1OIAA

U1a rnp domain 1-95
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
90
structure length
90
Chain Sequence
VPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribonucleoprotein
molecule keywords U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
publication title Crystal Structure of the RNA-Binding Domain of the U1 Small Nuclear Ribonucleoprotein A
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1oiaA00
2MQLA 2RQCA 1YJ9S 1WWHA 1R8HA 1K73T 2M0GB 2CPZA 2LXUA 5JVGQ 1X5SA 2OSRA 1DHMA 4C7QA 2HVZA 4Y00A 1NU4A 2LA4A 2DNGA 3RW7A 3UCZP 2ERRA 3UCGA 3G4SS 1X5OA 1U6BA 3FEXB 2M88A 2CPDA 1VC5A 2MGZA 1KD1T 1P27B 1N88A 3Q2SC 3EGZA 1HA1A 4IUFA 4WFNQ 2RRBA 1UAWA 4WIIA 3MOJB 4QQBA 5LXRA 3LPYA 2DNOA 1N8RT 1VBZA 2KVIA 1M90T 2KH9A 5ITHA 3MUTP 1DRZA 1JJHA 1SJ4P 2VOPA 1WELA 5FJ4A 2CPYA 2HZCA 5GVQA 3U1MA 2OTLS 1U6FA 2X1GA 3NS5A 3L3CA 2G0CA 1NO8A 1OO0B 3SXLA 3U1LA 2DGUA 2EK6A 3LQVA 4F02A 2CQ1A 4TU7A 1IQTA 2DNZA 2MQMA 5LJ5Y 2CQHA 2M2BA 1P1TA 2RS8A 3S7RA 3B4DA 2LCWA 1X4FA 4CIOA 1U1RA 2KHCA 2DH7A 4FXVA 2DNQA 1WG4A 2MZRA 1NJIT 2MKJA 3VAFA 2BZ2A 1UP1A 1HD1A 2E5GA 2SXLA 1A7GE 3BO3A 3JB9k 4QU6A 1X5PA 1WTBA 3ULHA 5DDQC 4IOCQ 2V94A 3DXBA 1N52B 2DHXA 2FHOB 2VONA 3CCMS 3BEGB 1FJ7A 1UFWA 1JJ2R 5HL7Q 2RQ4A 1FNXH 3THPA 3CF5Q 3B4MA 1OIAA 2RT3A 3P3DA 1VQLS 1YIJS 2MPUA 2DNYA 2GHPA 4F25A 2KM8B 4CQ1A 1VQMS 4QPTA 2OTJS 2L41A 2XS5A 2ADBA 2DNNA 4P6QA 3PIOQ 2CPXA 4A8XA 2JRSA 1M5OC 2A3JA 2DGSA 5D78A 5IQQA 3CXCR 1KOHA 2KT5A 3US5A 1AUDA 2MZTA 5H1SV 4PKDB 1Q7YT 3CULA 1VQ5S 2KG1A 2DGWA 1FT8A 3MDFA 4J5OA 4YOEA 4CH1A 3CD6S 2M52A 5DM6Q 3G8TA 2VODA 3SDEA 3S8SA 2NLWA 2KU7A 2RRAA 5D77A 2DIUA 1N54B 1VQ9S 3ZZZA 1YI2S 1S72S 1WG5A 1WHYA 5IM0B 4WF9Q 3NNCA 4TLQA 4IOAQ 2GO9A 2DNHA 2N7CA 2G1DA 1VQOS 1U1QA 2FC8A 2MQPA 2KFYA 1DZ5A 2LECA 1F9FA 5LSLA 3VALA 3UD3P 5BJRA 2XNRA 2DGOA 1YWXA 2ZJRQ 1U1MA 1WF0A 4WFBQ 3CMES 2CQ0A 2RNEA 4CH0S 2MZJA 1WEYA 2KG0A 2MQOA 3J7YU 2M9KA 2DISA 3HHNB 2N3LA 1D9AA 1VBYA 1S79A 2OSQA 2X1BA 1PGZA 3UD4P 2Q79A 2CQ4A 1Q86T 2DNLA 1B7FA 4U67Q 1M5VC 1JMTA 2ZJQQ 5MLCV 2DNMA 1X4BA 2CQ3A 2MXYA 1U2FA 1H2VZ 2RS2A 1YJNS 2EK1A 2MHNA 4BS2A 1VBXA 5GAEU 1KQSR 2CQPA 3ZZYA 1VQ4S 3CC2S 1PO6A 2DO0A 4OZ0A 5DDPC 1WHWA 2MKCA 2AYGA 1SJFA 2MQQA 3IWNC 4M5DB 2DNKA 5DM7Q 2MZ1A 2CQCA 2CQBA 2YH0A 3BO4A 2DGVA 4TU8A 3R1LA 2DNPA 2MJUA 4YUDA 2VOOA 3NNAA 3J7ZT 2KXNB 4LIRA 1YITS 1WI6A 2HGMA 2JWNA 2M70A 2KXFA 2L9WA 3P6YC 2MQNA 2M4MA 4V19X 2MKIA 3H2UB 5CYJA 3CUNA 2CPHA 2CPJA 3TYTA 2PE8A 1UW4A 2QA4S 3CC7S 1WF2A 5LXYA 1VC6A 2LQ5A 1OPIA 2CQDA 3TO8A 4LJMA 3H2VE 2MGZB 2HGNA 2LEAA 2FC9A 2J8AA 2KN4A 1WF1A 4OZ1A 2QFJA 3SMZA 3G71S 2E5IA 2FPHX 2MB0B 3D2WA 2D3OR 2HYIB 2G4BA 2F9JA 3THTA 3CPWR 4EGLA 4UY8T 1WI8A 2QEXS 3CCJS 2MJNA 1URNA 4PRFA 1K8AT 4ED5A 3VAIA 2N3OA 2MYFA 4Z2XA 2M7SA 4TU9A 3G6ES 3VAKA 2E5HA 4QU7A 2LEBA 1U1OA 3MI7X 1U1LA 1ZZFA 2KM8C 2F3JA 2PEHA 2MKHA 3MURP 3CMAS 3DLLQ 1FHTA 2M8HA 2CPIA 2UP1A 4PR6A 3NMRA 3CCQS 2E5JA 3UWTA 3CCRS 2XS2A 4W92B 2DNRA 2XNQA 2DITA 1O0PA 2KRBA 4WFAQ 2KYXA 1D8ZA 2DHSA 3CCLS 5DDRC 3R27A 1WEZA 3P5TL 5DETA 1X0FA 5HO4A 4LMZA 2DHGA 1X4AA 1A9NB 2KRRA 3K0JA 5LSOA 3MD1A 2O3DA 2JVOA 1WHVA 3CCSS 2MY8A 3VAMA 1QVGR 1K9MT 2YWKA 3FEYB 1VQKS 1ZH5A 4WKRA 5JVHQ 1YJWS 1M5KC 2HGLA 3G8SA 3EX7B 1SXLA 1QM9A 3VAGA 2E44A 2I2YA 2N82B 2J0QD 1OWXA 2CQGA 2LA6A 1U1NA 1FJCA 1X5TA 2X1AA 5DDOC 2LKZA 1KC8T 2WBRA 5GADU 2AYMA 2MMYA 1M5PC 1U1KA 1X4GA 1H6KX 1XN9A 4ERDA 3IRWP 2I38A 2DGQA 4W90B 2DB1A 2RU3A 3UE2A 1Q81T 2OJ3A 4C4WA 2EVZA 1U1PA 2DHAA 2YTCA 5GAGU 1HL6A 3G96A 3SDEB 4IO9Q 2YH1A 3CCUS 2J76E 1RK8A 3RW6A 2MZQA 5GMKa 1X4CA 1JJ4A 2AD9A 2XSFA 2YKAA 3VAHA 4F26A 5IM0A 3MUVP 2BOPA 1BY9A 3UCUP 1Q82T 2CJKA 2NZ4A 2LYVA 3BO2A 3NNHA 3MD3A 1H2TZ 4ZKAA 2MSTA 3NS6A 1FJEB 2DH8A 3Q2TC 1L3KA 2DGTA 1YHQS 2KI2A 5EN1A 3P49B 2KXHA 2D9OA 5LJ3Y 2K8GA 4RU2A 2MKKA 2U2FA 1VQ7S 3MXHP 2LMIA 3OW2R 1KOOA 5CXTA 3I55S 3MUMP 2RVJA 2AYBA 2DH9A 1WHXA 2U1AA 2RUGA 3S01A 1R8PA 1FXLA 1HD0A 3CCES 1FO1A 1WG1A 2JVRA 1X4HA 2DO4A 1YTYA 2FY1A 2M8DB 2F9DA 1VQPS 3PIPQ 2CQ2A 2CQIA 1WEXA 2DGXA 2MZSA 2CPFA 2XB2D 1QVFR 2D9PA 2JX2A 3CC4S 1H2UX 1W2BR 1SJ3P 1DBDA 2J0SD 3V4MA 1M1KT 2K3KA 3S6EA 3BS9A 3TP2A 1SJRA 2XS7A 3CCVS 2CPEA 3N9UC 3R1HA 1SJQA 2DIVA 4WCEQ 2AYEA 3I56S 4Y0FA 4C0OC 2MKSA 3CTRA 1X4DA 2LXIA 3VAJA 3EGNA 1VQ6S 1RKJA 1VQNS 2MSSA 3VF0B 5GAHU 2MY7A 3HI9A 1VC0A 4UQTA 2OIHA 1CVJA 5IFMA 1G2EA 2DK2A 3G9CA 5CA5A 4YB1P 1ZZNA 2X1FA 1X4EA 2ZJPQ 2B0GA 2L08A 2ADCA 1VQ8S 4FXWA
chains in the Genus database with same CATH superfamily
3TVYA 4OZ5A 2CPZA 1N5VA 3TRGA 4JV5J 1RTHB 1E6VB 2HVZA 4MYUA 1AB8A 2KVQE 3DHXA 1JLBA 3OL7A 5H9EJ 2DTJA 1HYSB 4WFNQ 3C2PA 1FRIA 5G4DA 4YR2A 2F1FA 4ZITA 1SKSA 4RU9A 2ZKUA 2GVDA 3D0GE 3KHRA 4K4YA 3DLJA 5THWA 3TUZC 4F7VA 1OS5A 1ZA1B 2CZVC 2ROPA 1P1TA 1OQ3A 2UXCF 2KFZA 2F4VJ 2R4FA 1MN9A 4ZHRB 2BABA 3V6KA 2BZ2A 3WBZA 3UI3A 4CLTA 1RHKB 3IR7B 3PFOA 1FESA 2KJVA 3E8OA 9RUBA 5KFCA 1SI9A 2PI4A 1GXTA 3THPA 3C8YA 1UPPA 3B8HA 1YIJS 4RKUC 2BUNA 4NMXA 2VC1A 4WTYA 2AJ0A 4DR7F 3AJ1A 4ED7A 1REVA 4FF3A 3RG6A 2YKNB 5H1SV 1VQ5S 2XULA 2DGWA 1WC5A 3VVTA 3IA0A 2M52A 5JXSA 5D77A 2DIUA 2ZH5A 1LWCA 4DV3J 4CM0A 1SH3A 3HP6A 4IOAQ 2GO9A 1Y5IB 1VQOS 4O0IA 1PSDA 1CJVB 3DRRB 2RDIA 4W4MA 3RR7A 3H5XA 2LQJA 2PDAA 3POTA 3MAQA 3R5AA 4WZMA 5AE1A 1S9FA 3KLEA 4OX8A 3KYLA 1PGZA 2XMAA 1EP4B 3JSMB 3HHDA 4DUTA 4YB6A 4MYTA 1JXVA 4OHZA 2V4RA 2V34A 2ABYA 3PW4A 1WKJA 3SQOP 1CQMA 3KXDA 3TR5A 3ZZYA 3PVXA 2JEFA 4FPRA 2CUYA 2MQQA 3IWNC 3PRDA 3QYYA 1JLQB 2CQCA 3LWLA 4RBVA 4CT8A 3PHTA 3DRPB 4YUDA 2KXNB 5A6PA 3AH6A 2MKIA 1E6VA 2E5LJ 5DLFA 3PZPA 4LBHA 3HFKA 3T1YJ 2CQDA 3QRRA 3EM1A 1WF1A 1KSPA 3VWSA 2EKNA 3BM7A 4PXCA 1RU2A 3UNGC 3CPWR 4NLRA 1XIQA 4ETXA 5E3CA 3VAIA 4LFBJ 1XTZA 4LSZB 2M7SA 4GKJF 2K2PA 4YB5A 5I42A 4BLGA 2YVSA 4IR1A 2HQGA 1PJ7A 1NMEB 3BR9A 1NPPA 4NLVA 3PCOB 2VBXA 1F3VA 4LQ9A 4M5NA 3L4BC 1O0PA 3OTOJ 1UFKA 2DHSA 4K50A 1HBOB 4N76A 4PPZA 1X0FA 4RUAA 3DOKA 3E01B 3BBBA 2UU9J 2LEPA 3CCSS 3UDCA 3QSYB 4A8KA 5F0WA 4F36A 3UD5A 3RJMB 3EX7B 2R7VA 2R2RA 2J0QD 1HR0J 1U1NA 3VGUA 1RABB 2YKNA 4E2FB 5L39A 4DPWA 2AYMA 2MMYA 3MM9B 5D0EA 3R3TA 4M8LA 3I4PA 4NLUA 3ETMA 2R8IA 2O66A 5DQIA 1ZM9A 1S1TA 4DR4F 1GMWA 3VAHA 3A8IA 1YGYA 2KDOA 2CJKA 2FZKB 4Q2LA 4HEA9 3DRRA 3G87A 4DSIA 1VOMA 2D9OA 2K8GA 1WC4A 3WIUA 3UPFA 1RTIB 5E0OA 1YZ7A 2BE9B 2WONB 4PCQA 4NLGA 3ICLA 3PIPQ 2DGXA 1EP4A 3T5LA 2JC1A 3JSMA 1C1BB 5EWFA 2CWXA 2IRUA 2KT2A 2E7WA 2YKOA 2HMIB 3D1QA 4NRUA 1N36F 2KZMA 1DURA 1VC0A 2EXUA 3KOAA 1JLQA 5L9XA 4UW2A 4LRAA 3DRPA 3SYZA 1K47A 4USUA 1RAEB 2M0GB 3WDOA 4HI2A 4J9PA 3RW7A 2QGFB 4YDXA 4DCOB 2JEIA 1P9QC 2BE7D 5HJYA 3FEXB 3DFEA 1FWPA 2KKHA 2PC6A 3UDLA 4TYBA 1UAWA 3VVUA 1U0SA 4L75A 4KT0C 3EGVA 5F8HA 1VR6A 5B7WA 3MHYA 3GV7B 1NDLA 5IT0A 2VJVA 4DL7A 4C3MA 3LAMA 1M0SA 3QJLA 1YJUA 3ZZUA 5B09A 4TU7A 1ZTTA 3T6JA 2JFDA 3RBZA 4JI8F 1IBMF 4YEAA 2E66A 4DU8A 2J5AA 1JLCB 2HQCA 4NLXA 3KLVA 1B0TA 1C0UB 1S5ZA 3HJFA 5F8NA 2RQ4A 2POKA 2EG1A 2C3PA 2DNYA 1IUJA 5F3ZA 4DV7F 3HXMA 2WW8A 2HHVA 2FJEB 1NRKA 1D9FA 2NZCA 3EYZA 3US5A 3MCNA 1MWZA 4ECYA 3MM9A 4CYUB 3CD6S 4DUZJ 4DV3F 2VODA 2GVZB 3PEJA 2KU7A 4O3PA 2IRYA 4WF9Q 1HNXJ 3ILIA 2FC8A 1IKWB 1XNQF 3VALA 1RTIA 1KDNA 3PM9A 4DLGA 5B08A 1U1MA 3QFHA 4WXWA 5KFZA 3PW0A 2MKYA 1MU2B 2RHSB 2UVWA 1P8GA 4FS1A 4WXOA 2ZKTA 3CW2C 5I3UB 1C1BA 3Q8VA 1JMTA 1X4BA 1NPRA 3I82A 4OZJA 3IWXA 2RS2A 4BS2A 1MW7A 4IO1A 2ZH6A 3HT3A 1S9GB 4M5LA 3VZIA 1SKRA 4AL7A 1S0OA 3QIPB 2UV8G 3BV8A 3N6NA 3OQ2A 4Q44A 3P96A 2E5LF 3TAMA 5KFNA 3M8QA 4GMKA 2VG5B 4GO7X 1G1XA 2HGNA 4JOUA 2LEAA 2IY5B 2E5IA 4UZCA 1UJ6A 1KQGB 2FJBB 4F4KA 5KG2A 5SUHA 1U4BA 2BA9A 3D6TB 1Q8IA 4WK1A 1T9XA 2UUCJ 2E5HA 2W9AA 2E9RX 2NSBA 4IG3B 2HHXA 3IN5A 2Y0BB 3BN7A 3SEOA 1WJ9A 1NH7A 1JLCA 3OTOF 5E33A 1VJWA 1UVKA 2UU9F 1QAYA 2ZHAA 2H4YB 1C0UA 2WB1D 4HTIA 3HVAA 2VJUA 4B17A 1U24A 2AV5A 4Z7YA 1HR0F 4J9QA 1AZSB 4DV0F 3QRQA 4B9TA 1IVZA 3KJFB 4NLWA 2YQ1A 2CNKB 2GHVC 5KFHA 3NWRA 2J9DA 3PJ9A 5HVGA 2LDIA 4DCJB 4LF2A 4UUWA 3M6VA 8AT1B 1YKWA 4DSFA 2GVZA 1FVSA 2XLJA 2F4FA 3QRPA 1EX8A 4M5GA 1IQZA 3GE9A 4F67A 1FDNA 3AOAA 2OP5A 2L9DA 2MSTA 3QJJA 2R8HA 1YHQS 2KI2A 1DJ0A 5LJ3Y 2CJXB 3DRXA 2IPOB 4RUCA 3S1TA 2IC3B 1FX2A 1VQ7S 3HPOA 5ETRA 3F73A 1ZBTA 4FBUA 1RYRA 1N0UA 3B78A 1VQPS 4DCPB 3BQ0A 1P1LA 2ZBQA 2QT7A 5I3UA 3CDWA 1H2UX 2NXNA 4M94A 1WOOA 2XS7A 3CCVS 3R1HA 3V6JA 3PNIA 4B02A 2W1BA 3CTRA 4ZP7A 4KY3A 1VQNS 2MSSA 1XBWA 4A8MP 3A4TA 4USHA 1S9GA 3SCKE 5HVFA 4OI2A 4OYIA 3QIPA 4K0KF 3H4BA 1S77D 4NZ6A 5ETMA 1Y7PA 1I94F 4Q5VA 4CM2A 1J5EJ 2VG5A 3A3NB 2CPDA 2GJIA 4HI1A 4R8UB 4OQJA 4QPXA 1CC7A 2HBZB 4CLWA 3D67A 1AYEA 4OJHA 3M1VB 1WELA 2FVSA 1SJ1A 3U1MA 4DPYA 2XC9A 2DGUA 3N28A 1Q1KA 2RS8A 4IG3A 2GMHA 3ET6B 1F60B 2YBVA 3IRXB 3KNGA 3BPSP 1N32F 2Z8QA 4W98A 3LF0A 4FVCA 5KFRA 1F0XA 2JSXA 1XMOF 2YKMA 3HMJG 5BR8F 4ZVRB 1IM6A 1T9UA 2RT3A 3V6HA 4ZLNA 2Y9HA 4F25A 2YY3A 2GW8A 1AZSA 4FYXB 1OSCA 2KYZA 4J9LA 5M2PA 1J5OB 4LSNB 1NKCA 4OHVA 1NXIA 5K8OA 1QAIA 1U48A 3LP0B 2VC0A 4F3QA 4CH1A 2CG8A 5KT6A 2V2ZA 2NLWA 2HAIA 4N7TA 1JKHB 4NX9A 1S72S 2FHKA 1T03B 3TA0A 2F8EX 4JV1A 3NY0A 2KFYA 1T9TA 5KG6A 1UEKA 2OI2A 4ZN1A 2OPQA 2I1RA 2H1YA 3RR8A 1RB0A 2BE2B 4C3KA 2GJ2A 4X64F 1VRUB 3HM9A 1ZETA 4HYKA 2OLWA 4J9RA 3EPIA 3EUNA 2X1BA 3CE8A 5M2UA 2IDLA 1APSA 2VG7B 3OUYB 4PXEA 2JLEA 3KHHA 3M8SA 3QGHA 3AXMA 1YBUA 3C6UA 4AQYF 2AEFA 4B3SF 3EXYA 5KG7A 3WC0A 4P75A 3G2XA 3D6FB 2MZ1A 1B3TA 2J7UA 2ZZTA 3GFYA 4N8NA 4PZVA 1PAUB 2L9WA 4U8VA 2MQNA 4NEZA 4CLLA 4QR0A 3H5SA 2IDEA 4NA2A 4JI4J 1E6YA 4R8UA 2MGZB 5HN0A 2AIRB 4DFMA 3TUIC 1M5SA 1XR7A 2F9JA 3M1VA 4DR5J 3I5AA 1W7WA 1MSWD 1IBLJ 2QLBB 1U09A 3Q8SB 4TU9A 1OSDA 1Y4ZB 2LEBA 2MHEA 4UUXA 1ZZFA 3MURP 3ET6A 1IM4A 2CPIA 3B54A 3IRXA 2E5JA 3FDSA 1T0TV 1Y11A 1KRPA 2DNRA 3AY0A 4NXNF 4DV2F 1KQFB 3CCLS 4DQPA 4X4OA 1DTQB 1RWPB 2QMUB 2AW0A 1DQAA 2GNKA 1HBUB 5HATA 4WKRA 1GFWB 2HRUA 2OEKA 1J5OA 3VAGA 2LA6A 3UO0A 1HW8A 1VYAA 4A47A 2LKZA 3OHBA 5GADU 2JJ4D 3ELHA 1WKLA 2Q6CA 5J1PA 4QIVA 3CNQP 2MZQA 1R0CB 4J37A 3Q83A 3MUVP 1T03A 1QE1A 1Q82T 3KDOA 4CLUA 2XYPB 2ZH3A 1RT5B 1R0AB 2BACA 4ZVGA 1SBRA 4QIFA 1VBKA 4P2MA 4QR2A 2BE2A 2PMHA 4LRBA 1OJ4A 3KDNA 2COLA 2PA3A 2RVJA 2AYBA 1VRUA 2VBZA 2XHWA 1HD0A 3MEEA 3LANA 2G0JA 3G8QA 4GVBB 2XB2D 1QVFR 1FKAF 3OUYA 4ZS6A 5KFSA 2NYIA 1FTCA 1BUXA 2XMMA 3SSRA 4DX5A 4K2XA 1TL1B 4P7TA 4C0OC 2PMWA 1Y3JA 2MKSA 3TA1A 4X62J 4B9UA 3FCHA 4PG8A 1RE1B 2CDQA 2X1FA 2EKYA 2RQCA 5KFVA 1WWHA 1RP5A 1X5SA 1J5EF 1DHMA 2QLWA 3KJNB 3QAUA 5KFJA 2ILZA 2FD2A 2DYAA 2MGZA 1IN0A 2L48A 4J90A 1RQ0A 3GFZA 4M5JA 4LR7A 1PBUA 2W7AA 5J1NA 2MQ8A 1JXLA 3G6YA 4NLYA 3N4WA 2EFPA 1WC0A 1GMVA 3H20A 4P52A 1S1WB 3A3OB 4O23A 1RLCL 1RBAA 4WWSA 2HNYB 4F02A 4DL4A 3IS9B 4UOCA 3AAWB 2DR9A 4YY3J 3B4DA 5CD4H 1N5YA 2ZE2A 3B82A 4NI2A 3MM6A 4JV2A 1HWUA 3D6HB 4ZLLA 2L3MA 3JB9k 1Q78A 2V2VA 4KHPJ 3I0RA 5KOWA 3CCMS 1UFWA 2N4DA 1VRTB 3LW5C 3OXLA 1EB0A 3JYTB 4ZVPB 4AL5A 3FSIA 2OTJS 3AOCA 1FK9B 4L72B 1W26A 3JXOA 3SSQA 3VQTA 3GIIA 1QJHA 3NXZA 3JQMA 2HQ3A 2PI5A 3PDNA 4BBYA 1LNQA 3N5FA 4E8UA 2FZCB 1AA1B 4OL8A 2C28A 3WX8A 4J7CA 1RT5A 1R0AA 1FKOB 3MOZA 4RR5A 3I6PA 2HHUA 1UA1A 1Z4UA 1U2CA 2HFOA 2DPIA 3PX4A 3JSBA 2XLKA 4C11B 4QWDA 3J7YU 4CO0A 2N3LA 4GVBA 4TXSA 3UD4P 2DRBA 4B3OB 3SQGB 3FBBA 2QYGA 2HQDA 3VR1A 2QA4G 4PAAA 5AE3A 2QJ3A 1TL1A 4OMFG 2RF2B 5DDPC 2MKCA 3QGIA 4H4MB 1X0PA 2DNKA 4A8YA 1TUWA 1IXKA 4ZK7M 3HFVA 2VASA 4WBFA 3RB0A 4Q43A 3UFCX 3V5RA 1F9EB 3M2VA 2QG9B 3I9ZA 1CEZA 3M8ZA 1TVRB 2GQCA 1QUVA 3ILJA 4DSJA 4FP9A 3AA9A 4LF7J 3JQJA 1M1GA 3A8JA 5HBMB 3ZFVA 1QLNA 1NHVA 2V8GA 2QFJA 2IVFB 1LXNA 4P7VA 4DR5F 4WFZA 3DM2B 2QEXS 3D5MA 3VHQA 1J27A 4MKYA 3IS9A 4QU7A 5GMDA 4QIEA 2XGQA 2PEHA 4R0EA 1EZZB 2GGPB 2ZHOA 3BGLA 2BJ8A 3L95X 1KFDA 2BRLA 3ZZOA 2C3MA 4JI2J 3CO9A 2IBOA 3GYNA 4CO4A 4WFAQ 1FE4A 1T02A 5DETA 2IAJB 4B9NA 2KRRA 5BYRA 1WHVA 1NHKL 4YFUA 2G13A 3JYTA 1ZH5A 1IKYA 5JVHQ 4O3SA 3W5ZA 4ECXA 3DDNA 4DFKA 4DUYJ 1RT3B 3R7BB 3NCQA 1YLXA 2RU3A 2VFUA 3OFHA 2AJFE 1B4SA 4ECUA 4DR3J 1DLOA 1S99A 3GG0A 3FZ2A 2DVIA 5KT5A 3RGIA 4ZPCA 3KMQA 4WFYA 4N8OA 2F7VA 2XSJB 1F1BB 2LLZA 3N0VA 3Q2TC 3F41A 2DGTA 3KKFA 2WVEA 4D3GA 2VU5A 2MKKA 1IBCB 3ZTPA 4O3NA 2CADA 2DH9A 5K8MA 4MAKA 3S01A 4C11A 1R8PA 1FXLA 1MWQA 3CJ0A 1U8WA 3FC9A 2W4DA 4Y6IA 4KR0B 4YR0A 3OL6A 4B3MJ 4EMDA 3NWGA 2XWYA 2W2MP 4BC9A 3EWGA 1FVQA 1U7LA 1M1KT 4O3OA 3S6EA 4Q0BA 1UPMB 4X62F 1HI0P 4CLKA 4X4VA 1JLEB 2RF2A 1EAYC 2W8LA 4H4MA 2FQQB 2ZH8A 3W2VB 4MFBB 1NSPA 1PILA 4KGZB 5K9FA 3TI0A 4F0KA 3BB5A 4ZA1A 2UXDJ 4CO3A 3T41A 3Q89A 4P9SA 4PQUB 1N33J 1TVRA 1IKXB 4QZVB 3UCZP 1UETA 4LF5F 4JI3J 1P27B 3Q86A 5F8JA 1V3RA 4LF6F 3MPYA 1WSVA 4DN0A 1DRZA 1XMBA 2Z0GA 3GIJA 2XBPA 5IT9Y 1BQMB 3Q23A 4ALZA 2E9ZA 2EK6A 1IBKJ 2O1PA 3J7Z5 3M05A 3T1HF 2DXFA 4ID5B 2GGPA 1VJQA 1N4LA 1RGVA 3R6LB 4HDHA 3MR3A 3I0SB 4OZNA 1BE4A 1D9DA 4OZ2A 4K4VA 2FJWA 2XM3A 2FLPA 2E5GA 4PG5A 2OKQA 3BO3A 3ULHA 1K44A 2IAJA 1FJGJ 3I5CA 2BM1A 1Q53A 3QNWB 5KG4A 1ULRA 3MMBA 3IBWA 4FBTA 1F6TA 1YRXA 4K4WA 2GHPA 5U47A 3AD9C 2C22A 3PTWA 1YJ7A 1FRHA 4ZOSA 1RT3A 4ICLA 2JRSA 3O2IA 2ALYB 2UUBJ 5IQQA 2EI5A 1OPZA 3W64A 2CAJA 2H5IB 1NB7A 4DX6A 1S6OA 2P6SA 2HWIA 3V6DB 3G82B 3O1LA 3LAKA 2XSJA 5IT9U 1Q16B 2J0WA 1G6BA 4ZVTB 2ZBCA 3ZTQA 5CZXA 4IFVB 5H9FK 4FZVA 1JQGA 5L8RC 5EDWA 3MEDB 2AEMA 2MLYA 2KG0A 4HH1A 3OBIA 1S79A 5CYMB 2CQ4A 2KHDA 2OMLA 5KFPA 2Z56B 3D28A 3IXQA 4FF2A 4I64A 4ZPAA 5AXMA 3CD5A 2IYGA 4ILLA 2ASYA 1FWKA 2VHGA 2PMZD 1YJNS 2DJWA 1N56A 1T9YA 4IH6A 5BYSA 2CNOB 2JFKA 1UJ4A 4CLZA 3HVTB 3EVOA 4MFBA 1UVNA 1PAEX 3BDEA 2DNPA 5HANA 4I6YA 5HMXA 3J7ZT 4PXDA 3P6YC 2BM0A 2V8VA 4LF7F 1IKXA 4J9SA 4ITSA 1H73A 1NKBA 1RT1B 4USMA 2HS3A 3H7HB 5LL6d 2CJQA 4OLPA 2OAUA 1EQ0A 2HS4A 2J6UA 2G1HA 4EGLA 4M5KA 1K8AT 4C0BA 4OX9J 3PX6A 1R27B 1U49A 1U1LA 4TQSA 4ID5A 5KFYA 1B0VA 4YQWA 3M32B 2BJ7A 2WSFC 1FERA 1KP6A 1UEVA 1QSSA 1QUPA 2HLTA 2E1CA 1AUSL 1A9NB 3IM9A 2B3TB 1K9MT 1VLYA 1VQKS 2QL5B 3AHPA 3CJTA 4DUYF 3SI8A 4A8SA 3H2LA 4C98A 2E44A 4A8OA 3OL8A 4OI1A 1T9WA 3MR7A 1F3FA 4GC7A 2OO4A 3D1OA 5L1JA 2ROGA 2I38A 4F4XA 2UUTA 3AXKA 4DR3F 4ES1A 2ZWPA 5MAOA 3ZO7A 3CCUS 4P10A 3HKWA 1Q5VA 5IT4A 1V5VA 1X9MA 2IHR1 3SIPB 3CJ4A 2B4OA 4MIBA 2QLXA 2DH8A 1PG5B 2KXHA 2OMOA 1HWLA 5KT2A 4PG6A 1FXDA 1NUEA 2UVVA 1QAJA 1R6VA 3MEDA 1K1SA 8ATCB 2C1EB 3ENWA 4B3MF 3GWCA 2XTJP 4FYVB 5CYMA 2Z57B 1SJ3P 3F56A 1H0HB 2K3KA 1S7HA 4RW4B 3W3SA 4CO1A 5F9LA 3OL9A 3QATA 3EVWA 3MAHA 3F44A 1ACMB 3BDPA 3FRZA 3HVTA 2V4JB 2V2QA 1A0OB 4RJVA 2UXDF 1JLFB 2L08A 2OELA 4HHHA 1TELA 2GHWA 1HI1A 2W4PA 2Z2MA 2CZ4A 1N33F 3KG4A 5HP1B 4ES2A 5JVGQ 1H3DA 2C2ZB 1JWWA 4JI3F 4AYBD 4ZCLA 4N41A 4QBUA 4RNOA 4L3KA 4EZ6A 4MTPA 2KTQA 1RHRB 4QYZJ 1GMUA 2HIYA 2WSEC 2KVIA 1CSJA 1R6YA 2D1CA 3NS5A 3DLKB 3U1LA 1VISA 3LQVA 2UUAJ 5HI7A 3NKYA 4LFAF 1X31C 3MZIA 3PJXA 5LMNF 3IBFB 3J7A1 2AQ4A 4F4YA 5LOQA 2WZ1A 5E5NA 2QA1A 1R8BA 2EW9A 1KLMB 5B0FA 1VQSA 4GRSA 3A8KA 3B4MA 2ASDA 2XWXA 4ZPTR 5G0RB 2RD5C 1VQMS 2E7XA 4IH5A 2UUBF 1C0TA 2QTWA 2GCFA 3NMAA 3W8PA 4UF4A 1H98A 4HH0A 2NXEA 1CULB 2MZTA 1VHFA 1TUVA 2XI2A 4NWBA 4J5OA 4ZVFA 1GTEA 1ZPWX 4K8RA 4MKVA 4J9UE 4KHRA 2FJDB 2RRAA 3GR0A 4H4KA 2WVDA 2GMLA 1RWUA 5A76A 4HACB 1YI2S 3PG9A 4OI4A 3LWMA 4X4PA 3TZYA 3W9JA 4USJC 3IWLA 2CA9A 2DGOA 2VQEJ 2JH3A 3NAIA 2VBYA 4DL6A 3KJQB 4TNOA 2VA2A 3GFHA 4K5RA 3KTQA 2D3O1 1FRXA 2DNMA 3RRHA 4RW4A 4ECTA 1UZDA 2GC8A 3FFIB 5J1EB 1TKTB 2EK1A 5F3TA 2XI3A 1SJFA 4LVOP 4NZ0A 5D0HA 3SCIE 3QJPA 4M5DB 5EWEA 4O44A 3GTYX 3QZ7A 3KK1A 3OXGA 3EGWB 2AT1B 2M70A 3I96A 2PE8A 1SQFA 4FYYB 2FVCA 4DDFA 2R7RA 4IG0A 3OR2B 3W1YC 1PKUA 3H42A 1Q4RA 4ANDA 5FDLB 4F2SA 4NYPA 2I9SA 1FWLA 3E51A 1TK0A 4ED1A 4EI2A 2HRTA 2BBEA 3DLKA 2R8GA 4C8NA 1ZAWA 4KGKA 3K89A 3M8RA 2XO6A 1Y9OA 5ETLA 4JI7J 2FLNA 3K5LA 2EPIA 1ZTWA 3H25A 1LOUA 3BQ2A 1LW2B 3ENVA 1F5BA 4TQRA 2OPPB 2YNIA 3VTIA 1YJTA 2VBWA 5HMWA 4JP8A 1KLMA 3MD1A 1LKZA 1FEHA 4HT5A 3UNYA 1WUUA 4ZJOA 2RH3A 2YX4A 4DJBA 4X2BA 1CULA 1GX5A 1N6QA 2XZDB 5CCLA 2G9OA 4CRJA 4F4WA 1U1PA 2KL8A 4HACA 5K14B 1RAIB 2YNHA 3RTVA 4RPFA 3FUYA 3T9NA 1UMJA 3PO4A 1L3KA 5ETKA 1KOOA 2GAHC 3V81B 5DLGA 3BKUA 3BSNA 1H7XA 3W8GA 4X4NA 4DR2F 5AXLA 2J7WA 3C66A 2HLUA 3MCMA 1NKEA 4GC6A 3HHLC 1RHUB 5J1EA 3FFIA 1TKTA 5KFGA 4EZ9A 1S97A 3CIMA 1SC3B 3ZTSA 1KS2A 2AGQA 3EXCX 4M5DA 1N34F 1G2EA 1WC6A 5L1IA 1EJ7L 2HHHJ 2LXUA 2C2DA 4H54A 1NU4A 1NJZA 2DNGA 1VLOA 5KFKA 2ERRA 2XG8A 3IAM9 4EK2A 3A13A 5FDLA 1N88A 4NEYA 3C3LA 1HA1A 2W4CA 2IVYA 3GCWP 3SCJE 1N5QA 3DKDA 4LF4F 1TTHB 5LXRA 2J0XA 3N01A 1VBZA 1DARA 4X65J 2FVQA 4ZVSB 3PFEA 4DN9A 4NA3A 5K20B 4NPOA 2UUAF 1HNVA 2XMVA 2Q3PA 1IQTA 5LJ5Y 5T7LB 2HFSA 2B8QA 4DPXA 1UFLA 1LW2A 4ZJQA 1R8AA 1XMQJ 3P5BP 1SQGA 4JB8B 2OPPA 3HT0A 2G2ZA 4UOHA 1S1XB 5FLXU 1D09B 4B3TJ 4IOCQ 3OTBA 1I51B 1XNRJ 4M5HA 1REGX 1LW0B 4IDKB 1OIAA 3B6BA 3GZ7A 3QQCD 5DG7A 4M1KA 5B0GA 4PEOA 2QLJB 3PYGA 2XS5A 4S0MA 1Q0NA 2R42A 1M5OC 2DGSA 4TVAB 3LOUA 1QY7A 3HF5A 1EHWA 1KBRA 3DRSB 3MDFA 2Y3YA 4ZVEA 3RUBL 4DL5A 2CWKA 3Q0AA 5DZ6A 1BQXA 1RAAB 2LDYA 4Q7AA 3TW0A 2GIRA 1FKPB 2LECA 3FQKA 4N77A 2C42A 3D68A 4DQQA 3QBCA 4NLOA 3V81A 3LGMA 1AW0A 3BR8A 2ZJRQ 1ZAVA 1WF0A 4Z37A 4WKYA 2MZJA 2MQOA 2M9KA 5I4MA 3RBEA 5KFLA 3C16B 3KLFA 1S57A 4KV8B 4F2RA 1RU1A 2WCXA 2E1AA 1TKXB 1RTJB 2HVEA 4LUBA 1XQIA 2CQ3A 4WK3A 5C24B 1U26A 2HNZB 4USWA 1H2VZ 5CCMA 2ZBRA 2BKPA 3ZZTA 1HMVB 1I3OB 3NP5A 1SL1A 1UL3A 1TL3B 4RZRA 4EBCA 4X4QA 1S6QA 2N4CA 3U27A 4I7FB 1TK8A 2JWNA 5CYJA 4O4GB 4ZPDA 2BR0A 2LQ5A 3PXGa 1X8DA 1SPBP 2KN4A 4OZ1A 3PYEA 5AJ3J 3D2WA 4X66F 3GV8B 1HFEL 2F40A 1OY9A 1WDDA 5KFMA 2C2NA 3CCJS 3J81U 3FGVA 4C8ZA 2W7PA 3Q24A 3NOGA 2BJDA 1RUSA 4RBUA 1VS3A 5T7LA 3JQKA 3MI7X 3BZQA 3EJMA 3GIMA 3DLLQ 3RRGA 1SKUB 2M8HA 1OYEA 2UP1A 4PR6A 4QYZK 2ZOFA 1S1XA 4DZ6A 3BBCA 1RZMA 2KRBA 4OFZA 4ELTA 2QSWA 5DDRC 4LMZA 2DHGA 2YX7A 1FNMA 1X4AA 1LW0A 4I68A 3KLIB 4IDKA 2YWKA 4ZVOB 3FEYB 4I2QB 4KKOB 1M5KC 2D3UA 2EBGA 4KB7A 2D3ZA 2B51A 1OWXA 1FEEA 4EO8A 1TL5A 1H7WA 1SCJB 1M5PC 3DRSA 1CQNA 1H6KX 4ERDA 2VICA 5A8RA 2Y1IA 3W61A 3SDEB 5HMZA 2LU2A 4OJ1A 4LRCA 2WOMA 4OZLA 3UCUP 3AA8A 2YNFA 1FKPA 2FHJD 2VL1A 3P49B 3NLCA 3HHLD 2B9WA 2HSEB 5LT5A 2FZGB 1QTMA 2XZWA 1WD6A 2JVRA 3GMGA 3C16A 1FRJA 2CQ2A 3UVJA 2Y8YA 3OSNA 2CJYB 2DEIA 4BWJA 1TKXA 5KG1A 4MT1A 2UXBJ 5C24A 1NK4A 2HNZA 3TP2A 2ZITA 1TMMA 1ZM3A 4QR1A 4Y0FA 3EGNA 1KLNA 4M63A 2ACYA 3D0HE 1X9WA 4YHHF 4I56A 2VDIA 2VV5A 2HHHF 3PW2A 1TL3A 4WU2A 2ADCA 4L73A 4I7FA 4O4GA 3NS7B 2JEGA 2PGCA 2WB4A 3KNAA 1HBNA 3A12A 3D0IE 3AQOA 1Q8BA 4E98A 4Q2MA 2V8DA 3GSIA 2BYCA 1WKKA 1NZ8A 3MM8A 1HNIB 2X1GA 2OPRB 2AEJA 3SXLA 2AX1A 4ANEA 1CJKB 1SQEA 2FIUA 3QO9B 5ETTA 1X4FA 2UZAA 2P9CA 1NJIT 2E1PA 2B9XA 1IR2A 3A3PB 4B3TF 1I1GA 1B64A 3FEZA 1N5SA 1XNRF 3DXBA 5ETNA 2IRXA 3HO1A 3O8WA 1RTHA 5HL7Q 4UY85 4DS4A 4OJGA 2EBEA 4KKOA 5EWGA 2HNDB 2B4VA 3NGSA 1S6PB 1HYSA 3GIRA 2AZ3A 3TZXA 3PYDA 2K7KA 2Y1LB 4QWBA 2ASLA 3EZ5A 2V9WA 4P73A 1FF2A 2JOQA 3M8YA 3M9OB 4Y2CA 5C7PA 1OY6A 3SDEA 5D15A 4WPAA 5IWAF 2FVPA 1RWWB 1C2PA 4DOZA 3R5GA 2VPYB 1WDTA 1F2HA 4PPDA 1UVJA 4O0NA 2VKRA 3PX0A 4ZHRA 3H4DA 4F0HA 3DDIA 3MEGB 4B3RJ 3K7RA 3TX0A 3MM5B 2YXLA 3LPEA 4WFBQ 1WEYA 1CC8A 1D9AA 2DR7A 2HBQB 3DRYA 2ZJQQ 4NXMJ 4TYAA 4I6WA 2UVUA 1VBXA 5GAEU 4ZCIA 5B0DA 2AYGA 4GO5X 4D3HA 1KHVA 4LREA 4OLOA 1HHTP 1D1UA 2CYYA 2D69A 2H65B 2KXFA 4V19X 1RT6B 1CJVA 1NK5A 1LWFB 2AGOA 2C3YA 7AT1B 3MMCB 2GFFA 1VC6A 2ZUGA 3G6VA 3C15B 4DV1J 2V6AA 2J8AA 3OR1B 1VIXA 3G71S 3X1LB 3CB4A 3CJSA 5F41A 2HHSA 1YZ6A 2HAFA 4IKAA 4UY8T 1BGXT 1HNIA 2MJNA 3PY8A 3GJSB 3WIVA 3CT9A 1LK5A 4OYPA 3ZC4A 2NYHA 1SC1B 3QO9A 4DV5J 4LQ3A 2KM8C 2W01A 2HVDA 1FHTA 3HD1A 3CCRS 3EDQB 4W92B 4NLDA 4A8WA 3AD8C 3AOBA 4USKA 3FBFA 4JV5F 5LSOA 5D6GA 1CS4B 2QN6B 3DXSX 2GS8A 4DPOA 1HARA 4KGMA 2QSFA 1VI7A 2N82B 4DWIA 3MR6A 2N7YA 1H74A 2IMOA 3W7BA 4DI6A 1UZHA 3H0PA 2YWGA 3R5DA 3BPDA 1QAXA 3TA2A 3RBDA 2RUSA 4C4WA 2EVZA 5AT1B 2ZBPA 2YH1A 2RE1A 5GMKa 5IOLA 2BDPA 2XSFA 4F26A 2BMBA 2F4VF 4RLEA 2FJAB 3MD3A 1RDRA 2A1BA 3QPIA 1OMSA 2ZM6J 3OTCA 1HQEB 1K0VA 3CIZA 3MEGA 3FBCA 1RHJB 2HFVA 1HBOA 4PG7A 1VQYA 2JLFA 3E01A 5L1LA 3MM5A 2P5VA 3L7OA 3RBXA 4UT4A 2H48B 2LQ8A 2M8DB 1SIWB 1HHSA 1TL7B 4JYAJ 3SV3A 2ZNYA 2VF3A 1DBDA 4DL0C 2J0SD 5KT3A 2RJZA 3BH6B 3BYRA 2FLLA 1RAFB 1SJQA 5L9NA 5KT7A 1HNWJ 3QWPA 1RKJA 1PYOB 1G3OA 2HURA 4NRTA 5CA5A 2HZAA 3GP9A 2ZJPQ 1NJWA 4FYDA 4NLPA 1GK8A 1K73T 1R8HA 1BD6A 3UN3A 5CQGA 1JB0C 1RT6A 3VZHA 4CO5A 2AU0A 1LWFA 3MMCA 2BV3A 3UCGA 1YK9A 2VDHA 2A2CA 3C15A 3LGNA 3R5JB 4ZIWA 3OR1A 3MR2A 2WONA 2RRBA 3OVBA 4WIIA 2OFGX 2K7JA 3DLEB 2KH9A 1XR5A 2AJ1A 5JJBA 2ZVIA 3L3CA 1Y10A 1AFJA 2NPIA 2XCAA 1HQUB 2YQ3A 4OYMA 1KVIA 2HMIA 2IM2A 4X4SA 1EKSA 5LSRA 4DQRA 2MZRA 1NDPA 3WHIA 2R2UA 1DTTB 3RYLA 4G1QB 1X5PA 1RAGB 1TMJA 2VONA 3LH2S 1CJUB 4OHWA 1CS4A 3BEGB 2EFGA 1RADB 4WZQA 3T1YF 2JHEA 4P74A 1VIOA 1LQ9A 1TUGB 3P4UB 2ADBA 4P6QA 2I8EA 4WU3A 4QW8A 5K8PA 5D78A 2ACMA 4LIWA 1YX2A 4YDDB 4PKDB 3CULA 1FFGB 4LFBF 4KAIA 1KNZA 4JV0A 5A8WB 2QX0A 1VQ9S 4C8KA 1Q95G 3ZZZA 1L3SA 1L3UA 3W65A 4KO0B 4C0HA 2G1DA 4DR6J 1GXLA 4K5SA 4DX7A 3OT9A 2D74B 3QT8A 1KFSA 4Y2KA 2ZC3A 3KG1A 3UR0A 1YWXA 3QT6A 1TAUA 1OYDA 2ZH4A 1S9EB 4KE5A 3PR4A 3MCSA 2CZ9A 2BQRA 3HLUA 2DISA 2W2QP 1NPKA 1MMNA 2V50A 2IFXA 5HQ8A 1M5VC 1N5TA 2LXFA 3AODA 4JBCA 4PXBA 4YR3A 2Y0SD 2JLGA 4CYUA 4ZVUB 1U2FA 5IXUA 1ZPVA 2ZOGA 1FDBA 1Y5NB 2UXCJ 2GX8A 3HK2A 2VPXB 5F9NA 5J2PB 2FJVA 4RUBA 2EFOA 1YITS 5HJXA 5J2QB 1IKWA 3CUNA 3OVAA 2VUGA 1RWXB 4ZP6A 5D0RA 2LQBA 2DY9A 4LJMA 3K57A 2Z30B 3THVA 4FNIA 3K5OA 2AHOB 2H3EB 2LU1A 3UDVA 1MU2A 2FGCA 2HYIB 4DG1B 8RUCA 3KHGA 1LK7A 3RZAA 4K4ZA 1OQ6A 3M2RB 4IFYB 4KIAA 2EFNA 3EVMA 4A46A 4QOTA 1Y5LB 3OD2A 1RCOB 1HQUA 3PACA 3KK3B 2MEWA 3W5YA 1F9HA 4RNNA 5IS2A 3NCRA 1QDUB 4QWCA 4ZVQB 1R3NA 4LF8J 4OYBA 1DTTA 5KFAA 2VZ9A 4G1QA 4G3IA 3FBEA 4NLSA 3TQEA 1NJXA 2XMKA 2ZHBA 1TR0A 4U7UK 1R0BG 1QVGR 4KPYA 3GSDA 1RTZA 4RW9B 2IM3A 2HGLA 1KKHA 3M2UB 1Z2ZA 1UCNA 4YMEA 4BC7A 3BJYA 1Z2LA 1NH8A 2VFTA 5E3RA 3BSAA 1FFSB 2PIIA 2OJ3A 5HQLA 2PA8D 5A8WA 1S12A 2VPWB 1RACB 4DSEA 2NPFA 2BOPA 4KO0A 2IIHA 5JMNA 1F5AA 2ZM6F 2DHHA 5KOXA 2JZ5A 2Z2LA 3SFUA 1O8BA 1FD2A 3GPAA 1R31A 3PJWA 1S9EA 4NLQA 2BXJA 4CO2A 4OI6A 3KLHB 1QTNB 2O01C 2FY1A 2MZSA 2JX2A 2GVDB 2VB6A 3K5MA 5GADI 3BKTA 1HQ2A 1D3WA 2OUGA 1SJRA 1HNWF 1O5JA 4DR1J 3FNNA 4DUZF 4GKJJ 5KT4A 1GMWD 2AKWB 4WP8A 4OYAA 5M2RA 2JEJA 5GAHU 4U7UD 1C1CB 2MY7A 2V67A 4ZN3A 2OIHA 3G9CA 3CJ2A 1HNXF 3OPKA 4DHVA 3I32A 4O3RA 3HSJA 3MPUB 5J2QA 1QD1A 2W2PP 1SL2A 1TQLA 3TEGA 3AB2B 4L74A 2IC3A 3G4SS 3EDRB 4XAKA 3HCXA 1KD1T 2Z2ZA 3FSYA 2DRDA 3N79A 4U95A 4QQBA 4DG1A 2HRYA 2DNOA 2ILYA 3PKMA 1FA0A 3MUTP 4IRCA 1JJHA 4DPTA 1VDHA 5GVQA 5KFOA 1SUQB 3TJ9A 5K8NA 1V3SA 3OVSA 1KTQA 3KK3A 1LWCB 2RDDA 2MQMA 5DGAA 2NQPA 2LCWA 4DEZA 1PC4A 4OJ3A 2MKJA 4UOGA 5D4NA 2XY6A 3I87A 3W9HA 4CNZA 3KWMA 2IA6A 2SXLA 2RSQA 4B9MA 2M3DA 3POTB 4CI0B 4CH7A 4XTTA 3CCWA 1FJ7A 3KLEB 1HWJA 1VQLS 4RW9A 1B7YB 3W60A 2M5YA 3OHAA 2DCUB 2KM8B 4CQ1A 4XIUA 2BEFA 4CLPA 4NE9C 1SVDA 3AFGA 2W2NP 4OV6A 3CXCR 3IM8A 2V2KA 5A2QU 2W2OP 3T9ZA 5EX3A 3V4IB 4XDCA 2WK4A 5L46A 3G8TA 2UUCF 4LF9J 3LGHA 1MLAA 3LA0A 3GR1A 3FJ2A 4DR6F 1NB2A 2WVCA 3MPVA 3IO1A 3N6LA 3BGRB 2DNHA 4XDDA 1K1QA 3CD7A 1DZ5A 2QFIA 3D3CJ 5HMYA 3R8YA 3OJUA 2CVIA 4X4RA 1NHUA 2O67A 3NGKA 3KUHA 3KLHA 2FGOA 2B7BB 3UN5A 4E0DA 4LSNA 5HK4A 5EGYA 3LP0A 3OFEA 3D66A 4KC5A 3WC2A 1SC6A 2CQPA 1JNZB 5I42B 5H9FJ 4JI8J 1C1CA 1IBMJ 3A1YG 1BLUA 1XERA 3RAMA 1JKHA 2CJBA 3L7PA 1EIYB 3DOKB 4LIRA 1WI6A 2DCLA 3BSCA 1UW4A 3BGOP 2XYGB 3LP2B 3IBCB 3J7YI 3JSYA 4DV7J 2HHQA 2G4BA 3BF4A 4DLEA 2UUWA 3BYPA 4URGA 4CWBA 4OI0A 5F8LA 3TNVA 1SUQA 2VG7A 4OI3A 2N3OA 1IWGA 4RO0A 1HW9A 1S1TB 4ECVA 3G6XA 2HZVA 2ZNZA 2ATLA 4PQAA 1FRLA 1HHQA 2CIMA 3MF5A 5GAGI 4AL6A 2A0FB 4LF8F 2ASJA 4GKKJ 4OHXA 3P45B 4LR9A 4K2JA 4DV6J 2XS2A 1MNEA 1XK8A 3K5PA 1XNQJ 2HVHA 3K0JA 1B99A 2H9ZA 4N56A 5KFUA 3TJ8A 3BQ1A 1SXLA 2K1RB 1N48A 4C8LA 2ROEA 3QMQA 4Y2AA 3W63A 3TANA 1FDAA 2NUHA 1NEEA 3IR5B 1PYSB 4YS2A 1X4GA 3V4IA 2LP4A 2GQQA 4WYLA 4MH8A 5DQGA 4EBEA 1RWNB 5B0AA 3D6MB 4ED6A 2IJNA 2YKAA 2ALZA 2XQCA 3BGRA 3QT5A 3NS6A 4LFCJ 4Z7CA 5EN1A 2EFVA 2O5DA 2Z58B 2IM1A 1DTQA 3MCOA 1Z1ZA 3H59A 1T11A 1HBUA 4DQIA 2QZ8A 3PRVA 1EETB 4CLFA 2HHTA 1YTYA 5E3AA 4ER8A 1OY8A 4LVNP 1DQ8A 1YSJA 4P2SA 4CDIA 2RAQA 1DY3A 3DOMB 3CC4S 1WORA 4J9NA 4DR1F 5D8HB 4ILMA 4ELUA 3PR5B 5CYQB 3N9UC 3C46A 1Q5YA 2P9GA 4RW7B 2VA3A 1WC1A 3TWZA 1T05B 2QC3A 3BKFA 1Q8KA 2V68A 4URQU 1UJ5A 2FDNA 3DMJB 3DC2A 2QV6A 4Q8FA 3K17A 4DFPA 3GJTB 2CFXA 2H54B 2OSRA 4HLBA 5K5MA 3SFGA 3LP2A 3GQCA 3CMQA 3OJSA 4Y34A 2ZC4A 4DV0J 4ED3A 3SZ2A 3CJQA 1VMBA 3T5KA 2CPYA 4BCAA 2OTLS 3IC1A 5DG8A 3ENAA 4Y28C 1W2IA 1CJTB 2CQ1A 3H90A 3CCZA 5KFIA 3KUEA 2VFVA 1GAOA 1UP1A 2F8MA 1A7GE 2HK3A 1WTBA 2V94A 3M4XA 2NXCA 2OFHX 4M95A 1JJ2R 5KAKA 2Q1LA 3JAMY 3UN2A 2XY7A 4JI4F 1VRQC 3TQ1A 3K2YA 4Y2IA 4FVMA 4WP3A 2K1RA 2C2KB 4A8XA 2E9TA 2Q6BA 5IV3A 4LF9F 4YOEA 1IBLF 1FXRA 1ITPA 3ZZPA 2HK2A 5DM6Q 1S1WA 4JI0J 2HNYA 2GIQA 3IR6B 3HZEA 4IOBA 1PJ5A 3NNCA 3AJDA 4TLQA 3WX4A 4K0KJ 5KFQA 2J6TA 1P9YA 3TAMB 3LP1B 3GYXB 3M8QB 3Q8PB 1I94J 4PYDA 1Q7LB 2LQ9A 4WIQA 4ED2A 2XMTA 2BKOA 1FE0A 2BANB 3R5CA 2FB0A 3CMES 1VFJA 1EETA 4M5MA 4XPCA 1VRTA 1FNOA 5KTQA 4ED8A 3IMQJ 3DOMA 5B0CA 2FTRA 3RRKA 3DLGB 1FK9A 3ONQA 1BWEA 2FY8A 3J7AN 3JAMU 4IYQA 2PFDA 5CYQA 4B08A 2MXYA 4RW7A 5IC6B 1NK0A 3DU6A 5KFFA 4J9OA 1T05A 2ZOMA 1LWXA 3CDBA 2H51B 2YKQA 3M9NB 3DMJA 3UQSA 4L3NA 3MMJA 1N32J 3NL0A 2FYXA 3GB0A 2HGMA 1FKOA 3DLHA 4RX6A 3QZ8A 2V9KA 3HSDA 3TYTA 2V63A 1H38A 2QA4S 1XMOJ 5BR8J 3DGPB 2ZH2A 5IV4A 2HW3A 1GT8A 3N5BA 2FC9A 4K4UA 2FUG9 2AX0A 2VD3A 4J9MA 3SMZA 2LVWA 1I5OB 2XHCA 1CLFA 3GU0A 3MWBA 1U6ZA 1TFWA 5DQHA 1HWKA 2ZZMA 4G65A 4B3OA 3SQGA 1WTFA 3MAAB 2WHOA 1L5UA 4U7CA 2MYFA 4Z2XA 1CJTA 3E3XA 1NDCA 4ED0A 2OEMA 1QSLA 1S1UB 2J7KA 4MKBA 2F3JA 4EFAC 4GKKF 4Y3CA 4DV6F 3UR3C 1WOSA 2RIJA 4WE1B 1IJFB 5KG5A 4KQZA 2ZBIA 3CJKB 2XO7A 4X64J 4WYWA 2XEXA 4UQGA 4U6PA 2V4QA 1WC3A 2HKEA 1T7PA 5HBMA 2I2YA 4KYZA 1TZ0A 2VFSA 2WBRA 1T3OA 1DQ9A 3DM2A 1PIEA 4AQYJ 5E7OB 1SIZA 3DOLB 4B3SJ 2QL7B 4IO9Q 4YY3F 1JX4A 1SKWA 4OZ3A 4OYXA 4ZPWR 1T3NA 4LFCF 5D3GB 1YDLA 2AF6A 3LP1A 4KHMA 3NEKA 4KHPF 5F8GA 1UVIA 5IQ6A 2BANA 3ZTOA 3SCLE 3EZOA 1X4HA 4FF1A 4NCBA 2F9DA 1L3TA 2JDJA 3DLGA 4PWWA 7FD1A 2E1RA 1S48A 2KT3A 4ATNA 3KHLA 2CPEA 2AYEA 2R9LA 5H9EK 2LXIA 3RB3A 3K8WA 2F5GA 5F8MA 3C19A 4MIAA 2DRAA 1CVJA 5IFMA 3ISZA 4LRDA 4QCLA 1JK9B 1S76D 2CKWA 4OYOA 5SZTA 3R9LA 1MMDA 1PJ6A 1S10A 4NXNJ 4DV2J 1CG2A 2KFNA 4MK7A 2YKMB 1S0VA 4I0WA 1O6XA 2LA4A 3DGPA 1X5OA 2BQUA 1U6BA 4FXDA 4UTGA 2A6MA 1SL0A 1HWIA 7FDRA 3EGZA 5ETPA 3CD0A 1TL4A 1JLAB 3ITHB 1V5IB 2ZH7A 1RA6A 3TUPA 3MAAA 1RHQB 3IGNA 1NBEB 1U6FA 4I67A 1NO8A 1I6JA 3HJVA 2RU9A 2OEJA 3F0NA 1S1UA 3W2WB 2CQHA 4NMLA 1JLEA 4B9SA 4EWTA 6FDRA 3HSZA 3W2VA 1HD1A 2OPQB 4WE1A 5DDQC 3L9ZA 5A0YB 4CCHA 2CNLB 3CJKA 3CDAA 2NS1B 2ZVSA 4PQUA 5DO2A 3MM7B 2I6WA 3P3DA 3T6BA 2B6AB 2CDRB 3ZNJ1 4KFBB 2XMJA 2L41A 3FCWA 4BWMA 3PIOQ 3QFWA 3R97A 3WZ0A 5AE2A 3LO3A 2KT5A 4M5IA 2HHWA 3UDEA 1URRA 4ECSA 5JUMA 3C6UB 1FT8A 4JI0F 4KGVB 2OH2A 4PUOB 3DOLA 3FZBA 1BQMA 3JTNA 5LM7E 2P2CB 3DLBA 2QA2A 4QIWD 5ETQA 5D3GA 2GAGC 1DAXA 2YWHA 4JI2F 3I0SA 3MEKA 3NBPB 3O6QA 2R8KA 5E3QA 3H98A 1RT7B 4J9VA 1T95A 1E6YB 1KQKA 1U45A 1MWYA 2RILA 1S0MA 3CJ3A 3M9MB 1GTHA 3M7VA 3HKZD 3HFZB 4HL9A 1FTRA 3FRYA 4UOFA 2MHNA 1AT1B 4RWWA 3CC2S 4OZ0A 1WHWA 3CDEA 2B7CB 3CJ5A 2XMUA 2YH0A 1U8SA 1YBTA 2HBYB 3V6DA 3G82A 2MJUA 2R8JA 5ETOA 3LTOA 4ECZA 3W5XA 2C3UA 2M4MA 3H2UB 1RWMB 3SBMA 3CC7S 4AD6A 1T9VA 1F2GA 1XWLA 3ETOA 4IFVA 3TO8A 1U47A 1RT4B 1RYSA 4IRKA 3ZTRA 1JLAA 3ITHA 2MB0B 2D3OR 2CXEA 5DJBA 3AB4B 1B70B 4P71A 3W9IA 4C2MA 3PKYA 2AP6A 4ED5A 2VPZB 2G2OA 3W2WA 4B9VA 3T1AA 1QE1B 3CMAS 4ANCA 3PEHA 2RMLA 3WQPA 4HDGA 3DI6B 2DITA 1NK6A 1TKDA 2KYXA 3IP0A 5A0YA 3H8YA 4FKYA 1KN6A 1HLWA 3BH7B 3MM7A 3TUJC 2YPYA 1M5HA 3MEEB 4WFXA 2B6AA 1FX4A 4KFBA 1RT1A 2YX1A 4EUVA 1RBOB 2CQGA 1IKVB 4PWUA 2HFZA 4DU7A 3ZZ0A 2BQ3A 1U1KA 4IQXA 3NGTA 2DB1A 4PUOA 2R7SA 1ZOTA 3GG1A 1IBKF 3MTJA 3VCDA 2YTCA 2V0NA 1YJRA 1YVFA 2X3GA 1X4CA 4KH0B 3BO2A 3M32A 2K3IA 3MMAB 3NBPA 4EYHB 3Q8YA 2JNJA 1RT7A 2AJ2A 2U2FA 3MXHP 2LMIA 1FJGF 3OW2R 5CXTA 4JI5J 4HHUA 2R2SA 2U1AA 1U0HB 2B4UA 1YJVA 3TAPA 1GNKA 1WG1A 3QGGA 3LALA 5IZHA 1Y00A 4WTOB 1TKZB 4OYZA 1NNDA 2K06A 2HIQA 3D7SB 5DGBA 3QGPA 2P6TA 1N5YB 4CT9A 4J9KA 2ZE2B 3R7NB 4NI2B 3MM6B 1ZAXA 3QLHB 3FMBA 2GMJA 4DPUA 4HVZA 4K4XA 5KG0A 1UKUA 3I0RB 3R7SB 4C7QA 4PYAA 2ZWOA 4Y00A 2LFVA 4USTA 2OPSB 2PFFB 4PABA 2IMWP 2M88A 2XGPA 1RT4A 1VC5A 4F3OA 3Q2SC 5B0EA 3TOQA 3CJ8A 1Y0HA 4JI6J 1HPZB 4TLRA 1M90T 5CH7B 2VOPA 3CJRA 1PCAA 4XPEA 2X7IA 2AJ4A 4CLYA 4K7QA 3W66A 4C97A 5D4OA 3TZZA 2HVIA 2ZFHA 2DNQA 2V4JA 1B0PA 2AMCB 1KEKA 3DI6A 3MFHA 4V1Ak 3MR5A 4KBIA 1JLFA 1TU0B 4QWEA 2DHXA 5HP1A 3U02A 2W9BB 4ZCKA 3CF5Q 4NOHA 1EKRA 4LSLB 3PW7A 3T19A 1IKVA 2CPXA 2A3JA 5C2CA 1RSCA 4NASA 4ED4A 3AQPA 1GX6A 3FQLA 2NUUG 3TVKA 3X3UA 4OX9F 2WW4A 4OV1A 2IBKA 1TFYA 4NYOA 1XR6A 4FPIA 5A8KB 5IM0B 3MMAA 3GCXP 2X51A 4YN3B 3M2VB 5LSLA 5HAOA 1NDKA 3UD3P 3NGUA 1S4EA 2WAQD 3HVWA 2GQ2A 4P72A 2DXEA 2ZH1A 4DXLA 1JLGB 1U0HA 2ZEJA 4LF5J 3FKBA 4RW6B 2RNEA 4QWAA 3NCPA 3R6GB 2A10A 5G0RA 2VIHA 2Z4PA 3DYAB 4LF6J 1Q86T 3K58A 2BW2A 1B7FA 4U67Q 1TKZA 3NRBA 4V19J 5AXKA 3KMSA 4CTAB 4F04B 1R7IA 2V8PA 1SH0A 4URSA 1MMLA 2VG6B 4KPCA 3T1HJ 2DO0A 2QMXA 4RL1A 1JIHA 4DF8A 2HEKA 3QLHA 3BO4A 4U9RA 1U2RA 3NNAA 2OPSA 1NZAA 1WF2A 4H4KC 1IKYB 2B4PA 3I31A 1KVKA 1NAQA 3SV4A 1RAJA 1HPZA 2J9CA 3C6TB 2R7TA 3CCTA 3RU0A 1DFDA 2AWZA 2KJWA 1WI8A 5I3PA 2R7OA 4PRFA 5B0BA 4ZP8A 4NCAA 3VGSA 2H4WB 1DLOB 1RT2B 2MKHA 5FLXY 3KUGA 1X9SA 1HBMB 4HR2A 3MFIA 3EE3A 4C8OA 2G0IA 2HQFA 3ZNUA 4QW9A 3P5TL 4L6V3 5CABA 2W9BA 5C42B 4LSLA 4RBTA 3OR2A 2Y1RI 2A18A 3G8SA 2BKNA 3KFWX 1QM9A 3QWUA 4X4TA 5E3PA 4DSKA 2P8IA 2H5JB 2BX6A 5D0GA 4Q0BB 3BGUA 1U02A 3NGRA 2HPUA 5GAGU 4DS5A 4Y2MA 4FDFA 5A8KA 1JJ4A 2AZ1A 5IM0A 3OXFA 1BY9A 5ADZA 4R25A 1NK9A 3D4JA 1H2TZ 1KHWA 1Y3KA 1RWOB 2MTLA 4JI5F 2BW7A 2QRRA 1JLGA 3Q8RB 1PYTA 1RXOB 4HT7A 2BJ9A 5KFEA 4KGXB 4RW6A 2OHDA 2C2MB 3DYAA 1NSQA 2CQIA 3TARA 4R0JA 4GVLA 2YWEA 4AE5A 2RKIB 1BQNB 2VQFJ 4CTAA 4G1IA 4K59A 2VG6A 3SSSA 3I56S 3M6XA 3VAJA 1VK3A 5HVHA 2CJ9A 2QMWA 2MDAA 5T41A 1FI4A 3FVYA 4YB1P 4ZCMA 5K14A 2B0GA 4CZCA 2BVZA 3AJ2A 3HZGA 2BRKA 1UVMA 3MMBB 4WP9A 3CSKA 3OTEA 3KJVB 2VQEF 1WSRA 2X3DA 2R7UA 2GJFA 4JI6F 4IUFA 3IFEA 4ICLB 3J81Y 3C6TA 3MOJB 2EG2A 5ITHA 4IH7A 3HULA 3DDKA 2E1MC 3ISNC 4AFFA 3W62A 5D4LA 3M8PB 3VV2B 2DNZA 1ZM4A 1RT2A 2M2BA 4CIOA 1HBMA 1U1RA 2KHCA 1EARA 1WG4A 3T5JA 3VAFA 1NLKL 3N6MA 3GFXA 4A4JA 2WTFA 3FSXA 1GQEA 3ILLA 2W24A 2R7QA 3EZUA 5C42A 1FNXH 3CGIA 9ATCB 2A6OA 3D54A 1S6UA 3KLGB 2QL9B 4JI1J 1XEZA 3J80Y 1KOHA 3IG1B 3NAHA 3GYGA 1TK5A 4DV4J 3GONA 2C2OB 2CRLA 3T5HA 1G4CA 3V2UC 4DL3A 4U96A 4JI7F 4A8QA 3GLJA 4LF1A 3D1HA 4AUKA 2HFNA 1U1QA 2MQPA 1RAHB 2HBRB 3QT7A 5BJRA 2DY1A 4OHYA 3KG0A 2B56A 1SV5B 1HNZJ 2CQ0A 3T3FA 2V5HG 4TN2A 3TAQA 3HHNB 1ELOA 4ZJLA 2OSQA 2DNLA 1O51A 4RNMA 2NR0A 2RKIA 1BQNA 1RBLA 1RTDB 4KSEB 3TJAA 1NK8A 2ZD1B 1KQSR 3ENQA 4I2PB 2GA7A 2FVRA 4LFAJ 3J80U 4ZPBA 5LMNJ 2CQBA 4HHJA 3R1LA 2OD4A 2PSZA 3EPGA 5CAAA 4ZLPA 2DD8S 5FIIA 1KWMA 2CPHA 2CPJA 3KJVA 5LXYA 3BGFA 4DQSA 5CZVA 3C14B 4OX7A 4TY8B 2YKPA 1BMQB 3HVRA 4C8YA 2FPHX 3J81j 4NZ7A 3THTA 2QO3A 1NM2A 2OD6A 1LFWA 1UVLA 4KV8A 4MIWA 4LT6A 1H72C 2DPJA 2PD1A 1RTJA 5IC4B 5GAEI 2HG4A 3M30B 3M8PA 4EBDA 4CLSA 3G6ES 3VAKA 4NL5A 1U1OA 2RDJA 2G2YA 1HMVA 5HROB 4F8RA 4DSLA 1KVJA 3NOCA 1ZS6A 1S4FA 4HKQA 3R27A 1Q8LA 1WEZA 5C2GA 4I69A 2MY8A 3DNCA 2VKZG 3OLAA 1T94A 1YJWS 4O4RA 4G1PA 3KLGA 4AXIA 2VFRA 3H5UA 4O3QA 2ZDOA 1FJCA 1X5TA 4X65F 3M6UA 2X1AA 3IG1A 5DDOC 4DMZA 4FF4A 3D3BJ 1FFWB 1TV6B 2V69A 1XN9A 2DGQA 2YPZA 4W90B 2WBMA 4OX6A 2AGPA 4USVA 3TX8A 3G96A 5C5JA 2NSCA 1IWAA 2ZDPA 3RAQA 3QAEA 2IVMA 1XMQF 2KO1A 4C48A 3A8EA 1JJCB 1RWVB 4DL2A 4XK8C 1S1VB 3QSIA 3DGVA 1SV5A 3OLBA 1IR1A 1UEUA 2WSCC 2WVBA 2XZTB 3MGJA 3BREA 3KLIA 3CCES 3BBFA 3KK2B 1J2VA 4TY9A 4I2QA 2XYHB 4OIXA 2D9PA 1BWVA 2VQFF 1WNEA 2HWHA 1RTDA 2RQMA 2YWFA 5DG9A 4ECRA 2ZD1A 4N47A 1ZM2A 4I2PA 5EX0A 2XMWA 4PG4A 3VF0B 3HHKA 4LBIA 3HI9A 4CP5A 1RI7A 3DHWC 4EO6A 1X4EA 2B9EA 4FXWA 2MQLA 1YJ9S 5LMUJ 3ISND 3JTPA 3LUYA 4IR9A 5AXNA 2HFUA 2B5JB 3HDSA 3C14A 1QSYA 4TY8A 1C0TB 4EEYA 4QJVA 2CJAA 3E2EA 2JL9A 1S0NA 2DEJA 2R7WA 1SJ4P 5FJ4A 3TZWA 3MPDA 1GXUA 3HHEA 2B8PA 1W25A 1OO0B 3M30A 2HWTA 4FYWB 4F50A 3S7RA 2Y8WA 5HROA 4ECWA 4FKXA 1YRTA 1FCAA 2QE5A 1HIYA 4MMOA 1RHMB 4AXJA 2NCKL 3JS9A 1M1HA 1VCTA 4I6AA 5F8IA 4RNHA 3CVKA 4AT1B 2DBBA 3HHLB 4C8MA 2QIFA 1RJJA 3L09A 5FD1A 4EYIB 4JI1F 4QPTA 1U25A 4DR2J 4MJKA 1GEHA 5AJ3F 4ZLJA 3VQSA 3AT1B 2MLZA 4UZBA 3JTOA 2I5JB 4ENOA 4DV4F 1AUDA 4YP3A 1Q7YT 1TV6A 4DZDA 1CBKA 3PV8A 2HS0A 3TVZA 2OPRA 4ES3A 3S8SA 4P2XA 4O44B 1CJKA 1N34J 2J9EA 1WG5A 3KK1B 5T14A 4N5SA 3PW5A 4C9DA 1JNRB 2DR6A 3O3LA 3HX9A 3QIDA 1S1VA 4IG0B 1F5CA 2XY5A 3U7JA 2RB7A 2VH7A 1HNZF 1V9OA 5KG3A 2IYIA 1RKIA 1VHIA 1NJYA 4CH0S 4ZPVR 3KK2A 2B43A 1BHNA 1A6LA 2HNDA 4LF4J 1KR4A 1RWKB 1RAOA 2Q79A 3I4HX 4NLTA 1NSKL 1S6PA 3L7UA 1KTVA 1FD8A 4RWXA 2J9DE 4U8YA 2EC2A 1T8EA 1VQ4S 3H5YA 4P2FA 4NYZA 3GILA 3VGVA 4EU0A 2DXDA 2YNIB 5DM7Q 3Q8QB 4C3LA 2DGVA 4QYRA 3G86A 5KFTA 1IJEB 3R5BA 1RA7A 2R2TA 5KFDA 2V8HA 1HKAA 2R3VA 3U1NA 2B5JA 1OPIA 3P8BB 1K0TA 2EEYA 2GO8A 4LR8A 2FLOA 5HLFB 4C6AA 3DN9A 2Y1JA 1IR0A 1BC6A 3OTDA 5C25B 3NG8A 1N6QB 2XLIA 1SC4B 2F65A 2C2EA 2UXBF 2PT0A 4ZVHA 2UV8A 1LEOA 2CNNB 2ZH9A 4Q8EA 4I4BA 1WACA 2YNHB 2WVFA 4H4OB 1ZA2B 2ZZNA 1NSAA 2GV1A 2EC0A 3UWTA 1D8ZA 2W9CB 1YBAA 2FHJA 5DS7A 1S7IA 1FRKA 4MKAA 1S59A 2O3DA 2JVOA 3HHLA 1C4AA 3VAMA 2W7OA 1UW9A 2QLFB 1SH2A 1G7CB 5E2QA 5KFWA 2FHMA 2DT9A 1AROP 2I5JA 2IM0A 2NREA 4J91A 3ILOA 4KTQA 2C3OA 1GH8A 4F3MA 2XCPA 1UWAA 3IRWP 5HSPA 4IQMA 3UE2A 1Q81T 2DHAA 2APOA 2J76E 5DZ7A 3GJRB 2AD9A 1AFIA 2BOAA 3OFGA 4K4SA 3NNHA 5A6WA 2DR8A 1JXEA 1FJEB 3O5TB 4HTJA 5ETVA 3RB4A 3O44A 3OFFA 2PN6A 3MUMP 3VGTA 1WHXA 2HHPA 3K59A 6FD1A 4RUHA 5DRKA 2NXUA 4DX8H 2F63A 4X66J 2ATCB 5RUBA 1W2BR 2JC0A 5J2NB 1HNVB 3BS9A 4L76A 4ETZA 2OGUA 2IA0A 4WCEQ 4BDPA 2F8HA 4NCGB 1LFPA 3RB6A 1VQ6S 3H40A 2W25A 1YG0A 3D9BA 3HD2A 2DK2A 2UVRA 4ZP9A 3BSOA 1ZZNA 3JSRA 5LMUF 4KJIA 1MROB 1LWEB 1HQEA 2DR5A 4B3RF 4LRFA 2I0XA 4TKTA 5J2MB 5HLFA 2RQKA 5F0UA 5C25A 3ADAC 3LPYA 2J6SA 1N8RT 2Z2YB 1RCXB 1TL7A 5E41A 4NXMF 2HZCA 3I5BA 2G0CA 4F4ZA 3M8WA 5GMEA 1XJWB 5GAHI 1C4CA 1ICEB 4H4OA 3K5NA 2DH7A 1LV5A 4ELVA 4FXVA 4FS2A 1WOPA 3OV7A 4MK8A 4BHQA 2W9CA 4QU6A 2P9EA 1N52B 1NCLA 2FHOB 2YWWA 4RNFA 1MG7A 2YNGB 4DV1F 4RW8B 1YRUA 2MPUA 3KLFB 1D8YA 3R2CJ 2DNNA 3Q8UA 2NXJA 2W8KA 2R7XA 4DR7J 2BJEA 3DLEA 3K8VA 2GZOA 1CPZA 3PRBA 2KG1A 1UWBB 3UW1A 3MECB 5KFBA 3PYFA 4PWDB 4DV5F 1N54B 4YHHJ 4CNYA 4IRDA 1WHYA 1SB6A 4ILRA 1RLDA 1S6QB 2N7CA 3R2DJ 1LXJA 4JUZA 3PO5A 3HSGA 5EHHA 1F9FA 1P6TA 1R8CA 5ETSA 1V3ZA 2XNRA 2GIFA 1V6HA 3BN4A 1CJUA 3PHEA 2YQ0A 3EMTA 1VBYA 2RRNA 4R5PB 3CEDA 1VK8A 1X60A 3GJQB 2ZUAA 4G6VB 1YQHA 5MLCV 5J2NA 3FCVA 3FMWA 5L38A 4MK9A 2Q66A 1VGYA 3I9V9 3M6WA 4NCGA 1PO6A 3Q22A 3CDUA 3IGVA 1UTAA 2B9YA 3RAXA 4TU8A 2VOOA 4A8FA 1MROA 2PO4A 4ECQA 2BJ3A 1UA0A 1FRMA 1Q79A 1LWEA 1FDDA 4QIGA 4X84A 1PC5A 2J8SA 5J2MA 5L1KA 3H2VE 1JLBB 3EICA 3FK4A 2IJFA 3OSPA 3GIKA 4OYWA 2C2RA 5D4PA 5HQMA 4JYAF 3ZZRA 5BXIA 4X4UA 1BXNA 1R89A 1R43A 4K4TA 1URNA 5A8RB 2L9NA 2DKOB 4ZIVA 1XC9A 2EWHA 2WOMB 2A2DA 5IWAJ 3CWJA 5KFXA 4F4AA 2E7VA 2YNFB 2CVEA 4Q45A 2EFQA 3NMRA 3ZXWA 3CCQS 1X7VA 2XNQA 2KB2A 1N0VC 1HI8A 5J2PA 5HO4A 4ZMMA 1AXQA 2YNGA 2D41A 1MN7A 4DBQA 4RW8A 3IAS9 4DF4A 5A2QY 3UVJB 2PEBA 5CHCB 4FNHA 1REVB 1ZYQA 2KZZA 1NK7A 1KC8T 4A48A 4FN5A 4NA1A 1S49A 3M2RA 1UWBA 1KONA 1TAQA 2WRMA 4IFYA 3MECA 1L3VA 1HL6A 4PWDA 5CD4A 4I1TA 6AT1B 3DCAA 3GV5B 1RK8A 3RW6A 4B9LA 5EUHA 5BYQA 4DR4J 2NZ4A 2LYVA 4ID8A 4KRWA 4ZKAA 1PBAA 2AJQA 4ZDNA 4RU2A 2H5EA 2MLXA 1HBNB 5I3QA 1ROFA 2E29A 3I55S 4XO0A 2RUGA 4KH1B 4F0MA 3DU5A 4DFJA 1FO1A 4YB7A 2DO4A 3NGDA 3MPWA 4R5PA 2BJ1A 1WEXA 4LBPA 2CPFA 2HQIA 3M2UA 4WJBA 3MM8B 4USIA 4Y65A 1TP7A 3V4MA 2DIVA 2IJRA 1D0EA 2Q43A 3CO0P 1X4DA 2RHQB 1EQMA 2FJXA 3MTKA 2QYCA 3AD7C 4UQTA 2CG4A 1RISA 1N36J 2D7SA 1VQ8S 3TEHB
chains in the Genus database with same CATH topology
4K4XA 4FYDA 5KG0A 4NLPA 1UKUA 3TVYA 1K73T 1R8HA 3BB5A 3I0RB 4OZ5A 4ZA1A 1BD6A 2CPZA 4CO3A 5CQGA 1JB0C 1N5VA 1RT6A 3VZHA 4CO5A 2AU0A 4C7QA 1LWFA 3TRGA 4PQUB 1RTHB 1E6VB 2HVZA 4Y00A 1TVRA 3MMCA 1IKXB 2OPSB 4MYUA 4QZVB 3UCZP 2BV3A 2PFFB 3UCGA 1UETA 2IMWP 2A2CA 2M88A 2XGPA 4LF5F 1RT4A 3DHXA 1JLBA 1VC5A 3OL7A 5H9EJ 4F3OA 3LGNA 1P27B 3Q2SC 3OR1A 5B0EA 2DTJA 5F8JA 1HYSB 3MR2A 2WONA 4WFNQ 1V3RA 2RRBA 3TOQA 3C2PA 3OVBA 4WIIA 1Y0HA 2OFGX 2K7JA 4LF6F 1FRIA 1HPZB 3MPYA 5G4DA 3DLEB 4YR2A 4TLRA 2F1FA 2KH9A 5CH7B 1M90T 4DN0A 1DRZA 1XMBA 2VOPA 1XR5A 2Z0GA 4RU9A 1SKSA 2AJ1A 2ZKUA 3D0GE 3KHRA 5JJBA 3GIJA 2XBPA 5IT9Y 3L3CA 4XPEA 4K4YA 1BQMB 3Q23A 4ALZA 1AFJA 2E9ZA 2NPIA 2EK6A 2AJ4A 2XCAA 3DLJA 2O1PA 5THWA 3TUZC 3J7Z5 1HQUB 1OS5A 2YQ3A 3M05A 2CZVC 4C97A 5D4OA 3T1HF 1KVIA 2ROPA 1P1TA 1OQ3A 2HMIA 2IM2A 4ID5B 2GGPA 4X4SA 1N4LA 1RGVA 2HVIA 5LSRA 2ZFHA 4DQRA 2UXCF 2DNQA 2KFZA 2MZRA 2R4FA 4HDHA 3MR3A 2V4JA 3I0SB 4OZNA 1B0PA 4ZHRB 2BABA 1KEKA 2R2UA 1D9DA 3DI6A 4K4VA 3V6KA 2BZ2A 2FJWA 3MFHA 2FLPA 1DTTB 3WBZA 2E5GA 4PG5A 3RYLA 3MR5A 2OKQA 4KBIA 1JLFA 3UI3A 4QWEA 3BO3A 4G1QB 1X5PA 3ULHA 3IR7B 3PFOA 2IAJA 2DHXA 1FESA 2KJVA 3E8OA 3I5CA 5KFCA 2VONA 1SI9A 3LH2S 2BM1A 5HP1A 3U02A 2PI4A 1Q53A 4OHWA 1GXTA 3BEGB 2W9BB 5KG4A 4ZCKA 1ULRA 3MMBA 3IBWA 2EFGA 3THPA 4FBTA 4WZQA 3CF5Q 4NOHA 3T1YF 1YRXA 2JHEA 3C8YA 3B8HA 4LSLB 1YIJS 1VIOA 4K4WA 4RKUC 2GHPA 5U47A 2BUNA 2VC1A 4WTYA 1LQ9A 2AJ0A 3PW7A 2C22A 4DR7F 3T19A 1IKVA 2ADBA 3AJ1A 2I8EA 4P6QA 1FRHA 4ZOSA 1RT3A 2CPXA 4ICLA 2JRSA 1REVA 3O2IA 4WU3A 4QW8A 5K8PA 2A3JA 5D78A 5IQQA 4FF3A 2EI5A 2YKNB 1OPZA 4LIWA 3AQPA 1GX6A 4YDDB 5H1SV 4PKDB 3FQLA 3CULA 1VQ5S 2XULA 2DGWA 2NUUG 3TVKA 3X3UA 4LFBF 4KAIA 3IA0A 4OX9F 1KNZA 2M52A 1NB7A 5JXSA 4JV0A 1S6OA 4OV1A 2IBKA 5A8WB 2P6SA 2HWIA 5D77A 2DIUA 2ZH5A 1TFYA 1LWCA 4NYOA 1VQ9S 4C8KA 1XR6A 3ZZZA 5A8KB 1L3SA 1L3UA 3V6DB 5IM0B 1SH3A 3O1LA 3HP6A 3LAKA 4KO0B 2XSJA 4IOAQ 2GO9A 1Y5IB 4C0HA 1Q16B 3MMAA 2G1DA 1VQOS 1GXLA 2J0WA 1G6BA 2X51A 4K5SA 4O0IA 2ZBCA 3M2VB 1PSDA 3DRRB 2RDIA 5LSLA 3RR7A 3H5XA 5CZXA 2LQJA 3UD3P 2PDAA 2WAQD 2D74B 3HVWA 2GQ2A 1KFSA 4Y2KA 2ZC3A 3POTA 3MAQA 4IFVB 2ZH1A 3KG1A 3UR0A 1YWXA 3R5AA 1JLGB 4FZVA 5L8RC 4WZMA 1TAUA 5AE1A 2ZH4A 1S9EB 4KE5A 1S9FA 3PR4A 5EDWA 3MCSA 3MEDB 4RW6B 2BQRA 2RNEA 3HLUA 2KG0A 4QWAA 4HH1A 3OBIA 3NCPA 3KLEA 2DISA 4OX8A 3KYLA 2A10A 5G0RA 1S79A 2Z4PA 3DYAB 1PGZA 5CYMB 1Q86T 2CQ4A 2KHDA 2OMLA 5KFPA 1EP4B 1MMNA 3D28A 3IXQA 3K58A 2IFXA 5HQ8A 4FF2A 2BW2A 4I64A 4ZPAA 5AXMA 4U67Q 1M5VC 1N5TA 1TKZA 3HHDA 3JSMB 1B7FA 2LXFA 4YB6A 3CD5A 3NRBA 4MYTA 4V19J 2IYGA 4ILLA 4JBCA 4PXBA 4YR3A 5AXKA 4OHZA 3KMSA 2V4RA 4CTAB 2ASYA 1R7IA 2Y0SD 2JLGA 4URSA 1SH0A 2ABYA 1MMLA 1U2FA 2VG6B 2PMZD 5IXUA 3PW4A 1YJNS 1ZPVA 1CQMA 3TR5A 3ZZYA 2DJWA 3PVXA 2ZOGA 1N56A 1FDBA 2DO0A 2QMXA 2JEFA 4IH6A 5BYSA 4FPRA 1JIHA 1Y5NB 2MQQA 2JFKA 4DF8A 3IWNC 1UJ4A 3HVTB 3PRDA 3QYYA 2GX8A 4MFBA 1JLQB 3QLHA 1UVNA 3HK2A 2VPXB 2CQCA 3BDEA 3LWLA 3BO4A 5F9NA 4RBVA 4U9RA 5J2PB 2DNPA 2FJVA 4CT8A 4I6YA 3DRPB 4YUDA 1U2RA 3NNAA 5HMXA 3J7ZT 2EFOA 2KXNB 1YITS 4PXDA 5J2QB 1IKWA 5A6PA 3AH6A 3P6YC 2MKIA 3CUNA 1E6VA 2BM0A 2V8VA 3OVAA 2VUGA 4LF7F 1IKXA 2OPSA 1NZAA 5DLFA 4J9SA 3PZPA 4ZP6A 1WF2A 4H4KC 4ITSA 1IKYB 2B4PA 3HFKA 2CQDA 2LQBA 4LJMA 1NKBA 3K57A 1RT1B 3I31A 2HS3A 4FNIA 3THVA 3K5OA 1WF1A 1KSPA 3VWSA 2LU1A 1NAQA 3SV4A 1MU2A 1RAJA 1HPZA 2J9CA 5LL6d 2CJQA 2FGCA 4OLPA 3C6TB 2HYIB 2R7TA 3BM7A 4DG1B 2OAUA 3KHGA 3CCTA 1LK7A 2HS4A 4PXCA 3RZAA 3UNGC 3RU0A 2J6UA 4K4ZA 1DFDA 3CPWR 4NLRA 1OQ6A 2AWZA 4EGLA 2KJWA 1WI8A 3M2RB 5I3PA 4IFYB 4KIAA 2EFNA 4ETXA 2R7OA 4PRFA 1K8AT 4A46A 4C0BA 4QOTA 1Y5LB 5E3CA 5B0BA 3VAIA 4ZP8A 1XTZA 4NCAA 1HQUA 2M7SA 3PACA 3KK3B 4GKJF 1DLOB 3PX6A 1R27B 1U49A 2K2PA 1U1LA 4TQSA 4ID5A 5KFYA 1RT2B 2MKHA 4YB5A 5FLXY 5I42A 4IR1A 2YVSA 1B0VA 4RNNA 4YQWA 5IS2A 1X9SA 3NCRA 3M32B 4QWCA 1HBMB 1R3NA 2WSFC 1FERA 3BR9A 3MFIA 1UEVA 4NLVA 1DTTA 2VBXA 4LQ9A 4C8OA 5KFAA 1QSSA 1O0PA 2VZ9A 4G1QA 1QUPA 2DHSA 2HLTA 4G3IA 1HBOB 4QW9A 4N76A 4K50A 4PPZA 2E1CA 3P5TL 1X0FA 4RUAA 3DOKA 4NLSA 3E01B 1NJXA 1A9NB 4L6V3 2XMKA 2B3TB 2W9BA 2LEPA 2ZHBA 3CCSS 1TR0A 3UDCA 5C42B 4U7UK 1QVGR 1K9MT 4KPYA 4A8KA 5F0WA 1VLYA 3GSDA 4LSLA 1VQKS 4RBTA 3OR2A 2Y1RI 4RW9B 2IM3A 2A18A 3AHPA 2HGLA 3G8SA 4DUYF 3M2UB 3SI8A 3EX7B 4A8SA 3KFWX 2R7VA 2R2RA 1QM9A 3H2LA 2E44A 1Z2ZA 4C98A 3QWUA 4A8OA 4YMEA 4X4TA 3OL8A 4OI1A 2J0QD 1U1NA 5E3PA 4DSKA 2YKNA 4BC7A 3BJYA 5L39A 4GC7A 2AYMA 4Q0BB 2MMYA 2OO4A 3MM9B 3D1OA 1Z2LA 3BGUA 5L1JA 1NH8A 2ROGA 2VFTA 3R3TA 5E3RA 3BSAA 2I38A 4M8LA 4F4XA 3I4PA 4NLUA 2PIIA 2UUTA 2OJ3A 2R8IA 2O66A 2HPUA 2PA8D 5DQIA 4DR3F 5A8WA 4ES1A 5GAGU 4DS5A 1ZM9A 2VPWB 4Y2MA 1S1TA