2CPYA

Solution structure of rna binding domain 3 in rna binding motif protein 12
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
114
structure length
114
Chain Sequence
b'GSSGSSGEGDVNSAKVCAHITNIPFSITKMDVLQFLEGIPVDENAVHVLVDNNGQGLGQALVQFKNEDDARKSERLHRKKLNGREAFVHVVTLEDMREIEKNPPAQGKSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA-binding protein 12
publication title solution structure of RNA binding domain 3 in RNA binding motif protein 12
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 15
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2cpyA01
5GAGU 2DHSA 1H2TZ 1NJIT 1WI6A 3NNAA 2CQCA 3ZZZA 2MKKA 2DIUA 4OZ1A 2XNQA 2MZ1A 3IWNC 3CCRS 3P3DA 2CPEA 3UCUP 2ADCA 2OIHA 3TO8A 1KOOA 1K8AT 1NU4A 2CPYA 2XNRA 4QU6A 2DIVA 3OW2R 2MQNA 3DLLQ 2KYXA 2GO9A 4LMZA 1NO8A 2M4MA 2FHOB 2LA4A 2CQ4A 2RQ4A 2DNPA 2RVJA 2CPIA 3UD3P 2KT5A 2VOPA 4F26A 2MXYA 1X5TA 2HGNA 2MQLA 1WHWA 2LYVA 1X4HA 3NNCA 1B7FA 1UW4A 1X4CA 2CPJA 1YI2S 2KU7A 2KXHA 5DM7Q 3H2UB 1WG1A 2CPZA 1M1KT 1QVFR 2ZJPQ 1WHVA 1URNA 3MI7X 2CPDA 2L08A 1KD1T 3R27A 2X1FA 4TLQA 3BO2A 3BO4A 2KXFA 3VF0B 2XB2D 5BJRA 3U1MA 2VONA 2N3LA 1WG5A 3MUVP 4PKDB 2M9KA 2DNGA 2DNZA 4FXWA 2K3KA 1DBDA 2LA6A 1H6KX 2J8AA 4EGLA 1X5OA 2D3OR 2MB0B 2J0SD 1U1RA 4C7QA 2DNHA 4WF9Q 3J7YU 2I2YA 2DO4A 3S8SA 4WIIA 3SDEB 2KRBA 2QA4S 2XS5A 4Y00A 2DNKA 2O3DA 1VQOS 1D8ZA 2DNMA 2MQOA 1DRZA 1W2BR 2OSQA 2M8DB 4WCEQ 1S72S 2MZQA 2KH9A 5LJ3Y 4J5OA 3G96A 2DH9A 2ADBA 5CYJA 1RKJA 3VAIA 4TU8A 4RU2A 3NS5A 4CH0S 1VC6A 1JJ2R 1ZZFA 2RS8A 3MD1A 4PR6A 5GAEU 2CQDA 2XS2A 1U1NA 2X1BA 4UQTA 2KFYA 5GVQA 5IQQA 1N88A 1YHQS 1FXLA 2MZJA 1U6BA 3VAGA 3UD4P 3U1LA 1G2EA 3VAMA 2CQBA 1FJEB 3MXHP 3PIPQ 2EK6A 4OZ0A 3THTA 3ZZYA 5DETA 2DGUA 3UWTA 2CQ2A 2MHNA 2KG1A 4WKRA 2KI2A 1FT8A 3HI9A 1N8RT 1F9FA 2DGWA 4ZKAA 2DNRA 2RUGA 4CIOA 2RS2A 2CJKA 1HA1A 2YH0A 3B4DA 2CPHA 1HD0A 4TU7A 3L3CA 3G6ES 2LEBA 5D78A 2HZCA 2LXUA 2D9PA 2YH1A 1VC0A 1M90T 2DNLA 1X4GA 1X0FA 2JRSA 4U67Q 3DXBA 2QFJA 5DDQC 1KQSR 2MGZA 2MKSA 1N52B 2JVOA 4YB1P 1K9MT 2DH7A 1U1QA 1VQ4S 1FJCA 1M5OC 3CCUS 1KC8T 1ZH5A 2JX2A 2M0GB 5IM0A 3CPWR 3VAKA 3CMES 1SJ3P 2HGLA 2CPFA 2KVIA 1SJQA 3MOJB 3CCVS 2E5HA 1R8PA 1SXLA 5LJ5Y 1YTYA 1JJHA 4F02A 1WF1A 2M88A 2DHAA 2KN4A 4W92B 4TU9A 2G1DA 5DM6Q 3S7RA 1PO6A 1JJ4A 2MKHA 1IQTA 1PGZA 1WEZA 3R1HA 2AYMA 4LJMA 2L41A 1XN9A 2MKIA 4ED5A 1K73T 2AD9A 2DK2A 1Q82T 2KHCA 3MD3A 3CXCR 1A7GE 3RW7A 4Y0FA 2BOPA 5D77A 1YITS 5JVGQ 3G71S 1X5SA 2MY8A 2E5JA 5EN1A 2CQIA 1VQKS 1VQPS 3VAFA 4IOCQ 2DO0A 3CTRA 3TYTA 3P49B 2DITA 3CUNA 1VQNS 1X4BA 3HHNB 5LSLA 1FO1A 1N54B 2DGTA 4QU7A 2GHPA 1WG4A 2VODA 1YJ9S 2HVZA 2EK1A 4IO9Q 2KXNB 1WHYA 2L9WA 2ZJRQ 2LQ5A 3CULA 2A3JA 2XSFA 3CC4S 1OPIA 1OIAA 1WF2A 3ULHA 5HL7Q 2LECA 4F25A 1UAWA 2M2BA 1CVJA 2AYEA 5H1SV 2G4BA 3K0JA 2MPUA 2DH8A 2KG0A 5IFMA 2M70A 2SXLA 2DNYA 1VQ8S 2OTJS 2DNQA 2HGMA 2DNOA 2JVRA 2MQPA 3NNHA 2Q79A 1DHMA 5LXYA 1YJWS 3VAHA 5GADU 2DISA 2NZ4A 2MY7A 4CH1A 4W90B 1U1OA 1DZ5A 3EGZA 5CA5A 2M52A 1Q81T 5LXRA 3FEYB 2CPXA 5GAHU 3IRWP 2G0CA 3CD6S 1SJFA 5JVHQ 1SJRA 2RQCA 2MZSA 1Q86T 2FY1A 3CCMS 3UE2A 1A9NB 3SDEA 5FJ4A 2CQHA 1BY9A 1YIJS 2J0QD 2DGOA 3G8SA 2U2FA 2N3OA 1FNXH 3SXLA 3P6YC 2RT3A 1ZZNA 3UCZP 1WTBA 1VQ9S 4M5DB 4A8XA 2MQMA 4V19X 1AUDA 1YWXA 3BEGB 2I38A 4IUFA 2CQPA 2NLWA 3Q2SC 1D9AA 2AYGA 1WHXA 1X5PA 2RRAA 2MKJA 2YTCA 1RK8A 1M5VC 1OWXA 3S6EA 1VQ5S 2FPHX 1U1LA 5MLCV 2CQ1A 5DDPC 2OJ3A 3JB9k 2DGVA 2MJUA 1P1TA 3H2VE 2CQGA 2LMIA 2E5GA 2KM8B 4WFNQ 2MKCA 1P27B 3LPYA 2ERRA 3V4MA 1YJNS 4YOEA 2X1AA 3VALA 1HL6A 4IOAQ 4ERDA 1KOHA 2MZRA 3VAJA 1U1KA 4QPTA 2YWKA 2QEXS 4QQBA 2BZ2A 2RNEA 5HO4A 2ZJQQ 2PEHA 2LKZA 2WBRA 2VOOA 1U6FA 1QM9A 2FC8A 4C4WA 3EX7B 3LQVA 4BS2A 1U1PA 1HD1A 3G9CA 2CQ0A 3UCGA 4PRFA 2LCWA 2MZTA 2E5IA 3MDFA 3Q2TC 1FHTA 2EVZA 2OSRA 3FEXB 4Z2XA 1X4DA 3I55S 1H2UX 2DHXA 3BO3A 3EGNA 3CMAS 2AYBA 1H2VZ 1M5PC 2DGSA 1O0PA 1VQLS 1R8HA 5GMKa 5DDRC 2D9OA 1Q7YT 1UFWA 1X4FA 1VQ6S 2F3JA 2HYIB 1WEXA 3US5A 3BS9A 1VC5A 2OTLS 4C0OC 2JWNA 1X4EA 2LEAA 1VBXA 1OO0B 3J7ZT 1QVGR 1U1MA 3S01A 1WEYA 4YUDA 2LXIA 2RU3A 2M8HA 1M5KC 2MMYA 2V94A 2DB1A 2MGZB 3CCQS 3B4MA 2YKAA 4WFBQ 1WF0A 2PE8A 2M7SA 5IM0B 5CXTA 2UP1A 2F9DA 4P6QA 4FXVA 2E44A 2RRBA 1S79A 1SJ4P 4UY8T 2MQQA 1VBZA 2KRRA 2XS7A 1VQ7S 5ITHA 2DHGA 3P5TL 3SMZA 1WELA 1WWHA 2MSTA 3NS6A 4LIRA 3D2WA 1FJ7A 2DGQA 2DNNA 2KM8C 5DDOC 3CCJS 3CCLS 2CQ3A 1WI8A 3THPA 5LSOA 2J76E 3G8TA 1JMTA 2B0GA 2DGXA 3CC2S 2U1AA 3CC7S 3CCES 1UP1A 3MUTP 3CCSS 2MJNA 3RW6A 4WFAQ 2F9JA 2MYFA 2N7CA 1X4AA 2N82B 2FC9A 3MUMP 3R1LA 2MSSA 2X1GA 3I56S 2K8GA 3TP2A 4CQ1A 3G4SS 1VBYA 3PIOQ 1U2FA 3MURP 1L3KA 1VQMS 3NMRA 3N9UC 3CF5Q
chains in the Genus database with same CATH superfamily
3K7RA 1Z2ZA 3H8YA 4WFXA 1WACA 1K44A 3QT5A 4URQU 3KLIA 1X8DA 3MHYA 1VK3A 4N5SA 2LA4A 4DF8A 3NAHA 4ZPAA 2NXUA 1X5TA 1J5EJ 1JB0C 2Z4PA 2BA9A 5DM7Q 4N56A 3FK4A 2XYHB 2CPDA 2CIMA 3BO2A 2R7TA 2GIRA 2VONA 1RT5A 2DNZA 1UA1A 3TZXA 4WK3A 4YFUA 1DBDA 3OR2B 3KHRA 4C8KA 1U1RA 4YY3J 5E3PA 4H4KC 3MM5B 2I2YA 3OUYA 4EBCA 1ZA1B 4MKBA 2QA4S 2KJVA 3UN5A 4DSJA 1UVLA 1DRZA 2XSJA 3LP1A 3MMAA 4E2FB 2DPIA 1HNWJ 2FD2A 4B3RJ 3VAIA 1QSSA 1RCOB 2HRYA 1NSPA 3MD1A 4NLDA 1KLNA 1RI7A 4CNYA 2X1BA 3LGNA 1AFIA 3TUJC 1N5QA 2HQIA 3HP6A 5K14A 2KG1A 5AJ3F 3MEDA 3OFEA 4J9UE 3M2VA 4HI2A 1RSCA 3PEHA 5D78A 1QSYA 4O44B 3TX8A 2WSCC 2FB0A 3ITHB 2JSXA 4FNIA 1WNEA 4YR3A 2FY8A 4QCLA 3BKUA 4NZ7A 3QAEA 1NHKL 4O4RA 1L3TA 3E3XA 2ASLA 1Y5LB 3JSMA 2HK2A 4NLUA 1GMVA 1S6PB 1RT6A 4XDCA 5E3QA 4EO8A 4C3MA 1DFDA 1RAGB 4Q2MA 1HW9A 1KP6A 4ZP7A 3RB3A 3K5MA 2IRYA 3R1HA 2EW9A 3C6TB 4YR0A 2ZZTA 5E2QA 2QN6B 1HHSA 5HROA 2NZCA 3UN2A 1JLAB 2GJ2A 1NSQA 1VFJA 4PEOA 1WSVA 1ROFA 3VAFA 1HNXJ 3TYTA 2UXCF 2HURA 3IC1A 3CUNA 2K1RB 2KTQA 3NOGA 4O3OA 2FHJD 2DCUB 1WG4A 3DDKA 2HQCA 2EFQA 3HCXA 4KHPJ 3IWXA 1OPIA 3J7A1 1EB0A 5KT2A 2LECA 1VK8A 4XIUA 3K0JA 4LSLB 2VICA 1J2VA 1VQYA 2VH7A 1UZHA 3OVBA 1Q8LA 3NNHA 2DNOA 3PW0A 2Z0GA 1DHMA 3OBIA 5GADU 1WD6A 3SBMA 3H42A 5CQGA 1F6TA 5GMDA 2ZOFA 4XDDA 3C14A 4RO0A 2GIFA 3SI8A 4YHHJ 2HW3A 4DDFA 2RDIA 1VDHA 4L75A 3ENQA 3K5PA 1RA6A 3I31A 3IN5A 4JI2J 2ZWOA 2CJYB 4Q8EA 1KN6A 3RB4A 2BQUA 1S0OA 5K9FA 2AWZA 1REVB 1WHXA 4LF2A 2FPHX 1ZTTA 2W2QP 2MJUA 2QRRA 1TKTB 1JLEB 1OYEA 2RIJA 3UD5A 3BGRA 4P73A 4YOEA 1T11A 3KK2A 2C2DA 4QQBA 1TFYA 1N36J 2RQMA 1TAUA 3L7PA 1N32F 3CO0P 3W1YC 3X3UA 5DQHA 4C4WA 4CO3A 2FLPA 2XZTB 1ZOTA 4UZCA 3UCGA 2J0XA 2E5IA 5A0YA 3HXMA 1X4DA 1S7HA 3BSCA 3MPDA 4ZCLA 2GVDA 4PQUA 1OY9A 1VQ6S 4DL4A 3ZXWA 2ZNZA 3LWLA 1BQXA 2W1BA 1QVGR 5KG7A 2FUG9 2UUAF 2MGZB 4WXOA 4O3PA 1TUVA 1GX5A 3I87A 5GMEA 5IM0B 2UP1A 2F9DA 2VD3A 3SSQA 2YPZA 4HT7A 4JI8F 5F0WA 4M8LA 4EZ9A 2LQ8A 4HHUA 5EX0A 3T41A 2XWXA 2RF2A 3C15B 4IG3A 1WI8A 3DHXA 1E6YB 5ETRA 3NCPA 4PWUA 5J2NB 2WZ1A 1RAJA 2W2PP 4QIWD 1VMBA 4I6AA 4P7VA 3HHLA 4JI5J 3PIOQ 2K7KA 4PZVA 4KKOB 1WI6A 3KLEA 2IJNA 2CQCA 2V2VA 2DIUA 2CADA 4OZ1A 1VBKA 1NZAA 3TZYA 3TO8A 3RBDA 1NU4A 2XI3A 4LF9J 2UZAA 2F4VJ 3DLLQ 2GO9A 2CQ4A 2HAFA 4DV0F 2EC2A 5B08A 2E1RA 3ZZOA 2M3DA 1JLQB 4ZCMA 1BC6A 1J27A 3A8IA 2X1FA 1DJ0A 4ES3A 4M94A 3AHPA 5G0RA 3HVWA 2HFVA 2CDQA 2J0SD 3MEKA 1FI4A 1TP7A 3BJYA 2WVBA 4A4JA 3T19A 4QIFA 2J5AA 4FF4A 3W7BA 4F4ZA 4Y00A 3L09A 2QA1A 1LNQA 4UOGA 1TL3A 3DU5A 1S1UB 1RKJA 5H9EK 1VC6A 1NK8A 1VRTA 2PMWA 4LF6J 3R6LB 4PPDA 3JAMU 3VAMA 2H5JB 4TN2A 2HKEA 3BBBA 3D1QA 5CD4H 5DETA 2MHNA 4IG0B 3EICA 4X4PA 4MK7A 1SV5A 4PUOA 4CIOA 3HDSA 3GV7B 4P10A 3R3TA 4OHYA 1YRTA 1Z4UA 2HZCA 3M8RA 1G4CA 2LXUA 2DNLA 4TYAA 3EVMA 5EX3A 3PRVA 2QFJA 1F5AA 3MEGA 2JVOA 4OZ2A 3EGWB 2WB4A 1U47A 1WTFA 4USWA 3OSPA 2HGLA 2CZ9A 2R2TA 4DV7J 3MOJB 3R5GA 4BBYA 3KMSA 2NYIA 3M1VA 2KN4A 4Y2MA 4W92B 3JAMY 2P9EA 3W9IA 4ZP9A 3H98A 3VGTA 3M8YA 4O23A 2KHCA 3MD3A 4MKYA 4J9PA 3G6VA 2VIHA 2C2EA 2MY8A 3R7SB 3LALA 4DV5F 4JOUA 1D9FA 1FO1A 4ECWA 3ZZUA 2O1PA 4FYVB 2V63A 1CJUA 3K2YA 1R6VA 4QWBA 3PR5B 1S57A 2HNYA 1HNIB 2H51B 1LKZA 4OFZA 3JTOA 2ZUAA 3QJLA 5BXIA 3CCWA 2WCXA 4P2SA 1YJWS 2F1FA 2OFGX 3AOBA 1DQ9A 5T7LA 5KFVA 2MY7A 4EI2A 3T9NA 4CH1A 2NCKL 4GKKF 1CC7A 1Q81T 4P72A 2DXDA 5E0OA 5D0GA 5JVHQ 1WSRA 2PDAA 2VU5A 4WBFA 4RWWA 3IBFB 1J5EF 3G8SA 4RX6A 1SPBP 3DNCA 1KNZA 3H5XA 4NOHA 3I9ZA 1U49A 4KSEB 4IRKA 2VHGA 1RA7A 3ONQA 1RK8A 1QTMA 3S6EA 2KVQE 3HD2A 2CQ1A 1P1TA 2HNZA 1OY6A 3I0RB 3A8EA 2BKNA 4WFNQ 1H74A 1ULRA 4A47A 4KH1B 4YY3F 4J37A 2YVSA 4NEZA 4YR2A 4G1QA 2EBGA 2ZH6A 5J1PA 1YJNS 1S10A 4DN9A 3CJQA 1HNWF 2F7VA 1HBOA 4FYYB 4B3RF 3SEOA 3MDFA 5HMXA 2H1YA 2R7XA 5CZVA 4X4NA 2QIFA 3MAQA 1S1XB 4MFBA 4ED3A 1UMJA 2I5JA 1HMVA 2J7WA 4P2XA 3HX9A 2IPOB 3JQMA 2QC3A 3QSYB 1CJTA 3QWPA 3OPKA 3PO4A 1TVRA 4P6QA 4ZLNA 1C0UB 1KLMA 1VQ7S 3GJRB 1V3RA 1WWHA 2MSTA 1JX4A 2Q6CA 1FRJA 4F2SA 3W3SA 1HWIA 2DNNA 3CCLS 2CQ3A 2ZH8A 2J76E 1FKOB 3KLHB 2R9LA 4OI4A 2BJEA 2AX1A 3MUTP 3MFHA 3RW6A 2VG7A 2NYHA 3POTA 3MPWA 4IR1A 2ZEJA 2K8GA 3TP2A 3LGMA 2QZ8A 2EFPA 3OTCA 3A3NB 3N9UC 2ZBCA 1NJIT 5EHHA 3G82B 2VFVA 2MZ1A 2IM0A 2R7UA 1K8AT 1HNXF 4IFYB 5D3GA 3H25A 3ISZA 2MQNA 4C98A 4AE5A 5T14A 3C46A 5KFAA 2VJUA 4IO1A 5KFWA 2XY7A 1C0TB 2KU7A 3H2UB 3LUYA 2JJ4D 1SH0A 1EETB 1UWBB 4K2JA 1CJKB 4CLYA 4R0EA 2OPSB 3BSOA 4DZDA 1E6VB 4R8UA 1T9WA 2PD1A 1Q8IA 4DPYA 3ILOA 3HPOA 4LBPA 3SCIE 1RTHA 3DM2A 3MR2A 3OD2A 5J2PB 5IC4B 2WVDA 1FK9B 3KJQB 4N8OA 4WIIA 2KRBA 1MLAA 2QL5B 1SKWA 4ZVRB 3NMAA 4KGXB 3IGVA 3PJWA 4YHHF 4ZVOB 4TU8A 4CO1A 1KDNA 4KJIA 3TVKA 2YNHB 4M5JA 1U1NA 4UQTA 3KLFA 4JI2F 3H4BA 1KBRA 2ZM6J 3KNAA 4C11B 4Z37A 4K4ZA 5GAHI 4O3NA 4NCGA 3VR1A 1FE4A 4K4VA 2OMLA 3EZUA 2K06A 2Z2ZA 2CNKB 4X4UA 1ACMB 3GJSB 1RU2A 2YH1A 1M90T 3M32A 3TARA 1YJUA 2XMKA 3T3FA 3SYZA 2UUCJ 2ZDPA 4ZVFA 4RW8A 1N36F 1G1XA 2OELA 3W9HA 9RUBA 3AJ2A 2IVFB 2ZC4A 2HPUA 3LP2B 2BDPA 2B8QA 1H98A 1GXUA 4XPCA 1RHMB 2DRDA 2ZBQA 3DHWC 3DRYA 2ASDA 4A8QA 1S77D 3RW7A 4I68A 2BEFA 1CS4A 1HBMA 3H40A 1FEHA 1FWLA 3QGGA 5A8RB 1N54B 1FKPA 2X51A 1BGXT 4J9RA 2JEJA 2KT2A 2VFUA 5K8NA 3E01B 3VHQA 5HVHA 4ID5B 3ETOA 2SXLA 3JTNA 4JI5F 5HP1B 2HGMA 1RJJA 2YWWA 8AT1B 1X9WA 4URGA 4ZK7M 1NPKA 2H5EA 2ZKUA 2BM0A 5LXRA 4K4UA 4ZPTR 4LF9F 1Z2LA 4KFBA 2F4VF 4NLGA 2R42A 2Z56B 1NKBA 1XR6A 3KG0A 1YRUA 3UVJB 3HULA 3QT6A 2BRLA 2FQQB 5HQLA 3TJAA 1QAYA 4HKQA 3JYTB 4QWAA 5B0EA 1G3OA 3DYAB 4ED7A 3LP0A 3Q2SC 1CQMA 2V0NA 1T7PA 4FPIA 3WIVA 2MHEA 4ZP8A 1BQMA 2B9XA 2DGVA 1RBAA 2LMIA 2F5GA 3KTQA 1VOMA 1LW0A 1MROB 4ZPBA 3TOQA 2B5JA 5M2UA 3WDOA 3MAAA 2QEXS 2BANB 5CABA 2ZJQQ 1QM9A 2FC8A 3MM7A 4BS2A 4KIAA 2NREA 2D1CA 4IDKA 4DQRA 2A10A 4J9NA 2ZFHA 2UUBF 4DV3J 2VUGA 4IQMA 1XIQA 4WZQA 4NL5A 2VG5A 4LF6F 5A8WB 3BKTA 3ISND 5KG6A 5GMKa 2F3JA 3J7YI 2QO3A 2IVYA 1NDKA 3NWGA 4RNNA 1HBNA 1I1GA 2HMIA 2GO8A 3KYLA 1RKIA 3CCTA 2HS0A 5CXTA 4ECVA 1WC4A 2A6OA 5KG5A 1S79A 1WKLA 1P8GA 3BQ1A 3BV8A 2IRXA 3IS9A 4YN3B 1FJ7A 2DGQA 2QMWA 2EG1A 3DOLA 4DV7F 1HKAA 1RT3B 1NKEA 2WOMA 4I2QA 3RBZA 5LSOA 3W5XA 1PSDA 4UY85 3O8WA 2IMWP 5K20B 2MSSA 4KV8B 1C1BB 3R7BB 4X4TA 1HNVA 3EGZA 3FFIA 3KK1B 1S6QA 3IWNC 3PM9A 3UCUP 1KOOA 3MMBA 3SSRA 2BBEA 1LXNA 2DIVA 1QAIA 1QUVA 3HHLD 1Q5VA 4AD6A 4ATNA 2L3MA 3KK3A 3MM6B 1N5YB 2VOPA 4O44A 3D9BA 1WHWA 1X4HA 1UW4A 1KQKA 2J7UA 2C2ZB 2QG9B 2XWYA 1M1KT 1XJWB 3MI7X 2IBKA 3W60A 5A6PA 2XB2D 1JLGB 5BJRA 1HPZA 4B3MJ 3RBXA 1WG5A 4ELVA 4A8MP 4KE5A 4OI0A 3QJPA 2OEMA 3HMJG 2K3KA 3TZWA 4EGLA 3UR0A 3OJSA 3R5AA 4Y28C 4K5SA 4QR0A 4U6PA 1PAUB 4ECTA 3EPIA 3C6TA 2R7RA 5HJXA 1QY7A 5DRKA 5HMWA 3PJXA 3F0NA 4WCEQ 3GONA 1N6QA 4BWMA 5AXKA 1F1BB 4DN0A 1RT7B 1H7WA 1ZZFA 1OPZA 4NA2A 3VGUA 4MH8A 3W5YA 1XNQJ 2XLJA 2VFRA 3LTOA 4M5MA 4F2RA 2CQ2A 4Q45A 1TL1B 2KT3A 1F9FA 4FBUA 1R8BA 4ZN1A 4OJGA 3L3CA 4DQIA 3V5RA 1AA1B 2D9PA 2N4CA 5KG2A 4F4XA 2JRSA 4LSLA 3I9V9 1F5BA 2XMWA 3VWSA 2BACA 3CMES 4UOHA 2H5IB 3I0SA 2VQEF 2HS3A 4Z7CA 1SXLA 1BLUA 2IYIA 5C24B 1EIYB 4LF7F 2CVIA 2GHVC 2UUTA 4LJMA 3KLGB 4ED5A 1RTZA 4ENOA 1KHWA 5KFKA 2W7OA 3IO1A 5E3CA 4LF4J 7FDRA 4Y2IA 1MU2B 1RWMB 3LA0A 5C42A 4R0JA 5EN1A 1VQPS 1RBOB 2CKWA 1JIHA 1RWOB 1RTJA 4N76A 4Q0BB 1XR5A 3CD5A 3MM9B 3DLJA 3IWLA 2VODA 3M7VA 4KRWA 5C2GA 1NK7A 2L9WA 4CT9A 5AXMA 4OQJA 1UVKA 1KTQA 2MEWA 1RADB 2ZE2B 3GYNA 4DX8H 3C2PA 3TAQA 2V4RA 2BE2A 1WDTA 1AZSA 2V2QA 1T95A 1YBUA 3N01A 4LFBJ 3N28A 3OXGA 4DS5A 2Z2MA 3Q23A 2W9BB 4UT4A 4F4WA 1ZAWA 3QMQA 4RNMA 2OPQB 2NXJA 3DRSB 3T5KA 5IZHA 3C66A 1SQGA 4NLXA 3CDAA 3M30B 2O01C 3OLAA 4PABA 4KO0B 1IKXB 4CZCA 2LLZA 4CLLA 3KWMA 1WTBA 3PYGA 1BWEA 4B02A 2FVRA 4MMOA 4ZS6A 3V6JA 5EDWA 2IIHA 3DLHA 3HFKA 4B3OA 3E8OA 1HWLA 1JK9B 4I4BA 4FF3A 1OWXA 1LQ9A 3ET6A 3M8SA 2IY5B 4RUHA 3GU0A 2ROPA 1ZM9A 3DLGA 4RZRA 1ZAXA 1NK4A 3HVRA 3O5TB 2HHXA 5HO4A 1AUSL 4IFVA 2BKOA 2CZ4A 2XZDB 1T3OA 2XGQA 4CLSA 2ACMA 1IR1A 1I51B 4PRFA 4ZIVA 4KQZA 3FEXB 2CYYA 3AJDA 3CMAS 2ZBRA 5L9XA 4CYUA 4AL5A 1Q7YT 2ZM6F 3HD1A 4DMZA 3EZOA 3M9OB 4O3RA 3GTYX 3MF5A 3PJ9A 4WIQA 5JMNA 1SC4B 4EBDA 4NXMJ 2UUCF 4UY8T 4MT1A 1IBKJ 4EU0A 1IUJA 4KB7A 3A13A 4ZP6A 2DGXA 1CSJA 1YBTA 3QNWB 3EE3A 4JI3J 4WFAQ 4ZA1A 4N7TA 4CQ1A 5B0GA 3NMRA 3CO9A 3CJTA 2YKMB 4CLZA 3NY0A 5BYRA 3IR6B 2CFXA 2CPEA 3GILA 2JL9A 4ZIWA 3OW2R 2JC0A 4KHRA 5LMNJ 4H4OA 2HHWA 2XBPA 2IA0A 3MEEA 4OV6A 2DT9A 2V2KA 4OX8A 1LWEA 1IKVA 1R27B 3UDEA 5EWGA 4WTYA 2YKNA 1BXNA 1OY8A 3H5SA 4NASA 3CJKB 2DY1A 1JLBA 2J8AA 3KMQA 1RGVA 3M2RA 1HQEA 2BRKA 4ECZA 4LRCA 4A8KA 3I5AA 3NBPB 2K3IA 2O3DA 4PXBA 3UR3C 4M5HA 3FUYA 4LRBA 1SL0A 3IXQA 3RBEA 3PW5A 2GMJA 3BYPA 3J7Z5 3VCDA 1N0VC 2D3ZA 3DCAA 2RS8A 3F41A 4HACB 3T6JA 1PKUA 2MZJA 1Q78A 1G2EA 4RLEA 1NJZA 4OZ0A 3RRKA 2NQPA 2JC1A 2OPPA 4TY8A 3A3OB 4CI0B 2P2CB 3KDOA 3D6MB 3B4DA 1HD0A 4XO0A 3HHEA 4J7CA 3SV3A 2LXFA 3ZTQA 1EKRA 2QE5A 1X7VA 3DXSX 2D69A 4QYZJ 3ADAC 1SJ3P 2XQCA 1NM2A 2CPFA 4BWJA 4OHWA 2YKQA 2GGPB 2UXDF 1R8PA 4PG6A 4DV3F 1YJRA 5C25B 1T3NA 4C8ZA 2HNDA 3KG4A 3GFYA 4DFMA 1EP4A 2C22A 3BGFA 3R9LA 2E7XA 1V9OA 2CXEA 2F63A 2YNFB 4NRTA 2C3YA 4DX6A 2YQ3A 3FCHA 2GMHA 3H7HB 3TA1A 3B6BA 1UETA 4HR2A 4GKJF 4EWTA 2J6TA 1TUGB 2EK1A 2WVEA 1LWFA 3MAHA 4YMEA 3A8JA 1RE1B 5DZ6A 1P9YA 3V4IA 4PCQA 3TUPA 2AJFE 1H73A 2CG4A 2XMMA 4ED1A 4GC7A 4NMXA 2IC3B 4NI2B 4F36A 5LMUJ 3U1NA 4UOFA 1U2CA 1C1CB 1GMWD 3PEJA 5KFNA 1RT1B 2CNNB 5D15A 5GAHU 1UL3A 1KQGB 1GH8A 2HBYB 4P2FA 3QRRA 2R4FA 5BR8J 5FJ4A 1S49A 1T02A 2RT3A 4V1Ak 1CJVB 1D0EA 2Y1LB 1D8YA 3GR0A 2HZVA 4B3MF 4A46A 1VQ5S 5KG0A 3OHAA 1FERA 2B7BB 4ZN3A 2BR0A 2G13A 2E5GA 1WC3A 1BE4A 3KLHA 3EXCX 1NNDA 1FD8A 3M8PB 3TA0A 6FDRA 3VALA 4ERDA 4J91A 1KOHA 1RHJB 2FHMA 2BMBA 3L4BC 2NPFA 3PW2A 3FBCA 2WONB 2GFFA 5CYMA 4ZCIA 2V8DA 2XCAA 5J1EB 1VGYA 2OSRA 3I6PA 1RHUB 2EWHA 2RD5C 3FBFA 2DGSA 1UJ4A 4DHVA 1NAQA 4EZ6A 2HQGA 5IV3A 3TZZA 1X4EA 1RYRA 3WHIA 5F9LA 1VRUA 1JLCB 2PA3A 4KYZA 1TMJA 2YKAA 2OPSA 1Y5NB 3BSNA 4W4MA 4LF1A 3W2WA 3QQCD 1T03B 2BE9B 3BREA 2XO7A 3VTIA 4RW9B 5ITHA 4J9QA 3CVKA 4U7CA 4WP9A 2XYGB 2XYPB 5F8IA 3DRRB 4DUZJ 1HWUA 3V6DA 3CDWA 1DLOA 1PBAA 3BN7A 3CC2S 1XERA 4LVOP 1SC6A 3MR5A 1WKKA 2KZZA 4RW7A 1ZTWA 4H4MB 4LF4F 1R8CA 1RYSA 1H2TZ 3OHBA 4C3KA 3NNAA 4F50A 2D3O1 1WC6A 2BVZA 4YDXA 2LFVA 3P8BB 4ER8A 4XAKA 4KGZB 1T9TA 1GK8A 1XR7A 2IHR1 2VA3A 4YB6A 4DLEA 4ID8A 4I7FB 3W65A 5HJYA 1CQNA 3DGPA 2KXHA 3B8HA 3O1LA 1WC5A 1TKZB 3OTDA 3UN3A 2W7AA 4OI3A 2FGCA 2ATLA 3L9ZA 2RMLA 2QV6A 4L73A 2V68A 4ZVTB 2DPJA 3RRGA 3TQEA 4LFBF 3RU0A 5C7PA 2OPRA 1LW2A 4RW4A 3J7YU 2RDJA 3FCVA 3SDEB 2R7VA 1MNEA 3P4UB 1D8ZA 5KG4A 1HBUA 1UW9A 2KH9A 3RJMB 2DH9A 2LDIA 3B78A 2UXBJ 2DR9A 2GCFA 2E5LJ 4J9KA 4LBHA 1LWXA 4ZVEA 4GRSA 1VHFA 2H65B 4HHJA 3UD4P 3U1LA 1T05A 4GO7X 1TAQA 1FRKA 2EK6A 3D6HB 3ZZYA 1XWLA 4AQYJ 4JV2A 4D3GA 1FT8A 1VI7A 1HA1A 2YH0A 5HI7A 4DF4A 1RTIB 1N5VA 5KOWA 1MWQA 2AW0A 3NAIA 2A2DA 1X0PA 1R0BG 3J81j 4JI4J 5K5MA 3CCUS 1KS2A 2Z2YB 1FRHA 2F40A 2RSQA 5JUMA 3CCVS 1B0PA 2B56A 3TR5A 2HSEB 2R2SA 1YTYA 2M88A 3QO9B 3W2VA 5DLFA 4USTA 4DV2J 4A8SA 2AD9A 1A6LA 5HLFB 4F3OA 2NUUG 4I69A 1AROP 4Y2CA 3CXCR 4LSNA 2ZITA 1JKHB 3PYFA 1CULA 5KTQA 3WX4A 3DYAA 2FLNA 2E5JA 2AJ1A 4IRDA 2Y1RI 4NXMF 4QWCA 2Y1JA 1IXKA 4PG5A 3QATA 2BJ8A 4QU7A 1FF2A 2B6AB 3M6XA 2DRAA 2HVZA 2FLOA 1IBKF 2JEIA 2ZH7A 3PX0A 3QFHA 1PJ6A 1HYSB 2MPUA 4K4TA 3IR7B 1VISA 4JI3F 4ZJLA 3D3BJ 2M70A 3GV5B 3OT9A 3CJSA 1U02A 4FDFA 3H2LA 2ZH1A 5HQMA 3RUBL 2MQPA 4N77A 1U8SA 3D68A 3LAKA 1FXRA 4W90B 2Y8YA 1JLFB 3QJJA 2CPXA 1R7IA 1UA0A 2MZSA 3KJVB 5LMNF 2R8JA 2W4DA 2WW4A 5F3TA 3J81U 2EG2A 2J0QD 4WE1A 1V5IB 2F8EX 5K8OA 1S9EA 4DQQA 2BXJA 1MG7A 2YTCA 2KDOA 4I2PA 4DR7J 5MLCV 3ZNJ1 1N56A 1XNRJ 2AGQA 1RTDB 3HO1A 4N47A 2MZRA 3VAJA 5I42A 3DOKA 5IV4A 2WBRA 4OHVA 3J81Y 2BJ1A 2BOAA 2VBZA 1H72C 3NL0A 3IG1B 1MN7A 3I55S 4HEA9 4X2BA 2ZZNA 5C2CA 2R8IA 4BC7A 4NYPA 1IWGA 3D66A 3DDIA 2W2NP 2X7IA 3DRPB 5J2MB 3BPDA 4DG1A 1GAOA 2ZBPA 1FFSB 4K50A 2GAHC 1NHUA 3OFHA 1TELA 4OYWA 3C19A 3TJ8A 2AEMA 2IBOA 4NLSA 1XK8A 5RUBA 1YRXA 4CO0A 4LIRA 3NS6A 1H7XA 3BPSP 3NCRA 4LVNP 1N5SA 3EJMA 1PIEA 3NS7B 4WTOB 1TV6A 4WP8A 2N82B 2IVMA 1TFWA 5E41A 1XEZA 1IQZA 2VPXB 2Y3YA 3M2UB 2RDDA 4DL7A 3QRPA 4DR6J 4F3MA 2BKPA 1IKYA 2KYXA 3OR1B 4X64J 1S76D 4F26A 2F65A 1F5CA 2ROGA 1URNA 1P1LA 1S5ZA 3N6NA 2YBVA 3Q89A 5ETOA 4M5GA 1HFEL 4MIBA 2AZ1A 4FN5A 5HSPA 2CZVC 2MLYA 5EGYA 1LK5A 4WZMA 2CUYA 1X5OA 1RLCL 1URRA 4OZLA 4X65J 2CNOB 1NJWA 2YWEA 4LIWA 3V81A 4JI7J 5CYQB 3MR3A 2V4JA 3PW4A 5CAAA 5L1JA 2W9AA 4F0KA 4DV1J 1MU2A 2FJVA 5HAOA 4CNZA 2KL8A 3OVSA 1GXLA 2AHOB 1OMSA 3P5BP 1LK7A 3K8VA 2ZZMA 3CSKA 3TUIC 4KGVB 2DGUA 3M05A 1IM6A 1RDRA 3HSZA 2DNRA 2ZH5A 4CTAA 4XK8C 2FLLA 3QGHA 4ECYA 2OD6A 1W2IA 3N5BA 2C28A 3IRXA 1U45A 5KFXA 3IAM9 4ANEA 3U7JA 3A8KA 5FDLA 3CDUA 4U67Q 1M1HA 4TNOA 4KT0C 5DDQC 3A4TA 1KEKA 1D09B 1V3SA 4DXLA 3OQ2A 1U0SA 1GT8A 2G1DA 3K5LA 1KVJA 1QAXA 1UTAA 2GIQA 2DK2A 1R0AB 3G6YA 4F04B 3KJFB 2CJBA 4CLTA 2BYCA 1FDNA 3BZQA 1UKUA 4IOBA 4A8WA 2MLZA 5F8JA 2WVCA 1S1TB 4B08A 2GMLA 2DO0A 3CTRA 4X4SA 2D3UA 2R2RA 4A8YA 3TEGA 4AXIA 1NMEB 4RW6A 4OLOA 3FRZA 4UQGA 4TY9A 1MMLA 1S1WB 4DUZF 4CH7A 4NLYA 3NP5A 1FDBA 5C5JA 4DL5A 2AGPA 1S1VA 1WF2A 1YDLA 2W9CA 2QLFB 4ETXA 3P45B 5D6GA 3NXZA 5E33A 2VC0A 1QUPA 4B9VA 3EMTA 3SSSA 2DISA 2R7OA 3J80U 3KKFA 4AL6A 1L5UA 2W7PA 3KLIB 1RABB 1U1OA 1MMNA 1KHVA 1LFPA 4ES2A 3G86A 2G0CA 1YLXA 1HI8A 4USUA 4NYZA 5EWFA 1RAOA 2P6SA 4PXDA 4P74A 3UDVA 4UF4A 2HWIA 4AUKA 2E29A 3UCZP 1RT5B 2COLA 4A8XA 5KFTA 3BEGB 2I38A 2UU9J 3QT8A 4B9NA 1HW8A 3AXKA 2J6SA 3VZHA 3DLKA 1NJYA 2PI5A 8ATCB 3OUYB 2CJ9A 2FIUA 3J80Y 4WP3A 2APOA 2QFIA 2VQFF 2XSJB 3LP1B 3W64A 3MMAB 1F9EB 1U1KA 3EWGA 2QLWA 3OV7A 4NA1A 2QSFA 2B4UA 1C2PA 1U6FA 2AKWB 2HHUA 2VA2A 3G9CA 2GVZA 2UXBF 1BQNA 2GNKA 1RAAB 1FHTA 4DQSA 2P5VA 4Z2XA 5K14B 3MEDB 3M2VB 4DCPB 1CG2A 3LPEA 3EVWA 4AQYF 4KPYA 2HHHJ 4C0OC 2LEAA 4G1IA 4GVBA 2J9EA 1WC0A 3AH6A 2GW8A 1M5KC 1KFDA 3CCQS 1FFWB 2HLUA 4PPZA 3C6UA 1WF0A 1U2RA 2E44A 3JSMB 4JI4F 3FSXA 4I6YA 2MQQA 1RT6B 3CJKA 2E1MC 4I64A 3M8QA 1WELA 1M5HA 4L74A 2VDHA 3HZEA 5L1LA 3SCKE 2LQ9A 3PX6A 3THPA 2NPIA 2V9KA 4CO4A 3NBPA 1O51A 5HROB 1LWCA 1RUSA 2GAGC 4DV2F 2N7CA 1CEZA 4WFYA 3G4SS 2V34A 1VQMS 1ZPVA 4RNOA 2FJDB 1IBLF 4DPWA 1TU0B 3DI6A 1S48A 2I6WA 4NPOA 5E5NA 4NLWA 1ZA2B 5IWAJ 3HJVA 2FVPA 5SUHA 5IS2A 1RCXB 2MQLA 1YI2S 3FDSA 3A12A 2N7YA 1R6YA 3SZ2A 1O8BA 2M5YA 4IRCA 1UJ5A 4NCBA 2GZOA 4M5DA 2M9KA 2RILA 5DG9A 3QZ8A 4B3SJ 3DLEA 1B0TA 2YNIA 2BJDA 2AX0A 4J90A 3C14B 3TX0A 4C7QA 5KFUA 2DNHA 4UW2A 4WF9Q 1UJ6A 1HIYA 2RUSA 3JQKA 2XS5A 3V6HA 4YEAA 3PHTA 1W2BR 4C0BA 1ZBTA 2OSQA 1FKAF 4DS4A 2BE7D 3G96A 4NXNJ 1JJ2R 2NUHA 3W62A 3R2DJ 3BDPA 3D5MA 2VDIA 4C97A 3FNNA 5LSRA 3GJTB 2EKYA 3OFGA 4FPRA 4YQWA 2KI2A 4DR7F 1Y10A 3BGRB 3BH7B 4U7UK 2LEBA 3KK2B 1GTHA 3CCZA 3TA2A 1XNRF 5HQ8A 3DXBA 4DSFA 1NPPA 2DH7A 1M5OC 7AT1B 5A0YB 3C16A 3HFVA 1FWPA 2P9CA 3F73A 3BR9A 3AD9C 1XMOJ 2IDLA 1VIXA 4F8RA 4PQUB 2GVDB 3TWZA 1IVZA 4TLRA 1PO6A 2HHVA 4DR2F 1K73T 1Q82T 1W7WA 3SQOP 2PA8D 2HIYA 5M2PA 4USIA 1A7GE 1C4CA 2BOPA 4WYWA 3MR7A 5D77A 4K4XA 5LT5A 3N0VA 1SJ1A 4UUWA 3Q8RB 1OS5A 2DGTA 2RF2B 4IG3B 2W4PA 4CT8A 1YJ9S 5IQ6A 3GYGA 3BBCA 4PWDA 4OYXA 2VFSA 2LQ5A 4YDDB 2XO6A 4L3KA 3NEKA 3DMJA 3ULHA 3PW7A 3HHLB 2M2BA 2G4BA 4C2MA 3MCMA 4FF1A 3KLEB 1N34J 2CWXA 4LQ9A 4QWEA 4IH6A 5J2QA 5I3QA 4QW8A 1TK8A 3FEYB 2B9WA 3BQ2A 2IA6A 3OVAA 1Q86T 4A48A 4X64F 4NWBA 3SCJE 1YIJS 1Q79A 3T5JA 1FNXH 4RWXA 3SQGA 4ZLPA 4OZ5A 5G0RB 2W8LA 1LFWA 1BUXA 1YWXA 4CLFA 5GAGI 2CQPA 4IR9A 4NLOA 1FVSA 2UUWA 5HBMB 4P7TA 2FJXA 1LOUA 2XMTA 5SZTA 1ZAVA 5B0BA 4DL0C 3VQTA 1R3NA 2KM8B 2WHOA 2MKCA 2D41A 2FHJA 5B0AA 2ERRA 3BGOP 3GZ7A 1AB8A 4X65F 1TL3B 4KAIA 4DU7A 2E1AA 1RWUA 2NR0A 4YS2A 1VRTB 4C6AA 1FA0A 1U24A 5KOXA 2LCWA 2HLTA 3TVZA 2EVZA 3LF0A 3OL6A 4CLKA 3IBWA 2DHXA 1RT2A 4RL1A 1SV5B 4PUOB 3A3PB 2HFUA 3I32A 5D0HA 2D9OA 3DOMA 9ATCB 4KPCA 1VBXA 1WEYA 3F44A 5B7WA 2HWHA 4B9TA 2MMYA 3MEGB 4O4GA 1SI9A 2GJIA 1FTCA 3NGKA 3T1YJ 1ZPWX 1QSLA 2BW2A 3TANA 2HRTA 1VBZA 5E7OB 1U0HA 5I3UA 3AB2B 4OYZA 1XMQF 3D2WA 3M1VB 3MPYA 3MMCA 1FE0A 2VBXA 3MCSA 5DDOC 4FZVA 4FNHA 1X60A 2H9ZA 4K0KF 3CMQA 3CCSS 3NRBA 1RQ0A 3KNGA 5F0UA 3E2EA 1T0TV 2YNGA 3PV8A 3BH6B 4OMFG 2G2ZA 2ZD1A 4K59A 4LFAJ 8RUCA 1T94A 4Q8FA 4QU6A 2Y0BB 3CDBA 3HM9A 3UD3P 1SC1B 1CJUB 2LYVA 1RTIA 4X84A 2NXCA 1JXLA 2HNYB 5D0EA 5D0RA 1KVIA 3VF0B 4KTQA 4TVAB 3U1MA 1P9QC 3N6LA 4K7QA 3CE8A 4ED0A 5T7LB 1RBLA 4ZPVR 3RYLA 2ZOGA 3M6WA 1WJ9A 2VB6A 5HMYA 3W8PA 4K4YA 3KHLA 2GS8A 1Y7PA 2JNJA 4X4OA 2OEKA 4ZHRA 1PBUA 2DHHA 1QE1A 3D7SB 2MKYA 2MQOA 3E51A 2MZQA 2MDAA 4ZPDA 1HQUB 2PO4A 5CYJA 4W98A 1HWJA 3TW0A 2CQDA 2J9DE 3PRBA 2KFYA 4C8OA 3D0HE 2FVQA 4R5PA 3AD8C 3PDNA 1U6BA 2UU9F 5HVFA 4OZNA 3HVAA 2HNZB 4HH1A 4NCAA 3UWTA 1J5OA 4DL3A 4ZVHA 2BABA 2H54B 3HF5A 3V2UC 4ZKAA 4WJBA 4G1QB 3AB4B 3KUGA 5IT9U 4NA3A 2UVWA 2CA9A 4DL2A 1F9HA 2VPZB 5KFPA 2AJ2A 1HBOB 4HL9A 3FSIA 5KFDA 3KXDA 1Y5IB 2B7CB 2JX2A 1ZH5A 2XLIA 3LWMA 4X62J 3LW5C 4EBEA 5CH7B 4MFBB 2DHAA 2I5JB 1HMVB 2O5DA 4Q44A 2G0JA 4PXCA 4DV6J 4ZITA 2CDRB 1ZM4A 2MKIA 4ZOSA 2RHSB 2J9DA 1CJTB 5DG7A 4FVCA 4O0IA 3BB5A 5IT9Y 2LU2A 2CVEA 1TVRB 4ZPCA 3MPVA 2D7SA 1KLMB 3ICLA 2I0XA 2CRLA 4RR5A 3OJUA 2P6TA 4WK1A 5LM7E 1NSAA 4OYMA 2XY6A 1SC3B 2E9RX 3CULA 2VG7B 1SUQA 2XI2A 3CC4S 2BJ9A 1SCJB 5IFMA 1VQ8S 4LREA 1EQMA 4NZ0A 1FD2A 4PAAA 4QIVA 4B9MA 2V8GA 5HVGA 2ILZA 1WUUA 5D3GB 3HK2A 3WX8A 3LANA 1SH2A 3RG6A 4CCHA 2UUAJ 4K4WA 4OV1A 2L9DA 5KG3A 5IWAF 4MKVA 1WOSA 1A9NB 2IJRA 1TL7A 1T8EA 3H90A 4U7UD 4ICLA 4DX5A 1DTTA 1YK9A 4R8UB 2RKIA 1YJVA 2IYGA 3K17A 1RTHB 1UVMA 3DM2B 1U1LA 3MECA 4B3SF 3H2VE 3KJNB 2CQGA 3QWUA 2JEFA 2VBWA 5K8MA 3W5ZA 2A1BA 3V4MA 4BDPA 1OJ4A 3B82A 3PNIA 3TVYA 4KHPF 1YJTA 4CM2A 3KLFB 4NXNF 4O3QA 1NDLA 3IFEA 1MMDA 2W01A 4WWSA 1YVFA 4NCGB 1O0PA 1VQLS 4U96A 2QJ3A 1BWVA 1NUEA 2ZHAA 5HANA 2PIIA 3M32B 1HNZJ 4X4RA 1W26A 1MWZA 3DKDA 3BGUA 4RW8B 1QJHA 4DL6A 1RWXB 2M7SA 3VGVA 3TJ9A 4J9LA 2RRBA 1JNRB 2MQ8A 1GX6A 5FIIA 4F4AA 2L9NA 2C2RA 3NGDA 1ZETA 1NK5A 4OX9J 5CYQA 2BQ3A 1TKXA 2ZKTA 4P2MA 1S4FA 4HH0A 1K1QA 1X4AA 3PXGa 2HHSA 2ZHOA 1Q0NA 4C3LA 4B9SA 1DQ8A 1DY3A 2BV3A 3DDNA 1V6HA 4H54A 2EC0A 3FKBA 1CS4B 1HBMB 3L7UA 2XNQA 4BLGA 4LQ3A 4EFAC 4MTPA 3KFWX 5KFMA 1U26A 3HLUA 4QYZK 1S9GA 4GVLA 3CB4A 4M5IA 4HYKA 3TRGA 1UZDA 4TLQA 5CD4A 3BO4A 1WOOA 3OTOJ 4DX7A 3AD7C 2YX1A 5A8KA 3K8WA 2HBQB 3BR8A 4FP9A 2LA6A 4F0MA 3IR5B 2W2MP 3TEHB 5KFRA 3C3LA 4KFBB 2OH2A 2WSFC 1DAXA 5I4MA 5KT3A 1B4SA 4ETZA 4DV5J 4U9RA 1L3SA 2W24A 3ELHA 3R5JB 4C8NA 3LP0B 1SKRA 1FXLA 3QIPA 5GVQA 5IQQA 1SQFA 5HMZA 2CQBA 1BQMB 1VJWA 2YY3A 1FDAA 1LW0B 2VG6A 5DO2A 2B5JB 2CJKA 2E1PA 1Y4ZB 3MAAB 3O6QA 4WU2A 3LOUA 3MM7B 3HT0A 1K9MT 3M8WA 4IDKB 4ZLJA 3JTPA 4GKKJ 1MSWD 2MLXA 4Q5VA 2VG5B 4CLPA 5KFQA 2W8KA 2KFNA 3IGNA 1APSA 5U47A 2VJVA 4ILMA 2R7QA 4LFCJ 1HBNB 2HMIB 3G2XA 2Z30B 3P96A 1UVIA 3M4XA 2E66A 2ZVIA 3MM8A 1YITS 1MWYA 2CQIA 1AYEA 4IOCQ 3T1YF 3IS9B 3GJQB 3DOLB 2AF6A 2WOMB 4Y2KA 4I2QB 4B9UA 1VHIA 3QLHB 1AT1B 4ZJOA 4E98A 2PFFB 3UDLA 1CVJA 4QIEA 5H1SV 1S0MA 4NLTA 2HVDA 1HNVB 3CGIA 2DNYA 2OTJS 3FFIB 3GFZA 1S6QB 2UVUA 3S1TA 1S12A 3MMBB 2FJBB 4NRUA 4V19J 2ASJA 1GEHA 3OR2A 3KK3B 4LFAF 1I6JA 2EFOA 1Q16B 4P52A 2ASYA 3MM5A 3CCMS 1KKHA 1R89A 2WW8A 1FNMA 3NLCA 1NK9A 4RBVA 2XGPA 2N3OA 3SXLA 3EZ5A 1HPZB 3K57A 3QYYA 5IOLA 1B3TA 2HG4A 2JFKA 4ZDNA 1DARA 1OSCA 1EZZB 3UO0A 3SCLE 3GG0A 4JI0J 3PACA 2FDNA 1P27B 4M5NA 4RBTA 5B0FA 3PFEA 4DUYJ 2X1AA 1FCAA 1N6QB 1KSPA 4HI1A 2XCPA 1Q53A 3ITHA 4USJC 1HD1A 2AP6A 2GA7A 4JUZA 1VQSA 2FVCA 2ZH2A 1FJGJ 3CJ5A 2XEXA 1G6BA 3KUEA 1H2UX 3BO3A 1S6PA 1PAEX 1WEXA 2PT0A 3FMWA 4FS2A 1Y3KA 1U1MA 4RBUA 4CO2A 1V5VA 3B4MA 3ZFVA 1NKCA 4TQSA 4NLRA 4ILRA 4WFBQ 2PE8A 4CDIA 1JLAA 3K59A 1RWVB 3I0SB 5GAEI 3BGLA 1FWKA 3M6VA 4RUCA 3MZIA 2KRRA 3QRQA 2I1RA 4I56A 3HZGA 2XMVA 3KG1A 1K0TA 3H5UA 4I67A 1KWMA 2K1RA 4X62F 1PJ5A 4EMDA 5F8MA 4OLPA 4U95A 4PQAA 4JBCA 2VZ9A 4J9MA 3MTJA 4OI6A 2QGFB 2HQ3A 3Q22A 1MW7A 1EHWA 4DV6F 2MYFA 5ETLA 4F4KA 1T9XA 5C42B 3MUMP 3R1LA 2L48A 4S0MA 1CPZA 1U2FA 4CLUA 2FJAB 5GAGU 4QR2A 1UPPA 4OHXA 3ZZZA 2MKKA 4OYBA 1JWWA 1RTJB 2Y9HA 3P3DA 4LR9A 1Q7LB 2ADCA 2OIHA 2B3TB 1NH7A 4DR3J 3GIKA 1NO8A 3U27A 4WKYA 4OI1A 3NNCA 1ZS6A 4DPTA 1K0VA 2OAUA 4I1TA 3ZTRA 2AJ0A 4C48A 2E9ZA 2BE2B 2IDEA 3H20A 1AZSB 2X3GA 3RGIA 2BW7A 2H48B 3CJ3A 3L95X 2RE1A 1H0HB 2C3UA 2Q1LA 1YJ7A 2AJQA 2XULA 1SVDA 1R43A 2JFDA 1QAJA 3BM7A 1N48A 1REVA 2VF3A 1ITPA 4ITSA 4GMKA 4GC6A 4UUXA 4Q2LA 4GO5X 1U09A 4JV1A 1TKTA 5KT4A 1JLEA 2DNKA 2GQQA 1RP5A 1S6UA 2CG8A 2V9WA 5DJBA 5D4LA 2ADBA 4ZLLA 4B3OB 1FRMA 5DS7A 1GNKA 4IYQA 3THVA 3ET6B 3WBZA 1PG5B 2C1EB 3MXHP 3DLGB 2ZH3A 2XY5A 2DGWA 4QW9A 3EDRB 2ZNYA 1O5JA 2Y8WA 3ZO7A 4ALZA 2AQ4A 3DFEA 3I4HX 3FSYA 4IFVB 4C9DA 2MGZA 2MKSA 1TK5A 3M8ZA 3RR7A 3KLVA 5KFGA 1FJCA 1KC8T 5IM0A 5IT0A 2KVIA 4WFZA 2UVVA 2VPWB 2HK3A 2E5HA 4CYUB 2IM2A 1WF1A 1U25A 2RB7A 1JJ4A 1IQTA 2MKHA 2GJFA 3ZC4A 1B7YB 2VKRA 3TUZC 3HKWA 3C15A 1E6YA 3HVTB 4OZ3A 1R8AA 5J2NA 1S97A 5ETNA 3D54A 2V8VA 2WB1D 2D74B 2VASA 1HNZF 3FZ2A 1X5SA 4NLQA 3W63A 4X4QA 1RZMA 1RWPB 4KC5A 2KFZA 2YWHA 1RU1A 4KKOA 5HBMA 3IM9A 1X4BA 4Y6IA 4DSIA 1HI0P 1PYTA 2ZOMA 4IO9Q 6AT1B 4OX9F 1OIAA 1S7IA 3CJ8A 4DPXA 2OKQA 4AL7A 2AYEA 2KG0A 2UUBJ 4O0NA 1JLQA 2ATCB 3PHEA 1IM4A 2JDJA 3IBCB 4RPFA 2Q79A 2CJQA 2OMOA 4QIGA 4JV0A 4PXEA 2AJ4A 2V2ZA 3OFFA 4H4OB 3H59A 4PYAA 2R3VA 3IRWP 3MEEB 3CD6S 2RQCA 2ABYA 2FZKB 2XMJA 1LWEB 1IKVB 3OL8A 2YKNB 1PC4A 1VRQC 4MYTA 4ECXA 1Q4RA 3I4PA 1S1UA 4QR1A 1VQ9S 2YQ1A 1IJFB 4OI2A 4DCJB 1AW0A 3OTOF 1JLBB 4NEYA 1RB0A 1YBAA 3KOAA 4RUAA 3M2RB 1HQEB 4WU3A 5DDPC 3ZNUA 3JB9k 2AZ3A 2OUGA 1RWKB 4IG0A 4FF2A 1HHTP 4TQRA 1X31C 2PEHA 1YZ7A 2LKZA 1T9VA 4FYWB 3WC0A 2IAJB 4QPXA 1VR6A 2R7WA 1JXEA 2DYAA 4TY8B 2OPPB 4LBIA 4DV4J 1M5PC 3IAS9 1R8HA 2R7SA 3ENAA 2OP5A 2HYIB 5KT5A 1AFJA 3CIZA 3OSNA 4JV5J 4OYIA 3FBEA 1ZYQA 1OO0B 4QWDA 3GWCA 3IA0A 1M5SA 2M8HA 3T1HJ 1VS3A 2KB2A 2Q66A 2OFHX 4MIWA 4ZMMA 2KJWA 3QGPA 2YWGA 1FRIA 4Y65A 3P5TL 3SMZA 1UVNA 3NOCA 4U8YA 1PYSB 2YX4A 1TR0A 2HNDB 4B3TJ 4DR4J 1RT4B 3HSGA 1EP4B 3PG9A 1HQUA 2FC9A 4OJ3A 4LFCF 4G1PA 1L3KA 5DQGA 2XG8A 2JZ5A 1HNIA 4USVA 2C42A 5L9NA 3N4WA 4FVMA 3DRXA 1IR2A 2FYXA 2J6UA 2CPYA 5DQIA 5E3AA 1TQLA 4KBIA 1LWFB 4LMZA 3OL9A 2RQ4A 4ZVUB 3QPIA 2KT5A 5H9FJ 3V4IB 1DQAA 2EI5A 3DN9A 4OJHA 2C3OA 3JXOA 4DLGA 2OGUA 5CCLA 4F67A 1L3VA 3R27A 3D1HA 1UFKA 2VQEJ 3T5HA 3KUHA 5AXLA 3FZBA 4MK9A 3N79A 4KR0B 4LF7J 4DSEA 2R8HA 2G1HA 4UOCA 3F56A 1RXOB 3QT7A 4L76A 5KT6A 3I0RA 3MOZA 1B70B 4QZVB 3ZZPA 5L38A 1VQOS 3UW1A 2M8DB 4CM0A 2AU0A 3JSRA 4PR6A 2AEJA 1VLOA 2XS2A 2BX6A 1Y00A 1PYOB 3D4JA 4OJ1A 3PIPQ 4IH7A 1B99A 4JI0F 1S1XA 1RHRB 1VC0A 1NXIA 1HQ2A 4C8YA 1B64A 4DUYF 5CYMB 4WXWA 3UFCX 2HBZB 1VQ4S 1RWWB 3IM8A 2F8HA 2M0GB 3BN4A 5KT7A 3CPWR 3A1YG 4JI1J 1C0UA 5A6WA 3N6MA 5B09A 4F02A 1FJGF 4TU9A 1F2GA 1RHKB 1H38A 1VRUB 2CWKA 3C8YA 1FKOA 5MAOA 4ELTA 2ROEA 1NBEB 1RISA 2H4WB 1S59A 3W2WB 3QFWA 4LR8A 1IBMJ 1VQKS 3D0IE 3M9MB 3HHNB 1R31A 3NKYA 4KGKA 3G82A 3R5BA 3V6DB 1K47A 3GCXP 5D4OA 1DLOB 4IFYA 4UZBA 5D8HB 1UFLA 1XNQF 2W25A 2C3PA 1PC5A 4NLVA 4RKUC 1C0TA 1UCNA 4F25A 1HHQA 4RW7B 1G7CB 2IMOA 3H0PA 1EETA 4B9LA 1UWBA 1CJKA 1KONA 4NX9A 3HKZD 4P75A 1E6VA 3TAMB 4ECRA 4CO5A 3GP9A 5KFLA 5CA5A 4JYAJ 2M52A 5ETVA 3GSDA 1WC1A 3J7AN 2FGOA 3DGPB 4L6V3 4DR3F 1TZ0A 5J2PA 1WDDA 4DWIA 1FK9A 1BY9A 4DR5J 3KHGA 3P6YC 3OL7A 1BD6A 1NB7A 4EUVA 3GQCA 3D67A 1AUDA 1UWAA 2V4QA 2YPYA 2GHWA 2EEYA 2BJ3A 1D9AA 2YNHA 1N4LA 2OPRB 3RAQA 3VZIA 2PFDA 3FVYA 1LW2B 4RW4B 3K58A 2J0WA 4C11A 2F4FA 1IKWB 1HBUB 3EDQB 1HL6A 5K8PA 4J9OA 3UNYA 2BZ2A 2NS1B 1Q95G 3PZPA 3EX7B 4EEYA 1U1PA 5KFOA 1T05B 5D4PA 4DR1J 3D28A 2HFSA 5DDRC 1GMWA 1UFWA 4YB5A 3LP2A 2RQKA 3G87A 3T5LA 1RAIB 3J7ZT 4CLWA 4E8UA 1JNZB 2V94A 3CJ4A 3OTBA 5AE3A 2DEIA 2LEPA 3BDEA 3TQ1A 3QSIA 3GIRA 5EUHA 2Q43A 2VKZG 3QZ7A 1S6OA 2B43A 3W2VB 5A8RA 1F60B 3UQSA 3G8TA 1JMTA 1D9DA 2U1AA 2YWFA 2HFOA 1UP1A 4LSNB 1T9UA 1KVKA 2WRMA 1CULB 1D3WA 4ANCA 3I56S 1Q5YA 3E01A 2GX8A 1N5TA 2LQJA 4ID5A 3R97A 2DHSA 3JSBA 5HP1A 3ZZRA 5F3ZA 2WSEC 2XNRA 5CZXA 4EK2A 1EX8A 5B0CA 2DNPA 4OZJA 5EWEA 2RVJA 2HFNA 3AQPA 2HGNA 1B7FA 1X4CA 3HSJA 4DJBA 5F8LA 2ZJPQ 1WHVA 1U8WA 1NCLA 3PR4A 1RWNB 1B0VA 3UVJA 2UXDJ 2KXFA 2KZMA 1DTQB 1XTZA 3SIPB 3CJ0A 2GC8A 3JYTA 2DNGA 4B17A 1HR0J 2PC6A 3CD0A 1SIZA 2D3OR 2LU1A 4I0WA 2DR8A 2ZHBA 1YKWA 2FVSA 1KQFB 2IRUA 1MROA 2V5HG 4WE1B 4MAKA 5LOQA 2DNMA 2H4YB 1SB6A 3AXMA 2BANA 4RU2A 5AE1A 4GKJJ 4NMLA 4Y34A 4X66J 4CH0S 1S9EB 5GAEU 1FDDA 4U8VA 4LT6A 4JB8B 4I2PB 1U7LA 3THTA 3HI9A 1N8RT 3QLHA 2FJWA 1FX4A 2YKOA 5A8WA 2RS2A 2CPHA 3UI3A 4ED2A 3Q83A 1FTRA 2IM1A 5I42B 1NPRA 3GIJA 3DOKB 2HIQA 2J8SA 5KFJA 3B54A 2E9TA 3EUNA 4E0DA 2Y0SD 1UVJA 2QSWA 4DFJA 2C2OB 5L1KA 5E3RA 1X9SA 1UEVA 1HLWA 2HFZA 5DG8A 2E1CA 5FD1A 1UEKA 4AXJA 4C8LA 2BQRA 3PCOB 4DV4F 1PGZA 5IC6B 1RT3A 4ED8A 2AYMA 4DG1B 3CWJA 2HS4A 4JV5F 1LV5A 2ZWPA 4OX7A 5KFEA 3PRDA 4AYBD 4J9SA 3T1HF 5F9NA 4KV8A 3MGJA 1KR4A 1C1BA 2A6MA 5H9EJ 3KK1A 5LSLA 1KRPA 1RLDA 5I3PA 3I5BA 1WOPA 2ZJRQ 5L39A 2A3JA 3MM6A 1TV6B 4B3TF 1N5YA 3NGTA 4DR4F 3U02A 2QLXA 1NH8A 1UAWA 4HHHA 1RHQB 2ZH4A 4RJVA 3PX4A 1V3ZA 1A0OB 2DNQA 1JLGA 5L8RC 3ETMA 1I94J 1IKYB 4BCAA 2FTRA 4DEZA 1CC8A 2DD8S 3HSDA 1GMUA 3Q0AA 2HHQA 3PY8A 2AT1B 5ETQA 6FD1A 3UDCA 1KFSA 2WBMA 4ZCKA 2DGOA 2RAQA 4USMA 1ZZNA 3BKFA 2VBYA 3NCQA 3NWRA 1RT7A 1FVQA 4WPAA 1GXTA 3QAUA 4DBQA 4O3SA 2B4VA 2B9YA 2EFVA 2PI4A 3RB0A 2PGCA 3Q24A 4H4KA 3V81B 3JSYA 1TL1A 3LH2S 3LPYA 2V8HA 2V4JB 4IOAQ 5HN0A 1S0NA 3V6KA 2R8GA 3D6FB 2ZDOA 4K4SA 4LF5J 1D1UA 1JQGA 4LRDA 2MZTA 4ECSA 1IN0A 3T6BA 2JLEA 5ETKA 5LMUF 4JI6J 3CT9A 4CTAB 1Q1KA 2R2UA 4M1KA 1QTNB 5C24A 1GFWB 3US5A 3IRXB 3CW2C 4P71A 5ETPA 3TNVA 3KLGA 4YUDA 5FDLB 2LXIA 3QIDA 2LVWA 1F3VA 3PVXA 3DU6A 3ILJA 3W66A 5BR8F 2OD4A 4FXVA 5F41A 3VGSA 4TYBA 2EKNA 4JI1F 5LL6d 5M2RA 2E7VA 3W9JA 4Q0BA 3MM9A 3CD7A 3AA9A 3CC7S 2MJNA 4RNFA 3GPAA 2LQBA 2QMUB 4MK8A 3OXFA 7FD1A 4RNHA 4F0HA 2ZE2A 3MURP 2XHCA 3BBFA 2GQCA 2OLWA 2PEBA 1IBMF 4OYOA 3CCRS 2Q3PA 4M5LA 4RW6B 3O44A 1GTEA 5JJBA 1EJ7L 4LF8J 3K5NA 1XMBA 5DGAA 2W9BA 2FHOB 1BHNA 2XZWA 1Y9OA 1S1VB 2OPQA 2HVIA 3DGVA 3DRSA 2CPJA 4EYIB 2CPZA 3M30A 2W9CB 2L08A 2DJWA 4KO0A 1KD1T 1IKXA 4Q43A 1O6XA 2C2NA 1QLNA 1N33J 3R6GB 2VV5A 1H6KX 1S9FA 2G2OA 4FYXB 3PYEA 4JYAF 2EFNA 2XMAA 3LO3A 3HVTA 3FQLA 4FS1A 2FHKA 4IKAA 2C2MB 2C3MA 2YXLA 4DR5F 4F7VA 2IFXA 3NS5A 4HTIA 1SL2A 2G0IA 1FESA 1YHQS 3DLKB 1CBKA 3VAGA 2EFGA 4CRJA 5DGBA 2AV5A 2ZC3A 5T41A 1SH3A 4WKRA 1TTHB 2Z58B 1WORA 3Q8PB 3MCOA 3PKYA 2R8KA 2RUGA 4Z7YA 3CDEA 1X4GA 3ZZTA 1X0FA 4MJKA 1FNOA 2CJAA 4NYOA 4K8RA 4YB1P 2GVZB 1BQNB 4F3QA 3PTWA 4C0HA 3VAKA 4PG7A 1ELOA 2DR7A 2V50A 1TMMA 2IJFA 1TKDA 4DR1F 3S7RA 3GIIA 4GVBB 1WEZA 4ZJQA 3GSIA 3EPGA 1NSKL 2PMZD 4F4YA 3SV4A 3C6UB 2LP4A 4HLBA 2QA2A 4X4VA 4NE9C 3M8QB 2YKPA 2DITA 2QA4G 4USKA 2YKMA 4ELUA 3GCWP 2JOQA 1S4EA 2E5LF 1NEEA 2EPIA 1WHYA 1LWCB 3HJFA 4XTTA 3ISNC 4QYRA 4USHA 5HL7Q 1HI1A 1AXQA 1KTVA 4OYAA 4ZVSB 4ES1A 2DH8A 2QL9B 1LXJA 1C4AA 3I5CA 3FJ2A 4DQPA 3DI6B 4A8FA 2IAJA 3D3CJ 4I6WA 2ALYB 4QBUA 2V6AA 1ZM2A 2AEFA 3UNGC 3N5FA 1Q8KA 2KHDA 3SFGA 4EYHB 3GB0A 2FY1A 3CNQP 4DUTA 4RU9A 3UE2A 3TAPA 2CQHA 4HTJA 2U2FA 2NSCA 2O66A 4WYLA 2DRBA 4R25A 1MN9A 3MTKA 2CNLB 4M5DB 5F8NA 2MQMA 2B9EA 3WQPA 5J1NA 1YQHA 3DLEB 2RHQB 2Z57B 4QJVA 1IBCB 3GR1A 2YNIB 4HACA 1M5VC 3M6UA 3UPFA 1HR0F 5F8GA 1YSJA 2AGOA 3LGHA 1UPMB 1RT4A 3OXLA 3HHLC 4BC9A 5A2QU 1PILA 2YWKA 2RNEA 4IQXA 2HVHA 2F8MA 2UV8A 4HDGA 2DBBA 2VOOA 5CCMA 3LQVA 2I8EA 4X66F 1IR0A 2EBEA 4EO6A 1SQEA 3EGNA 4J9VA 1YZ6A 1H2VZ 2RJZA 2GGPA 4ZVGA 1X4FA 4KH0B 2K2PA 2OTLS 2ZBIA 3ZTSA 4DPUA 5C25A 4CWBA 3FGVA 2CAJA 1UEUA 3C16B 5A2QY 4ECQA 3RR8A 4MKAA 2YNFA 3Q8YA 5DLGA 1SL1A 2HAIA 2KM8C 2HVEA 4L3NA 4L72B 2HZAA 2B4PA 2FJEB 2WVFA 1Q8BA 3MFIA 3CCES 4N8NA 3D0GE 1JJCB 2QLBB 1VBYA 2C2KB 4ANDA 4OIXA 2IC3A 3CF5Q 4NI2A 2J9CA 2KKHA 3K89A 3W61A 2HRUA 1L3UA 3AY0A 1OQ3A 1C1CA 1GQEA 4PWDB 2VPYB 2QT7A 1HWKA 1RT1A 1I3OB 3WC2A 2M4MA 1SIWB 2CPIA 2MXYA 3DMJB 1VCTA 3SFUA 3LAMA 3R8YA 1WG1A 4OL8A 1QVFR 5L1IA 4AT1B 1CJVA 1RACB 2DY9A 2UV8G 3CJ2A 2G9OA 5J2QB 1VIOA 1I94F 3OLBA 1PCAA 3EYZA 3NGSA 4ED4A 1FRLA 3MCNA 2KYZA 3SQGB 3M8PA 4M63A 5BYQA 5LJ3Y 4DFPA 4KHMA 3EXYA 2DCLA 4OX6A 2WONA 1U4BA 4C8MA 5D4NA 5IT4A 2OI2A 3AOCA 5GADI 2MTLA 2HWTA 5J1EA 3QGIA 1IWAA 2NXNA 3Q8UA 5FLXU 1NRKA 4FKYA 5ETSA 4DR6F 4TU7A 4DSKA 3JS9A 3ZZ0A 1NZ8A 2HBRB 1RAFB 5KFIA 2V69A 1JLCA 1Y0HA 1KQSR 3GFXA 3CEDA 1OQ6A 1Z1ZA 1NK6A 4LF5F 3TAMA 1T03A 1RT2B 2XTJP 4RW9A 3HT3A 1OSDA 4URSA 3DOMB 5KAKA 3DRRA 2AIRB 4JI6F 3NG8A 1OYDA 3GYXB 3R2CJ 5FLXY 4O4GB 4DCOB 2XC9A 4JI7F 3HFZB 1RAEB 1EQ0A 4ED6A 1U0HB 4H4MA 5I3UB 4DFKA 2RH3A 4DV1F 1VQNS 1SKSA 1SKUB 3MMCB 2VQFJ 2RU9A 2V8PA 5KFBA 2BJ7A 3AOAA 3DC2A 2Q6BA 2JLFA 3ENVA 4PG4A 2W4CA 1F3FA 1M0SA 2KXNB 1IKWA 1QDUB 2XSFA 4I7FA 2B51A 2YNGB 1TKZA 3ZTPA 2ZD1B 3HHDA 4NZ6A 3Q8VA 1TL4A 1NK0A 3AQOA 1EAYC 4LRAA 5JXSA 5HK4A 2Y1IA 5THWA 3WIUA 3I82A 1PJ7A 1SJRA 4LF8F 2KO1A 4N41A 3FMBA 3ILIA 2B8PA 1FRXA 3SDEA 1YX2A 3AODA 5G4DA 1XQIA 3EVOA 4KGMA 2N4DA 2J7KA 1TUWA 2OEJA 1JXVA 3Q8QB 4IUFA 1FX2A 3PYDA 2NLWA 5CHCB 2DTJA 3BQ0A 1YG0A 1X5PA 5AJ3J 3Q8SB 1N33F 4D3HA 3AFGA 1F2HA 2ACYA 3BSAA 4ZHRB 2P9GA 4PYDA 1QE1B 1P6TA 2QL7B 1NDCA 1IBLJ 4FBTA 4QPTA 3PKMA 1U48A 3MR6A 2YX7A 4M95A 1X9MA 4R5PB 2QX0A 1Y3JA 4LRFA 4A8OA 2XHWA 3EM1A 1J5OB 3G6XA 4NLPA 4DOZA 3GMGA 3QO9A 3BS9A 2PSZA 3AT1B 2IM3A 2QMXA 2JWNA 4ILLA 2RU3A 1M1GA 3GE9A 5HLFA 3RZAA 1K1SA 1VLYA 1FXDA 1DTQA 5L46A 1JKHA 2UXCJ 4IH5A 3D1OA 2PMHA 1SJ4P 4ZVQB 2HHTA 2DHGA 3VV2B 2X3DA 1VYAA 2DEJA 1CLFA 2P8IA 4ECUA 3CCJS 4FXDA 2B6AA 2B0GA 4UTGA 2OO4A 5BYSA 3Q86A 2CJXB 1HYSA 3CJRA 1EKSA 4M5KA 2RRNA 2DR6A 3FC9A 2HQDA 2GV1A 4K2XA 1SUQB 1JLFA 2I9SA 3KJVA 3MMJA 1ICEB 3ILLA 4MYUA 2VC1A 2HHHF 3K5OA 4DU8A 2N3LA 3MUVP 4PKDB 4YB7A 4FXWA 2QLJB 1Y11A 2POKA 3T1AA 3RRHA 4DR2J 2QTWA 2MB0B 5B0DA 3BF4A 4HDHA 2QYGA 2DO4A 3S8SA 5HATA 3NGRA 4G65A 4OHZA 3GV8B 2XM3A 1RTDA 1TL7B 3T9ZA 1N32J 4ICLB 1S72S 3POTB 1DTTB 2HHPA 4J5OA 2AMCB 1T9YA 4BHQA 2DVIA 1NB2A 4KY3A 2RKIB 4TXSA 3MWBA 1N88A 5DZ7A 3IG1A 4FYDA 1FJEB 3MECB 2ILYA 2DKOB 2JHEA 2JLGA 2NXEA 1NLKL 2BUNA 3VQSA 3OTEA 4LUBA 3G6ES 5KFFA 3ZTOA 1NDPA 1XBWA 2EXUA 4ZVPB 2PN6A 2XLKA 3BYRA 2E7WA 3DRPA 5J2MA 5A76A 2V67A 1TL5A 4JI8J 2HEKA 3PO5A 2ALZA 4PG8A 1N52B 2Z2LA 1U1QA 3AJ1A 5KFCA 3R5DA 1SJQA 3H4DA 1DURA 4QOTA 5LJ5Y 2WTFA 5ADZA 1JJHA 2BM1A 5DM6Q 1N0UA 1R0CB 5KFYA 2L41A 1XN9A 3CIMA 3TI0A 4Y3CA 1HARA 3FCWA 2JH3A 4DI6A 4CP5A 1EARA 4Y0FA 1I5OB 2ZUGA 2QYCA 1QD1A 5JVGQ 1SBRA 3G71S 3KHHA 3GFHA 2K7JA 1WKJA 1S99A 5KFSA 3P49B 2NSBA 3M2UA 3R7NB 4DZ6A 4DV0J 2GHPA 1FEEA 3QBCA 4OYPA 3FEZA 1TKXB 3PFOA 3OR1A 4P9SA 2B4OA 3IMQJ 3FBBA 5F8HA 1U6ZA 3H5YA 2FZGB 1F0XA 4MIAA 5ETMA 4ZPWR 2JVRA 2ZVSA 4FKXA 3VVUA 5LXYA 3VAHA 2NZ4A 2FZCB 4LSZB 3FRYA 1DZ5A 3IP0A 1REGX 5KG1A 2ZH9A 1SJFA 1XMOF 2VFTA 4G3IA 1W25A 3I96A 1S9GB 5IXUA 4G6VB 3NGUA 2A2CA 3RAMA 1IJEB 4AFFA 1XMQJ 4V19X 5A8KB 3R5CA 1H3DA 2AYGA 3HHKA 2RRAA 2MKJA 3O2IA 1ZM3A 4K0KJ 4RUBA 4JP8A 3RAXA 3W8GA 5KFZA 1TK0A 3EGVA 2OJ3A 3DLBA 1FKPB 3L7OA 2OHDA 2H3EB 3FQKA 2W2OP 4HVZA 1S0VA 3GG1A 4DPOA 3KDNA 2HQFA 3MPUB 3GLJA 3X1LB 1RAHB 4PWWA 2A0FB 1BMQB 3WZ0A 3QIPB 1VJQA 1YGYA 2CQ0A 3Q2TC 5ETTA 5AXNA 5H9FK 2Z8QA 2VG6B 2AYBA 2JEGA 3ENWA 4Q7AA 3VVTA 1N34F 3JQJA 1VC5A 3RTVA 2GQ2A 3AAWB 2DXEA 4TKTA 5AT1B 2DXFA 3S01A 4LR7A 4HT5A 1R0AA 2DB1A 2LDYA 2XMUA 3AA8A 4K5RA 5KFHA 1NHVA 1LEOA 1S1TA 2XS7A 2UVRA 4YP3A 2VL1A 4XPEA 2G2YA 4Y2AA 3M9NB 3O3LA 2A18A 5AE2A 1S1WA 1NJXA 1FFGB 2WAQD 3GIMA 2F9JA 2YQ0A 3MM8B 2WK4A 3RB6A 2X1GA 4DSLA 3D6TB 2DR5A 2O67A 3G8QA 1XC9A
chains in the Genus database with same CATH topology
2DHSA 3JSBA 1Z2ZA 2ZD1A 3H8YA 3CO9A 3K7RA 4WFXA 4K59A 2YKMB 1WACA 5BYRA 5HP1A 3ZZRA 3IR6B 2CFXA 5F3ZA 2CPEA 4URQU 1T94A 4Q8FA 2WSEC 2XNRA 4QU6A 3GILA 2JL9A 5CZXA 3OW2R 2JC0A 3KLIA 1X8DA 3MHYA 1VK3A 4N5SA 4KHRA 2LA4A 5B0CA 3CDBA 3HM9A 2DNPA 4OZJA 5EWEA 4DF8A 3NAHA 2RVJA 4H4OA 4ZPAA 3UD3P 2HHWA 2HFNA 2XBPA 2NXUA 1X5TA 2IA0A 3AQPA 2HGNA 3MEEA 1JB0C 2LYVA 1RTIA 1B7FA 2Z4PA 4X84A 1X4CA 4DJBA 2BA9A 5DM7Q 5F8LA 4N56A 1JXLA 2DT9A 2ZJPQ 2V2KA 1WHVA 4OX8A 2HNYB 3PR4A 1B0VA 1LWEA 1IKVA 1R27B 2CPDA 5EWGA 1KVIA 4WTYA 2CIMA 2YKNA 3BO2A 2KXFA 3VF0B 2KZMA 4KTQA 2R7TA 1DTQB 3U1MA 2GIRA 1P9QC 3N6LA 2VONA 1XTZA 3CE8A 3CJ0A 4ED0A 2GC8A 5T7LB 1RT5A 3JYTA 2DNGA 4B17A 2DNZA 3H5SA 4ZPVR 2PC6A 1UA1A 3RYLA 3CD0A 2ZOGA 4WK3A 3M6WA 4YFUA 1SIZA 3CJKB 1DBDA 3OR2B 2D3OR 1JLBA 2J8AA 2VB6A 3KHRA 4C8KA 1U1RA 3KMQA 5HMYA 2LU1A 1RGVA 5E3PA 3M2RA 4H4KC 1HQEA 4I0WA 3KHLA 4K4YA 3MM5B 1Y7PA 2BRKA 4ECZA 2DR8A 2I2YA 3OUYA 4EBCA 4X4OA 2ZHBA 4MKBA 4A8KA 3I5AA 3NBPB 2QA4S 2FVSA 2KJVA 2K3IA 4ZHRA 1KQFB 2IRUA 2O3DA 1MROA 2V5HG 4PXBA 4WE1B 3UR3C 1QE1A 4DSJA 1UVLA 4MAKA 2DNMA 2MQOA 1DRZA 2XSJA 1SB6A 3LP1A 3MMAA 1SL0A 3E51A 2MZQA 3JSMB 2DPIA 2MDAA 4ZPDA 1HQUB 3IXQA 2PO4A 3RBEA 3PW5A 2FD2A 5CYJA 2GMJA 3VAIA 2BANA 1QSSA 3J7Z5 3VCDA 1N0VC 4RU2A 5AE1A 2HRYA 4NMLA 4Y34A 2D3ZA 3DCAA 4CH0S 2RS8A 3MD1A 1HWJA 1S9EB 3F41A 3TW0A 4NLDA 1KLNA 1RI7A 5GAEU 2CQDA 1FDDA 2J9DE 3PRBA 4LT6A 3T6JA 4CNYA 2X1BA 3LGNA 2KFYA 4C8OA 3D0HE 2FVQA 4R5PA 3PDNA 1AFIA 2MZJA 1U6BA 4I2PB 1Q78A 1G2EA 4RLEA 2UU9F 3TUJC 1N5QA 4OZNA 2HQIA 3HP6A 1NJZA 3HVAA 1U7LA 4OZ0A 3THTA 2HNZB 4HH1A 4NCAA 5K14A 3UWTA 2KG1A 1J5OA 3RRKA 4DL3A 4ZVHA 5AJ3F 3HI9A 2JC1A 2OPPA 3MEDA 4TY8A 3OFEA 4CI0B 2BABA 3QLHA 1N8RT 3HF5A 2FJWA 2YKOA 3M2VA 3V2UC 4WJBA 4ZKAA 5A8WA 4HI2A 2RS2A 4G1QB 3B4DA 2CPHA 1HD0A 4XO0A 3UI3A 3AB4B 4ED2A 3PEHA 5D78A 1FTRA 3HHEA 1QSYA 2IM1A 4O44B 5I42B 4NA3A 2UVWA 3GIJA 4DL2A 3DOKB 3TX8A 2HIQA 3SV3A 2VPZB 2FB0A 2WSCC 5KFPA 2LXFA 5KFJA 3ITHB 2E9TA 2QE5A 3EUNA 2JSXA 4FNIA 1WNEA 1HBOB 4YR3A 4HL9A 4E0DA 2Y0SD 1UVJA 3FSIA 1X7VA 2QSWA 5KFDA 4DFJA 3DXSX 5L1KA 4QCLA 4QYZJ 4NZ7A 3QAEA 4O4RA 1Y5IB 5E3RA 1L3TA 1X9SA 2B7CB 2JX2A 1ZH5A 3E3XA 2XLIA 2ASLA 1SJ3P 1UEVA 2HFZA 3LWMA 5DG8A 2CPFA 4BWJA 1Y5LB 3JSMA 4OHWA 4NLUA 2YKQA 1S6PB 2GGPB 1RT6A 5FD1A 4XDCA 5E3QA 2E1CA 2UXDF 1R8PA 3LW5C 4EO8A 4C3MA 1DFDA 4PG6A 4AXJA 4C8LA 4EBEA 2BQRA 5CH7B 4DV3F 4MFBB 1YJRA 2DHAA 2I5JB 1HMVB 4Q2MA 2O5DA 1HW9A 4Q44A 5C25B 4DV4F 1T3NA 1PGZA 4C8ZA 4ZP7A 1RT3A 4PXCA 3K5MA 2IRYA 4ED8A 3RB3A 3R1HA 1ZM4A 2AYMA 2EW9A 2HNDA 4DG1B 3C6TB 4YR0A 2MKIA 4ZOSA 3CWJA 3KG4A 5E2QA 3GFYA 1HHSA 2J9DA 5HROA 2HS4A 4JV5F 4DFMA 5DG7A 4FVCA 1EP4A 2C22A 1LV5A 4O0IA 4OX7A 5KFEA 3BB5A 5IT9Y 3PRDA 4AYBD 1JLAB 2LU2A 2CVEA 2GJ2A 1TVRB 3BGFA 4J9SA 4ZPCA 3T1HF 1VFJA 3MPVA 5F9NA 2E7XA 1V9OA 4KV8A 2D7SA 1KLMB 3MGJA 2NQPA 3ICLA 1ROFA 1KR4A 3VAFA 1C1BA 2YNFB 4NRTA 2I0XA 3TYTA 2UXCF 2C3YA 2CRLA 2YQ3A 3FCHA 3IC1A 3CUNA 2GMHA 2K1RB 2KTQA 3OJUA 5H9EJ 2P6TA 3KK1A 4WK1A 3TA1A 5LSLA 1KRPA 1UETA 4O3OA 4GKJF 2FHJD 2DCUB 1WG4A 4EWTA 3DDKA 2J6TA 2EK1A 5I3PA 3I5BA 2XY6A 2ZJRQ 5L39A 1LWFA 2E9RX 3MAHA 2EFQA 4YMEA 3CULA 2A3JA 2VG7B 1SUQA 1TV6B 3MM6A 2XI2A 4B3TF 1N5YA 3CC4S 3V4IA 3IWXA 1OPIA 3J7A1 4PCQA 4DR4F 3U02A 2QLXA 1NH8A 5KT2A 2LECA 2AJFE 1UAWA 1VK8A 4XIUA 2ZH4A 2CG4A 3K0JA 2XMMA 4ED1A 4GC7A 5IFMA 2IC3B 4LSLB 3PX4A 1J2VA 1VQYA 2VH7A 1VQ8S 1V3ZA 3U1NA 3OVBA 2DNQA 4NZ0A 1FD2A 1Q8LA 2DNOA 3PW0A 1JLGA 3NNHA 4QIVA 4B9MA 2V8GA 2Z0GA 1DHMA 5L8RC 1C1CB 2ILZA 3OBIA 5GADU 5D3GB 1IKYB 5KFNA 3PEJA 1WD6A 4BCAA 3HK2A 3LANA 5CQGA 1SH2A 2FTRA 1RT1B 4DEZA 1CC8A 2DD8S 4CCHA 2ZOFA 4XDDA 5GAHU 1UL3A 1KQGB 1GH8A 3Q0AA 2HHQA 4K4WA 3PY8A 4OV1A 6FD1A 2R4FA 3UDCA 2L9DA 3SI8A 5KG3A 5IWAF 1KFSA 2HW3A 1A9NB 4DDFA 5FJ4A 1S49A 2RDIA 2WBMA 4ZCKA 2DGOA 1T8EA 1T02A 3ENQA 3K5PA 2RT3A 4ICLA 1ZZNA 1RA6A 1D0EA 2VBYA 3I31A 3NCQA 1D8YA 1DTTA 3IN5A 4R8UB 1RT7A 3GR0A 4Q8EA 1KN6A 3RB4A 2BQUA 1FVQA 1S0OA 5K9FA 2RKIA 2AWZA 1GXTA 1REVB 3QAUA 4B3MF 4A46A 4DBQA 1YJVA 4O3SA 2B4VA 2B9YA 2IYGA 1WHXA 2EFVA 1RTHB 1UVMA 2PI4A 1VQ5S 5KG0A 3RB0A 3DM2B 2FPHX 1ZTTA 1U1LA 3OHAA 1FERA 2PGCA 2B7BB 3MECA 2BR0A 3Q24A 2MJUA 4B3SF 2G13A 3H2VE 2QRRA 2CQGA 4H4KA 3V81B 1TKTB 2E5GA 3QWUA 3JSYA 1JLEB 1TL1A 3LH2S 3LPYA 2JEFA 3KLHA 3EXCX 2V8HA 2RIJA 2VBWA 2V4JB 5K8MA 3BGRA 1NNDA 1FD8A 2A1BA 3M8PB 3V4MA 3TA0A 6FDRA 3VALA 4BDPA 4IOAQ 4ERDA 4YOEA 1KOHA 5HN0A 3KK2A 1S0NA 2FHMA 3V6KA 2R8GA 2C2DA 4QQBA 3B82A 3PNIA 1TFYA 2NPFA 2ZDOA 2RQMA 3PW2A 4K4SA 3L7PA 1TAUA 1N32F 3TVYA 2WONB 3X3UA 2GFFA 5CYMA 4ZCIA 5DQHA 4KHPF 1D1UA 1YJTA 4C4WA 4CO3A 2FLPA 2V8DA 2XCAA 3KLFB 1ZOTA 4NXNF 3UCGA 4O3QA 5J1EB 2MZTA 2J0XA 2E5IA 1IN0A 4ECSA 1VGYA 5A0YA 3HXMA 3T6BA 2JLEA 3IFEA 1MMDA 2OSRA 4V19X 1X4DA 1S7HA 3BSCA 3I6PA 2EWHA 1YVFA