2CPYA

Solution structure of rna binding domain 3 in rna binding motif protein 12
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
114
structure length
114
Chain Sequence
GSSGSSGEGDVNSAKVCAHITNIPFSITKMDVLQFLEGIPVDENAVHVLVDNNGQGLGQALVQFKNEDDARKSERLHRKKLNGREAFVHVVTLEDMREIEKNPPAQGKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords RNA-binding protein 12
publication title solution structure of RNA binding domain 3 in RNA binding motif protein 12
rcsb
source organism Homo sapiens
total genus 15
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2cpyA01
3SDEA 2E5JA 3SMZA 3TP2A 2N7CA 3IRWP 2FPHX 1WELA 3TYTA 2MZTA 2LYVA 2G4BA 1WF1A 5BJRA 2XS7A 1M5PC 4QQBA 1VQ5S 2MXYA 2X1FA 1H6KX 1VC0A 1VQKS 3ZZYA 1X5OA 3VAFA 2MYFA 1KQSR 1U1PA 3G8TA 3CCVS 2LMIA 2CPIA 2I2YA 2L41A 2DO4A 2KT5A 2O3DA 1Q81T 3K0JA 4C4WA 1WHXA 5LJ5Y 3B4MA 1WG4A 1M90T 1JMTA 4FXWA 4LJMA 4YB1P 1FNXH 2NLWA 3R1HA 3NS5A 2M9KA 3FEXB 3CCRS 3J7YU 3U1LA 2CQBA 3L3CA 5H1SV 2MQNA 2YH1A 1UW4A 2M8HA 1G2EA 3CPWR 3S7RA 1B7FA 3CC7S 2CPXA 2CQIA 2YH0A 1CVJA 3NS6A 2G1DA 4ERDA 3DLLQ 3Q2TC 2CQ2A 1U1RA 2YTCA 1M1KT 4BS2A 2CPDA 4Y0FA 5LSOA 2XNRA 3MOJB 2J76E 1X5TA 1FXLA 2DNOA 2DNYA 3V4MA 3CCSS 4IOAQ 5LSLA 2ADCA 1YHQS 4IUFA 3LPYA 1Q86T 2CQDA 3UCUP 4PR6A 1ZZFA 2DGXA 1FJCA 1M5KC 1D9AA 2CPHA 2LCWA 2AYEA 2J8AA 1HD0A 3CCMS 5DDPC 2J0QD 2CQCA 1VQOS 3CCLS 4WCEQ 2CQGA 2DGVA 2MQOA 3CCQS 1Q7YT 4YUDA 1VQ8S 1YWXA 4C0OC 3R1LA 2DGUA 2XS5A 1YTYA 5CXTA 2N82B 2AYMA 1WF0A 3EGNA 2LA4A 5CYJA 1X4BA 2XB2D 1X5SA 5GAHU 2DH9A 3CULA 2ERRA 2DITA 3MXHP 4LMZA 1SJFA 1OWXA 2KXNB 2G0CA 1U1OA 1WEXA 5LJ3Y 1P27B 2DO0A 1WEYA 1DHMA 3G6ES 2VONA 1OO0B 1SJRA 3MDFA 2MY7A 5HO4A 1KOHA 3EX7B 1H2TZ 2B0GA 2KM8B 2AD9A 3NMRA 4OZ0A 4WKRA 4WFBQ 2LKZA 1FJ7A 2CQHA 2CQ4A 2LXIA 2LEBA 2M52A 1SJQA 3BO2A 2VOOA 2VODA 3HI9A 1HL6A 1X4HA 2M0GB 4TU9A 4CIOA 2DGSA 2CPYA 2DNMA 2MJNA 4F26A 1KOOA 1WF2A 2N3LA 2U1AA 1RKJA 2MKIA 2HYIB 3LQVA 2XNQA 1X5PA 3MUMP 3J7ZT 5IM0B 2JX2A 3UCGA 1VQMS 4LIRA 3BO4A 4WIIA 2MGZA 2CJKA 1X4EA 5CA5A 2V94A 2MZJA 2DGTA 1X4DA 1YJ9S 2BZ2A 2RS8A 1WWHA 3U1MA 2ZJPQ 3BEGB 2OJ3A 3PIPQ 1U1MA 1W2BR 2M70A 1NO8A 2E44A 3G4SS 3CCJS 1A9NB 3CD6S 2F9JA 2D9PA 4CH0S 4W90B 1WG5A 2DGOA 3S8SA 2EVZA 1WI8A 3MUVP 1ZZNA 1VQ6S 2DHSA 2KXFA 3PIOQ 5JVHQ 4ZKAA 3VAGA 3BO3A 5DDOC 5ITHA 5D78A 2PE8A 2XSFA 1K8AT 1R8HA 2AYBA 1URNA 5GVQA 3US5A 1WTBA 2MKSA 2DISA 2HGNA 4OZ1A 2CQ3A 2CPFA 1N8RT 5DETA 3ULHA 3RW7A 1P1TA 4PKDB 2KH9A 1S72S 1YIJS 1KC8T 2A3JA 3UD3P 3G71S 1DBDA 5GAEU 1WEZA 3THTA 1U1QA 1JJ2R 1WHVA 1QM9A 2M8DB 2WBRA 2HGLA 2MY8A 3S6EA 2JVOA 1X4FA 2DGQA 1SXLA 2DNQA 3MURP 2RUGA 1VBZA 2MQLA 3FEYB 2LEAA 2DIVA 1NU4A 3P3DA 1L3KA 4V19X 2CPZA 3UCZP 4P6QA 1VQLS 2RVJA 4IOCQ 2DNGA 1PGZA 2LECA 3N9UC 2DHXA 2MZSA 5JVGQ 2OSRA 2DH7A 2F3JA 1X0FA 2KYXA 3JB9k 1UAWA 4WFNQ 1OPIA 2M4MA 4RU2A 2U2FA 1JJ4A 3VAMA 2RQCA 1YJWS 2EK1A 4W92B 2ZJQQ 1NJIT 2DGWA 3SXLA 2DIUA 2DNRA 3G9CA 1VQ9S 3TO8A 4U67Q 4QU7A 3HHNB 2MMYA 1U6BA 5HL7Q 4Z2XA 4A8XA 2DH8A 2RU3A 2OTJS 2LXUA 4YOEA 2MZQA 2MZRA 5EN1A 2DNKA 3NNCA 2L9WA 1YI2S 3NNAA 1FHTA 2DNPA 2MKCA 2OSQA 1WHWA 3MD1A 1U2FA 1D8ZA 1WHYA 2RT3A 2LA6A 4EGLA 5DDQC 3EGZA 2CQ0A 3CMAS 4TLQA 3CUNA 2OIHA 1FJEB 1JJHA 3NNHA 3MUTP 2MQMA 2CQ1A 5FJ4A 2X1GA 2X1AA 1UFWA 1BY9A 1S79A 2J0SD 2JRSA 3BS9A 4IO9Q 1K9MT 2NZ4A 2HVZA 4F25A 2UP1A 5GMKa 3IWNC 1A7GE 1N52B 4TU7A 3I55S 1PO6A 2K3KA 1VQPS 3MI7X 1X4CA 2MHNA 2L08A 1M5VC 1AUDA 1IQTA 4J5OA 2RS2A 2KRRA 1F9FA 3P5TL 4CH1A 2DB1A 3DXBA 1OIAA 2D9OA 1U1NA 1DZ5A 3Q2SC 2XS2A 2VOPA 3B4DA 5IQQA 2KG0A 2FY1A 1U1KA 3S01A 2EK6A 3SDEB 2JWNA 5IFMA 5DDRC 2YWKA 2F9DA 1FO1A 2M7SA 1O0PA 5GADU 1QVFR 1XN9A 2YKAA 2MQQA 3R27A 1VQ7S 2MGZB 3CMES 3VAKA 2DHAA 2DK2A 2FC8A 3G8SA 1H2UX 3MD3A 5GAGU 2Q79A 2MZ1A 1VQNS 3H2VE 1X4AA 2MJUA 3VAHA 4PRFA 2KI2A 2KN4A 2X1BA 1VBYA 2RRBA 2N3OA 1M5OC 2M88A 1N54B 2E5IA 3CC4S 4F02A 1K73T 4ED5A 2QFJA 3VAJA 2ADBA 2SXLA 1VC5A 3P49B 1FT8A 1H2VZ 2MSSA 3CTRA 5MLCV 2MQPA 3OW2R 2KU7A 2JVRA 3THPA 3VAIA 2HGMA 1HA1A 2KM8C 2MSTA 2KHCA 3UD4P 1U6FA 2OTLS 4UQTA 2QEXS 1VQ4S 3RW6A 2BOPA 4QU6A 1DRZA 2MPUA 2CPJA 1Q82T 1N88A 3H2UB 3VALA 2DNHA 1YJNS 3P6YC 3CF5Q 2RRAA 1WI6A 2MKJA 2KFYA 2E5GA 1YITS 4M5DB 2CPEA 1WG1A 2DHGA 3VF0B 2RQ4A 2FHOB 2DNZA 3CCES 2MKHA 3ZZZA 3CCUS 2KVIA 3CC2S 4QPTA 2I38A 1SJ3P 2LQ5A 3I56S 5IM0A 2CQPA 4Y00A 1UP1A 2GO9A 1X4GA 3CXCR 2E5HA 1QVGR 2FC9A 2KG1A 4WF9Q 2DNLA 3UE2A 3D2WA 1VBXA 2K8GA 2HZCA 1VC6A 2AYGA 4FXVA 3G96A 1SJ4P 1RK8A 2QA4S 2PEHA 1R8PA 4WFAQ 4C7QA 4UY8T 1KD1T 5D77A 3UWTA 2MB0B 1HD1A 2ZJRQ 5LXRA 4TU8A 1ZH5A 2KXHA 2RNEA 2M2BA 2GHPA 5DM7Q 2D3OR 2DNNA 2KRBA 2MKKA 5DM6Q 1U1LA 5LXYA 4CQ1A
chains in the Genus database with same CATH superfamily
2ZFHA 1DTTB 1MNEA 2FPHX 1HNXF 1IBMF 2LYVA 4UF4A 4ES1A 4QIWD 4B3RJ 2XI3A 1WC3A 4EUVA 1WOPA 1WKKA 3K8WA 3G8TA 2W4DA 2FZKB 2OEKA 4FYDA 2ZBIA 1SC6A 4YY3J 2L9NA 4Y28C 1WHXA 3B4MA 2VDHA 2OI2A 5ETTA 1M90T 3UN5A 1FNXH 4GO7X 3HHKA 4PXCA 3GFXA 5ETKA 1Q5VA 2CQBA 4ECVA 2EG1A 1UW4A 2QSWA 4CYUA 4OI0A 3TZWA 2HVIA 2CQ2A 3PFEA 1M1KT 3C3LA 4Y0FA 1I94J 2V68A 2R2SA 5FLXU 1MMLA 3M1VA 2YY3A 4K2XA 4PR6A 1FJCA 2KT2A 3PFOA 4I2QA 2GIFA 3HFKA 2VASA 4OI2A 2PO4A 4DL3A 5I3PA 1VQ8S 4DG1B 4UQGA 4ZPWR 2XLIA 3MPWA 3TX0A 2K3IA 1SH0A 1WEYA 3BV8A 1MMNA 4DUZF 1U2CA 2ZBRA 4KKOB 3C15A 1PYOB 2RIJA 4C3KA 1V3ZA 3MTKA 3KMSA 3JS9A 2IRXA 3BO2A 4DX5A 3HI9A 1HL6A 4ED0A 3PACA 2BANA 1GMWD 3NBPA 1CC8A 1SUQB 4CT8A 2E1AA 3UO0A 4ES3A 3PW5A 4WIIA 1JK9B 1S12A 4G1QB 4B3RF 3MR6A 2RDIA 4EEYA 4YY3F 4CM0A 1XMQJ 4ZLJA 2HNDB 2XBPA 2YX1A 3DDIA 3BYPA 2YNGB 3PIOQ 4TLRA 2R7WA 3BO3A 5DDOC 5ITHA 1XR6A 1YVFA 3GIMA 1T03A 4OZ1A 5CCMA 1N8RT 3D6FB 3RUBL 2V4QA 1LWFA 2GGPB 1I5OB 2AJQA 3RG6A 1OYDA 2E9TA 4GC7A 2JVOA 1X4FA 5KFEA 2NR0A 4W98A 3EVOA 4NI2B 3N01A 4KIAA 2Y1IA 1H38A 3L4BC 3CCTA 3ET6B 5I3UB 1RT5B 4WIQA 2BQRA 3SIPB 4RU2A 2U2FA 1LV5A 3QFWA 1NCLA 1DQ8A 1RWKB 1CS4B 4TYAA 5KFVA 3PR5B 4ICLA 2DH8A 2MEWA 3KLGA 5K5MA 1TL3A 2L9WA 2VQFF 3VCDA 1BC6A 4DPTA 4N7TA 2YNIB 3EGZA 3MAHA 1FJEB 5A6WA 4EZ9A 4Y2KA 4CO1A 2NZ4A 4J7CA 2J6UA 2WB1D 4Y34A 2L08A 3OTCA 1IQTA 1OY8A 2OH2A 4UW2A 5KFUA 4YHHF 2JWNA 1NH7A 3QT7A 2YKAA 1WOOA 3HHLB 3IM8A 4A8WA 2YBVA 3TOQA 3J80U 3MMAA 3QSIA 1LK7A 1JLCA 2CNNB 2EKNA 1XEZA 2JFDA 2XMUA 4F02A 4B08A 4ED5A 1RWPB 2A2DA 4BC7A 1PG5B 1IKVA 3SQOP 5B0FA 1GMUA 1X9MA 1Q82T 2AJ0A 2A10A 2I5JA 1F9EB 2M5YA 3W8GA 2E5GA 5H9FJ 1YX2A 4NCAA 4K4YA 2R7QA 3R7NB 5AJ3J 4YB6A 1BQNA 1BWVA 1SJ3P 2XSJB 2IPOB 2CQPA 1V5IB 2KG1A 1N4LA 4ZVFA 4JI3J 3UE2A 1HMVB 1HHTP 2WOMB 2AYGA 4IRCA 4I2QB 4JI2J 2YQ1A 2ZOFA 4UY8T 2IC3B 5D77A 1TAUA 1FE0A 4TU8A 1RE1B 2BE2A 5JXSA 2RNEA 1S1VA 3J81j 3BH7B 3M6WA 2E5JA 1FDAA 2OMOA 5BJRA 2XS7A 4ZPTR 1U48A 2AHOB 3VZIA 3JTNA 3KJVB 3FQKA 2E1PA 1CJUB 2GZOA 3W8PA 1DTQB 3OL9A 2EXUA 1B0PA 3EPGA 3TEHB 2Z0GA 4DCPB 3DRPB 5EHHA 5ETOA 1EIYB 4WK1A 3GWCA 1M1GA 4RW8B 5J2NA 4O3QA 1R6YA 3KJFB 4IUFA 4DX8H 1QSSA 1HNWJ 1X31C 3MEGB 2KZMA 1EQMA 3CCQS 2XMKA 2NCKL 3QT5A 1CPZA 3LAMA 2K06A 1KHWA 2LA4A 2GVDA 4JI3F 5F9LA 2FJWA 2DH9A 2ILZA 3IP0A 2Y8WA 3FFIA 3FSXA 1R3NA 4LVOP 4DS4A 4H4OA 4DPOA 1PBUA 5HBMB 2B0GA 4GKJF 2C2OB 4ZITA 3FRZA 3NMRA 5DQHA 1RTJA 4RUAA 4DV6J 4NLTA 2IYIA 2MJNA 4IOBA 3AOAA 1QE1B 3B82A 4OX9J 4M5MA 1LWXA 1F5AA 2MZJA 1HR0J 5BYSA 5KG7A 2QO3A 2R42A 2W2PP 2O1PA 2HSEB 3D0IE 3H98A 4C11A 4M1KA 1BLUA 2RDDA 3W2VB 3PM9A 3CCJS 1RLCL 4Y2CA 1C4CA 1FNOA 3H59A 2XGPA 1VYAA 1NK0A 3RW7A 2KH9A 5K9FA 4O3SA 1FDNA 4CLKA 3THTA 1U25A 1C1CA 2BA9A 2GMHA 3DRSB 1AA1B 2ZC3A 4ED4A 4UY85 3IWXA 1HNWF 3OPKA 2V2KA 1GMVA 2BOAA 4JP8A 1JLCB 1SC3B 3BGRA 2BM0A 2W1BA 2H4YB 2LECA 4MYTA 1T3NA 3MM8B 4FP9A 4PG7A 1OPIA 2R9LA 3VAMA 4ID5B 4W92B 2DGWA 1S5ZA 3I6PA 3H4DA 4X2BA 3TO8A 4N8NA 2I5JB 2QLBB 3SCIE 1GX5A 4H4KC 4DV6F 1R0CB 3C14A 2FVPA 2HW3A 1GH8A 4DHVA 1P8GA 3O5TB 5HROB 2ZVSA 4I2PA 4Z7CA 3EJMA 4OX9F 1RISA 1QD1A 1S6UA 4PG8A 1HR0F 3M2RB 4ZP9A 4ZVEA 3PY8A 4LF4J 2YWGA 1N52B 2HQGA 3K2YA 4QCLA 4AL6A 4LFBJ 4B3SJ 1RBOB 2UUCF 4I6WA 1DJ0A 3UN2A 3HLUA 1LFWA 5MAOA 2MGZB 2DK2A 3L9ZA 2Z4PA 5M2RA 2N7YA 3OLAA 1JLQA 4BLGA 1NK5A 3VAHA 2YWHA 3C16A 1EP4B 5E2QA 3VAJA 1F0XA 1KFDA 1VRTB 1CJVB 4ANCA 1CSJA 4A8OA 3BSAA 3P6YC 1U47A 5RUBA 2KO1A 4TY8B 5DLFA 1TKXA 4NRTA 1C1BB 4NLUA 4IFYA 2I38A 4P2FA 1EETA 4X4VA 4LIWA 5F0WA 2QX0A 2GVZA 1UW9A 2FC9A 1VBXA 4N5SA 3KK3B 2PDAA 2RSQA 8AT1B 4XPCA 3TA1A 1KVKA 2V2QA 2RRNA 3WC0A 1N5TA 4CT9A 2DNNA 2KRBA 4A47A 2MKKA 4OZLA 1EKRA 3IRWP 1JLAA 2XO6A 4OIXA 3MPUB 1WF1A 1D9FA 1RI7A 3QZ8A 3TZXA 2X1FA 4LFBF 4B3SF 3IG1A 2LFVA 4ENOA 2ZC4A 4DU7A 2FHJA 1KVIA 3F44A 2O3DA 2WTFA 3G86A 1Q81T 1PIEA 2GX8A 4FXWA 2Q3PA 2QYGA 2ASJA 3THVA 2JC0A 2YQ3A 1C0TB 3HPOA 1R43A 4I7FA 4MFBA 2DHHA 4URQU 4NMXA 3AOCA 3ZZOA 1B0TA 1Q78A 2B9WA 4K59A 3GJRB 3MOJB 3Q8YA 3HD1A 1XTZA 3V4MA 4YQWA 1EX8A 4IOAQ 4PUOA 1RCOB 4NLVA 2J8SA 1MMDA 1UL3A 2DGXA 3AFGA 4ZPCA 1M5KC 1CC7A 4YP3A 2MTLA 4GC6A 1RTDA 3CJ3A 2CQGA 4ID8A 2VA3A 3H90A 2NYIA 4NRUA 2PN6A 2XMTA 4NXNF 3GV7B 2AF6A 1U2RA 2OPRB 3PHEA 1FJGJ 4LMZA 1OWXA 4HHHA 3HXMA 5LJ3Y 2COLA 4I6AA 1BMQB 4ZVGA 4F50A 9RUBA 4WFBQ 1HWIA 1GX6A 3BDEA 2DXDA 5BXIA 3NGSA 4KAIA 4R0JA 4YR0A 2VOOA 5HMZA 3HT0A 2N3LA 2MKIA 4DN9A 3Q86A 1QTMA 4KV8B 1TU0B 3BSCA 2HRYA 2QFIA 4RNFA 5KFZA 3T5KA 2OJ3A 4OYXA 1ACMB 3W1YC 5K20B 3CVKA 3SEOA 1H7XA 2DGOA 2UUWA 1LNQA 4NLQA 2MLYA 2IVYA 5CZXA 3AJ2A 2H51B 1RT2B 3MPDA 1Y3JA 1URNA 1SB6A 1WTBA 1TQLA 3QPIA 4OZ5A 4RL1A 1VRQC 1U1QA 3BGFA 1SV5B 3JSYA 2HFZA 2YKNA 4IH6A 1KHVA 1ZYQA 2RUGA 3MMCB 5AXKA 1NBEB 3A8KA 1KRPA 4OL8A 4DL6A 2R3VA 1NU4A 4K8RA 1BQXA 4ITSA 3UCZP 1B4SA 2HHXA 4A8SA 1QDUB 3R6LB 4IR9A 1FJGF 2M4MA 3BKFA 1XC9A 3IS9A 5C25A 2DNRA 1PKUA 3M05A 4NLOA 2VPXB 1YSJA 2ZDPA 1HNIA 3HF5A 4D3HA 4DSJA 4NPOA 1IR0A 3NNCA 1YI2S 2P6TA 3KKFA 4ZCLA 2JLEA 4YFUA 7AT1B 3CJ0A 2RT3A 4X62J 2H48B 3CUNA 3UDEA 5BYQA 4ECRA 3V4IA 2D3ZA 4LFAJ 4JV5F 1H72C 3R5CA 1G1XA 1S9EA 1S79A 4RJVA 5H9EK 2YKMB 3DLJA 4NWBA 3A12A 1FD8A 1XR7A 3NGDA 3K5PA 3AD9C 5GMDA 1HBUB 2EC2A 1S7HA 3P5TL 4A4JA 1HBOA 2B9XA 2ZD1A 4IRKA 3GPAA 3GSDA 2KG0A 5A8RA 4X4UA 5IFMA 3OFEA 2C3YA 4ECQA 2W8KA 1VQ7S 2Z2ZA 1Q7LB 5GAGU 3FSIA 2UXDJ 1RAFB 4DV0J 2UXBJ 2C28A 2SXLA 2G0IA 3CJKA 2JVRA 3VAIA 4DZ6A 2ZH7A 2OMLA 3T1AA 2OTLS 4ZIWA 2VG5A 1DRZA 1KBRA 2FLPA 4JOUA 4I7FB 4Q2LA 2GJ2A 4M94A 2BXJA 1FEEA 3MR5A 4PCQA 1WG1A 1KN6A 2ZM6J 4J9PA 4X4PA 5HP1B 3OTOF 3K5LA 1TL7B 1REVB 2WHOA 3L09A 3CGIA 1QLNA 1Y5IB 5AT1B 1VGYA 4CLYA 1FXDA 2QA4S 4X62F 1IJEB 2CKWA 2F8MA 3LP1B 4LFAF 2AX1A 3W60A 5K8NA 7FDRA 2V8PA 2VG7B 2BR0A 4P71A 4PWWA 3M8SA 2B3TB 1VQ5S 4B3OB 5ETQA 4CTAA 3MM9B 3MPVA 2H1YA 4DR3J 2CJBA 2YNFB 1Q8BA 3JYTB 4O0IA 3T9ZA 4URGA 4C4WA 3CCZA 5B08A 2FVSA 4OYBA 3KTQA 4DSFA 1OSDA 1CQMA 2M8HA 1B7FA 3DC2A 2YH0A 2UXBF 3D6HB 4RLEA 1S1UA 4NLSA 3T6JA 3JAMU 3GR0A 2CPDA 2UVRA 2XMVA 3W9JA 1SH3A 2IVMA 5LSLA 1YHQS 4NEYA 1UVLA 2J8AA 2ZM6F 2OKQA 5J2MB 3DN9A 3OR2B 1S76D 3H5XA 2MQOA 1Q7YT 3DLGB 2CA9A 4R8UA 1CJTB 2AYMA 2HWHA 4G1IA 3M2UB 1RT6B 3LA0A 2J7UA 4F4AA 3G8QA 1H2TZ 2H4WB 4DBQA 4WFYA 5IS2A 2CQ4A 4XAKA 3MFHA 1PC4A 2NXEA 4M5GA 3ETMA 1KOOA 3LQVA 1DLOA 4FVMA 4ETZA 5L39A 2CJKA 4F3MA 3QIPA 4DR3F 3W7BA 3NWGA 3DRXA 4USVA 3HVTA 2AU0A 1VR6A 1BGXT 2HNYB 4ZVOB 1TMMA 1FRHA 4Y65A 5DRKA 2DEIA 1NKEA 2HBZB 2F8HA 5IV4A 3ZXWA 3QO9A 1SC4B 2XSFA 3GIRA 1B70B 4BBYA 2KB2A 4TYBA 5DETA 2HWTA 3MM6B 1S72S 1MW7A 2DRBA 3UPFA 1Y0HA 1UCNA 3VHQA 3UD3P 3OD2A 4OYOA 2CAJA 2WBRA 2PA8D 3DGPA 4RBTA 1NJZA 3NY0A 4CI0B 2EFGA 2ASLA 3TARA 1S9GA 3QYYA 1S1WB 2CWKA 3ZZUA 4LF7J 2MDAA 4ZVUB 2ZH1A 3RRHA 3NCPA 2D7SA 4V19X 1HYSB 5KOXA 5LT5A 1RT4B 1B3TA 5LMNJ 1HARA 2V4JA 3N28A 4DV3F 3PTWA 4RWXA 3I87A 3OL6A 1R7IA 5L1LA 2A18A 1S0VA 3E01B 4RNHA 3VVTA 1QSYA 2OTJS 3QMQA 3N6LA 1ZM4A 4AL7A 1NNDA 1T9WA 2AJFE 2OSQA 1F2GA 4ZVPB 2ZUGA 2HAFA 2V63A 5F8JA 4DXLA 4LBPA 2HS4A 4LRBA 2RHSB 4WP8A 3SSRA 4F67A 2RE1A 1R0AA 4B3TJ 2QA4G 2V0NA 1Q79A 2Y8YA 1K0TA 2HVZA 5L8RC 2R2TA 4ED2A 3D4JA 5IWAJ 2RJZA 3MM5A 5F41A 1G6BA 2JEJA 2Q43A 4FF2A 1JXVA 2D9OA 5G0RB 3S01A 2ASDA 2BJ7A 5EX0A 3M8PB 4QOTA 5I42A 1XNRJ 3CMES 4ZMMA 1IN0A 1SJ1A 3SSQA 1KONA 1RT3B 2GQ2A 4PRFA 4Q8FA 2W9BB 1M5OC 1EJ7L 2BJDA 4IYQA 3FCWA 1W25A 4NLWA 4B3MJ 3THPA 1YGYA 1VQ4S 2Q6BA 3ISNC 4ZS6A 4ED8A 3VALA 1YJNS 5C7PA 2CJ9A 2EFVA 5IC6B 1QTNB 2VIHA 5CZVA 3FJ2A 2MKHA 1SVDA 4YB7A 2KJVA 3DKDA 2B43A 2GHVC 1IWGA 4IG0B 4Y00A 1X4GA 3Q8SB 2RILA 4P7TA 4WF9Q 5EWEA 1WC0A 2C3MA 4HACA 3J81Y 2HZCA 5A8WB 1RT7A 3N5BA 4OLPA 2KVQE 1FWPA 3C8YA 3DYAA 4B3TF 3PJ9A 2IM3A 2M2BA 2HRUA 4V19J 1S6QB 4LSNA 5A6PA 4FPRA 6FD1A 3VAFA 3ITHB 2LQJA 2NUHA 3GR1A 3F73A 1U1PA 3OV7A 2HHHF 4PYAA 2K1RA 1DLOB 2KT5A 1MROB 1XNRF 1GAOA 4YMEA 4EI2A 1S99A 1ZTTA 2BKNA 4DSIA 2EFOA 3PKMA 4CO2A 2CZVC 4ELTA 2Y1JA 2PEBA 2KFZA 2GNKA 2ZH9A 2DXEA 3DLLQ 4I67A 4FXDA 2FLOA 3ZZRA 3DRRB 5LSOA 1F2HA 4G6VB 3ZO7A 1HI0P 2IIHA 4WU2A 2DR5A 1UZDA 2ATLA 2F7VA 1XK8A 2CVEA 4DR5J 2NXUA 3M7VA 2H54B 1HD0A 3H5UA 4K4ZA 2FGOA 1LWEB 1YWXA 2DGUA 3A3OB 2G1HA 3EGNA 4C8YA 4GMKA 1MLAA 3IGNA 2J0XA 3T5HA 2AKWB 2DY9A 2E7WA 4QYZJ 2KXNB 3IBWA 1XQIA 1SPBP 3LP2A 2IJFA 3W3SA 2BYCA 1IM4A 2KM8B 3FBEA 4L76A 2NREA 2W7AA 1E6VB 1B64A 4F26A 4NCGB 4X4SA 5F8IA 4ECZA 2C42A 5AXMA 4PQUA 3W5ZA 2DGTA 1P9QC 3D6MB 1TVRB 2C3OA 3JSMA 2I9SA 3W2WA 2E44A 3GFYA 4KGVB 2VQEJ 2GV1A 1ZZNA 1FX2A 2ZBPA 2RAQA 3AAWB 2AX0A 5J1EB 4HH0A 2HGNA 1KTVA 1XWLA 4KR0B 1A6LA 3MZIA 2XY7A 3OVAA 2Y0BB 1YIJS 4AYBD 1NB2A 1DBDA 2P9CA 4RUCA 5GAEU 3J7A1 1F6TA 1FKOB 5CABA 2FUG9 3Q8VA 2QLFB 2VKRA 3GCWP 4ANEA 2KFNA 4DR5F 2FVQA 3GG1A 4DL7A 2DNQA 1WJ9A 2YKOA 3Q24A 2JEGA 3WX4A 4B9VA 1RAAB 2DNGA 2BJ8A 4IG3B 3DM2A 2OSRA 1LWCA 2UUTA 3V81A 1JXEA 1REGX 1XBWA 1AYEA 2RQCA 2HQDA 3K5NA 3QSYB 3SXLA 2XO7A 4QU7A 1S0NA 2EG2A 5IT9Y 4QWEA 5KFQA 1D0EA 4DLGA 2E1MC 4PABA 2Z58B 4U7UK 5IC4B 4IRDA 2FJAB 2JC1A 3GCXP 2R8IA 2R7SA 3AT1B 3KHLA 3VTIA 3MAAA 2VQEF 1CULA 1IKXA 1MWQA 1AB8A 4X66J 1DZ5A 2KHDA 1NLKL 2EBGA 3KLIA 4M5LA 3EE3A 6AT1B 2G0JA 3PO4A 5HLFB 2CZ4A 3VAKA 2D69A 2Q79A 2V2ZA 3PYDA 2J5AA 5KG5A 2CNOB 5B0CA 1J5OA 1N32J 2QMXA 3R9LA 2XEXA 4K7QA 5MLCV 3RB0A 3BBCA 1EZZB 4G3IA 1UEKA 2PMHA 1U6FA 4L74A 1N88A 5GMEA 3TAMA 1Y10A 4P2MA 1RBAA 1VCTA 2ROGA 4IQMA 2CNKB 4QJVA 1UVMA 7FD1A 2KVIA 4ED1A 4KO0B 3WIVA 1WOSA 5IM0A 1QAJA 4DR6F 3BB5A 3KLEA 2E5HA 2B9YA 1IQZA 4NLPA 1TL4A 5G4DA 5HI7A 3HD2A 4J9OA 4ZVRB 3M30A 1SKWA 3DI6B 3CJSA 2JNJA 2ZZNA 2DR6A 1GT8A 3M6VA 3KK2B 4WE1A 3NGKA 4OYAA 3MFIA 5KG0A 2GHPA 2HEKA 4JI8J 1UJ6A 1U1LA 2DT9A 3SDEA 2GW8A 4FNHA 5A0YA 4O3NA 1FKPA 2OPPA 4C8MA 3DDNA 4QQBA 3M4XA 4X66F 3MOZA 2R8KA 1RT1A 2DO4A 4QIVA 4HEA9 1WG4A 1TKTA 2XMWA 3NKYA 2CYYA 4PXEA 3DOKB 2VV5A 2WSCC 3BDPA 3W64A 3J7YU 5CD4H 5H1SV 4ZDNA 4EFAC 5BR8J 3J7YI 2XMMA 1FFGB 2PIIA 3IR7B 2HURA 3Q2TC 2QZ8A 3AY0A 2HIYA 4I4BA 4OJ3A 2G2YA 1HBNB 2QGFB 4CLPA 4UT4A 3A1YG 2HS0A 2QV6A 1N33J 3IAM9 3ZTQA 4K4UA 4WK3A 3DXSX 2C2ZB 3DHXA 2XZTB 2YNHA 3GYGA 1WF0A 1RBLA 4L3NA 1V6HA 5KTQA 5KG4A 3DRYA 2HK2A 4JYAJ 1YBUA 1WEXA 4MKBA 2QN6B 1X9WA 2CJXB 5HO4A 1KOHA 2MQ8A 2EKYA 1WC1A 4NCBA 2D1CA 5FLXY 3DM2B 1WORA 1E6YA 1LWCB 2W7OA 2RF2A 4TU9A 1HWLA 3QQCD 4KGZB 4URSA 3K5MA 1VQMS 1L5UA 2YX4A 4DQQA 3BYRA 1S1TB 1MSWD 1KKHA 4XIUA 1UPMB 3JTOA 3HZGA 1LEOA 4TY9A 3QGHA 2OD6A 4ZIVA 2AT1B 4OJHA 1IVZA 1NJWA 2OP5A 3EVMA 4AXIA 1W7WA 2B4PA 1XR5A 2QT7A 5BR8F 3MCOA 1R8HA 5KT3A 2AYBA 4Y6IA 1AZSB 1KQKA 3F56A 4X64J 3RR8A 3G71S 4O44B 1RQ0A 4DOZA 4MMOA 4WZQA 3AHPA 4IH5A 3ILOA 4MK9A 3C6TB 5U47A 3FNNA 4O4GA 3QLHA 1S6PA 3B8HA 4ZJLA 1N33F 3NRBA 4FYWB 3D1OA 2HQ3A 4CWBA 5B0EA 2HZVA 4PXDA 3UW1A 4JYAF 3BGUA 1VIXA 4ED6A 2J7KA 5DG8A 1UZHA 3ILJA 3L7PA 1HPZB 3IRXB 3MMJA 1U6BA 4RW7B 3BGOP 3O44A 1FK9B 3OSNA 2YXLA 4USJC 2KZZA 3AD8C 4PZVA 4EBDA 1YRTA 3S1TA 5L46A 3N6NA 1T05B 1JJHA 1IJFB 4JV0A 1IBLF 5B0BA 5FJ4A 2X1GA 1UFWA 3LALA 1ZAVA 3OUYA 4DV1F 1JLFA 3R8YA 2LDYA 3AXMA 4OI3A 2CDQA 2W24A 2BEFA 1T9TA 4JI0J 3D67A 2NZCA 2A6OA 3CJ8A 3A3NB 5E0OA 2RKIA 1HNVB 3RU0A 3M9MB 4TQSA 2RDJA 4DCJB 3SDEB 4LR9A 4RW6A 2HG4A 4X64F 5D4PA 1S6OA 1FRXA 3AB4B 5EUHA 3DLKA 1KVJA 1PCAA 3T1YF 2OPSA 3H7HB 2HFOA 3MMBA 3H2VE 4HTJA 1V5VA 1C0UB 3QJJA 2GJFA 5CYMB 5F8LA 3TRGA 3GYNA 4ZPDA 4ECXA 4DQSA 1Y7PA 1VC5A 4OV1A 2VH7A 1LW0B 1ZM9A 2MSTA 1RUSA 2FVCA 5LSRA 4RNOA 4M5DB 3BJYA 3CNQP 1FRLA 4LBIA 4CLUA 1XMBA 3WIUA 3RAQA 3CCUS 3CC2S 2W8LA 2OEMA 3BR8A 3J80Y 1QVGR 2GJIA 3N5FA 1SKUB 2W9AA 2KT3A 1U24A 3E2EA 4UOCA 4OFZA 1HD1A 3PCOB 1ZH5A 3U02A 1URRA 4WYWA 3VV2B 3FCHA 2D3OR 3V6DA 5D8HB 5LXYA 3C46A 1N5VA 3OTEA 4Q5VA 3ZFVA 1QUPA 3Q8QB 3A4TA 3JSBA 1DQ9A 3TW0A 3ILLA 5HVGA 3O1LA 3HJVA 5CYQA 1WC4A 1HQEA 3OXGA 1L3SA 3W9IA 3PYFA 2J6SA 1B99A 3TX8A 4ZN1A 2UXCJ 1JJCB 3RRGA 3GLJA 4N41A 5F3TA 2DR7A 1FE4A 3TQ1A 2RQKA 3KLFA 4ZVHA 1CVJA 4CM2A 4OV6A 3NS6A 2G1DA 2HMIA 5FD1A 4CZCA 3GYXB 1MWZA 5H9FK 4RW4B 3CE8A 2J76E 3T5LA 3L7UA 3LUYA 3HK2A 5KFFA 4ED3A 3O6QA 1ZM3A 2WONA 3HDSA 1QJHA 2VA2A 2HNZB 2V2VA 4V1Ak 5C42A 3D68A 3BN4A 4AT1B 5HMWA 1YTYA 3N79A 4N76A 1TKZA 2CUYA 1TV6A 4RBUA 4GKKJ 4LFCJ 1Y00A 5ETSA 1TTHB 2A1BA 3MEEB 2DITA 2FIUA 2Y9HA 3CD0A 1U1OA 5HATA 2DO0A 1PJ5A 3MDFA 4YEAA 2ZUAA 3GP9A 4ZP7A 2POKA 3G82B 3GZ7A 2KDOA 1VK8A 3CJRA 2U1AA 2XNQA 1YZ6A 1ULRA 4M95A 2BV3A 1C2PA 2W2QP 3BSOA 3CDBA 1VMBA 3MWBA 1RABB 1U1MA 2M70A 1X7VA 5F0UA 2OEJA 3TZYA 1VRUB 3G87A 2UXCF 1IBMJ 1AROP 1IR2A 1WG5A 2BKPA 2KXFA 3BZQA 1TKDA 4H4MA 4KGKA 1BWEA 1Q95G 2HVHA 3AD7C 1K8AT 1Z2ZA 3US5A 4EBEA 1KNZA 5A2QU 3DFEA 1Y3KA 1MG7A 2QLXA 1RTHA 3W65A 1VBKA 4KE5A 2W9CB 1L3UA 3EDRB 4TN2A 3I0SA 4JB8B 4NASA 5D4NA 3G2XA 3DLBA 5EGYA 3IGVA 3ADAC 1S7IA 4OZ3A 2QL5B 2XLJA 1VLOA 3PRVA 3BN7A 3UDVA 4AFFA 4GKKF 1DFDA 1RWWB 4LFCF 1FWKA 2DHXA 5ADZA 3IFEA 4DPYA 2QIFA 4HHJA 3I0RB 1UAWA 2UZAA 2DTJA 1YJWS 2ZJQQ 4AD6A 4OX7A 1KWMA 3NXZA 3CJ2A 3PW7A 1NK7A 4BCAA 3DOLA 3D6TB 4P10A 3W62A 3AA9A 1WHWA 3OXLA 3ZNJ1 3DMJB 4B9SA 1S1XB 3AQPA 2UV8A 4DUZJ 4CO0A 1RTIA 2ZDOA 2B6AB 3TR5A 3V5RA 4C8KA 1G3OA 3RYLA 5GMKa 2ALZA 2VPYB 4WWSA 2FJBB 1VQPS 3KNAA 4PYDA 5L1IA 4K4XA 3V6JA 1F9FA 5H9EJ 2KL8A 2AZ1A 5KFTA 2OPQA 5IT0A 3M6UA 4DX6A 1F5CA 1FO1A 4Q45A 5A8KB 5KT5A 1PAEX 1GXLA 1UVNA 3POTB 1H2UX 3GIKA 1M1HA 5D0GA 1HQEB 1LXNA 2F4VF 1FFWB 4O23A 2A0FB 3PRDA 4WXOA 3CC4S 3UNGC 3MEDB 1T95A 4F7VA 2IBOA 4WP9A 5DZ6A 2OD4A 4PPDA 2FJXA 2EPIA 1S4EA 3BBFA 2KU7A 3QWUA 1HA1A 4C6AA 1VQYA 3BSNA 4HR2A 2KHCA 4C2MA 2VZ9A 3UD4P 3TUPA 3D0HE 1TP7A 2GA7A 4U7CA 3BPSP 3L7OA 3TAPA 3DLEA 3PW4A 1VHFA 2HMIB 4BWJA 4F4WA 2IMOA 4DQPA 1F5BA 3GILA 4O3RA 1ELOA 1VK3A 1FTRA 3HKZD 2DNLA 3QJPA 1NPKA 1ITPA 4RR5A 2VBXA 1UVKA 1TUGB 3PHTA 2RU9A 4KH0B 4WFAQ 4C7QA 3JQKA 2KXHA 5JJBA 1KP6A 1VIOA 2CJYB 5DM6Q 2VQFJ 3I4PA 2MZTA 4GRSA 4ILMA 4F0HA 3GIIA 3KLHB 4DI6A 8RUCA 2YWWA 1Z4UA 4JI4J 2LMIA 2CPIA 3G6XA 5KFAA 4OHYA 1KS2A 1NDLA 2VL1A 2W2MP 4O0NA 5CD4A 4KFBA 2AEFA 4U7UD 2CVIA 2RHQB 4L6V3 3GV8B 5IV3A 3U1LA 1G2EA 4NA3A 3CPWR 4YHHJ 2JDJA 5KFXA 5D15A 1NSAA 1FA0A 5EDWA 1RJJA 4RW9A 4WZMA 2WAQD 2DCLA 4BS2A 2GIRA 4H4MB 3MCMA 3Q89A 5K14B 2DNOA 4ZJOA 3MECB 3CCSS 4ECWA 5KFKA 2VBZA 3LPYA 1Q86T 3W9HA 4L72B 2C2KB 1JLEA 1SCJB 5D4LA 4F4KA 5D3GB 3C2PA 1BXNA 2LCWA 2YPZA 3SCJE 1ZS6A 2OFGX 1O6XA 2CQCA 1VQOS 2RB7A 2DGVA 2HHVA 2JSXA 3PEHA 3UR0A 2JH3A 2XTJP 2BUNA 2ZH5A 2XB2D 1TAQA 4IDKB 1IKYA 5BYRA 3OHBA 3M8WA 3C19A 1OO0B 5D0RA 1WUUA 1UFKA 3R5AA 4FN5A 3D1HA 4XPEA 1J27A 1ZAXA 2AD9A 4OZ0A 2BKOA 4DSKA 4I68A 4DPWA 2M52A 2BVZA 4J91A 3K7RA 1JNZB 2M0GB 2CPYA 2NXNA 3OXFA 2CRLA 1JLGA 3HHLC 2I0XA 3DOMA 1TL1A 3J7ZT 2Z2MA 2W7PA 4TKTA 3SBMA 1RB0A 1X4DA 4JI4F 5T7LA 3HCXA 1NH8A 2VHGA 4TVAB 2ACYA 4DWIA 1WTFA 4OZJA 3M8QB 2IAJA 2W25A 4CH0S 2CDRB 4F3OA 4OQJA 4GVBB 3TEGA 1NSQA 5B7WA 4F4XA 2B8PA 3EGVA 4LF8J 3HJFA 2MKSA 2DISA 1YZ7A 3QBCA 2AW0A 3NEKA 1NKBA 3CDAA 1N5YA 5KFSA 4NYZA 3JTPA 2QJ3A 4F2RA 2OPQB 1QM9A 2M8DB 4IH7A 2DR8A 2QA1A 4USTA 3GQCA 1RU2A 1YDLA 4RZRA 3RTVA 2MQLA 2AGQA 1APSA 1R8AA 2EWHA 1T9XA 2CPZA 1VQLS 4IOCQ 5I3QA 2FB0A 1N5SA 4CYUB 4QR1A 2UV8G 2HFSA 4CO3A 1BD6A 1WSVA 3P96A 2XY5A 4KPYA 2XM3A 1K0VA 1YRXA 3MCSA 2CIMA 3IC1A 4DUYF 2MMYA 1PC5A 3M1VB 1RXOB 4KHRA 1CEZA 3D3BJ 1SQGA 2DNKA 1H98A 1JIHA 2HQCA 4LF5J 1FHTA 2Q6CA 4J9VA 4DPUA 2DNPA 4RPFA 1SL1A 2VDIA 3TA2A 2R7VA 4EGLA 4GKJJ 4I69A 3NNHA 2Z2LA 1VDHA 3KHHA 1RCXB 5HJYA 1BY9A 3BS9A 1K9MT 1D1UA 4TU7A 1JWWA 3C15B 1U45A 3TVYA 3ELHA 4PWUA 4HDGA 4CH1A 2L48A 3D7SB 3AB2B 1DARA 1JB0C 3NG8A 2BANB 3NBPB 4KYZA 4LF8F 4I6YA 3R27A 4W4MA 2P9GA 2FY8A 4KHMA 1TK5A 2MZ1A 2H5EA 1UWBA 3HSDA 3VWSA 4KFBB 2NPIA 1HHQA 3DU6A 2BJ3A 4DV4J 2LDIA 2XG8A 3RB3A 3TI0A 4R25A 2GIQA 2I6WA 4M5IA 3H2UB 4HT5A 2WVCA 1T03B 3T1HF 4R5PA 3J7Z5 2F63A 3MM7A 1U6ZA 4RW9B 2CPEA 4ZP8A 4TNOA 3SI8A 2QMWA 1F9HA 1LWFB 4C8NA 2DNZA 3OLBA 1ZTWA 4WKYA 2H65B 3GB0A 1QUVA 4NZ7A 4XTTA 4LQ9A 4DQRA 2ROPA 1FFSB 3DHWC 4LF5F 4K4SA 2XWXA 1R8PA 4FKYA 4ECTA 3TWZA 4USMA 1P9YA 1VJQA 1U0HA 3QGGA 2P5VA 4OZNA 3QJLA 1JKHA 1KLMA 4P75A 5D0EA 2CG8A 4DPXA 3I82A 3NAIA 4ICLB 3KLGB 3SSSA 2E66A 1TL3B 1U4BA 4G1PA 4ALZA 4DV7J 1KQSR 4EBCA 3CCVS 4QWCA 4IKAA 5CHCB 4B9MA 3KK1A 4YB1P 1G4CA 2ZOMA 4ILLA 1TL5A 1OSCA 1OYEA 5E3AA 5DO2A 1ICEB 2IHR1 3C6UA 3L3CA 4AQYF 2UUCJ 3BPDA 3UVJA 2AEJA 4ZPVR 1AW0A 2VBWA 4DV4F 2DRAA 3MAQA 4E98A 2XNRA 2B5JA 1FDDA 4OHZA 4QIGA 3H5YA 2BJ1A 2V34A 1D9AA 3CCMS 2BACA 5DDPC 2J0QD 3MMAB 2OFHX 3CIZA 1HWKA 3KXDA 2XHCA 2XCAA 5B09A 2VU5A 2XS5A 3M8ZA 4DU8A 1CQNA 5C2GA 1B7YB 1IKVB 4RNMA 2CNLB 1SJFA 1FRIA 1Q8KA 3JAMY 2MY7A 4WXWA 5C24A 3I9ZA 1PJ6A 4PWDA 2LKZA 1MU2A 2ZHBA 2VODA 2XYHB 1RKJA 1HHSA 1BQNB 3MUMP 2V50A 4OYZA 2AQ4A 1X4EA 5KAKA 2KJWA 3IN5A 4DV7F 5KFMA 1WWHA 3TQEA 1K1SA 1XMOJ 1CJKA 1Q1KA 1VI7A 4C8LA 1U09A 3HSJA 1N6QA 4ZPBA 3A13A 3BBBA 4JUZA 5J2QA 4PPZA 2D9PA 3LGHA 2BE2B 1YLXA 1S1VB 4ZKAA 4AE5A 1LW2A 1J2VA 1TUVA 3FMBA 3CT9A 5HVFA 4JI7J 3PYEA 2A3JA 5B0GA 1JJ2R 4ANDA 4I56A 5DGAA 4CP5A 3IMQJ 3CJ5A 4RO0A 2F40A 4LVNP 2HLUA 4Q0BA 3OR1A 3K58A 3LH2S 4PQAA 3RAXA 2GAHC 1RHKB 2D74B 2OUGA 2C22A 1X0FA 1V3RA 1U0SA 1QY7A 1DTTA 4YDDB 5J2NB 1UTAA 4Z7YA 2E9ZA 5J1PA 2BX6A 4YOEA 4DL4A 1XNQF 4NXNJ 4CLTA 3IR6B 1WHYA 4ZHRA 3RBDA 4L75A 2GVDB 4TLQA 2QC3A 3MUTP 1ZBTA 4DL2A 1XMOF 3FFIB 3KUHA 3N0VA 5ETLA 4H4OB 3RBEA 1A7GE 3MI7X 5FDLA 1AUDA 3SV3A 1RTJB 3OHAA 3HP6A 3H40A 2HRTA 1N36F 1NSKL 4F0MA 4NOHA 4JI7F 5GADU 2PMWA 1XN9A 3PW0A 4LUBA 3OTBA 2DHAA 5GADI 4O3OA 2HPUA 3G8SA 4AL5A 5AE1A 1X4AA 4C11B 2KI2A 2RRBA 4NXMF 4OX6A 4DG1A 2M88A 3PG9A 2Y1LB 2CXEA 2ADBA 3WZ0A 3VZHA 3WC2A 1N34J 1FT8A 3CTRA 1Y5NB 5M2UA 3RRKA 2UVWA 3RW6A 1KSPA 4KKOA 1FVQA 3HFVA 2MKJA 2HWIA 4K5RA 4F8RA 4LRDA 2QYCA 2J6TA 3MTJA 3P5BP 1YQHA 1RWNB 2E9RX 3E3XA 4NLGA 5K8MA 5DQGA 4EO8A 1Y5LB 1C1CB 1NMEB 5EWFA 3T6BA 3VGSA 3CXCR 4G1QA 4HLBA 2BDPA 1PILA 2DBBA 2BQUA 1Q0NA 4USWA 2HNDA 5SZTA 3LOUA 3BGRB 3TJAA 2ZJRQ 2BQ3A 2QG9B 3I32A 4GVLA 2YWEA 2V69A 1XIQA 3TYTA 3PW2A 2G4BA 3FZ2A 4DLEA 1LKZA 2CADA 4FBUA 3C14B 2HK3A 1D8YA 2ZNZA 2WW4A 4JV5J 3SQGA 2IJNA 2Z30B 1NK9A 4I2PB 4ZVQB 3KNGA 1Y11A 3QRRA 2M9KA 3PEJA 1TZ0A 4D3GA 4M5HA 3ZZPA 3QFHA 3U7JA 3DGVA 1GXUA 2V8GA 4NI2A 2HLTA 3NOGA 1YBTA 3KLVA 3ET6A 1N34F 1RHRB 2VJVA 5I3UA 4DR4J 1HFEL 1S49A 1PBAA 4UZCA 3E8OA 1RT5A 3ZTPA 1LW2B 3RBXA 4QWAA 4KGXB 3CD7A 1CS4A 1RWOB 2GAGC 5DGBA 1UEVA 1FESA 2GS8A 3B6BA 4K5SA 1JLQB 1U8SA 3CCLS 2HAIA 1HWJA 4GO5X 1KQFB 2XY6A 2YNIA 3C16B 3VGUA 5CYJA 1TFWA 3HX9A 3CULA 3QAEA 5CH7B 1WC6A 4FPIA 5ETPA 3GV5B 4ER8A 1SJRA 3GFHA 5KFWA 1D3WA 1EKSA 4ETXA 3OTOJ 4QPXA 2ZBCA 4LRCA 2XGQA 1BE4A 1TKXB 4KGMA 2LEBA 4IQXA 4IFYB 4NMLA 1PYSB 2OGUA 1WF2A 2XCPA 1A0OB 1EETB 1EHWA 2GVZB 4FNIA 3OFHA 3HHLA 3OL7A 5I4MA 2J0WA 3VVUA 1HNZF 3PIPQ 4KHPF 3W66A 4FKXA 4ZHRB 4ATNA 2KTQA 1A9NB 4ZPAA 2WBMA 1ZOTA 4S0MA 2R7XA 3CMQA 1VQ6S 5JVHQ 1WSRA 3BF4A 5HQMA 1JLAB 1SH2A 2B4VA 4QBUA 5FDLB 4DR4F 4MIWA 3QGIA 4MK7A 3IG1B 4HH1A 1WEZA 4CLZA 1RA6A 1Z2LA 2MY8A 2B9EA 2XSJA 1YJVA 2F5GA 2C2NA 4IR1A 5AXLA 3RR7A 1NZAA 1HMVA 3EZOA 2WOMA 3FK4A 1NEEA 1RAGB 2DIVA 3P3DA 1L3KA 4M63A 4MFBB 2IC3A 4QYZK 1PAUB 2K7KA 4YDXA 2LU2A 3UN3A 2KYXA 1S0OA 4DUTA 1X60A 4O4RA 4NLYA 4USIA 4JI1J 2VFTA 2DIUA 1N0UA 4DMZA 4PUOB 1S9FA 3P8BB 3HHNB 3UFCX 4Z2XA 1NK8A 2HFVA 4DN0A 5HSPA 2OO4A 4WYLA 3QZ7A 1RTDB 1U2FA 1SQFA 4HTIA 2AJ2A 4DEZA 3BKUA 3KJVA 1WKLA 1YBAA 2VPWB 1CJUA 2ZHAA 3A8IA 1DTQA 4ZOSA 3EZ5A 1F3VA 1HBMA 4J9MA 2UP1A 4OHXA 2E1CA 2K3KA 3DRPA 4JBCA 2VJUA 2R8HA 3DXBA 4P9SA 2WCXA 3B4DA 3EXCX 3M6XA 2DPIA 1C4AA 2LU1A 4RW8A 3UNYA 2O5DA 3EICA 4QWBA 2OHDA 1I94F 3MD3A 3MEGA 3R5GA 1KTQA 1IBCB 3SQGB 3WQPA 1UMJA 1NAQA 1ZA2B 2QFJA 2X7IA 3EWGA 3P49B 1ZM2A 1SL2A 1TMJA 3NGTA 2HBRB 3WDOA 5HBMA 2O66A 4NZ0A 3KDNA 1D09B 2Y3YA 3EZUA 3M9NB 3FCVA 5ETNA 1RU1A 4JI1F 4F4ZA 2VG6A 2YQ0A 2RQ4A 2FHOB 1O5JA 3ZZZA 1I1GA 1VFJA 3I56S 1QE1A 2V8DA 1UP1A 4KY3A 2YKNB 4DV3J 3D2WA 3NGUA 1GFWB 3G96A 1RK8A 3W2VA 4EK2A 2JHEA 3H25A 3CWJA 1G7CB 1AFJA 2FGCA 1J5EJ 1FD2A 3PXGa 4LSLA 2ZE2A 1XMQF 2F1FA 3IS9B 5C25B 1QSLA 5L9XA 1GK8A 1M5PC 4FBTA 3EXYA 1HNIB 1H6KX 1OS5A 1Q8LA 1S57A 5DG9A 3I5CA 2I2YA 1F1BB 2XC9A 3K89A 3DRSA 3AJ1A 1JMTA 2JLGA 3NS5A 3V4IB 5LOQA 3WHIA 4F0KA 2X3DA 3CCRS 3LW5C 1T7PA 1S9EB 2QA2A 2MQNA 3SV4A 3S7RA 1P6TA 4ZCMA 2CPXA 5ETMA 4DV5J 1UPPA 3G6VA 2YTCA 3MM8A 1HBOB 2ZD1B 1S48A 4OHVA 1TR0A 4ID5A 5A8RB 4DFPA 5C5JA 4DSLA 5DLGA 5HK4A 1LQ9A 4QZVB 2AYEA 4FF4A 5KG1A 1GQEA 4R0EA 3V6KA 5HROA 5HJXA 3R5DA 4C0OC 3R1LA 5E3RA 3QT6A 3SYZA 4QW8A 3HVRA 3M2RA 3IR5B 2ERRA 3CJKB 2XLKA 3G6YA 3I9V9 2OAUA 2VG5B 4M5NA 1J5EF 4WKRA 2R7OA 2QL7B 3FKBA 2DGSA 3R3TA 4C9DA 5E41A 3QRPA 3BO4A 2MGZA 2RQMA 4MAKA 4OLOA 3EPIA 2RS8A 2ZVIA 3FGVA 3U1MA 5L1JA 3CO0P 3H5SA 3UDLA 1HW9A 1EP4A 4WPAA 3TANA 5KFIA 2EVZA 2GFFA 2NUUG 1VRTA 3GTYX 1CJVA 1K47A 1HBMB 1SKRA 2HHHJ 4HT7A 4C8ZA 1YJUA 5GVQA 2R4FA 3PJWA 4DV5F 3OSPA 4CTAB 4TY8A 2AGPA 4DDFA 1C1BA 2I8EA 2ZH2A 4DX7A 4P74A 2VFSA 3KJNB 2B4OA 3DCAA 2P6SA 1X9SA 1M5SA 2PT0A 2HVEA 2ILYA 5AJ3F 1BQMA 3KK3A 2LLZA 2VD3A 4I0WA 3PDNA 3GONA 3KWMA 1S1UB 5E5NA 1L3TA 3BH6B 3N9UC 2HHSA 1N0VC 3CB4A 4YB5A 2DH7A 4RUBA 4LRAA 4JI2F 4LT6A 4OMFG 2EK1A 4RU9A 1RTZA 2G2OA 4FYVB 3WX8A 1IKWA 4EYIB 4CLFA 2LXUA 3T19A 4UTGA 2VG6B 2BRLA 5L9NA 2DJWA 2V9KA 3BREA 3CO9A 4XDCA 2E7VA 4R8UB 4X65J 3U1NA 4NZ6A 2HBYB 4MTPA 2H5IB 2VPZB 1RYSA 2W4PA 4EMDA 1MN9A 5F3ZA 2CQ1A 1IBKJ 1C0TA 3K5OA 2EFPA 1PO6A 1X4CA 1DQAA 4QW9A 3IBCB 5HAOA 4J5OA 2I1RA 4MYUA 1FERA 3UI3A 1U1NA 4LSLB 2WW8A 3AXKA 1OPZA 2ZE2B 1IXKA 4ZCIA 2EC0A 2F9DA 2ZKTA 2BJ9A 3EMTA 5D0HA 4Y2MA 4KB7A 3QIPB 3FBCA 1RP5A 1NHUA 4TQRA 3TA0A 2JJ4D 4EU0A 4DS5A 1VQNS 3HVTB 3TUJC 4OZ2A 4C98A 2MJUA 1VBYA 3Q0AA 2J9CA 3ZZ0A 4C8OA 1K73T 1V3SA 1ZPWX 3NGRA 1HLWA 2MSSA 1H2VZ 1U49A 1EARA 2OPRA 4M5JA 2KM8C 3CJQA 2QEXS 4C3LA 4QU6A 3QO9B 1SQEA 1WACA 1KLNA 1JX4A 1YITS 2MLXA 1H74A 5M2PA 1CG2A 4KJIA 4ECUA 5KG2A 3DGPB 2O67A 4KV8A 2WVBA 3W5YA 4F36A 2V8VA 1YJRA 1S9GB 3UR3C 2BRKA 4EYHB 2BMBA 3GIJA 4X65F 4YS2A 2V4JB 4WFZA 2CG4A 1GMWA 4YR3A 1IBKF 5EX3A 2F4FA 4MH8A 1RT2A 2M3DA 2YVSA 2GO8A 3D0GE 4DL5A 1WELA 2B51A 3L95X 2D41A 4K0KJ 3SFUA 3PX0A 1RAOA 3D1QA 5L38A 1SV5A 5ETVA 1IM6A 2L41A 4MJKA 3K0JA 2PD1A 5E33A 2VFUA 2PI5A 3FUYA 1R0AB 5B0DA 4UUXA 3D3CJ 3MMCA 1UEUA 2R8GA 4K4VA 3MEKA 2YH1A 1S97A 1MN7A 4HVZA 1M5HA 4RNNA 2R7RA 1KQGB 3MM5B 2W2OP 3X1LB 4ZVTB 3O2IA 4F04B 1Q4RA 2R7UA 5HANA 5I42B 3UCUP 1T9YA 3K8VA 1OQ3A 3ISND 4PG4A 1SC1B 5J2PA 3KOAA 2JEFA 4USHA 3PJXA 4C48A 4FDFA 1X5SA 1NZ8A 2LXFA 5KFCA 1T9VA 1BQMB 1MWYA 4J9UE 2YKMA 5KFOA 3NWRA 1UETA 4J37A 4C0HA 3BQ0A 2P9EA 4DR6J 1HBUA 4X4RA 1YRUA 2DNMA 2V67A 4LF4F 4CLSA 2ZZTA 3UCGA 4K0KF 1IKWB 3ICLA 4HACB 2IVFB 4RX6A 1FNMA 1RT7B 3GG0A 3V6HA 1NK6A 2V9WA 2XI2A 3P45B 2VICA 3I4HX 1HQUA 3DYAB 1IR1A 3LWMA 1WI8A 3CCWA 3TVKA 3IWLA 1LXJA 4OX8A 1NXIA 2JZ5A 4Z37A 2DD8S 4Y2AA 4NYOA 5F8GA 1T3OA 4LSNB 4CLLA 4U6PA 3IBFB 2CQ3A 2K2PA 2FHMA 2LQBA 2K1RB 2ZH3A 2GQQA 5HP1A 3HO1A 4OI1A 2B4UA 1TL7A 1REVA 2DGQA 1O8BA 1SXLA 4MIAA 4NLXA 1VBZA 2ZNYA 3HT3A 4MKYA 1Z1ZA 3LP1A 3JSRA 2KYZA 2F3JA 1R27B 4WFNQ 1FF2A 2FJVA 1SIZA 2VG7A 5A2QY 5DZ7A 2IA0A 1H7WA 2QLJB 3PNIA 2ZOGA 4B3OA 3MM9A 4ZLNA 5HL7Q 4ILRA 3KHGA 2YWFA 2RU3A 2IFXA 5EN1A 2YNFA 3JYTA 4J90A 2PMZD 1TK8A 3ILIA 3DLHA 1DY3A 5KFDA 2LVWA 3MHYA 2MHEA 3RGIA 1S59A 4ED7A 2NSCA 4QIEA 3PYGA 2AWZA 3KG1A 3RB4A 1VHIA 2J0SD 2JRSA 4A8QA 2WVFA 2EEYA 2IA6A 2WB4A 3VGTA 3LP2B 1Y9OA 4LR7A 4LF1A 3I55S 2MHNA 2RS2A 2EFQA 4ELUA 3W63A 2W2NP 4AUKA 1U1KA 3NCQA 2C2DA 2HHQA 2Q1LA 2CJQA 4MIBA 4PQUB 3ENAA 3KDOA 3HHEA 3JSMB 5J2MA 4HDHA 3OR2A 3DLGA 3W2WB 2AMCB 5HMYA 4Q2MA 1CJTA 1N54B 5F8HA 4E2FB 1TK0A 4AXJA 3ISZA 1HKAA 3FEZA 4LF9J 2FQQB 3KUEA 1K44A 1DAXA 3ENVA 3M2UA 1RT6A 2HGMA 3MR2A 2BOPA 4ZLPA 3CDWA 3HKWA 5CAAA 4OI4A 1HI1A 1UVIA 2ABYA 4ZK7M 3IAS9 4UOGA 2EI5A 4NEZA 2EW9A 1NK4A 5SUHA 2ZITA 4X84A 4B9NA 4L73A 4M8LA 1GXTA 3CD5A 4WP3A 4P2SA 5J2PB 4FXVA 4OHWA 4QWDA 3EYZA 2HNYA 2VKZG 3VGVA 3N6MA 2DKOB 3FRYA 2HQFA 1JQGA 4IO1A 4ECSA 5AE3A 4LSZB 1T02A 3V81B 2RMLA 4L3KA 2CWXA 2B7CB 2FZGB 2DEJA 4DSEA 3MM6A 3HZEA 3TJ9A 3UDCA 2P2CB 1AT1B 3LANA 3SCKE 1IBLJ 1LFPA 1U26A 4XDDA 2NXCA 1N48A 2GHWA 4DV1J 1VQSA 3ENWA 1RWUA 4CO4A 4LJMA 2UVUA 2NLWA 3Q8RB 3T9NA 3RAMA 3H2LA 1S1WA 1NHVA 1ZA1B 3GJTB 1FTCA 4WBFA 5GAGI 1HYSA 4YN3B 2RD5C 1RT4A 2YX7A 3GJQB 3MAAB 1HQUB 4ERDA 4LF9F 1CULB 1BHNA 1IKXB 3VQSA 3T1YJ 4HL9A 5F9NA 2DNYA 2IYGA 3KLIB 2FVRA 4NA2A 2AZ3A 3E01A 1ZZFA 2W01A 5K8PA 3IA0A 2HBQB 5KFRA 2N4DA 2HHPA 4KBIA 1J5OB 2ZWOA 1WD6A 2C2MB 3CDUA 3GU0A 1NJYA 3MXHP 1ZETA 2G0CA 3DU5A 2ACMA 1DHMA 5A76A 1W2IA 3TAMB 3R2CJ 2QE5A 2PGCA 2AIRB 1SJQA 5G0RA 1T94A 2R2RA 5F8MA 4CIOA 2B7BB 2WSEC 2HYIB 2VFVA 1PJ7A 1F60B 2XHWA 1IUJA 1HWUA 2DPJA 5IM0B 3M8PA 4LIRA 3KLEB 2ZH6A 4DCOB 4C97A 2G9OA 2ZJPQ 3M30B 4KT0C 1JLBA 1RT3A 2W9BA 4WE1B 1RHQB 2UXDF 3MF5A 1RAJA 3LWLA 3LTOA 1T0TV 4E0DA 4DV0F 1SBRA 5A0YB 1FKPB 2OPPB 1X0PA 3F0NA 4MT1A 1RT1B 2G13A 2HGLA 4IG0A 1TKTB 2XMAA 2HHWA 5A8WA 1RWMB 3FEYB 5KFBA 4OJ1A 1IWAA 2K7JA 2H3EB 2PI4A 3PX4A 2Z57B 4PXBA 4JI6J 4J9NA 2ZKUA 4Y3CA 2BJEA 2Q66A 2FD2A 4J9KA 4PG6A 5KFYA 1S6QA 4J9SA 3HFZB 2ZH8A 1VS3A 4A8XA 5KFHA 3ITHA 5CCLA 3HSZA 4CNYA 3UD5A 1P1LA 2QSFA 1MROA 3OT9A 2PSZA 3EDQB 2YNHB 3SCLE 1Q53A 3W61A 3AQOA 1UA0A 3K57A 1R8CA 3MCNA 3IWNC 2VF3A 4ZA1A 1V9OA 1FRMA 1KEKA 2N4CA 1R31A 3ZC4A 5E7OB 4FS1A 4B9TA 3DRRA 1E6YB 2XS2A 3Q2SC 2VB6A 2RF2B 1VISA 2FY1A 2F65A 3QRQA 2EK6A 5DDRC 2YWKA 5JUMA 1O0PA 4WFXA 2FC8A 2C2EA 2NS1B 3C66A 3LPEA 3FBBA 2JL9A 3HM9A 4JV2A 4CLWA 2V5HG 2NYHA 3RB6A 1XJWB 2GMJA 2KN4A 4X4OA 1LWEA 2N3OA 2HIQA 1UA1A 4Q8EA 3LP0A 3I31A 4H54A 3NAHA 1FX4A 3R5JB 1DURA 1VLYA 4BHQA 4XO0A 4BWMA 3KUGA 5KFPA 4TXSA 5AXNA 1M0SA 2MPUA 2CPJA 5IT4A 1RZMA 4JI6F 3M8RA 1UFLA 4CO5A 8ATCB 2QLWA 3GSIA 2C1EB 1E6VA 1AFIA 2YKQA 3AA8A 4NCGA 5KT4A 2G2ZA 3CCES 1W26A 2XWYA 3LAKA 2GO9A 3RZAA 4MK8A 4O4GB 3QLHB 1O51A 1S6PB 2X51A 3KFWX 1TVRA 1VC6A 5B0AA 4H4KA 4EWTA 3Q8PB 1KD1T 3WBZA 2MB0B 5CQGA 2DR9A 1FRKA 2J9EA 2UVVA 2BM1A 3H42A 1YKWA 4FS2A 4RBVA 5J1EA 1L3VA 2ZHOA 2W4CA 4B9LA 4DV2J 3M32A 3QAUA 2MXYA 1VC0A 3B78A 4CDIA 4DL0C 3FZBA 5K8OA 3D28A 3QT8A 5HN0A 4K2JA 3CSKA 1FKOA 3GMGA 3D9BA 3NCRA 5LJ5Y 1NDPA 1NPRA 2PC6A 2MKYA 2B56A 1YJTA 2ZBQA 1NHKL 3QGPA 1JLBB 6FDRA 3OUYB 1JLFB 3CC7S 1RWXB 4IG3A 1FDBA 3JQMA 4USUA 1Q16B 2RKIB 2HHUA 4LF7F 3MR7A 1NJXA 3A3PB 3OVSA 2E5LJ 4C0BA 2F4VJ 5LMNF 4RW6B 2FZCB 1NUEA 4K4WA 2CQDA 3DLKB 2IM0A 3AH6A 2OPSB 2H9ZA 2CPHA 3O8WA 1T8EA 3MMBB 3FVYA 3FQLA 3K59A 3R6GB 4YUDA 5CXTA 3OJSA 1RLDA 3A8JA 2FYXA 5GAHU 3ONQA 2A6MA 4K50A 5GAHI 4X4NA 3K17A 3Q22A 1NDKA 4JV1A 4O3PA 1FJ7A 2WK4A 9ATCB 2EBEA 4F2SA 1GTHA 1X5PA 1UVJA 1X8DA 2QMUB 4DV2F 5IWAF 4A46A 1NKCA 5HLFA 3MR3A 1YJ9S 1FWLA 3KYLA 2ALYB 3PZPA 1OY6A 2WVDA 4PEOA 3G4SS 3E51A 2F9JA 2FJEB 3S8SA 3TUIC 2IMWP 2LP4A 2GMLA 3V6DB 2WZ1A 3H8YA 3FDSA 2F8EX 2ATCB 3OBIA 4B3MF 5CYQB 5THWA 2E5LF 1WHVA 3ZZTA 4KO0A 2R7TA 4BC9A 1FEHA 3VQTA 3TNVA 3JQJA 4OYMA 1S4FA 3DI6A 1U02A 4N47A 4FVCA 1HIYA 4NL5A 2IDEA 3KLFB 3KK2A 4ZLLA 1OJ4A 3R5BA 3LP0B 1WDDA 4M5KA 5JVGQ 4Q44A 4NA1A 3CIMA 1I6JA 2YKPA 3OFFA 4N77A 3G9CA 1VQ9S 4DR1J 3Q8UA 2WONB 4A8MP 3NNAA 3OFGA 3NLCA 1OY9A 5T41A 5C42B 1S10A 2LA6A 1TKZB 2CQ0A 1TV6B 3CMAS 2WRMA 3DOKA 1SIWB 4MKVA 2OIHA 5DJBA 5LL6d 4DR7J 2X1AA 4YR2A 3BKTA 4KRWA 1M5VC 2XYPB 4B9UA 1EQ0A 1VOMA 2IBKA 1FCAA 1HBNA 3R7SB 3PVXA 2FJDB 4X4TA 2JEIA 4A8FA 2MQQA 5EWGA 3M32B 2DCUB 5AE2A 4IFVA 1N56A 5GAEI 2NQPA 2FLNA 3AJDA 2DXFA 3KG4A 4CNZA 2MQPA 3H20A 1KDNA 3OTDA 2YPYA 5HQ8A 3KG0A 2AGOA 3LGMA 4G65A 3BQ1A 2RRAA 1WI6A 2KFYA 2CZ9A 1RTHB 3CW2C 3KHRA 4RWWA 3VF0B 3FC9A 3I0SB 4DR1F 2LQ5A 4JI5J 4ZN3A 2K8GA 1S1TA 2EFNA 2BE9B 2C3UA 3FMWA 3TZZA 1EB0A 2O01C 3HVWA 2ZH4A 1HQ2A 3ZTSA 2NXJA 1GTEA 4DUYJ 4DR7F 2QTWA 4HHUA 4F4YA 1WKJA 4LF6J 4LQ3A 2IM2A 2IRYA 3TP2A 2N7CA 4CCHA 3O3LA 3BM7A 1AZSA 5E3QA 4ELVA 4J9QA 3DOLB 1FKAF 4NX9A 1X5OA 4PAAA 3NL0A 2MYFA 2JLFA 4O44A 3H4BA 1AUSL 1RAIB 3C6TA 2FHJD 1UJ5A 3M2VA 1RTIB 3ETOA 3I96A 4I1TA 3Q83A 1XERA 1SL0A 3FEXB 1RKIA 5KT7A 2AJ1A 4P52A 1Q5YA 1YJ7A 1U1RA 3Q23A 4J9RA 3DDKA 4A8KA 3AOBA 1NRKA 1X5TA 5HQLA 1FXLA 1CLFA 1HPZA 3IRXA 4F3QA 2ADCA 2BE7D 4UUWA 1R8BA 1ZPVA 2AP6A 4RW7A 3QWPA 1N5QA 3GFZA 3NOCA 1RACB 2BBEA 1FK9A 5IXUA 2ZZMA 4JI5F 4WCEQ 1UKUA 4USKA 1X4BA 3T1HJ 1T05A 1T11A 3NMAA 3R7BB 5E3CA 3QIDA 3G6ES 2GQCA 3BR9A 5KG3A 5KOWA 3EX7B 3DLEB 3SZ2A 5D6GA 2CQHA 2LXIA 3QATA 4LF6F 1HNVA 1X4HA 4ZCKA 2C2RA 1WDTA 4DR2J 3UQSA 4A8YA 2B8QA 2JX2A 1B0VA 4OYPA 4DZDA 2ZEJA 4KSEB 5KT6A 2BZ2A 3SFGA 4CRJA 1S0MA 3A8EA 4DQIA 4I64A 1W2BR 1C0UA 5JMNA 5DQIA 1R89A 2HFUA 5KT2A 3AODA 1QAXA 4U96A 5CYMA 4LREA 4HI2A 3CD6S 3HHDA 3MUVP 3ENQA 2DHSA 2IRUA 4EO6A 3PX6A 1LW0A 5IOLA 3VAGA 1NM2A 4B02A 5F8NA 2V6AA 2PE8A 2XYGB 1N32F 4CH7A 5C2CA 3ULHA 4M5DA 3OVBA 2E1RA 2QL9B 3LO3A 2PFDA 3FBFA 1RHUB 1TUWA 3BGLA 2L9DA 4AQYJ 4B17A 3OQ2A 3I5BA 5D4OA 2L3MA 4P7VA 2HQIA 1SI9A 4KTQA 2A2CA 2CJAA 4IFVB 4HKQA 1U7LA 3PV8A 1I51B 4N8OA 3PRBA 1PGZA 2MZSA 3V2UC 2BW2A 4P72A 4DJBA 3VR1A 1JJ4A 3B54A 4U9RA 3HSGA 3TUZC 4WJBA 4FZVA 2UUBJ 2HVDA 1JLEB 3F41A 4JI8F 2MZRA 4NE9C 5KFGA 3KMQA 1CBKA 3NP5A 4DR2F 4A48A 1D8ZA 3CEDA 3HVAA 2E7XA 2VC0A 2OELA 1FRJA 1IKYB 2MQMA 3HHLD 5HVHA 4IO9Q 4Q7AA 4WTOB 3RBZA 4DF4A 4WU3A 1S77D 2GC8A 1OIAA 3IO1A 2QRRA 5IQQA 4RW4A 1RHJB 5DS7A 2J7WA 1PYTA 4BDPA 1JLGB 3LGNA 3DOMB 2Z56B 1TL1B 1QVFR 4DF8A 2X3GA 3CJ4A 4XK8C 2MLZA 3TAQA 3EM1A 2HNZA 2HS3A 3X3UA 2X1BA 5T7LB 4KH1B 1NSPA 3J81U 3NS7B 3ZTOA 1NDCA 4K4TA 2IAJB 3M2VB 3PR4A 3MEEA 2UU9J 4LF2A 2D3O1 2HKEA 4UOHA 5ETRA 2DNHA 4QYRA 3G82A 1H3DA 1N5YB 2IJRA 1UJ4A 2DHGA 1U8WA 2DRDA 4QPTA 2NPFA 2UUBF 1JXLA 3T41A 2AV5A 3P4UB 4LR8A 1UWAA 1SJ4P 3EVWA 3W5XA 1VRUA 3CJTA 1Q8IA 2R8JA 2PA3A 3OJUA 3UWTA 4FYYB 2LQ8A 2FHKA 1ZAWA 5DM7Q 1XNQJ 4CQ1A 1RHMB 3SMZA 3U27A 1LOUA 1NB7A 2R2UA 1SKSA 3ZTRA 1VQKS 3ZZYA 5L1KA 4QR0A 3TVZA 3D5MA 4FYXB 2W9CA 4Q43A 2XULA 3BQ2A 4HYKA 1FXRA 2HFNA 3J7AN 1Y4ZB 1VJWA 3H0PA 3R1HA 4QR2A 2ZWPA 5LMUJ 1RYRA 5DG7A 2XMJA 2CQIA 1N36J 3ZNUA 2UUAJ 2NSBA 2UU9F 3D66A 2ASYA 3I0RA 3PKYA 4PG5A 2XZDB 4ZJQA 5FIIA 1RA7A 3HULA 4NLDA 2C3PA 5KFJA 1KFSA 4NXMJ 4P2XA 2Z8QA 2IM1A 2DVIA 2DY1A 3D54A 2Y1RI 3DMJA 1S1XA 1RGVA 1UWBB 3M8YA 4NLRA 3PO5A 2N82B 4U8VA 3TJ8A 1H73A 2FLLA 2B6AA 2LQ9A 1YG0A 2KKHA 2V8HA 5E3PA 1P27B 3QNWB 2VONA 1QAYA 1OMSA 3MPYA 4R5PB 1OQ6A 5KFLA 3MM7B 2D3UA 2JFKA 4ZVSB 1EAYC 2VUGA 3M9OB 1H0HB 1I3OB 4JI0F 4RKUC 5A8KA 4ZP6A 5T14A 5CA5A 3EUNA 2V94A 3POTA 3T5JA 2P8IA 3EGWB 3BEGB 2FTRA 2LEPA 3LF0A 1NO8A 2FDNA 4DFMA 5HMXA 1WNEA 3MEDA 4W90B 3RJMB 4KQZA 2JOQA 1U0HB 5LMUF 1PSDA 4OJGA 5D78A 4RUHA 1JKHB 3IXQA 1KLMB 1GEHA 2UUAF 4DFJA 2CPFA 4N56A 1P1TA 4PKDB 1BUXA 2IY5B 1KC8T 1YK9A 2Y0SD 4ECYA 5IT9U 1TELA 3S6EA 3KK1B 3GJSB 4X4QA 2BW7A 1D9DA 2E29A 3MURP 2AJ4A 2LEAA 3C6UB 4P6QA 2RVJA 1F3FA 3UVJB 2WVEA 2IDLA 2PFFB 4E8UA 3JB9k 2HHTA 2B5JB 3N4WA 1HI8A 3DNCA 2Z2YB 2WSFC 1NJIT 1SUQA 3R2DJ 1FVSA 3FSYA 4U67Q 1AXQA 4OYIA 4P73A 1NPPA 4U95A 4LRFA 2RUSA 1RWVB 3KLHA 3KJQB 2MZQA 2GCFA 2MKCA 3MD1A 5KG6A 4FF1A 2OLWA 2V4RA 1RSCA 3MGJA 5DDQC 4WTYA 1JNRB 4ES2A 3IM9A 2VBYA 2YNGA 4UOFA 1RAHB 2XZWA 4F25A 2VFRA 2J9DE 5IZHA 5C24B 1K1QA 1HNXJ 4PWDB 1TFYA 2KRRA 1GNKA 1MU2B 2RH3A 2DB1A 2VOPA 3OL8A 1ROFA 2GGPA 1QAIA 1HNZJ 3HMJG 3GE9A 4KHPJ 5K14A 3MECA 5IQ6A 2M7SA 1R6VA 4C3MA 1RAEB 1LK5A 1RDRA 2CFXA 5D3GA 5LM7E 2ROEA 1FI4A 3I5AA 4QIFA 1CJKB 1N6QB 2E5IA 5J2QB 2VC1A 3T3FA 4IDKA 3OW2R 2AEMA 1WC5A 2J9DA 4KC5A 4NYPA 3R97A 4UQTA 1KR4A 3JXOA 3CF5Q 1HW8A 4FF3A 4U8YA 4UZBA 4KPCA 2DYAA 1RADB 5KFNA 2HZAA 2BABA 4MKAA 4EZ6A 4J9LA 4HI1A 4Q0BB 3OR1B 1R0BG 4OYWA 2PEHA 2XQCA 3CDEA 2APOA 3M8QA 4OI6A 5LXRA 2H5JB 4Y2IA 4DFKA 5J1NA 4GVBA 4LBHA 1T9UA
chains in the Genus database with same CATH topology
1JKHA 2ZFHA 1DTTB 1KLMA 1MNEA 2FPHX 2B7CB 4V19J 1HNXF 1S6QB 4LSNA 1IBMF 2LYVA 5A6PA 4DSEA 4ES1A 4FPRA 6FD1A 4QIWD 3I82A 3NAIA 4ICLB 3MM6A 3HZEA 3KLGB 3UDCA 3SSSA 2E66A 2XI3A 3VAFA 4EUVA 3ITHB 1TL3B 2LQJA 2NUHA 3LANA 4G1PA 4ALZA 3K8WA 3GR1A 3F73A 1U4BA 4EBCA 3G8TA 3SCKE 3OV7A 3CCVS 1LFPA 1U26A 2W4DA 4XDDA 1U1PA 2HHHF 2K1RA 4FYDA 2ZBIA 1DLOB 1SC6A 2KT5A 2L9NA 4Y28C 1MROB 1N48A 2GHWA 1WHXA 4QWCA 1VQSA 3B4MA 3ENWA 4IKAA 1XNRF 1RWUA 4CO4A 1GAOA 4YMEA 1M90T 5CHCB 4B9MA 3KK1A 4LJMA 4YB1P 2UVUA 1FNXH 2NLWA 2ZOMA 1S99A 1ZTTA 3Q8RB 4GO7X 4ILLA 1TL5A 1OSCA 4DSIA 3HHKA 3T9NA 3RAMA 4PXCA 5E3AA 5DO2A 3H2LA 1S1WA 2EFOA 2IHR1 3PKMA 3GFXA 1NHVA 4CO2A 3C6UA 2CZVC 1FTCA 2CQBA 3L3CA 4ECVA 4ELTA 4AQYF 5GAGI 2Y1JA 2EG1A 1HYSA 2KFZA 1UW4A 2GNKA 2QSWA 2RD5C 1RT4A 2YX7A 1HQUB 4OI0A 2ZH9A 4ZPVR 4ERDA 4LF9F 3DLLQ 4I67A 1IKXB 4FXDA 2HVIA 2CQ2A 2FLOA 3PFEA 3ZZRA 1AW0A 2VBWA 4DV4F 1M1KT 3DRRB 3MAQA 2DRAA 3VQSA 4E98A 3C3LA 4Y0FA 5LSOA 2XNRA 2B5JA 1FDDA 4OHZA 4G6VB 2R2SA 4HL9A 4QIGA 1MMLA 5F9NA 1HI0P 2DNYA 2IYGA 3KLIB 2FVRA 4WU2A 2DR5A 4NA2A 2ATLA 3M1VA 3E01A 2F7VA 3H5YA 1XK8A 2CVEA 2NXUA 2YY3A 4K2XA 1ZZFA 4PR6A 5K8PA 1FJCA 3IA0A 2KT2A 1D9AA 3PFOA 1HD0A 3CCMS 2BACA 5KFRA 5DDPC 4I2QA 2J0QD 2N4DA 3H5UA 3MMAB 3HFKA 2OFHX 2VASA 3CIZA 1HWKA 4OI2A 4K4ZA 2PO4A 4DL3A 2FGOA 1LWEB 5I3PA 4DG1B 2XCAA 1VQ8S 2HHPA 1YWXA 5B09A 4UQGA 2DGUA 4KBIA 2XS5A 1J5OB 1WD6A 3EGNA 4C8YA 4GMKA 3IGNA 3CDUA 2J0XA 3T5HA 4ZPWR 1CQNA 1IKVB 4RNMA 2XLIA 3MPWA 1NJYA 3MXHP 2E7WA 1ZETA 4QYZJ 2K3IA 1SJFA 2KXNB 3IBWA 2G0CA 3DU5A 1FRIA 1SH0A 1WEYA 3LP2A 2IJFA 1DHMA 3W3SA 2BYCA 1IM4A 3JAMY 2MY7A 1MMNA 4DUZF 4WXWA 1W2IA 5C24A 3I9ZA 4KKOB 2KM8B 3TAMB 4PWDA 2RIJA 2LKZA 2QE5A 2PGCA 1MU2A 1V3ZA 3MTKA 4C3KA 3KMSA 2ZHBA 1SJQA 2NREA 2IRXA 2W7AA 3BO2A 5G0RA 1T94A 2VODA 2R2RA 1E6VB 3HI9A 1HL6A 5F8MA 4CIOA 4ED0A 1B64A 3PACA 4F26A 4NCGB 2BANA 1RKJA 2B7BB 4X4SA 2WSEC 2HYIB 3NBPA 1HHSA 1BQNB 2VFVA 1CC8A 3MUMP 1F60B 2XHWA 1SUQB 4CT8A 5F8IA 2E1AA 2C42A 4ECZA 1IUJA 1HWUA 4ES3A 2DPJA 5IM0B 5AXMA 4PQUA 3M8PA 3PW5A 4LIRA 3KLEB 4WIIA 1JK9B 2AQ4A 2ZH6A 1X4EA 4G1QB 4B3RF 2DGTA 5KAKA 2KJWA 3IN5A 4C97A 2G9OA 4DV7F 1P9QC 5KFMA 1TVRB 1WWHA 3MR6A 2C3OA 2ZJPQ 3M30B 2RDIA 4KT0C 3JSMA 4EEYA 1JLBA 1RT3A 1K1SA 4YY3F 2W9BA 2I9SA 3W2WA 4WE1B 1Q1KA 1VI7A 4C8LA 2HNDB 1U09A 2E44A 2XBPA 1N6QA 2YX1A 4ZPBA 3GFYA 4JUZA 5J2QA 4PPZA 2D9PA 2BE2B 2GV1A 1ZZNA 2YNGB 3PIOQ 1S1VB 4TLRA 4ZKAA 2R7WA 3MF5A 4AE5A 2UXDF 3BO3A 1LW2A 1RAJA 5DDOC 3LWLA 5ITHA 4E0DA 1XR6A 1J2VA 3AAWB 1TUVA 1YVFA 4DV0F 3FMBA 1SBRA 2AX0A 3CT9A 4HH0A 5A0YB 5J1EB 3GIMA 1T03A 1FKPB 2HGNA 4OZ1A 5CCMA 2OPPB 1KTVA 1N8RT 1X0PA 1XWLA 4KR0B 1A6LA 3MZIA 2V4QA 2XY7A 3OVAA 1YIJS 4AYBD 1RT1B 2A3JA 5B0GA 2G13A 1LWFA 1DBDA 2P9CA 2GGPB 4RUCA 5GAEU 2AJQA 3J7A1 1JJ2R 1FKOB 4I56A 2FUG9 2VKRA 2HGLA 4IG0A 5DGAA 2E9TA 2KFNA 4DR5F 1TKTB 4GC7A 2JVOA 1X4FA 5KFEA 3CJ5A 2NR0A 2FVQA 3GG1A 2F40A 4LVNP 4DL7A 2DNQA 2HHWA 2HLUA 5A8WA 4Q0BA 3OR1A 2YKOA 3FEYB 3K58A 5KFBA 3LH2S 3Q24A 4OJ1A 2K7JA 2PI4A 2JEGA 3WX4A 4PQAA 3PX4A 3RAXA 4B9VA 3N01A 4KIAA 2DNGA 4PXBA 2Y1IA 1H38A 4IG3B 3CCTA 2D74B 3DM2A 2C22A 4J9NA 2OSRA 5I3UB 2ZKUA 1X0FA 1LWCA 2UUTA 3V81A 1JXEA 4Y3CA 2BJEA 1XBWA 1RT5B 2Q66A 1V3RA 2BQRA 4RU2A 2FD2A 2U2FA 4J9KA 2RQCA 1LV5A 1QY7A 4PG6A 5KFYA 3K5NA 1DTTA 3SXLA 4YDDB 1DQ8A 1S6QA 5J2NB 4J9SA 4TYAA 2XO7A 4QU7A 1S0NA 2EG2A 5KFVA 3PR5B 2ZH8A 2HRUA 4ICLA 5IT9Y 1VS3A 4A8XA 5KFHA 2DH8A 3KLGA 2E9ZA 5J1PA 4QWEA 3ITHA 5K5MA 4DL4A 1XNQF 4YOEA 1TL3A 5KFQA 5CCLA 1D0EA 2L9WA 4CNYA 4DLGA 2VQFF 1P1LA 3IR6B 2QSFA 3VCDA 1MROA 2E1MC 1BC6A 4U7UK 1WHYA 2PSZA 4ZHRA 2YNIB 4IRDA 3RBDA 3SCLE 2YNHB 3EGZA 1Q53A 4TLQA 3MAHA 1FJEB 3AQOA 2FJAB 3MUTP 5A6WA 4EZ9A 1ZBTA 2JC1A 2R8IA 2R7SA 4DL2A 1XMOF 1UA0A 3FFIB 4Y2KA 4CO1A 3K57A 2NZ4A 3N0VA 1R8CA 3KHLA 3VTIA 4H4OB 3RBEA 2J6UA 3IWNC 1A7GE 4ZA1A 2WB1D 1V9OA 1FRMA 4Y34A 2N4CA 1KEKA 1R31A 3MI7X 3ZC4A 2VQEF 2L08A 3OTCA 5FDLA 1AUDA 1IQTA 1IKXA 5E7OB 4FS1A 3SV3A 1RTJB 4B9TA 2OH2A 3DRRA 3OHAA 1E6YB 4UW2A 1DZ5A 2XS2A 3Q2SC 3HP6A 3H40A 2VB6A 2KHDA 2RF2B 2FY1A 5KFUA 2EK6A 4YHHF 2JWNA 5DDRC 2YWKA 1N36F 2EBGA 3KLIA 5JUMA 1NH7A 4NOHA 1O0PA 5GADU 4JI7F 1XN9A 2YKAA 3PW0A 3PO4A 4LUBA 5HLFB 4WFXA 2CZ4A 3OTBA 3VAKA 2DHAA 2FC8A 4O3OA 5GADI 2C2EA 2HPUA 3HHLB 2NS1B 3G8SA 4AL5A 5AE1A 3C66A 4A8WA 2JL9A 2Q79A 3HM9A 4JV2A 1X4AA 2V5HG 3TOQA 4C11B 3MMAA 3RB6A 2GMJA 1LK7A 2KI2A 2KN4A 2RRBA 4NXMF 1JLCA 4OX6A 1LWEA 2N3OA 4DG1A 4X4OA 2HIQA 2J5AA 5KG5A 1XEZA 2JFDA 1UA1A 2XMUA 2M88A 4Q8EA 3LP0A 3I31A 5B0CA 1J5OA 4F02A 2QMXA 4B08A 4H54A 3NAHA 4ED5A 2ADBA 3WZ0A 1DURA 2XEXA 3VZHA 3WC2A 1VLYA 4BHQA 1FT8A 3CTRA 5MLCV 1Y5NB 2A2DA 4BWMA 4BC7A 5M2UA 5KFPA 1IKVA 4XO0A 3RB0A 4G3IA 5B0FA 3RRKA 4TXSA 5AXNA 1M0SA 2UVWA 2PMHA 1U6FA 3RW6A 1X9MA 2MPUA 2CPJA 5IT4A 1N88A 2AJ0A