1OIAA

U1a rnp domain 1-95
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
90
structure length
90
Chain Sequence
VPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the RNA-Binding Domain of the U1 Small Nuclear Ribonucleoprotein A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ribonucleoprotein
molecule keywords U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
total genus 21
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1oiaA00
3MOJB 3R27A 4C4WA 1KOOA 3NS5A 2KT5A 3S8SA 2RU3A 1U6BA 2CQ0A 3B4MA 1U1QA 1UP1A 3U1MA 2AYBA 1HA1A 2CQCA 2RRBA 1VBZA 3S01A 1VBXA 1L3KA 2RUGA 3MXHP 2GO9A 4J5OA 3VAMA 2DGXA 3THTA 2CQGA 2OSRA 2KM8B 2KG1A 2CPFA 2DHGA 1OWXA 1SJFA 1WEXA 4TU9A 5LJ5Y 3HHNB 2DNPA 4Y0FA 2E5JA 4QU7A 2QFJA 2DNMA 1KD1T 1YJNS 3BO4A 2DNNA 4PKDB 2L41A 2CQ1A 2DNOA 2KXHA 3DXBA 3VAFA 2YTCA 3J7ZT 2OSQA 5GVQA 3VF0B 2CPYA 2DNKA 5GAGU 2CQ4A 3NNCA 4M5DB 2DB1A 2M4MA 4WCEQ 1OPIA 3OW2R 5HO4A 1M5OC 2YH1A 2F3JA 1YHQS 5D78A 5CYJA 2M52A 3CCES 2X1GA 2D9OA 2J76E 2MPUA 1A9NB 1K8AT 2KI2A 1WHVA 1PGZA 5MLCV 3TP2A 4ZKAA 1M5VC 3UCZP 2MZQA 1FJCA 3P49B 4Y00A 1NO8A 1WHXA 3UWTA 5HL7Q 3Q2TC 2BZ2A 4YB1P 3R1HA 5GAHU 2N7CA 3P3DA 1X5OA 2DH7A 4V19X 1P1TA 1UFWA 1X5TA 4QQBA 2ADBA 2RS2A 3PIPQ 1FO1A 2MZSA 2JX2A 2MQQA 3V4MA 4ED5A 1VQ7S 1N52B 2K8GA 3G9CA 1N88A 3THPA 2FY1A 2YKAA 2D3OR 2CPZA 2LYVA 3P5TL 1X4FA 2VOPA 3UE2A 2DGSA 1YI2S 3RW6A 3NS6A 2MGZA 1VQKS 5LXRA 2XB2D 4TLQA 1WI8A 2D9PA 2M88A 1U2FA 2BOPA 2XS2A 3FEXB 5DM7Q 5IM0B 2LA4A 4OZ0A 2MKHA 3TYTA 1VQOS 2Q79A 1G2EA 2RRAA 2DNHA 1KOHA 1WG4A 4WKRA 4UY8T 1JMTA 2X1FA 3FEYB 1B7FA 1NJIT 5EN1A 2RNEA 2B0GA 3CCRS 2CPHA 3G8SA 3ZZYA 1O0PA 2G1DA 5LSOA 2NZ4A 5LSLA 3JB9k 1WELA 2HZCA 2YH0A 4TU8A 1VC6A 3LQVA 2M8HA 4PR6A 2CQIA 3MUVP 1DZ5A 3BS9A 4UQTA 1QVGR 3U1LA 4QU6A 3CTRA 1Q86T 1WF2A 2HGMA 2KG0A 3G8TA 1VC0A 1QM9A 3SDEB 1X4BA 2E44A 1YTYA 3SDEA 5ITHA 2OTJS 3US5A 2M0GB 4WFBQ 2CQBA 2WBRA 5CXTA 3CCVS 1WTBA 4PRFA 1WF1A 2MY8A 1RKJA 3N9UC 3RW7A 4F02A 2XS7A 1H2UX 1FXLA 4U67Q 3L3CA 5H1SV 2MQNA 2M70A 2O3DA 2YWKA 3CCLS 4C7QA 2LEBA 1CVJA 2HVZA 3CCMS 2MYFA 2DGOA 2DGTA 2VODA 3ZZZA 1H2TZ 3CF5Q 3P6YC 2LKZA 2MY7A 1WHWA 3G71S 2DNYA 1VQ9S 1K9MT 3CCUS 2M9KA 2KH9A 3MUTP 2RS8A 5LXYA 2I38A 3CPWR 4LJMA 1DRZA 2LCWA 2OTLS 1WI6A 4LMZA 1Q81T 1FNXH 2F9JA 1DHMA 1R8HA 3PIOQ 4YOEA 2LMIA 1QVFR 2F9DA 2KYXA 1UAWA 2JRSA 3ULHA 1BY9A 3D2WA 2MZJA 3NNAA 1P27B 1S72S 2DGWA 2E5IA 2CPDA 2VONA 1WHYA 3EX7B 1WWHA 1HD1A 2LQ5A 3G6ES 3S6EA 3CCQS 1U1RA 2MQMA 3VAHA 5GAEU 1W2BR 1HL6A 2AYEA 2MXYA 3K0JA 2M7SA 4FXWA 3BO3A 2MSSA 1SXLA 2MJUA 3G4SS 1JJHA 3UD4P 3SXLA 1NU4A 1X0FA 2DGQA 2DH8A 5DDPC 1U1MA 5JVGQ 1FJEB 2MJNA 3VAGA 3I56S 2DNGA 3IWNC 2CPIA 2FHOB 3H2UB 2KXNB 4RU2A 2DIUA 4WFNQ 2LEAA 3CC2S 3NNHA 4OZ1A 2DH9A 1DBDA 2E5GA 2NLWA 2DNQA 4F26A 1VQ6S 5DETA 1D9AA 2XNRA 1U1LA 1WEYA 2G4BA 5D77A 2JWNA 2CPXA 1YWXA 3H2VE 4LIRA 1PO6A 2MKIA 2CQHA 2LXUA 2M2BA 2A3JA 2AYGA 2JVRA 3CC4S 1YJWS 1ZZNA 2KN4A 4IOCQ 1M90T 3J7YU 2DHAA 2EK6A 1VQLS 4ERDA 3G96A 3CCSS 1FHTA 4CQ1A 2CPEA 3I55S 5CA5A 1U1NA 2MQPA 1WG1A 1VQ4S 3DLLQ 2DGVA 3CXCR 1VQMS 1WG5A 1A7GE 2KM8C 1WEZA 3TO8A 1X4DA 2DIVA 2VOOA 3BO2A 1ZZFA 2MZTA 4A8XA 2MQLA 1X4CA 1R8PA 2LXIA 2RVJA 3EGZA 1VBYA 2M8DB 2RQCA 3HI9A 1X5SA 2SXLA 2MSTA 3CD6S 1FJ7A 2J0SD 1X5PA 3CUNA 2MKJA 2MMYA 5IQQA 2CPJA 1WF0A 2X1BA 1VQPS 2CJKA 4CH1A 2J8AA 2FC9A 1Q7YT 2EK1A 2XSFA 3IRWP 2LA6A 3CCJS 2EVZA 2RQ4A 3MD3A 3VAIA 1M5PC 2UP1A 2DHXA 2GHPA 3EGNA 2KFYA 3UD3P 2DO0A 1X4EA 4P6QA 2CQPA 2MB0B 3CULA 4WIIA 1H6KX 2KXFA 2MKCA 1KC8T 3Q2SC 4EGLA 5GMKa 1SJRA 3CC7S 4IOAQ 2PE8A 2DHSA 2U1AA 2AYMA 4F25A 1JJ4A 2QEXS 2MZRA 1X4HA 4C0OC 1N8RT 1YITS 2KRBA 3B4DA 2AD9A 1SJQA 2E5HA 1IQTA 2HYIB 5BJRA 2K3KA 2ADCA 1U6FA 2KRRA 1HD0A 2JVOA 5LJ3Y 2KHCA 1YJ9S 1VQ8S 2I2YA 2MZ1A 1U1PA 4YUDA 2RT3A 1ZH5A 1SJ4P 1M1KT 3BEGB 3CMES 3S7RA 4FXVA 2FPHX 3UCGA 2OJ3A 2XS5A 3NMRA 3MURP 1XN9A 2HGLA 5DM6Q 4WFAQ 5DDQC 2QA4S 3MDFA 1S79A 1M5KC 4IO9Q 5DDRC 1AUDA 2DISA 4QPTA 1OO0B 2N82B 2ZJPQ 1H2VZ 5JVHQ 1SJ3P 3MD1A 1K73T 4W92B 3CMAS 3UCUP 2CQ3A 4TU7A 5IM0A 1RK8A 2KU7A 4Z2XA 2L08A 2DO4A 3LPYA 1D8ZA 2OIHA 2L9WA 4CH0S 1VC5A 2DNZA 1F9FA 1VQNS 2FC8A 2XNQA 1U1OA 1Q82T 4IUFA 3SMZA 5GADU 3R1LA 4WF9Q 1KQSR 2G0CA 1N54B 2DNLA 2J0QD 2MQOA 2ERRA 2ZJQQ 1YIJS 3VAJA 1VQ5S 2DNRA 2HGNA 2MKKA 2N3OA 4CIOA 1X4AA 2DITA 2DK2A 2KVIA 2MGZB 1FT8A 2N3LA 5DDOC 2DGUA 3MUMP 3MI7X 1U1KA 1URNA 2PEHA 3VALA 2CQDA 2CQ2A 4BS2A 2LECA 2MHNA 1OIAA 1X4GA 2ZJRQ 2U2FA 2X1AA 3VAKA 5FJ4A 5IFMA 1UW4A 2V94A 1JJ2R 4W90B 2MKSA
chains in the Genus database with same CATH superfamily
2B7BB 2C3PA 2OPPA 5E3AA 2UXBJ 4V1Ak 4LVOP 5CAAA 1KOOA 3CT9A 2KT5A 2RMLA 3NCRA 3GR1A 2CQ0A 1U1QA 4KFBA 1U02A 5J1NA 2LU2A 2E1AA 3HXMA 3ILLA 5EDWA 2XMTA 3I87A 3M8ZA 3MFHA 3DM2A 2VFRA 3S01A 4I7FB 5KT4A 2RUGA 4M5GA 5DZ7A 4LREA 2CQGA 5AXNA 3RB4A 3C6TB 3MM7A 1YG0A 4C8ZA 2KVQE 2EFVA 2KG1A 1IKXB 3NAHA 2A0FB 2NS1B 3KJFB 2DHGA 4ZPTR 3EICA 3IG1A 4CLLA 1J2VA 1WEXA 2QA1A 1SJFA 1IKXA 5KFIA 1UKUA 3QNWB 4OFZA 5LJ5Y 2HHHJ 3HHNB 4HH0A 1JJCB 3HFKA 3KG4A 3K5OA 2DNPA 1F5BA 2R42A 3EZUA 1TAQA 4LSLA 5D8HB 2QFJA 4KB7A 4CO2A 2DNNA 4TY9A 3ILJA 4QWBA 4UZBA 3FEZA 3DXBA 2B4PA 2IRYA 4JYAF 5FDLA 4PWDB 1EQ0A 4ZLLA 2UV8G 4YN3B 2ZZMA 1UMJA 3OFHA 5GVQA 3V2UC 3T3FA 4ZCIA 5FD1A 2DNKA 4UUWA 5GAGU 2HPUA 2K1RB 3BV8A 3IRXB 3I82A 3NCPA 4M5DB 3VGSA 3GQCA 3V4IA 5HANA 4ECZA 4JI1F 1OPIA 4OYAA 4RW7B 5LL6d 4RUBA 5HO4A 4EYIB 2C2ZB 5HLFA 1M5OC 2E7XA 1Y3KA 4BC9A 2YH1A 1YHQS 2QFIA 2NQPA 3CEDA 5IT0A 2KTQA 4ICLB 5CYJA 4J37A 4DV1J 1L5UA 1JLEA 2RHSB 3J7Z5 3WBZA 3TW0A 2J76E 5GMEA 5HVGA 1H3DA 4UF4A 1RTDA 5E3PA 4FP9A 2V34A 1VRUA 4DR1F 3TA1A 2MPUA 4A46A 2F5GA 2PT0A 1U4BA 3UO0A 4DHVA 2Y1LB 2BDPA 2BABA 1FVQA 3TP2A 5F8HA 1Q8KA 3A12A 5BXIA 1H0HB 2WVEA 1RHKB 2MZQA 3W5XA 2OPPB 1KP6A 1KS2A 4Y00A 4A8QA 1S12A 1WC5A 1YRUA 1ZPWX 3FRYA 3P49B 3QWPA 3Q2TC 2BZ2A 3AD9C 1N0UA 1R31A 3JQJA 1KHWA 1S0MA 1U2RA 1X5OA 1FFSB 5IV3A 4O3SA 4PWDA 2R7UA 1IBLJ 2B6AA 4P72A 4QZVB 4BC7A 5L1KA 1X5TA 4FYYB 3SCLE 2O66A 2NR0A 1HBNA 3ENAA 1RWUA 2V4QA 3C46A 3QJPA 4LBPA 3PIPQ 4DR5F 4P2FA 2JX2A 3GONA 1O8BA 5AT1B 2PSZA 3O5TB 3IXQA 4WU3A 3HSGA 4YMEA 3H25A 1DTTB 1N52B 2ROEA 2UVWA 1WOPA 2QSWA 2Z2YB 3BR8A 3G9CA 4JOUA 3MR7A 3QBCA 2DXEA 2XMUA 5LM7E 1LNQA 2AU0A 3THPA 1IM6A 5C42A 3NOGA 4O3OA 1L3VA 4DUYF 2D3OR 4MYTA 2ASLA 2R7SA 4CI0B 1MMNA 1X4FA 1J5OB 1RI7A 2XHWA 2B51A 1K0TA 3TAPA 3RW6A 2VV5A 1QSSA 5E0OA 2OPSB 4EEYA 4NLXA 3D9BA 1YJUA 3OJUA 3JQKA 4GKJF 4CLZA 5KG4A 3UVJA 1H74A 4KSEB 1ZM2A 3DDNA 3MAAA 1D1UA 5KOWA 4P10A 4ZIWA 2YWHA 3GIKA 3M30A 5ETMA 2A10A 4KFBB 2VPZB 5L8RC 4ES2A 3PW7A 1EIYB 2XS2A 1TAUA 2YNFB 2VQFJ 2MKHA 4KHPJ 2DNHA 1Y5IB 3GIJA 2BQRA 1T03A 4UY8T 5EX3A 4E8UA 2X1FA 3NGRA 4JV1A 1VJQA 2WVFA 3DYAB 3KLHB 4AL6A 4ENOA 4P74A 2OFGX 4X4NA 4EFAC 5EN1A 1SKUB 3HSZA 2RNEA 4QYZK 2K3IA 4TLRA 4DX7A 3AQPA 3M2UB 4EBEA 2WONB 3DOKB 2VBXA 1FX2A 4CYUA 1JLBB 2G1DA 5T7LA 4B08A 1EP4B 5LSOA 4DPTA 2GJFA 2FTRA 2COLA 2Z4PA 1EP4A 3P5BP 3DLJA 3H5UA 3JB9k 5G4DA 1NKBA 4WXOA 2CDQA 2YH0A 1ZA2B 3GWCA 5KFXA 2N4DA 3BSNA 1NJXA 1DARA 1N0VC 1R8AA 2CQIA 3A4TA 3BS9A 2PMWA 3FCVA 3OHBA 2R7RA 2E9ZA 1URRA 3CTRA 4M1KA 1TR0A 4ZITA 3LP2A 5IV4A 4K7QA 3G8TA 1T8EA 1QM9A 3SDEB 1X4BA 2HMIB 2LVWA 1VR6A 1S6QB 2UVVA 3FUYA 4ZCLA 3I9ZA 4BHQA 3SDEA 4FF1A 1VYAA 1SC4B 2H9ZA 3P8BB 4KQZA 3SSSA 2HAIA 1XMOF 1AUSL 1RCXB 4PYAA 4CO5A 2P6SA 3B54A 4WFBQ 1N32F 1Q4RA 4ZVOB 4ES1A 5ETTA 1C2PA 4F36A 1D8YA 3N9UC 1DTTA 5A6WA 1EB0A 4ED6A 2J9DA 2AKWB 1HBMA 2CNNB 4X62F 3QRQA 5B0AA 3L3CA 3UDCA 1YJ7A 2LEPA 2MQNA 3MOZA 4JBCA 2BANA 3I6PA 5H1SV 3KJVA 4JI7F 4FXDA 1UFLA 2O3DA 2P2CB 3RBDA 1JLGA 3G2XA 4U6PA 4IG0B 4U96A 1IBCB 3PW2A 3ICLA 2RF2A 3I0RA 3LH2S 2VODA 4IDKA 4U7CA 1REVA 2V8DA 1S57A 4HTJA 5ETLA 2VL1A 1RT3A 3SQGB 4A8FA 1SQFA 4X62J 2R7OA 2QG9B 1WHWA 2BE2B 1LK7A 2H65B 4QR1A 2DPJA 3QAEA 1CS4B 4K8RA 4P73A 4C11B 3W9IA 1HBOA 2GQCA 4QW8A 5IC4B 3M30B 1W7WA 2V4JB 1LXNA 4J7CA 4AD6A 3D6MB 2FUG9 3FKBA 5CXTA 5J2MA 3GYNA 4WE1B 1F5AA 2B6AB 2OTLS 2UZAA 1EX8A 3AD7C 3TX0A 3PO4A 2CIMA 5A76A 2BOAA 1ZA1B 2OELA 2ZBIA 3BF4A 4Z7CA 2IRUA 4YOEA 4JI1J 1TKZB 2IJNA 3QGPA 3R6GB 3AB4B 5E7OB 2HURA 2HG4A 1PJ5A 3MPDA 1RT6B 2KYXA 3MMBB 1TKZA 2OH2A 1F0XA 2J9CA 2JRSA 1SC1B 3ULHA 4EWTA 1BY9A 5CABA 1UZHA 2YQ1A 2ZNZA 5KFJA 2MZJA 5KT3A 2OEMA 2I8EA 4RR5A 4U8VA 1V5VA 3AA8A 4F0KA 3W5ZA 3PYEA 1RU2A 5IQ6A 3MECB 2HHTA 4C8NA 2QA2A 2R7XA 3OVBA 4M5JA 3D3CJ 2LQ5A 4E0DA 4EO8A 3QIPA 1REGX 4KY3A 3DOLA 1J5EJ 3DCAA 3DU6A 5F9LA 3VAHA 1S9FA 3CO0P 5GAEU 2MXYA 1D9FA 5L39A 2M7SA 3GJTB 2HHPA 2QYGA 1SXLA 2JLFA 3G4SS 4EU0A 4ZLNA 2BQ3A 1QLNA 2LDIA 4ZP6A 2CJYB 3C16A 4OYZA 5DJBA 4MFBA 3DLEA 4OHXA 4DG1B 4IH5A 3IN5A 1FWPA 3DRRA 1LWEA 3FQKA 4WZQA 5KAKA 4K0KJ 1A0OB 3GFHA 2HHVA 5HVHA 1RUSA 2ZH2A 1T9UA 3VAGA 1RT2B 1FRHA 2K7KA 3J81j 2XLIA 4H4MB 4DR3J 2ZBQA 4ED2A 2EBGA 1X9MA 1RWKB 3D4JA 3IWNC 1LWFB 2XWXA 2GIFA 2KXNB 4NLSA 4PWUA 4Q0BB 2LEAA 2HKEA 4I7FA 2V8GA 4OI2A 4OZ1A 4ZVSB 1DBDA 1RHUB 2YNHA 4N7TA 2UUAJ 2E5GA 1VRTA 4LBIA 1F3FA 1KN6A 1JLCA 2DNQA 3ZZPA 2UXBF 1JK9B 5ETQA 2AJ1A 5DETA 4UTGA 4X66F 1VQ6S 4WPAA 3SSRA 3PRDA 3LTOA 3IG1B 3KNGA 5D77A 4XPEA 2CPXA 1Q95G 1M5SA 1RAGB 4B9SA 4JI4F 4RWXA 4J91A 4WYLA 1VDHA 3B8HA 4XIUA 4DR4J 2IYGA 4C8MA 2J9EA 3PDNA 1YJWS 4RNHA 4IFVB 4IOCQ 4ETZA 4XDDA 3Q8SB 2IY5B 1Q5YA 1KNZA 2EK6A 2OPQA 2XLKA 1HNIA 2AV5A 4P2SA 3PM9A 4G1IA 2EI5A 4CLYA 3MEGB 2L9NA 1LFPA 4ERDA 4KO0B 2ZZNA 5J2PB 3IM9A 3H2LA 1LW0B 2PO4A 2J0XA 2YQ0A 2W7OA 5CA5A 2ZH3A 2JSXA 2OP5A 2ZH4A 4OX8A 1U1NA 3ZTOA 2QTWA 2MQPA 2B9WA 2JLGA 1BQNA 3BB5A 1FD2A 3LGHA 3QMQA 3C6UA 1CC8A 2HZAA 5J1PA 1IBKF 4ID5A 1VQMS 2HVDA 3DLLQ 1DAXA 1HQUB 2M3DA 2RF2B 2DBBA 2W2QP 1XNRF 4DUYJ 3N5BA 1YSJA 1UVMA 2QX0A 3HD1A 3DDKA 5KFCA 1IJEB 1TL7B 2MQ8A 3RBZA 2XO7A 1X4CA 4RNOA 1JXLA 2P5VA 5E3CA 4RW6A 3ZO7A 4I56A 3TUJC 2Y1JA 1VRUB 4OX6A 3E01B 1RAIB 1N5YB 2E9TA 1R0CB 4LF6F 2XLJA 4D3HA 1Q16B 1C0TB 5KFKA 2A1BA 2VF3A 4NI2B 2MKJA 1RA6A 1P1LA 2G9OA 2YKQA 5B0GA 1LWEB 3LA0A 2WSCC 4ZOSA 1K1SA 1WC1A 2J5AA 5C2GA 3EPGA 3CDEA 1VQPS 4J9KA 3OL8A 2VICA 4K4SA 1Y00A 1FE0A 4YR3A 2LQJA 3WX8A 1RA7A 2R4FA 2WVDA 4QIWD 5AE1A 2HQ3A 2FC9A 2FYXA 3N01A 2HNYA 4WTOB 2EK1A 4WJBA 3IRWP 5IOLA 1XMQJ 3PJXA 2EC2A 1X8DA 3UFCX 1R8CA 5KFWA 1NKCA 2JJ4D 5DLGA 2OPRB 2BEFA 1HBNB 1RHMB 4IH7A 1H7WA 5E5NA 1FKOB 3IO1A 3UDEA 3EGNA 2Z2LA 3ZNJ1 3TAQA 1T11A 2R2UA 1CJKA 4OHVA 2IM1A 3W9HA 4WFZA 4D3GA 2GVDA 5F3TA 5FLXU 4KV8B 3MR2A 2AMCB 1UVKA 2MB0B 3ETMA 2MKCA 2IHR1 4G65A 1S6PA 5GAEI 1TTHB 3Q2SC 5KFPA 4WFYA 4EGLA 1QTMA 2P9CA 3OSNA 1SJRA 2BW2A 4G6VB 5SUHA 3ZTRA 1S0VA 1WC0A 2PE8A 4IDKB 4PAAA 1S9GB 1MN7A 2WTFA 4DR5J 2RB7A 1HMVA 3PTWA 4IG0A 3D0GE 1S9EA 2FVQA 4FZVA 1S9GA 4B3TJ 3NG8A 3QLHA 1SI9A 5K14B 4K4ZA 4C0OC 2H51B 4B3RJ 1FJGJ 2DJWA 3RZAA 1IR2A 1RAAB 2AF6A 2J7UA 3SQGA 4O23A 1YITS 1UFKA 3B4DA 2CZVC 2E5HA 1C4AA 4O3PA 3PNIA 2DR9A 1UVIA 3K8VA 2OLWA 3ISNC 3QSYB 3ETOA 3CJSA 4O3NA 3SBMA 4OI1A 3D0HE 1U6FA 2KHDA 1T94A 2WSEC 1HFEL 4NA2A 4IO1A 1VQ8S 3KHGA 1EZZB 4CTAB 3QFWA 5L1LA 1HQUA 3D6HB 1SKSA 2OD6A 1GX5A 4R8UB 2HRTA 1TKTB 1ZH5A 3PRVA 4U7UK 1T7PA 2E1CA 1RLDA 1TUGB 2HNZA 4RWWA 4IR1A 2O5DA 1XNQF 1U2CA 2FPHX 4IOBA 5HATA 5LOQA 2ZBCA 1FVSA 2ZH7A 2DR7A 4CNYA 1NXIA 1JQGA 2Y0BB 1AROP 2YKMA 1R43A 5DM6Q 4WFAQ 5DDQC 2V2VA 3MDFA 4R5PA 2QA4S 1QY7A 1E6YB 4X4VA 3MMCA 1PAUB 4I67A 1N56A 1QD1A 1S1UB 4F67A 4CP5A 2BRKA 4DL4A 3D3BJ 1RTHB 4RW9B 5BYQA 1TK0A 2RILA 4M5MA 3EDQB 1OO0B 2N82B 2FVRA 1BWEA 3VGTA 1DJ0A 1SC3B 4E2FB 1SJ3P 4DR6F 1RAEB 1U7LA 3DLGA 3VQTA 2Z2MA 3KLGA 2FLPA 3HVAA 4QCLA 5IM0A 2ASDA 1RK8A 3KJQB 2GCFA 3WQPA 2KL8A 3FFIA 1X9WA 2R2RA 4K50A 1B99A 2P9GA 1Q8LA 3W65A 1O6XA 2OIHA 4LF7F 4F4YA 3GYGA 3K8WA 1UVJA 3POTB 2FJWA 1S1XA 2UU9F 3QIDA 3U1NA 2G2OA 1E6VA 4O44A 3UQSA 4X4TA 2GVDB 4WF9Q 2F7VA 2OKQA 4O0NA 3KK1B 2FGCA 1KQSR 1LWFA 3NWRA 2YNGB 1T9YA 2FJDB 4L3NA 3H0PA 4J9NA 4JV2A 3BH6B 2ERRA 3IGVA 1TL1B 5DLFA 1HI1A 2KYZA 2APOA 2VG5A 1RT3B 3HHKA 4PQAA 3N5FA 4LF2A 4DZ6A 3MAQA 3V6JA 2P6TA 5AJ3J 4F50A 2DK2A 4B17A 5L1JA 1Q0NA 4PPDA 2DCUB 1PBUA 2I6WA 1UEKA 4B9UA 2PEHA 5D0EA 2UUTA 3BKFA 2CQ2A 2YWFA 4BS2A 5D4PA 4PXEA 3V6HA 1I94J 2UXDJ 1CLFA 3WC0A 1OIAA 4ECVA 3TARA 2HHUA 4ZK7M 1MU2B 2QMUB 2QT7A 2U2FA 3CWJA 3VAKA 2X51A 3WHIA 1GT8A 1NUEA 5A2QY 1K44A 1JJ2R 4Q8FA 4LF5J 4OL8A 2HNZB 1N5VA 4W90B 2R9LA 4Y28C 4O3RA 4JI2F 2Y9HA 3MOJB 4RJVA 4K4UA 1Q8BA 3LOUA 3PHEA 2H48B 3UPFA 2UUAF 3NS5A 1KFSA 2BA9A 1U6BA 3KG1A 1GK8A 1LW2A 1MW7A 3U1MA 2NPIA 5DO2A 4A4JA 4DCPB 2IFXA 2RRBA 2Q3PA 2NXEA 3A8KA 2YKPA 1WC6A 4ER8A 3CIMA 2IAJB 1UJ5A 3DM2B 4LQ3A 4J5OA 4RW9A 3PXGa 2GFFA 2CG8A 2OSRA 2XHCA 3WIUA 5T41A 2VG6A 3R5AA 4NLUA 4ZVQB 2CPFA 2XTJP 1OWXA 1YK9A 3HHLA 3HZGA 4L72B 4YR2A 4F2SA 2QLJB 3BBCA 2GHWA 3M6WA 3N28A 4CYUB 1C1BA 3A8EA 4RPFA 1TVRB 4AUKA 5KG2A 4NCBA 4DSIA 1DLOB 3ENQA 4DV3J 3VZIA 3TANA 1QSLA 4DSJA 1DQAA 1MNEA 1TL5A 3BO4A 4B9TA 2V9WA 4ZHRB 2BUNA 1KLMB 4QWEA 5SZTA 2KO1A 3CCSS 3C19A 3PACA 3VR1A 4O4RA 4UY85 5F8NA 3VAFA 1FDAA 5DGBA 2ZITA 2EG1A 2D3O1 2YTCA 5BYRA 2YNGA 3OXFA 3JSYA 4OV1A 1YQHA 4AL7A 1PGZA 4ETXA 3CMQA 2HIYA 1NCLA 2W4DA 3VF0B 2HQDA 3A8IA 4WFXA 3F41A 4WXWA 4IQMA 2CQ4A 1TL3B 3KTQA 3W2VB 3KLFA 3BYRA 2NREA 1TQLA 1SH0A 4X64J 4BDPA 2M4MA 2GMHA 4WCEQ 3K89A 2DR8A 4DL5A 5B0EA 5IT9Y 1CULB 2A6OA 1YDLA 4DZDA 2MDAA 2XYHB 3HT3A 3A3NB 4K0KF 3ILIA 2ZH9A 1IBMJ 1ACMB 2P8IA 3FC9A 2EPIA 1J27A 2RIJA 2X1GA 1QAIA 4AE5A 4IRDA 3E8OA 4URQU 2XGPA 3OTDA 3KK3B 3KHHA 4PG6A 3PW4A 3N6MA 3NGSA 2KI2A 3E2EA 1KDNA 3GFZA 1PILA 2OUGA 3D28A 3CJ3A 1NDPA 2H3EB 3MEGA 4I64A 5KFLA 1ZETA 4ZVHA 4JI4J 2JC0A 4ATNA 1B70B 3LALA 1MN9A 1AXQA 1NO8A 1WHXA 2G2ZA 5AXMA 5HP1B 2ZE2A 1DURA 1YRTA 3UWTA 4DX5A 5HL7Q 1X7VA 4ZPAA 4YB1P 3R1HA 5GAHU 4HHHA 3RYLA 3GFYA 1CJUB 3HFVA 3NLCA 2GQ2A 3CD7A 3CVKA 4X65J 2OAUA 2DH7A 2W9BA 1QAJA 2ZM6F 1S97A 4ED8A 2Q6CA 4XTTA 1P1TA 3A1YG 3ZXWA 5J1EA 1OQ6A 3FJ2A 2XWYA 2Y8WA 2E7VA 5HQLA 1BMQB 3RB6A 3R9LA 1IKWA 2MZSA 4NXNJ 2BRLA 4DLGA 3PX6A 2MQQA 5JJBA 2IM0A 1FCAA 5JUMA 1VQ7S 3NEKA 3AXMA 3W2WA 1WKLA 4Y3CA 4ZVFA 1S1WB 4K5RA 5HMYA 1N5YA 2R7VA 2WHOA 3IA0A 3W2WB 1RWPB 2FY1A 4ELVA 2YKAA 4O3QA 2LYVA 3T1HF 2C2RA 3PYDA 4N41A 3FBEA 4DV3F 1RACB 2VOPA 1TELA 2CRLA 2DGSA 2GIRA 2QL7B 5CZVA 1J5OA 1KFDA 1NSPA 2OPQB 2WOMB 3L9ZA 3NS6A 4YB5A 3DLGB 2GHVC 3VHQA 4YY3J 3BQ0A 2GS8A 3TR5A 2XB2D 4YEAA 1JX4A 3AA9A 3K57A 2BM1A 2XCPA 4ZCMA 4X84A 1U2FA 2XZTB 1KEKA 1IR1A 3K5NA 2PA3A 3FEXB 2YPYA 3MGJA 5IM0B 5ETVA 1U24A 2LA4A 5IWAF 4OZ0A 5KFZA 2R8IA 1AT1B 4J9LA 4DV5F 1VQOS 4HT7A 1NK0A 2RRAA 2GA7A 1KOHA 1WG4A 4WKRA 3GMGA 4HVZA 4X4OA 4PXCA 2Y8YA 2E7WA 4LR7A 3FEYB 1B7FA 2KT3A 4YHHF 4LF8F 4KV8A 5E3RA 4JI6J 2EWHA 5J2NB 1EETB 1VCTA 3EVOA 5F8GA 2CFXA 1VK8A 2QLXA 2R8KA 4Q0BA 3MCNA 1TL7A 1OYDA 3SEOA 3JQMA 3HVRA 1CSJA 2IDLA 4HT5A 3ZZYA 2HZVA 3G82B 3KUHA 3T5JA 1HMVB 2NZ4A 1KQFB 1ZAXA 1NEEA 4LFBJ 1WELA 3QGHA 1TUVA 1NHKL 4M5HA 1FTRA 2HZCA 3OLAA 1XMBA 3W64A 3J80U 2VG5B 2DCLA 2M8HA 3LQVA 3I4HX 2IMWP 4UQTA 1F2HA 5CCMA 3JSMB 3U1LA 3CO9A 1XIQA 3D6TB 3RG6A 3M8YA 3QT6A 1TZ0A 3DHWC 2LDYA 4LRCA 2V4JA 4USIA 2CKWA 5EUHA 2E44A 2D3UA 3EGVA 4OYPA 4P7VA 1ELOA 4EUVA 5ITHA 1HNIB 4LF5F 3MMJA 2VPYB 3W8GA 5HI7A 2IVMA 3MEDA 5EWFA 3IP0A 2R3VA 3KUEA 3NGTA 3UD5A 1WF1A 2P9EA 4PRFA 2MY8A 1RLCL 2VFTA 4DSFA 3PJWA 4Q8EA 4WTYA 4F8RA 1WKJA 1U0SA 3ILOA 3DRPA 4QJVA 2XS7A 4F02A 5A0YA 5LMUF 4U67Q 1IM4A 2CA9A 3OTEA 5KFAA 4DV7F 3RAQA 1MG7A 3MMBA 2Q1LA 1HI8A 1BGXT 4DFJA 2GQQA 2HSEB 4L73A 4DN9A 3CCLS 2JEJA 1NH8A 1NZAA 4KHPF 4EMDA 4C7QA 2VQFF 3ZZTA 1CVJA 2HS0A 5KFNA 4TKTA 2GO8A 4HI2A 2DGTA 4K4YA 2HRUA 2VJUA 2IYIA 1OJ4A 4DEZA 1VQSA 1I94F 3OFEA 3P6YC 5LMUJ 3T19A 1GEHA 3PO5A 4IYQA 3JTPA 3DI6A 4ZS6A 4TU9A 3G71S 1ZBTA 1GH8A 1C1BB 1HKAA 2XY6A 2Z57B 2JNJA 4RUHA 1K9MT 3MEKA 2DRBA 2BJ3A 2M9KA 2QLFB 3HHLB 3SFUA 3KLEA 3NXZA 3UN5A 2I38A 4X4QA 4FKXA 1AZSA 4QIVA 3LW5C 2XBPA 4ZHRA 1C1CA 5HMZA 3RAXA 2K06A 3FGVA 3C16B 1KTQA 4UOCA 4R0EA 5KFUA 2ILYA 3LWLA 1SB6A 4OIXA 1WI6A 3H40A 5I3UB 3TI0A 1X9SA 4KYZA 4M5IA 3KLHA 4YP3A 1Q81T 1Y3JA 1HHQA 1Y10A 3FZ2A 4R8UA 2OFHX 2F9JA 3MTKA 4I6AA 3Q8QB 2R2TA 4K4VA 2GZOA 3D1QA 1QVFR 4B3OA 2XMMA 3CJQA 3DN9A 4JI6F 2F9DA 3AHPA 5KFMA 2DXDA 3M6VA 2YWWA 5T7LB 3KHLA 2VQEF 1HNWF 4ED1A 1WSVA 5ETOA 3MR3A 4WBFA 3D2WA 1P27B 1A6LA 3DHXA 4LF7J 2XCAA 1N32J 4TVAB 1F6TA 3BH7B 2CPDA 2V2ZA 1WHYA 3EX7B 2VFSA 3DRSB 5A8WA 2W9CB 1HD1A 3N4WA 2R8JA 1VI7A 1RTJB 4CT9A 3G6ES 1FJGF 1UEUA 5EHHA 4CLPA 5C24B 4K4TA 5D0HA 2HMIA 4U95A 2NZCA 3BN4A 5C42B 5CYQB 3KLGB 3BKTA 4FXWA 5E3QA 5KFDA 5BR8F 4Q7AA 1KWMA 4E98A 4DV2J 5D0RA 4DR3F 1V3ZA 2AT1B 4CNZA 3DOMB 4MKBA 5E41A 2OI2A 1R0AA 3SXLA 2IDEA 3S1TA 1NLKL 4Q2MA 3OQ2A 2XI3A 2DH8A 1X0FA 5DDPC 2YWGA 4C48A 4ED7A 5DS7A 3HZEA 3O3LA 3T9NA 2ATLA 3CJRA 2AJFE 1YX2A 3W9JA 2DNGA 3GIIA 3I5CA 2FHOB 5CD4A 4MIAA 1VJWA 3KOAA 2DIUA 4M5NA 1BQNB 4WFNQ 4DV7J 3NNHA 4NXNF 2J9DE 1X0PA 1Q7LB 1REVB 2IJFA 2NLWA 3KDOA 3LGNA 5DZ6A 4RU9A 4WK3A 4YFUA 4CLFA 1T03B 4EZ6A 8RUCA 3M32A 2BR0A 5I4MA 1RTIA 1UPPA 1WTFA 2VKRA 3MM8A 2ALZA 1NDKA 3PJ9A 1U1LA 2A18A 1XK8A 4DDFA 3JS9A 2G4BA 2KFNA 1JLAA 4QPXA 1F9EB 1HBOB 1VK3A 4AXJA 1YWXA 3AQOA 2HFVA 3MR6A 4LIRA 1RYSA 2MKIA 2BACA 2WONA 2QMWA 3KYLA 4ANEA 3HK2A 4F4AA 3HD2A 1S1WA 2CYYA 4LSLB 4F3OA 4KRWA 4I68A 3D54A 4KH1B 3OTOJ 1M90T 2RH3A 2EFNA 1CEZA 1U0HA 2PN6A 4NLRA 1IVZA 3MEEA 5CQGA 4KTQA 2GC8A 3K5PA 4CRJA 1HARA 1T9XA 3OXLA 4K5SA 3PYGA 3FSYA 5JMNA 2RKIA 1M1GA 1V5IB 2VC1A 3PCOB 3LP2B 4MK8A 2CPEA 4PABA 5ETKA 1Y11A 3EWGA 3EVWA 5KFVA 4CQ1A 1VQ4S 2B4OA 3HM9A 2JZ5A 2OGUA 3IRXA 3H5YA 2YKOA 4AFFA 1ZPVA 4ZIVA 4PUOA 3R97A 1WKKA 1WG5A 1FKOA 2BJDA 4Y2IA 1HR0J 1A7GE 1PYSB 3TUZC 2DRAA 3BYPA 4MMOA 3VV2B 1X4DA 3BO2A 5M2UA 6AT1B 4LR8A 4TQSA 1TK8A 2UUBJ 1ZZFA 1C4CA 1DY3A 2MZTA 3H42A 3PV8A 2JEGA 1N33F 5I42B 1S5ZA 4J90A 1T05A 2LXIA 2RVJA 4F4ZA 1PG5B 2VFVA 4ED0A 4GC7A 4KGXB 1VBYA 4USHA 2RQCA 1RSCA 1TKXA 4LF4J 1X5SA 3AD8C 5KG0A 3I0RB 3UN3A 4X66J 4YY3F 4X4PA 4FYDA 4DL0C 3Q86A 1Z2LA 3HX9A 3K59A 2UXCF 1QUVA 3G82A 1G7CB 2MMYA 2D1CA 4RBVA 3T41A 2CWXA 3CIZA 1C0TA 2F65A 2UUWA 1WF0A 5KFEA 2X1BA 1IBLF 4P75A 2XEXA 5A8RB 2HHQA 4L6V3 3AXKA 1MWQA 3SZ2A 2FGOA 1BC6A 1NK5A 2PMHA 1UW9A 3MM5A 1FDBA 5K20B 1Q7YT 1FTCA 2W2MP 3ADAC 4J9PA 3HFZB 4NYOA 1NMEB 2B43A 2RQ4A 3MM9B 3MMAB 4OX7A 4QWAA 4IG3A 1HNXF 2XMAA 3MFIA 3BGFA 2CJQA 3M2RA 3W66A 2H5IB 3KMQA 4DN0A 4ECRA 1IJFB 1ZAWA 1XBWA 3DRPB 4NZ7A 3MM7B 4ANDA 1FRKA 5AE2A 1SBRA 2ZC4A 2J6SA 2XYGB 4B3TF 4WIIA 1V3SA 1KC8T 2WW8A 4RBTA 3ZZUA 4X65F 5IT9U 3TEGA 3CC7S 2YX7A 2C22A 4NLPA 1NPPA 2U1AA 3T5HA 2AYMA 3HJVA 4USKA 2EW9A 3HKZD 1U45A 1GTHA 1TFWA 3TRGA 4C0BA 1FD8A 2OEKA 1JB0C 2MZRA 3DI6B 4LUBA 5C25B 1N8RT 3TJ8A 1L3TA 2DEIA 1Z2ZA 3DOMA 1RT5B 4RW8A 1NSQA 5GADI 1R0AB 2KRBA 4DF4A 5KFTA 5M2PA 2AD9A 2B4VA 1AB8A 2GNKA 3AT1B 4WWSA 1RCOB 4Y2AA 5BJRA 2H5JB 3RBEA 2HYIB 2ZVIA 2V0NA 4QWDA 3CDUA 1GFWB 2EFGA 3T1HJ 2ADCA 3ZTQA 2QMXA 2GGPA 2F1FA 1B0PA 1JLQB 1NJWA 3KLEB 1YJ9S 3KK3A 3HSJA 3IAM9 2I2YA 4MFBB 4DG1A 1AYEA 1RT1A 3BM7A 4RBUA 3V6KA 2VZ9A 1RJJA 3BEGB 4RX6A 3GIMA 3CMES 3OHAA 2DY1A 4BLGA 4ZPWR 4B3MJ 3UCGA 4RW6B 3NMRA 3EE3A 1LXJA 2ZDPA 2BX6A 4WKYA 1APSA 1S1TB 2HWIA 3R2DJ 2JFKA 1JLBA 2FLNA 2ZDOA 2VHGA 4DJBA 2JEFA 2VB6A 3B82A 1M0SA 1RHRB 1RT6A 2NUHA 2IBKA 1PYOB 1M5KC 3QJJA 4OHZA 4HKQA 3M1VA 2CZ4A 2N7YA 2AZ1A 4S0MA 2G1HA 4QPTA 4DCOB 1R3NA 3GSIA 3FDSA 4YHHJ 5JVHQ 2YWEA 2FZCB 1WC3A 3QYYA 2WRMA 4A8WA 2V2KA 3MD1A 3M4XA 3MPUB 2H4WB 3MPYA 4I6YA 4NPOA 2XZDB 1K73T 4NASA 5DRKA 2CQ3A 5A2QU 1P9YA 4TU7A 3NY0A 3UCUP 2ZOMA 2L08A 2ACMA 3K7RA 4MK9A 3V81A 3N6NA 3BQ1A 2WSFC 2W4CA 2EXUA 3LPYA 1V9OA 2YY3A 4HR2A 3OSPA 2VBWA 5D15A 2H5EA 3NAIA 4BWJA 3U7JA 4UQGA 5K8OA 1F9FA 1VQNS 2XNQA 1U1OA 1RE1B 3DC2A 1CJKB 1Y7PA 3JTOA 1Q82T 4KPCA 1NB7A 1K47A 1U8SA 2LQ8A 4Q2LA 2POKA 4TN2A 3SMZA 4PG8A 5GADU 3EZOA 3R1LA 2VDHA 4QYZJ 4YB6A 1FRIA 2HHHF 1LW2B 1JKHB 3I9V9 2G0CA 1QJHA 1UWBA 1Y9OA 1MWYA 1N54B 2QV6A 3CDAA 4WP9A 2J0QD 4GMKA 3OV7A 1GX6A 1PIEA 2Y1RI 1EQMA 1NK7A 2DNRA 2LP4A 3FMBA 2GJ2A 2NYIA 4Y2MA 2MKKA 2B3TB 3J7AN 4FNIA 5AXKA 2N3OA 1JXEA 1TL1A 2W2OP 1WNEA 1MSWD 4XO0A 3AH6A 2AQ4A 3WZ0A 4Z7YA 2HQGA 1UL3A 3FBFA 3KXDA 3GG0A 3QO9A 2CQDA 2HS4A 2IPOB 4MAKA 4BCAA 2ROGA 2VH7A 1B0VA 1RXOB 4L3KA 1IBKJ 2X1AA 3W1YC 4P2MA 2V63A 1UA0A 4XK8C 4W98A 3DFEA 5IWAJ 3GJQB 3Q8YA 2W8KA 5F3ZA 4NLQA 4RU2A 4ANCA 3R27A 4C4WA 2MLYA 1HYSA 1FK9B 3BN7A 2PI5A 4UUXA 1HPZA 4K4XA 2HHWA 4B3OB 5L46A 4FKYA 4KO0A 3AJ2A 4OYIA 4UT4A 3G6XA 2YKMB 5I3PA 1HA1A 1HWLA 3T5KA 2W4PA 2GAHC 5U47A 4PUOB 3DOKA 3CCZA 2DR6A 5E33A 3DMJA 4HEA9 2HVEA 4AL5A 1VBXA 3LAMA 3HJFA 1N34J 2GO9A 1VLYA 3VAMA 1HW8A 3H20A 2UU9J 3THTA 3D67A 3EDRB 3FZBA 1ZM4A 3PEHA 3UN2A 3ZTPA 1ZYQA 5C25A 2F8HA 3IR6B 5H9FJ 4I2PA 4UW2A 2HBYB 4HH1A 8ATCB 3E3XA 3J7YI 1PJ6A 5KFHA 2GVZB 3ZZ0A 3M9MB 3T6JA 3HT0A 2GIQA 4G1PA 4BBYA 1TK5A 2QJ3A 4Y0FA 4NLOA 2E5JA 2IA0A 3LP0A 1IKVA 3NGDA 2DNMA 3I5BA 3GILA 2C1EB 2ZWPA 3OT9A 1YJNS 3D1OA 1KD1T 2B8PA 5A8RA 4PKDB 1RWVB 1LFWA 2CQ1A 1RADB 4CLTA 4CLSA 2L41A 3K5LA 4IR9A 4DR7J 3C14A 2F63A 2KXHA 1RT2A 4Q43A 2WAQD 1HBMB 1JNRB 1G6BA 5HROB 5EWGA 4PYDA 2CPYA 4DBQA 3N0VA 1F3VA 2UXDF 3NNCA 4M95A 2KJVA 4DXLA 3FSXA 1ZAVA 3IAS9 3Q83A 3G6YA 1OS5A 2ZH6A 4RL1A 3CNQP 4DMZA 2NCKL 1NDCA 1RT7B 1P8GA 2DEJA 5D3GB 4IG3B 3UNYA 1RHJB 2DHHA 2HQIA 1NDLA 3M2RB 5D78A 3C6TA 3EXCX 1SCJB 3AOCA 4TY8A 3N79A 2M52A 3RJMB 2CVIA 3J80Y 3KK2A 3CCES 1GMWD 2W2NP 3IGNA 4DQSA 7AT1B 1OYEA 4ZP7A 4QOTA 4C0HA 3K5MA 3GIRA 3SV3A 3PFEA 2WZ1A 1RISA 1KVJA 2ALYB 1S1UA 2QL9B 2ZHOA 3N6LA 1FRLA 1FNMA 2AWZA 5LT5A 3OVSA 3V6DB 2ZKTA 5KT6A 1QTNB 4DV4F 3H8YA 3FCWA 4ZKAA 5DGAA 2XMJA 2VG7A 3AJ1A 3UR3C 5G0RA 4MKVA 2QL5B 3L7UA 4N8NA 4DR1J 3BQ2A 2G0JA 1RP5A 3BDPA 3V5RA 4M5KA 4P2XA 1YBUA 2VJVA 3IBWA 2KDOA 4KR0B 1YGYA 2D41A 3TJAA 4RLEA 5K9FA 4WYWA 3CDBA 3OTOF 4V19X 4LR9A 2J6TA 2F4FA 1R6YA 2B9YA 2QZ8A 4QQBA 3TVKA 2ZH8A 2ZOGA 3DRYA 3BSOA 2RS2A 3Q89A 1FO1A 1HWIA 3GSDA 4QR0A 7FD1A 4ZMMA 5KG7A 5KT7A 3IWXA 3MECA 4ITSA 5F0WA 3H7HB 2EFOA 4FPRA 3NP5A 3V4MA 5K8NA 5KOXA 2XZWA 2EFPA 2G0IA 5GMDA 3VGVA 4GC6A 3A3OB 2RUSA 3LPEA 5K5MA 4X4RA 2XQCA 3RRHA 2K8GA 4KGKA 2AIRB 1KBRA 4DL3A 5KFRA 2PDAA 4PCQA 1EAYC 2HEKA 1UTAA 2FLLA 1H98A 1NSAA 3TZYA 3GV7B 3P5TL 1OSDA 1LWCA 3CJTA 3KKFA 3ET6A 3TA0A 5KG1A 3TWZA 3UE2A 5HMWA 1HR0F 5BR8J 2W9CA 4OQJA 4C8KA 3AODA 2MGZA 2ZFHA 3AB2B 1H7XA 1S10A 3K17A 5HBMA 4LF4F 3AOAA 2Z30B 4GKKF 4H4KA 2D9PA 2M88A 4JV0A 2BM0A 4N56A 5CYMB 4OZ2A 2ZHBA 5LMNF 3HHLC 3CJ0A 2BOPA 2OPRA 3IWLA 3TZWA 4K4WA 5AXLA 3Q23A 4NLGA 1RT7A 2DKOB 5D3GA 4CO0A 1X31C 1JMTA 1T0TV 3UW1A 1U48A 2KFZA 2C2KB 4R0JA 2HNDB 2FJXA 2W1BA 1NJIT 2VD3A 3POTA 1RKIA 1FKPB 3O44A 2ZBRA 2HNDA 4C98A 2ZM6J 4YQWA 2XO6A 2MHEA 3CCRS 1FRJA 1PBAA 5C2CA 4ECYA 1HNXJ 3G8SA 2ACYA 3DLKB 4HACB 4OYOA 3GB0A 1YBAA 1RAHB 1KVKA 1U26A 3PHTA 4ILLA 9RUBA 3DLKA 4HACA 4OZ5A 2RQMA 4DLEA 3M2VB 3UDLA 3QT8A 1FRXA 2NXCA 2JLEA 1VC6A 4TU8A 2EKYA 2Q6BA 1U47A 3PFOA 4PR6A 4AQYF 2BVZA 3HDSA 4DL7A 2HLTA 2YKNA 1DZ5A 1N5SA 2JH3A 2LLZA 2IRXA 2O01C 3BDEA 3EVMA 3OD2A 4QU6A 1S77D 2JHEA 1WF2A 2HGMA 2OHDA 2XI2A 3EXYA 4ZJLA 2F8MA 3TVYA 2HFSA 4WP3A 3W62A 4CLWA 4A8YA 1FKAF 2GGPB 5HQ8A 2AP6A 4DFPA 3QT7A 3QO9B 5CHCB 4CTAA 2OTJS 4ZPCA 1U0HB 4ZVRB 1AFJA 2YNFA 3PRBA 4ID5B 2M0GB 3UI3A 4JI5J 4KC5A 4DV0J 1FESA 4FYWB 2H1YA 1CJTA 2WB4A 3IBCB 3FBBA 1U6ZA 1SIZA 5DQIA 5KFSA 2CNOB 3DYAA 3MEDB 2HFOA 3NGUA 4G1QB 1KHVA 1D3WA 1CJTB 1S0OA 3IC1A 3I0SB 1FXLA 4ECTA 3K2YA 3GCWP 4AXIA 1R6VA 2HBQB 3QGGA 4TY8B 4UOFA 4ZPVR 1U8WA 4F0MA 3M8PA 1MWZA 1VS3A 2M70A 2YWKA 4DPWA 1E6YA 8AT1B 2NUUG 4ELUA 2M5YA 2LU1A 1VQYA 3RUBL 2DGOA 1SL0A 2B7CB 4OX9J 1KSPA 3DGPB 4QIGA 1H2TZ 3I31A 3CF5Q 2LKZA 4NL5A 3JSRA 4GO5X 5I42A 2FJVA 3NL0A 6FDRA 1WJ9A 5HBMB 2DNYA 3LWMA 3T1AA 2PEBA 1VQ9S 2DPIA 3MHYA 3W60A 1N5TA 3CCUS 3LUYA 1UEVA 3OXGA 4F4WA 4RZRA 3HO1A 2XGQA 1RBAA 2RS8A 2V8PA 3CPWR 2DY9A 4USUA 4LRAA 3JYTB 4LFBF 1UJ6A 4DUTA 3DLEB 1IKVB 5DQGA 3GYXB 1SVDA 5HVFA 4PXBA 5B08A 3IMQJ 1RT1B 2HQCA 4NRTA 3K58A 1FNXH 1NRKA 5HJYA 2XYPB 3T9ZA 4MH8A 3PIOQ 2V9KA 2LMIA 2V50A 4KGZB 2XC9A 2GJIA 4DR4F 2BANB 5KFQA 4DQPA 2EEYA 2Z8QA 1S1TA 2QN6B 3QJLA 3NNAA 4ID8A 4DUZJ 1BHNA 1VRTB 4B9NA 4WIQA 1S72S 2DGWA 2WB1D 2E5IA 4OHWA 2JOQA 1HBUA 1LKZA 3HVTA 1GMUA 2VONA 1IWAA 3BR9A 3R5BA 3UDVA 1WWHA 1JLAB 2LFVA 2QRRA 3R8YA 1VFJA 1U1RA 1XR5A 2DYAA 3S6EA 1BLUA 4CDIA 2FVSA 1GMVA 2E1PA 4IRCA 4RO0A 4C11A 4F4XA 1RTJA 1F2GA 2I1RA 4L74A 3KFWX 4N5SA 3CGIA 4CM0A 4LRDA 4MT1A 2IJRA 3EZ5A 3MR5A 5HMXA 1VBKA 1MU2A 3LP1A 5ADZA 1IWGA 1XC9A 3H4BA 5F0UA 2HWHA 1T02A 3LP1B 4RW8B 1OQ3A 2QA4G 3M05A 1NU4A 3R5CA 2WOMA 1TKTA 2ILZA 1VOMA 2V2QA 5THWA 2IC3A 3I5AA 4ZLPA 5JVGQ 5G0RB 1FJEB 4NXMF 4DWIA 5T14A 1ZOTA 3BGLA 4ES3A 1CG2A 3I56S 2F4VF 3ENVA 1H73A 1NPRA 1VMBA 2CPIA 3H2UB 2Z58B 4OZNA 1RWNB 4ECWA 3PW0A 4LSNA 3CSKA 3CC2S 3V4IB 1CPZA 4RUAA 5D4NA 1DQ8A 3DMJB 2XY7A 1T95A 2BKPA 2CNKB 3A13A 2RD5C 4LT6A 1NJZA 1BQMB 1C0UB 1VHIA 2A2CA 3D66A 4F26A 2XSJA 1LV5A 4FBUA 3QZ7A 1R27B 2ZZTA 2EC0A 2X3DA 3MM6A 1UVNA 2XNRA 4OYXA 1IKWB 3TVZA 5C7PA 4KPYA 1TUWA 2HFNA 1D09B 3MCSA 3H59A 3PEJA 3GE9A 4USMA 3F73A 3T1YJ 1PO6A 3PYFA 1BQXA 4YB7A 4C3MA 2M2BA 2AYGA 4OYMA 4IFYA 4XAKA 2D74B 5H9EK 4DPYA 1N34F 1C1CB 2Y0SD 3P45B 4NE9C 1JWWA 3EJMA 2EFQA 1PJ7A 1TU0B 1SIWB 2ZD1A 2DHAA 3NBPB 1W26A 3QZ8A 2VIHA 4WZMA 5ETSA 2Z0GA 1HWKA 3M8RA 1T9TA 4BWMA 4H4OA 2F40A 4GKKJ 3SCIE 2NXNA 2BJ7A 3VTIA 4CCHA 3KK1A 4G1QA 3I55S 1HNZJ 1HYSB 4OHYA 4FF3A 3FK4A 1WORA 2HNYB 4LRBA 4DV2F 3ONQA 3W2VA 3RBXA 3KLFB 1IBMF 1WG1A 4MJKA 3VVUA 2CADA 3CCWA 3HHEA 1XMQF 1S48A 3LO3A 1SL2A 2UUCJ 3WDOA 3TEHB 1NJYA 3CXCR 1FRMA 4UZCA 4A8OA 4HYKA 1QSYA 1T9VA 4P7TA 1SQEA 3RR7A 1FNOA 1HNWJ 2CDRB 4KAIA 2KM8C 2PFFB 3DRSA 2DD8S 4L76A 5HSPA 2VOOA 3G87A 2BJEA 3DNCA 3BPDA 3Q22A 2IIHA 4A8XA 5F8IA 1OY6A 4GRSA 1S59A 3D0IE 1GTEA 1S6PB 5H9FK 2EBEA 3IS9A 3F0NA 2AGOA 5J2NA 1R89A 1T05B 3EGZA 3E51A 2M8DB 3IS9B 5L9NA 1NZ8A 4MYUA 3H5SA 3M2VA 5M2RA 5KG6A 2W2PP 2J0WA 3CW2C 3CCTA 3H90A 2V6AA 4KIAA 4NLVA 2ZH5A 3CD0A 1AA1B 1S49A 3ZFVA 2ASYA 3M9OB 1N48A 3VCDA 5IQQA 3OJSA 4YR0A 4N77A 2IC3B 1DFDA 3HP6A 3RRKA 3C2PA 3M6XA 3L4BC 1N4LA 4C8LA 2YKNB 3DLHA 4C9DA 1CJUA 3L95X 3UVJB 5ETRA 4ECSA 1AW0A 3A3PB 2RE1A 3ZTSA 2XSFA 4PPZA 1I51B 4LFCF 4CM2A 2ATCB 3D7SB 3FMWA 5B09A 4DV6J 2DTJA 4AYBD 5HROA 1I6JA 4PG7A 3SQOP 1F1BB 1HNVB 2R2SA 3MD3A 2UP1A 2B4UA 3EMTA 4EBDA 1OMSA 3KJNB 3MM9A 1HNVA 1RWOB 1CC7A 1UPMB 3MM8B 3R7NB 2LQ9A 3UR0A 5KFOA 5CD4H 3CJ5A 2KFYA 3TNVA 3AAWB 3GP9A 1HBUB 3ITHA 2DO0A 4O0IA 1X4EA 4DSLA 2CQPA 3CULA 3IFEA 2FQQB 2BQUA 1KVIA 5HQMA 3RRGA 1R8BA 3KK2B 3TAMB 1RU1A 5GMKa 3PY8A 2X3GA 4OX9F 4B9LA 1VLOA 1DLOA 2DHSA 3PX4A 2QIFA 2L9DA 4F25A 4HTIA 1JJ4A 4J9RA 3ET6B 1RYRA 1JLFA 5EGYA 2VQEJ 3WX4A 2OD4A 1N36F 2QGFB 3LGMA 1SC6A 3MEEB 4NI2A 2KZZA 1KLMA 1NHUA 2I9SA 5F8LA 2Q66A 4X2BA 1KONA 4DS4A 4ZVUB 3DGPA 5DQHA 5DG7A 1LQ9A 4ZVGA 4HL9A 4KT0C 1SJQA 2CJXB 4FDFA 2C3MA 3C15A 1HWUA 4OJ1A 4AT1B 1DTQB 4DCJB 4Q5VA 1VC0A 4JI8J 4DFKA 3OL9A 4PQUA 2RAQA 2K3KA 3MAHA 3PG9A 2BXJA 2MEWA 4C3LA 2OEJA 1WC4A 2PD1A 2R7WA 1GAOA 2JVOA 2HRYA 2VBZA 2YNIA 1T3OA 5LJ3Y 2C2DA 3QAUA 3HF5A 2CVEA 3HPOA 2G13A 4M94A 1JLQA 1U1PA 1MMLA 4YUDA 1KR4A 3HHDA 4K59A 2RT3A 1O5JA 2UUCF 4O44B 3M8QA 1QE1A 4NWBA 4O4GB 4ZPBA 4JB8B 3PR4A 3R6LB 1U09A 3S7RA 1M1KT 1FKPA 2J6UA 4FXVA 1FHTA 1EETA 4I0WA 2XS5A 1Q53A 2VU5A 5CZXA 2BKNA 3CJ2A 3MURP 5J2QB 1XMOJ 1T3NA 1LK5A 2PMZD 2RDIA 1XN9A 3M8SA 3GPAA 1NSKL 3FRZA 1S79A 1JLGB 3QQCD 1O51A 4IO9Q 1SJ1A 4ECUA 5KFFA 3W3SA 2PGCA 1LEOA 3PVXA 1AUDA 2DISA 2ZD1B 3NBPA 4OJ3A 3Q24A 3CE8A 5J2QA 1PC5A 2ABYA 4K2XA 4EK2A 4W92B 2V8VA 4DPXA 2YBVA 3CMAS 2ZOFA 3L7OA 1SH2A 4FN5A 1RTZA 2KU7A 4Z2XA 4NOHA 1KQKA 4Z37A 1NNDA 2QLBB 1TV6B 2NXUA 4JYAJ 3RGIA 5CYMA 1UCNA 4LIWA 1VC5A 2N4CA 4OYBA 4ZA1A 3X3UA 3KHRA 3BGRB 4DV6F 1ZTWA 2B5JA 2FC8A 3OBIA 2KKHA 4PEOA 4HI1A 1G3OA 4DQIA 2KB2A 4IUFA 2GMLA 4NCAA 2VBYA 5KT2A 2OO4A 4ZPDA 2C28A 2YX4A 4B02A 1RBLA 1KLNA 2VDIA 4EBCA 4JV5F 1IR0A 1R0BG 4R25A 3Q8UA 4HLBA 1SKWA 2VKZG 1S7HA 4QIFA 4I4BA 5ETNA 4P52A 3IBFB 1X60A 5IT4A 2MQOA 3EM1A 2ZJQQ 1KRPA 5A6PA 4GVLA 1FE4A 2C3UA 3SIPB 2IAJA 4OZ3A 2WVCA 3VAJA 2OMOA 3RAMA 3SV4A 4LBHA 4CIOA 4LVNP 1X4AA 2PIIA 2DITA 2HK3A 4DI6A 1VIOA 1FFWB 2FJEB 2KVIA 3OL6A 4OJHA 3OR1A 4NA1A 4C2MA 1FT8A 2O67A 1YJTA 3IR5B 3MM6B 4LQ9A 5E2QA 4ECQA 5DDOC 4OI4A 2DGUA 1U1KA 3MI7X 1RHQB 3SYZA 4YDXA 1YVFA 1TKXB 3CDWA 1XEZA 4F3QA 1FDNA 2MHNA 4ZDNA 1SJ4P 3QT5A 2ZJRQ 3F44A 2W25A 3BREA 3HULA 1R7IA 5L38A 1WD6A 5LMNJ 4WK1A 4DX6A 1Z4UA 4F2RA 4I69A 3BBFA 1KQGB 1RWMB 4ELTA 4NZ0A 5D4LA 2MKSA 3BSCA 4FPIA 1NAQA 1L3UA 1CBKA 3O2IA 3S8SA 4DQQA 1P6TA 2RU3A 3B4MA 1FK9A 4GVBB 1UP1A 3JSBA 2AYBA 4N8OA 2CQCA 3OR2B 3SCJE 3M2UA 1F9HA 1HQ2A 3RB3A 3J81Y 1VBZA 3FCHA 4B3MF 2YNHB 1L3KA 1VRQC 3MXHP 4OMFG 1MLAA 4PZVA 3J7A1 2AEMA 2DGXA 3KG0A 2KM8B 3KNAA 4NLYA 3TA2A 4OI0A 1XJWB 3VGUA 1IKYA 3AY0A 4KHMA 4QR2A 1NB2A 2VA2A 1YLXA 4TYAA 1IN0A 1RAJA 2J7WA 3BZQA 2KJWA 3GZ7A 3C15B 4U9RA 4DSEA 1OPZA 2PA8D 4GO7X 2JL9A 4ALZA 2HHSA 4QU7A 2HHXA 2PC6A 3NKYA 3OUYB 1FA0A 2NXJA 3B6BA 3BGRA 4CLUA 5K14A 4H54A 2DNOA 2R7QA 3D68A 1H38A 3VZHA 4P71A 1BE4A 1XR6A 2Z56B 1FWKA 4JI5F 3W63A 2E1MC 1VHFA 1FXDA 3C14B 1JKHA 4DPOA 2FHKA 2OSQA 3J7ZT 3FNNA 3R2CJ 4ZN3A 2W9BB 2MKYA 3MAAB 3EGWB 4USTA 2DRDA 2DB1A 1Q79A 2HK2A 4MIBA 3OW2R 2QYCA 3KWMA 1RBOB 1NHVA 4ICLA 3QPIA 1WOSA 2F3JA 2ZUGA 2D7SA 4NMLA 1EARA 2J8SA 3OR1B 2VG6B 4NXMJ 4A8KA 3CJ8A 2LXFA 2D9OA 1CS4A 3HMJG 2D69A 1HLWA 4KBIA 4IH6A 3U27A 1XNRJ 1QAYA 2CG4A 2KZMA 5L1IA 5DG8A 1A9NB 1K8AT 1WDTA 1FWLA 3DU5A 3M1VB 1B7YB 4FYXB 4FVMA 5J2MB 1WHVA 2E5LF 4JI0J 4W4MA 5MLCV 4ED4A 2PFDA 4ZP9A 4LSZB 1M5VC 4ILRA 2E9RX 4H4OB 3UCZP 2AZ3A 3PR5B 2CJKA 1FJCA 3BGUA 1HPZB 3HSDA 4PQUB 2RQKA 4J9SA 3T1YF 3TJ9A 2V67A 1XERA 1UZDA 1XR7A 3GLJA 4NLWA 2N7CA 1FI4A 3EPIA 2VA3A 3P3DA 1CJVB 1N33J 4URGA 1GMWA 2K1RA 3MWBA 2RDJA 2L3MA 1UFWA 3RB0A 3GTYX 5RUBA 2O1PA 1MMDA 2LQBA 3LF0A 1RZMA 2A6MA 2ADBA 2RRNA 1N6QB 4X4UA 3EYZA 1BQMA 1C0UA 1EKSA 4WU2A 2XSJB 2BV3A 4ED5A 4HDGA 1PKUA 2W8LA 1SL1A 2HFUA 3T6BA 1FFGB 3TQ1A 2JDJA 4UOGA 3ISND 1N88A 2RDDA 3HVWA 1GXLA 4TQRA 4QW9A 4B9MA 2CPZA 2C2OB 3DXSX 2CNLB 1D9DA 2AX1A 2QC3A 1VGYA 3W8PA 2HS3A 1YI2S 3HKWA 2NPFA 1SH3A 2B9XA 4ED3A 3SI8A 3Q8VA 4NA3A 3OLBA 3DRRB 2AX0A 5D4OA 3JSMA 2BE2A 1VQKS 5JXSA 4FYVB 5LXRA 1JIHA 1TMMA 4CZCA 3MM5B 3AJDA 3R7SB 4TLQA 1WI8A 3TQEA 5BYSA 4JI2J 1RT4A 1FXRA 2FHJA 4RNFA 3OTBA 1OY8A 4CO4A 2ZUAA 3TZXA 2AEFA 3ELHA 5DM7Q 3MMAA 3MZIA 2DVIA 1CQNA 2YPZA 3TYTA 5B0DA 2Q79A 3V81B 5KG3A 1G2EA 4LF9F 2VPXB 4I2QB 2XMVA 3M32B 2HQFA 4DPUA 3M9NB 2AW0A 2HVHA 3CJ4A 3L09A 2BE9B 2WCXA 3ISZA 2B0GA 2CPHA 4JUZA 4LSNB 1XQIA 4B9VA 1Z1ZA 2F8EX 4NLDA 2HLUA 2A2DA 2FIUA 3KUGA 4XDCA 1RWWB 4YS2A 2FJBB 1O0PA 4JI3F 4FNHA 1UWBB 3NOCA 1JLFB 4J9QA 2IM3A 2YVSA 2FD2A 3D5MA 5LSLA 1WDDA 4J9OA 5KFBA 4NCGA 2I0XA 2XG8A 2V4RA 3VVTA 5HJXA 2E5LJ 4MTPA 1EHWA 2WK4A 5B0FA 2D3ZA 4NCGB 3MUVP 2I5JA 2W7PA 3X1LB 1QVGR 1NH7A 2OMLA 1NBEB 1LW0A 2IMOA 1Q86T 4C8YA 1S6OA 4IKAA 2KG0A 4EZ9A 2DXFA 1K0VA 1HQEB 4LFAJ 5K8PA 2E1RA 4Y6IA 1HNZF 4NYPA 1N36J 2JEIA 2YNIB 5B0CA 1YTYA 3G86A 4MIWA 4LF6J 1IQZA 4OI3A 3JTNA 4DR2F 2C3YA 3US5A 2FDNA 3C3LA 4DF8A 1DQ9A 1HIYA 1TMJA 1BUXA 1W25A 1YJVA 2CQBA 1S4FA 2WBRA 2XMWA 3F56A 3FVYA 3QGIA 4RW7A 3CCVS 2BJ8A 2FHJD 1WTBA 3OPKA 1D0EA 4IQXA 2HFZA 4HDHA 2WW4A 4TNOA 4DQRA 3RW7A 1RKJA 1U49A 1H2UX 5EX0A 4F3MA 3Q8RB 1AFIA 5KFGA 4OLOA 3O8WA 2W9AA 1B4SA 2DT9A 2VC0A 2ZNYA 4ZJQA 1JXVA 3NCQA 3TAMA 3M8PB 5D6GA 2LEBA 2KT2A 2HVZA 4B3SF 4MKYA 3CCMS 2MYFA 1CULA 2UUBF 4USVA 4J9MA 3ZZZA 3HVTB 4N76A 1RB0A 4JI7J 1FF2A 4ZP8A 5FIIA 3ZZOA 2MY7A 2Z2ZA 3T5LA 2MLXA 2HW3A 1YJRA 5KTQA 2FVCA 4EYHB 3PX0A 3LAKA 2X7IA 4A8MP 3O1LA 2C2MB 3NS7B 2K2PA 4H4KC 2RHQB 4HHJA 4WP8A 1IKYB 4I2PB 2KH9A 3MUTP 1ZS6A 5LXYA 2FVPA 3O6QA 1SPBP 4LJMA 4P9SA 4F04B 1V6HA 3V6DA 1DRZA 2GX8A 1I1GA 1KKHA 1Q1KA 2LCWA 2B5JB 2FHMA 3MPVA 2HWTA 2FB0A 3MF5A 2V8HA 1HW9A 3P96A 4Y65A 4N47A 4LMZA 1HHTP 3SSQA 2BE7D 2FJAB 3R5GA 1Y5LB 5KFYA 1DHMA 2QE5A 2ZE2B 5IC6B 1R8HA 4F4KA 1S99A 3OVAA 1L3SA 4C97A 3FBCA 4R5PB 2V69A 2Y1IA 2IM2A 2CZ9A 4ZJOA 3MMCB 1GXTA 3CJKB 1UAWA 2W24A 2MLZA 3EUNA 5EWEA 3KMSA 1RQ0A 3KJVB 3ZZRA 3G6VA 2GW8A 1UETA 3I4PA 5J1EB 1UA1A 3C6UB 2H4YB 1RAOA 3BBBA 3TUPA 4Y34A 2B56A 3TOQA 3Q8PB 4QIEA 2CJAA 5MAOA 2AJQA 2CUYA 5K8MA 4NMXA 3RR8A 1NKEA 2NSBA 3CCQS 3GG1A 5B0BA 2K7JA 3THVA 3QSIA 1G4CA 4FBTA 2MQMA 3R5DA 4KGVB 3L7PA 4V19J 1HQEA 3U02A 1IXKA 1HL6A 1QAXA 2AYEA 1W2BR 3K0JA 4JV5J 5F8JA 3BO3A 2GAGC 2FLOA 2MSSA 5HAOA 5HN0A 2MJUA 1P9QC 1SV5B 2F4VJ 1JJHA 1S1XB 3DDIA 4WE1A 1S4EA 3UD4P 3OFFA 1ULRA 4A47A 2DGQA 1PAEX 3ZNUA 2XULA 4I2QA 1U1MA 2Y3YA 4H4MA 5L9XA 1JNZB 5F41A 2MJNA 2W01A 4DV1F 2VASA 2AJ2A 2J7KA 4KHRA 3W5YA 1OY9A 2QLWA 1FEHA 1TL3A 2RJZA 2V5HG 2ZWOA 3C8YA 3I96A 2YQ3A 4M5DA 1CJVA 3TX8A 2DH9A 2UXCJ 4LF8J 2FZGB 1HWJA 2R8HA 4USJC 2FZKB 2Q43A 1RGVA 3BJYA 4A8SA 4B3SJ 1D9AA 3BKUA 3KLVA 2EG2A 1WSRA 5A8KA 1WEYA 3FQLA 2XY5A 4Y2KA 2DR5A 2GV1A 4Y2CA 1F60B 1RABB 5CCLA 4DL2A 3A8JA 2JWNA 3QIPB 3HCXA 5A8KB 3H2VE 6FD1A 2CQHA 3H98A 2LXUA 4I1TA 1KTVA 4OJGA 1SUQB 4KKOA 2A3JA 2CJBA 2JVRA 4IFVA 1FERA 3GV5B 3CC4S 3LP0B 4B3RF 1GXUA 1ZZNA 3MTJA 3OUYA 2KN4A 4YDDB 3JYTA 3JAMU 1NK9A 1SKRA 5GAHI 3J7YU 1ZM3A 2OPSA 3G8QA 3W61A 1S9EB 3DGVA 4USWA 5H9EJ 1VQLS 3QLHB 1LWCB 4NRUA 1TFYA 4KH0B 2ZVSA 3GCXP 1VIXA 1K1QA 2ZBPA 3NWGA 1Y5NB 1I3OB 4CLKA 3PZPA 4NEZA 4I6WA 4L75A 1GQEA 1CQMA 1FX4A 4ZVEA 3RU0A 3GU0A 4QWCA 2ZHAA 2UVUA 1YZ6A 1B3TA 2YXLA 1SQGA 3OR2A 2UVRA 1XNQJ 2DGVA 1B64A 3IR7B 3OFGA 2FY8A 4OI6A 4X4SA 2E29A 1TL4A 1PSDA 1WEZA 2BJ1A 2DIVA 1RTIB 3TO8A 4A48A 3M7VA 4RW4B 3I0SA 3QFHA 4PG4A 2MQLA 5A0YB 1R8PA 3E01A 3MCOA 2PI4A 5IXUA 1T9WA 4M8LA 3BSAA 3HI9A 4OLPA 3NMAA 2SXLA 2MSTA 2IVFB 1RWXB 2GMJA 3CD6S 1PCAA 3ENWA 1FJ7A 2NSCA 5IS2A 4KGMA 1X5PA 4UOHA 3W7BA 4JP8A 2J0SD 4DR6J 3GJSB 4J9VA 4ZVTB 3CUNA 1N5QA 1W2IA 2VG7B 4U7UD 3FSIA 3AOBA 5FDLB 2CPJA 3Q0AA 1QDUB 4RNMA 4CH1A 2R8GA 1EKRA 2L48A 3I32A 2ASJA 1BXNA 2J8AA 1YBTA 3GV8B 4M5LA 3VQSA 5KT5A 1DTQA 1Q78A 2ZC3A 3SFGA 4TYBA 3WIVA 2I5JB 1EJ7L 4EI2A 3MCMA 2E66A 1Y4ZB 3R5JB 2HIQA 2AGPA 1YZ7A 1AZSB 2JFDA 2LA6A 3CJKA 3CCJS 3FFIB 2EVZA 2XMKA 3CD5A 2ZH1A 5LSRA 4JI0F 3VAIA 2AJ0A 1M5PC 2NYHA 1XWLA 2BYCA 2DHXA 4URSA 1OSCA 1N6QA 2GHPA 1ZM9A 3GJRB 1QUPA 2BJ9A 1TP7A 2EKNA 2RU9A 3AFGA 3QATA 3UD3P 4P6QA 2C2EA 2IVYA 2C3OA 3B78A 1H6KX 2KXFA 4DU8A 4AQYJ 1ITPA 1GNKA 4DV5J 1RAFB 1SUQA 4KKOB 4LRFA 1TVRA 1HHSA 9ATCB 1FEEA 1TKDA 4FF4A 4IOAQ 5B7WA 2R7TA 1V3RA 1YRXA 4F7VA 4JI8F 2QEXS 2ROPA 3SCKE 1PYTA 4RNNA 3PKYA 4LFAF 3H5XA 1X4HA 4FS2A 4FF2A 5A8WB 2JC1A 2C2NA 2ZEJA 1J5EF 3NRBA 1MROB 2QO3A 5KG5A 1M5HA 3OL7A 1IQTA 4C3KA 4DFMA 1MROA 2BW7A 4F0HA 5CYQA 3P4UB 4CO1A 4OV6A 3KLIB 3OTCA 1TV6A 1S6QA 2KRRA 1HD0A 4DR7F 4NLTA 4OZLA 4DUZF 1U25A 5F9NA 2KHCA 4ILMA 2H54B 2YX1A 5AE3A 3R3TA 3HLUA 4CO3A 5I3QA 2MZ1A 1M1HA 4NEYA 4GKJJ 3UNGC 4KJIA 7FDRA 1BD6A 1WUUA 3QRPA 1NM2A 5ETPA 1Q5VA 1S1VB 3PKMA 1S76D 2RSQA 3VWSA 2AEJA 4PWWA 4PXDA 2OJ3A 3MPWA 4DX8H 2BBEA 5AJ3F 1H72C 3DLBA 2HGLA 4CT8A 5IZHA 1UVLA 4C6AA 4Q44A 2AJ4A 3D6FB 4U8YA 3JAMY 4LF9J 4DL6A 3JXOA 3J81U 1NPKA 3QWUA 5DDRC 3D1HA 5HLFB 4TXSA 2W7AA 2HVIA 4QBUA 2HBZB 4DV0F 2UV8A 3M6UA 3LANA 4OYWA 4PG5A 4XPCA 2ZJPQ 1H2VZ 2VFUA 3HHLD 1RT5A 1Y0HA 4OZJA 5F8MA 1NK6A 1RTDB 5CH7B 4X64F 4MKAA 1B0TA 4NYZA 4DV4J 5HP1A 4DSKA 5J2PA 4QYRA 4G3IA 4J9UE 2HBRB 4IRKA 2DO4A 4DS5A 5FLXY 4JI3J 1I5OB 1PC4A 1BWVA 2MTLA 1UWAA 1D8ZA 2VUGA 2IBOA 1RT4B 2L9WA 4CH0S 4DU7A 3C66A 3IM8A 5C5JA 3PW5A 4C8OA 2DNZA 1E6VB 1ROFA 1G1XA 3KDNA 1SV5A 4LFCJ 5DG9A 5I3UA 2BKOA 3ITHB 1S7IA 2ZKUA 4RKUC 4DOZA 4EO6A 1RDRA 5D0GA 1XTZA 2RKIB 1NK4A 3DRXA 3GR0A 4ZCKA 2V68A 3WC2A 2BMBA 1F5CA 4GVBA 4RW4A 4KE5A 2G2YA 4CH7A 3TZZA 3H4DA 5HK4A 1ZTTA 1UJ4A 1S0NA 1WACA 1LOUA 1HI0P 2DNLA 4LF1A 1S6UA 2CXEA 2WBMA 2VPWB 3CB4A 3DKDA 2AHOB 4DR2J 4ZVPB 1YKWA 1JLCB 4M63A 4ECXA 2CJ9A 2QSFA 1YIJS 1VQ5S 1FDDA 3BGOP 2HGNA 1VISA 3GFXA 1ICEB 4RUCA 2IA6A 2CAJA 4CWBA 3RTVA 1Q8IA 2C42A 1RTHA 2WVBA 1LWXA 4K2JA 3G96A 2HAFA 4FVCA 1NK8A 2MGZB 4FS1A 2GVZA 1JLEB 2CWKA 2N3LA 4ZN1A 1IUJA 3DOLB 3MUMP 4HHUA 1URNA 5C24A 3TUIC 5GAGI 3KLIA 3VALA 4NZ6A 3ZC4A 2B8QA 3QRRA 2LECA 2XM3A 1X4GA 5FJ4A 2AGQA 4IFYB 4MK7A 4ZLJA 3R7BB 4NX9A 3M8WA 2B9EA 1WOOA 5IFMA 3M8QB 1QE1B 1UW4A 2V94A 4O4GA 4Q45A 3NGKA 1S1VA 3BPSP
chains in the Genus database with same CATH topology
2B7BB 2C3PA 2OPPA 5E3AA 4LVOP 1KOOA 3CT9A 2KT5A 2RMLA 3NCRA 3GR1A 2CQ0A 1U1QA 4KFBA 5J1NA 2LU2A 2E1AA 3HXMA 5EDWA 2XMTA 3I87A 3MFHA 3DM2A 2VFRA 3S01A 4I7FB 5KT4A 2RUGA 3RB4A 2CQGA 5AXNA 3C6TB 3MM7A 1YG0A 4C8ZA 2EFVA 2KG1A 1IKXB 3NAHA 2NS1B 2DHGA 4ZPTR 3IG1A 1J2VA 1WEXA 2QA1A 1SJFA 1IKXA 5KFIA 1UKUA 5LJ5Y 4OFZA 3HHNB 4HH0A 3HFKA 3KG4A 3K5OA 2DNPA 1F5BA 3EZUA 1TAQA 4LSLA 5D8HB 2QFJA 4KB7A 4CO2A 2DNNA 4TY9A 4QWBA 3FEZA 3DXBA 2B4PA 2IRYA 4JYAF 5FDLA 2UV8G 2ZZMA 1UMJA 3OFHA 5GVQA 3V2UC 3T3FA 4ZCIA 5FD1A 2DNKA 4UUWA 5GAGU 2HPUA 2K1RB 3IRXB 3NCPA 3I82A 3GQCA 4M5DB 3V4IA 4JI1F 4ECZA 1OPIA 4RW7B 5LL6d 5HO4A 4EYIB 5HLFA 1M5OC 2E7XA 1Y3KA 4BC9A 2YH1A 1YHQS 2NQPA 3CEDA 5IT0A 2KTQA 4ICLB 5CYJA 4J37A 1L5UA 1JLEA 3J7Z5 3WBZA 3TW0A 2J76E 1H3DA 1RTDA 5E3PA 4FP9A 1VRUA 4DR1F 3TA1A 2MPUA 4A46A 2PT0A 1U4BA 4DHVA 2BDPA 2BABA 1FVQA 3TP2A 5F8HA 1H0HB 2MZQA 2OPPB 1KS2A 4A8QA 4Y00A 3P49B 3FRYA 1YRUA 1ZPWX 3QWPA 3Q2TC 2BZ2A 1N0UA 1R31A 1S0MA 1KHWA 4O3SA 1U2RA 1X5OA 4PWDA 2R7UA 2B6AA 4BC7A 4QZVB 5L1KA 1X5TA 3SCLE 2O66A 2NR0A 1HBNA 1RWUA 2V4QA 3C46A 3QJPA 3PIPQ 4DR5F 2JX2A 1O8BA 2PSZA 3O5TB 3IXQA 4WU3A 4YMEA 3H25A 1DTTB 1N52B 2ROEA 2UVWA 2QSWA 3BR8A 3G9CA 4JOUA 2XMUA 2AU0A 3THPA 5C42A 4O3OA 1L3VA 2D3OR 4MYTA 2ASLA 2R7SA 4CI0B 1MMNA 1X4FA 1J5OB 1RI7A 2XHWA 2B51A 1K0TA 3TAPA 3RW6A 2VV5A 1QSSA 5E0OA 2OPSB 4EEYA 4NLXA 1YJUA 3OJUA 4GKJF 5KG4A 4KSEB 1D1UA 1ZM2A 3DDNA 5KOWA 2YWHA 3GIKA 3M30A 4ES2A 2A10A 4KFBB 2VPZB 5L8RC 3PW7A 2XS2A 1TAUA 2YNFB 2MKHA 2DNHA 1Y5IB 3GIJA 1T03A 4UY8T 5EX3A 4E8UA 2X1FA 4JV1A 3DYAB 3KLHB 4AL6A 2OFGX 4X4NA 4EFAC 5EN1A 2RNEA 2K3IA 4TLRA 3AQPA 3M2UB 4EBEA 2WONB 3DOKB 2VBXA 1JLBB 2G1DA 5T7LA 4B08A 1EP4B 5LSOA 2FTRA 2COLA 2Z4PA 1EP4A 3DLJA 3H5UA 3JB9k 5G4DA 1NKBA 4WXOA 2CDQA 2YH0A 3GWCA 5KFXA 2N4DA 3BSNA 1NJXA 1DARA 1N0VC 1R8AA 3BS9A 2CQIA 3OHBA 2R7RA 2E9ZA 1URRA 3CTRA 4M1KA 1TR0A 3LP2A 3G8TA 1T8EA 1QM9A 3SDEB 1X4BA 2HMIB 2LVWA 2UVVA 1S6QB 4ZCLA 3I9ZA 4BHQA 3SDEA 4FF1A 2H9ZA 4KQZA 3SSSA 1XMOF 2HAIA 4CO5A 2P6SA 4WFBQ 1N32F 1Q4RA 4ES1A 1C2PA 1D8YA 3N9UC 1DTTA 5A6WA 4ED6A 2J9DA 1HBMA 4X62F 5B0AA 3L3CA 3UDCA 3MOZA 2LEPA 2MQNA 4JBCA 5H1SV 2BANA 3I6PA 3KJVA 4JI7F 1UFLA 2O3DA 3RBDA 1JLGA 4U6PA 4IG0B 3PW2A 3ICLA 2RF2A 3I0RA 3LH2S 2VODA 4IDKA 4U7CA 1REVA 2V8DA 4HTJA 3SQGB 2VL1A 1RT3A 4A8FA 2R7OA 1WHWA 2BE2B 1LK7A 2DPJA 4QR1A 3QAEA 4C11B 1HBOA 2GQCA 4QW8A 3M30B 2V4JB 1LXNA 2FUG9 5J2MA 3GYNA 4WE1B 1F5AA 2B6AB 2OTLS 2UZAA 3PO4A 2CIMA 2ZBIA 3BF4A 2IRUA 4YOEA 1TKZB 2IJNA 3QGPA 5E7OB 3AB4B 2HG4A 1RT6B 2KYXA 3MMBB 1TKZA 2OH2A 1F0XA 2J9CA 2JRSA 3ULHA 4EWTA 5KFJA 1BY9A 2ZNZA 2MZJA 5KT3A 2I8EA 5IQ6A 3AA8A 2HHTA 3MECB 4C8NA 2QA2A 2R7XA 3OVBA 2LQ5A 4E0DA 4EO8A 3QIPA 3DOLA 3DCAA 3DU6A 5F9LA 3VAHA 1S9FA 5GAEU 2MXYA 1D9FA 5L39A 2M7SA 2HHPA 1SXLA 2JLFA 3G4SS 4EU0A 2BQ3A 1QLNA 2LDIA 4ZP6A 5DJBA 4MFBA 3DLEA 4OHXA 4DG1B 4IH5A 3IN5A 3FQKA 3DRRA 1LWEA 4WZQA 5KAKA 3GFHA 2HHVA 2ZH2A 3VAGA 1RT2B 1FRHA 2K7KA 2XLIA 4H4MB 1X9MA 4ED2A 3IWNC 2EBGA 1LWFB 2XWXA 2KXNB 4NLSA 4PWUA 4Q0BB 2LEAA 4I7FA 2V8GA 4OI2A 4OZ1A 1DBDA 2YNHA 2E5GA 1VRTA 1KN6A 1JLCA 2DNQA 3ZZPA 2UXBF 1JK9B 4X66F 2AJ1A 5DETA 1VQ6S 3SSRA 3PRDA 3IG1B 3KNGA 5D77A 4XPEA 2CPXA 1M5SA 4B9SA 4JI4F 4RWXA 4WYLA 3B8HA 4XIUA 2IYGA 4C8MA 2J9EA 3PDNA 1YJWS 4RNHA 4IFVB 4IOCQ 4ETZA 4XDDA 3Q8SB 1KNZA 2EK6A 2OPQA 2XLKA 1HNIA 2AV5A 4P2SA 3PM9A 4G1IA 2EI5A 3MEGB 2L9NA 1LFPA 4ERDA 4KO0B 2ZZNA 5J2PB 3H2LA 1LW0B 2PO4A 2J0XA 2W7OA 2ZH3A 5CA5A 2ZH4A 2JSXA 2OP5A 4F4WA 4OX8A 1U1NA 2MQPA 2B9WA 2JLGA 1BQNA 3BB5A 1FD2A 3QMQA 5J1PA 3C6UA 1CC8A 1VQ4S 1IBKF 3DLLQ 4ID5A 1VQMS 1DAXA 1HQUB 2M3DA 2RF2B 2DBBA 1XNRF 3N5BA 1YSJA 1UVMA 3DDKA 5KFCA 1IJEB 1JXLA 1X4CA 4RNOA 2P5VA 5E3CA 4RW6A 4I56A 3TUJC 1VRUB 4OX6A 3E01B 1N5YB 2E9TA 4LF6F 2XLJA 4D3HA 1Q16B 1C0TB 5KFKA 2A1BA 2MKJA 1RA6A 1P1LA 2YKQA 2G9OA 5B0GA 1LWEB 2WSCC 4ZOSA 1K1SA 2J5AA 1VQPS 3EPGA 2CJKA 3CDEA 4NCAA 4J9KA 3OL8A 4K4SA 1Y00A 1FE0A 4YR3A 2LQJA 1RA7A 2R4FA 4QIWD 5AE1A 2HQ3A 2FC9A 3N01A 2HNYA 2EK1A 4WJBA 3IRWP 3PJXA 3UFCX 1X8DA 1R8CA 5KFWA 1NKCA 2JJ4D 5DLGA 2OPRB 1HBNB 4IH7A 1H7WA 5E5NA 1FKOB 3IO1A 3EGNA 2Z2LA 3TAQA 2R2UA 4OHVA 2IM1A 4D3GA 4WFZA 5F3TA 4KV8B 3MR2A 2MB0B 1UVKA 2MKCA 2IHR1 5GAEI 1S6PA 3KK3A 1QTMA 3Q2SC 5KFPA 4WFYA 4EGLA 4F4KA 2P9CA 3OSNA 1SJRA 2BW2A 4G6VB 5SUHA 1S0VA 2PE8A 4IDKB 1S9GB 2WTFA 2RB7A 1HMVA 2FVQA 4IG0A 3D0GE 1S9EA 4FZVA 1S9GA 3NG8A 3QLHA 1SI9A 5K14B 4K4ZA 4C0OC 2DJWA 3RZAA 2AF6A 2J7UA 3SQGA 1YITS 4O23A 3B4DA 2CZVC 1C4AA 2E5HA 4O3PA 3PNIA 2DR9A 1UVIA 3K8VA 2OLWA 3ISNC 3ETOA 4O3NA 4OI1A 3D0HE 1U6FA 2KHDA 1T94A 2WSEC 1HFEL 4NA2A 4IO1A 1VQ8S 3KHGA 4CTAB 5L1LA 1HQUA 1SKSA 2OD6A 1GX5A 4R8UB 1TKTB 1ZH5A <