1OIAA

U1a rnp domain 1-95
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
90
structure length
90
Chain Sequence
VPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
publication title Crystal Structure of the RNA-Binding Domain of the U1 Small Nuclear Ribonucleoprotein A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ribonucleoprotein
total genus 21
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1oiaA00
2DGQA 2DNNA 4ZKAA 3CC4S 3VAIA 1U1QA 2U1AA 3N9UC 3H2VE 3G4SS 2LA6A 2CQIA 2CJKA 3R1HA 2CQHA 3CD6S 2D9PA 3ZZZA 3FEXB 2DGUA 4C0OC 3BO4A 3SMZA 3PIPQ 3VAFA 2ZJPQ 1U6BA 1U6FA 3UCGA 5HL7Q 2KU7A 2MKKA 5LXYA 1WG1A 4P6QA 2RNEA 4UY8T 2E5HA 1VBZA 2M8DB 5DDQC 2E5GA 1K73T 4QPTA 2DO4A 2LECA 5CXTA 2DGTA 2MKHA 2CQBA 2XS7A 3B4DA 2D9OA 2G1DA 2HGNA 3J7ZT 2CQGA 5BJRA 2DH7A 1S72S 1X4FA 3MDFA 3V4MA 4CIOA 3I56S 2JWNA 2OIHA 2EK6A 3H2UB 1KOHA 1L3KA 1P27B 2DHSA 2KFYA 2KXHA 4PRFA 1NO8A 3CCSS 4FXVA 1N54B 5LSLA 1DRZA 1VQMS 1M1KT 1K9MT 2KG1A 2LQ5A 2DNPA 3SXLA 3VAJA 3NNAA 3J7YU 1KD1T 5GVQA 1WG4A 2JVOA 2YWKA 3Q2SC 2MYFA 4CH1A 2X1FA 2MQNA 2DNQA 2M0GB 2SXLA 3U1MA 3CCQS 3DXBA 2DIUA 2KRRA 3CCVS 1PO6A 4TU9A 2KXNB 2XS2A 2CPIA 1X4CA 1U1KA 3UCUP 2DNOA 1QM9A 1HD1A 5GMKa 1KC8T 2UP1A 2MQLA 2JVRA 2HZCA 2ZJQQ 2CQ3A 2L08A 1X4HA 1OIAA 1X5SA 5CA5A 1URNA 4YUDA 4IOAQ 2RQCA 4LMZA 1N52B 1X5TA 2DNHA 2E5IA 2MZQA 2RS8A 2WBRA 2DIVA 1VC6A 1DHMA 5GAHU 2GHPA 1M5KC 1VQKS 2KM8C 1WI8A 3HI9A 2L9WA 2XNRA 4ERDA 2MJUA 2CQPA 2M2BA 3UE2A 3CCMS 2O3DA 2VODA 3LPYA 3CMES 3ULHA 4W92B 2CPYA 5IM0B 2F9DA 2J0QD 2HGMA 1H2TZ 2LXIA 2AYBA 5FJ4A 2M4MA 5LJ5Y 1S79A 5HO4A 1VQ9S 2VOPA 1FNXH 5CYJA 4LJMA 2X1BA 1VC5A 1QVGR 2DNGA 2YKAA 2KHCA 2KM8B 3EGZA 2CQ1A 2DNKA 2OSRA 2MZ1A 2VONA 3FEYB 3THPA 4W90B 2N3LA 2J76E 2KXFA 3NNCA 2MKCA 3Q2TC 1JJHA 4ED5A 2RUGA 4F26A 2XB2D 1VQ8S 3JB9k 2VOOA 2PEHA 2MB0B 2RVJA 3VAHA 2MMYA 5IQQA 1WTBA 3MD3A 2LKZA 5JVGQ 2U2FA 4QU6A 3MUMP 4YB1P 2JX2A 2LMIA 2MZJA 2BOPA 4Z2XA 2FPHX 2MHNA 2AYEA 2XS5A 2MZSA 2KN4A 3S8SA 4WIIA 1WEYA 5H1SV 5GAGU 1AUDA 3VAGA 2OSQA 1BY9A 1D9AA 1WHYA 1JMTA 4YOEA 3UCZP 1FO1A 3EGNA 5LJ3Y 1X4BA 1U1MA 2CQ4A 2DO0A 2K3KA 4WCEQ 2ZJRQ 1A9NB 2DGXA 3VAMA 1WI6A 3BEGB 1X4AA 1SJFA 1OO0B 1ZH5A 5IFMA 1VQ6S 1SJRA 2MZRA 3CUNA 3CF5Q 3G9CA 1OWXA 1VC0A 2MXYA 3CCLS 2A3JA 3CMAS 1YJNS 1UP1A 1VQOS 2X1GA 1DBDA 2RRAA 1NU4A 2KYXA 2I2YA 2AYGA 1RK8A 1XN9A 2N82B 3CULA 2RT3A 2CPDA 5DM7Q 2F9JA 5GAEU 3CC7S 3P6YC 3G96A 1O0PA 2AD9A 5EN1A 3BO2A 1HL6A 2KG0A 2F3JA 2DNLA 2DNYA 1VQ4S 2KH9A 4IO9Q 5LXRA 4V19X 4QU7A 1OPIA 2XSFA 1YITS 1WF0A 1X4GA 2DHAA 3CTRA 2DGVA 1VBXA 2PE8A 2CPZA 3BO3A 3VALA 1RKJA 2OTJS 2ADBA 5GADU 2QA4S 4C4WA 2DGOA 1U1LA 4CH0S 2J0SD 2MKSA 2M7SA 1M5VC 1U1PA 2LEAA 3CCES 3IWNC 3SDEA 2EK1A 2HYIB 4F02A 4PKDB 2M88A 1ZZNA 2K8GA 1W2BR 2E44A 1X4DA 2LYVA 1WHWA 1H2UX 2DGWA 4J5OA 4IUFA 2JRSA 1D8ZA 3S01A 1YJ9S 3L3CA 3RW6A 2MKJA 1WEZA 1X5PA 1UFWA 1FJ7A 4PR6A 1YTYA 2HVZA 1QVFR 4OZ1A 2DH8A 1YI2S 3MI7X 1N8RT 1U1NA 1R8HA 2MSSA 3RW7A 2AYMA 4EGLA 2MQOA 1FHTA 4C7QA 3P49B 2DH9A 4FXWA 1Q7YT 4TLQA 4OZ0A 2DB1A 1WHXA 3CCRS 3IRWP 2G0CA 1P1TA 1H2VZ 3DLLQ 1JJ2R 1SXLA 3BS9A 3LQVA 1DZ5A 3THTA 5DM6Q 4WFNQ 2YH1A 5DETA 1SJ4P 2MY8A 2DGSA 2MGZA 2RQ4A 2MQQA 2DK2A 1M90T 4TU7A 1M5PC 1FXLA 1PGZA 2CPXA 2FC8A 3VF0B 2CPFA 2MJNA 5DDRC 1FJCA 2CPJA 2I38A 3K0JA 3CPWR 2DISA 2HGLA 2KI2A 2QFJA 3EX7B 2BZ2A 2J8AA 3G71S 5MLCV 1YWXA 4LIRA 2M70A 1VQ5S 3MD1A 2CQDA 1CVJA 1SJQA 1FT8A 1HA1A 1N88A 3CC2S 4UQTA 2NZ4A 4F25A 2OTLS 1KOOA 4WFBQ 5ITHA 5D77A 1VBYA 2QEXS 2G4BA 2XNQA 2CQ2A 3R27A 4BS2A 3TYTA 1WF2A 2YTCA 2MKIA 2L41A 1VQLS 2LA4A 5LSOA 2FHOB 1U2FA 2DNRA 4M5DB 3U1LA 2M9KA 3NNHA 1K8AT 1KQSR 3NS5A 2MSTA 3MOJB 2CPHA 3NS6A 2EVZA 2KVIA 3MURP 3ZZYA 3D2WA 1IQTA 3B4MA 1B7FA 1WWHA 3I55S 2E5JA 4RU2A 2CQ0A 5D78A 2D3OR 1Q81T 3G6ES 3NMRA 2LEBA 1M5OC 3PIOQ 3SDEB 3CCUS 2M52A 1X5OA 2CPEA 2MPUA 4Y0FA 1VQPS 1Q86T 1HD0A 3HHNB 3S7RA 4IOCQ 2B0GA 3US5A 2MQPA 4TU8A 2X1AA 3UD4P 3G8SA 1U1RA 1R8PA 2KRBA 2Q79A 2ERRA 1VQNS 2LCWA 2DNMA 2M8HA 2V94A 2LXUA 3S6EA 1VQ7S 3OW2R 4Y00A 2CQCA 3MUTP 3G8TA 2ADCA 3UWTA 5DDPC 1A7GE 2MZTA 1U1OA 2N3OA 1YIJS 2NLWA 1NJIT 2MY7A 2DNZA 2OJ3A 1WF1A 4WKRA 3VAKA 1X0FA 3CXCR 2RRBA 2FC9A 1YJWS 2DHGA 1SJ3P 2FY1A 3P3DA 1WG5A 1H6KX 1G2EA 1Q82T 4A8XA 1FJEB 1WEXA 2DITA 2MGZB 2YH0A 2MQMA 3MXHP 4CQ1A 2GO9A 4WF9Q 1ZZFA 2KT5A 1UW4A 1WHVA 3CCJS 2RU3A 1WELA 4U67Q 5DDOC 1X4EA 3MUVP 3P5TL 2RS2A 1JJ4A 3R1LA 3TP2A 2N7CA 2DHXA 4QQBA 3UD3P 1F9FA 3TO8A 5IM0A 4WFAQ 1UAWA 5JVHQ 1YHQS
chains in the Genus database with same CATH superfamily
1UMJA 2H48B 3VAIA 4M94A 2B56A 2WSEC 3DGPA 1S7HA 3HKWA 3OL7A 2XMTA 1S9GA 1RYSA 3KLHB 4MK9A 1HQUB 1LV5A 1VRUB 2XO7A 1HFEL 3FMWA 1NSAA 1PG5B 2RQKA 4HLBA 1RWUA 4Q0BA 2QGFB 3AQOA 3Q8VA 3PW0A 3TRGA 3WHIA 4I2PA 3TOQA 3V4MA 4CIOA 3I56S 3H2UB 1S6OA 3K58A 4ZCLA 3SBMA 4MFBA 5GVQA 4J9SA 5LMNJ 2MYFA 4DQSA 1T94A 4LSNA 2KXNB 1J5OA 2CPIA 3IA0A 5LMNF 1RT6B 3C6TB 1LK7A 5L8RC 2ZHBA 3O8WA 2HZCA 4A8MP 1QAIA 2VKRA 2V6AA 1Z1ZA 4K4UA 1TKZA 3NAHA 5FIIA 4YP3A 1XNQJ 3ULHA 5G0RB 1TMJA 1TELA 2LXIA 4C8MA 2AYBA 4JUZA 4ANEA 1XNQF 2GS8A 2AX1A 5ETTA 2X1BA 3NGRA 3W60A 2DNGA 4ECUA 2AU0A 3THPA 1SV5A 2AZ1A 3Q8SB 3OLBA 4DL4A 5HI7A 4ED5A 1V5VA 2PEHA 3K5PA 1RB0A 1RWKB 1FK9B 4XIUA 3MM5B 3KJQB 3VAGA 1MWQA 4DR4J 4I67A 4ZK7M 3P96A 2Y8YA 3VHQA 1KN6A 1FJGJ 4DR4F 5CCMA 3M6XA 1UZHA 5IFMA 1TQLA 3VGUA 2GJFA 1FDDA 3M2VA 2V9KA 1FJGF 4QYZJ 2ZUGA 4ELUA 3UO0A 2H4YB 1PYOB 3TJ8A 2W2OP 1OY8A 1Q4RA 4USHA 3A3NB 3TZWA 2CPZA 3DI6B 1EKRA 1IR2A 1O6XA 1NPPA 2IPOB 4P2XA 3GILA 2LEAA 3D5MA 1HHQA 1JX4A 1XK8A 2AZ3A 4M5IA 1V5IB 3QT8A 4DR1J 4A8OA 2LYVA 3IG1B 5GAGI 2F7VA 4RO0A 1F3FA 1RHJB 1WEZA 4DR1F 2AV5A 1FWPA 2V0NA 4F4WA 2NXEA 3O2IA 5KG2A 4FNIA 1WNEA 4FXWA 4W98A 2F5GA 1U24A 2JOQA 3LQVA 3BB5A 4YN3B 3FRZA 3OTOJ 4LFAJ 1WD6A 4OI2A 2DJWA 3BDEA 3OTOF 3TAQA 4LFAF 2XMJA 2ZWOA 1Y4ZB 3M1VA 3UQSA 1I5OB 1UVNA 1VOMA 3RYLA 2NQPA 2XYHB 1RJJA 3IAS9 1FT8A 2RSQA 4G65A 1DARA 5FLXY 1S1TA 1Q5YA 2K7JA 5KT3A 4NLGA 2B8QA 4O4GB 5DO2A 1V3ZA 1U47A 3ET6B 3JSBA 4PEOA 4RW8B 2OPRA 2GIFA 3TAMA 4NZ0A 4JOUA 4PG4A 4I69A 3T6JA 3NOCA 3KG0A 5CHCB 2YQ0A 4N76A 2H5EA 5KT7A 5K9FA 5BYQA 3BKFA 2E29A 1ZM4A 2FJWA 2P8IA 2XBPA 1S1UB 2VDHA 4CYUA 3GE9A 1Q53A 3QYYA 2P2CB 3PYFA 1KR4A 1ZPVA 4WKRA 4P10A 3LALA 1CJTA 2DHGA 1SJ3P 3MAHA 3P3DA 1HYSA 1VGYA 2DRBA 3QT7A 1ITPA 2KT5A 2E1PA 1WJ9A 3CCJS 5DRKA 3UD3P 3Q83A 1U49A 5HVGA 2HNZB 3ELHA 2WRMA 4M63A 1JIHA 2J8SA 4ED2A 4DX5A 4DL2A 2RILA 3SMZA 1S10A 1JLBB 3R8YA 5EX0A 3OJUA 1ULRA 2VBZA 4OLOA 1JJCB 1YKWA 1I94J 4ECXA 3KDOA 5CXTA 2ZD1B 2R7WA 1I94F 2CQGA 1ZOTA 4ZDNA 5K8NA 4DN0A 3RR7A 1REGX 2ZE2B 3NGUA 2DNPA 3AAWB 3Q8PB 3N6LA 4LRCA 3K7RA 1YJUA 3CCQS 1U8SA 2V68A 3ITHB 3JAMY 2UP1A 2MQLA 3ADAC 3DRSA 3D0HE 1X5SA 1URNA 4IOAQ 1IKVA 2UVUA 4OHZA 2V4QA 4E0DA 4ZVUB 4CP5A 5J2MB 4DUTA 2KM8C 5DQIA 3MEEA 4ILMA 1CS4A 3VV2B 3R6GB 4ZMMA 4Y34A 3K5NA 3KLFA 2HHVA 2CJ9A 5H9EK 5F3ZA 4AL6A 2BKNA 5C7PA 5ETKA 5IV4A 3MWBA 5B08A 4A8SA 2BANB 1HHTP 1AYEA 3C16A 3WX4A 1GTEA 3DN9A 3D6TB 4ER8A 3I87A 2X51A 3J7YI 4QBUA 2C2EA 3NWGA 1X8DA 2EPIA 3CJSA 1RT3B 3FCWA 4MJKA 3GFYA 4MKVA 4WIIA 1AUDA 4ATNA 3BSCA 1U02A 3M8PB 4NL5A 5E3RA 1RADB 3UCZP 2HLUA 1FO1A 3IGVA 3TX0A 2C2RA 1SJRA 3PVXA 3CF5Q 2Q1LA 1RTHA 3O44A 2PMZD 4C8ZA 5T7LA 2R7RA 2K7KA 5J2NB 5IC4B 4LBHA 3GR1A 3CW2C 1HI1A 3G8QA 1KTVA 2DNYA 3AA8A 3W2WA 2W4DA 3KUHA 4IO9Q 4V19X 1UVKA 1YITS 2DHAA 2OEJA 1OQ6A 4ZCIA 3DRYA 3LGHA 3UN2A 2GVDB 2V50A 3FRYA 3M32A 4OYPA 1W2BR 2DGWA 4DL6A 3OHAA 4NCGB 2RIJA 4JI7J 4CZCA 1UFWA 3PYGA 4JV0A 2DH8A 3N79A 4OQJA 4JI7F 1R8HA 3AOBA 2E7XA 2DH9A 3AD7C 2EFQA 3IRXA 3FQLA 4OX9J 2R7OA 2C3PA 4W4MA 1S1VB 4KH0B 1CC7A 4OX9F 4C8KA 1S12A 4C8NA 1WC4A 4F3QA 4DFKA 2ZEJA 3C8YA 3I31A 1BWVA 3QRQA 3R5CA 4OHYA 2Z8QA 4EBCA 4QYRA 2BQUA 2JEJA 3C15B 4A8YA 4FZVA 3WC0A 1NK0A 3QWPA 5A0YB 4URQU 2UVVA 1K0TA 3EWGA 1BQMA 1TL3B 2KVIA 3MURP 2CUYA 3F44A 5B0EA 4X66J 3OTCA 1RI7A 2FJXA 1LW0B 4RBVA 4X66F 1LWCA 2MPUA 3TJAA 4WTYA 2ERRA 2CWXA 2Z57B 1HPZB 3UPFA 3Q8QB 1FCAA 4NLPA 3M6WA 3MUTP 3QGIA 2MZTA 4FF1A 4KGXB 4XK8C 3BR8A 2OJ3A 2BKPA 2QA2A 1S1WA 2LXFA 1VBKA 1H6KX 5KOWA 3DLHA 2MQMA 1UFLA 3RBZA 4DCOB 2YY3A 3RUBL 3TP2A 2N7CA 2CNLB 4A47A 3NCQA 3FQKA 2HHHJ 3CC4S 2DR7A 4JBCA 2VBWA 4BBYA 4OHXA 2VG5B 3BPSP 5F8MA 2HHHF 3GZ7A 3A8KA 3L9ZA 3FEXB 3HX9A 1O5JA 4UY8T 2VBXA 2M8DB 5DQGA 2BR0A 3N0VA 4LQ3A 1NK7A 5KG0A 1KEKA 2AJQA 2D9OA 4E8UA 2G1DA 2YWHA 4LF4J 1TK5A 1APSA 3CJ4A 5SZTA 1SKUB 1X4FA 3MEDA 1Y9OA 3D54A 3TAPA 1P27B 1CJKA 4Q45A 4LF4F 1ZA1B 1K44A 1DRZA 2DT9A 1NB2A 1VQMS 4ZPDA 3D28A 1WG4A 2JVOA 4N8OA 5C2CA 3GJQB 2HWTA 3DXBA 4PPDA 4UUWA 1VRTB 4OI3A 4J9OA 4KR0B 3MMBA 1L3UA 1NZ8A 1T3OA 3M8QB 4KGZB 1BHNA 2IIHA 4P75A 1M5KC 2IAJB 3DRXA 4DQRA 3NBPA 3IR7B 1IKXB 3Q86A 4RBUA 4MAKA 5AE3A 3WZ0A 2QT7A 2RDIA 4ECSA 2IYIA 4RUHA 3WIUA 3A8EA 1F2HA 3BZQA 4RW7A 1KLNA 2CADA 4X84A 1WC1A 3R2CJ 3PX0A 1JLAB 1UVMA 5IQQA 3AJ1A 2U2FA 2BXJA 1NXIA 2GVZB 4DX8H 5CYQA 2F63A 1GMVA 3PW4A 4YOEA 3EGNA 1A9NB 4QWDA 4KPYA 1G6BA 4WK1A 4F8RA 1VQ6S 5HJYA 3CJKB 3MAAA 3HK2A 2X1GA 2LDIA 3GV7B 1C1CB 5J2QA 2HSEB 3ZTRA 3B8HA 1RK8A 3KLGB 1S9EA 2CPDA 2O67A 2F9JA 5GAEU 4O3QA 2AD9A 2KG0A 4I6AA 2F4VJ 2KH9A 1FRKA 3QATA 5CZXA 2F4VF 1DQ9A 3LGNA 3P5BP 4G1PA 2HRUA 5D4OA 3EICA 1TKXB 2R4FA 4KKOB 2FHJD 3M9OB 3V2UC 4ECVA 3EVMA 1X9SA 2ACYA 3L3CA 1FFGB 4DR5J 2JC0A 1RTZA 1RT2B 2GAGC 3T19A 3IGNA 3I0RB 2MSSA 1RAHB 3H5XA 2ROEA 2V2KA 2EFPA 1YGYA 3KYLA 3SZ2A 2R2SA 2E1MC 4DF4A 2YH1A 4HHUA 3KOAA 1M5PC 3PEHA 4HTIA 1C4AA 2I38A 3FBCA 4J9MA 3PFEA 1PJ6A 3OVBA 1JLQA 4M5JA 1TP7A 3NGTA 4OHVA 4F0MA 2GV1A 4LFCJ 1N88A 4R25A 2IM1A 3MPYA 2WOMA 4LFCF 3CVKA 2YTCA 2MKIA 5IS2A 2IFXA 2YX1A 1DTQB 1TAUA 2VUGA 3W1YC 2PSZA 2CPHA 1TL1B 4C3KA 1UEVA 3HT0A 4P7VA 3MFIA 3JTOA 3DOKA 4CO0A 3HHNB 2B0GA 5L1KA 3UD4P 3LP0A 2B7CB 1N56A 4Q7AA 3SYZA 1OY6A 2VQEJ 1ACMB 2HVHA 2CQCA 4AFFA 2O1PA 2IVFB 3UWTA 1A7GE 2V8VA 2VQEF 3KK1A 3DRPA 4DN9A 3NG8A 3RZAA 4FXDA 2HW3A 3P8BB 1YLXA 4JI3J 3CD5A 1WEXA 5U47A 4OZNA 1UWAA 1FKOA 3MXHP 4CQ1A 3GIIA 1WELA 2WAQD 4JI3F 2NS1B 2Y8WA 2LQJA 2R7SA 1PCAA 1GT8A 2UUCJ 1TZ0A 1XERA 1U0HA 4G1QA 1QUVA 4DI6A 4LFBJ 5KFSA 4HT7A 1VDHA 4MYUA 1FKAF 3BREA 4NOHA 3QZ8A 3I9ZA 2UUCF 3DOLB 4CT9A 2CZVC 5IT9U 4LFBF 5JMNA 1YBUA 2R3VA 3PIPQ 1DJ0A 3M7VA 3FC9A 3ZC4A 3DXSX 4CNYA 1HBUA 1IWGA 1G3OA 4R8UB 1DY3A 4OZ2A 1BQNB 3VZHA 4J9KA 4WP8A 1K1QA 3F41A 3U1NA 1HBNA 5DLGA 4O0IA 2BE9B 2KZMA 3JSMA 5MAOA 3PJWA 1HBOB 2YWKA 3T9NA 4N41A 1S6QB 4L76A 5ADZA 1VR6A 1WSRA 5KT4A 4ID8A 4CLYA 5KFZA 3S1TA 4DJBA 2IC3A 3GG0A 4GRSA 5BXIA 4ENOA 5CA5A 1RWWB 1T11A 3PZPA 3TR5A 5HVHA 3IWXA 1MROB 2DNHA 3HSJA 2JFKA 3IO1A 4I1TA 2E7VA 2DIVA 2BJ3A 3OV7A 1VK8A 1R0AA 2B4UA 4NZ6A 3Q22A 4FYDA 4ERDA 2M2BA 5IXUA 1T9TA 2KJWA 2RDDA 4LF7J 3OL6A 2CPYA 5CZVA 3OVAA 1H2TZ 4LF7F 3QJJA 2FJVA 1RTDA 1FNXH 2AEMA 4KSEB 4DV7J 3I5CA 4RBTA 1YX2A 2EKYA 5DGAA 3Q2TC 2NUUG 4DV7F 4V1Ak 2RUGA 2YWGA 1FRJA 4KE5A 4ID5B 1KBRA 3D66A 2PA3A 3M30A 2YWWA 5JVGQ 2HQFA 2BQ3A 3J7A1 3DFEA 3A3OB 5H1SV 4TQSA 3H0PA 2Z2ZA 1WC3A 3ZTOA 4GC6A 3PYEA 4CO3A 5LJ3Y 3LPEA 4PQUB 4NI2B 5LMUJ 2C2KB 2DGXA 3GWCA 4IOBA 3QRRA 2PGCA 3C6UA 1HKAA 5LMUF 4ECQA 4CO4A 1SL2A 4OJHA 2MLXA 5B0AA 2HHTA 4Y6IA 1VHIA 1VS3A 5D15A 4DS5A 3LANA 4A8FA 2BABA 1TKDA 2WBMA 1ZAWA 3FGVA 4UY85 1F60B 2GHVC 3D6HB 4LR8A 2XSFA 2EFVA 3BO3A 2P9GA 2Z2MA 1PJ5A 4I6YA 1L3SA 1RBOB 1VRQC 1H0HB 2OTJS 4DV6J 3POTB 3O1LA 1RP5A 1M5VC 2MLYA 2HZAA 3IAM9 2OPPB 4UTGA 3DYAA 1DFDA 1WSVA 4DV6F 4J91A 2VFUA 4DU8A 4DPWA 1X31C 1TU0B 2ASYA 3IR6B 2H5JB 3H5SA 2A0FB 1VJQA 2C2MB 1RHKB 1SC3B 3V6DB 3Q0AA 1V3SA 1YRXA 2YWEA 5AE2A 1DLOA 2AEFA 1AFJA 4DEZA 3OR1A 1NBEB 5IOLA 2FJDB 4OZ0A 4IG0B 2G0CA 3C2PA 1RHQB 1H2VZ 3DM2B 1SXLA 2BE2A 5ETLA 2V4RA 3DOMB 4KY3A 2CPXA 3HVRA 3I5BA 1NMEB 4Q5VA 3NMAA 4K7QA 3TUZC 1Q16B 1K0VA 5D4NA 4BS2A 1IBMJ 2L41A 3PJXA 5K14B 3QNWB 3EZUA 1KQSR 2R8GA 2XY6A 4RW4B 4DUZJ 4DX7A 1IBMF 3NS6A 2XSJA 2AW0A 1B7FA 1DQ8A 4DUZF 4QWCA 3IWLA 1CULA 4RKUC 3TVYA 1X5OA 2DKOB 3S7RA 3TW0A 2VB6A 2CVEA 2W4CA 1S6PB 4M5HA 4QWAA 3KFWX 4R5PB 3OW2R 4QIVA 2AJ2A 1B7YB 5DDPC 4OYBA 5J1EB 1WF1A 4UQGA 2HIYA 4UT4A 1OYEA 1WG5A 3H4DA 1RTIA 4RPFA 1ZZFA 1BE4A 3MPWA 1X4EA 1RDRA 4PG5A 4JI6J 3WDOA 3BR9A 1UAWA 3ZFVA 4M5LA 4JI6F 3N9UC 2GGPA 2ZBCA 3ILLA 3ZZZA 1QSLA 2CKWA 3KLEB 2ZC4A 1ZAXA 1C4CA 2R42A 4YR2A 2MTLA 3ZNJ1 2RNEA 2WCXA 2I0XA 1VBZA 2GQCA 2GC8A 4C8LA 3N01A 3QSIA 1Q79A 2CQBA 5CYMA 2QG9B 2HGNA 3ENAA 3J7ZT 2GIRA 2HLTA 4I7FA 1GXTA 1EJ7L 5HK4A 1CLFA 2PEBA 2J9DE 2O66A 1RAAB 4AXJA 4Y2MA 1LWEB 3BGRA 3Q24A 4PWUA 2CJQA 1PO6A 3R5JB 4TU9A 2WVDA 1U1KA 2V2ZA 4MMOA 1PKUA 2BVZA 2ZJQQ 5SUHA 4Z7CA 1OIAA 3LOUA 2RU9A 3LWMA 3PY8A 3OTEA 3LP1A 3FVYA 1NJZA 2AKWB 1GMWD 3LP2A 2RDJA 1PILA 4NLQA 3MMCA 3R5DA 2DXFA 2Q6BA 3U7JA 4C3MA 3LF0A 2CQPA 3MEGA 2HHUA 2O3DA 3BGLA 3M6VA 1E6YB 1Q7LB 5C42A 5CD4H 1HNZJ 1LKZA 1P1LA 1MU2A 1U48A 5HMZA 2J0QD 4F7VA 4QR1A 4TY9A 1RUSA 1NH8A 1HNZF 2VG7A 4LJMA 1EB0A 3KLIA 3EGZA 2JDJA 2I5JA 2ZFHA 2HQ3A 2F65A 4PCQA 3DMJB 2VZ9A 1IQZA 4PXBA 4EYIB 5I42A 3ENVA 2F8EX 4X4UA 4Q2MA 3D0IE 3NWRA 5F8NA 3N6MA 3CD0A 5KTQA 4O3PA 1UWBA 5HANA 1IKYA 4CM2A 3GV8B 2MZJA 3K57A 5DQHA 3HZGA 1WEYA 2YNFA 2CRLA 1LWXA 4H4KA 2FHJA 2GCFA 3L09A 4HI2A 4GVBA 2O5DA 2DO0A 3HO1A 1Y00A 5GAHI 3TUPA 2W4PA 1ZH5A 4H4OA 3M8YA 3CCWA 2AF6A 1R27B 4PXDA 2MXYA 4C2MA 3D67A 2I2YA 2RAQA 3TA0A 1FRMA 1BMQB 1VCTA 4A4JA 1H98A 5DM7Q 4BC9A 3DLKB 3RRGA 3TANA 3TEHB 5A8WB 3BPDA 5J2PB 4KQZA 1RKJA 5GADU 4CO1A 4F4KA 4PKDB 1JB0C 2M88A 1TK8A 1FDNA 4K50A 4J5OA 1JXEA 3PM9A 4RW9A 2QE5A 4Y2KA 5HP1A 3AD8C 2ZH7A 1EP4A 2ZKUA 3OSNA 2J7KA 7FD1A 1HQEB 5KFBA 2ZH5A 1N8RT 2OPQB 4U96A 4B3MJ 2ALYB 2QSWA 2YNIA 2DPIA 2DRAA 1EAYC 2FDNA 1D09B 3CCRS 4B3MF 1BGXT 4Q2LA 3Q8YA 1U8WA 2VDIA 5E3QA 1DZ5A 2B7BB 2EBEA 4JI2J 4RX6A 2MGZA 3GLJA 3M8WA 1H7WA 3GIJA 2KTQA 2HMIA 4JI2F 4IKAA 1PGZA 2FC8A 1JLGA 2BJEA 3CCTA 3FMBA 1MWYA 1UA1A 2PDAA 1R0BG 2J6SA 1C0UB 3KLHA 1HWIA 1RAJA 3CC2S 3VGSA 1HQUA 3EDRB 1VRUA 3TARA 4RNNA 3KMSA 8RUCA 3HD2A 1TL4A 2LA4A 3KKFA 5A8KB 3MOJB 5HJXA 1ZA2B 4HDGA 5D78A 4Q43A 4KB7A 2EW9A 2V63A 2UUBJ 1Q86T 3ZZ0A 4FKYA 4LQ9A 2ZVIA 2W8KA 1X7VA 2MQPA 5HQLA 3EUNA 2UUBF 1KKHA 1OYDA 2GMJA 2M8HA 2W7OA 2V8PA 2B9EA 2BKOA 1F5AA 1VQ7S 1WC0A 2YQ1A 1NKEA 4JI1J 3H42A 2W9BB 2ZOGA 5KFVA 2NLWA 3OBIA 4JI1F 4AL7A 2FC9A 1CJVB 4V19J 2PI5A 3UNYA 2MKYA 4LF2A 3M9MB 1ZETA 5F0UA 4RUCA 3QGHA 4UF4A 4GVLA 2HK2A 3D1QA 5G0RA 2XGQA 4H4MB 3AXKA 1NK5A 1VISA 4C11A 2EG1A 1JK9B 3SV3A 1MG7A 1PAEX 3M2VB 2DGUA 4TYAA 5HL7Q 4N77A 5LXYA 4MIWA 1HW9A 2GJ2A 1SKWA 1YG0A 2E5GA 2J7WA 4QPTA 3BN7A 2LECA 1FK9A 2GZOA 1I1GA 2ZWPA 2E66A 3IN5A 1NJWA 4CH7A 3MM5A 4RWWA 3OL9A 4FP9A 1S49A 2HWHA 1FESA 1I3OB 2OEKA 3OJSA 4WZQA 2MDAA 2BRKA 1Q5VA 3Q2SC 4M8LA 5D4LA 3ENQA 4TLRA 4ANDA 2W9CB 3N5BA 3BQ0A 2DVIA 3W64A 1X4CA 2HQIA 3UCUP 3E2EA 4WP9A 3RR8A 1FRXA 2LLZA 4E98A 2CQ3A 5A6WA 1ZS6A 2RKIB 2JNJA 1UJ5A 1NHVA 3CJTA 3WIVA 3FKBA 5JUMA 3DI6A 3N6NA 3CJQA 4UZBA 2B6AB 5EHHA 3JQJA 2JC1A 2NXCA 4EK2A 1N6QB 1R0CB 5KG4A 4Q8FA 2ROGA 5LJ5Y 1VQ9S 3IG1A 2J9CA 2YWFA 2KHCA 3UDVA 4L3NA 2ZH3A 2AX0A 1R8BA 3NNCA 2UUTA 2CZ9A 4ED1A 1NPRA 1N5YB 3MD3A 3E51A 5F8GA 2Z2YB 4USUA 4X4QA 3RJMB 1FERA 2NSCA 2PFFB 2XM3A 4JB8B 1U4BA 4M5GA 3SSSA 4LIWA 3TAMB 2C2ZB 2HVIA 4HHJA 4ED8A 3HM9A 2HHPA 3ILOA 1NB7A 2E1RA 1QTNB 2UVWA 3OFFA 3PX6A 5F8JA 3OT9A 3G96A 4DHVA 1VQ4S 1NUEA 1SQGA 5E2QA 1OMSA 3SSQA 1HWKA 4O4GA 3MCSA 3KHLA 4LT6A 3W8PA 3UR3C 1P9YA 4RW8A 3JTPA 1S48A 4DMZA 3HHEA 2YX4A 5A2QU 4WYWA 3V4IB 4OI0A 2IMOA 4FPRA 1WKKA 4RUAA 2JLEA 4IUFA 4WK3A 3BH6B 1N33J 2Q6CA 3A8JA 3MM9B 4DG1B 2GJIA 4PR6A 2HVZA 4IDKB 1N33F 3MI7X 3MZIA 1S1UA 2AYMA 3OXFA 3BM7A 3V81B 1Q7YT 2ATLA 4TLQA 2VJUA 2HHXA 3LUYA 1RT1B 1REVB 3ZTQA 4WFNQ 2KVQE 4KAIA 1KTQA 1P8GA 5KFYA 5RUBA 4PG7A 1R89A 3HLUA 3KK3B 5KFWA 4RL1A 4P74A 2CPFA 2HNZA 2HZVA 4HACA 4MK8A 1E6VB 3MD1A 4L6V3 1XJWB 3RBEA 2V8DA 3HHLB 2HPUA 2OTLS 2Z2LA 1VBYA 3AT1B 4UOFA 4XDDA 1BUXA 4L75A 1JLBA 4HT5A 1FX2A 4M5DB 3NNHA 3D4JA 5DG7A 1K8AT 2R7TA 1NSKL 4OMFG 4OYZA 3PNIA 5ETVA 2ZD1A 8AT1B 3BGUA 4IH5A 3ZZUA 1M5OC 1U45A 1CJUB 3HSGA 2GQ2A 3T5HA 4ETXA 4NLSA 2ZE2A 1SCJB 2FZGB 3US5A 1CS4B 1RT5B 3OXGA 4KIAA 5HATA 4LF8J 5M2UA 2E9RX 3ISZA 2H65B 4LF8F 5D4PA 5I3UA 4K59A 3ITHA 5KFIA 5F8LA 2QMXA 2RMLA 1NK8A 3CXCR 1FJEB 5J2MA 2YH0A 5KFXA 4NA2A 4OX7A 2RHQB 4MKBA 2XMAA 1YRUA 1V9OA 3BJYA 1KWMA 4I4BA 1AW0A 3EPGA 4ZKAA 1UVIA 1YBAA 3IS9B 4EFAC 1U1QA 1FEHA 4N47A 2C1EB 1SUQB 3RBDA 4ZITA 2C28A 2BANA 3ZZTA 4GKJJ 2HQGA 1F2GA 2V69A 1LNQA 4QOTA 4IQXA 2ZJPQ 4GKJF 4K2XA 2QL9B 1GMWA 3BF4A 3HCXA 4DR7J 4NLTA 4Z7YA 2OGUA 2L9NA 3B4DA 2ATCB 1RT3A 4DR7F 5IT9Y 4ZPBA 3TA1A 3E01B 3V6KA 6FD1A 2LVWA 1LXNA 3QAEA 3M8PA 2ZBIA 4DZDA 5J1NA 4ILLA 2UXDF 1UEUA 3NNAA 2NPFA 2X1FA 3QGPA 2FUG9 2V2QA 2SXLA 5LSRA 1SL0A 1N4LA 4DR2J 3MF5A 2XMVA 5J2NA 2M3DA 2NXUA 1X4HA 4BHQA 5J1PA 4DR2F 4QW8A 1L3TA 2GMLA 4HL9A 1XBWA 4F4ZA 2N7YA 4U7UD 4ZJQA 4EEYA 1XR5A 1N5QA 5GMDA 3FEZA 1K47A 4OI1A 2GVDA 1D3WA 2Z56B 4LF9J 1PYTA 1S79A 3QIDA 4OYXA 4LF9F 1UPMB 3PJ9A 4NCGA 3AOAA 4OJ3A 5C25A 5KFKA 2QJ3A 2JEFA 1MWZA 1KS2A 1QY7A 2XO6A 2WVFA 4G6VB 1NK4A 4F26A 1KLMA 1VQ8S 3JB9k 2VPYB 2J5AA 1T05B 2LKZA 3H2LA 3LWLA 2HFOA 4HEA9 2EG2A 2BOPA 4Z2XA 3D68A 4O4RA 5B0DA 5I4MA 3M9NB 4ECWA 2AEJA 3QSYB 1N48A 4E2FB 1S0OA 5D8HB 4KO0B 4WCEQ 3KUGA 1QAYA 2ZJRQ 4FVCA 5KFRA 3AY0A 4I2QA 4DL3A 1SIZA 5L9NA 2EWHA 2QYGA 2A3JA 1YJNS 1NU4A 3PEJA 1IBCB 2H54B 4X4VA 4CTAB 1RYRA 4A8QA 2E1CA 2PO4A 3BV8A 2P5VA 3I9V9 2PE8A 1TL3A 3KG1A 3I32A 2EEYA 2ADBA 5HQMA 4LBPA 4C4WA 4B3TJ 2ZH1A 6FDRA 1LW0A 4B17A 2GHWA 2BV3A 4F02A 4B3TF 3ZNUA 1JNZB 2XCPA 4BWMA 1X4DA 1ELOA 3GFXA 4N7TA 1AZSB 4IH7A 4LUBA 5K8MA 5KFUA 1GAOA 1HPZA 1FJ7A 5KFMA 4H4KC 2ZH8A 3DLBA 1J5EJ 2RQMA 1J5EF 2QZ8A 3PR4A 3PCOB 3V6JA 4NCBA 1KNZA 3HP6A 3K17A 5HVFA 4FF4A 2C3OA 1RSCA 2BJDA 2HQDA 3RAMA 1BLUA 6AT1B 3PDNA 1IUJA 3QBCA 3SQGB 3W9HA 2XQCA 5KFTA 1CJKB 5HQ8A 2CJXB 1HQ2A 2DISA 2HGLA 4A46A 2BZ2A 3A1YG 5EWGA 3T5LA 1SJQA 2VG5A 3FFIB 3K2YA 4CLSA 2IDEA 4F25A 4KGMA 5CH7B 3WBZA 2HK3A 4ICLB 2GMHA 2C22A 2FHOB 2DEJA 2M9KA 3BSNA 2EVZA 2R9LA 2AHOB 1Y5NB 4O3RA 2Y1IA 3DHXA 3ZZPA 3CCZA 2ZBPA 3UDCA 3M8SA 4DQIA 2PA8D 1XMBA 2RUSA 2QFIA 1CBKA 1FDAA 1PAUB 4ZCMA 3CT9A 3IR5B 4IFVB 2JEGA 4J7CA 1RKIA 1VRTA 2EBGA 1YQHA 1F6TA 3T1YJ 3M8QA 2FQQB 4CRJA 3VAKA 4ZVFA 4DLEA 2C2NA 2QA1A 5LM7E 4GKKJ 2VBYA 3T1YF 3QWUA 1Y3KA 3GQCA 1FXRA 2OPSB 4GKKF 2IAJA 1IKXA 4ZIWA 4ES3A 1I51B 5KT6A 5C24B 3QIPB 1Q78A 3M4XA 3TUJC 1NRKA 2KDOA 3H98A 1NK9A 1QDUB 2U1AA 4EZ6A 4O44B 4DV0J 4WBFA 2CQHA 4KFBA 1WOSA 2DCUB 4C0OC 1XR6A 4WFZA 3BO4A 2HNDB 2QTWA 4DV0F 1RACB 1YBTA 3HF5A 2YKMB 4FYYB 2GVZA 4O23A 2ZH2A 1RWOB 1IVZA 1YZ6A 3TI0A 3MR3A 2KFYA 1R8AA 4YFUA 1GXLA 1K9MT 3IM9A 1B0TA 3MM7B 5EWEA 2DBBA 4ANCA 1MN9A 4CH1A 1V6HA 3CJKA 4DPYA 2XS2A 4K4XA 1C1CA 4HI1A 2JVRA 5HROB 1R8CA 3KLGA 2X3DA 3BDPA 1DURA 2AGQA 4NRTA 4RJVA 3C66A 1ZM2A 4NZ7A 4ZP9A 5A76A 2UUWA 2WBRA 5D0GA 2G9OA 2XY5A 3MPUB 1U6ZA 5H9FJ 4USKA 3R97A 1TKXA 4KKOA 1QE1B 4OX6A 1EQMA 1QVGR 1B3TA 2YKAA 2V34A 5HLFB 3FEYB 2A18A 3UN3A 1RT2A 5H9FK 3EZ5A 2J9DA 3I0RA 2WHOA 3PHTA 3AB4B 1UJ6A 2HIQA 1S0NA 3CJ8A 4ZHRB 3CWJA 4JI4J 1WKLA 2JX2A 3EXYA 1IJEB 4ES1A 4LRBA 2VICA 2QIFA 4R0JA 2C2DA 4JI4F 4RNHA 2RD5C 2CXEA 1X4BA 2XZTB 4QR2A 2AJ4A 3U27A 2DR9A 4N8NA 4TXSA 1B70B 1QSSA 1FDBA 4H54A 2Z58B 5HMYA 4ED6A 3GCXP 3H7HB 5BYRA 2VFTA 2N82B 1VIOA 4B02A 1T3NA 3L4BC 2VIHA 4JI0J 3D3CJ 3Q8RB 1DTQA 3DLJA 1OPIA 3J7AN 3OTDA 1X4GA 3M2UB 5AXMA 2W8LA 4IG3B 1TL1A 4JI0F 2VU5A 3R2DJ 1R6YA 2YKQA 2I9SA 1FKOB 3IWNC 2EK1A 1TKTB 2L48A 4FKXA 1YJVA 4QWBA 1L3VA 2QMWA 4MKYA 1S1XB 1QVFR 3QMQA 4N56A 4ZA1A 5D0HA 4LR9A 3KJVB 4C7QA 2R8KA 3P49B 2V67A 3W2VB 4K4SA 3CJ0A 2CDRB 3RTVA 4Y28C 2KHDA 4M5KA 1HBUB 1PSDA 4X2BA 2COLA 3I5AA 1WUUA 2MQQA 2VJVA 3HKZD 3PRBA 5HSPA 1FXLA 3AHPA 2R2UA 2HRTA 3VF0B 2Z4PA 3OFEA 1S57A 3TZZA 1TL7A 3IXQA 3K8WA 3DOLA 1KOOA 2DPJA 2QN6B 3TJ9A 3G6YA 2IY5B 4B9UA 3QPIA 4R8UA 3CDWA 1BQNA 2PMWA 1YK9A 1UW9A 3G82B 4NRUA 4NEZA 5F8IA 2Y1JA 3W9JA 3SCJE 4Y65A 3R9LA 1OS5A 3MGJA 4DZ6A 3SDEB 2M52A 4FYWB 4LF6J 4IOCQ 4WPAA 3VQTA 1KFDA 3Q8UA 4DL7A 4OJ1A 2VPXB 3G8SA 2JJ4D 4LF6F 3HT3A 1HBOA 2W2MP 3W66A 1S6QA 2OKQA 2LXUA 3S6EA 1S0MA 1D9FA 3AQPA 5DS7A 5H9EJ 2V4JB 2KKHA 1T03B 3PHEA 4NE9C 2MY7A 3BGOP 3GIKA 1MROA 3I0SA 4YEAA 1QAJA 2DITA 4C8OA 4U67Q 4ECZA 3R1LA 1F9FA 2R8HA 2CWKA 3W5ZA 2DGQA 2DNNA 4NXNJ 1HHSA 1WC5A 3FBBA 3H2VE 3G4SS 1UVLA 2LA6A 4NXNF 1F0XA 5E3CA 2BMBA 3D6FB 5KFAA 3MR5A 3PW5A 4DV4J 4WTOB 5EUHA 1Z2ZA 5AT1B 4CDIA 4ID5A 4I68A 4DV4F 1HNWJ 1TTHB 3GCWP 3QQCD 1RWXB 5KFCA 4EU0A 4CLUA 3UFCX 4P2SA 1HNWF 2DH7A 2OIHA 3SQOP 2BBEA 1ZYQA 2IDLA 2WZ1A 5ETRA 4PQUA 2FY8A 1NCLA 4BWJA 4Y2AA 1X0PA 2BA9A 3ILJA 3FZBA 5B09A 3HFVA 2XTJP 4XPEA 1HNIA 5GMKa 2MQ8A 3PV8A 4Q8EA 2RQCA 1MW7A 3JQMA 4GO5X 1FNOA 2VF3A 1VYAA 4DFMA 3KHGA 3NS7B 4XAKA 2VC1A 4DV5J 4F3OA 3UR0A 2HBQB 3TZYA 2LFVA 3POTA 2PT0A 4DV5F 2LU1A 4MH8A 1IJFB 5IM0B 1RAFB 1HI8A 3GPAA 2W2QP 2OPPA 4K4YA 3KLVA 4WZMA 3GJRB 2RRNA 2VONA 4ZVGA 4W90B 3V6DA 4FYVB 4Y2IA 4UZCA 5AXKA 4YB5A 2ILZA 3J81U 4ALZA 1WTBA 1U26A 1C1BB 2V9WA 4IG0A 5ETPA 2J0WA 2LMIA 5CCLA 2V8GA 3DM2A 5KFPA 3IBFB 2XS5A 4PWWA 1RLCL 1U0SA 2FVRA 3DOMA 3ISNC 1YRTA 4KHPJ 5BYSA 3O6QA 1NJXA 3JYTB 4KHPF 2HAFA 2NXNA 1CPZA 4Y2CA 3CJ2A 3OVSA 5EN1A 3DDNA 3D6MB 5FD1A 4RW4A 2DGVA 2C2OB 2DY1A 2DGOA 1AROP 2MKSA 4ZS6A 4RNFA 3K5MA 1LWFB 3OPKA 1ZPWX 1FTCA 2HYIB 5HMXA 2JSXA 1O8BA 4DXLA 4F3MA 4ZPCA 3C14B 1TFYA 1S6PA 4LSLB 1NDPA 2BE7D 1YTYA 1UKUA 4R5PA 3LW5C 4NASA 5A2QY 5T41A 1C2PA 1SH2A 3HHLD 4ZVPB 5J1EA 2XHWA 1WACA 3CNQP 2GO8A 5GAEI 1HWJA 1IKWB 3ZZOA 3M2RB 1NNDA 3W3SA 5DDRC 1X60A 2J8AA 5MLCV 1YWXA 2CQDA 4DL0C 3GFZA 3CDBA 3R7BB 1RBAA 3UI3A 2QLBB 2ACMA 4FNHA 3KLEA 4EMDA 5KOXA 4FYXB 2QEXS 2WB1D 1N5SA 2QMUB 1HMVA 3R27A 1SB6A 2YBVA 4FPIA 4R0EA 2QLJB 5KFJA 3AXMA 2BJ8A 4ECRA 5KFGA 4RU2A 4YY3J 3W8GA 1FWKA 1VQPS 4YY3F 2BX6A 2IBKA 4CLPA 1RT7B 2Q79A 3U02A 1VQNS 1LWEA 4YR0A 1SL1A 2FLLA 1N34J 3GJSB 5AXLA 2CJYB 1W25A 5E0OA 5IV3A 3C3LA 4NLWA 2WSCC 2N3OA 1N34F 4F50A 2CNOB 5I42B 3M8RA 1J27A 1YJWS 2RE1A 4RLEA 3NGSA 1G2EA 4PWDB 2OFHX 3X3UA 1E6YA 2O01C 4OV1A 5JVHQ 1QLNA 2WONB 3BQ1A 2HNYB 4GVBB 1VHFA 1OSCA 4C48A 3G6VA 1TR0A 3NEKA 2CQIA 4Z37A 1HLWA 5D6GA 2CJKA 1TV6B 2XWXA 3DMJA 4HH1A 1KFSA 4U8VA 4ZLNA 5KFFA 3KK2B 5KG5A 2IRUA 1WKJA 4X62J 2CJBA 3EGVA 4PYDA 1UL3A 1YJTA 1ZM3A 3C46A 2XS7A 3SV4A 4X62F 3J81j 2VASA 3OR2B 1UJ4A 1RGVA 1VJWA 1M1KT 2P6TA 4NLOA 1Q1KA 3VAJA 5HBMB 2B9YA 2AGOA 2VC0A 3CDEA 2MQNA 1T8EA 2NSBA 2VFVA 2C3YA 4LSZB 4RW9B 2AWZA 2HFZA 3W61A 1R3NA 1TAQA 1EP4B 2ASDA 3TZXA 1KHVA 4DSLA 4OL8A 1YJ7A 2VG6B 1FD2A 5DJBA 3DLKA 3D1HA 2XLJA 5A8WA 2OO4A 1AUSL 2YNIB 7AT1B 1T9YA 3FNNA 4JV2A 5J2PA 1VIXA 3BQ2A 4B9SA 1KP6A 4NCAA 1GK8A 3B78A 3LPYA 1JXVA 3LO3A 3VZIA 5DG8A 4YHHJ 2HMIB 4EO6A 3AB2B 5CYJA 3JTNA 4QPXA 4DR5F 4YHHF 2BEFA 4YDDB 4LBIA 1WTFA 2OSRA 1HQEA 1OSDA 2KXFA 2ZOMA 1JJHA 2OPQA 1LFPA 2MMYA 2AJFE 4ELVA 2B5JB 1S4FA 1HBMB 4OV6A 3DHWC 4XO0A 4JI8J 4I64A 4DV3J 1KDNA 2GX8A 1YJRA 2MHNA 4G1IA 2MZSA 4JI8F 3S8SA 4DV3F 1FXDA 1WDTA 1JMTA 4MTPA 2BW2A 3O5TB 2E5LJ 1OY9A 4OFZA 3GMGA 2P6SA 2MZRA 1UVJA 4PUOB 1VC0A 2E5LF 3CCLS 3CMAS 3V6HA 3GYGA 3RAQA 5KT2A 1C0UA 2OELA 2HHQA 1DTTB 4RZRA 4CLLA 3CULA 3UD5A 2RT3A 2OLWA 3QGGA 3GJTB 2G13A 5LXRA 5IT0A 4OYMA 5A8KA 4YMEA 1HNVB 3EJMA 3RB3A 1BQXA 5DLFA 2DXDA 2EI5A 4YQWA 2QLFB 4URGA 1Z2LA 2J7UA 3OUYB 4LF5J 1JLEB 3UVJB 2UV8G 1FRHA 4WU2A 2FVPA 4C9DA 4LF5F 2HVEA 1Q8BA 2WW8A 4C11B 2IJNA 4DU7A 3TX8A 3HHKA 5L1JA 2W9BA 3BKUA 3HSZA 1S4EA 2FJEB 4K4TA 2YQ3A 5A8RB 1CJVA 3QJLA 3BS9A 2DGSA 3R5GA 2FGCA 2A6MA 1SIWB 2DK2A 2VFSA 3A8IA 3ILIA 4H4MA 3CPWR 2KB2A 1P9QC 1OPZA 3UDEA 3GV5B 4ED4A 1RBLA 1NHKL 1OQ3A 4S0MA 4DL5A 5D77A 3PRVA 5JXSA 4X65J 3TQEA 2YX7A 3HVTB 3TYTA 1PBAA 4KV8B 3EPIA 4X65F 1GFWB 4MKAA 4HVZA 2UXCJ 4USWA 4HR2A 3D2WA 3R7SB 2I1RA 5C2GA 2UXCF 4QYZK 2KYZA 4J9QA 4RWXA 1NDCA 4TU8A 2HFUA 3FCVA 3OFGA 2KRBA 1GQEA 3PFOA 5M2RA 2W9CA 2QX0A 4X4PA 1YIJS 3B54A 5AXNA 2HS0A 1NSQA 2RKIA 1PBUA 3D0GE 4LVNP 1H72C 3KJFB 2LP4A 2HBRB 5B0GA 2H5IB 1CEZA 2W24A 3SCKE 3DLEB 4AE5A 4ZLJA 4O3NA 1CC8A 1TK0A 4PZVA 2YKOA 2B6AA 1FX4A 3RAXA 3VCDA 1N6QA 3SIPB 2HFVA 2YNHB 1RTJB 4EI2A 1FTRA 4ZP8A 3THVA 5FDLB 1S5ZA 3CD6S 1JLCB 1TFWA 1U6FA 4QW9A 1KQGB 4OI4A 4P6QA 4NYOA 2XMWA 4AYBD 3N28A 2AJ0A 1H74A 1N5YA 1K73T 3TEGA 1S6UA 4ED3A 5C5JA 4P72A 2MKHA 1NDLA 4KGVB 3KHRA 4RW6B 2MLZA 1RHRB 2OD4A 5BJRA 3OD2A 2JWNA 3RU0A 2QLWA 2YNGB 4PAAA 2G0IA 1NO8A 4IFYB 4FXVA 2EC2A 3M05A 4ZLPA 2KG1A 2D3O1 2OHDA 4B3OB 1RWNB 2BM0A 3MTJA 3W5YA 3LTOA 4WKYA 3VR1A 3CCVS 2V2VA 4YB6A 1LW2B 3ETMA 4TY8B 2A2DA 2PFDA 3H8YA 1AFIA 2HEKA 3OFHA 4O3OA 3N5FA 2E5IA 3WX8A 3DRRB 1T9XA 2MZQA 2RS8A 1FFWB 1VC6A 2GHPA 3MAQA 3JS9A 5ETOA 4Q44A 4ZVQB 3CCMS 2EXUA 1S7IA 1KVKA 1NZAA 2F9DA 3NCRA 2IVYA 2ZNYA 5E41A 4X4SA 3V4IA 2K1RB 2M4MA 4EWTA 3G2XA 2KM8B 3MM9A 4DG1A 1Q95G 1UTAA 4U7UK 2FZKB 2MZ1A 4HACB 4IDKA 1Y11A 4G3IA 3NRBA 1Y7PA 5EDWA 3PACA 2CNKB 2RVJA 2R7QA 2XLKA 4LRDA 3V81A 2ASLA 4QU6A 1RT1A 2FPHX 2XGPA 1REVA 1NH7A 5GAGU 2AIRB 1XC9A 4A8KA 3KK3A 1EETB 2K3KA 4K0KJ 1WI6A 4WXOA 2GIQA 3A13A 4K0KF 1OWXA 3ZTPA 1UP1A 1E6VA 1DBDA 3UW1A 4ZLLA 3HHLA 2QL5B 2FHMA 1JLFB 3OSPA 4KJIA 5I3UB 1LK5A 2B51A 4J9VA 1CQNA 2IVMA 4ZOSA 4M5DA 2VA3A 2RF2B 1L5UA 2NR0A 2J6UA 5ETQA 1VBXA 3B82A 1C0TB 2XI3A 3ZZRA 2KZZA 2M7SA 1CJUA 2BJ1A 1FD8A 1M1GA 1RT5A 3S01A 3W9IA 2F4FA 3MM8B 1FA0A 2XC9A 4DV1J 1N0UA 1AT1B 3MMAB 2XY7A 1GNKA 2EKNA 2BYCA 3L7UA 4DV1F 3MCMA 4M5MA 3CB4A 1XEZA 3IRWP 1Q8LA 4C8YA 3QLHA 4GO7X 2ZUAA 3QO9A 1KHWA 2CNNB 2OH2A 4QJVA 2UVRA 3AA9A 4NLXA 4C97A 2RQ4A 3H59A 3GP9A 1FRIA 5IC6B 4TU7A 2UXBJ 1NHUA 2R7XA 1H7XA 4X4RA 1T9WA 3MPVA 3IP0A 1SC4B 4NMLA 2B3TB 2UXBF 5GADI 2ZDPA 1SI9A 5EGYA 3IS9A 3H90A 1R31A 1SUQA 3DLGA 2RB7A 3HJVA 4D3GA 5LT5A 2WW4A 1WF2A 1T95A 4WE1B 4ZPVR 1V3RA 4NYPA 1SJ1A 3GYNA 3CIMA 1SKSA 1RAEB 3TVKA 4DOZA 1MMLA 5K5MA 5ETSA 2R7VA 1QSYA 3KMQA 2ZM6J 2JLFA 3E01A 2LEBA 3GFHA 2Y1LB 3PIOQ 3EE3A 3CCUS 1HD0A 2V8HA 3ZTSA 2JFDA 2ZM6F 2ABYA 1S9FA 1NSPA 2BACA 3MM6B 4OZLA 3KNGA 5CABA 1WORA 1U1RA 4QIFA 2VH7A 3MPDA 2DNMA 5KAKA 2V94A 4Y3CA 1U09A 4Y00A 3JSRA 4OLPA 5C25B 4L72B 1JKHB 3CO9A 2PI4A 1KLMB 1RZMA 4NX9A 2LDYA 1RT4B 5L9XA 1G4CA 2J0XA 3PR5B 1JJ4A 3MECB 3FSYA 1K1SA 4QWEA 3CE8A 1JNRB 3I96A 4MT1A 2XMMA 2DTJA 1RISA 3T5JA 3K8VA 4ILRA 2YKNB 4I2QB 4B9VA 2BRLA 3LH2S 1U6BA 2G0JA 1RA7A 2MKKA 2GW8A 5E3AA 9RUBA 4DCJB 3PW2A 2D3ZA 1LOUA 4B3SJ 1EKSA 5D3GA 1T05A 1U2RA 4L74A 1X9MA 4B3SF 1FKPB 4KT0C 4EO8A 3GYXB 1N54B 3SFUA 3H5UA 4KO0A 2DR6A 3Q89A 3J7YU 2HS3A 3OLAA 3KHHA 2M0GB 2DIUA 1FRLA 2Q66A 3DCAA 2CDQA 3DU6A 2HFNA 1Y0HA 1OJ4A 2GA7A 1TVRB 1N52B 5I3QA 4CTAA 1W7WA 5L39A 3ETOA 3QAUA 3KJNB 1BC6A 2ZOFA 3HZEA 3GIRA 2EFGA 1AB8A 3VVTA 2ZHAA 2LEPA 2IYGA 2KT3A 3LA0A 1T02A 3DGPB 4C6AA 4PXCA 3DC2A 3DDIA 3T1HJ 1S9GB 1VC5A 2Y3YA 3FDSA 5K20B 2LQ8A 1AZSA 2J9EA 2A6OA 2P9EA 2FD2A 2M5YA 3T1HF 3VQSA 2FJBB 1Y5IB 4ZVEA 2K2PA 2F40A 1U25A 4FS1A 3SFGA 2ZNZA 4Q0BB 2G2ZA 2FLNA 1HW8A 2XMKA 3CEDA 4OZJA 4I2PB 2KN4A 1QUPA 1KSPA 3OTBA 1F3VA 1BY9A 4OZ3A 1PYSB 4USJC 2FB0A 3J81Y 1IBKJ 4HYKA 1TL5A 3SQGA 4MFBB 4DSJA 1SJFA 1OO0B 2JL9A 5L1LA 1IBKF 4ECYA 5KG7A 2JLGA 3ZO7A 4LSNB 2PMHA 2G1HA 1J5OB 2W2NP 1XIQA 3FFIA 3MR7A 1XN9A 1UA0A 2ZH6A 1HI0P 3I6PA 3T1AA 1AA1B 5ETMA 2ZH4A 1RAOA 1O0PA 1TKZB 1N5VA 4ICLA 2HBYB 2XLIA 4A48A 2VV5A 4WJBA 4ZPAA 3CTRA 3R7NB 2XYPB 5KG6A 4HTJA 2K3IA 1KQKA 2DEIA 1SH0A 1SVDA 3CCES 3CJ5A 3I4PA 4XDCA 2QA4G 2B4PA 3PXGa 1H2UX 1RT6A 3C6TA 4C0HA 4M5NA 5KFQA 4IFVA 4F0KA 1SV5B 2Y1RI 4KTQA 2HFSA 5E33A 3RW7A 4NLRA 4EGLA 4KFBB 3MFHA 3AJDA 3JXOA 4ZP7A 3FSXA 2DB1A 2CZ4A 2F8HA 2C42A 1F1BB 5IQ6A 2A2CA 5DM6Q 3CSKA 1SJ4P 2OPSA 2OMLA 5CQGA 4AXIA 3FCHA 3NKYA 5C24A 1FJCA 4ED7A 3QIPA 3R5BA 1XWLA 3G71S 4WYLA 2CJAA 1FVSA 2M70A 2OI2A 2X3GA 1EHWA 1SH3A 5E5NA 4FBUA 1HA1A 4DX6A 4O44A 4OHWA 4IRDA 1CSJA 2VA2A 1NAQA 3QFHA 1M5HA 2HNDA 4QZVB 3Q23A 2VD3A 1VQLS 2IM2A 1P6TA 2YKMA 3NS5A 2NREA 2DXEA 3AFGA 2AQ4A 3RB4A 5KG3A 3B4MA 1WWHA 2D3OR 1Q81T 2E9ZA 3NMRA 2W01A 3PRDA 2DCLA 1B99A 3OQ2A 4DSFA 1TUVA 5IWAJ 2OP5A 4AL5A 3MR2A 3VVUA 3MM7A 5IWAF 4J9LA 4JV1A 4X4NA 4M1KA 3JSYA 3J80U 4LREA 1EQ0A 5LL6d 3H5YA 2B8PA 3RRHA 4J9RA 1U1OA 5HROA 3LGMA 1XTZA 4TVAB 2GAHC 4USTA 2HHSA 3BBCA 1B0PA 1UETA 5F3TA 2QRRA 1WHVA 1XMQJ 3RBXA 3MUVP 2RS2A 3M1VB 1XMQF 5KG1A 3BGFA 1QE1A 3NP5A 5BR8J 2YVSA 2ROPA 5JJBA 4DUYJ 2J6TA 2R2RA 1S1TB 5HLFA 5BR8F 1F5CA 3D1OA 4BLGA 1TUGB 4DUYF 4ZPTR 4C3LA 4NLDA 1U7LA 4ZHRA 3HDSA 1O51A 4C98A 2OPRB 3HVWA 3W7BA 4JV5J 2C3UA 4DPTA 1ZAVA 2H3EB 4ITSA 3EGWB 4QR0A 2NPIA 4JV5F 2LQ5A 4F04B 2UU9J 1KD1T 4X4OA 2JZ5A 2UU9F 1FE0A 4CYUB 3CIZA 2W25A 2XWYA 4WP3A 1KC8T 4B9NA 1N32J 2H4WB 3BYRA 3PX4A 4GMKA 4NXMJ 3ET6A 4YUDA 2IM0A 1CQMA 1N32F 1CJTB 1X5TA 4AQYJ 4NXMF 1HYSB 3J7Z5 4PG6A 1PIEA 3IM8A 3M2UA 1VQKS 1WI8A 3HI9A 4AQYF 4IG3A 1F5BA 1R6VA 3K5OA 2XNRA 1NK6A 3L7PA 1MNEA 4W92B 3GU0A 3TNVA 3CD7A 3GG1A 5FJ4A 1MN7A 2WTFA 2KJVA 1TKTA 1TMMA 4JYAJ 2FJAB 1IXKA 1B0VA 1S1XA 2VPWB 4JYAF 2MKCA 4JI5J 1TL7B 2R2TA 4PQAA 3KJVA 2HBZB 3VAHA 4JI5F 3W2VA 4LR7A 3RB0A 3MUMP 4YB7A 1MLAA 2XZWA 4DCPB 1WHYA 5DZ7A 3IBCB 2WSFC 4K4VA 1RCXB 3GR0A 4OJGA 2IRYA 1EX8A 1WOOA 1RHUB 1W2IA 2OD6A 2AYGA 3KTQA 3DRSB 1SBRA 3EXCX 4F2SA 3D7SB 2G2OA 1IKVB 2QSFA 3TWZA 5B7WA 3CC7S 4AUKA 3HMJG 4CI0B 5GMEA 3CJRA 4QU7A 3T41A 4FVMA 4F0HA 3VALA 4WFXA 3MEEB 3AOCA 1UZDA 3I0SB 2DY9A 3G82A 1U1LA 2APOA 3KLFB 4IR9A 3PKMA 4MYTA 3EZOA 5AJ3J 3SDEA 3MHYA 3NGKA 4EZ9A 5AJ3F 4ZVSB 1UEKA 2JRSA 1NM2A 3EYZA 5L46A 2MKJA 3C16B 1YVFA 1URRA 1UPPA 4KGKA 2UUAJ 3QT5A 2MHEA 4OZ1A 3V5RA 4YDXA 2UUAF 2V4JA 1T03A 4UOHA 2L3MA 2N4CA 2ZBRA 2PC6A 4IYQA 4CLWA 2LU2A 1IR0A 1G1XA 1VQYA 2MY8A 4FF2A 3HHLC 1B4SA 1M90T 5KT5A 3I82A 1NEEA 2CPJA 4TKTA 4MIAA 3EX7B 2HRYA 1RTHB 4LIRA 1VQ5S 4O3SA 1FFSB 3GONA 1CVJA 1ICEB 5T7LB 3D9BA 2HURA 2WVCA 2HWIA 4IO1A 3VGVA 4WFBQ 1QD1A 1LEOA 2G4BA 1KVIA 1DQAA 1HNIB 3WC2A 5LSOA 3W2WB 1U2FA 2FYXA 4WU3A 4L3KA 4RR5A 1HR0J 2ZVSA 4GC7A 3LAMA 2Z0GA 2POKA 5B0FA 1PC5A 1HR0F 3QFWA 2RH3A 3FZ2A 1B64A 5E3PA 4HDHA 4O0NA 2A10A 4BC7A 3M32B 1Y10A 1NDKA 2W7AA 2X1AA 3FBEA 4F67A 1SC6A 2E7WA 4RNMA 1RA6A 2OAUA 2ILYA 1M5SA 1S76D 4P52A 2G2YA 2HS4A 3IRXB 4NLYA 2Z30B 2XCAA 4X64J 2DD8S 1Q82T 1FE4A 1S99A 3T5KA 2HVDA 4K4ZA 4X64F 3H20A 2RU3A 5DDOC 2Y9HA 3A3PB 5IM0A 1D8YA 3HULA 2ZITA 3N4WA 1GXUA 4WFAQ 4URSA 4EBEA 2XEXA 2QYCA 4DS4A 1RU1A 3IFEA 2VL1A 2N4DA 1F9EB 3FUYA 3FSIA 4I0WA 4U6PA 1VK3A 1S1VA 3EM1A 2L9DA 1NPKA 2PIIA 1BQMB 1C1BA 3F56A 5DZ6A 4KC5A 1RQ0A 2EK6A 5F41A 4IRKA 1LWCB 3ONQA 5F9LA 2BOAA 1T0TV 4DFJA 1FF2A 3SXLA 2EFNA 1F9HA 1HNXJ 3JYTA 1VI7A 4ES2A 3U1MA 2DYAA 1HNXF 2LQ9A 3C15A 2DNOA 1EZZB 2CFXA 4AD6A 2ZH9A 4QIGA 2YPYA 5A0YA 4KRWA 1S1WB 2QL7B 2QV6A 4PABA 1AXQA 2W2PP 4CLTA 3G86A 2MJUA 5L1IA 4A8WA 1ZTTA 1NKCA 1WDDA 1LWFA 7FDRA 2BJ9A 5HO4A 3HJFA 4I56A 5K8OA 3C14A 3GSDA 5CAAA 4LSLA 3MEKA 3CDUA 2IM3A 2VOOA 2MB0B 3KNAA 4OYOA 2VQFJ 3B6BA 1HMVB 4YB1P 2VQFF 2KFNA 3A4TA 3MEDB 3H4BA 2CA9A 3HHDA 1IKWA 3PTWA 1NKBA 4P7TA 4NA3A 1RE1B 1D9AA 3M2RA 3L7OA 4CCHA 3IMQJ 4CNZA 2ZZTA 3W65A 4RNOA 2GQQA 1X4AA 2FVQA 2FZCB 3BH7B 1GEHA 1VQOS 3GTYX 3QZ7A 2RRAA 4QCLA 4CLZA 2KYXA 5G4DA 2H1YA 3MMBB 4XPCA 4ZN3A 4CO5A 1HIYA 2ALZA 2WB4A 3P6YC 1RWVB 1FNMA 4CM0A 2DNLA 1FVQA 1UCNA 2I6WA 3R5AA 3CO0P 2NCKL 3NBPB 2FLPA 4NA1A 3WQPA 2VHGA 2J0SD 4OYIA 2BW7A 2BUNA 2P9CA 2K8GA 1H73A 1GTHA 2KT2A 1YJ9S 3UNGC 1RT7A 1CG2A 1LFWA 3OL8A 2UV8A 3W62A 3PO5A 3HD1A 4DBQA 4RW7B 2OUGA 4FBTA 2D69A 3SEOA 5F9NA 1U1NA 5I3PA 3CGIA 2GNKA 2ZZNA 1P1TA 4D3HA 5DG9A 5HMWA 4DSEA 1JJ2R 4ZP6A 3NOGA 1FEEA 5CYQB 3THTA 9ATCB 3E8OA 5DETA 2GFFA 3ISND 5FLXU 1W26A 4B08A 4PWDA 3FJ2A 5KFNA 3X1LB 2MJNA 4YR3A 3GB0A 3K0JA 2NZCA 2WONA 3PO4A 3KUEA 3MAAB 2HNYA 3MOZA 4AT1B 5IZHA 4ED0A 5J2QB 1JLAA 2JEIA 1TV6A 2NZ4A 1S9EB 1VQSA 5M2PA 4USVA 2OMOA 3F0NA 3P4UB 5ITHA 1QJHA 4WXWA 4HH0A 1Q0NA 8ATCB 3KK2A 2IJFA 4TN2A 3FBFA 1SPBP 4DV2J 4ETZA 3SCLE 2D41A 4KH1B 3I55S 2AP6A 3G6ES 4DV2F 2XMUA 2W1BA 3OR2A 5EX3A 1SC1B 5HBMA 1R8PA 1MMDA 2BQRA 1RCOB 2LCWA 2B4OA 4JP8A 3HFKA 4B9LA 3G8TA 2IA6A 4IR1A 3NY0A 4NYZA 4DPXA 1KVJA 2BDPA 4DQPA 2FHKA 2VG6A 3M8ZA 2D74B 1N0VC 1TUWA 2FTRA 4A8XA 2PD1A 1PC4A 2IBOA 2GO9A 4WF9Q 2K06A 3EDQB 3P5TL 2DHXA 4QQBA 3TO8A 1JXLA 2B43A 4F36A 1JLQB 1RAIB 4I6WA 4J90A 3UN5A 2ZC3A 3R1HA 2KFZA 4CT8A 2B4VA 4U8YA 3VAFA 2WOMB 3G87A 3UCGA 2FLOA 1VMBA 2E5HA 5D0RA 1RLDA 5KFHA 4F4XA 4TYBA 2B5JA 2EC0A 1S97A 1HBMA 4LRFA 2ZKTA 2R7UA 1M0SA 2BM1A 1S72S 3QJPA 3MDFA 4ZN1A 4UOCA 3BBFA 2DHSA 3P45B 4PRFA 3JAMU 3DOKB 3CCSS 5LSLA 1EIYB 2CG4A 1XMOJ 3LP0B 1QAXA 2DNQA 3L95X 4RUBA 1XMOF 3MTKA 4BCAA 4PUOA 2KRRA 3PW7A 1NJYA 4U95A 3KK1B 3DRPB 1DTTA 2L08A 1SQEA 2CIMA 2ZHOA 3HXMA 1IBLJ 3O3LA 4KHRA 3HFZB 4F4YA 1DHMA 1HNVA 5GAHU 2JH3A 1IBLF 2L9WA 2Q3PA 3DU5A 3UE2A 2VODA 3NCPA 4DR3J 1RAGB 1A6LA 3AODA 4BDPA 4UW2A 3OUYA 4ECTA 4G1QB 1U0HB 1JLEA 3UVJA 2AGPA 4DR3F 3HSDA 4F4AA 2R8JA 2HKEA 3W63A 2XG8A 4ZCKA 2CQ1A 5D0EA 3LAKA 3GSIA 3VTIA 4NPOA 2WVBA 3RGIA 1SQFA 3DNCA 4OYAA 4DR6J 3MR6A 2DR8A 5A8RA 4QIWD 1IM4A 3CJ3A 4PPZA 4DR6F 2AYEA 1VLOA 1HBNB 2OSQA 4NWBA 2WVEA 4N5SA 1A0OB 1U1MA 3JSMB 2CQ4A 1IN0A 3CUNA 4WIQA 4U9RA 4UUXA 3DGVA 2LQBA 2IC3B 5THWA 1FI4A 3HVTA 3BO2A 1HL6A 3ENWA 4KV8A 3G6XA 2DRDA 1ZBTA 4LF1A 4QIEA 1N36J 1ZM9A 4ZJLA 2YPZA 2D3UA 1R0AB 4B9MA 2ASJA 1N36F 3BN4A 4L73A 2QA4S 1KQFB 4ZIVA 3TA2A 1D0EA 2Q43A 5KFOA 4DDFA 1DAXA 3T3FA 4EYHB 1RTDB 2E44A 4KHMA 1WHWA 2FGOA 1D8ZA 1EARA 2CAJA 2DR5A 4J37A 1X5PA 4PXEA 2MEWA 1XQIA 1YI2S 3T9ZA 2MQOA 2F1FA 3PKYA 1FHTA 3M30B 3BBBA 2QO3A 1WHXA 2E9TA 1RU2A 5KFLA 3VWSA 4DSKA 1ROFA 5T14A 4K2JA 3DLLQ 3CDAA 3F73A 4USMA 4LRAA 1RXOB 3DLEA 1PJ7A 2QC3A 1BD6A 1LXJA 2VPZB 1Y5LB 5HN0A 5B0CA 2NUHA 3H25A 3DDKA 3EVOA 3C6UB 1IR1A 2KI2A 2QFJA 3BSAA 4IH6A 1FWLA 4DFPA 1RABB 2YNHA 1HWLA 1RTJA 1GX6A 4CWBA 3UDLA 1T9UA 4DPUA 3QRPA 5FDLA 2I8EA 2D1CA 2VKZG 1JLCA 1S59A 3KG4A 2CVIA 2NYIA 2HG4A 2CYYA 2B9XA 3MCNA 4K5SA 4M95A 2MSTA 2YKPA 2XZDB 3ZZYA 4RW6A 2CQ0A 4NI2A 3K59A 1JWWA 4OX8A 3DYAB 2CPEA 3IC1A 2YNGA 2XHCA 4IFYA 3TQ1A 4U7CA 1YSJA 4MIBA 2R8IA 1S77D 2OEMA 3AD9C 1RWMB 3VGTA 4P2MA 4B3OA 3MCOA 2AJ1A 2F8MA 1NLKL 1IM6A 5IT4A 2XULA 1LW2A 2ADCA 1DLOB 3OR1B 4TY8A 1G7CB 2FVCA 2FY1A 2H9ZA 3PG9A 3J80Y 3DRRA 4HHHA 4IQMA 2BE2B 1RHMB 1RWPB 1H38A 1UW4A 1HWUA 1R7IA 5K8PA 4J9PA 3BKTA 4CLFA 5CD4A 2E1AA 3RG6A 1YHQS 2FVSA 2IHR1 2K1RA 3EMTA 2D9PA 3NAIA 3TUIC 4OYWA 4EUVA 2KU7A 4EBDA 1WG1A 1M1HA 5DDQC 3H40A 3R6LB 4J9NA 2DO4A 1Q8IA 2XSJB 2DGTA 2V5HG 4USIA 4FDFA 1T7PA 4F2RA 4ELTA 4ZVOB 1CULB 1ZTWA 1X9WA 1GMUA 1KOHA 1L3KA 2KXHA 3SCIE 1EETA 4HKQA 2Y0SD 2ZBQA 5F0WA 2XYGB 4DF8A 4ZVRB 4PG8A 4XTTA 4FN5A 3BYPA 1QM9A 4OI6A 1HD1A 1WC6A 5K14A 4KYZA 2B9WA 1JLFA 4OIXA 4LMZA 5L38A 2H51B 1LQ9A 4KBIA 4P73A 2EFOA 2RF2A 1RTIB 4ZPWR 4ZVHA 4UOGA 4MK7A 1WOPA 3QLHB 1D1UA 4DWIA 1N5TA 2X7IA 3QO9B 1C0TA 3CMES 1IWAA 1U2CA 2HGMA 4P2FA 3EVWA 1H3DA 2QLXA 1J2VA 2VOPA 3PYDA 2GGPB 1S0VA 4C0BA 5EWFA 3D3BJ 2DNKA 3MM8A 2N3LA 2J76E 3MMAA 2XB2D 3KWMA 3DLGB 2ZZMA 2KO1A 3CMQA 3TVZA 2IJRA 1BWEA 5CYMB 4PYAA 5LOQA 2ZDOA 2IRXA 1XNRJ 5HAOA 4I7FB 4CLKA 4B3RJ 2HHWA 3AJ2A 4ZJOA 3KXDA 2CG8A 5AE1A 1XNRF 3E3XA 4YS2A 4B3RF 2UXDJ 4DQQA 4TQRA 5DGBA 3VAMA 3BEGB 3R3TA 3BGRB 1MMNA 3G9CA 3HVAA 3SSRA 5B0BA 3K89A 3I4HX 4J9UE 4NLVA 1GX5A 3KDNA 1VFJA 3FK4A 3IBWA 3LP1B 1KRPA 2F3JA 4WE1A 5F8HA 4LVOP 3LP2B 1VLYA 5A6PA 1WF0A 3NL0A 3MMCB 2XI2A 2KL8A 2YXLA 1T9VA 3AH6A 4ZVTB 3MEGB 4CH0S 3GIMA 1Z4UA 5C42B 1U1PA 3M6UA 1MU2B 1GH8A 4B9TA 1ZZNA 2VG7B 3KLIB 3MM6A 3RB6A 3RW6A 1Q8KA 2C3MA 2AMCB 3OHBA 2RJZA 1UFKA 2I5JB 1Y3JA 2NYHA 4OZ5A 3NGDA 4P71A 4DLGA 4WFYA 5KFEA 1JQGA 1KONA 4NLUA 1JKHA 1UWBB 1IKYB 1R43A 4NEYA 5ETNA 3W5XA 4K4WA 2YNFB 5D3GB 1YZ7A 2Y0BB 4DPOA 4FS2A 1RT4A 2JHEA 2PN6A 3HPOA 3MECA 3C19A 4H4OB 2RHSB 4K5RA 2AT1B 2YKNA 4UQTA 4IRCA 2XNQA 2CQ2A 1QTMA 2DNRA 3U1LA 4TNOA 2IA0A 2IMWP 1IQTA 2A1BA 2NXJA 2E5JA 1FKPA 2D7SA 2HQCA 1XR7A 2W7PA 3DKDA 4Y0FA 2VFRA 3A12A 3NLCA 2OFGX 4KPCA 5KFDA 1HARA 4CO2A 1D9DA 5HP1B 4X4TA 3SI8A 4DSIA 3ZXWA 3ICLA 3K5LA 4P9SA 4RU9A 1NJIT 2DHHA 5E7OB 1BXNA 2DNZA 1TVRA 1X0FA 2RRBA 3T6BA 3NXZA 3JQKA 4WWSA 1MSWD 3OXLA 2UZAA 2W9AA 3MMJA 4FF3A 2WK4A 1I6JA 2FIUA 4NMXA 1SKRA 2BJ7A 2MGZB 3RRKA 1YDLA 4K8RA 3QT6A 1JLGB 3BSOA 2HAIA
chains in the Genus database with same CATH topology
3BGFA 2DGQA 2DNNA 1UMJA 4JI6F 1HHSA 1QE1A 3VAIA 2B56A 2WSEC 3DGPA 4M94A 1S7HA 3N9UC 3H2VE 3HKWA 3NP5A 3OL7A 3G4SS 1UVLA 2XMTA 2LA6A 1S9GA 2YVSA 2ROPA 1RYSA 3KLHB 2GGPA 4MK9A 5JJBA 2ZBCA 4NXNF 2J6TA 2R2RA 1S1TB 1F0XA 1HQUB 5E3CA 5HLFA 3ZZZA 1LV5A 1QSLA 1VRUB 5BR8F 2XO7A 2CKWA 3KLEB 1HFEL 5KFAA 3MR5A 1F5CA 1ZAXA 2ZC4A 3D1OA 1C4CA 3FMWA 4YR2A 4DUYF 4ZPTR 3PW5A 5EUHA 1Z2ZA 2RNEA 2WCXA 2I0XA 1VBZA 4C3LA 4NLDA 2GQCA 2GC8A 4ID5A 2RQKA 1U7LA 4HLBA 4I68A 4DV4F 1RWUA 4ZHRA 4C8LA 4Q0BA 3HDSA 3N01A 1Q79A 2CQBA 3AQOA 3TRGA 3PW0A 5CYMA 1O51A 5KFCA 4EU0A 4C98A 2OPRB 3UFCX 2HGNA 3HVWA 4P2SA 3J7ZT 1HNWF 2GIRA 2DH7A 4I2PA 3W7BA 3TOQA 3V4MA 2HLTA 4CIOA 3I56S 4I7FA 2OIHA 3H2UB 1S6OA 2C3UA 1GXTA 1CLFA 2BBEA 3K58A 1ZYQA 1ZAVA 2J9DE 4ZCLA 4ITSA 2O66A 3EGWB 4QR0A 2NPIA 4PQUA 4JV5F 4AXJA 2LQ5A 4Y2MA 4MFBA 1KD1T 1LWEB 5GVQA 4BWJA 4J9SA 3BGRA 2MYFA 4X4OA 4Y2AA 3Q24A 4DQSA 1X0PA 2BA9A 1T94A 4PWUA 3FZBA 2CJQA 2JZ5A 5B09A 1PO6A 2UU9F 1FE0A 4LSNA 4TU9A 2KXNB 1J5OA 2CPIA 3IA0A 5LMNF 1U1KA 3CIZA 1RT6B 2W25A 4MMOA 4XPEA 3C6TB 1LK7A 1HNIA 2BVZA 2XWYA 5L8RC 5GMKa 1KC8T 4B9NA 2ZHBA 3O8WA 2HZCA 4A8MP 3PV8A 4Q8EA 3PX4A 2ZJQQ 4GMKA 5SUHA 1QAIA 2VKRA 1OIAA 4YUDA 2RQCA 1MW7A 2IM0A 1Z1ZA 2RU9A 3LOUA 3LWMA 1CQMA 4GO5X 3PY8A 1N32F 1FNOA 3OTEA 1TKZA 4K4UA 3LP1A 1X5TA 3FVYA 4NXMF 1HYSB 3NAHA 1NJZA 4DFMA 3J7Z5 3KHGA 4PG6A 3LP2A 2RDJA 1PILA 4XAKA 2VC1A 4NLQA 3MMCA 3R5DA 3M2UA 2Q6BA 4F3OA 3U7JA 1VQKS 1WI8A 3HI9A 4C3MA 3UR0A 4AQYF 4IG3A 1F5BA 3K5OA 2XNRA 3LF0A 5FIIA 4YP3A 1NK6A 3L7PA 2CQPA 3MEGA 2HHUA 2O3DA 1MNEA 3POTA 3BGLA 2PT0A 3M6VA 4DV5F 1E6YB 3ULHA 2LU1A 4MH8A 4W92B 1IJFB 1Q7LB 5IM0B 5C42A 5G0RB 5CD4H 1HI8A 3TNVA 1LKZA 1P1LA 1MU2A 2OPPA 5HMZA 1U48A 2J0QD 3CD7A 2LXIA 3GG1A 4C8MA 2AYBA 4QR1A 4TY9A 4JUZA 5FJ4A 1XNQF 4K4YA 3KLVA 2WTFA 4WZMA 2KJVA 1NH8A 2AX1A 1HNZF 2VG7A 1TKTA 2RRNA 4LJMA 2X1BA 3KLIA 2DNGA 4ECUA 3EGZA 2JDJA 2FJAB 1IXKA 2AU0A 2I5JA 2ZFHA 2HQ3A 2VONA 1B0VA 4PCQA 4ZVGA 3THPA 3DMJB 4W90B 1S1XA 1SV5A 3V6DA 2VPWB 3Q8SB 4JYAF 2VZ9A 3OLBA 1IQZA 2MKCA 4PXBA 4EYIB 4DL4A 5HI7A 5I42A 4Y2IA 4ED5A 2R2TA 4PQAA 3ENVA 2F8EX 5AXKA 2PEHA 3K5PA 4YB5A 3KJVA 4Q2MA 2ILZA 3D0IE 3VAHA 4X4UA 5F8NA 4ALZA 1WTBA 4JI5F 3W2VA 3N6MA 1FK9B 3CD0A 1U26A 5KTQA 4O3PA 1UWBA 4XIUA 1C1BB 2V9WA 4IG0A 1IKYA 3RB0A 3MUMP 3GV8B 2J0WA 2LMIA 2MZJA 5CCLA 2V8GA 3K57A 3DM2A 4YB7A 5DQHA 5KFPA 3HZGA 3MM5B 2XS5A 1WEYA 2YNFA 2CRLA 2XZWA 3VAGA 2FVRA 4H4KA 2FHJA 4I67A 2GCFA 4ZK7M 3DOMA 3L09A 1WHYA 2WSFC 3ISNC 3P96A 4K4VA 4HI2A 1YRTA 2O5DA 2DO0A 3HO1A 1KN6A 5BYSA 1Y00A 4DR4F 5GAHI 3O6QA 5CCMA 1NJXA 3GR0A 3M6XA 4OJGA 3JYTB 2W4PA 2IRYA 1ZH5A 5IFMA 1TQLA 4H4OA 4KHPF 1FDDA 3CCWA 3M2VA 2V9KA 1FJGF 2AF6A 1R27B 4PXDA 2MXYA 4C2MA 1W2IA 4QYZJ 2OD6A 2ZUGA 4ELUA 2I2YA 2AYGA 3KTQA 1CPZA 3TA0A 1FRMA 3DRSB 1SBRA 3EXCX 4F2SA 4Y2CA 1H98A 4A4JA 5DM7Q 3CJ2A 4BC9A 1IKVB 2QSFA 5B7WA 3CC7S 4AUKA 3HMJG 3OVSA 3DLKB 5EN1A 3RRGA 3TANA 4CI0B 3DDNA 5A8WB 5FD1A 1Q4RA 4QU7A 4RW4A 4USHA 2DGVA 4FVMA 5J2PB 2CPZA 3DI6B 4KQZA 3VALA 4WFXA 1RKJA 3MEEB 3I0SB 5GADU 2DGOA 1U1LA 2APOA 3GILA 1AROP 2MKSA 4ZS6A 4RNFA 4CO1A 3KLFB 3K5MA 4IR9A 4F4KA 3PKMA 2LEAA 1LWFB 3D5MA 3OPKA 4MYTA 1JX4A 1ZPWX 1FTCA 1XK8A 3SDEA 2HYIB 5HMXA 4PKDB 1JB0C 2M88A 3MHYA 3NGKA 1TK8A 2JSXA 1FDNA 4A8OA 2LYVA 4EZ9A 4K50A 4J5OA 1JXEA 3IG1B 3PM9A 5GAGI 5AJ3F 1O8BA 2JRSA 4RW9A 4F3MA 2QE5A 4Y2KA 5HP1A 4ZPCA 2F7VA 3EYZA 1TFYA 1S6PA 2MKJA 2ZH7A 1EP4A 1WEZA 2ZKUA 1YVFA 2J7KA 2AV5A 7FD1A 4LSLB 3OSNA 1HQEB 1URRA 4KGKA 2V0NA 1YTYA 1UKUA 4R5PA 3LW5C 4F4WA 2MHEA 5KFBA 4OZ1A 5A2QY 2ZH5A 1N8RT 3V5RA 2OPQB 3O2IA 4YDXA 5T41A 5KG2A 1C2PA 4FNIA 2UUAF 1WNEA 2V4JA 2QSWA 1T03A 1SH2A 2L3MA 2N4CA 2YNIA 3HHLD 4FXWA 2DPIA 5J1EA 2PC6A 2DRAA 2FDNA 3CCRS 4B3MF 2XHWA 1BGXT 1WACA 4Q2LA 1U24A 4IYQA 2LU2A 1IR0A 2JOQA 1G1XA 5E3QA 1DZ5A 3LQVA 3BB5A 2GO8A 2B7BB 1VQYA 3FRZA 2EBEA 5GAEI 1HWJA 4RX6A 1IKWB 2MY8A 4FF2A 2MGZA 3ZZOA 3HHLC 1H7WA 1WD6A 4OI2A 3GIJA 2KTQA 3M2RB 1M90T 2HMIA 5KT5A 4JI2F 4IKAA 1NNDA 2DJWA 1PGZA 3BDEA 3OTOF 3TAQA 2FC8A 4LFAF 3W3SA 2XMJA 1JLGA 3I82A 2BJEA 5DDRC 1NEEA 1Y4ZB 2CPJA 4TKTA 3M1VA 3UQSA 4MIAA 3CCTA 1VOMA 3FMBA 3RYLA 3EX7B 2HRYA 1RTHB 1MWYA 1UVNA 2J8AA 2NQPA 1UA1A 5MLCV 2PDAA 1YWXA 4LIRA 1VQ5S 1RJJA 3IAS9 2J6SA 2CQDA 4O3SA 4DL0C 1CVJA 3GFZA 1C0UB 3CDBA 1FT8A 5T7LB 3KLHA 2RSQA 5FLXY 1DARA 1HWIA 1RAJA 3CC2S 3UI3A 2HWIA 4IO1A 1S1TA 1HQUA 4WFBQ 1VRUA 4FNHA 3KLEA 3TARA 5KOXA 2QEXS 2WB1D 4RNNA 1N5SA 3KMSA 2G4BA 1HMVA 3R27A 2K7JA 5KT3A 1KVIA 4NLGA 1TL4A 1DQAA 1HNIB 1SB6A 2LA4A 3WC2A 5LSOA 3W2WB 1U2FA 4R0EA 3KKFA 4O4GB 4WU3A 5DO2A 1V3ZA 5KFJA 1U47A 5A8KB 3MOJB 3JSBA 2ZVSA 4RW8B 4GC7A 4ECRA 3LAMA 2Z0GA 5KFGA 4HDGA 2POKA 5B0FA 4RU2A