1OIAA

U1a rnp domain 1-95
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
90
structure length
90
Chain Sequence
b'VPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
publication title Crystal Structure of the RNA-Binding Domain of the U1 Small Nuclear Ribonucleoprotein A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ribonucleoprotein
total genus 21
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1oiaA00
3N9UC 2Q79A 1X5OA 1JMTA 2OTLS 3P49B 2HGMA 5LJ5Y 5LJ3Y 1SJQA 3R27A 5IFMA 5LSLA 2ADCA 1URNA 5IM0B 3S8SA 2CQDA 2OTJS 3VAJA 2MB0B 2HGLA 4Z2XA 2JVOA 2BOPA 1WWHA 3UE2A 1WTBA 1X4FA 2N3OA 1X5TA 2MY8A 4YB1P 1QVGR 2LA6A 2DNYA 4Y0FA 2KFYA 4ZKAA 1VBZA 2X1BA 4Y00A 3R1HA 2MMYA 1KD1T 1YI2S 2XB2D 2MJNA 2NZ4A 4W92B 1S79A 3VAHA 2DNMA 2HZCA 1UFWA 1VBYA 3UCUP 2MZQA 2G4BA 1Q82T 5FJ4A 2O3DA 2GO9A 3J7ZT 1R8PA 2DO4A 2KXHA 4WFNQ 2DNNA 2KRBA 4WFAQ 3BO2A 1X4AA 3MXHP 2E5JA 1U2FA 4IOCQ 2MSTA 2E5GA 1M5OC 2DNZA 1FT8A 3UWTA 1N54B 2CQ2A 2DGSA 2QA4S 1M5VC 2KXFA 1SJ4P 3BEGB 1X4HA 1D8ZA 2ADBA 2JRSA 1VQ6S 2YTCA 1G2EA 2KM8B 2SXLA 3NS6A 2EK1A 2L41A 1B7FA 3LQVA 2MKIA 3VAGA 1N52B 2CPYA 1OWXA 2YWKA 1HD1A 2CQ3A 3J7YU 2OSRA 3ZZYA 5DDPC 5H1SV 3S6EA 1UW4A 2K8GA 1FHTA 2G0CA 4OZ1A 2MKKA 1VC5A 1VC0A 3I55S 1KC8T 2XS5A 3G4SS 1S72S 5EN1A 2AYBA 3THTA 1H2TZ 2M9KA 3ULHA 2ZJQQ 2UP1A 2DH7A 4ED5A 1WF1A 1YITS 3G9CA 2N3LA 3Q2SC 2J0QD 3OW2R 1VQNS 5HL7Q 1U1NA 2DNHA 2NLWA 1WG1A 2KN4A 3DXBA 2CQBA 5DDRC 3CCSS 1WHWA 3H2UB 1OIAA 2DHAA 3Q2TC 1H2UX 1VQMS 2QEXS 1X5SA 3P5TL 3CC4S 5CYJA 2JWNA 1VQPS 2M8DB 2KYXA 1U1OA 3S01A 1M5PC 1YWXA 3MUVP 3CCJS 2MZ1A 4CH0S 1RKJA 2AYGA 2RT3A 3CXCR 1Q81T 2CQ4A 1QVFR 2MQMA 4PRFA 1VQ4S 2DB1A 2RUGA 3MDFA 2KU7A 2LYVA 3CF5Q 4CQ1A 5D77A 2MQLA 5LXRA 2CQPA 1SJFA 1YIJS 5DDQC 1HL6A 4OZ0A 4LJMA 3NNHA 5HO4A 2MZJA 2YKAA 3BO4A 1BY9A 2LCWA 4CH1A 3SDEA 3H2VE 4LIRA 2HVZA 3MD1A 4P6QA 2D9OA 5GAEU 3VAFA 1SJ3P 2DH8A 2MGZA 3L3CA 1UP1A 5DETA 2LEBA 2LKZA 4UY8T 2DGQA 1FJEB 2M52A 1N88A 1W2BR 3CCVS 3FEXB 2CPJA 2KG0A 3G96A 4WKRA 3G6ES 4TU7A 2AD9A 1AUDA 3TYTA 1WEZA 2G1DA 1A7GE 3BS9A 3CD6S 3UCGA 2FC8A 2ZJRQ 1R8HA 1FJ7A 2MSSA 2OJ3A 1U6BA 2X1GA 2RRAA 1DZ5A 1ZH5A 3EGZA 1X4EA 1DHMA 3DLLQ 2XS7A 1ZZFA 1NO8A 1ZZNA 5IQQA 4F25A 2DNRA 1FO1A 1VQKS 1WEXA 5CA5A 2GHPA 3ZZZA 2DHSA 3NMRA 2DNKA 2A3JA 4PR6A 2DGVA 4CIOA 2CPFA 2RS8A 2LEAA 2KHCA 1WF0A 5GAGU 3EGNA 2QFJA 3PIOQ 1OPIA 3IWNC 3LPYA 2LXIA 2HGNA 3CC2S 1M1KT 4IO9Q 3CTRA 3NNAA 3P6YC 5JVGQ 2AYMA 2DGOA 5BJRA 2FC9A 4LMZA 2WBRA 1U1LA 1X4CA 2PEHA 1D9AA 3VALA 1WEYA 2MZTA 1P27B 5CXTA 1WHYA 3B4MA 1Q86T 2CQHA 2EK6A 2F9DA 1X4GA 3NNCA 2N82B 2X1FA 3MI7X 2MQOA 3D2WA 2MJUA 4TU9A 4BS2A 3B4DA 2E5IA 5GADU 1FXLA 1U1MA 4C4WA 5DM7Q 2DH9A 2MKJA 3MUMP 2LXUA 4YOEA 4QU7A 4FXWA 2DK2A 2LA4A 3CCQS 3MD3A 2KRRA 2CPZA 2KXNB 1WHXA 4WCEQ 1FJCA 3TO8A 3CMAS 1U1RA 2FY1A 2RQ4A 3THPA 3UD3P 3FEYB 2FPHX 2CQ1A 1YTYA 1YJWS 1K73T 2M8HA 3CPWR 2CPEA 2X1AA 1X4BA 4TLQA 1KOOA 2EVZA 1VQ5S 2MKCA 1NU4A 2ZJPQ 2DNGA 3IRWP 4ERDA 1WI8A 5GVQA 1H2VZ 1VQOS 3P3DA 2DNOA 2CPDA 2FHOB 4EGLA 4QQBA 5LXYA 3CUNA 1YJ9S 2CJKA 3SXLA 1WI6A 1VQLS 2J8AA 2MXYA 1X0FA 2KG1A 2VONA 4U67Q 2JX2A 3CCES 5GMKa 1N8RT 1K9MT 2MHNA 2LECA 2M4MA 3NS5A 3G71S 1PO6A 3K0JA 2E5HA 2OIHA 2DGWA 1U1QA 3G8SA 2J76E 4C7QA 2DIVA 3VAMA 2B0GA 2MKHA 2M7SA 2OSQA 3CCMS 2DHGA 1OO0B 2CQGA 2CQ0A 3CULA 1U1PA 5JVHQ 2D9PA 2RRBA 2DGXA 2CPIA 1VQ8S 3CCLS 1YHQS 1SXLA 4WFBQ 2CQIA 2L9WA 4QPTA 3MURP 2M2BA 1CVJA 2D3OR 1M5KC 1FNXH 4PKDB 2YH0A 2V94A 2N7CA 2XNRA 1KOHA 2DO0A 2RVJA 2MYFA 3V4MA 3VAIA 2E44A 1VBXA 3HHNB 1YJNS 5MLCV 2DNLA 1WG4A 2CPXA 2MQNA 2PE8A 1KQSR 1QM9A 2DHXA 1O0PA 2DGTA 2MZRA 2MZSA 2MQPA 2M70A 3U1LA 2MKSA 2MPUA 1U1KA 1HA1A 4RU2A 3CCUS 3VAKA 5GAHU 1PGZA 3SDEB 2VODA 2MY7A 2M88A 3TP2A 1H6KX 1A9NB 1P1TA 2MGZB 1WELA 1L3KA 3G8TA 4WF9Q 2JVRA 4F02A 1WG5A 2KM8C 4UQTA 4FXVA 2VOPA 4QU6A 2KVIA 5IM0A 3R1LA 1K8AT 4IUFA 5ITHA 2DNQA 3RW6A 1HD0A 2DIUA 2LMIA 2KI2A 1DRZA 1X5PA 2DNPA 3MUTP 3RW7A 2M0GB 2RS2A 3PIPQ 2F3JA 2ERRA 1U6FA 4W90B 3UCZP 3CC7S 3SMZA 4M5DB 2J0SD 3CMES 1XN9A 2BZ2A 2DGUA 1RK8A 2L08A 4A8XA 1JJ4A 3JB9k 3MOJB 1M90T 2YH1A 2VOOA 4TU8A 2F9JA 1VQ7S 4WIIA 3UD4P 2LQ5A 2I38A 1VQ9S 4V19X 3U1MA 3EX7B 1WHVA 1F9FA 1X4DA 3BO3A 3VF0B 1WF2A 2RQCA 4YUDA 2XSFA 3I56S 2XS2A 5DDOC 4IOAQ 5DM6Q 2CQCA 2DISA 2RU3A 1VC6A 2KH9A 2K3KA 2KT5A 2DITA 2MQQA 2I2YA 1IQTA 2AYEA 3US5A 4F26A 1DBDA 2XNQA 2HYIB 4J5OA 1NJIT 1JJHA 5D78A 3S7RA 1UAWA 2U1AA 3HI9A 4C0OC 1JJ2R 2RNEA 3CCRS 2U2FA 1Q7YT 1SJRA 5LSOA 2CPHA
chains in the Genus database with same CATH superfamily
4DSJA 2HKEA 3KKFA 3FCVA 3QWPA 1URNA 2YNGB 3AD7C 3NY0A 4A46A 2JVOA 3W65A 2JSXA 1Y5LB 3M2UB 4A47A 5T14A 3QJPA 1P6TA 2NS1B 3T5HA 5E3PA 1N5VA 3C3LA 2B43A 4K8RA 1JXEA 1HQUA 4QW8A 1HR0F 4USHA 1CJVB 4CZCA 2ADBA 1G2EA 2RDDA 1HD1A 1IQZA 3IGNA 5F41A 3PYDA 1Z1ZA 3J7YU 5KFMA 1JLFB 2EKNA 9ATCB 4I1TA 1S76D 2UVRA 1EZZB 5KFZA 4LBPA 4HI1A 2XS5A 4F4KA 3L7OA 3GYNA 3V5RA 1SV5A 4LSLB 2AP6A 5KFVA 5C2CA 1UJ4A 3LGHA 4QOTA 2IRYA 2DY9A 1Q1KA 2UUCJ 3DRRB 2CJYB 1RUSA 2YX7A 2BQUA 3P5TL 2JWNA 1U1OA 2FHMA 1Q8LA 1RAIB 4ECYA 1RKJA 4ED7A 7AT1B 2FJXA 3MDFA 3LO3A 3BZQA 3CE8A 4CM0A 2MQLA 1SJFA 1YIJS 4FF1A 5FLXY 1APSA 2MZJA 5G4DA 5KG2A 1QSLA 3HSZA 3M2VA 3OFEA 4RW8A 4TU7A 3UCGA 1NDCA 3PX0A 5E0OA 1ZH5A 1MROA 2GJIA 4N8OA 1KS2A 2Y8WA 3QGGA 4J9OA 3NMRA 2CJXB 8AT1B 3AJDA 3QAEA 1AZSB 1RCOB 4PR6A 1S57A 2BQ3A 4H4OA 1WSVA 2NYHA 3AH6A 4NLTA 2CXEA 3CDEA 2H65B 1GMWD 3TAMB 1DTTB 2AYMA 4CLWA 2PGCA 2FDNA 1U8WA 2CNKB 3LANA 1C4AA 3V4IA 3D2WA 1M1GA 2Y0SD 4ZJLA 3HZEA 1NKBA 2WVCA 4YDDB 2D7SA 3TEHB 3FMWA 2IM1A 1U09A 2CQ1A 4U6PA 5B0GA 8RUCA 3CPWR 1EX8A 2FZGB 1FRIA 5J2NB 3DU6A 4ZITA 1H2VZ 3UR0A 3CUNA 4CLFA 2I0XA 2NXEA 4OJ3A 1HWLA 3CCES 3GV8B 4KB7A 3BDEA 3J7Z5 2QL7B 4DL7A 2KL8A 3KHHA 1KNZA 4HHJA 2IAJA 4DL0C 2C2ZB 3GTYX 2K1RA 2NUUG 4TYBA 2DO0A 3VAIA 4WE1A 1VBXA 3CWJA 2AJ4A 2V5HG 1B0TA 5CYQA 3H4BA 5IQ6A 2J6UA 4K4SA 3GR0A 1FI4A 2PIIA 3OR2B 1HA1A 5GAHU 1QSSA 4I56A 2ZITA 2MY7A 4JI8J 1A9NB 1R7IA 4Q44A 2XHCA 3ZZPA 3G8QA 5A0YA 3AJ2A 3KK3A 5BXIA 4IUFA 1BD6A 4RWWA 1HD0A 2QA2A 2RS2A 2QLXA 4HYKA 2X3GA 3TQ1A 1OYEA 3SMZA 4K59A 3BPSP 4KJIA 1TL4A 3EM1A 3PKYA 1REVB 3K5LA 3KNGA 4WIIA 4HACB 2HVIA 2QZ8A 4KAIA 3A3NB 1CSJA 4JI6J 3DOKA 2IJNA 1IQTA 3PM9A 3A8JA 2MLXA 2HHPA 2P2CB 5THWA 1RZMA 1JJHA 2LEPA 4V19J 2IRUA 3NMAA 3HI9A 3CCRS 3MM5B 3TOQA 5LSOA 1RT3A 2C28A 3U02A 1GEHA 1SH3A 4URGA 4UZBA 1VBKA 5KT7A 3PDNA 1BQXA 4ZP6A 3MPDA 5KFRA 3O3LA 3PV8A 2FTRA 3R5CA 2JNJA 5A2QU 2J7UA 2OEMA 3EE3A 4Y2IA 3BGRA 3ICLA 1KTQA 3Q8PB 1WOSA 5J2PB 1AFIA 4P2FA 1F9EB 1U02A 1X4HA 4DSFA 1EIYB 3RB4A 5AT1B 3NS6A 2GHWA 3MMCB 4ZCIA 5DGAA 3LAMA 4NCGA 3PW5A 1ZYQA 4OJGA 3PO5A 4P71A 5IS2A 2ZJQQ 2JLFA 3RRGA 1WF1A 4ECXA 3T3FA 3TEGA 2GQ2A 1S9EA 3QRPA 4EMDA 4F50A 4DOZA 2HBYB 4LF9J 2RQKA 1S6OA 2K2PA 2NR0A 2C2OB 3Q2TC 2ZM6F 2ZBIA 1UTAA 3TJAA 2OPRA 4CM2A 5KFAA 1S6PA 3C15A 3C14B 3S01A 4P7TA 5HI7A 3M30A 1E6YA 4FVMA 2C3YA 4IFVB 4ELVA 3QFWA 3L7PA 2RUGA 3O5TB 4DR6F 5A8KB 4J9MA 2DYAA 1RJJA 2RJZA 4LJMA 3W5XA 4AFFA 2AX0A 2FZCB 2LCWA 3H2VE 3NOCA 2PDAA 3MEGA 1L3VA 3NCPA 1RTZA 3EJMA 3MAAB 2V2QA 3WHIA 1NK4A 1FJ7A 2WRMA 3EVMA 1YGYA 2KT2A 1TL7A 2LFVA 4X64J 2GIRA 3TA2A 8ATCB 2ZZTA 4OHZA 4PWDA 2UUBF 4JYAF 3VV2B 2QFJA 1LWEA 3LPYA 1M1KT 3MEDA 3RB6A 4IRCA 3PRDA 1KVKA 3THVA 4R5PA 1YK9A 1FRKA 3PY8A 1XK8A 1HKAA 4L6V3 3D1HA 3HSJA 1S7HA 3P45B 4MFBB 3BV8A 1H73A 1KBRA 2YNIA 3M7VA 1VR6A 1U0HB 2HNZB 2HIQA 3KLHB 1G7CB 3VHQA 3OLAA 3BJYA 1URRA 3O44A 3QSYB 4DSEA 3DOLA 1T94A 5DG9A 2PI4A 1ACMB 2RQ4A 2FY1A 3ZNUA 4LIWA 1LXNA 2FJEB 2YY3A 1X4BA 4PWWA 3AB4B 3MAHA 3MZIA 4X84A 4ERDA 2GVDA 2H48B 4ZVGA 2YKOA 1UEKA 1FK9B 4C97A 2W01A 1X0FA 4LF6F 4DBQA 3ISZA 2VG6A 3FBFA 3QRRA 3K59A 5E41A 2DGWA 1U1QA 5C24B 2AGQA 2M7SA 5DQIA 1JIHA 4A8KA 1N4LA 1FCAA 2ASJA 1SXLA 2CQIA 4LFAJ 2L9WA 4DV4J 2D3OR 4B02A 2Z57B 5DZ7A 2PMZD 5KFXA 1HI8A 3HHNB 1IKYB 3BBCA 2FQQB 4NLSA 4JI5F 2V50A 4LSNB 3HVRA 3PCOB 2OFGX 3NOGA 2YVSA 3D1OA 3GFHA 2W7OA 2XMWA 3OR1B 5FDLA 2J7WA 1RAGB 3MFHA 1L3KA 3JYTB 2JVRA 2Y1IA 2KZZA 1PIEA 3SFGA 2VHGA 1VISA 3KK2A 3RW6A 2DIUA 1DLOA 2J9DA 5HK4A 2YWEA 2NXCA 3BYPA 5MAOA 3T1YJ 2OMOA 4YY3F 1F2HA 4P72A 3HKZD 1HWIA 3L7UA 4OX8A 4KO0B 4YUDA 3D6HB 4R8UB 5A8RA 2WSCC 1RTHA 3MPWA 2K3KA 3D6TB 2KB2A 3TVYA 1S1UB 2H4YB 4IRDA 3V6DA 2RF2A 4WFXA 1GMUA 1WKJA 2NCKL 4DQQA 3T5LA 2DR8A 3P4UB 4OX6A 3P49B 2ASLA 1YJRA 1JQGA 4O3OA 1JLEA 4I0WA 5CCMA 4R0EA 4DLGA 3KLGA 3H90A 3QT5A 3I0RA 4CO1A 5A76A 3M1VB 3F41A 4MK7A 4NLRA 2WVDA 1CC8A 2FLNA 4Y2KA 4FYDA 2Z56B 2E5JA 3BN4A 4KQZA 3UWTA 3EGWB 4OZNA 1D8ZA 2P5VA 2JRSA 2ZH7A 1VQ6S 3M8SA 2FY8A 2HNDA 3LQVA 4USMA 2HZVA 2IM0A 2VA3A 4EUVA 2HHQA 5HBMA 2L48A 1QE1A 4U95A 4BC9A 1C0UB 3LALA 1T9UA 3VQSA 3GWCA 1FFSB 4WK1A 2AV5A 2NLWA 2C3MA 3H2UB 4IKAA 1VJQA 2HW3A 4DV0J 3W60A 3L09A 5CYJA 1DTQA 3CJRA 1T95A 2XY6A 2OGUA 2ZKUA 1NCLA 1LK7A 2KU7A 4ED0A 3Q23A 3Q89A 3SCLE 3T9NA 4DDFA 1GX5A 1S99A 5ADZA 1Q7LB 1NSPA 4TQSA 3UO0A 3GZ7A 3SDEA 4DR5F 1OS5A 3T1HF 2BA9A 1V6HA 3V6KA 4DG1A 1R3NA 4GKKF 3DFEA 3KMQA 1YZ7A 1NB7A 4TXSA 2ACYA 2XSJA 3QT6A 3K5PA 5LM7E 4ZHRA 3QWUA 4ITSA 5KG4A 4C9DA 2MSSA 1U6BA 4J9KA 3M32A 1XMQJ 5EUHA 3DOMA 2RH3A 1T05A 5GMDA 4NYPA 5CCLA 3Q8VA 5AXKA 2VBXA 2DTJA 2POKA 2BKNA 2O66A 3HVWA 3CCZA 1T3OA 5E3QA 4YQWA 2HHVA 1IKXA 3QJLA 1R0BG 2W25A 4DV1J 1IR0A 1HYSB 3IA0A 3MTKA 2DGOA 2EC2A 5LL6d 1IVZA 1NPPA 4N56A 3PRVA 2HWIA 4OFZA 4XO0A 3W5ZA 1P27B 3E8OA 3JTPA 4ZPBA 5BYRA 3OVAA 2KKHA 1N5QA 1X4GA 2BV3A 1HNIB 1NM2A 3RTVA 1F0XA 1N5YA 4BBYA 1DY3A 1FESA 5KAKA 4PZVA 2GJFA 3S1TA 3C16B 4DX5A 3PW2A 4FXWA 3MD3A 3V2UC 4DS4A 2IPOB 2V4JA 1B99A 3THPA 4U8VA 3KNAA 4P9SA 1VGYA 2OEJA 2CPEA 2BACA 5FIIA 1M0SA 3WQPA 4JI2F 2G13A 3TX8A 1SUQA 2M3DA 3A3PB 4AQYF 1HBOA 2BX6A 1S1XA 2XQCA 1SI9A 3BGUA 4U67Q 2VONA 1P9YA 3MPVA 2OFHX 1N8RT 2M4MA 1UFKA 4PCQA 3ILOA 2DEIA 4GO5X 1V3RA 4EBDA 3R5JB 5EWFA 4NI2A 1PSDA 5IWAJ 1UJ5A 3TR5A 2R8JA 3PVXA 1RT5A 3WC0A 2N7CA 1PYTA 2XNRA 3UPFA 5B0BA 3GIIA 1FDDA 4NCBA 3X1LB 1MMNA 2J6TA 4FF4A 1WG4A 2FJVA 1RKIA 2CUYA 5CAAA 4G1PA 2MZRA 4HR2A 2G1HA 2IMWP 2Y9HA 3GU0A 4AL6A 3M9NB 4LF2A 1H6KX 1TK5A 1C1CA 4FKXA 2HEKA 4YB6A 1D09B 3UN3A 1RT4B 3GIKA 3QT7A 1D9DA 4ICLB 3HFZB 4C48A 2KI2A 3MUTP 3RW7A 1FRHA 1RWUA 3LUYA 4R25A 3OTDA 2F3JA 4W90B 1IKWA 4OZ5A 3ENVA 2PD1A 3HJVA 1JJ4A 1M90T 4ECSA 2R7VA 4J9NA 2HNYA 3MR7A 3GJSB 2KH9A 2I9SA 5F3TA 4HKQA 2Z58B 2HYIB 3QZ8A 2BANB 1Q0NA 5IT9Y 1I51B 1MN7A 2KFNA 3OXGA 1TU0B 3GCXP 1HPZA 2ASDA 1AT1B 1X5OA 3T19A 2G0JA 4B3RJ 4FP9A 3U27A 3VGTA 1XTZA 4UUXA 3D4JA 5B0DA 5M2UA 3F56A 2YNHA 4CO2A 1U25A 4DPOA 3BH7B 5KT3A 4NLWA 2XMJA 1VI7A 2N3OA 4DV5J 2KFYA 3JTOA 4YFUA 3Q8UA 1OMSA 3HHLB 2MMYA 4B08A 3KJVA 5IC4B 2WTFA 3UCUP 1U8SA 5T7LB 2V2KA 3GLJA 4DPXA 4TY8A 2ZH4A 4KPCA 4OLPA 4QWCA 3HK2A 5G0RA 2MSTA 2HVHA 1M5OC 4KGKA 3PKMA 2CFXA 2QL9B 1EHWA 1GXLA 1J5EF 3W7BA 3I32A 2IRXA 2AGOA 3VAGA 1FERA 1B4SA 1XR5A 2KDOA 1Y11A 2V4QA 3GG0A 4ES3A 1GQEA 1YRUA 3G9CA 3R6GB 4LF8F 3H5YA 3Q2SC 2BJDA 1GXUA 1REGX 1TELA 3R7BB 1FKAF 1OY9A 5J2QB 4DFPA 2C42A 7FD1A 5C25A 2Q66A 2BJ9A 2AEFA 3Q8QB 1WTFA 2PC6A 2WSFC 4RUCA 4NPOA 2OPPA 1R6YA 1G3OA 3CF5Q 5J1PA 3MM6B 3C2PA 2HK2A 3CEDA 4KKOB 2GAGC 4ZOSA 1H72C 5K8OA 3DGVA 5HO4A 3LTOA 1F1BB 3BO4A 1BY9A 1DFDA 2IBKA 2QMXA 1SJ3P 3G86A 1FRMA 2LEBA 3MM8A 3BH6B 3OUYA 2YNFB 5I4MA 4GKKJ 4MIAA 4CLSA 1HNXJ 3JS9A 4RW9A 2AD9A 4Q8FA 1WEZA 3BS9A 1Q8IA 1NK0A 5HVGA 1LWFA 4S0MA 2VL1A 2EXUA 2VJUA 1TK0A 5HP1B 4C3LA 1X4EA 3FVYA 2XS7A 2P9GA 4QCLA 3H20A 5HMWA 2XGPA 1E6VB 3V6JA 1UKUA 4J9PA 1KWMA 2E1MC 2DVIA 2XTJP 4MMOA 5E2QA 2LEAA 4CYUA 3MF5A 3EGNA 3UDVA 3IWNC 4I2PB 4IO9Q 3HP6A 3DHXA 4A8QA 4FXDA 1VDHA 3M9MB 2XLKA 4XPCA 3BGOP 4USVA 1AW0A 1U48A 5KFQA 3QLHB 1U1LA 1D9AA 4RW4B 2R7SA 3H25A 2G2ZA 1V3SA 1X9MA 1LFPA 3CJ5A 2I5JA 1Y10A 1S77D 2F4FA 2MJUA 4FYWB 3K89A 3D3CJ 4HH0A 4B9MA 2VU5A 1CEZA 3W1YC 4C4WA 4WK3A 3HKWA 3MMAB 4PEOA 2W2PP 3UDLA 2DK2A 1NHVA 2FB0A 3FEZA 2Z2LA 5I42A 2HPUA 1U1RA 4YEAA 3LP2A 5KG7A 4LUBA 1NLKL 2M8HA 4CTAB 4WP9A 2BOAA 4HHUA 3IRWP 2XYPB 1VRTB 3I4HX 2AWZA 1RBOB 4KHMA 2HSEB 3QFHA 5DQGA 2JDJA 3QT8A 4WKYA 1N56A 2FGCA 2HHWA 3D28A 1CC7A 3K58A 4ED3A 4O0NA 4YR2A 4O4GB 1YX2A 2HHHF 2DGXA 4ECZA 3A8IA 3TUIC 1LK5A 2BRKA 1WKLA 1LNQA 1RTJB 3QGIA 2RVJA 3GV7B 2W7PA 3IWLA 4CH7A 4IR9A 1X7VA 3UVJA 3KLIA 2MQPA 2BRLA 4RU2A 5HROB 1R6VA 1D9FA 3MM9A 3SQGA 4NZ6A 1B3TA 3QBCA 3DI6B 1JLBB 3ZO7A 1SL1A 4FXVA 3HF5A 4QR0A 4OYXA 4J90A 2W9AA 4WYLA 1N36J 5GAGI 3UCZP 3PHTA 2UVVA 4ZPTR 1UCNA 2XMTA 4B17A 5K20B 1N0UA 1RTIA 2F9JA 2YPYA 2FGOA 5K14B 4FPIA 3C46A 1EKSA 2OELA 2KTQA 2VF3A 2BE7D 3TANA 3MCMA 2AYEA 4JI1F 5H9FJ 3NKYA 2VDHA 4Y65A 2HS3A 1T03A 1SJQA 2IBOA 1S1VA 3S8SA 2HVEA 1CJUA 4K2XA 3O1LA 1B0PA 2DEJA 1TMMA 3PNIA 4YB1P 5KOWA 1SQFA 5K5MA 3DLGB 2XB2D 2NZ4A 2N7YA 3G87A 2G4BA 3I4PA 2R42A 4PUOB 4ZVTB 5I3UA 4C11B 2LP4A 4JI4F 2KRBA 3HPOA 1F3VA 1FT8A 2HMIB 5KFFA 4LF4J 2QTWA 2KXFA 1SJ4P 1SIWB 4NE9C 2Q1LA 1Z2ZA 2VC1A 1R8AA 1MWYA 1EETB 2Z2MA 3R5AA 1QJHA 5D4LA 5ETPA 4F8RA 2J5AA 2FJDB 1RGVA 5L1KA 2GIQA 5F8HA 4DR2F 1RB0A 4BC7A 3EDRB 3NGKA 3DHWC 1U1NA 2QRRA 1RT7B 3DRYA 2V8PA 3DLHA 1HNWF 4DEZA 4WXOA 4F3MA 4DQPA 1TAUA 4NCAA 4MKBA 1W2IA 2ZNYA 5F8GA 2KJVA 2IVYA 2UUTA 2KYXA 3BKTA 1TV6A 3GJTB 5C42B 1YWXA 5A2QY 1GAOA 1NEEA 1SKSA 1SIZA 3TA1A 1SL2A 4DMZA 3AOAA 2EBEA 4I7FA 4YHHJ 3QJJA 1MU2B 2GO8A 1XEZA 3MR5A 4OYMA 5I3PA 4ZLLA 3M8PA 2KHDA 4LSZB 4OZ0A 3GB0A 4ZLJA 3GIRA 1NSKL 3DRPB 2LQ8A 1U0SA 4P6QA 4NX9A 2MGZA 3MR6A 2BEFA 1RSCA 4PQAA 5DETA 3D0HE 3QNWB 3K5NA 2YKNB 2XULA 3FEXB 2KG0A 5DS7A 3CD6S 1Z4UA 4NLOA 4C8ZA 2G9OA 2MDAA 1DZ5A 2GV1A 4F25A 1EQMA 4EI2A 2A2CA 2BXJA 4QIFA 3ITHB 2EFQA 4ELTA 2KHCA 3N4WA 1FDNA 4RNOA 4CLLA 4F3QA 1LW2A 4UTGA 4NLXA 4M5GA 1SC4B 4H4MA 4USIA 3QRQA 4O3RA 3QAUA 1WC1A 4DR7F 3UFCX 3R5BA 4IQMA 3B4MA 2F4VJ 4ID5B 2Z8QA 3LW5C 2RRNA 2FVCA 4QW9A 1U49A 1OQ3A 1HQUB 4C3KA 2R7QA 2PA8D 3M05A 3BREA 4WU3A 4O23A 4YOEA 2LA4A 2R4FA 4LRFA 5KOXA 3VGSA 2CPZA 4Y2AA 3WIUA 3HM9A 3M8QA 2GC8A 3VVUA 3NGSA 1JXLA 5D4NA 3ZZRA 4Y2MA 1X9SA 3BR8A 1NU4A 4DCPB 3HZGA 2FZKB 4MK9A 5GVQA 2YX4A 4J37A 2GJ2A 4G1QB 4EGLA 1VQLS 2JX2A 3W8GA 2HIYA 4OX9F 4DL5A 2W2OP 4NLYA 3MWBA 3G8SA 3PJXA 2VG7A 2V2ZA 2B0GA 1Q5VA 3AXMA 3CCMS 2CQGA 4ZLNA 4N41A 3PRBA 2B9YA 1CVJA 1YKWA 1O51A 1RQ0A 5JXSA 1RU2A 2E1CA 1T9WA 5KFNA 1QM9A 1FTCA 1S1WA 3AHPA 5K8NA 1QUPA 2M70A 4ZIVA 3H59A 1ITPA 2QJ3A 1NSQA 4RW7A 2QFIA 1S10A 1MSWD 3IWXA 1CULB 3C66A 5BYQA 2CZ9A 1TKZB 2KM8C 2YNGA 3CCWA 3FK4A 4CWBA 4Q0BB 2UVWA 4RZRA 4FF2A 3TI0A 2XY5A 4KGMA 4RBUA 3FQKA 2J0SD 2DXFA 1X9WA 3G6XA 2HZAA 1VQ7S 3K8WA 1FEHA 2BJ7A 4X4OA 2MEWA 1UEUA 3MOZA 1IUJA 2RQCA 2VBWA 4H4OB 4LQ9A 4KTQA 1LKZA 1DBDA 2D69A 4FNHA 1CJVA 5CH7B 4O3SA 1VIXA 4KY3A 2JEFA 4C98A 2CPHA 3NGRA 4NA1A 2OTLS 2AEJA 1JLFA 4UY85 3VAJA 2HGLA 4B3SF 4EU0A 2V34A 2HWTA 1MWZA 3DGPA 2F63A 4LSLA 3RUBL 4W92B 1FEEA 3SFUA 3PR5B 1HMVB 2O3DA 2V67A 3DRRA 3T41A 4IRKA 2EBGA 2WOMA 3G2XA 3U7JA 2CQ2A 1HW8A 3BEGB 3TQEA 4L3NA 4NXNF 4XDCA 2L41A 4WZMA 3QSIA 4I6WA 4OYZA 1N52B 1SPBP 1EARA 3MTJA 3QZ7A 2B4UA 3LGNA 4OJHA 1FHTA 4MKAA 2VFSA 3RU0A 5L39A 3IS9A 2VQEJ 1HNZF 5B08A 1HWKA 1H2TZ 2UP1A 2OMLA 3K57A 2IAJB 3B78A 5B0AA 4C6AA 4DR2J 4DPWA 4K2JA 1TL1B 1LV5A 5AE2A 1OSDA 4IOBA 4WE1B 3DLEB 3UNGC 2V68A 2VFUA 2UXCJ 2VKRA 4FYXB 2YKPA 3DLBA 3ILLA 2K7JA 3GFZA 1RWMB 3IR6B 4JV5J 1VRUB 5A0YB 4EYIB 3KK3B 1AZSA 2ZWOA 3IBCB 5HLFB 3AFGA 2GGPB 4LREA 3I5CA 2FLOA 1RHJB 4K4WA 3KUGA 1DTTA 3VAFA 2IIHA 2AZ1A 4LRDA 4ES1A 4H4KC 2DGQA 1FJEB 3KHRA 5F0UA 3CCVS 4MT1A 3FKBA 2B56A 4M95A 1IXKA 3CD5A 2BVZA 1HWJA 2XZWA 2OJ3A 4NXMF 3KMSA 1GT8A 1BLUA 4C8MA 2ROGA 1NO8A 1ZZNA 1P9QC 4Q7AA 2K3IA 4N47A 1RT3B 5F9LA 1LW0B 5EWGA 2AIRB 3OHAA 1O5JA 3PJWA 3N5FA 4DUYJ 4X65J 1S7IA 4ECRA 4ZVQB 2E9TA 3VGVA 1UJ6A 5J2NA 2DHHA 2VPXB 5EHHA 3VALA 2GX8A 3VQTA 1TFYA 1NRKA 3E01A 3W2WA 3NXZA 3MGJA 3MEEB 3GV5B 2H3EB 5DM7Q 3MR2A 3BQ0A 4CLYA 3BSAA 3I9ZA 3BDPA 2R2TA 1QTMA 2VH7A 2HVDA 1S12A 1XMOJ 3IR5B 2MKCA 3OR2A 3PW7A 4NLDA 3OSPA 2BKOA 1S9EB 4HTJA 4URSA 2VB6A 3P3DA 2HRTA 4DUZJ 3DMJB 4ALZA 1FXRA 2VFRA 2YWFA 4U7UK 4O3NA 4OI1A 2AT1B 4NRTA 2OLWA 3CULA 3C19A 3R5DA 1E6YB 2ZVIA 1REVA 5L1IA 1T9YA 2VPYB 1FNXH 4HACA 2R7TA 3W62A 2E44A 4LQ3A 3OFFA 2KYZA 3HVTB 1KQSR 2PE8A 1QUVA 2P6SA 4DZDA 2ACMA 2G2YA 4C8KA 1U1KA 1YRXA 2J0XA 3TJ9A 2IA6A 2KO1A 2ZBCA 3NGDA 3MM5A 3MEGB 4C8YA 5A8WB 2A0FB 2QLWA 3K7RA 1NPKA 3ONQA 4PPDA 2AEMA 2R8IA 4NRUA 3W5YA 3CMQA 2UUCF 1YLXA 4TU8A 1TL7B 5CQGA 5H9FK 5AJ3F 3H7HB 1WF2A 3WIVA 1WC6A 5J2PA 3UN2A 2OH2A 3UDEA 1ELOA 3GONA 2XNQA 3MPUB 3ENQA 3IRXB 2Z0GA 3ENWA 3ISND 1GX6A 5KT4A 3GR1A 3A3OB 5K8PA 5HMZA 4NZ0A 5KFTA 1ZM2A 4ED1A 2BE2B 1OJ4A 5IM0B 2HLTA 3IMQJ 2OD4A 4O44B 5KFHA 4MIBA 3K8VA 1X5TA 4HT7A 2N4CA 4ZKAA 1HW9A 5AXMA 4FYVB 1S79A 2B9WA 1VBYA 4K50A 3D5MA 3L9ZA 4CCHA 3IAM9 3IC1A 2CDRB 1U2FA 5DGBA 2QA4S 1Q95G 4IH7A 1M5VC 3MHYA 1NJZA 1RAAB 3RYLA 4KIAA 2ZBRA 3NBPB 1MNEA 2EPIA 2XCAA 4ES2A 5A8KA 3UR3C 3I55S 2AYBA 1UMJA 3F0NA 3FSYA 1HNZJ 5KFGA 3NCQA 4X2BA 5J2MB 1AROP 2UZAA 1MLAA 3MAAA 5HN0A 1X5SA 3CC4S 3ET6B 3FZBA 1VQPS 3FFIB 2OD6A 4KH1B 2AYGA 4K5RA 4RR5A 1PJ6A 2CADA 1P1LA 2NPFA 4P10A 3MEKA 2ZH5A 5LXRA 2O01C 2IDLA 1DLOB 4RUBA 4GVBB 3Q22A 4ED8A 2DH8A 4XK8C 3KG4A 2XBPA 4MYTA 2DPJA 4ELUA 1KVIA 2D1CA 1N88A 5D3GB 4F2SA 1W26A 3CJ4A 5FLXU 1IM6A 5KFYA 2PA3A 3KLFB 5CZXA 4MFBA 3T9ZA 1DHMA 5CYMB 1U0HA 2HNZA 1BGXT 2RF2B 3CB4A 5E5NA 4N7TA 1WEXA 5CA5A 2PI5A 4QWBA 1N5SA 2DJWA 4CIOA 3K5OA 5HVHA 2ZWPA 3BM7A 1JLEB 4JI8F 1CBKA 2HGNA 4NLQA 4WPAA 3UW1A 1RABB 1FK9A 4USKA 3A13A 1WEYA 4ZPWR 1ZA2B 4LFBJ 5F0WA 1K44A 3GYXB 1J2VA 1TKXB 3SCIE 3UN5A 3CD0A 5C24A 4TU9A 2BM1A 3T5JA 1FXLA 4Y34A 1B70B 5ETTA 4JI6F 1NHKL 1PG5B 1SH2A 1GMWA 2AJFE 3FEYB 1BQNB 3CNQP 1YJWS 4MTPA 4LSNA 1UVLA 4ER8A 5HBMB 3KHLA 1KQFB 3V81B 4OZ2A 2XGQA 3OR1A 1U47A 2FHOB 1OYDA 2EW9A 4QWDA 3AOCA 1ZPWX 3K0JA 2HHXA 1YBTA 4RNMA 3MPYA 1NZAA 2XI3A 4LF7J 1FX4A 2COLA 3G82B 1UL3A 3MURP 5E3RA 2JEJA 2YH0A 2V94A 5IXUA 2D74B 1FJGJ 3POTB 4KO0A 5ETVA 4DFKA 2QIFA 4R8UA 2GVZB 5MLCV 1QLNA 4NWBA 4AXJA 1RWPB 1S1UA 2PSZA 2WCXA 3FBBA 3SDEB 2VFVA 3TP2A 1TUWA 3CD7A 4DPYA 4C8OA 2Q6CA 2RQMA 4KYZA 2WVEA 2WVFA 4J9UE 3RBDA 5ITHA 1HBMB 4ZHRB 1U7LA 3DYAB 1SB6A 2KVQE 2KFZA 3HFKA 5L1JA 2DD8S 2CZVC 2E29A 3FBEA 3W3SA 3JAMY 3CC7S 1M5HA 2YWWA 3M32B 1L3TA 3DOMB 4LF9F 3LP1B 4J9QA 2RAQA 3M1VA 3JB9k 2AJ0A 1R8BA 1VMBA 1CG2A 3OXFA 4P73A 4KBIA 3PYGA 5DDOC 5AJ3J 3W64A 2PFFB 3KDNA 3BQ1A 4B3MJ 1WOOA 1S49A 5D0RA 4ZVUB 2Q79A 1BXNA 3I82A 2HGMA 1N33J 2FVRA 1ZOTA 2WBMA 3EVOA 1KLNA 1Q78A 3UDCA 4DR3J 2HRYA 4DWIA 1V9OA 1S97A 1N5YB 1QVGR 4K5SA 4WTOB 4LFCJ 1C0UA 4C3MA 2RKIB 1KD1T 2CWXA 4K4UA 2DNMA 1MMDA 1IR1A 3M6UA 3OBIA 4K4YA 4E0DA 1IM4A 4QIEA 2WONA 5LMUJ 2F65A 1Q79A 4ZVHA 2XMVA 4RW6A 2J9DE 3KG1A 1PCAA 2VKZG 4X64F 2ZHAA 1PKUA 1C1BB 5KFDA 3PXGa 1B7YB 3MFIA 1MN9A 2YWKA 2FVQA 4BDPA 3QQCD 4PAAA 1ZPVA 3CW2C 1RA6A 5ETKA 4K4VA 2WW8A 4G1IA 3GIJA 1PC5A 3Q24A 3OW2R 4ETZA 5B0CA 2IC3B 4JI3J 2OKQA 2CNLB 1UZHA 3L95X 3SZ2A 1WOPA 3CJKB 5L8RC 3GFXA 1JLCB 1W7WA 2EFGA 4DSKA 2A6MA 1FE0A 3CXCR 1QVFR 4DU7A 2BJ3A 3ZTSA 3LH2S 5ETNA 2R8GA 2R2SA 4EK2A 1HQEA 4DJBA 1JNRB 1Q8KA 2YKAA 4QR2A 1HYSA 4CH1A 3M9OB 3BGLA 2XO7A 2RHSB 4CRJA 1R0AB 2VICA 1MG7A 1VCTA 2ATCB 2LKZA 3LGMA 4P75A 3R8YA 2B5JB 2NUHA 1NK5A 2CVIA 2HNYB 3AQPA 4GMKA 1NPRA 1HNIA 4P2MA 4DR4F 4LFAF 1M5SA 4HVZA 4DV4F 2X1GA 3L4BC 1FO1A 4QPXA 3C16A 3BPDA 4RPFA 2E5LJ 3PW4A 1C2PA 4IO1A 3CJSA 1L5UA 2RS8A 5M2RA 2QV6A 3CTRA 3NL0A 4PG4A 3RB3A 1X60A 2IM2A 1X4CA 1JLGB 2GQQA 3CJ3A 1WHYA 5CABA 2H54B 3T1YF 1JLAB 5KFJA 5G0RB 2M5YA 1KEKA 2XYGB 1RTDB 1XR6A 1V5IB 4USWA 4ZPDA 2AU0A 1JKHB 4L3KA 2XLIA 4WCEQ 1FJCA 2Q43A 3PFOA 5KG5A 4X4PA 3UD3P 4ZLPA 5DLFA 2X1AA 3MCSA 1DAXA 4PXEA 1D0EA 1ROFA 4KV8B 2ZFHA 1FKPA 2QA4G 2LQ9A 2RMLA 1RT4A 2LECA 3NS5A 3ZZUA 2NYIA 1WJ9A 4ICLA 1A6LA 5C25B 4B3TJ 2DHGA 1Y3KA 1SVDA 3OL7A 3SV3A 1XJWB 3GQCA 5HQMA 3M2RB 1YHQS 2ZDOA 3GG1A 2RD5C 6AT1B 3WBZA 4U7CA 1YDLA 2W4DA 1XNQJ 2MQNA 5KG0A 4OYIA 1CQNA 4GKJJ 3RR7A 3MECA 3KJQB 1S9GA 3HJFA 1RA7A 2VODA 3R2DJ 2Z2YB 1UA1A 5RUBA 3CDBA 2NSCA 2CZ4A 3LWLA 4M1KA 1RXOB 2LMIA 2M0GB 1I3OB 3BN7A 2ERRA 4DFJA 4CLUA 3HHLA 4OIXA 1Q5YA 1RWXB 3HD2A 4DV0F 4ED6A 3DDNA 2ZH8A 1WHVA 4WJBA 3J80Y 1BHNA 4TN2A 3OFHA 1GMVA 4EO8A 2RU3A 4OZ3A 1N32J 4NASA 4OZJA 2Y8YA 2F8MA 4EFAC 4YS2A 1SJRA 1XNRJ 3AD9C 1FRXA 2FLPA 2EC0A 4ZVOB 1FXDA 2F8HA 2CQDA 1BC6A 1RAHB 4DUTA 5DZ6A 2ZHBA 4PXBA 2I5JB 1TKDA 1WWHA 2VD3A 1VS3A 2JOQA 2JL9A 1N0VC 4DU8A 2CNNB 1HLWA 2RILA 5L46A 5I42B 2KXHA 1O8BA 1X4AA 1XMQF 3I96A 3LP2B 1KLMB 4Y3CA 2DGSA 4ZVEA 1UWAA 5U47A 1DURA 3RBEA 4UF4A 1NK9A 4Z7YA 3B6BA 2MKIA 1OWXA 3I0SA 4DV1F 3D6MB 3KLVA 3MM7B 3MM6A 4CNYA 4KKOA 3C8YA 1S4FA 3NCRA 1NHUA 1S1TA 5BR8J 3ULHA 3LP0B 2DCLA 4DS5A 1DQAA 3KUHA 3TAPA 4DV3J 4X66J 9RUBA 2LU1A 2BW7A 2EFOA 2DNHA 4OV6A 2IHR1 1PAEX 2YNFA 3N6NA 1OIAA 1F9HA 3Q8RB 4HDGA 2PFDA 1Q4RA 1BQMB 2AQ4A 3LWMA 2MZ1A 3DXSX 3AT1B 3GJRB 5F3ZA 3EWGA 4OZLA 1ZM4A 2A18A 2A10A 4I6YA 5DDQC 2ZE2B 2HS0A 1T02A 2CJBA 2VV5A 1UPPA 4I2PA 1FNOA 2D9OA 4K4ZA 5KFIA 2LVWA 1HIYA 2J8SA 3OJSA 4QWEA 3QLHA 4RW4A 3GE9A 2M52A 4B9SA 2B8QA 4AXIA 1RE1B 3Q83A 3QO9B 5IWAF 1ZBTA 2C2RA 3FMBA 5CD4A 2JZ5A 4DR4J 4DV2J 4B9TA 3HHLD 2DPIA 2D41A 3M8WA 4P2SA 3NLCA 2RU9A 1J5OB 3Q86A 4UOHA 1KFSA 4JV2A 4U96A 1VK8A 1ZTTA 4L73A 3HXMA 4NMLA 4CTAA 4FDFA 2Z4PA 2APOA 1NKEA 5H9EK 1S0MA 4A8OA 4C0HA 2FC9A 4JI7J 5D4OA 1LWCB 2XMUA 3P96A 3PYEA 2H1YA 2P9EA 1VHFA 2PEBA 3E51A 2N82B 4PPZA 4ZJOA 1WACA 3CGIA 2E5IA 4O4GA 2JEGA 4PYDA 1GTEA 3DNCA 4OMFG 2HG4A 4QJVA 1RBLA 3D9BA 4EZ9A 3H5UA 1RTJA 2YQ3A 3W63A 5HAOA 1BE4A 3H40A 3SYZA 2GMLA 3QGHA 2EVZA 4MJKA 5HROA 2ZJPQ 3OSNA 1WI8A 2IFXA 2ILYA 3HVAA 4B3RF 2MLYA 4QQBA 3DI6A 1JLBA 5IOLA 3OL8A 4OYOA 4HEA9 5GMKa 1C0TB 4DV5F 3WDOA 2E7XA 2A6OA 4WU2A 2DIVA 1RAFB 2W9BB 4WYWA 3A8KA 4QZVB 1RT6B 4Y2CA 3VZHA 1K0VA 1TKTB 2YKMB 3W66A 3DM2B 1JLQA 4F2RA 1FFGB 1DQ8A 3PEJA 1WC3A 3EXCX 5K14A 3V4MA 2QSWA 4NA3A 4WTYA 2ZC3A 2PN6A 4CLZA 4YB5A 2XC9A 3EZ5A 4QYRA 1Y7PA 5KFKA 4F4ZA 4J91A 4TYAA 2YXLA 1RWNB 1P1TA 2MGZB 3I5AA 1WORA 2ZH2A 1NXIA 3TJ8A 3CO9A 1CJTA 1PJ5A 2Y1JA 3GSIA 4O0IA 2UXDJ 1TL3B 4X62J 4M5DB 4ANDA 5LSRA 2V0NA 2H51B 3PFEA 1F60B 2RIJA 1OQ6A 4A8XA 4K0KJ 4RLEA 3DLGA 2YH1A 3IBWA 3PR4A 1EKRA 4C11A 2R7RA 2CQCA 2RUSA 1JXVA 3OTCA 1TUVA 2MQQA 2H5JB 1FD2A 1HARA 2HMIA 2NPIA 5E3AA 4I2QB 3DLKA 2WSEC 3PO4A 2D3ZA 1IN0A 3EMTA 4WP8A 1Q7YT 5GADI 1EETA 3BF4A 3N9UC 3E2EA 4AYBD 1PYSB 3FCHA 4Z2XA 2GA7A 1MW7A 1X4FA 5ETQA 7FDRA 1CS4B 5IT9U 3GILA 2X1BA 3IO1A 4DV7J 4KHRA 4D3HA 1HNXF 4Z7CA 4ECWA 4Q43A 1Q82T 3SCJE 4Q8EA 1RT7A 3J7ZT 4WFNQ 2HFSA 4IR1A 5IT4A 3KDOA 3MCOA 3V6HA 3IBFB 2YQ0A 1RP5A 3FDSA 1Q16B 3EGVA 4CP5A 4B3OB 1VOMA 2QN6B 1MU2A 3BGFA 4RWXA 3AAWB 1NH7A 1T9TA 4DZ6A 1X31C 4UQGA 1N34J 2DH7A 4ED5A 2ZEJA 5AXNA 3DRPA 3N5BA 4A8SA 4X4SA 1KONA 1VQSA 2UXBJ 4GRSA 1WG1A 3QIPA 3P8BB 1N6QB 1WHWA 2QLFB 2YKNA 4ETXA 4KHPJ 5A6WA 4OJ1A 3FUYA 4WWSA 2ZH3A 5CHCB 1RT1B 4LR7A 4OHWA 2IMOA 3AD8C 2LYVA 3ITHA 5AE1A 5LMNJ 2HLUA 2VUGA 3JSYA 2CG4A 4I64A 4RNFA 2UU9J 3RRKA 3VR1A 2QE5A 4LIRA 2HVZA 3MD1A 4CT9A 1YJUA 2C3UA 4KGVB 3VGUA 3M8ZA 4PQUB 2JLGA 3KHGA 3NAHA 3SBMA 3R3TA 4J7CA 4WKRA 3G6ES 4ID5A 3DCAA 1IKVB 3MMBB 1D1UA 2HAIA 4HDHA 1KFDA 2WZ1A 1VQYA 4O4RA 2CJAA 2H5EA 4OLOA 2B9XA 5GAGU 2FVPA 1IBLJ 5HQ8A 4X4VA 4ZVPB 5JVGQ 3DGPB 3FSXA 4CLPA 3BYRA 4G1QA 3FQLA 1HBNA 1NH8A 3JSMB 4R0JA 5CXTA 2HQGA 2ZVSA 1GK8A 2EK6A 1N36F 2HQDA 2GHVC 2WOMB 3HSGA 4USJC 1IBMJ 3TZYA 1FF2A 2UUAJ 2C2MB 5EX3A 3TA0A 1QAIA 1UVJA 1S5ZA 2BYCA 4DX7A 1K1SA 2KXNB 1WHXA 4FNIA 5DG7A 4OHVA 2UUWA 2OPSB 3KXDA 2HQ3A 3ILJA 3OPKA 4G6VB 4NYZA 2FPHX 1YRTA 3W8PA 1K73T 3IS9B 4DF8A 1VQ5S 1VQOS 1M1HA 4F7VA 1CULA 1WI6A 4U8YA 2MXYA 2KG1A 1TKZA 2X51A 3GP9A 2R9LA 1IR2A 4DXLA 2XG8A 4Q0BA 3VAMA 2MKHA 2C1EB 2CQ0A 4LRCA 3CO0P 3M8RA 1Y00A 3I31A 1S59A 3OTEA 2M2BA 2B7CB 5GAEI 3R7NB 3J81U 3T6JA 4LF4F 1C4CA 1I94J 2AZ3A 1YJNS 1CJKB 2QMUB 4JP8A 2QT7A 1YVFA 3NGUA 2FHJA 1SH0A 3D68A 3NGTA 3JTNA 4J9LA 1WELA 3EXYA 2VG5B 4QU6A 2DXDA 2KVIA 2PT0A 4TLRA 2OUGA 3O2IA 1RHMB 1F6TA 3MMJA 4WFYA 2Y0BB 2EFVA 4QIGA 1UFLA 4DR1F 3CMES 1XN9A 1FRJA 4BHQA 2GFFA 2VOOA 3W9JA 1IBKJ 1HMVA 1H7WA 2HQFA 3JXOA 2XSFA 2IY5B 5KFBA 1S48A 3QATA 2NXNA 2DITA 4ECVA 4F36A 4YHHF 1AUSL 1RAOA 1IWGA 3PYFA 3K5MA 2ADCA 1SC6A 2MB0B 1J27A 2Y1LB 3E01B 1T9XA 3W2WB 5HVFA 3UQSA 1RI7A 4IG3A 4F0MA 1KQGB 1HNVB 4RL1A 3OL6A 4AL5A 6FDRA 1FKOB 1TL1A 5F8JA 2ZD1B 1HBUA 5HJXA 2R2UA 4RUHA 3DLEA 2LLZA 5KFEA 4CDIA 1RT2A 2QGFB 1RYSA 2YTCA 3N6MA 4ANCA 1OSCA 2WB4A 2D3UA 3OTOJ 3J81j 1VRUA 4U9RA 2K8GA 2G0CA 4RO0A 1EJ7L 5HLFA 5D6GA 2AGPA 3G4SS 2GGPA 3THTA 4NLUA 5L38A 3JSRA 1H98A 5D8HB 4U7UD 3CT9A 5EX0A 1VQNS 2F4VF 4M5KA 1KDNA 3N79A 1A0OB 4DN0A 4PG8A 3PW0A 3DXBA 3CCSS 2F5GA 1GH8A 1PJ7A 4Y6IA 2M8DB 2L3MA 1M5PC 3OXLA 2NSBA 1FRLA 1LXJA 3KYLA 2W2QP 1PBAA 1S0OA 1OY6A 4IG0B 3PTWA 1LW0A 1VQ4S 3RG6A 2Y3YA 4PG7A 3TNVA 4CQ1A 3C6TB 3Q8YA 4PYAA 1EAYC 2CQPA 3TW0A 1S0NA 4AUKA 4LF5F 4OI2A 4RX6A 1U6ZA 2GQCA 2FHJD 2XCPA 2C22A 5J1NA 4L72B 3IAS9 2C2KB 2QYCA 2E1RA 3OLBA 1K1QA 1SQEA 2IJFA 4PWUA 5KT6A 2HRUA 4ZDNA 1R8HA 3MEEA 4M5NA 4UT4A 5DLGA 2B6AA 2CAJA 3CJ8A 3CCTA 2W9CB 1HR0J 3ZC4A 3CDAA 4E98A 3TUPA 5I3QA 4IFYB 4I69A 1OPIA 3MAQA 2BDPA 2LXIA 4WZQA 3ZTPA 2K06A 3IG1B 3PX6A 4CO5A 4ENOA 3DMJA 4QBUA 1Q86T 3G6VA 3J7YI 3NNCA 2DRDA 2VPZB 5D0EA 5HJYA 2JC0A 5T41A 2FJBB 3KJFB 4ZN3A 2QYGA 1G1XA 3KLEA 5KFLA 1XC9A 4N76A 2HFUA 1R43A 3MCNA 4G3IA 4QR1A 4OI4A 4ZCLA 4IDKB 2GAHC 3HVTA 4EEYA 4TLQA 4ANEA 1KOOA 3VWSA 3DRSA 4K7QA 1RLCL 2IYIA 5A8WA 4ATNA 4CLKA 3G71S 1PO6A 1YZ6A 4QIWD 3W2VB 2OSQA 1OO0B 4JI0F 1KRPA 2CPIA 4FYYB 4P2XA 1RADB 3HHLC 3DC2A 2B3TB 2HQIA 1S4EA 2C3OA 1S6QA 5KFUA 5IT0A 2YPZA 1O0PA 4ZPVR 4NEZA 4KFBB 3FGVA 3IRXA 3N01A 1EP4B 2MTLA 2VQEF 3RAXA 2MHEA 4F4AA 2EEYA 1F5AA 2BE2A 5IM0A 1K8AT 4FPRA 3EZOA 1V5VA 4JUZA 2JEIA 4O44A 1DRZA 2DNPA 2HHSA 1TP7A 4DQIA 1UWBB 5KTQA 1GTHA 2ZZMA 2BZ2A 2R7WA 1RK8A 4DR1J 1UZDA 2VFTA 3WX4A 3UD4P 2I38A 4V19X 2UXCF 3FZ2A 1VLOA 2I2YA 1KHVA 2FD2A 2ZH9A 2QLBB 3GMGA 3Q8SB 1UAWA 4JV5F 1WDDA 2JHEA 4OQJA 2U2FA 5GMEA 3NBPA 1PC4A 3ZXWA 1HFEL 2JJ4D 3N6LA 4IH6A 3C6UB 2YX1A 5LJ5Y 3D67A 4KC5A 5J1EB 3OFGA 2OPQB 1T3NA 3CIZA 5AE3A 1JWWA 5LOQA 4B9VA 4CO4A 3KK1B 1RAJA 2VJVA 1YI2S 2VA2A 2YWHA 5J2MA 4ECUA 2MZQA 4ZIWA 3BSCA 5ETOA 4BWJA 3EYZA 2C2NA 4J9VA 3QGPA 2H9ZA 2WW4A 3ET6A 4KRWA 4USTA 4QYZJ 5EDWA 4NL5A 3FFIA 4A8WA 1CPZA 1B7FA 3G6YA 1FA0A 2PMHA 4DUYF 1X8DA 5H1SV 4X65F 4OZ1A 1KC8T 2F1FA 1HQ2A 1UW9A 4EO6A 3QIDA 2N3LA 4GO7X 4GVBA 4XPEA 5GAHI 1YJVA 3NP5A 1ZA1B 3IN5A 2KN4A 2QA1A 4B9NA 3GJQB 5D3GA 2DHAA 3CVKA 4XAKA 2RDJA 3D1QA 4DQSA 3KLFA 1RHQB 2HQCA 2L9NA 1SBRA 1XMBA 1AFJA 3H0PA 1JB0C 5CYMA 3CJTA 1ZM3A 5D4PA 3ZNJ1 1XMOF 4YDXA 1I5OB 2V8HA 2FVSA 1GNKA 3W61A 2ZOFA 4OI0A 4DUZF 4NLGA 4UW2A 1SV5B 4LF5J 2FUG9 3MR3A 2VBZA 3OT9A 2N4DA 3IR7B 1W2BR 2CPJA 1AUDA 4M5JA 3TYTA 3DN9A 2CVEA 2XMAA 1G6BA 1TKXA 2XWXA 1KKHA 2RRAA 4D3GA 2R8KA 2LXFA 4L75A 4JB8B 2AKWB 2DRBA 5IQQA 2HHUA 4M5IA 1VQKS 4DN9A 5HANA 2DHSA 1U2RA 2DNKA 1L3UA 4F67A 5JMNA 2CPFA 2UV8G 3ADAC 1WF0A 1PBUA 1BQNA 2W4CA 3PIOQ 1U45A 1T8EA 1SQGA 3PX4A 3V81A 1TVRA 2BBEA 4CT8A 4RUAA 2JFDA 3IP0A 4PXDA 3M2VB 3TWZA 3PZPA 4RW8B 2BMBA 2WONB 1UETA 2F9DA 4DPTA 4KH0B 3MI7X 4RW6B 3WC2A 3NWRA 2YWGA 3NS7B 4N77A 2ZM6J 1NJWA 1MROB 3M2UA 3G82A 3HHEA 5DO2A 2MKJA 3BQ2A 2B51A 1XQIA 3AA8A 3POTA 1FVQA 2GVZA 3OD2A 4ZJQA 4DR6J 3OQ2A 4ILRA 4MAKA 2V6AA 4OX7A 4MIWA 5LXYA 1YJ9S 5M2PA 1RCXB 3WX8A 4USUA 3T5KA 3V4IB 1U2CA 3QMQA 2XWYA 2DRAA 4QIVA 3DRXA 2HBZB 1HBMA 1ZAWA 3DYAA 2WVBA 2RHQB 2W1BA 3B54A 2EKYA 3LA0A 3TZZA 1R27B 4WFBQ 4JI0J 3LP1A 4W98A 1KOHA 4TNOA 1HQEB 1NSAA 4O3QA 3EPGA 1NAQA 3ETOA 2MZSA 2UUBJ 3Q0AA 4JYAJ 1NJXA 1FWLA 3QPIA 4EYHB 4WXWA 4H4KA 2YKQA 1NDLA 3G8TA 4ZCKA 3UD5A 4EWTA 1PILA 1YJ7A 2VOPA 3B8HA 3RJMB 4E2FB 5KFOA 4ZK7M 5IZHA 3OHBA 1XR7A 4RKUC 2W2NP 5KG1A 3HX9A 4QWAA 1YBAA 2K1RB 2L08A 2RKIA 3R7SB 3HFVA 4DX6A 2LQ5A 3KFWX 5DM6Q 5KG3A 4DQRA 2DISA 1VC6A 5CYQB 3KG0A 5L9XA 4ZPCA 3US5A 1UVNA 3CDUA 4GC6A 2MLZA 4PG5A 4DLEA 2IVFB 1C1BA 3WZ0A 2ZOGA 1NB2A 3HT0A 3RRHA 2ZC4A 1RLDA 5LSLA 2OTJS 3VCDA 3SSQA 4GVLA 4A8YA 2GMJA 4N8NA 4LF6J 3CJ0A 3UE2A 1FDAA 1WTBA 3J7A1 3U1NA 3BKUA 3TAMA 1OY8A 1HHTP 3H4DA 4ZS6A 4NA2A 3NWGA 3VAHA 2HZCA 2IC3A 3JQKA 4YN3B 1KVJA 4CI0B 1R8PA 3DOKB 3CSKA 2DNNA 3CJQA 3CJKA 4DX8H 2E5GA 3TX0A 3HDSA 1JLCA 2FYXA 1Q8BA 4NZ7A 3EUNA 2XHWA 4JI5J 1LFWA 3W9HA 4FKYA 4CO3A 2EK1A 1FKPB 5ETMA 5KG6A 5C2GA 2IM3A 1SL0A 4KE5A 2XI2A 2RB7A 4URQU 3BBBA 4F0HA 3BGRB 4LFBF 1R0AA 2W8LA 3R97A 3IM8A 4YY3J 3HMJG 1WD6A 2ALZA 2CNOB 4M63A 2B5JA 1BMQB 3IGVA 3OVSA 1VQMS 2ZZNA 3CIMA 2AJ2A 4UOFA 3MECB 3A4TA 4EZ6A 1S9GB 1SKWA 4HT5A 3BSOA 4FF3A 1KSPA 2ZH6A 4PRFA 2PMWA 2R7XA 3ZTOA 2B4VA 4NCGB 4LBHA 2VZ9A 1YQHA 2ZHOA 4C2MA 3NNHA 3TVZA 4DL3A 3D54A 1BUXA 3ZZTA 1SKUB 5E3CA 5EGYA 1CQMA 2G0IA 3RAQA 2K7KA 1JLGA 3E3XA 4LF7F 2H4WB 2OI2A 4MKYA 5JUMA 1JLAA 2OPRB 1Y5IB 1S6PB 2FC8A 4LBIA 3C15B 1DQ9A 1CLFA 4WFZA 3EVWA 2V8VA 1RTDA 1VLYA 3FJ2A 3M30B 1FJGF 2KZMA 4LVNP 2V2VA 3R6LB 2QLJB 1JKHA 2A3JA 2W8KA 4C8LA 1GFWB 3CC2S 1NK8A 4YB7A 2B4PA 4KV8A 4P52A 2LU2A 4YP3A 4ID8A 3H98A 4HTIA 5SUHA 4JBCA 2BJ8A 2DH9A 3M2RA 4QU7A 4ZA1A 2KRRA 3I0SB 1RACB 3CMAS 4PWDB 4B3MF 2V9KA 2ZNZA 4ECQA 1LQ9A 4K4XA 1YTYA 1LWEB 3N28A 1S1TB 1ZAXA 1XBWA 5IV3A 2XLJA 3MEDB 2DNGA 3R5GA 1N33F 2NZCA 2DNOA 4R5PB 1T11A 3MMCA 2E66A 4DR5J 3T1HJ 2UV8A 4DR3F 1BWEA 4N5SA 4LFCF 4FZVA 4Q5VA 4C7QA 5C5JA 4TKTA 2A1BA 2HK3A 4F3OA 2YNIB 3IFEA 2CDQA 3N0VA 4LRAA 3X3UA 5B7WA 2LDYA 5F9NA 5LMUF 2I8EA 1Z2LA 1M5KC 1MMLA 3F44A 1N48A 3IM9A 3DOLB 2R7UA 2ZUGA 2CPXA 4YMEA 1ZS6A 3C14A 3VVTA 3VAKA 2GVDB 4M94A 4G65A 4HH1A 2V8GA 2BJ1A 4IFVA 2EG1A 2EG2A 4WF9Q 3TZWA 3M4XA 2HBQB 3K2YA 3I9V9 2VG6B 1I6JA 2EWHA 2DXEA 2ZDPA 1X5PA 4UZCA 1NBEB 3KJNB 2BR0A 1FFWB 4JOUA 4JI3F 4OV1A 1VQ9S 2V4RA 1Y9OA 3RBXA 1F9FA 3BO3A 4HI2A 3SQOP 1P8GA 4F26A 1B0VA 1KLMA 3D6FB 3JAMU 4J5OA 2LQBA 5D78A 5FDLB 1RWVB 4X4UA 1RDRA 3O8WA 4JI2J 1BWVA 4AQYJ 2DR5A 3D66A 1FVSA 3J81Y 1ULRA 3MM7A 4LT6A 3KK2B 1AA1B 1RAEB 1K0TA 2EFNA 2MY8A 3SI8A 3LP0A 1WKKA 4ECTA 2W24A 4Y00A 4OHXA 2BW2A 5JJBA 4OHYA 2GO9A 5A8RB 4QYZK 1RTHB 4WFAQ 3BO2A 3MXHP 2ZBPA 1R89A 1BQMA 2O1PA 3V6DB 1H3DA 3KLHA 3ETMA 2E5LF 1XERA 2AW0A 4TVAB 1Y3JA 2KM8B 1TR0A 2OP5A 4Q45A 2CPYA 2R2RA 2CQ3A 3ZZOA 2IYGA 3UI3A 3GPAA 4I68A 1VC0A 4RU9A 3JQJA 2ZE2A 1S72S 2JFKA 5EN1A 4OYAA 3KLGB 3I0RB 4I4BA 2J0QD 2VIHA 1QD1A 1JLQB 4ZVSB 1D3WA 2ABYA 4F0KA 3IXQA 2DKOB 4P74A 2J7KA 3QO9A 4L76A 5KFCA 1S0VA 4ED2A 2KJWA 3HCXA 2D3O1 1HI0P 4ZPAA 1VIOA 2HNDB 2QX0A 4C0BA 5B0EA 2EI5A 2DB1A 3LOUA 1FDBA 1OPZA 1IKYA 1J5OA 1CJTB 1HL6A 2B4OA 2YBVA 2BKPA 1QE1B 2CG8A 3D7SB 5E7OB 3T1AA 1TK8A 3JYTA 4NOHA 3NEKA 3L3CA 2QC3A 3H42A 1QAXA 2WB1D 3DDIA 4UY8T 1LWCA 1F2GA 4B3TF 2A2DA 2VC0A 2GNKA 1DTQB 3VTIA 1RWKB 3DLKB 1ICEB 1SC1B 2AF6A 1PYOB 4BLGA 2GHPA 3ZZZA 1XNQF 1J5EJ 4B9UA 4GKJF 2Q6BA 2DGVA 4ILLA 4KR0B 2DBBA 4LRBA 4EBCA 2C2DA 3P6YC 3TARA 2CWKA 4L74A 5IC6B 3ELHA 4DG1B 2WHOA 1NK6A 5SZTA 2DR7A 3BB5A 4LF8J 1LWXA 4DCOB 2XSJB 2E9ZA 1C0TA 2B8PA 1I1GA 4M5MA 2CKWA 2VPWB 5B0FA 2MQOA 1Y4ZB 3B4DA 2W9BA 4OYWA 1T05B 1RT6A 3MUMP 1TKTA 2YKMA 1NUEA 3CCQS 3DM2A 4DF4A 2HFNA 1N32F 1T0TV 4I6AA 1IKXB 2BJEA 1QY7A 1YG0A 4X4RA 1XNRF 1N5TA 2ROPA 2PO4A 1L3SA 3SIPB 1TFWA 4A48A 2OAUA 1RYRA 4MK8A 1KR4A 2HFZA 3SXLA 2L9DA 1K47A 3QIPB 1YBUA 4DL4A 2MHNA 2E1AA 2E5HA 4XIUA 4LF1A 2OHDA 1WC5A 3LF0A 4OYPA 1ZM9A 1TL3A 1DARA 4C8NA 5JVHQ 4ILMA 4M5DA 1YJTA 2BM0A 1DJ0A 1HHSA 2F7VA 5D15A 2J0WA 2RDIA 4PKDB 2HWHA 2V4JB 5FD1A 4M8LA 4GC7A 1FD8A 5HATA 4ED4A 5BYSA 3CCUS 1SUQB 1PGZA 4I2QA 1HBOB 1WDTA 2V69A 2M88A 2BQRA 1S1XB 4XDDA 1R8CA 4Q2MA 1WG5A 4UQTA 5BR8F 2FJAB 1RISA 2XO6A 2W7AA 3R1LA 3SEOA 3KWMA 2CJQA 4DV3F 4X66F 2KT3A 1VRQC 1H7XA 4XTTA 1MWQA 1CS4A 4NI2B 4ZP8A 2E9RX 1TMJA 3MOJB 1RT5B 4RNNA 2V63A 3NG8A 4EBEA 2J6SA 3EX7B 3HLUA 1X4DA 2XS2A 1KTVA 3H2LA 3T6BA 4Q2LA 4Y28C 4ZP7A 1R0CB 4NLPA 5HMYA 2GS8A 4DFMA 2IJRA 3OJUA 1G4CA 5KFPA 1C1CB 5D0GA 4F4XA 1WNEA 2FJWA 4B3OA 1JMTA 1HBNB 3P5BP 5ETRA 3PJ9A 3R27A 5IFMA 2R7OA 5LJ3Y 2XYHB 3J80U 2ROEA 2C3PA 1F5BA 3GSDA 3KTQA 4J9SA 2BOPA 3AA9A 1IKWB 2GZOA 2DNYA 2LA6A 2ZUAA 4Y0FA 2Y1RI 1VBZA 4MH8A 1U4BA 1QTNB 1RWWB 2MJNA 2O5DA 3EICA 1X0PA 4K4TA 4F4YA 1UFWA 3RBZA 2HHHJ 4MKVA 1N6QA 2DO4A 4LR9A 4F04B 5F8MA 1ZAVA 4KT0C 1TL5A 3QYYA 4DV2F 2NREA 1VK3A 4ZVFA 4FS1A 2IA0A 1HPZB 3DU5A 4ZN1A 2SXLA 1RT1A 2W2MP 2F8EX 2X7IA 4UOGA 2JH3A 2OSRA 3GFYA 3ZZYA 2VASA 2YNHB 3S6EA 1UW4A 5B09A 1JX4A 1VC5A 2WAQD 5F8IA 4NMXA 2M9KA 2OEKA 3GCWP 4JI7F 3LAKA 1YITS 2JC1A 4HL9A 4KGXB 3FCWA 3KJVB 1KQKA 4PQUA 1SC3B 3HHKA 2CQBA 2ASYA 4TY8B 5DDRC 4H54A 4WIQA 2QEXS 4CLTA 3R9LA 1IKVA 4ZP9A 3MMBA 2RE1A 3ZFVA 3MUVP 3CCJS 4JV1A 4CH0S 4JI1J 1TQLA 4DHVA 1Q81T 2CJ9A 4DL2A 1FNMA 2Z2ZA 4KSEB 4O3PA 3D0GE 3BR9A 3OTBA 4BWMA 4ZVRB 3LPEA 3OV7A 1AB8A 1QDUB 3W9IA 1UP1A 3ZTRA 2VQFF 5HMXA 1RHKB 3HO1A 4FVCA 3JSMA 4F4WA 3M6XA 1HI1A 3D3BJ 3ILIA 1F3FA 3BBFA 2G1DA 1A7GE 4FBTA 3HHDA 3D0IE 2ZJRQ 1VJWA 4NYOA 2ZH1A 4JI4J 3EGZA 5KFWA 2HHTA 3DLLQ 1SJ1A 4I67A 2I1RA 2OPPB 2Z30B 3NRBA 4OI3A 2XZDB 2QSFA 1RHUB 2OPSA 1IBCB 1JJCB 2GIFA 5AXLA 4W4MA 2BANA 4IG3B 2QO3A 3NNAA 4JV0A 3DDKA 1S9FA 5CZVA 1IWAA 3I87A 4LMZA 3EZUA 2OO4A 2WBRA 3MM8B 2PEHA 4WBFA 3OUYB 2MZTA 4PABA 2UXDF 4RW9B 4X62F 2CQHA 1EQ0A 3CJ2A 1UA0A 1LWFB 1HBUB 3I5BA 4YR0A 1SKRA 1HNWJ 4K0KF 4DV6F 4BS2A 2JLEA 3PG9A 1RT2B 5L9NA 1XIQA 5GADU 1U1MA 1H38A 2VDIA 5T7LA 3TO8A 1T7PA 2ALYB 3R2CJ 4CYUB 2XY7A 2CRLA 2AHOB 1CJKA 1NNDA 1KHWA 3AODA 5D0HA 1AYEA 5IV4A 3OVBA 2J8AA 3SSRA 2VG5A 3SSSA 3TVKA 4BCAA 5DRKA 2OIHA 3DLJA 5K8MA 4DV7F 3PHEA 3AOBA 4P7VA 1VFJA 4NLVA 3H8YA 2XMMA 2D9PA 1VQ8S 1JNZB 3CCLS 2R3VA 1RHRB 1EB0A 1TUGB 3BKFA 3AXKA 5J2QA 1H74A 4DSIA 5ETSA 1NKCA 2G2OA 2P9CA 2WK4A 3TZXA 2DGTA 2EFPA 1D8YA 2MKSA 1B64A 4YR3A 4DI6A 5HQLA 1ZTWA 1FWPA 2QG9B 3TUJC 3ZZ0A 4DL6A 1RWOB 4F02A 4AD6A 4CNZA 1N34F 1F5CA 2DNQA 4DR7J 2AJ1A 3PIPQ 1WC0A 1KP6A 3TRGA 1XWLA 2HAFA 2UXBF 2P6TA 2B6AB 5F8LA 5HSPA 4X4QA 1HNVA 1FKOA 3EPIA 2ILZA 3VF0B 3RR8A 4KHPF 4DPUA 2F40A 3I56S 2CYYA 4IOAQ 4DSLA 1SCJB 2B7BB 2ZD1A 3UVJB 2KT5A 3KLIB 1RU1A 2LQJA 3KOAA 2DR6A 5HP1A 1Y0HA 1NJIT 1UPMB 3MM9B 3S7RA 4C0OC 1QAJA 3ISNC 3SQGB 2HBRB 2DY1A 3BSNA 5LMNF 1E6VA 1GXTA 5C7PA 5KT5A 2AX1A 2E7VA 5F8NA 1O6XA 4TQRA 3RZAA 2UU9F 2P8IA 2FIUA 3H5XA 3A12A 4LVOP 4OX9J 4ZMMA 3R1HA 1RTIB 4HHHA 3JSBA 3KLEB 2GMHA 4AE5A 5K9FA 5FJ4A 1WUUA 4TY9A 1PAUB 4IYQA 1LOUA 1YSJA 3AB2B 4IOCQ 3A8EA 2DNZA 2MQ8A 1N54B 2AJQA 4M5LA 1UVKA 2LDIA 4X4NA 2J9EA 3MMAA 3DRSB 3RB0A 1TZ0A 2E1PA 1FE4A 2XZTB 4UOCA 1NJYA 1T03B 4IG0A 1S1VB 2CA9A 5E33A 1IBLF 3KUEA 5DDPC 4WP3A 1IJFB 3C6TA 1CJUB 2NXJA 2MKKA 1FTRA 1NDKA 4A8MP 2HS4A 5DG8A 3RAMA 1VRTA 4X4TA 5EWEA 5HL7Q 4RNHA 1IBMF 3FSIA 5I3UB 2UUAF 3PACA 3AJ1A 1H2UX 2J9CA 3SV4A 3UNYA 3FNNA 3JQMA 1S6QB 1QAYA 2RSQA 4IQXA 2NXUA 4OYBA 3HSDA 2XEXA 3ZTQA 2DT9A 2HFVA 1WSRA 3FBCA 1WC4A 2RT3A 4MYUA 5CD4H 2W9CA 2H5IB 1VYAA 2CQ4A 2CIMA 3VZIA 2MQMA 2AMCB 4LR8A 5D77A 4IFYA 3J7AN 4KPYA 4V1Ak 1LEOA 1NK7A 4B3SJ 4Z37A 2MKYA 5GAEU 2BE9B 5KFSA 3IG1A 4HLBA 4PG6A 1S6UA 1U26A 3TAQA 3G96A 2VQFJ 3FRYA 2ZOMA 2IVMA 2QMWA 1TV6B 4RBVA 1ZZFA 2ZBQA 2HFOA 5DJBA 2DNRA 1I94F 4I7FB 3B82A 5L1LA 4NXNJ 5DQHA 3NAIA 3FC9A 1VHIA 3M8PB 2DCUB 4IDKA 2ATLA 1KN6A 4OI6A 1Y5NB 4FS2A 2E7WA 5BJRA 3CDWA 2C2EA 2GW8A 2QL5B 1H0HB 2X3DA 1ZETA 3HT3A 1W25A 1TAQA 2X1FA 3W2VA 2XMKA 3O6QA 3GIMA 3AQOA 4FBUA 1IBKF 2Q3PA 4DV6J 2UVUA 1Q53A 1UEVA 3AY0A 2LXUA 1NZ8A 4CO0A 1FWKA 4PUOA 1NMEB 2ZKTA 4KGZB 4A4JA 2O67A 1UVMA 1HHQA 3I6PA 1AXQA 4DCJB 1LW2B 3HULA 1NDPA 4KFBA 4IH5A 1RBAA 2FHKA 4RJVA 2XM3A 4M5HA 4H4MB 1EP4A 2CJKA 2CPDA 3OL9A 4NEYA 2GCFA 3H5SA 4PXCA 2V9WA 1K9MT 4UUWA 1TTHB 3EDQB 4E8UA 2J76E 1UWBA 1U1PA 2RRBA 3HD1A 4QPTA 4NXMJ 3A1YG 2MYFA 4ZCMA 3M8QB 3FRZA 3M8YA 1R31A 2FLLA 3DKDA 2DNLA 3F73A 2BABA 2DHXA 3U1LA 2MPUA 5C42A 4AL7A 2W4PA 3M6WA 3OTOF 1UVIA 4A8FA 2DR9A 5ETLA 3C6UA 2B9EA 5LT5A 4J9RA 1QSYA 4OL8A 5J1EA 4B9LA 2V8DA 2BUNA 5H9EJ 2OPQA 6FD1A 2VG7B 3GYGA 1U6FA 2VBYA 2IDEA 3KK1A 2DGUA 3TUZC 4RBTA 1JK9B 2NQPA 3M6VA 4FN5A 3K17A 3U1MA 2HURA 1U24A 3RGIA 1HWUA 1IJEB 4AT1B 3PEHA 1S1WB 1FX2A 3ENAA 3SCKE 5KT2A 4RW7B 1T9VA 2U1AA 1JJ2R 2RNEA 5A6PA 2YQ1A 1TVRB 1V3ZA 2I6WA 2R8HA
chains in the Genus database with same CATH topology
4DSJA 2HS3A 1FRXA 2FLPA 2EC0A 3KKFA 1FXDA 3RRHA 1T03A 2ZC4A 1SJQA 3QWPA 5LSLA 1URNA 2IBOA 2YNGB 1S1VA 2F8HA 2CQDA 3S8SA 3VCDA 2OTJS 3SSQA 1BC6A 4A46A 4A8YA 2GMJA 4N8NA 4K2XA 2ZHBA 2JVOA 3O1LA 4PXBA 2I5JB 3CJ0A 1WWHA 3UE2A 1FDAA 1B0PA 1WTBA 1TKDA 3J7A1 2VD3A 3U1NA 3PNIA 4YB1P 5KOWA 3TAMA 1VS3A 2JOQA 2JSXA 2JL9A 1HHTP 1Y5LB 3M2UB 3H4DA 5K5MA 4ZS6A 3DLGB 4NA2A 4A47A 2XB2D 2N7YA 2NZ4A 3NWGA 5T14A 1N0VC 3VAHA 2HZCA 3QJPA 1P6TA 2IC3A 2NS1B 3I4PA 3T5HA 2G4BA 1KVJA 4PUOB 2RILA 5I3UA 5E3PA 1N5VA 4C11B 4CI0B 1R8PA 5I42B 2KXHA 1O8BA 2B43A 3CSKA 3DOKB 2DNNA 3C3LA 4JI4F 2KRBA 3CJKA 1JXEA 4DX8H 1X4AA 1XMQF 3I96A 3HPOA 2E5GA 3LP2B 1HQUA 1FT8A 1KLMB 4QW8A 4Y3CA 2HMIB 5KFFA 2DGSA 3HDSA 1JLCA 1HR0F 4ZVEA 2KXFA 4USHA 1SJ4P 4CZCA 1Q8BA 1SIWB 4NZ7A 2ADBA 2Q1LA 3EUNA 2XHWA 5U47A 1DURA 1Z2ZA 2VC1A 1LFWA 3RBEA 1G2EA 1R8AA 1MWYA 4CO3A 1NK9A 2EK1A 1EETB 1FKPB 2Z2MA 2MKIA 1HD1A 1IQZA 1OWXA 3R5AA 3IGNA 3I0SA 1QJHA 5F41A 1Z1ZA 3J7YU 5KFMA 1JLFB 4DV1F 3KLVA 3MM7B 4I1TA 5KG6A 1S76D 2UVRA 3MM6A 5D4LA 2IM3A 5KFZA 4F8RA 2J5AA 4CNYA 1SL0A 4KKOA 2FJDB 4HI1A 1RGVA 2XS5A 3C8YA 4F4KA 1S4FA 3NCRA 4KE5A 1NHUA 3L7OA 2XI2A 1S1TA 2RB7A 3GYNA 3ULHA 5L1KA 4URQU 2GIQA 3LP0B 3V5RA 2DCLA 5F8HA 4DS5A 4DR2F 1DQAA 1SV5A 4LSLB 3TAPA 3BGRB 2AP6A 5KFVA 4BC7A 4LFBF 3NGKA 2LU1A 1UJ4A 3DHWC 1R0AA 4QOTA 2EFOA 1U1NA 2W8LA 2DNHA 2IRYA 2QRRA 1Q1KA 2IHR1 1RT7B 3DRYA 3DRRB 3DLHA 3HMJG 1HNWF 1WD6A 2ALZA 2YNFA 4DEZA 4WXOA 4F3MA 3N6NA 1OIAA 4M63A 2B5JA 3IGVA 3OVSA 4DQPA 2PI4A 1TAUA 2YX7A 4NCAA 1VQMS 3Q8RB 2BQUA 2ZZNA 4HDGA 1W2IA 3P5TL 2ZNYA 4MKBA 5F8GA 3CIMA 1Q4RA 2KJVA 2IVYA 1BQMB 2JWNA 2AQ4A 3MECB 2UUTA 4EZ6A 2KYXA 1U1OA 1S9GB 1SKWA 3LWMA 1TV6A 4HT5A 5C42B 2FHMA 1Q8LA 1YWXA 5A2QY 1GAOA 1NEEA 3BSOA 1SKSA 1SIZA 2MZ1A 3DXSX 3TA1A 4ECYA 1SL2A 4FF3A 4DMZA 1RKJA 4ED7A 5F3ZA 4OZLA 2EBEA 4I7FA 2FJXA 1KSPA 1ZM4A 2ZH6A 1MU2B 2GO8A 3QJJA 4PRFA 3MDFA 2R7XA 1XEZA 2A18A 2B4VA 3LO3A 2A10A 3BZQA 3MR5A 3CE8A 5I3PA 4NCGB 4I6YA 2VZ9A 1YQHA 3M8PA 2MQLA 2KHDA 1SJFA 2ZHOA 1YIJS 4FF1A 4C2MA 5DDQC 2ZE2B 4OZ0A 2HS0A 3NNHA 5FLXY 1APSA 3TVZA 1T02A 4DL3A 3GB0A 3D54A 2CJBA 2VV5A 2MZJA 5G4DA 4I2PA 3ZZTA 3DRPB 5KG2A 5E3CA 1FNOA 2D9OA 4P6QA 5EGYA 4K4ZA 5KFIA 4NX9A 2LVWA 1CQMA 2MGZA 3MR6A 3RAQA 2K7KA 1QSLA 3OJSA 4QWEA 4PQAA 3QLHA 5DETA 1JLGA 4RW4A 3GE9A 3D0HE 3M2VA 3E3XA 2M52A 3K5NA 4B9SA 3OFEA 4LF7F 4RW8A 2YKNB 2XULA 3FEXB 4AXIA 2KG0A 4MKYA 5DS7A 4TU7A 5JUMA 3CD6S 1Z4UA 1JLAA 2OPRB 4NLOA 1Y5IB 3UCGA 1S6PB 2FC8A 4C8ZA 3QO9B 5IWAF 3PX0A 1ZBTA 2G9OA 1DQ9A 5E0OA 3FMBA 2C2RA 1CLFA 2MDAA 4WFZA 1DZ5A 1ZH5A 2V8VA 2JZ5A 1RTDA 1VLYA 1MROA 3FJ2A 2GJIA 2GV1A 3M30B 4N8OA 1FJGF 1KS2A 4B9TA 4F25A 2KZMA 3HHLD 4LVNP 3QGGA 4J9OA 2DPIA 2D41A 2A2CA 2BXJA 4P2SA 4QIFA 3NMRA 3ITHB 1JKHA 2A3JA 2EFQA 3NLCA 2RU9A 4ELTA 3QAEA 4PR6A 1J5OB 2BQ3A 1KFSA 2W8KA 4H4OA 4JV2A 3AH6A 4C8LA 2KHCA 4NLTA 3CDEA 3N4WA 1VK8A 1FDNA 4RNOA 1ZTTA 4F3QA 3CC2S 3HXMA 1LW2A 4NMLA 4CTAA 2Z4PA 2APOA 3TAMB 1NKEA 1NK8A 1DTTB 4NLXA 4YB7A 2AYMA 2B4PA 4KV8A 1S0MA 4A8OA 4C0HA 2FC9A 2PGCA 4H4MA 2FDNA 4USIA 2LU2A 5D4OA 4O3RA 1LWCB 3QAUA 4YP3A 4DR7F 3UFCX 2XMUA 3P96A 3R5BA 4ID8A 4IQMA 3B4MA 4ID5B 2Z8QA 3H98A 3LANA 1C4AA 3LW5C 3V4IA 2RRNA 2P9EA 4HTIA 2FVCA 1VHFA 3E51A 2N82B 4PPZA 4QW9A 5SUHA 1U49A 1OQ3A 1WACA 3D2WA 4JBCA 1HQUB 3CGIA 4C3KA 2R7QA 2E5IA 4O4GA 2JEGA 1GTEA 2PA8D 3DNCA 4OMFG 3M05A 3BREA 4WU3A 2DH9A 2HG4A 4O23A 3M2RA 4QJVA 4YOEA 2Y0SD 3HZEA 4QU7A 2LA4A 2R4FA 4ZA1A 4EZ9A 5KOXA 1NKBA 4YDDB 2KRRA 2CPZA 3H5UA 4Y2AA 2D7SA 3I0SB 1RTJA 3HM9A 3CMAS 2YQ3A 4PWDB 3FMWA 2IM1A 2GC8A 3M8QA 4B3MF 2V9KA 2ZNZA 4ECQA 1LQ9A 1U09A 3H40A 2CQ1A 4K4XA 3SYZA 1LWEB 4U6PA 1YTYA 2GMLA 5B0GA 3QGHA 1JXLA 5D4NA 3ZZRA 3CPWR 3N28A 4Y2MA 1FRIA 1S1TB 1X9SA 3BR8A 1ZAXA 1XBWA 2XLJA 2EVZA 4MJKA 1NU4A 3MEDB 3HZGA 2ZJPQ 5HROA 2DNGA 3OSNA 5J2NB 4MK9A 1WI8A 2YX4A 5GVQA 2IFXA 2ILYA 3DU6A 2GJ2A 3HVAA 4J37A 4B3RF 1N33F 4G1QB 1H2VZ 3UR0A 4EGLA 2DNOA 4R5PB 4QQBA 3MMCA 3CUNA 3DI6A 2E66A 2I0XA 4OJ3A 1VQLS 1JLBA 1HWLA 2UV8A 3OL8A 2JX2A 4DR3F 3CCES 4HEA9 5GMKa 3GV8B 1C0TB 4KB7A 4OX9F 1BWEA 3BDEA 4N5SA 4DV5F 3WDOA 2E7XA 3J7Z5 4DL5A 4NLYA 4FZVA 3MWBA 4LFCF 4DL7A 3G8SA 4Q5VA 3PJXA 4C7QA 5C5JA 2VG7A 4TKTA 3KHHA 2A1BA 4WU2A 2DIVA 4F3OA 2B0GA 3CCMS 2YNIB 1KNZA 3IFEA 2W9BB 2CDQA 2CQGA 4WYWA 3N0VA 4HHJA 4QZVB 1RT6B 4N41A 2IAJA 4Y2CA 3PRBA 3VZHA 4DL0C 3X3UA 1K0VA 1TKTB 5B7WA 2YKMB 2LDYA 5F9NA 5LMUF 2I8EA 2B9YA 2K1RA 2NUUG 1CVJA 3DM2B 1Z2LA 1JLQA 4F2RA 1O51A 1MMLA 1M5KC 1DQ8A 3PEJA 3F44A 1N48A 1RQ0A 5JXSA 3EXCX 4TYBA 2DO0A 5K14A 2E1CA 3V4MA 3DOLB 2QSWA 4NA3A 4WE1A 4WTYA 2ZC3A 3VAIA 1VBXA 2R7UA 2PN6A 3CWJA 2ZUGA 2AJ4A 5KFNA 2CPXA 2V5HG 1B0TA 4YB5A 4YMEA 1QM9A 1FTCA