA 1ZTTA 1PAEX 1LFPA 2CQHA 4TVAB 1EHWA 1M5PC 2B9WA 2IJFA 1HL6A 1IR0A 2WONB 1RTIA 3DRSB 4HT7A 1RBLA 1GXTA 3N9UC 5F3TA 4ECQA 1S6PB 3TAMA 2D9OA 2NR0A 1Q53A 3C2PA 2IVMA 1OPZA 1WDTA 4C98A 2ZEJA 3AXKA 3UCUP 2FLLA 2ASLA 4NCBA 3PV8A 2ZH9A 2B9XA 3WC0A
chains in the Genus database with same CATH topology
1ZH5A 1N5YB 3HDSA 2VKRA 2FVCA 1X4EA 3QO9A 4BDPA 3TVYA 1ZZFA 3BSAA 1C0UA 2J9DE 5HI7A 1HA1A 2NLWA 2R4FA 3MOZA 3G96A 5GMKa 4PG8A 3CWJA 1HFEL 3JAMY 1KQKA 1KLMB 1U8SA 1Q4RA 3CCLS 2WB1D 1Q78A 3KLGA 4XPCA 3DC2A 2JEFA 4QYRA 2OP5A 1N52B 3DU5A 2LDYA 1FO1A 3H25A 4I67A 3G4SS 1GXUA 3KHLA 2XMWA 4MK7A 4C8NA 2IVYA 4C97A 2OFGX 2BXJA 3MMCB 4R5PB 2XSJB 5G0RA 4HYKA 3AB2B 5DS7A 1HNIB 5KG2A 1FD8A 2YX1A 1OIAA 2ZE2A 5MLCV 2ADCA 3FNNA 1N88A 3ZZPA 1MMLA 4I6YA 3VAKA 4OHYA 3T5KA 2W9AA 3M9NB 2RB7A 3LGNA 3PEHA 1R8HA 1D9DA 2CRLA 2MHNA 4KB7A 4ED3A 4PG7A 2R8GA 2XMMA 2XNQA 1WF0A 2RKIB 1FRIA 5DQGA 4J9PA 5F8JA 3KLFB 3MR5A 4JI1F 2NZ4A 3HZGA 2RE1A 1S1TB 3GFZA 4CNYA 4NLOA 4MYTA 5AJ3F 1UAWA 4KR0B 5A8RA 4K0KF 2ZM6F 2Z8QA 4FPRA 6FD1A 4DDFA 1QVFR 2POKA 2RQKA 1B0VA 2LXIA 1XR7A 1X5SA 2WW8A 2ZOMA 4NLVA 2Y1JA 1Z2ZA 3U1MA 1PGZA 1LW0B 3O5TB 1WG4A 1NHVA 2YNGB 3K7RA 2KYZA 5KT2A 3PX0A 1UVLA 3D0IE 1KR4A 5DLGA 1AUDA 2OTLS 2DVIA 2HVHA 5K8OA 1TL4A 2FJDB 4O44B 3OLBA 3SCJE 3GV8B 3RRKA 4CNZA 3GZ7A 4FP9A 2JLEA 2J9DA 4KE5A 3Q8SB 3MM7A 3P3DA 4WFYA 5IXUA 3PZPA 1N34F 1BWEA 4I69A 4HT5A 4I2QB 3OTEA 2A3JA 1LWCA 2KG1A 2RS2A 3V4MA 2GHVC 2IC3A 1KTQA 2HNDB 3DLGB 3PACA 3OVSA 3QJLA 2DGXA 5LXYA 4NLWA 3CJ3A 3L09A 3NG8A 3TA2A 4GC7A 1J5EF 4DSKA 4EBDA 2XGPA 2LXFA 3SZ2A 2OIHA 3T6BA 4WZQA 2XMVA 4HEA9 3CCMS 2EC0A 1RKIA 4QIGA 4IOAQ 2I1RA 3FZBA 3HO1A 1FKAF 2AJ1A 3T9ZA 4DQPA 2BYCA 4EYIB 4K4TA 3JYTA 5EWFA 1H98A 3CXCR 2FGCA 2GO8A 3PFEA 3L95X 4Q8FA 2L9DA 1K73T 1UVNA 3DLBA 1IJFB 3HVTB 2UZAA 3Q2SC 3THTA 4PPDA 5I4MA 2EFNA 5L1IA 3MM6A 2LKZA 1U7LA 1HBOB 3JSMB 1S0OA 4RNOA 5F8HA 1ZM4A 2L9NA 1RT7A 4R8UA 3E01B 4RBUA 1P27B 2V2KA 4RZRA 4F3QA 1YIJS 5KOWA 1Q81T 5EX3A 1QE1B 2NPIA 2KFNA 3CULA 4NZ7A 1X0FA 2CQGA 2GMLA 2ILYA 4YFUA 1PO6A 2DNLA 2E5GA 4DS5A 4LFBF 2JEIA 2WAQD 2WOMB 3CIMA 2CPFA 2FHOB 2E1AA 4DR5F 4ZP9A 2O5DA 4NA2A 1LXJA 3VAIA 4OLOA 2X3GA 4ED7A 4A46A 1HW9A 2F7VA 3FRYA 1JLBA 1S1VB 1EETA 4QWDA 3PR4A 1DQ9A 2JVRA 1TVRB 1RTDA 3FJ2A 4QBUA 2ROPA 3X1LB 1JLFB 1YJVA 1OWXA 4X84A 2KJVA 5KAKA 2KU7A 1H2UX 1ROFA 1O51A 1S9GB 2LVWA 2PC6A 3IAS9 4DLEA 4I68A 3T5HA 2KFZA 2AYBA 1ZM2A 3NWGA 3OFGA 3GIKA 3M30A 1S10A 3V6DB 1UL3A 4NLXA 2VODA 4JI0F 2ZH2A 4U9RA 3NS6A 2WSEC 3NL0A 5AE2A 2KXNB 4I1TA 3M9OB 1TQLA 1C1BB 1XK8A 1T05B 3I87A 1SL1A 2GNKA 4ES2A 4AQYF 2NXUA 3EGZA 5KFWA 1KTVA 2DCLA 2R7VA 2IBOA 2EWHA 2GW8A 2AJQA 1JLCA 2IM3A 2APOA 5IT9Y 3AAWB 2XS2A 1RGVA 1B0TA 4DLGA 3CO9A 5E7OB 1FNOA 3M2VB 3CC4S 1R43A 1VRUA 2RF2A 2YNIA 4C0BA 3SYZA 1QAIA 4B3TF 3CDWA 1RP5A 4QR2A 3EXCX 4LJMA 3HM9A 2K7JA 4UUWA 4C7QA 4X4SA 2R7TA 1IQTA 2FJBB 3D28A 1J5OA 1SH2A 3MTJA 2A2CA 2X1GA 3NP5A 2DISA 4B3RF 1FDNA 3L7PA 3BDEA 4KGMA 1WF1A 2W4CA 3OXGA 2AJ4A 3QLHB 1U49A 2KFYA 2MPUA 2JEJA 3M8PB 5B0CA 4NLPA 4RW6A 3QWUA 1S4FA 2WCXA 2WBMA 4OZ0A 2VA2A 1MMDA 1U1MA 2N7YA 3G86A 2FLPA 3BB5A 2PT0A 3FEZA 1R8AA 2KB2A 5B0AA 2HMIA 3HVWA 1T94A 2VOOA 4DR7F 3OLAA 4X4NA 2OH2A 2SXLA 4XK8C 4QU6A 1UWBB 1FXLA 4ZCIA 3K58A 4FS2A 1KD1T 2BE2A 1T95A 1DTTB 4C3KA 4ZMMA 3D2WA 2VBXA 2KTQA 4DHVA 3Q23A 4DL7A 4UY85 4WKYA 2N4CA 3RRGA 3LP2B 2Q43A 4Q2LA 2WONA 2L41A 5E2QA 1KVIA 3MECA 4O3RA 3H2UB 3ETOA 3QAEA 2WHOA 1JJHA 3O6QA 3RW6A 2M4MA 3FSYA 2PO4A 3DRSA 4NPOA 1DHMA 5KFXA 5A8WA 2NREA 4OMFG 2BANA 2QA1A 5D4NA 4YMEA 3NNAA 4P7TA 2YH0A 3FMBA 3GYXB 5KG7A 4DSFA 2BQRA 4JV1A 4YB1P 3ICLA 2PMZD 1S6PA 3TA0A 2P6TA 1S9EB 5ADZA 4HHJA 4RU2A 2VPZB 2YNFB 1WF2A 1YJUA 3ITHB 3FEXB 1YJNS 1VIOA 4ID5B 3H8YA 1JB0C 3KG1A 4Q0BA 1VC0A 1RJJA 5HP1B 1VQKS 3HI9A 4ED1A 2HGNA 2IRXA 4AL6A 2K7KA 1NZAA 2QZ8A 3ULHA 2MB0B 2CYYA 4CTAB 2ATLA 1KRPA 2BJDA 1D3WA 2R8JA 3B78A 1HBNB 1UKUA 1D9AA 1N5YA 2DT9A 3GIMA 3C66A 1NH8A 5DRKA 4FXWA 4U7UK 3TVKA 2A18A 2YKAA 4ZHRB 5LMNF 1S6UA 2VASA 5ITHA 4KFBB 3GV7B 1KLMA 3KMSA 1KHVA 3BQ2A 1NKEA 4I6WA 5E0OA 4CIOA 3ISNC 4UQGA 1UA0A 3SSSA 3TOQA 4USIA 4DOZA 1CC7A 1H7WA 1TL3B 3PM9A 2P9EA 5HN0A 1WELA 5K9FA 4FZVA 1FD2A 1VQ7S 3MMCA 1NK4A 2XSJA 4PXBA 2FJAB 1HNIA 3J7A1 1ULRA 4DL0C 1LQ9A 4M94A 1RT5B 4O4RA 3NNCA 4E98A 1DTQB 4M5DB 3JSYA 5IFMA 1X5OA 2BACA 4QJVA 4QWCA 3WX4A 1UFLA 2QSWA 2IA0A 2RKIA 3G9CA 2QT7A 3KLFA 4ECRA 4ZVHA 1HBMB 4NA3A 5EWEA 3GFXA 5KG6A 2CJQA 2D3OR 1S1TA 2VA3A 1MMNA 1RYRA 4LF5F 2IMOA 2UP1A 1RAJA 1SJRA 4DR1F 1YRUA 1SJ1A 1R31A 4AXIA 1BQNB 2IA6A 2C2RA 3MCSA 3B8HA 2VPWB 4KQZA 2YNHB 4LF7F 5T41A 4ZK7M 2WTFA 3KTQA 5THWA 3AB4B 4LUBA 2MKKA 1M5OC 1LW0A 2VFRA 2YNGA 3NCPA 4TNOA 3GILA 3M8QB 1FE4A 2F9JA 2FJWA 4Y2MA 4G1QB 4O44A 3EXYA 2PIIA 3ISZA 1FNXH 2I2YA 3PO4A 1HBUB 2FUG9 1YJ9S 1YG0A 1HNVB 1Z2LA 2HS4A 2JX2A 4I2QA 4CO5A 3BDPA 4HTIA 1VQLS 2HNDA 3DLGA 3H2VE 4IO9Q 3GE9A 4OI0A 5D4PA 5J2PB 2YTCA 1WHWA 3OW2R 5L1KA 2BBEA 3WZ0A 1R0AB 4ZP7A 3CD5A 5JJBA 1DAXA 2JFDA 3KHHA 2D1CA 3RB3A 1N32F 1C2PA