2CPYA

Solution structure of rna binding domain 3 in rna binding motif protein 12
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
114
structure length
114
Chain Sequence
GSSGSSGEGDVNSAKVCAHITNIPFSITKMDVLQFLEGIPVDENAVHVLVDNNGQGLGQALVQFKNEDDARKSERLHRKKLNGREAFVHVVTLEDMREIEKNPPAQGKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA-binding protein 12
publication title solution structure of RNA binding domain 3 in RNA binding motif protein 12
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 15
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2cpyA01
2GHPA 3N9UC 1K8AT 4J5OA 1U1QA 4PR6A 1SJ3P 1FHTA 3J7YU 1R8HA 1WEYA 3CULA 3RW6A 2RNEA 3OW2R 2CQ2A 2KT5A 3ZZZA 2OTJS 1QVGR 1KC8T 2OJ3A 2VOPA 3ZZYA 1S79A 2DH8A 2AYGA 1ZZFA 3LQVA 3CC7S 2M52A 1VQ4S 2RUGA 3G8SA 1A7GE 1WWHA 2PE8A 4TU8A 1UW4A 4A8XA 2HGLA 4WFNQ 1XN9A 1NO8A 2CQ3A 1Q7YT 1K73T 2D9OA 1KOOA 2BOPA 2XNRA 2YH1A 2FC8A 1FO1A 1U1LA 3DLLQ 1G2EA 2RQCA 2LXIA 2MHNA 1SXLA 2E5JA 1WG5A 2MQNA 2MKCA 2VODA 5JVHQ 1JMTA 2EVZA 1DHMA 2CQBA 2ADCA 5GAGU 2D9PA 2J8AA 2DNMA 1M1KT 2F9DA 4YUDA 4F25A 3V4MA 3G4SS 1WHWA 3UCUP 3MXHP 2KH9A 2X1FA 3SXLA 2DNNA 3CCSS 2CPJA 5LXYA 2KRRA 3VAFA 1A9NB 1X4BA 3P5TL 3CUNA 5IM0B 4QQBA 3CCJS 5LJ5Y 3P6YC 2M2BA 5LSLA 2M7SA 4IO9Q 2MZTA 3S8SA 2OIHA 1VQKS 1VC5A 1YHQS 1DBDA 3P3DA 2LEAA 3MOJB 2J76E 1M5PC 2LKZA 4CQ1A 2CQPA 1U1KA 2CQHA 3CMES 3R1HA 2Q79A 2DHSA 4QPTA 2DHXA 2XNQA 4Y0FA 2KFYA 3EX7B 5GADU 2MPUA 1WI6A 2DO4A 2U2FA 4ERDA 2L9WA 2DGVA 2MQMA 3S7RA 4M5DB 2KXFA 2N3OA 1HA1A 2MSTA 3CXCR 1OPIA 2OSQA 1FNXH 2UP1A 2YKAA 3EGNA 2KXHA 2DNOA 2I38A 2DNPA 2NLWA 4LMZA 2DNGA 1X4EA 1N88A 2NZ4A 2ZJQQ 2ERRA 3JB9k 5GAEU 5D77A 4WFBQ 2M70A 1R8PA 5DM6Q 2X1BA 1SJ4P 1OWXA 4FXVA 5DM7Q 1VQ9S 2XS7A 5GVQA 1FJCA 5BJRA 1F9FA 1VBXA 2HYIB 3MDFA 3SDEA 2JVRA 2CQCA 3S6EA 1HL6A 2DH9A 3CC4S 5DDOC 2VOOA 5GMKa 1FJ7A 2JVOA 2EK6A 2E44A 3LPYA 1QVFR 2CQ0A 1YWXA 2DIVA 4C0OC 2DIUA 4P6QA 4WFAQ 2LQ5A 1P27B 1U1OA 4TLQA 2CQDA 2HZCA 2DH7A 1X0FA 2DNQA 2AYEA 1U1PA 2KN4A 1DRZA 2QA4S 3BO4A 2LXUA 4QU6A 1NJIT 2DHAA 3I56S 2MZ1A 1WTBA 3CCVS 3VALA 2MJUA 3G96A 4ZKAA 5IFMA 2CQGA 3H2UB 1ZH5A 1ZZNA 3P49B 1URNA 2MQQA 2F9JA 2MB0B 4F02A 2CJKA 4C4WA 1WHYA 2YH0A 2N82B 2DGSA 2KU7A 2KG1A 3Q2TC 2G1DA 2DGWA 4Z2XA 1X4FA 2XSFA 2XB2D 2DNHA 4Y00A 2QEXS 2KI2A 3CCES 3BS9A 2F3JA 2ADBA 3NNAA 2MQLA 3R27A 2RVJA 2CPIA 2ZJRQ 3THTA 2M8DB 4YB1P 4EGLA 2CPDA 1YITS 2HVZA 3UCZP 1QM9A 3G9CA 1WI8A 2XS2A 1X5TA 1SJFA 2X1GA 1P1TA 3CTRA 1PGZA 2JRSA 5CA5A 4U67Q 4WKRA 1K9MT 2RU3A 1X5PA 1VQ5S 2FPHX 2MKJA 2CQIA 1D8ZA 2V94A 2J0SD 3UD3P 5DDPC 1VQ6S 2XS5A 2DNLA 2YWKA 3VAMA 1VQLS 1X5OA 1Q82T 3NNHA 3CCMS 3NS5A 2G4BA 1JJHA 2MYFA 3UE2A 1U1MA 2JWNA 4WF9Q 1JJ4A 1DZ5A 2MQOA 1WF0A 2EK1A 3B4MA 1UAWA 5D78A 1YJ9S 2KYXA 3CCRS 1SJRA 1YIJS 1X4GA 1Q86T 2MZJA 3MUVP 1RKJA 3TO8A 2VONA 2M9KA 3G71S 3VAJA 2B0GA 4PRFA 1WF2A 5FJ4A 2MKHA 2KRBA 2G0CA 3L3CA 2MZQA 1VQMS 3CF5Q 1VQOS 1L3KA 2MKKA 2MKIA 5JVGQ 1X4AA 3FEYB 2YTCA 3VAIA 1FJEB 4OZ0A 1KD1T 4C7QA 3Q2SC 2X1AA 3H2VE 2LEBA 1M5KC 2DGOA 2JX2A 3HHNB 3TP2A 3U1MA 3MUMP 2M88A 3PIOQ 2DGUA 2M0GB 3VF0B 3SDEB 5LSOA 4LJMA 1NU4A 2CPHA 1W2BR 1KQSR 1BY9A 1SJQA 2CPFA 3CMAS 2BZ2A 2N3LA 2MGZA 1VQNS 1OO0B 2FHOB 1H2UX 1PO6A 1H6KX 2LMIA 1X4HA 1AUDA 2CPYA 2DGXA 1VC0A 2AYBA 2FY1A 3VAKA 1N54B 3US5A 3CCLS 1VQPS 2KG0A 1WHVA 1VBYA 2CPXA 1VBZA 3MD3A 2MQPA 5HL7Q 1YI2S 1N8RT 3B4DA 1YJNS 2MY7A 5DDRC 2DGTA 5CYJA 1WHXA 1VQ8S 2K3KA 2DGQA 2LCWA 2L41A 1H2TZ 3FEXB 3G8TA 3UCGA 3CC2S 3HI9A 2E5HA 3CCUS 2RRBA 3NMRA 4QU7A 1D9AA 3TYTA 2WBRA 2DHGA 3BO2A 1WG1A 2AD9A 1Q81T 1U1RA 1UFWA 1U1NA 3U1LA 2K8GA 1O0PA 1S72S 5EN1A 2HGNA 1VC6A 3DXBA 3ULHA 2DISA 4PKDB 3G6ES 2M4MA 2DNYA 2MKSA 2RQ4A 4CH0S 3CCQS 4IUFA 2RRAA 1N52B 2DO0A 2E5IA 1WEZA 1M5VC 3MD1A 3IWNC 4ED5A 2FC9A 3MI7X 2D3OR 1JJ2R 3K0JA 3I55S 2OSRA 2KHCA 1FT8A 2L08A 5DDQC 3BEGB 4FXWA 3CD6S 3VAGA 4OZ1A 5IM0A 1OIAA 4BS2A 1X5SA 4W90B 2N7CA 1HD0A 2MZRA 4TU7A 3MURP 2SXLA 5CXTA 2RS8A 4UQTA 2DNRA 1YJWS 1IQTA 2M8HA 4W92B 1M90T 2KM8C 4CIOA 3NNCA 2GO9A 3EGZA 2E5GA 3IRWP 2I2YA 3J7ZT 4TU9A 2MSSA 4WCEQ 3D2WA 1WG4A 2CQ4A 3BO3A 1X4CA 2DNKA 3VAHA 2MZSA 4LIRA 1H2VZ 4CH1A 2MXYA 1WEXA 4UY8T 4YOEA 2RS2A 4IOAQ 3MUTP 2LECA 1WELA 2HGMA 2KXNB 5HO4A 2ZJPQ 1HD1A 2QFJA 4IOCQ 2CQ1A 2RT3A 4WIIA 2CPZA 2DITA 1RK8A 3S01A 5LJ3Y 1YTYA 2DNZA 5DETA 2KM8B 2MMYA 2CPEA 2DB1A 2KVIA 2O3DA 2U1AA 1CVJA 4F26A 5ITHA 3R1LA 1KOHA 3SMZA 1VQ7S 2MY8A 3PIPQ 3CPWR 5H1SV 2A3JA 1FXLA 2LA6A 2PEHA 4V19X 1U6FA 5GAHU 1UP1A 1M5OC 2OTLS 3UWTA 3THPA 5IQQA 1X4DA 2MJNA 3UD4P 3RW7A 2LYVA 2AYMA 2LA4A 2J0QD 4RU2A 1U6BA 1WF1A 2MGZB 3NS6A 1U2FA 1B7FA 5LXRA 5MLCV 2DK2A
chains in the Genus database with same CATH superfamily
2GHPA 3N9UC 2D3UA 4P52A 1FHTA 5K8OA 1C1BB 2YPZA 4ID5A 1T02A 4WK1A 2K2PA 4L74A 4RWWA 4HEA9 3D7SB 1EHWA 4TQSA 4CRJA 5HQMA 1TKZB 4UY85 1QSSA 2PE8A 4D3GA 1U8WA 1F2HA 3LOUA 3UVJB 2W7OA 1F60B 3FVYA 4NLVA 5LMUJ 1X31C 3OSNA 4I7FB 3GYNA 3GJTB 4KHPJ 1LWCB 2IVFB 2XY7A 4ZIVA 2UUBF 1LW0B 1RWOB 2ZE2A 3N4WA 1VK8A 5LJ5Y 2RKIA 1AXQA 3TRGA 3HXMA 1SKRA 2J76E 3J81U 3R1HA 1YDLA 2E9TA 2MPUA 1WI6A 2BE2A 3DFEA 2L9WA 4B3MJ 4WZQA 2OO4A 2HMIB 5KFOA 1RE1B 4ZPWR 4O3QA 1JB0C 2V4JA 3NGRA 5A6WA 1C0TA 5I42A 4MKAA 4NEZA 4WFBQ 2HEKA 4QWEA 2ATLA 3MCMA 1QE1A 4DV6J 1Y0HA 2DH9A 4K4SA 1TL1B 5GMKa 2OPSB 2FVSA 2CQ0A 3HKWA 1NSQA 4DR4F 4E0DA 4WFAQ 2EW9A 1PBUA 4LVOP 3VV2B 5DZ7A 1U1PA 1KVIA 1ZM2A 5HMZA 3A8EA 2XO6A 1HBMA 2DHHA 2VFSA 2IJNA 1HHSA 2MEWA 1RHKB 4ZVTB 4I67A 4GKKF 3AOAA 4USJC 4YR3A 2HQGA 2YQ3A 1IBMF 2MQLA 1IQZA 2CPDA 1FWPA 1R0AA 2CG4A 3MM5B 3UD5A 3WC2A 1RT5A 1PGZA 3KHLA 1FESA 2RU3A 1NPPA 1HHQA 3OR2A 1G7CB 3PG9A 4B08A 5J2MB 4NL5A 3RAXA 1RBAA 4KPYA 3NS5A 5B7WA 4FYVB 3RG6A 1H98A 4X66F 2V34A 2JWNA 3EUNA 3DLHA 1WF0A 4J9NA 1GMWA 4OX8A 1SJRA 2J6SA 5E3CA 3EXYA 4LRDA 2A0FB 2OAUA 2W2NP 4NCGA 1IKVA 2BOAA 1ZPVA 3D1HA 4MKVA 4LF9J 3BM7A 4OJHA 2CPHA 2YXLA 3RZAA 3RBZA 4X84A 4PWUA 2UUAF 2ZUAA 3P96A 2FHOB 5T7LA 1H6KX 3TZXA 2IC3A 5CYQA 5KG3A 2KG0A 1FA0A 2RSQA 5FDLA 1WKLA 3DLKB 2QA1A 2JEGA 4C9DA 4LFBJ 4MFBA 2DGTA 3GSDA 3G8TA 3UCGA 3G87A 3M9NB 1M1GA 3PR5B 1ZM9A 1BWEA 2HBQB 2E1RA 3J7YI 3H5YA 4QWDA 3DXBA 4J9UE 1IR0A 2B7BB 2W24A 3RBXA 2R2UA 4DR2F 3GR1A 3GR0A 4PXCA 3NS7B 4GC7A 1DQ9A 3MHYA 4OV1A 1HKAA 1VJWA 5HBMB 2GO8A 2L08A 3I9ZA 3CD6S 4BCAA 1S0MA 4LSNB 1Q7LB 1ZM3A 1F1BB 3J81Y 2HS4A 3QZ7A 3BKUA 3W2WB 2GO9A 3IRWP 1S4FA 4O4GA 4TU9A 4WCEQ 4F4XA 3MEGB 1Q95G 5KFJA 1HI8A 4DXLA 3V81A 4DN9A 3MM6B 3CCTA 1KBRA 3MUTP 2A2CA 1KSPA 5K8MA 4JI0F 2Y3YA 4QPXA 4C8YA 4FPRA 2JLFA 3W8PA 1UPMB 4N76A 1S1VB 2R42A 2OI2A 2DB1A 2HAFA 1CBKA 3L95X 3QGHA 2YWEA 3HVAA 4ETXA 4C0HA 4XPCA 3FBCA 5HQLA 5EUHA 3UW1A 3NCQA 5J2NA 1DLOA 3FJ2A 4EUVA 5LL6d 1QAJA 1WKJA 4C3MA 1FE4A 4DX5A 2F5GA 3KFWX 2E7XA 3NGUA 3BR9A 4USVA 1WEYA 4LSZB 1TKDA 1F5BA 2OTJS 3KK2A 3IGNA 3C14B 5KFAA 1SCJB 1YRUA 2H65B 2I1RA 5ETKA 1A7GE 4TU8A 3IAM9 4RW4B 2UVRA 3QLHA 2FJWA 2VDHA 2OPQB 3T9NA 3JSRA 3VGSA 3M2UA 2WZ1A 5GAGU 1OY9A 4MYTA 1TK5A 3V4MA 1ZA1B 2HFVA 3T1HF 4NZ0A 5KFEA 2R7SA 3FSIA 3AJ1A 1Y5IB 3CCZA 3IG1A 2Y0BB 3EVWA 2VA3A 2GIFA 1JLAA 4ZJOA 2BANA 4J9OA 4CQ1A 3O1LA 3X1LB 1JIHA 4F4KA 3E8OA 3GZ7A 2KFYA 4K50A 2DO4A 3HO1A 1SBRA 3PCOB 3PYEA 3MMAB 1KTQA 2R7WA 3M9MB 2KXFA 3HFKA 3NMAA 2FVPA 4RPFA 2KXHA 2NLWA 4JI7J 2DNGA 2VZ9A 5E7OB 5GAEU 3HSGA 3NGKA 1N5YB 4NLQA 2VDIA 3HPOA 1I1GA 1WC1A 3DLBA 4CLZA 1RA7A 2N7YA 3UFCX 2DVIA 1DY3A 4J9QA 4YHHJ 2E44A 1SC6A 3MZIA 4X4VA 4EFAC 3PEJA 2B6AA 3QJJA 3KLIB 2LQ5A 1U1OA 2HHTA 2DH7A 4DR5J 5IS2A 4CLKA 2V2KA 2F8HA 4NASA 5CD4H 3PKMA 1CULB 4NXMJ 3LA0A 4CCHA 1MU2A 2HVEA 1JNRB 2QLWA 1RZMA 3H2UB 3LH2S 3AH6A 4K4WA 5DJBA 1VIOA 1WOSA 2N82B 1WC3A 3DU5A 4W98A 1P9QC 4DV2J 4LR9A 4XTTA 3TUZC 1OY6A 2P9CA 4KKOA 3CJTA 2HQ3A 3CCES 2IMWP 4URSA 3V6DA 3IAS9 2PGCA 2BRKA 4RUBA 3OSPA 5D4OA 3TANA 4RW9B 3AT1B 3I0SB 3M9OB 1RYSA 1IWGA 1H0HB 2IFXA 2HIYA 2XLJA 2NZCA 5CAAA 3JS9A 4ZCIA 4RO0A 4AL5A 4H4OB 2HRUA 1TL5A 1TV6B 2UUCJ 1YJ9S 2YX4A 1ZS6A 2MZJA 1HARA 2FLPA 4NZ6A 2HNYB 1S1UB 5AJ3F 4MIBA 3QJLA 2MKIA 5ETPA 2Y8WA 2QSWA 2QE5A 1LQ9A 3LTOA 2GX8A 1HBUB 2DGUA 5LSOA 3IMQJ 1KQSR 3HF5A 4J91A 2N3LA 3Q8QB 1H2UX 3N5BA 3C19A 4JBCA 4BDPA 5CYMA 2DGXA 4LQ9A 4NYZA 2QJ3A 1OSCA 5HL7Q 3A13A 1N8RT 3FCWA 4FVMA 1JLFB 2JOQA 3DM2B 4ER8A 2V69A 1RA6A 1AZSA 4M95A 2EKYA 1T9VA 1R7IA 3BO2A 3CB4A 1Q81T 4DI6A 2ZH9A 1UVNA 1W7WA 4OQJA 4K5RA 3ULHA 4FZVA 2OP5A 1E6VA 3HHLB 3A12A 2QLFB 1XTZA 1M5VC 4HDGA 4YMEA 3I55S 1SC3B 5HROA 3K8VA 2YPYA 5IM0A 4BS2A 2I5JA 1X5SA 4C6AA 4W90B 4QZVB 1VR6A 1LEOA 2SXLA 4JI6F 4ZVHA 4LBIA 4HI2A 1IQTA 4DCOB 5HJYA 3CJ2A 3DRRB 1NDPA 5KFBA 3RU0A 4QYZK 3QRQA 2RS2A 4IOBA 4M5DA 1BQMB 2AHOB 3M2RB 2K06A 2CQ1A 4WIIA 2E9ZA 2Z30B 3G6YA 2MMYA 4ENOA 1LWEA 2U1AA 4X2BA 3H90A 2MY8A 2XLKA 3B8HA 2C28A 3CNQP 2IYIA 2R7VA 4OLPA 4LBPA 1VIXA 3GYGA 2D3O1 4QWAA 4G6VB 4J90A 2GC8A 1K8AT 2GVZA 3OL8A 4JP8A 1ZTWA 2UXDF 1KQFB 3MWBA 2CQ2A 2IDLA 4LF6J 1QVGR 1R8AA 1S79A 2W25A 2IPOB 4Z7YA 2HAIA 3O8WA 2ZZMA 1QAYA 4WFNQ 1RKIA 2D9OA 3U27A 4F50A 2H1YA 2YH1A 4C0BA 4PEOA 4JI1J 1HNWF 3V6HA 2EVZA 5IWAJ 4NLYA 3GCXP 4N8NA 3JSYA 2KRRA 5EWGA 2XY5A 3UNGC 1HQUA 3OFEA 2IM0A 3SV3A 4USKA 1JLCB 1VQSA 3C8YA 4OL8A 2YNHA 2C3MA 3E01A 2OGUA 1V5VA 3QT5A 5FLXY 1RWNB 1AB8A 1JLEB 1IKYA 4HH0A 5DM6Q 2X1BA 1SJ4P 4JI4J 1VQ9S 3BGUA 1VBXA 1NK8A 1CC7A 3FC9A 2VOOA 2WB1D 2W4PA 3RBEA 4KC5A 5DQGA 4AQYF 1GXUA 1T05B 4HLBA 1L3TA 2ZVIA 2B4OA 2QIFA 4C3KA 2FGOA 5GMDA 2EPIA 4PCQA 1ICEB 3D5MA 2HQIA 4FYXB 3D28A 1URNA 4JV5J 5MAOA 3E51A 2GIQA 1FNMA 3LALA 3G82A 4F36A 5E3QA 1NK4A 1I6JA 1U45A 4EMDA 4RW6B 1WC6A 2KI2A 2QO3A 3RB6A 4IO1A 2A1BA 3V4IB 4AXJA 4DUZF 4FNIA 4J9VA 4PXDA 2VFUA 1S9EB 4K4TA 4J37A 1SV5A 1Y5LB 1TK0A 4DR7J 3HD2A 1URRA 5CABA 2CQIA 5DDPC 2KJVA 1FD2A 3LGNA 4ZLJA 5DZ6A 1RWWB 1XMOF 4NE9C 4Y6IA 2AJQA 4WF9Q 1DZ5A 3CCRS 2HFZA 4DPTA 1YIJS 2QLJB 2NPFA 4Y2MA 4Z7CA 5E2QA 2M9KA 1HNZF 1DTTA 2ZH7A 2LQJA 3FKBA 1HMVB 4C8MA 5L8RC 4KO0B 5KFRA 1FJEB 4F04B 3VGVA 4DLGA 3IFEA 5F8JA 1KS2A 1S1TA 4FYDA 2YKNB 3PIOQ 1NHKL 4A47A 2BJ3A 2JLGA 1KEKA 1NK9A 2YKMA 1FERA 4ZVGA 2KFNA 1F3FA 3OHBA 2DCUB 5DGAA 3MD3A 3KUEA 4H4KA 3B4DA 4WXOA 3KLFA 3QSYB 5U47A 2FZKB 2ZH8A 4HHJA 1TKXB 4I1TA 3NL0A 2UU9J 3H5XA 4QIVA 3EZOA 3IBWA 5F9NA 1WG1A 2AD9A 4ICLA 2QL5B 5EN1A 5F8GA 2DISA 5KFHA 3Q89A 2ZHBA 3AJDA 4E98A 5D8HB 4F4YA 2VHGA 4QOTA 4PWDB 4C11B 2GJIA 1DAXA 1G6BA 3OJUA 3LP0B 4P75A 2XMKA 1X7VA 2DNRA 2VBXA 1LNQA 4MKBA 4JB8B 4KGZB 1NDCA 2YNFB 4QCLA 3D2WA 1BUXA 1WG4A 5G0RB 3BGLA 2ZBIA 1Y11A 4ED6A 4OI6A 4RUCA 4UY8T 4YOEA 1P8GA 2Q6BA 3DRYA 2GS8A 1EETB 3PV8A 2J9CA 3I0RB 2ZH2A 5J2QA 4DQIA 2L9NA 2V68A 4FYYB 1IVZA 5KT5A 3IBCB 1X60A 4LFCF 1CVJA 3FSXA 4F26A 3ILJA 1FXLA 2R8JA 1YBUA 1X4DA 2C2MB 4YDXA 2WCXA 2HQFA 3ELHA 4ZJQA 4MK8A 2HBYB 4GVBB 4RU9A 2NXCA 2UVVA 3MTJA 1QSYA 1SB6A 2EFOA 2EC0A 4DPOA 3SZ2A 3BH6B 4U95A 2VOPA 2AX0A 1C1CA 2WW4A 4NI2A 5HJXA 1O6XA 5C25A 3Q83A 1GNKA 3OFHA 3WDOA 1SI9A 2CUYA 4IFVB 2OEKA 1T11A 1YBTA 4OI1A 2Q43A 2O66A 3EZUA 2ZDOA 4FPIA 2YNIB 4AL7A 3UDCA 2KH9A 3A1YG 1VFJA 2VG5A 4M5NA 4DR1J 2BRLA 4X65J 3CCJS 4U8YA 2BE9B 4IO9Q 3S8SA 3C15B 1M5SA 2P9EA 1Q53A 5KAKA 3HZEA 4I56A 4KT0C 3EJMA 4FKYA 4YQWA 2JEJA 3PNIA 3QFWA 2O1PA 1VMBA 4OZLA 4DL3A 4OI0A 2UP1A 3QMQA 3EGNA 2QA2A 1QAXA 2I38A 2GCFA 4DR3J 1QTMA 4Y2AA 3ZO7A 1R8PA 4DN0A 4HTJA 4J9PA 2XS7A 2F8MA 3TJ9A 1NSKL 3C3LA 1R3NA 2MTLA 3RRGA 1T3NA 4ZOSA 2JH3A 1BWVA 4C0OC 2DIUA 2GFFA 3L09A 4NX9A 4QU6A 4CO2A 1B7YB 4GKKJ 4N56A 1ZH5A 2B56A 2VFTA 1IBMJ 4F02A 3MEDB 2DGSA 8AT1B 2HS0A 2DT9A 4ZPVR 2XSFA 1VDHA 4Y00A 3QGPA 3TX8A 4FF3A 4RWXA 1F0XA 4DSJA 1WC4A 4ZA1A 4CH7A 4E8UA 1CEZA 1NLKL 1HNVA 3DRPA 1K9MT 1VQ5S 2VPWB 3NCRA 4ECSA 2J0SD 2Y9HA 1S6QB 3GONA 1GX5A 3N5FA 2GQQA 1VRUB 1SKSA 3NY0A 1HNIB 2IM3A 3ZZUA 2ALYB 1N4LA 2GZOA 1ZYQA 1OS5A 3VWSA 3K5OA 2EBGA 5K8PA 2PI5A 2VONA 1S9GB 2ZNZA 2DBBA 1XQIA 3K89A 3ETMA 3CO9A 5EDWA 2ASJA 4R5PB 1YJTA 1KDNA 2BEFA 4K4UA 5HN0A 2OMLA 1Y00A 4OYXA 4ZVOB 4UUWA 4U8VA 3BDPA 4RNNA 1AYEA 4CLFA 2XZDB 3CD5A 3ZZ0A 3H2LA 3R7BB 1K44A 2MY7A 3VZHA 1CJTB 3AQPA 2WOMA 2LCWA 4UT4A 2NYHA 3OR1A 3NOGA 1MROA 1UFWA 2VFRA 2ZNYA 4QIFA 3SEOA 2JEIA 1XR6A 4P2SA 4ECRA 4ZDNA 1VC6A 1PSDA 3QWUA 3FDSA 2FZCB 2PN6A 3NGDA 3PTWA 4WE1A 2KHCA 4I2QB 4A48A 1FT8A 3BEGB 1U2CA 5LMUF 5DRKA 4OZ1A 1RT7A 1BXNA 1MW7A 1VBKA 3MURP 3SIPB 2PC6A 2WBMA 4KHPF 2KT2A 2I2YA 4V19J 3DGPB 2XY6A 2EFPA 4FF2A 3L7PA 3ITHA 3BPSP 4PQUB 2AW0A 4YR0A 1SKWA 2LECA 3DCAA 4ZMMA 2KXNB 3BGOP 1JLQB 3CT9A 2HHWA 2FJEB 4M94A 1GFWB 4IFYA 2H51B 4B9NA 5LJ3Y 4DSLA 3V6KA 3RYLA 1C4CA 4LRAA 2A6OA 5ITHA 4B3MF 3FZ2A 2A3JA 1TL7A 5H9FK 4ETZA 2AEMA 2GVDB 5KG6A 5GAHU 1UP1A 5EWEA 1UEUA 3D3BJ 3OXGA 3ONQA 2PA3A 2NREA 4DV6F 5GAHI 3CULA 4B9SA 5I4MA 4EZ9A 3ZZZA 2CADA 2CWXA 1HWKA 3LQVA 2FY8A 2YKPA 2RUGA 2G1HA 4KFBA 2CQ3A 1Q7YT 3KJVA 3TX0A 3Q23A 1APSA 1TAQA 3GP9A 4Q0BA 4B9UA 1JMTA 1DHMA 1S4EA 4USHA 2DXDA 3CDBA 1XC9A 1M1KT 3QIPA 2X7IA 4F25A 1WHWA 2HHHJ 4P72A 1E6YB 3CCSS 5KOWA 2Y1IA 1LK5A 3LP1B 5I3UB 3KLEB 3D6TB 3NXZA 2RUSA 4CLLA 2IAJA 3FRYA 3Q0AA 2B8QA 4X64J 4U9RA 2UVUA 1RHQB 1B3TA 3D1OA 3T1AA 2DHSA 2KDOA 2CA9A 2I8EA 4K0KJ 2QMUB 1V3SA 4ECZA 1VS3A 4H54A 4WBFA 4AUKA 2D3ZA 2XMMA 4B17A 2CNNB 3J7A1 5C42B 2JVRA 1U0HA 1SUQA 1FJ7A 1HQ2A 3LPYA 1LW2B 2W8KA 1KFSA 4IDKB 3I5CA 2QT7A 1O8BA 4TLQA 2ZM6J 1DFDA 4LF9F 2KN4A 1BHNA 2DHAA 1ZBTA 1VYAA 2MZ1A 1YKWA 3BYPA 1U24A 3CCVS 2PA8D 2RDIA 5HMWA 2AWZA 3KNAA 1TR0A 1TTHB 5IFMA 2CQGA 1ZZNA 5LM7E 2B4UA 2MQQA 5KFKA 1N5SA 1JNZB 4CLUA 1WHYA 2DRAA 1VRTA 4EWTA 2JZ5A 4QR1A 2OD6A 2J6UA 4KJIA 4LFBF 2CXEA 2R3VA 1CQNA 3TEGA 2CPIA 3PRVA 1F5AA 5HANA 2XS2A 2X51A 1X5TA 1UZDA 1HQEA 3M32B 3CTRA 3RJMB 2JRSA 2ACMA 2YX7A 1XNQF 2G13A 2VB6A 1FDNA 2DR8A 4AL6A 1TVRA 4DV0J 1PCAA 3NNHA 4HYKA 2AJ1A 3UE2A 1R89A 1OY8A 5B08A 1UA1A 2QLBB 2Z2MA 4OI4A 5AJ3J 3AFGA 5C24A 1RAFB 1F3VA 3EPGA 4I0WA 2HRTA 3LWLA 5D3GB 3RAQA 5C2CA 1LWFA 1MN7A 3HSDA 2V9KA 4ZJLA 2LEBA 4OZ2A 1BGXT 2WONA 1UJ4A 2F4FA 1L3UA 3N0VA 4Z37A 4RZRA 4CNZA 4OYIA 2PFFB 1W26A 4DZ6A 1X4HA 1PC5A 2AYBA 3A3NB 3TAPA 3JSMA 4O3NA 2Q1LA 5A0YA 3PJ9A 3H42A 3TJAA 4H4MB 4O3RA 3T5LA 1XBWA 3DOKA 3I4PA 2ZD1A 5M2RA 2BQRA 2YBVA 4KSEB 3ICLA 3M7VA 4ZHRA 4G1QB 3DLEB 1UFKA 2A6MA 3IWNC 3MI7X 3I32A 4Y65A 3TUJC 3QO9A 3PX0A 2VFVA 5ETSA 3PX6A 1NEEA 2JHEA 4WP3A 2D74B 3VAHA 4F2SA 4LREA 3SCLE 1S7IA 4LF7F 5F8IA 2W2QP 4RL1A 2AGQA 1IKXA 3IR7B 3T6JA 2LXFA 2QFJA 4XAKA 4IOCQ 4IG0B 2E66A 2J5AA 3PYGA 3QNWB 5D0RA 4F0HA 2P6SA 3QWPA 2Z0GA 3THPA 1M1HA 2MJNA 4IRCA 1LFPA 3KJQB 4IG3B 4OYWA 3PO4A 3BGRB 4ZPCA 3CSKA 3WQPA 4DG1A 2NXNA 3FCHA 1U2FA 5LXRA 1SJ3P 3LF0A 3EGVA 4NCBA 1SL1A 2OJ3A 1KVKA 5KG4A 1ZZFA 1EQ0A 2YWFA 3C2PA 4DR5F 2V8HA 3B78A 3MPDA 3DU6A 3C6TA 1RT2A 1RABB 3T5KA 3TAMA 1G2EA 3WC0A 2HZVA 5BYSA 3Q8YA 4KE5A 1F5CA 3NGTA 1ZAVA 2HLUA 2V8DA 4MJKA 1BQNB 4IRDA 4DV2F 3GCWP 5KG0A 2B7CB 2DY1A 1M0SA 1REVA 3H4DA 5ETRA 3W62A 2M7SA 2GW8A 2HNZA 2IRUA 4CNYA 3M4XA 2HKEA 4O23A 4N7TA 3IRXB 3M2VB 2IHR1 4BLGA 2FZGB 1RB0A 1UWBA 1S6OA 2U2FA 3ET6A 3QYYA 3T1YJ 1RYRA 3HHEA 4Q45A 4C48A 4MMOA 3MPWA 1U2RA 2ZJQQ 2UUCF 1NJXA 4AQYJ 2QN6B 1UVKA 3SDEA 5HVGA 3BKTA 3LGHA 3A8IA 4RW7A 2HFUA 1HBNA 3IS9A 2WVBA 4WTOB 5D15A 3R3TA 2IA0A 2HZCA 4PWWA 3MOZA 2FB0A 2FYXA 3K5MA 1ZM4A 4OJ3A 4ID5B 2VUGA 4Q43A 1T9WA 3D6FB 2F9JA 3QT8A 5A6PA 1KNZA 1RT6A 3I96A 3ZTSA 1T95A 3G6XA 1K47A 2WSEC 3P5BP 2J9EA 4DUZJ 5KT7A 4LIWA 2XB2D 4O0NA 2QEXS 4B3OA 2ZJRQ 4OX7A 3THTA 2WHOA 1N6QA 3KG1A 3QGGA 4KTQA 2R2SA 1KWMA 1XMOJ 5DG8A 3W5ZA 4ECYA 1PC4A 4ES1A 2FHJA 2BM0A 3K7RA 1RU1A 1V9OA 2ZE2B 2AJ2A 3GIKA 3VAMA 4PZVA 2RKIB 2BJ1A 2W9CA 2HHVA 2Z2YB 1PYTA 3FSYA 2JL9A 4ALZA 2V5HG 4A8FA 4RJVA 3TQ1A 2BE2B 5AXLA 4JOUA 2BKPA 4ZVFA 3OQ2A 2Y1RI 2EFGA 3CDWA 5A2QU 2Q66A 1VK3A 1NPKA 4U96A 2V4JB 4F4WA 5I42B 1C0TB 3HZGA 2HHQA 3EDQB 2JX2A 2DR7A 2CZVC 3HMJG 3EPIA 1QE1B 4XO0A 2ZBPA 4Q8EA 2HLTA 4HH1A 2BJ8A 3UNYA 1PO6A 4P74A 1YBAA 2BW7A 4CYUA 3ISND 3PVXA 3VAKA 5ETVA 2OELA 3T5JA 5K9FA 1NB7A 1TL3A 2DPJA 1LFWA 3AA8A 4A46A 1EB0A 4DOZA 2GGPA 1HBMB 3PFOA 1UPPA 3F56A 3R7NB 1EZZB 2PIIA 4DWIA 2B43A 3MR6A 2RB7A 2ATCB 2POKA 2HK2A 3M1VA 4PKDB 3DC2A 3ZXWA 2LFVA 3GIMA 2M4MA 2H9ZA 4C8NA 1SJ1A 4B9MA 5AT1B 4MH8A 1R0AB 1NK6A 2IRXA 5E3PA 3KXDA 1CJVA 2CIMA 4JI1F 1YSJA 1FEEA 1RT5B 2Y0SD 5IWAF 2N7CA 1LK7A 3OR2B 3JTOA 1RLDA 1YJWS 4CDIA 1FRXA 3T6BA 4GRSA 3D68A 2DD8S 3MMCA 5KFIA 1FK9A 2YWWA 4OX9J 2EFVA 3DLJA 3SCIE 2ZFHA 3HVTA 3MECA 1L3VA 5HO4A 1NKEA 1S48A 1IR1A 3BBFA 1RK8A 4G1PA 3HULA 4NCGB 2XZTB 3SCKE 3KUGA 4KYZA 1IKVB 2XHWA 3R5CA 4ITSA 1Y9OA 3R1LA 1KOHA 2V4RA 3VCDA 5E41A 5H1SV 5GADI 4DPWA 3SCJE 1YZ7A 3FRZA 2HHPA 3CIMA 3X3UA 3UR3C 2HQDA 1R0CB 4JI4F 5T7LB 4L3KA 3D9BA 5MLCV 2DK2A 2RDDA 3I87A 1WTFA 2K1RA 2IC3B 2VG6A 8ATCB 5CYQB 3KDNA 2RIJA 4B3RJ 5FDLB 2BACA 2ASYA 3CIZA 3F0NA 4ELTA 2FDNA 4MFBB 1AW0A 2G2OA 3MCNA 4YY3J 1NO8A 5HI7A 3I6PA 4NLDA 4XDCA 3RTVA 4CLPA 1CS4A 4JV5F 1PBAA 4NXNF 2PMZD 1UEVA 2ADCA 1U8SA 4PQAA 2AT1B 2WTFA 1I51B 4LSLA 5KG2A 2YKQA 2DR5A 3OTEA 4DFPA 3AQOA 4LT6A 5AXKA 5JJBA 4ED3A 5LXYA 1RTDA 3I5AA 3WX8A 2B9XA 2AP6A 1JXLA 5FIIA 2O5DA 3MOJB 4J9RA 1KONA 4DR7F 2IBOA 2HWTA 4O4GB 1UTAA 4ZP6A 1RHUB 2PDAA 4ED0A 5J1EA 3V81B 1S0NA 1HNXJ 2FLLA 4TYAA 2WAQD 3ILOA 2C42A 2HBZB 3HKZD 2DNPA 1ZAXA 4DL5A 2MLZA 3C16A 4TNOA 3JB9k 3QZ8A 2CNLB 1OWXA 5BJRA 3BF4A 4O44A 4FKXA 2CQCA 4KHMA 4X4TA 3NBPA 3CJ0A 5J2NB 1QTNB 5F0UA 1DLOB 4K4ZA 3CDEA 2CWKA 3HFVA 3I56S 5BXIA 3ZTQA 3BR8A 4Y2CA 3OXLA 4DQQA 1NRKA 3KK2B 5B0GA 3FQKA 4HACA 1GMVA 4WFXA 3LUYA 3QLHB 5LOQA 3OTCA 3BV8A 3BS9A 2UU9F 3M2UB 2B5JA 1RAAB 4TY8A 1IKWA 1PAUB 2HSEB 5IT9Y 2C2KB 5CQGA 2Z2LA 1Z2LA 2VKRA 4CTAA 4RLEA 2DRDA 1UVMA 2C2RA 4M5GA 3IG1B 1X5OA 1SQEA 3OLBA 3G86A 1JJHA 3MPVA 2ZEJA 2DR9A 4WK3A 3MEEA 1UJ5A 1Z4UA 5CCLA 1JLAB 2FGCA 4TY9A 2IA6A 2BANB 3CJ3A 4F0KA 5L9XA 1EP4A 3MUVP 2CNKB 1P6TA 3KK1A 4PRFA 5FD1A 4KBIA 3CE8A 2HWIA 3B54A 2YTCA 5I3PA 3O6QA 4C7QA 3M8PA 5ETTA 1B99A 1S76D 2UUTA 3LO3A 2VG7A 3MUMP 1SH0A 3LW5C 1YQHA 2M0GB 4USTA 4RW8A 5T41A 1BY9A 3R2CJ 3QBCA 4Q8FA 3PRBA 2VKZG 2B6AB 3TVZA 1JXEA 4A8QA 4K5SA 4OZ3A 1VHIA 4BBYA 3HHLC 5HP1A 2YNGA 2WSFC 2E9RX 1MU2B 1O51A 2ZOGA 4JUZA 4RUHA 3PFEA 2RRBA 2DHGA 1QDUB 1NSAA 4FS1A 3D6MB 3D0HE 1N36J 4X4NA 4KKOB 3FGVA 4C8KA 3V6DB 2RRAA 1UFLA 1N52B 2E5IA 1AFIA 4B02A 3IN5A 3Q8PB 2BQ3A 2OSRA 2KT3A 2V0NA 1NUEA 4RNOA 1HYSA 4EK2A 3W2VA 2PMWA 4UOFA 3NNCA 3MEKA 2E5GA 1UW9A 2YVSA 2VH7A 1AUSL 4LUBA 1ELOA 4DR1F 4F8RA 4CH1A 2H5IB 4X65F 1T03A 1T9TA 2CG8A 1K1QA 4ZK7M 5J1NA 5LMNJ 2KM8B 4Y3CA 1KHVA 2XEXA 5RUBA 1FRMA 3KNGA 3W5XA 4DR3F 3M6XA 3SFUA 2QL7B 3ENQA 2RF2A 4YEAA 1U6BA 1HPZA 1WF1A 2EFQA 5A8KA 1B7FA 2BBEA 3R5BA 5CYMB 3RW6A 2XMWA 5E5NA 1FRKA 1RTHA 3FFIA 2GMHA 4S0MA 2PFDA 3NG8A 3ZTRA 3MMJA 1RT1A 1JK9B 3G8SA 3DOLA 3I9V9 1AZSB 3QJPA 2AQ4A 4U6PA 4ILRA 4C2MA 2VQFJ 3M8RA 1FO1A 4KIAA 4NRTA 2E5JA 2GMJA 3U7JA 1SQFA 1R0BG 4KGXB 4USIA 4FNHA 1E6VB 2J7WA 2G9OA 2PO4A 1WDDA 1XR5A 4ZPTR 2DNNA 1ZOTA 5HROB 4BC9A 1X4BA 4IH6A 5IM0B 2I5JB 3MM9A 2M2BA 1YHQS 3R7SB 2NQPA 3A4TA 5CD4A 3HT0A 5AXNA 3R9LA 1PJ6A 2XMUA 3EVOA 3J80U 3O3LA 5KT2A 3VVUA 4WP8A 4M5DB 2H48B 2OSQA 2R4FA 3D4JA 5HLFA 2H3EB 4I68A 5D0HA 2JDJA 5KFYA 1LKZA 1RISA 1LWEB 5DM7Q 3OT9A 4UZCA 1C0UA 1NK7A 2V9WA 2W01A 1OQ3A 4DCJB 1H7WA 4DU8A 2CQDA 5L1LA 1DRZA 1FDDA 2GVZB 4F3OA 1RWUA 3UN2A 5D0EA 4R8UA 3MMBA 4DSFA 2R8KA 2NSBA 4MK9A 3IP0A 1RI7A 3JYTA 5KFLA 4DF4A 3VGUA 2V2VA 3KLHA 5ETLA 4DSEA 2VBYA 5DG9A 4IR9A 1YJRA 1RT3A 4OZJA 4UOCA 5KT6A 5K14A 1S0VA 1QM9A 1XNQJ 3MR2A 2C3PA 3A3OB 4KPCA 4KQZA 3MPYA 2B9WA 2BR0A 3ISNC 2MKJA 4DMZA 1HQUB 2DJWA 3KUHA 4IKAA 3LP2A 1ROFA 2OPPA 4DDFA 3KHHA 4CZCA 3PW7A 4IH7A 4J9MA 3UI3A 2R7OA 1U25A 2YNHB 4G3IA 4TQRA 3E01B 5D78A 4EO8A 1IBLJ 4C8LA 3HDSA 3JAMY 2DXFA 4CO0A 2BM1A 2Y1JA 3L3CA 4IH5A 3OPKA 2XMVA 3CGIA 1NB2A 1IKYB 4PUOA 3D6HB 4N47A 2D69A 1SJQA 1FF2A 3DGVA 1XIQA 2FY1A 3WZ0A 1N54B 3GG1A 2EC2A 1N32J 1NXIA 2J7UA 4WIQA 2XBPA 2CJQA 3W7BA 2D7SA 1H2TZ 3FEXB 2QYCA 3CCUS 2N4DA 4Y2IA 2QMWA 3G82B 4DCPB 3TJ8A 5B0BA 1U1RA 2IJRA 4DJBA 3CO0P 1S72S 3MAAA 4LF5F 2GMLA 4JI3F 4ED5A 1D9FA 2FHKA 1SV5B 1U09A 1DQ8A 1RTZA 3KKFA 4WKYA 2JEFA 3GSIA 4OZNA 2AF6A 2NUHA 9RUBA 4M8LA 2DR6A 2RD5C 2DXEA 5T14A 2HHHF 5GAGI 4CIOA 3J80Y 2OKQA 3N28A 4LF7J 2AIRB 4OYPA 5AE1A 1WC0A 1P1LA 2YQ0A 4O4RA 2W2PP 3W9HA 3RRHA 4OI2A 5IT0A 4X64F 1T7PA 1DTTB 4Y28C 1FWKA 4P10A 1MMNA 2CPEA 2KVIA 4K0KF 2Z58B 2KL8A 2GAGC 1CG2A 3ZZTA 4J9LA 3PJXA 3CPWR 5IV4A 3FBBA 1D9DA 1S1TB 1TUWA 1NK0A 2CVEA 1YJ7A 5GAEI 2YKMB 2R7TA 3SBMA 3OTDA 2ZDPA 2ROPA 1WACA 2QFIA 5A8WA 3KLFB 2ZM6F 4PG5A 2VBWA 5IQ6A 5J1PA 5F8HA 4I6YA 3MM7A 1UW4A 2EI5A 2RHQB 4B3SJ 1XN9A 3TNVA 3QPIA 3PJWA 2RQCA 4F7VA 2BUNA 4ICLB 2MQNA 3Q8UA 4AD6A 4QYRA 1TZ0A 3MAQA 3CD0A 3IR5B 4LF4J 3BQ2A 4ZPAA 4QR0A 2DNMA 4DUTA 4WTYA 2X3DA 4DV1J 5KFWA 2ZZTA 4IQXA 1EKRA 3VAFA 4QQBA 4LQ3A 3P6YC 4EEYA 1OYDA 4RBVA 2HPUA 2OIHA 4K4VA 5D4NA 4PYDA 4ES2A 3W1YC 2HZAA 4EU0A 2JJ4D 4FBTA 1NKBA 2QMXA 3GYXB 1IJFB 3OL7A 4ZCMA 2GHWA 2Y1LB 2ZWOA 1R6YA 4DV0F 2HW3A 1S9FA 3FEZA 4I6WA 1ZETA 3IM8A 3FBEA 4K8RA 2XHCA 5J2QB 3OUYA 4HI1A 2NZ4A 1LOUA 5ETNA 3O5TB 2W8LA 4ZP8A 3PW0A 1S1XA 2WVCA 1DTQA 5FLXU 3H5SA 1WJ9A 4TN2A 1KFDA 2IVMA 2XGQA 4DS5A 2HVHA 3HVWA 3AOCA 4EBEA 4P6QA 5KFGA 1X0FA 1GQEA 3OVSA 4CM2A 2M3DA 1Y3JA 2GIRA 4YDDB 1OYEA 3OFFA 3OTBA 4F4ZA 2MJUA 2V8GA 4ZKAA 4WZMA 1C1CB 4NI2B 2CDQA 2CJKA 3FZBA 5C25B 4ZITA 3NWRA 2GAHC 2C2DA 4UUXA 4B9TA 2XQCA 4FYWB 3R27A 4MAKA 4KH1B 3W9IA 3GV5B 3DDKA 1TP7A 2X1GA 3OVBA 1DJ0A 3NAIA 3TUIC 5SZTA 2IM1A 2VG5B 1GXTA 2BQUA 2XS5A 1F9HA 2DNLA 2CJYB 2QX0A 3OTOJ 2G4BA 5B0DA 4OZ5A 4P9SA 1TUGB 2B9YA 3KLVA 4Q2LA 2FVCA 2R7UA 1S1WA 5C7PA 2WVFA 5B0EA 2MZQA 1VQMS 1VQOS 1F2GA 3ZNUA 2R8HA 3HJVA 2WSCC 3Q2SC 2J8SA 3H2VE 1C4AA 3M8YA 3U02A 2BMBA 4DSKA 2P2CB 4ZP7A 3JSBA 2Q3PA 1IXKA 1S6PA 4WU2A 3R5GA 3KG0A 4WPAA 5AE2A 2XSJA 1HWUA 1QD1A 2VBZA 4OYAA 3MM8A 4DBQA 2DYAA 4NLPA 3CC2S 4FBUA 1XWLA 1QAIA 2Z57B 2JC1A 3R97A 5DG7A 3TZWA 3RRKA 2B8PA 4WJBA 1HBOA 4HVZA 1WEZA 2G2ZA 2F1FA 2D3OR 4FDFA 3SQGA 2Z56B 4P7TA 3HM9A 2HHUA 1VJQA 1HNVB 1RTIA 4M5KA 4ZN1A 3DRPB 1IBKJ 4CP5A 1RACB 1KQKA 2HK3A 2Z2ZA 3TA0A 2XGPA 4W92B 2VPYB 1G1XA 2XI2A 4I2PA 1X4CA 3FK4A 3HD1A 4DL7A 1RBLA 3AA9A 3CDUA 3DMJA 3KOAA 5KFQA 4ZVSB 2RT3A 3S01A 1N33J 2R8GA 2IM2A 2DNZA 4PABA 4NLRA 3SMZA 3MCSA 3T1YF 1W2IA 1VQ7S 5GMEA 3BGRA 2BJEA 3ZTPA 1CJUA 2UV8G 1M5OC 5IQQA 4FP9A 1XJWB 2LYVA 1KLMA 1VISA 4UF4A 5J2PA 1GMWD 3BBBA 1SVDA 2RNEA 1LWXA 4X4RA 2G2YA 5JMNA 1NZ8A 4RBUA 2WVDA 2LQ9A 1GEHA 9ATCB 2WOMB 1WWHA 2EG1A 1JKHA 1LXJA 4NXNJ 2Z4PA 3UDVA 2MKYA 3OR1B 1KOOA 2QV6A 3H4BA 3DLLQ 2FJBB 1MROB 3QQCD 1D8YA 1Y10A 4ECQA 3G8QA 3A8KA 3BSCA 2D9PA 2W2MP 2WW8A 4LR7A 4WE1B 1U26A 2I9SA 5KG1A 3LWMA 1RT7B 2MZTA 2BDPA 4NEYA 4CLYA 5IZHA 4LRCA 3T9ZA 5DGBA 2CQPA 5IC4B 3ITHB 2KZMA 4QPTA 4L3NA 3VHQA 4Y0FA 3DI6A 3M6VA 2F4VF 3S7RA 1FNXH 1OPIA 3RBDA 2BJDA 2EEYA 3K58A 4IFYB 1WORA 1FRHA 4TYBA 2M70A 4FS2A 5E0OA 1F9FA 1FKPA 4HT7A 3TOQA 1UVLA 1TL7B 1TMJA 2EK6A 4ECWA 4N77A 3W3SA 2DIVA 3O44A 3THVA 3CD7A 4DV7J 4NA1A 2LXUA 4CO5A 4DV4J 4BHQA 4DX6A 1IM6A 2V8VA 3K8WA 1LV5A 1KLNA 4ES3A 1S5ZA 5H9EJ 7AT1B 1JQGA 4KFBB 2ILYA 4KR0B 2K7JA 3KJVB 4JYAJ 1MWYA 1JJCB 4DL2A 2JC0A 4Q0BB 2PT0A 2ZITA 4WP9A 1LXNA 2KYZA 3GB0A 2AZ3A 3QIPB 1SJFA 1JLBA 2UVWA 1J27A 1FX4A 1NHUA 1RWKB 4LF1A 1FKAF 4J9KA 4QWBA 4W4MA 5KFVA 1XMQJ 1JX4A 3AD8C 2IAJB 3TQEA 1D0EA 1Q16B 3NEKA 1ZTTA 2VD3A 4WFYA 2EK1A 1UAWA 3BREA 4RX6A 4J9SA 2L9DA 3EZ5A 4OYOA 3TO8A 3GWCA 2ALZA 1FXDA 3VAJA 5KFSA 5FJ4A 2KRBA 4OX9F 2LLZA 3DLGA 3D3CJ 1L3KA 4YB6A 1Q0NA 3NRBA 1FCAA 1KD1T 4ILLA 3NP5A 3V5RA 5KFXA 4O0IA 3G6VA 4ZPBA 5LT5A 2HWHA 1RHRB 3N01A 4UW2A 1U0HB 1UMJA 1FWLA 1SUQB 1UVIA 2BV3A 1J5OA 3US5A 4ED1A 1VQPS 1QY7A 1YI2S 4X62F 3QSIA 2XULA 3GU0A 3R8YA 4GVLA 4QU7A 1T0TV 4B3RF 2VJUA 1VRTB 1U49A 4YS2A 2AEFA 4CO1A 2YKOA 1Q8IA 2C2NA 1RWMB 3BH7B 4YY3F 1FKOA 1PAEX 3DRSA 3N6NA 3W60A 2J0WA 3NGSA 3K5NA 2FC9A 3P8BB 4C98A 3K0JA 4URQU 1J5EF 3TA1A 1HQEB 4FXWA 4PG6A 3VVTA 2YX1A 4DV3J 3WBZA 4OMFG 4ID8A 1RWVB 1TVRB 2UZAA 1SPBP 3HK2A 3EGZA 1F6TA 3GE9A 2COLA 1K1SA 4NLOA 2CQ4A 2R7QA 2MXYA 2XCPA 3RUBL 3KLGA 1RTJA 4CLSA 1X0PA 5C24B 1R6VA 3CJ5A 3DRXA 2H54B 2ZJPQ 3KK3A 3CJ8A 4L75A 1MNEA 3GV7B 3GPAA 4AYBD 2AJ4A 1YJUA 4QW9A 1Z2ZA 1WSVA 1LWFB 2AGPA 1CQMA 3POTA 1HNXF 4ZS6A 4F2RA 2J6TA 1UEKA 2W4DA 4L73A 2WONB 2OTLS 4NA2A 3ZC4A 3UWTA 3H59A 2OPRA 2JFKA 2KB2A 1HHTP 2CDRB 2NXJA 4JV1A 2Y8YA 4NMXA 1N34J 3J7YU 3JSMB 5A0YB 1V3RA 3SSSA 1AA1B 1U6ZA 2V50A 1VQ4S 3NCPA 5L9NA 3DOKB 3HSZA 2ZD1B 3JXOA 4ZVPB 1RCOB 4JI8J 3VGTA 2R8IA 4C97A 4OYMA 2VODA 5JVHQ 4ZPDA 2XLIA 3UN3A 4ATNA 4ZHRB 3M30A 2ABYA 3G4SS 4M5LA 1KP6A 3LAKA 2CPJA 3QO9B 2ZOFA 1RSCA 3OHAA 2B9EA 4OIXA 3C6UA 1NDLA 1CC8A 2WB4A 4RR5A 4BWJA 2C1EB 2F65A 2UXCJ 3EE3A 3Q8VA 1SIZA 3EX7B 1KR4A 3IC1A 4WFZA 3RB0A 1IKXB 3AD7C 2ACYA 1JLGA 3DOMA 3KJFB 1FRIA 3MR3A 4DQSA 4FXVA 3MDFA 1HL6A 4K4XA 3MAHA 1GH8A 2HIQA 2R2TA 3PRDA 2DNQA 4DG1B 2GA7A 2ZVSA 1EARA 3CJKA 2KZZA 3OL6A 3TARA 2W9BA 4C4WA 4OHXA 1JXVA 3KTQA 2KG1A 3Q2TC 1TKTA 1FVQA 2DGWA 4Z2XA 3C6TB 1RT2B 2QSFA 4ANEA 3TAMB 4ANCA 1CJKA 2DY9A 4FXDA 1T9UA 5E3AA 3Q86A 1YITS 1N5QA 3AD9C 5AXMA 1Q5YA 1WI8A 4NOHA 3DHWC 4NYOA 1P1TA 3ETOA 2AZ1A 5HSPA 1N36F 1H72C 5CA5A 3PY8A 4WYWA 4EZ6A 1S7HA 1TQLA 1REVB 2PMHA 1RADB 2XMTA 4JI2F 3M8QA 1VQLS 2HNZB 3D54A 2DTJA 4QR2A 4WYLA 3EVMA 3N6MA 3QT7A 1B70B 1NJYA 5L39A 2ROEA 1GK8A 1P9YA 1PKUA 4KRWA 1HR0J 4UTGA 4JV0A 1Q86T 2VJVA 1UWBB 3ET6B 2F40A 1RT4A 1WF2A 5SUHA 1YGYA 2NS1B 3W65A 5A8RA 1U0SA 4ZCKA 2X1AA 2A10A 3TP2A 2V2QA 4KV8A 2DEJA 5LMNF 3SDEB 3IBFB 4RW7B 3TVKA 1U47A 2YWHA 4EI2A 2MGZA 1VQNS 1OO0B 3N79A 1HBNB 3IS9B 2HNDA 4HT5A 1CLFA 3OBIA 1K0VA 4DV5F 2P5VA 1C1BA 4OHVA 2HQCA 3KJNB 2CRLA 2VA2A 3I4HX 4MYUA 4N8OA 1TKZA 1VQ8S 2K3KA 2E1AA 5EX3A 1BE4A 1RT6B 3W66A 4LF5J 3OL9A 1BLUA 2IBKA 2HHSA 3UVJA 4JI3J 4B3OB 4GKJF 4I7FA 2CJAA 3MD1A 1N6QB 1LWCA 1AT1B 2VQFF 3RB4A 2C3UA 4JI5J 3Q8RB 1LW0A 4BC7A 3VAGA 1S97A 3CMQA 5KOXA 3H5UA 4MIWA 5CXTA 1T94A 2GQCA 2KFZA 3V2UC 2MSSA 4QWCA 1GX6A 4WXWA 4LIRA 2W9CB 2ZBQA 1WEXA 2PSZA 2WVEA 4IOAQ 1QJHA 2HMIA 1Q4RA 4U7CA 4AE5A 2RDJA 1HW8A 3GFYA 1B0VA 4LRFA 2ZC4A 1KTVA 1WDTA 3QGIA 2G0JA 5F3ZA 5DETA 4USUA 1YK9A 2C3OA 2ROGA 1QUPA 3S1TA 3PIPQ 1FX2A 5EGYA 1TL1A 2OPSA 4XPEA 1IBCB 2CJXB 2J0QD 8RUCA 3W61A 2FVQA 5BR8J 4QBUA 1X9SA 2E29A 4J5OA 4CYUB 5F8NA 1K0TA 2XMAA 3OW2R 3M05A 1TL3B 4OV6A 2JLEA 3J7Z5 4I69A 1KC8T 2PD1A 4Q7AA 1SC4B 3BYRA 1RAIB 2GGPB 3SYZA 2C2OB 1K73T 3W64A 1RXOB 4NLSA 4RNMA 2BOPA 1U1LA 2H4WB 1R8BA 2LXIA 1NZAA 4CWBA 1EX8A 2HFSA 1CSJA 3M1VB 3MM5A 4AT1B 3GJRB 4YUDA 1NH7A 4DR6J 5AE3A 3SFGA 3CJ4A 1CJVB 5B0CA 3QATA 1D09B 1Q1KA 4AFFA 5J2MA 4WU3A 2AKWB 1YVFA 4K4YA 3AXMA 1FVSA 3PHEA 4PPZA 4YB7A 2N4CA 2E1MC 3MMCB 1U1KA 1FK9B 2CQHA 1GMUA 2NXUA 5DS7A 4I6AA 4CT9A 1RJJA 3OJSA 2ZHOA 1ITPA 4ERDA 3M6UA 3HVTB 3MECB 2N3OA 3WX4A 1BMQB 1MWZA 1TK8A 4RUAA 2G0IA 3K5LA 5L1KA 5D77A 1IBLF 3JQKA 1FJCA 2R2RA 4ECXA 2XC9A 1QVFR 3BSNA 1BC6A 3B82A 4USWA 2QA4S 1B0TA 3DLKA 2K1RB 1WTBA 2VG6B 4DX7A 1T9XA 2QA4G 2J9DE 2KJWA 1HI0P 1N32F 2FJDB 1FTRA 4X4PA 1N56A 2KU7A 4A8WA 2RE1A 5C5JA 3Q22A 2AJFE 1UJ6A 3D66A 1FJGJ 3NNAA 4PG7A 1CS4B 3RR7A 1BD6A 5HBMA 4LSLB 3BJYA 4U67Q 4LSNA 1EKSA 1KKHA 1X5PA 3BSOA 1RTDB 1YRXA 3OVAA 3H7HB 2YWKA 2CFXA 3W2WA 1SH3A 5THWA 4GO5X 3MEGA 1VQYA 3M8WA 2V8PA 3H20A 3MM6A 2EWHA 4F3QA 2W4CA 2FJXA 5A76A 3HVRA 4ED2A 4DHVA 5J1EB 3HHLD 1S1VA 3CF5Q 2MKKA 2ZH1A 2FLNA 2ZHAA 5JVGQ 3DDIA 4OZ0A 3C16B 2QG9B 2E1PA 4CM0A 2M88A 1S99A 3UQSA 3VF0B 1R8CA 2XYPB 4O44B 4DL6A 3FQLA 1NU4A 5IV3A 3DYAB 3NBPB 1UKUA 1N5VA 3AOBA 1V5IB 1AUDA 4EYIB 3UPFA 4ZCLA 5F0WA 1RBOB 3M6WA 2CPXA 4MKYA 2FJVA 3QAUA 1RCXB 3C14A 4G65A 5DDRC 4RW4A 1MG7A 2E7WA 3NMRA 4HACB 1MSWD 4F0MA 4M1KA 1I3OB 2ZUGA 2OPQA 3L7UA 4ZIWA 3MR7A 1D3WA 1NPRA 1VCTA 2E5LJ 3G6ES 4A8SA 3BKFA 2MKSA 3Q24A 2EFNA 4B3SF 4P2MA 3K59A 2DO0A 2HVIA 4U7UD 2B5JB 4M5HA 4TY8B 1IKWB 3CEDA 4DQPA 1U7LA 3TAQA 4CTAB 4LF4F 3FNNA 3JTPA 3CW2C 4NPOA 2KM8C 1H74A 2VC0A 4ED4A 2VQEF 5F41A 4DV1F 3MGJA 1H2VZ 3MEEB 3IR6B 4LFAJ 3MMAA 1IUJA 1GTHA 1SKUB 4NCAA 1EP4B 2DRBA 2IRYA 3KK1B 3KYLA 4B3TJ 1YTYA 5KFCA 1NK5A 1N5YA 1MMDA 2RU9A 3BQ0A 5HK4A 1R43A 1FDAA 2H5EA 2BJ7A 2O3DA 5KG5A 3KHRA 3M8PB 4Y34A 4V19X 2VG7B 4MT1A 1RAEB 5ETQA 4ZLPA 4DFKA 4RW8B 1GTEA 3KLIA 1OMSA 1RWXB 2KKHA 4HHUA 3HT3A 1WNEA 2HFOA 1CULA 1IWAA 5HVFA 2RRNA 7FD1A 2XO7A 1HFEL 1G4CA 4KGMA 5IT4A 2LU2A 5HP1B 2YNGB 2BXJA 1XNRF 2XNRA 4ZLLA 2KHDA 4ZP9A 4YN3B 2MHNA 4LBHA 2ZH6A 1KN6A 2QYGA 2OEJA 3IGVA 3OLAA 2F9DA 2W2OP 5CZXA 2X1FA 2FLOA 1WOPA 2FHMA 4RW9A 1VLOA 3I0SA 2XI3A 4LF8J 1A9NB 1KRPA 3CUNA 3TEHB 5B0FA 1HYSB 5LSLA 2APOA 4ZVQB 3W2VB 1FE0A 4Q2MA 1B0PA 1H7XA 1DBDA 2W7AA 3PW2A 2ZKTA 4FF4A 3VZIA 4H4OA 3FCVA 2F4VJ 3I31A 1M5HA 1TV6A 2NPIA 3L4BC 4E2FB 4R25A 3OTOF 4OHZA 1NKCA 1T03B 2HNYA 4U7UK 1S1UA 1XR7A 5F9LA 3DDNA 3RB3A 5KFZA 5F8MA 1IR2A 2UXBF 4OYZA 2I6WA 1I94J 1HBUA 2BA9A 3GFXA 3CC4S 5DDOC 3VQSA 3IM9A 1SIWB 1QSLA 2MLYA 3W8GA 5DLFA 2XYHB 2GJFA 1Y5NB 2QL9B 4ZVUB 2RF2B 3HP6A 4PXEA 1HPZB 4KH0B 5A8KB 1S49A 2XYGB 1D1UA 4N41A 2XM3A 1JLFA 1UL3A 2IVYA 1RTHB 3DM2A 2LQ8A 3FFIB 3G96A 1WUUA 2B3TB 3P49B 1SL2A 3IXQA 4M5JA 1RT1B 3KMQA 3BQ1A 3DOLB 1T8EA 2M5YA 2DNHA 2F3JA 2UUBJ 2IMOA 6FD1A 2M8DB 3HHLA 4NLXA 1WSRA 1IJEB 3UCZP 2H4YB 4F3MA 4B9VA 3T3FA 3A3PB 4R0JA 3BGFA 2FPHX 5CCMA 3D0IE 1OJ4A 2LQBA 3MM9B 5IT9U 3FBFA 5KG7A 3F41A 4OLOA 2MYFA 4XDDA 3TZZA 1V6HA 1U1MA 1IBKF 3DRRA 4L6V3 1JWWA 3VQTA 3B4MA 4M63A 3UR0A 1BQMA 3M2RA 4MK7A 3SSQA 3OV7A 2AJ0A 2NR0A 1EAYC 2BKOA 3GJSB 2MKHA 4CI0B 3D67A 2V2ZA 4F67A 1WKKA 1FRJA 4DL0C 5L1JA 3GV8B 1UZHA 5HLFB 4DR4J 1X8DA 4P73A 2HHXA 1M5KC 3UN5A 1N33F 2IDEA 4LJMA 1W2BR 2AU0A 1C0UB 3HCXA 3CMAS 3VTIA 2W1BA 4ELUA 4X62J 1UA0A 4BWMA 3DKDA 5DQHA 3A8JA 1S57A 4ED8A 3BPDA 5CYJA 4P71A 4R8UB 3MMBB 2DGQA 2L41A 4G1IA 3ZZOA 2E5HA 2P8IA 3HFZB 1U48A 3JYTB 4DUYF 1L5UA 2ZC3A 3GG0A 3KLHB 2HGNA 3MFHA 4LF2A 1X9WA 4QYZJ 3NOCA 3RAMA 3LAMA 1RT3B 3CWJA 1J5EJ 2DNYA 2RQ4A 5K14B 5DQIA 1J2VA 3TR5A 5DDQC 2W9AA 4X66J 2C3YA 1HD0A 2LVWA 3QRRA 1UETA 4UQTA 1JLCA 4ED7A 4EO6A 2M8HA 3LP2B 2OPPB 4P2XA 3DNCA 3MPUB 3K17A 3PYDA 1WELA 4ELVA 3M8SA 3PX4A 5HMXA 3EMTA 1UCNA 4EBCA 1JLEA 2LDIA 4K59A 2CPZA 2DITA 1S77D 1GT8A 4I64A 2KO1A 4A4JA 4TLRA 2UUAJ 1ULRA 3M8ZA 4H4KC 4PUOB 5DO2A 2LA6A 1U6FA 3BBCA 4CLWA 2KVQE 2BVZA 1T05A 2JNJA 5ETMA 3GLJA 3W9JA 3E2EA 1XMBA 2RILA 1U1QA 4PR6A 5L46A 3TUPA 3GFHA 4IR1A 1VOMA 2ZBCA 1Q78A 3ENWA 1G3OA 3N6LA 3ZZYA 2DH8A 4O3PA 2ZH5A 2OFHX 4ZN3A 4DV7F 4CO4A 4DPXA 1TELA 4A8XA 5EWFA 4DV4F 4DR2J 2IYGA 3ILIA 3G2XA 1YG0A 4UZBA 4RW6A 2FC8A 3PO5A 2FIUA 2FD2A 1WG5A 3V4IA 3GFZA 3MAAB 1S9EA 3BN7A 4LR8A 4JYAF 5ETOA 3SXLA 3QT6A 3J81j 2NYIA 3P5TL 1PJ5A 2LP4A 4DS4A 3PACA 3L9ZA 3LANA 1RDRA 3T5HA 3H0PA 3NWGA 3AXKA 1VQKS 4JI0J 2XWXA 2LEAA 4KHRA 1M5PC 3CMES 2J0XA 3AB2B 1W25A 1VLYA 3SSRA 1S10A 2DKOB 4NWBA 1Q79A 2HVDA 1XMQF 4NLUA 3AHPA 2DGVA 2VPXB 2VF3A 2MQMA 2OMOA 1YX2A 2C22A 1HA1A 1FFWB 2MSTA 1HMVA 2XZWA 2DNOA 4KO0A 1FRLA 2ZBRA 4LMZA 1SH2A 4UOHA 1N88A 1X9MA 4IRKA 3J7AN 3NAHA 2B4PA 3W5YA 2V67A 2YKNA 5GVQA 3O2IA 2RMLA 3S6EA 1FXRA 3PM9A 2O01C 2GNKA 4YP3A 3DHXA 3HHDA 1B4SA 4A8OA 5D4LA 1ZA2B 1CPZA 2ZZNA 1DQAA 1NJIT 1Q5VA 3CDAA 2GQ2A 5A8WB 1DURA 1TKXA 3R2DJ 3MM7B 1RAJA 2QLXA 2FVRA 3T1HJ 2HFNA 2RVJA 5KFTA 4YB1P 4EGLA 2UV8A 2HVZA 3K2YA 3BSAA 5DLGA 5F3TA 4OYBA 1RU2A 4PWDA 2VASA 2FUG9 4C11A 4GC6A 4JI2J 4NLGA 5KFFA 3LP0A 6AT1B 1MWQA 2FJAB 4QJVA 3UD3P 3KMSA 1PYOB 2CZ4A 2YNFA 4OX6A 2AMCB 5G0RA 2QZ8A 4HR2A 2OD4A 2FTRA 2FQQB 1NBEB 4DV3F 1JJ4A 1OSDA 3C46A 4X4UA 3GIIA 2B51A 2PEBA 1RKJA 1EETA 3I0RA 3GILA 2C2EA 1ZPWX 2B0GA 2XG8A 4EYHB 2JFDA 2G0CA 3BB5A 1RWPB 4USMA 3OUYB 1X4AA 3GJQB 2IJFA 1H73A 4FN5A 4UQGA 2AV5A 2IIHA 3JAMU 1S6UA 2DGOA 3HHNB 3U1MA 1S1XB 1R31A 1DTQB 3NLCA 2Z8QA 3TI0A 2NXEA 4DV5J 5K20B 5M2PA 3T41A 2O67A 2BYCA 4K7QA 3D0GE 2VPZB 4GVBA 1FEHA 1NMEB 1TL4A 1WHVA 2AEJA 1VBZA 2W7PA 4DFMA 1Q8KA 2OEMA 1N34F 3HI9A 3H98A 5D6GA 4CT8A 3TYTA 2WBRA 4TVAB 2OHDA 4HKQA 4GKJJ 2XMJA 1U1NA 4NA3A 3U1LA 4IFVA 1PILA 3DN9A 3LGMA 3EYZA 5G4DA 1REGX 4IUFA 2YNIA 5K5MA 1Y7PA 3SI8A 4ANDA 4JI8F 1RAOA 2BW2A 2ZKUA 3TZYA 1EJ7L 1OIAA 3KG4A 2MZRA 4TU7A 1TFYA 2EBEA 3C15A 4DSIA 2MDAA 3IA0A 4PG8A 3J7ZT 1Q8BA 3PKYA 3EXCX 4D3HA 3BO3A 3DXSX 2XTJP 5HMYA 4V1Ak 4B9LA 1NHVA 5BYQA 1S1WB 3QFHA 1HD1A 4L76A 1AFJA 2UXCF 2FHJD 1V3ZA 3HX9A 5C2GA 1UVJA 1ACMB 1HWLA 4O3SA 5L38A 3UD4P 2OUGA 3R5AA 3RW7A 2LA4A 3OFGA 3H8YA 1S6PB 3NS6A 3CJQA 2E7VA 4PYAA 1A6LA 4QW8A 4DPUA 5KFMA 1R8HA 2EG2A 2ZH3A 1C2PA 4ECTA 2XSJB 1RP5A 3MM8B 3ENAA 5KT4A 3MEDA 1VRQC 4NZ7A 2VIHA 4CO3A 2L3MA 1SXLA 2V4QA 4OHWA 2L48A 3FUYA 2CQBA 2KTQA 2QTWA 1Q8LA 2R7XA 4JI6J 5HVHA 2ZWPA 1HBOB 3PYFA 5HQ8A 3MXHP 1FI4A 3SQGB 3I82A 1NDKA 3RGIA 1RTIB 4OJ1A 3K5PA 3LPEA 3Q8SB 4RNFA 1S6QA 5M2UA 1VC5A 2ILZA 3W63A 1VRUA 2CNOB 3QRPA 1HNIA 1HWJA 3TWZA 2CJ9A 4DX8H 2LKZA 4I2PB 4IQMA 2Q79A 2J9DA 1NM2A 2E1CA 1NCLA 3ILLA 1S9GA 4Q5VA 4OHYA 3DMJB 3PW5A 2BX6A 2YKAA 4GMKA 1HIYA 4R5PA 3TVYA 1HR0F 3JQMA 4ZVRB 4GO7X 3TA2A 2HYIB 1XEZA 4JI7F 2UXDJ 2JVOA 1CJUB 3C66A 1YWXA 1KLMB 5J2PB 4YHHF 3GTYX 2AYEA 2OFGX 3BO4A 3R5DA 3PDNA 1RAHB 3GQCA 5KFNA 2RH3A 3VALA 1CJTA 4Q44A 1FTCA 2BKNA 2R7RA 4XK8C 1HNWJ 1EQMA 2MB0B 4NXMF 4MTPA 3HLUA 1JKHB 3HJFA 2G1DA 4NMLA 1HW9A 1NSPA 3OXFA 2OLWA 2BJ9A 5EHHA 2ZH4A 4DEZA 2JSXA 4MIAA 1N0VC 4I4BA 3G9CA 4I2QA 3PXGa 2CYYA 2H5JB 3AB4B 4KGKA 1D8ZA 3BDEA 4ZLNA 2CJBA 1Q82T 3CVKA 3CCMS 2YY3A 5IOLA 3DGPA 5H9EK 1TAUA 4JI5F 5CZVA 5KFPA 3H25A 2NUUG 4DU7A 4PQUA 1O5JA 1ZAWA 2KYXA 1X4GA 3KWMA 1JLQA 4NYPA 5KFDA 1NNDA 1L3SA 4YR2A 3DI6B 1RUSA 3ZFVA 1GAOA 3D1QA 4X4QA 4NRUA 2EXUA 3U1NA 3VAIA 3MCOA 3CJRA 1BQXA 3KHGA 3L7OA 2K7KA 1N48A 2GVDA 4X4OA 4JV2A 4PPDA 3K57A 3E3XA 1FKPB 1FNOA 1OPZA 2CPFA 2BZ2A 4YB5A 4XIUA 2Q6CA 4ECUA 2LMIA 1WD6A 2RQKA 1VC0A 3CCLS 2MQPA 1YJNS 5KTQA 3R5JB 1WHXA 1PYSB 4WWSA 2VICA 5BR8F 3GIRA 4K2XA 4QIWD 4DLEA 5D4PA 2MQ8A 1MMLA 2K8GA 1O0PA 4M5IA 5BYRA 1TFWA 3I5BA 1WOOA 4CH0S 3CCQS 1N0UA 4P2FA 3MF5A 1JJ2R 1E6YA 2D41A 3EICA 1KQGB 1JLBB 4AXIA 1KVJA 1T3OA 3LP1A 2OH2A 3KDOA 2CKWA 5I3UA 5E33A 2VQEJ 3KLEA 2HURA 1R27B 1NH8A 5H9FJ 4DR6F 2MHEA 1M90T 2GJ2A 2D1CA 1HNZJ 3MR5A 2A18A 3EDRB 2QGFB 1VHFA 3UDLA 2HGMA 5B09A 1NJWA 4NLTA 4X4SA 4RNHA 3F44A 2RAQA 1T9YA 4K2JA 3DLGB 4A8YA 3QIDA 5C42A 3AJ2A 4O3OA 3BN4A 1S12A 1WC5A 1PG5B 2PEHA 3EGWB 2LEPA 3WIUA 1LW2A 1SL0A 1YRTA 4IDKA 3PR4A 3H40A 4DZDA 4RU2A 2WK4A 3R6LB 2ZOMA 2NSCA 4OJGA 1J5OB 2X3GA 7FDRA 1UWAA 3SQOP 1GXLA 2KT5A 5LSRA 1I5OB 3P4UB 3AY0A 1XNRJ 2AYGA 3CC7S 2GHVC 2M52A 5IC6B 4DFJA 4LF6F 1NAQA 2HGLA 4DF8A 1QUVA 2DEIA 3PEHA 4C8ZA 2BE7D 2MKCA 4DL4A 4PXBA 2WRMA 4HHHA 1DARA 2J8AA 1FKOB 1MLAA 4C3LA 3DRSB 2GV1A 1SC1B 5I3QA 3M32A 5KT3A 3UCUP 4TXSA 3CJSA 4URGA 1Y3KA 2P6TA 1FJGF 4M5MA 3MFIA 4HL9A 3NKYA 1FD8A 1RGVA 2DPIA 2AGOA 3ZTOA 2YQ1A 3SV4A 1U02A 3PHTA 4F4AA 1H3DA 1HWIA 3P3DA 2LDYA 1VI7A 2LU1A 1RHMB 1B64A 3AODA 5E3RA 4QIEA 5KFUA 4PAAA 3IWLA 2IY5B 2DHXA 2XNQA 4LFCJ 2AX1A 5GADU 4YFUA 3EM1A 2CVIA 1TU0B 1NJZA 3KLGB 3MTKA 3GMGA 4RBTA 1RTJB 5D3GA 2UXBJ 3CXCR 1N5TA 3KK3B 1YZ6A 4P7VA 1X4EA 2BABA 2ERRA 5CH7B 1MN9A 3ADAC 4L72B 4LRBA 2XWYA 3POTB 1VGYA 3ZZRA 2EKNA 4R0EA 4UOGA 1RLCL 4HTIA 4LVNP 4ECVA 5EX0A 4ILMA 2OPRB 5D0GA 2PI4A 1A0OB 1IM4A 1KHWA 1P27B 3RR8A 2P9GA 1HI1A 4H4MA 4ZVEA 4CLTA 5JUMA 1Y4ZB 1RHJB 2QC3A 1AROP 2RJZA 3EWGA 2QRRA 4FF1A 1S59A 2YH0A 1FFSB 2CAJA 1X4FA 1H38A 3FMBA 1S0OA 2V6AA 5ADZA 3ZNJ1 2ADBA 2HRYA 4G1QA 3AAWB 3DLEA 2RQMA 5L1IA 4NLWA 2VU5A 3M30B 5HATA 4C8OA 5CHCB 2YWGA 4PG4A 1RAGB 2CZ9A 4WKRA 2E5LF 1IN0A 2V94A 1VQ6S 4KGVB 1HLWA 1SQGA 3C6UB 2ASDA 4DPYA 2R9LA 2F63A 1PJ7A 5A2QY 4DQRA 2C2ZB 4J7CA 2MQOA 1FFGB 3P45B 2MLXA 3WIVA 3OD2A 3G71S 4IG0A 4TKTA 4RKUC 2UUWA 1Z1ZA 1TMMA 3PW4A 1JLGB 3FMWA 3B6BA 3FEYB 3QAEA 4LFAF 3DOMB 2DCLA 4Y2KA 5K8NA 1QLNA 3JTNA 2VL1A 3DYAA 3IWXA 4IYQA 4B3TF 4KB7A 3F73A 3ISZA 4IG3A 1RQ0A 4OFZA 2XCAA 2CPYA 5HAOA 1XK8A 1YLXA 3IO1A 1VBYA 4HDHA 4DUYJ 2J7KA 2B4VA 3CJKB 4OI3A 3HHKA 1D9AA 2W9BB 2F7VA 4KAIA 2VV5A 1TKTB 2V63A 2ASLA 2RHSB 3HSJA 1CJKB 1OQ6A 2K3IA 1BQNA 5B0AA 2F8EX 1U4BA 4QIGA 4A8MP 2RS8A 3JQJA 3ZZPA 3M8QB 2HBRB 4KY3A 4A8KA 2NCKL 5JXSA 3IRXA 4LF8F 2DNKA 2MZSA 2HS3A 3M2VA 3TW0A 3BZQA 1PIEA 3VR1A 1EIYB 3PZPA 1F9EB 2A2DA 1TUVA 2I0XA 3WHIA 1YJVA 1RT4B 3UO0A 5F8LA 4FVCA 2HG4A 3UDEA 5A8RB 3R6GB 3T19A 3ENVA 3V6JA 4N5SA 4KV8B 3GIJA 6FDRA 2VC1A 1FDBA 3CCWA 1XERA 4EBDA 2AYMA 2MGZB 1I94F 2HNDB 5IXUA
chains in the Genus database with same CATH topology
2GHPA 2HFOA 4DV6F 3N9UC 2D3UA 1FHTA 5GAHI 5K8OA 3CULA 4B9SA 5I4MA 4EZ9A 1C1BB 3OTDA 2ZDPA 2ROPA 1WACA 4ID5A 1T02A 2RRNA 4WK1A 2K2PA 3ZZZA 7FD1A 5A8WA 2XO7A 1HFEL 1HWKA 4HEA9 4RWWA 4KGMA 3KLFB 5IT4A 2LU2A 5HP1B 4TQSA 2YNGB 3LQVA 2BXJA 2YKPA 2ZM6F 4PG5A 2VBWA 1TKZB 5IQ6A 2RUGA 5J1PA 5F8HA 4UY85 4I6YA 1QSSA 2PE8A 3MM7A 1UW4A 2EI5A 4KFBA 1XN9A 3TNVA 2CQ3A 1Q7YT 4D3GA 3KJVA 1XNRF 2XNRA 3QPIA 3Q23A 3PJWA 1APSA 2RQCA 1TAQA 2KHDA 4ZP9A 2BUNA 4ICLB 3LOUA 2MHNA 2MQNA 2W7OA 1F60B 4QYRA 4Q0BA 3FVYA 4NLVA 1TZ0A 2ZH6A 4B9UA 3MAQA 1KN6A 3CD0A 3IR5B 1JMTA 1DHMA 4USHA 3CDBA 3BQ2A 4ZPAA 4QR0A 1XC9A 3IGVA 3OLAA 2DNMA 1M1KT 3QIPA 3OSNA 2F9DA 4I7FB 4F25A 5CZXA 3GYNA 1WHWA 4WTYA 2X1FA 2FLOA 1LWCB 2FHMA 4RW9A 2IVFB 1E6YB 2XY7A 3CCSS 3I0SA 5KOWA 2Y1IA 1LK5A 5KFWA 2UUBF 2XI3A 4IQXA 1LW0B 2ZE2A 3VAFA 1A9NB 3LP1B 1KRPA 5I3UB 3CUNA 3N4WA 4QQBA 1VK8A 5LJ5Y 3KLEB 4LQ3A 5B0FA 4EEYA 1HYSB 5LSLA 2RKIA 1AXQA 2APOA 4RBVA 3P6YC 3TRGA 3W2VB 2HPUA 2OIHA 4K4VA 1FE0A 4Q2MA 5D4NA 1B0PA 2IAJA 1H7XA 1DBDA 3FRYA 4ES2A 3Q0AA 3HXMA 1SKRA 2W7AA 4EU0A 3PW2A 4U9RA 2UVUA 2ZKTA 4FF4A 2J76E 2JJ4D 3VZIA 4H4OA 4FBTA 1NKBA 2QMXA 3I31A 3GYXB 1M5HA 1TV6A 3R1HA 1IJFB 3OL7A 3D1OA 2NPIA 3T1AA 2DHSA 2KDOA 4ZCMA 2GHWA 2I8EA 2E9TA 1V3SA 2MPUA 1R6YA 1WI6A 4R25A 2BE2A 4DV0F 4ECZA 3OTOF 1S9FA 2HW3A 1VS3A 3DFEA 2L9WA 4H54A 4OHZA 1NKCA 1T03B 2HNYA 3FEZA 4U7UK 1S1UA 2OO4A 4I6WA 4WZQA 1ZETA 2HMIB 5KFOA 4ZPWR 1XR7A 5F9LA 4AUKA 3DDNA 5J2QB 3OUYA 3RB3A 2D3ZA 4O3QA 2XMMA 4HI1A 4B17A 1JB0C 2V4JA 5KFZA 2NZ4A 1LOUA 5F8MA 5A6WA 1C0TA 5I42A 4MKAA 3O5TB 2UXBF 4WFBQ 4QWEA 2W8LA 3J7A1 4ZP8A 3PW0A 2ATLA 5C42B 1S1XA 1HBUA 2BA9A 1DTQA 3GFXA 1QE1A 3H5SA 2JVRA 1Y0HA 4TN2A 1KFDA 2DH9A 2IVMA 5DDOC 3CC4S 3VQSA 1SUQA 2XGQA 1TL1B 5GMKa 4K4SA 2OPSB 1FJ7A 3LPYA 4DS5A 1LW2B 2HVHA 1SIWB 1QSLA 5DLFA 3HVWA 2FVSA 2W8KA 2CQ0A 3HKWA 4DR4F 1KFSA 4E0DA 4EBEA 4IDKB 4P6QA 1Y5NB 2EW9A 4WFAQ 3I5CA 2QT7A 4LVOP 1O8BA 2RF2B 4PXEA 4TLQA 5KFGA 1HPZB 3HP6A 1X0FA 1DFDA 4LF9F 5A8KB 1U1PA 2KN4A 1S49A 1D1UA 1GQEA 3OVSA 4N41A 1KVIA 1ZM2A 5HMZA 2DHAA 2M3DA 1Y3JA 1ZBTA 2GIRA 3A8EA 4YDDB 2MZ1A 3OFFA 1U24A 3OTBA 1JLFA 3CCVS 1UL3A 2IVYA 2PA8D 2RDIA 4F4ZA 5HMWA 2AWZA 1RTHB 3DM2A 2MJUA 1HBMA 3KNAA 2VFSA 1TR0A 2IJNA 2V8GA 3FFIB 1HHSA 4ZKAA 5IFMA 2CQGA 2B3TB 3G96A 1ZZNA 3P49B 2B4UA 1SL2A 2MQQA 5KFKA 4WZMA 3IXQA 4I67A 1N5SA 1C1CB 1JNZB 1RT1B 2CDQA 2CJKA 3KMQA 1WHYA 3BQ1A 2DRAA 4GKKF 3DOLB 1T8EA 4USJC 1VRTA 4YR3A 2M5YA 4EWTA 3FZBA 5C25B 2JZ5A 4QR1A 2OD6A 2C2DA 2J6UA 4KJIA 2YQ3A 2DNHA 4UUXA 4LFBF 1IBMF 4B9TA 2F3JA 1CQNA 2MQLA 1IQZA 2IMOA 3R27A 2CPIA 6FD1A 2M8DB 3HHLA 2CPDA 4NLXA 1IJEB 1R0AA 2CG4A 3MM5B 3UCZP 4MAKA 1F5AA 4F3MA 3GV5B 3WC2A 4B9VA 2XS2A 2X51A 3DDKA 1X5TA 1TP7A 2X1GA 3OVBA 1HQEA 3M32B 3CTRA 3T3FA 1RT5A 1PGZA 2JRSA 3KHLA 4R0JA 1DJ0A 2YX7A 3BGFA 3NAIA 1FESA 2G13A 3TUIC 5SZTA 2RU3A 1XNQF 2VB6A 2FPHX 5CCMA 1FDNA 2IM1A 2VG5B 2DR8A 1GXTA 2BQUA 4AL6A 3OR2A 3D0IE 2XS5A 1TVRA 2DNLA 1G7CB 2LQBA 3MM9B 4B08A 5J2MB 4NL5A 3RAXA 3NNHA 4KPYA 3NS5A 5B7WA 2G4BA 5KG7A 5B0DA 4OZ5A 2B9YA 3KLVA 1H98A 4HYKA 3F41A 4X66F 4OLOA 2AJ1A 2MYFA 1R89A 4XDDA 4Q2LA 3UE2A 1V6HA 5B08A 1U1MA 1IBKF 1UA1A 2JWNA 3DRRA 3EUNA 4L6V3 2Z2MA 4OI4A 1JWWA 3DLHA 1WF0A 2FVCA 3VQTA 4J9NA 3B4MA 4M63A 5C24A 2R7UA 4OX8A 3UR0A 1SJRA 1S1WA 1BQMA 3M2RA 4MK7A 3SSQA 3OV7A 2J6SA 3EPGA 5E3CA 2AJ0A 4I0WA 3EXYA 2NR0A 2OAUA 2MKHA 4CI0B 3LWLA 5D3GB 4F67A 3RAQA 4NCGA 2MZQA 5B0EA 1VQMS 1VQOS 1F2GA 1FRJA 4DL0C 5L1JA 1LWFA 3GV8B 2V9KA 1IKVA 2R8HA 5HLFB 1ZPVA 2WSCC 1X8DA 3Q2SC 2HHXA 3H2VE 2LEBA 1C4AA 1M5KC 1BGXT 3D1HA 2WONA 3U02A 1UJ4A 4DSKA 1L3UA 3BM7A 4ZP7A 3JSBA 3N0VA 1N33F 4LJMA 2Q3PA 4OJHA 2CPHA 1IXKA 4Z37A 1W2BR 3RZAA 2AU0A 1C0UB 3CMAS 4RZRA 3VTIA 4CNZA 1S6PA 4X84A 4PWUA 2UUAF 3P96A 2PFFB 2FHOB 4WU2A 5T7LA 1H6KX 1X4HA 4ELUA 1UA0A 1PC5A 2AYBA 2IC3A 3KG0A 4BWMA 3TAPA 3JSMA 5CYQA 4O3NA 2Q1LA 5A0YA 5KG3A 5DQHA 2KG0A 1FA0A 5AE2A 2RSQA 5FDLA 2XSJA 4ED8A 3DLKB 4H4MB 4O3RA 1HWUA 2QA1A 2VBZA 2JEGA 3T5LA 4C9DA 4MFBA 2DGTA 3MM8A 5CYJA 4DBQA 3GSDA 4R8UB 3MMBB 1XBWA 2DGQA 2L41A 3DOKA 3I4PA 4NLPA 2ZD1A 3G8TA 4G1IA 3ZZOA 3UCGA 3CC2S 3M9NB 2E5HA 4FBUA 1XWLA 1QAIA 1U48A 3PR5B 5M2RA 2JC1A 3JYTB 1ZM9A 4DUYF 1L5UA 5DG7A 1BWEA 2E1RA 3J7YI 2BQRA 2ZC3A 3GG0A 3H5YA 3KLHB 4QWDA 3RRKA 2HGNA 3MFHA 3DXBA 1X9WA 4QYZJ 4WJBA 4KSEB 3RAMA 1IR0A 3ICLA 2B7BB 3LAMA 1RT3B 3CWJA 2DNYA 2RQ4A 4ZHRA 4G1QB 1HBOA 5K14B 2W24A 2R2UA 4HVZA 5DQIA 4DR2F 3DLEB 1J2VA 1WEZA 3GR1A 3TR5A 2F1FA 3GR0A 4PXCA 3IWNC 3MI7X 2D3OR 4GC7A 1DQ9A 3MHYA 3SQGA 4OV1A 1VJWA 5HBMB 4P7TA 3I32A 4Y65A 3TUJC 2GO8A 2L08A 3QO9A 5DDQC 2W9AA 3HM9A 3PX0A 3I9ZA 2HHUA 3CD6S 2VFVA 1HNVB 1RTIA 3DRPB 4BCAA 2C3YA 1S0MA 1HD0A 4LSNB 2LVWA 3PX6A 1Q7LB 1ZM3A 1KQKA 3J81Y 1NEEA 2HS4A 3QZ7A 1UETA 4UQTA 3TA0A 1JLCA 2XGPA 2JHEA 3W2WB