2CPYA

Solution structure of rna binding domain 3 in rna binding motif protein 12
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
114
structure length
114
Chain Sequence
GSSGSSGEGDVNSAKVCAHITNIPFSITKMDVLQFLEGIPVDENAVHVLVDNNGQGLGQALVQFKNEDDARKSERLHRKKLNGREAFVHVVTLEDMREIEKNPPAQGKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title solution structure of RNA binding domain 3 in RNA binding motif protein 12
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords RNA-binding protein 12
total genus 15
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2cpyA01
2MQMA 1YTYA 1F9FA 2LXUA 2J0QD 3U1MA 1U1RA 3NNAA 2DNKA 2X1GA 1DRZA 2JWNA 2UP1A 2RS2A 1U1KA 1PO6A 3ZZZA 5EN1A 2CPDA 2MKJA 2L08A 2HGMA 3IWNC 1IQTA 5ITHA 3DXBA 4QQBA 2MQLA 2PE8A 1VQNS 3CUNA 2HGLA 3I56S 2CQ2A 2MZQA 1WHVA 2U2FA 3MUMP 2LKZA 3SXLA 1X4AA 4Z2XA 4LIRA 4ED5A 2KT5A 4ERDA 2DNHA 3N9UC 5LSOA 1VBZA 1UP1A 2DO4A 3UD3P 1VQ5S 2D9PA 1YJNS 2LMIA 1P27B 1DHMA 2KXNB 3MUVP 2AYGA 1YI2S 1K9MT 3G8TA 2KG1A 2ADBA 2M8DB 2DGQA 3CCSS 5GAGU 1R8PA 4UQTA 2MKHA 2M52A 2G0CA 2DIVA 3R1HA 3BO2A 1Q81T 2CQ3A 1X4DA 3NS6A 1X5PA 3SMZA 3CC4S 2DGUA 1WI8A 5LXYA 3BS9A 5JVGQ 2DHGA 2RNEA 2AD9A 5GADU 3TYTA 1U1LA 3PIPQ 1H2VZ 3HI9A 2AYBA 4ZKAA 2MZJA 1OO0B 3G96A 2XS2A 2LXIA 2CQ1A 2YWKA 5DETA 2E5IA 3U1LA 2ZJPQ 1CVJA 1X4EA 5DM7Q 1KOOA 1RK8A 2KVIA 1S72S 2MY7A 2EK6A 4CQ1A 1ZZNA 2XB2D 3UWTA 3G4SS 2HYIB 2CPIA 1X5SA 1YIJS 1X0FA 3P6YC 3CTRA 1N54B 2MKIA 2I2YA 2CPFA 1JJHA 2ERRA 5CYJA 3UD4P 2FC9A 2MKSA 1UAWA 4OZ0A 4A8XA 3MUTP 2QEXS 1DBDA 2DNYA 2DH8A 2I38A 2J8AA 2M0GB 2LCWA 2RRBA 2V94A 3J7ZT 3MI7X 4V19X 4F26A 1SJQA 1VQ7S 3MURP 3RW7A 2MQQA 1R8HA 3UCZP 2MQOA 2CQGA 3VAMA 1YHQS 2A3JA 2N82B 1JJ2R 5LJ3Y 2FPHX 2MSTA 3J7YU 3ULHA 3CC7S 5D78A 2DNZA 2CPZA 2OJ3A 1BY9A 1FNXH 2DGVA 4FXVA 1X4CA 2D9OA 3THTA 1QVGR 2CPYA 2YTCA 2MQPA 2MMYA 2KM8B 2J76E 1SJ4P 2KRBA 1WELA 4IO9Q 1YJ9S 5DDQC 1HD0A 4OZ1A 3ZZYA 2CPEA 2K8GA 2YKAA 3US5A 1WF0A 2KH9A 3Q2TC 1WEYA 1SJRA 2RVJA 2KXFA 2CQCA 1NU4A 4IUFA 1JJ4A 4W92B 2NLWA 1G2EA 5DDPC 3CCQS 1KQSR 3UE2A 2MKKA 2CQHA 2DNNA 3P3DA 2DNRA 2DHAA 2CPHA 1NO8A 3S6EA 3FEYB 2DNOA 2XNQA 4M5DB 2KRRA 3NS5A 2RU3A 2MYFA 1HD1A 1KOHA 1WG5A 2GO9A 2HVZA 2LQ5A 1VQ4S 1SJFA 2X1BA 4C4WA 1RKJA 2M7SA 4F25A 3UCGA 5D77A 1VC6A 1M1KT 2VONA 4WKRA 2RS8A 1DZ5A 1VQOS 2MGZA 2DGSA 2M2BA 1U1OA 2VOOA 3Q2SC 4QU6A 1X4HA 3BEGB 2KN4A 2MSSA 3LQVA 3CULA 1SXLA 1D9AA 2DNLA 5FJ4A 1VBYA 3LPYA 1H2TZ 4F02A 2KG0A 2OSRA 1S79A 3HHNB 1M5KC 3DLLQ 3P5TL 1H2UX 2BZ2A 4FXWA 2DHSA 1VQ9S 4TU9A 3VALA 1HL6A 2DNQA 2E5GA 1URNA 1FJ7A 5MLCV 2CPJA 2JVOA 2KXHA 1O0PA 4WCEQ 4UY8T 3VAJA 4WFBQ 1FT8A 2DGOA 5HL7Q 4CIOA 2XSFA 3FEXB 3CMES 5GMKa 2LECA 3R27A 4WF9Q 2CQ4A 3EGNA 4TU8A 2MQNA 2EK1A 1VBXA 1WF2A 4LJMA 1FJCA 1WF1A 5DDRC 1QVFR 5IM0A 2K3KA 2N7CA 4Y00A 2DNPA 2ADCA 2X1AA 3G8SA 2D3OR 2KHCA 1N8RT 1ZZFA 1VQ8S 1M90T 1B7FA 3SDEB 2RQ4A 2DISA 4WFNQ 3MOJB 2KU7A 5LXRA 1WG1A 2CQIA 3CCMS 2MY8A 3CCUS 2MZRA 1X5OA 4IOCQ 2FC8A 3CCES 1VC0A 4PRFA 4EGLA 2LA4A 4CH0S 3CPWR 1WHXA 3IRWP 2LEAA 2U1AA 3NNCA 5GVQA 2BOPA 2VODA 3R1LA 1L3KA 3TP2A 5JVHQ 1U2FA 1N88A 2M4MA 3CXCR 4TU7A 3P49B 2OTLS 3I55S 2DB1A 1FO1A 2OIHA 2HZCA 1WG4A 2FHOB 3S01A 1M5PC 4PR6A 1VQ6S 3SDEA 3PIOQ 2F9DA 3CCRS 2AYEA 2G4BA 2HGNA 2QA4S 2F9JA 4RU2A 2LYVA 1K73T 2RRAA 2SXLA 4W90B 1NJIT 1OIAA 5IM0B 5DDOC 2M8HA 3OW2R 3VAGA 5CXTA 2DGXA 2KI2A 1K8AT 1M5OC 2N3LA 1YWXA 3BO3A 5CA5A 1VQKS 1YJWS 3MD1A 1WHYA 1UFWA 3JB9k 2MZSA 1SJ3P 2EVZA 2DIUA 3CMAS 2DNGA 4BS2A 4YUDA 2YH1A 1WWHA 3G9CA 4IOAQ 2MZ1A 1A7GE 2DO0A 2VOPA 2LA6A 3S8SA 4YB1P 2CQDA 2M88A 2KFYA 3G6ES 2MKCA 1WTBA 2MZTA 3CC2S 1X5TA 2M70A 2N3OA 3VAKA 1FJEB 2DITA 1Q86T 2RT3A 1M5VC 3MXHP 2MB0B 2DH9A 3MD3A 3CD6S 1N52B 1KD1T 2MPUA 3D2WA 2E5JA 1XN9A 2QFJA 1HA1A 5LSLA 3H2UB 3S7RA 2OTJS 4J5OA 1X4BA 1A9NB 5HO4A 1H6KX 2J0SD 2XNRA 1VQMS 2M9KA 2E5HA 2DHXA 3V4MA 1U6BA 3VF0B 3G71S 3EGZA 1WHWA 2XS5A 2F3JA 2JX2A 1QM9A 1UW4A 2JVRA 2CQ0A 3NMRA 3BO4A 5GAHU 3NNHA 2L9WA 3CF5Q 1U1PA 2NZ4A 5H1SV 3H2VE 4TLQA 3VAIA 2DGWA 5LJ5Y 4WIIA 5GAEU 2CQPA 1KC8T 4P6QA 1P1TA 2MXYA 1VQLS 2MJUA 3UCUP 4CH1A 5IQQA 1YITS 1D8ZA 4PKDB 1AUDA 3THPA 1U1QA 2XS7A 1U1NA 3CCVS 2MHNA 2DGTA 4YOEA 1Q82T 2WBRA 3K0JA 1WI6A 5DM6Q 2CJKA 2X1FA 1FHTA 3CCLS 5BJRA 3L3CA 3EX7B 2MGZB 1OWXA 2CQBA 2MJNA 2CPXA 2RQCA 3CCJS 3VAHA 2LEBA 5IFMA 3VAFA 1VQPS 3B4DA 2YH0A 2G1DA 1W2BR 1JMTA 2DH7A 1OPIA 3TO8A 2FY1A 3RW6A 1U1MA 2KM8C 2DK2A 1X4FA 4Y0FA 4QPTA 2RUGA 1VC5A 4WFAQ 2DNMA 1WEXA 2B0GA 4C0OC 4U67Q 2ZJRQ 2KYXA 2Q79A 1ZH5A 4QU7A 1Q7YT 1X4GA 1WEZA 1U6FA 2ZJQQ 2E44A 2PEHA 1FXLA 2GHPA 2L41A 2OSQA 3B4MA 4C7QA 2AYMA 2JRSA 3MDFA 2O3DA 1PGZA 4LMZA
chains in the Genus database with same CATH superfamily
4HHHA 2MQMA 2OUGA 1YTYA 1F9FA 2LXUA 3I0RA 2ZITA 3NCPA 1HBMA 1RZMA 2B9WA 2J0QD 3Q89A 1TK8A 3AXKA 4Q44A 2BRLA 1V3ZA 2DNKA 3VGTA 2G2YA 3SZ2A 1DRZA 3GJQB 4FF1A 2YNFB 2W9BB 1SB6A 4ER8A 2R8JA 1EZZB 5IZHA 4B3MF 3PFEA 3QO9B 4X62F 3T5KA 1RJJA 4OZJA 3V81A 1U1KA 5EN1A 3CO0P 3N01A 4CO5A 3EZ5A 3KG0A 3MEDB 7FD1A 2ZZMA 1CULA 1FNMA 1ZTTA 2W2OP 1KRPA 5G0RA 3BBBA 3IWNC 2PIIA 3VV2B 3NLCA 3DRPB 5E3CA 2JLEA 2FHJA 3KJQB 1QSLA 2MQLA 2PE8A 4MTPA 4QIFA 2KO1A 3DDKA 2XO7A 3M8SA 1F5BA 1GNKA 2MZQA 3SSSA 1WC6A 1WDDA 1N6QB 1BC6A 2AW0A 4ZHRB 4Z2XA 2AJ4A 3LGMA 1URRA 3ELHA 1NNDA 1Y0HA 2ZNYA 4LIRA 1UL3A 2KT5A 1TMMA 1DURA 2JSXA 2B9XA 1JNRB 3G82B 2A18A 5KFHA 2XHWA 2GVDB 3EPIA 4HH0A 2P9CA 3FGVA 4PWDB 3KLEB 5LSOA 2A1BA 4L3NA 1CBKA 4KO0A 4OX6A 1VQ5S 4IR9A 2PMZD 5IC4B 1N48A 1M1HA 1HHSA 2VPZB 2PA8D 4B3OA 3DRXA 2XZDB 1YJNS 2LMIA 4V19J 4ECXA 1F2GA 1OMSA 5E3AA 1FXDA 1FD2A 1QUVA 2KXNB 1YI2S 3TVKA 4OYXA 2J0XA 3BH7B 5E7OB 1VI7A 3PR5B 3H5UA 5D4OA 3I0SA 2DR7A 2D41A 4A48A 4BC7A 2RD5C 4CTAB 1S9EA 2CNLB 1FI4A 4J7CA 1GX6A 1MN9A 4RW6B 5HI7A 2G0CA 4TY8B 4TY8A 2X7IA 3NG8A 5KFVA 3BO2A 1ZM3A 4A8QA 2CQ3A 4RW9B 1X5PA 1K1SA 2J7WA 3F56A 4LQ9A 4PEOA 4ILRA 3SMZA 1HQUB 1UTAA 1TVRA 2ZHBA 3DGVA 1N5QA 3I0SB 4GKJF 2C3OA 3CC4S 5D4NA 1OSCA 5J2QA 2DGUA 2JZ5A 2Q3PA 4RNHA 2AIRB 4EBCA 3BSAA 1PKUA 3UN3A 2D3UA 3OR2B 2CWKA 1S9GB 1PYTA 2B4VA 1RTDB 3WC2A 1GMUA 2HFUA 4KT0C 3TRGA 3TYTA 4DSFA 2M3DA 1LKZA 2EXUA 1G1XA 1BGXT 4IO1A 4AT1B 1NKEA 4JI2F 2IRXA 4F8RA 3CJ2A 3BJYA 4B17A 4NI2A 2G2OA 4JI6F 1T05A 4YN3B 4HHJA 4X4PA 3EJMA 3VQSA 5DLGA 4F4WA 4NYPA 1MN7A 3R5CA 2CQ1A 5DG7A 3PRVA 1V3RA 4AD6A 1S1TB 1N34F 2IVMA 2WHOA 4U6PA 3GB0A 4NLDA 1VISA 5F9LA 2GHVC 3UR0A 1JLBA 2HZVA 3HSGA 1S72S 2KVIA 1HLWA 2MY7A 4I68A 4CLZA 4QZVB 1LFPA 2XB2D 1ZPVA 3E8OA 4L72B 1U26A 4ZVFA 1MU2B 3UWTA 3ENWA 3G4SS 3TEGA 2VV5A 2CPIA 2BKNA 3EVWA 4H54A 1B0VA 3EE3A 4X4QA 1T3NA 2GCFA 2XSJB 1YIJS 1WDTA 4ANCA 2X3GA 1DLOA 4K4ZA 5F0UA 1LEOA 3A1YG 5DRKA 4QCLA 1HPZA 1MWYA 2XMWA 3R7NB 1IBLJ 4HKQA 2VH7A 3DRRB 4O4GB 1Q78A 4OYMA 1HKAA 1WC5A 2O66A 4A8XA 4KO0B 3MUTP 2IC3B 1KLMA 1CSJA 1YLXA 4LIWA 5K9FA 2OKQA 2DNYA 3JQKA 5ETSA 3JYTB 1NK8A 2J8AA 2M0GB 4WU2A 2V94A 3J7ZT 3MI7X 1GEHA 1V5VA 2K7KA 3TUIC 1SJQA 3M8QB 4OMFG 3MURP 4LF9F 4NCAA 3DGPB 4NXNJ 4J37A 2DBBA 2MQQA 1HWIA 3GZ7A 1KR4A 2VG7A 4NCGA 2HHHF 4Q45A 1PC4A 2KZZA 2B8PA 3TOQA 2FGCA 4FBTA 4LF4J 3AFGA 2P5VA 4HI1A 3OXGA 2IA0A 3BN7A 3CJRA 2HNDA 3W9JA 4KJIA 2GS8A 2HHTA 7FDRA 3J7YU 3DFEA 5E33A 3I5CA 3ULHA 3U7JA 1BHNA 2XCPA 1TQLA 2ATCB 1YRTA 3CJTA 1FRKA 3HKZD 2UZAA 3NCRA 3QBCA 5HBMA 4FXVA 4DPXA 3RUBL 1QVGR 1WD6A 4J91A 3MFHA 2YTCA 2MQPA 2W9BA 2FLPA 4IH7A 2NS1B 3V4IA 2WVBA 1SJ4P 3J81Y 4LSZB 4OHWA 3UPFA 1ITPA 1YG0A 3T5LA 3DLEA 3IWLA 5ETTA 2NXNA 3QWUA 5E0OA 4OIXA 1T9UA 3IMQJ 1HD0A 4U7CA 3JSMA 5M2RA 1G6BA 3NCQA 4KKOB 2FVQA 4J9OA 1HNWF 3QATA 1JLAB 4OZLA 2NZCA 1RADB 2W7AA 5HROA 5KFWA 4XDCA 1D0EA 3FSXA 5FIIA 2AHOB 2F63A 5A6WA 4NLGA 1S0VA 1U7LA 5F8MA 2O1PA 4KR0B 2UV8G 3HPOA 2PD1A 1Q16B 3RRGA 1REGX 2XHCA 1AT1B 4X66F 2BQUA 1XMQF 4FBUA 1WEYA 4KHPJ 2AV5A 2CQCA 1RT4B 4IUFA 1JJ4A 5L9XA 1OY6A 4ZPBA 3MCMA 5KFLA 2C2OB 4OZ5A 3CCQS 4DLEA 4DUZJ 4TQSA 2CQHA 2MKKA 3FFIA 1XR5A 4QWCA 5T14A 3KLHB 4PYAA 1QDUB 2B43A 2DHAA 4ZJOA 2J9DE 4M5DB 4DG1B 4M5LA 2IYGA 2NUHA 3H90A 4I56A 4A8FA 2E9ZA 3OXFA 5J1EA 1WG5A 3ISNC 2GO9A 5IT0A 1SV5B 2HVZA 1HHQA 1HWUA 1RTHA 2QGFB 2YKMB 3BM7A 3HHKA 4I2PA 1VQ4S 2BJ7A 1XMOF 1Q53A 1FVQA 2CJ9A 5D77A 5E3RA 4X4OA 1EQ0A 1EX8A 1JLEA 5LOQA 3D68A 2RS8A 4M5KA 4YEAA 4F4ZA 3Q8UA 2YX4A 1VQOS 1WC4A 3QT7A 2M2BA 2HMIA 4IG0B 3JSRA 4DV2J 1HQ2A 2FVCA 3D0GE 3M32B 3CDWA 3N79A 3NS7B 1HNWJ 2KN4A 3LQVA 3BQ1A 2QL7B 4DL5A 2FLOA 2RIJA 3UDCA 1YK9A 4OLPA 5H9FJ 3UO0A 1VBYA 1VK8A 1J5OA 5FJ4A 4N56A 1EJ7L 4MT1A 4M5IA 4P10A 3TX8A 4M94A 2ZWPA 4F02A 2ZHAA 1UFKA 2MDAA 1KHVA 3I9ZA 3MMCB 5B09A 2J5AA 3I82A 3CDUA 3MOZA 5ETPA 3N5FA 1PAUB 1YBUA 1XNRJ 4G1QB 4L6V3 4J9NA 1M5KC 1NDCA 2CNOB 3CDEA 3C46A 3JQJA 1LW2A 2VG5B 4R0EA 1HL6A 3PCOB 3ZZPA 4CLUA 2UXDF 2E5GA 4X84A 3DM2B 2FVPA 1O5JA 4HYKA 3IR6B 3W60A 1T94A 2GQ2A 1S48A 4KAIA 4M5JA 4X62J 2XMAA 3RBXA 1S1WB 2GVZA 2MTLA 3HT3A 1MMDA 1QSSA 1FEEA 1QY7A 1R3NA 5CZXA 4NZ7A 1RWKB 4MJKA 3GV7B 3VAJA 1D1UA 3WIVA 1QAIA 4B9UA 1FT8A 1NK7A 3R9LA 4QOTA 2ZOFA 2F7VA 4CLTA 3D9BA 1IM4A 3ILLA 5HL7Q 1RBLA 2XI2A 3FEXB 2EFGA 2J9CA 1M5OC 5K8NA 4Y2AA 3VR1A 4DQPA 5IWAF 3OV7A 3PW7A 3PG9A 2XY7A 2CQ4A 1NJZA 4WF9Q 2MQNA 2EK1A 3D0IE 1A6LA 1UZHA 4YP3A 4ZDNA 1T0TV 1VMBA 2ZEJA 4LBIA 5EDWA 2FLLA 1EIYB 4A8YA 4JV1A 3QAUA 3VCDA 1RHKB 2N7CA 4Y00A 4NZ6A 3EXCX 1NXIA 1ROFA 4EO6A 5HQMA 3M05A 1NHVA 3H2LA 4EMDA 1ZZFA 1TKXB 1VQ8S 3DM2A 1MNEA 1TUVA 2UUWA 3MAHA 4ID8A 1M90T 1EKRA 2DRBA 3SDEB 1S0OA 1B7FA 3CJKB 2IM3A 2XWXA 4KHRA 4K2XA 2W9CB 1ACMB 1CC7A 2J8SA 3ETMA 4N7TA 4WFNQ 4NXMJ 2KU7A 5LXRA 1LQ9A 2W1BA 4URQU 3CCMS 4I6AA 1KNZA 3C8YA 3PW4A 2QL5B 3QGGA 3KHGA 1UJ6A 2P8IA 2VFVA 1R6VA 3CCUS 2MZRA 5C42B 3CEDA 1HMVA 1X5OA 1ZM2A 3ISND 4Y2KA 4IOCQ 2GAHC 3O8WA 1BXNA 3AJ2A 3JAMU 2GJIA 3MMCA 3CPWR 1WHXA 3MM8B 4DEZA 3IBCB 4L3KA 3W64A 1N5YB 5GVQA 3PX0A 1D9FA 3SSRA 2VFTA 3DLJA 3KDOA 1IR1A 3RB0A 4LVOP 4LFCJ 3CJ5A 2VODA 4CLFA 3CT9A 4MH8A 3TP2A 4CLKA 4DSKA 4W98A 3IA0A 2BBEA 1UKUA 5KFRA 4CLWA 4ETXA 3FSIA 4ED8A 2CAJA 2M5YA 2LU1A 2VF3A 1FKAF 2JFDA 4TU7A 3OVBA 1AROP 3GP9A 4F0KA 3NWRA 4KKOA 3A13A 2LDIA 4WYWA 3ITHB 2HZCA 5HMXA 5BR8F 1B70B 2AZ3A 2OIHA 3UN5A 3S01A 3S1TA 3PJWA 4YHHF 1GH8A 3SDEA 4JV2A 1RYRA 3G86A 4KGVB 3TZWA 4ZP8A 2DD8S 4B9NA 1FK9B 3TZYA 4CLLA 2F8EX 2KT2A 4KC5A 2J6TA 4LF7F 2SXLA 4IFVB 2IIHA 4KPCA 3KK1A 1CQNA 2ZH8A 1NJIT 4FF2A 3HP6A 1T02A 4OI2A 4W90B 1OIAA 5IM0B 2RHQB 4DI6A 2RH3A 3MAQA 4K4UA 2WVFA 3OW2R 2WRMA 3VAGA 3JTNA 2DRAA 4B3RJ 1K8AT 4ZVUB 1KEKA 5HMZA 2N3LA 4EYHB 5C2CA 4L73A 1R8BA 5E41A 1KWMA 1KTQA 2PSZA 4PQUA 1TL1B 2EVZA 2DIUA 2P2CB 3CMAS 5DG8A 1RE1B 4O3PA 3H25A 3E51A 4JV5F 2XZWA 3KK2B 2C22A 3MMBA 1UA1A 1N5YA 3W65A 1W2IA 2AGQA 5AXKA 2IAJB 4NMLA 5HP1A 2FJAB 3O44A 4MYUA 4O44A 4ZA1A 2VA2A 1A0OB 2CQDA 1YGYA 3CDAA 3T1AA 3VVUA 1ZA1B 5LMUJ 2HEKA 3ZFVA 5EWEA 1N36J 4NE9C 3SSQA 4DV0J 2HWIA 4B08A 4ED1A 3A8JA 2R7VA 1V9OA 4RL1A 4B3TF 4WFZA 1YJRA 3HVWA 2H48B 5IWAJ 2BQ3A 2P6SA 3K89A 3T1YJ 1M5VC 2RT3A 4O3QA 1UPPA 1RDRA 2MB0B 3THVA 4DL4A 2OAUA 3MD3A 4HH1A 1IBCB 1UVKA 3TQEA 2HWTA 2XSJA 4BC9A 1VBKA 2J7KA 2MPUA 2PI5A 4OHYA 1AW0A 2JFKA 4RU9A 4HDHA 4CO0A 5GAHI 1U4BA 2VU5A 4V1Ak 4FYVB 1TUWA 4C3MA 3FRZA 5IT9Y 3PY8A 2XGPA 5HO4A 1H6KX 2HFOA 1X0PA 2YQ1A 5I4MA 4UF4A 3CJ8A 2WSFC 3M9OB 5A2QY 2CKWA 4K4VA 1QD1A 3LW5C 2HQCA 4HHUA 4M5MA 3V6DA 4U8VA 1N0UA 1IKVA 2E7VA 3DKDA 4BDPA 1UVNA 2BV3A 4IQMA 2NPIA 1XNRF 3I5BA 1YBTA 4LF7J 4C8LA 1TAQA 2QIFA 2JX2A 2F3JA 3H8YA 2HSEB 4MKVA 2ACMA 5K14B 1QM9A 3K57A 4JI0F 4DQQA 4JI4J 1HR0J 2CQ0A 2YNGB 3L4BC 2F4VJ 3TJ8A 1NUEA 5LM7E 2N4CA 1PC5A 2XMKA 2ASYA 1U1PA 2NZ4A 1S6QB 2K3IA 2PGCA 3C6TA 3RB6A 4ICLA 3HVTA 1LW0A 5DLFA 2DGWA 1F2HA 3QGPA 4I7FB 4NLXA 3CMQA 5I3UA 2FQQB 2HZAA 4GO5X 3GIMA 1NEEA 1VQLS 2P9EA 4B02A 1VCTA 2V68A 3DOLB 3EGWB 3DU5A 3I31A 3J7YI 3KK3A 1D8YA 4GKKJ 2HHQA 4LR9A 2LP4A 2XEXA 3WBZA 3EGVA 3THPA 3OTCA 2XS7A 4LRBA 2C3MA 3QRRA 1HARA 2VD3A 5J2NA 4ZVSB 4PG7A 4B9LA 2H5IB 3LWLA 1VFJA 1WI6A 3TAPA 4JOUA 4ZK7M 2BANA 4NX9A 1DQAA 5DM6Q 5D3GB 1FHTA 2BA9A 2HNZB 1FE4A 3CCLS 1RT6B 5BJRA 2PA3A 1R89A 2ZDPA 1VDHA 2W4PA 2UU9F 1F0XA 2L9DA 2AP6A 2CQBA 2CJQA 4ZPVR 1EARA 1G4CA 3VZHA 3VAHA 4X4TA 4LFCF 3GG1A 2HHVA 4Q8FA 2R7SA 5LMNJ 1CJUA 1WNEA 1H74A 1CG2A 4ELUA 1RCOB 2HQGA 3KFWX 4RNFA 4LSNA 1XBWA 2HBZB 2EC0A 2KJWA 2UXCF 4KHPF 5D0EA 3DLKB 3TEHB 3WX8A 2XM3A 2EW9A 2LU2A 2IVYA 3GYXB 5F9NA 3CCZA 1HI8A 1PCAA 4K4SA 3OR2A 1RLCL 2C1EB 5L8RC 2HS4A 4R5PA 3KLHA 2XMJA 3ZO7A 2DY9A 3ILIA 1X4FA 4OYIA 3FKBA 3DLGB 1SH0A 2V9KA 4G65A 2YY3A 5KFTA 2KTQA 4WYLA 1TV6A 1UWBB 3ICLA 1TAUA 1PSDA 3LGHA 4C0OC 4DR4F 2VG7B 1H7WA 4NCGB 4Z7YA 1R43A 2QYCA 4OHZA 1S0MA 3RR7A 2Q79A 1RWWB 4DV4F 1IWGA 1X4GA 5DZ6A 2YNFA 4F7VA 1N0VC 1LWXA 3H5YA 4ATNA 2PEHA 4NLVA 4HT7A 2W24A 2AEFA 3I0RB 1Z2ZA 3AB2B 3CNQP 3MDFA 1WKJA 3C14B 2IVFB 1NH8A 2IY5B 2DXEA 3T5HA 4MKYA 2JC1A 5DJBA 4HDGA 1DQ8A 1HPZB 2BW7A 1U1RA 2NYIA 2H3EB 4FYDA 2RHSB 1L3SA 3CW2C 2X1GA 2DPIA 1FTCA 1V5IB 1R0BG 3HJFA 2Y1JA 3M30A 4NRTA 1GK8A 2HIYA 2YPZA 3HSJA 4M63A 2YKOA 4PPDA 3UNYA 3ZZZA 4KHMA 6FD1A 2XQCA 3EVMA 2ZC4A 1LWCB 1REVA 2E1PA 2RAQA 3EYZA 4ECVA 4B9SA 1KBRA 3OTDA 3K5LA 2BDPA 2OD6A 3BGRB 4ZVTB 2IJFA 8AT1B 4TXSA 3HVRA 1BQMB 4QQBA 3DRPA 3DLGA 1T8EA 1FRLA 2JNJA 4TLRA 1TL7A 3I56S 3IBFB 4TVAB 4DL2A 2CQ2A 3O1LA 5KFGA 2WW8A 2B4OA 1WHVA 2VBYA 3IXQA 2C3YA 1TTHB 3SXLA 2IDLA 4F3MA 4P72A 5KFMA 3DLKA 1WOSA 2OEJA 3POTA 5E2QA 2W2NP 4LSNB 3T9ZA 4J9PA 2AJ2A 2ASLA 1JXVA 2GA7A 3LGNA 3RZAA 3N9UC 1RT3B 3JSBA 4XPEA 2ZBIA 1RTDA 2DO4A 2UUCJ 4RKUC 1RTIB 4DUTA 2QA1A 1D3WA 1GMWD 4DPTA 2GIRA 1DHMA 1WKLA 2VDIA 2QX0A 3A8EA 3IRXA 4NZ0A 1QAXA 3MUVP 1Q8BA 3Q0AA 3G8TA 3LF0A 3T5JA 1PG5B 5F8LA 1K9MT 3MMJA 3N4WA 1FESA 1GTHA 4WIQA 5DO2A 2M8DB 1SKUB 3CCSS 2ZC3A 4USUA 5GAGU 4DV6J 2WZ1A 4F67A 2V67A 4UQTA 3PYDA 2V50A 2Y8WA 4JI6J 5L38A 4ECYA 1XJWB 1Y9OA 4AFFA 3UI3A 4ZVPB 4N47A 1SVDA 3C16B 3OFFA 1PJ7A 2NR0A 1JLBB 2LEPA 4PABA 3NGSA 4P2MA 1ZS6A 2FVSA 5I42A 2QZ8A 2MKYA 3IRXB 3ZZOA 4QIGA 3GR0A 3BS9A 3HT0A 1NSKL 4DV7J 3DLHA 3BDPA 3PACA 4ICLB 4DR2J 1RHJB 1RABB 1U45A 2DXFA 1JLQB 2PDAA 5GADU 1H98A 2FZKB 2ZM6J 4NI2B 2R2RA 2H54B 3TA1A 2F1FA 3GLJA 4KGMA 3EUNA 4X4SA 3MM6A 1V3SA 4OJHA 3SQGB 4K4WA 4S0MA 3TNVA 3OJUA 4FF4A 1GXLA 1DTTB 3G96A 3GMGA 2G9OA 1OY8A 4PWUA 1UCNA 2DY1A 3BDEA 4DPYA 4E8UA 1PYSB 2LXIA 3OBIA 3WC0A 3J7AN 3M8ZA 4LRCA 2OPPB 5DETA 5GAGI 3OTEA 3MAAB 2Z2ZA 3U1LA 5A8WB 5CABA 1BQMA 2ZJPQ 1X4EA 1T03B 3QJPA 2NXCA 4ZCKA 3HO1A 1EP4A 1U48A 4HACB 1OPZA 2GIFA 2XO6A 4MFBA 3DI6A 9RUBA 2XWYA 3SCKE 1ZZNA 1MG7A 3D5MA 4R25A 4RUAA 1NK4A 2Y8YA 3NKYA 4NEYA 3JTPA 5ETOA 1B4SA 1S9EB 2ALYB 2HKEA 3NGUA 4Y3CA 1RISA 2B6AA 3BH6B 4CT8A 5J1PA 3J7A1 4P2XA 1HNZJ 4DR6F 3DOLA 3P6YC 3K58A 1BD6A 1N54B 1RWMB 2BUNA 3KUHA 1SKSA 2O5DA 1C0TA 3VZIA 4R8UA 4J90A 3T9NA 1EAYC 3ILOA 2I1RA 4X65J 1K0VA 5D15A 2QRRA 4J9QA 4J9RA 4OX8A 2AU0A 1XNQJ 2B7BB 2GX8A 1UAWA 1G7CB 3C15B 3D1OA 2R7UA 2ZZTA 2QEXS 4PG5A 2FTRA 4C8NA 5F3ZA 4QYZK 3AOBA 4FYXB 5KFXA 4O3RA 5KFQA 4QYRA 5EWGA 3POTB 1NDLA 1VQ7S 2BR0A 1WC3A 1VS3A 2DT9A 2J9EA 3BKUA 2EBGA 3OTOJ 1IKVB 2K7JA 2V2QA 3DC2A 1FTRA 1R8HA 2CJXB 3GJSB 3MCOA 5KFCA 2BRKA 1NPKA 2V69A 5F0WA 2MQOA 1GAOA 2CQGA 3KK2A 2N82B 2FJEB 4OI3A 4UY85 1TL1A 2HLTA 2V9WA 1K1QA 4PQUB 5F8IA 5LJ3Y 2FPHX 1S6OA 4ELTA 3LWMA 4DPWA 3R5AA 4ID5A 1AUSL 2YKNB 3CC7S 2JC0A 2D69A 4Y2CA 4X64J 3L7UA 2CPZA 2QTWA 3MEDA 3OR1A 3N6LA 2XLJA 5KAKA 1FNXH 4Q5VA 3CD0A 1X4CA 3W63A 5DS7A 2BE7D 1JX4A 3HULA 5CAAA 2MMYA 4UW2A 4B9MA 3GWCA 4I2QA 5L1IA 1KVJA 1RT2A 2QMUB 2QN6B 2KRBA 1RT7B 4LT6A 2PEBA 4ILMA 1WELA 1CEZA 1CJUB 1RLDA 4PWWA 3TAMB 4N41A 2RF2B 2IM2A 2HFNA 5D0HA 4MKBA 3R6GB 4P75A 3ZZYA 1U8SA 3C14A 1NRKA 4MMOA 5IT4A 1RU1A 4DV5J 1WC0A 3M2UA 3MR7A 4F04B 3QFHA 2HNZA 3E01B 3UD5A 1SC4B 4KH0B 4DQRA 1I3OB 1HYSA 2IAJA 3L7OA 1CJVB 2KH9A 4NLWA 4P2SA 1FJGJ 1X9MA 3M8WA 2H5EA 3F41A 1SJRA 3MMBB 3CO9A 3EPGA 2KXFA 2RE1A 1NU4A 3M2RA 2HHUA 4W92B 3QPIA 4FKXA 2R42A 2ASDA 3TA0A 5LMNF 4RW8B 1XTZA 2QLXA 1U0HB 2GZOA 5DDPC 1KQSR 2HAFA 3UE2A 4ES1A 1N5VA 2OPQA 3G87A 3JS9A 1Q8IA 1BQNA 2Y1IA 1M0SA 1RHUB 5HVFA 2V4JA 1SIWB 1WTFA 3S6EA 2XYPB 3CD7A 1S6QA 2XNQA 3C6TB 2H1YA 4LRDA 7AT1B 2FIUA 2KRRA 1HD1A 2MYFA 1FF2A 1YZ6A 2LQ5A 1VHIA 3PTWA 4C11A 1B0TA 2X3DA 3LP0A 3OL6A 1Q5YA 5LT5A 2ZZNA 4CO1A 2M7SA 4DZDA 1RWOB 1YJVA 2XBPA 4PCQA 3EWGA 3UCGA 3MEGB 3F44A 1M1KT 1YKWA 1YVFA 1S57A 3DNCA 3N6MA 5L39A 2VONA 5LSRA 2NQPA 4DV3F 2GGPB 1N33F 3M1VA 4QU6A 2UU9J 4B3SF 1JLCB 5C2GA 2KDOA 3BEGB 3CULA 2BANB 2RSQA 1D9AA 2Z2LA 3QT5A 2DNLA 2BACA 1XQIA 3RB3A 3LPYA 3D1QA 3QJJA 4ZP7A 1H2TZ 4QYZJ 4USHA 1L3UA 3CDBA 1M5HA 3DMJA 2HVEA 5C7PA 2KG0A 5DGAA 1RHQB 2BVZA 3N6NA 2HFVA 2GVZB 1S79A 1FRHA 3IGNA 3GV8B 4RNOA 2ZH7A 5I3PA 4O3OA 5I3UB 2DHSA 3HXMA 3BGOP 4F4KA 1RWUA 2A2DA 4OYWA 3J81U 2ZUAA 1HBNA 2DEJA 3BKTA 1WC1A 2DNQA 1S7IA 4L75A 3TI0A 4DCOB 3CIMA 1VR6A 3OHAA 2HQDA 2CA9A 2QG9B 2DTJA 1O0PA 1P8GA 1RTJB 2HHPA 3MTKA 4MKAA 1OQ6A 5FD1A 4WCEQ 2A6OA 1Y11A 3UDVA 4K5RA 1RGVA 4IOBA 2NREA 3QRPA 2YWFA 4NLUA 2MQ8A 3QLHA 2LXFA 4EYIB 2YWHA 4DUZF 3MHYA 2BJ1A 2HNYB 2RJZA 4JI8F 3AQPA 3BSNA 3R2CJ 4DU7A 3V6DB 4E98A 1AYEA 1HI1A 4M5NA 5GMKa 4AL5A 4B3SJ 4O0NA 1FDAA 1JLCA 3W1YC 4ZLJA 4CO2A 2W2PP 4W4MA 5HLFB 1VBXA 1WF2A 2HNYA 4ED4A 2EKNA 4LJMA 1WF1A 2BJEA 5DDRC 1HFEL 2EG1A 3L7PA 4USKA 1N4LA 4OYBA 2OD4A 2VFSA 4OZ3A 5CD4H 1MWZA 3G8SA 4XTTA 2D3OR 1MW7A 2KHCA 3U02A 3QGHA 2KT3A 2KJVA 2Z56B 3FNNA 4H4KA 4USMA 4Q2MA 4DV1J 1N8RT 1RTZA 1R0AA 4I1TA 5BXIA 4TYAA 2EFVA 1KSPA 4X4NA 1QE1B 2BKPA 2UXBF 1HW9A 2V4JB 3T6JA 1HNXF 1NH7A 1X9WA 2R7WA 1TFWA 2HBQB 5CD4A 2COLA 4ECRA 3FRYA 4RW7B 4DV0F 3IAS9 2FJBB 4G1QA 1U0HA 2AGPA 3SI8A 4PXBA 2PI4A 4B3RF 1H7XA 2FC8A 1HNZF 2ZBQA 3PW2A 1NPPA 2LA4A 3M2RB 2YXLA 2QC3A 3EICA 3IRWP 3HD2A 4F0MA 2U1AA 3M8RA 3OFEA 3MM8A 3O2IA 5C5JA 4MIWA 1QAJA 3H5XA 4ZVQB 1RWVB 3R1LA 2DVIA 5IOLA 3K59A 1U2FA 4I69A 3K17A 4JV0A 1IQZA 1KFDA 1N88A 4P9SA 1I94J 5DGBA 3CXCR 1LFWA 2OTLS 2V63A 3WQPA 3ZZUA 1F5AA 1KP6A 2OFGX 1IBMJ 1KLNA 1WG4A 3TVYA 2NSBA 5KT4A 3RBZA 5HJYA 2ALZA 4FP9A 2DXDA 3GSDA 2OMLA 2VASA 2ZNZA 3LANA 4ZJLA 4KY3A 3JSMB 3PIOQ 3W62A 1JKHB 4DLGA 4PUOA 2WAQD 8ATCB 3BQ2A 5EGYA 4CLSA 4DL3A 1GQEA 3V4IB 1K73T 5KFEA 5L1LA 3QSIA 5DQIA 1FD8A 5K8PA 5ETLA 3C19A 2XMUA 2M8HA 5CZVA 3C66A 1B64A 5CYQB 2RRNA 1VQKS 3TJAA 4DV7F 3V6JA 1JLFB 1YJWS 4DSEA 2R7XA 4A8SA 3OL9A 3A4TA 2VQFJ 3JB9k 2MLZA 2MZSA 5KT3A 1KN6A 2Y0SD 3LAMA 2E5LF 2KFNA 1SI9A 4K59A 5A8KB 2DHHA 2YH1A 1RWXB 2EEYA 2GMLA 3P5BP 4DCJB 3G9CA 3TA2A 3B8HA 4ANEA 1PJ6A 3FBFA 2GJ2A 2Z0GA 3OD2A 5J2PB 1T9YA 3I4HX 5KFZA 4UOFA 3DYAB 5B0FA 3G6ES 2QSWA 1ZOTA 4GVBB 2WOMB 1ICEB 1KKHA 2V2ZA 3M8PB 2VKZG 5U47A 1IR0A 2M70A 2Z2MA 4P7TA 1J2VA 2VG5A 4AYBD 4QBUA 1BWEA 3W66A 4USWA 2DITA 5HMYA 2NXUA 1I51B 3TWZA 2DH9A 3CD6S 2W01A 1R7IA 1N52B 4Z37A 1KD1T 1WACA 5LSLA 1NDKA 4NASA 2HFZA 3DI6B 3H2UB 4LF1A 4MFBB 2OTJS 2R7TA 5D4PA 4J5OA 3W8PA 4CT9A 4YR0A 2XNRA 1OYDA 2GAGC 3L95X 3PXGa 1UWAA 3PKYA 3RRHA 2V8VA 3QQCD 3OL8A 3QZ7A 3CE8A 2JDJA 2H51B 4DR6J 1UVMA 2J9DA 3HK2A 1UMJA 4ZN1A 4ED6A 3CIZA 1T3OA 3IFEA 4DR7F 4NMXA 5KFNA 1I6JA 3SFGA 3EGZA 1OSDA 1FNOA 4NCBA 4NYOA 3DGPA 3PJ9A 3ZTSA 4U7UD 3T6BA 1HNVB 4C0BA 4DWIA 2Y9HA 4USTA 4XPCA 2JVRA 2LQ8A 3OTBA 4NYZA 1TELA 2QMXA 3BO4A 5J1EB 2ZH2A 1Y5NB 1S77D 3W3SA 4ZCIA 1DARA 3AJ1A 2W7PA 5H1SV 1SL0A 3OPKA 2HWHA 5BR8J 4YB6A 3QJLA 4GC7A 3W2WB 4BCAA 1NZAA 2CVIA 1C0TB 3PR4A 1S6PB 2I0XA 4C8OA 2AJQA 2GW8A 1YX2A 4CH1A 1H0HB 4DR3F 4FYWB 2CG4A 1YITS 4PKDB 4A8MP 1IWAA 1U1QA 2BM0A 3KLIB 2BABA 1XR7A 3AQOA 2VBWA 4USIA 3CCVS 1SH3A 4DV6F 4EUVA 1CJVA 1YRUA 2DGTA 4JI3J 1RAIB 1VK3A 4YOEA 2WBRA 3SYZA 2B56A 3R5JB 4F4XA 2UUBJ 1UJ4A 2X1FA 1NKCA 3DLLQ 3HJVA 2VB6A 4LF2A 1PILA 2FZGB 3L3CA 2HMIB 4DV2F 1LV5A 3MEEA 2MGZB 3M2VB 3KJVA 2MJNA 4UUXA 5EWFA 2RQCA 3UDEA 5IFMA 4P71A 3GIKA 1E6VA 1KQGB 4C97A 3QMQA 4IFYB 1T05B 4N8OA 2FJWA 1RT7A 5IV3A 4A4JA 2UVRA 2GVDA 4YS2A 5AE1A 4JI3F 4LF5J 1W2BR 3FSYA 1HBUB 2B7CB 3G2XA 2UXCJ 1JMTA 1LWFA 4LF5F 2EI5A 1Y4ZB 3KJFB 4LSLA 5KFOA 2KM8C 1VGYA 2A0FB 2MLXA 1U1MA 4HL9A 4DF8A 1F3FA 1FKPA 2FLNA 3HCXA 4JI5J 3ET6A 4LR8A 3KMQA 5B08A 5GMDA 1J5EJ 3FFIB 5KT2A 3W2VA 3SCIE 2V8PA 2DCLA 3IS9B 4OV6A 2ZHOA 3QFWA 4OI6A 1SQFA 2CYYA 1SKWA 4RW8A 4DUYF 2W25A 1M5PC 4F2SA 5DG9A 3HVAA 3KLFB 4KE5A 1R8AA 1C4CA 3GONA 3FCHA 4IH5A 1B99A 4EI2A 3OSNA 4LF6F 4R5PB 2P9GA 2BQRA 4U67Q 4C8YA 2ZJRQ 3TZXA 1Y5IB 1DJ0A 3AXMA 3VQTA 2ZBRA 1ZH5A 2ZVIA 2D3ZA 3B54A 3FMBA 4QR0A 1Q7YT 3PO5A 2ZJQQ 1Q1KA 4JB8B 3GFHA 4UOHA 1EQMA 3MM5A 2L41A 3B4MA 1PIEA 2B9EA 3LP2B 2AJ1A 1NMEB 1MROB 1PGZA 4LMZA 2E29A 6FDRA 2XY6A 3MPWA 2ZOGA 4I64A 2JJ4D 2VDHA 4R8UB 3KLEA 2JEJA 2ZD1A 3A3OB 3NNAA 1HQEA 4LF4F 2I9SA 2JLFA 3EDQB 1RT2B 3W5ZA 4AXIA 3K5PA 3JAMY 2E1RA 2GC8A 2AQ4A 2E7WA 2PMHA 2YNIA 2JWNA 4FS1A 4F36A 1W26A 1SPBP 2WTFA 1ZBTA 2RS2A 1PO6A 1NPRA 3BZQA 1GTEA 4FNIA 1Y7PA 2C2MB 4LBHA 2NPFA 5HBMB 4AL6A 2CPDA 2HURA 2MKJA 1RT5B 2L08A 2HGMA 1FRMA 3PX6A 3PDNA 3M8YA 4ZCMA 1SIZA 2NCKL 3TAQA 1U6ZA 3AODA 3CUNA 4EK2A 2Q66A 2R7OA 5F3TA 3ZTOA 1S1TA 3PV8A 2RDIA 3Q8VA 3ET6B 3HDSA 2D7SA 2U2FA 1PBUA 1RACB 3PYGA 1CQMA 3B6BA 1X4AA 3QO9A 4XIUA 2DR9A 2GQQA 3J80U 4ED5A 1F3VA 3QT6A 2Z2YB 4GRSA 1GMWA 3UN2A 2RU9A 5KFJA 4LF9J 4ERDA 5KFIA 1ZETA 4UTGA 2ZD1B 4KQZA 1HBMB 4Y65A 1HWJA 1VBZA 1UP1A 1CJTA 3UD3P 1NAQA 1L3VA 2RUSA 3TVZA 2E5LJ 4KTQA 2D9PA 2E7XA 2FY8A 3X3UA 3LAKA 3LP2A 2VQFF 4J9KA 3ZC4A 2AYGA 4GC6A 4K7QA 5K5MA 5I42B 2OHDA 4QIWD 5HSPA 1UJ5A 2QL9B 1XEZA 2WVEA 3BR8A 3CD5A 2B6AB 5LMUF 2MEWA 4Q43A 1R8PA 4ZLNA 1XMQJ 1KS2A 5J2NB 3CJ4A 3NGKA 4PG4A 1ZAWA 2DIVA 3R1HA 1Q81T 1DAXA 3VGSA 1X4DA 3V2UC 1Y5LB 1E6YA 1KQFB 4C98A 1TV6B 1UWBA 1VLOA 3EXYA 3R8YA 3IS9A 3W61A 2IBKA 4OQJA 8RUCA 5I3QA 2C2RA 1S1VA 2YX7A 5LXYA 3TUZC 1N34J 4LFAJ 1LW0B 4CCHA 2DHGA 1R8CA 2B5JB 2RNEA 3M6WA 1Q4RA 2AD9A 2DR8A 4U8YA 4CRJA 2C2NA 5EUHA 1X60A 4PWDA 3RJMB 1U1LA 1LWFB 3SCLE 5AXLA 4ECQA 4WTOB 1H2VZ 3HI9A 3IAM9 3BBFA 3LP1B 3LP1A 4WU3A 5K14A 3OLAA 2AYBA 4ZKAA 3DDIA 2HS3A 4LR7A 1E6VB 3A3PB 4LRFA 1IBKJ 1UVIA 4QJVA 3RAMA 4TQRA 3WIUA 4ZLPA 3BYPA 4ZOSA 5E5NA 2IA6A 1VRUB 4MK7A 4CP5A 3E2EA 3RR8A 1S1VB 2YWKA 4U7UK 3KYLA 1RT6A 2E5IA 3N28A 1BE4A 1PAEX 2H4YB 1C2PA 2ILZA 4KBIA 5SUHA 3KLGA 4WXWA 2VFUA 1TVRB 5DM7Q 5D3GA 2F4VF 1E6YB 1R27B 4RWXA 4RW9A 1HR0F 1U02A 2GHWA 4CQ1A 1SL2A 2FVRA 2K06A 4F4AA 3TUPA 1LOUA 3PO4A 2KZMA 2HYIB 5CHCB 5KG7A 4H4MB 4K50A 3AD7C 2VC1A 1X5SA 3BQ0A 5B0EA 1FCAA 1X0FA 3ENAA 2CNNB 3AT1B 5A2QU 2N7YA 2OPSA 1SBRA 3T1YF 2I2YA 2CPFA 1TKZA 2CRLA 4LRAA 1JJHA 2ERRA 1YRXA 5CYJA 3C2PA 2MKSA 2WCXA 1IBLF 5H9FK 1ZAVA 1CJTB 2Q43A 1JQGA 2HK2A 1HBOB 2F65A 3MM5B 4PXCA 4AQYF 2LCWA 2RRBA 4V19X 1VIXA 3H98A 2LQBA 3B78A 5HQ8A 3IN5A 4JI8J 4DN0A 2NXEA 4F26A 2RILA 2YKPA 5D0GA 4DPOA 5KFFA 2HS0A 5IV4A 4PG8A 2QLFB 3HHEA 5HATA 3RW7A 2ABYA 3KNGA 3ZZ0A 4CNZA 5F8HA 4AQYJ 3M4XA 3M7VA 1X7VA 4C2MA 3UCZP 1UW9A 3RAQA 1RAHB 4X4UA 3W5XA 4BBYA 3VAMA 2A3JA 3P96A 1YHQS 3WZ0A 1JNZB 1SKRA 2FDNA 3GU0A 5KG3A 4CO3A 3VVTA 3BGRA 1K47A 5CYQA 3I6PA 3BBCA 5D78A 4ZLLA 1FDDA 2OJ3A 1BY9A 1FKPB 2DGVA 1H38A 2CZVC 3ZZRA 2D9OA 2XG8A 4LSLB 2V0NA 3THTA 1GXTA 2V34A 5EX3A 4RUHA 4ZMMA 4IFVA 5HANA 4OX9F 2JH3A 1C4AA 1AZSA 4H4OB 3PX4A 4PXEA 3PEJA 4WP9A 3KUGA 5DDQC 3DRYA 3J7Z5 3BPDA 2XULA 3C6UB 5D8HB 3UNGC 3TANA 2XLKA 5E3QA 1JXLA 2CPEA 2AJFE 4CNYA 4KPYA 1RWNB 2PC6A 1EETB 1FFSB 1SC3B 4GVBA 2EBEA 4DV3J 2IM1A 2V8DA 1TMJA 3IG1A 2AGOA 1PJ5A 6AT1B 3KOAA 1P9QC 2YKAA 2YKQA 1DQ9A 3AOAA 1BUXA 3WDOA 1WF0A 5A8RB 2EG2A 4WE1B 3A8KA 4PZVA 3K5MA 4F2RA 3TUJC 1Z4UA 4ZP6A 1U49A 4OX7A 1L3TA 1QAYA 1UZDA 4XAKA 1CPZA 5KFDA 3MCSA 3D3BJ 2XY5A 4PAAA 2Y0BB 1KQKA 2QJ3A 1S6PA 1S9FA 1IJFB 2DNNA 3P3DA 2OPRA 1JLGA 1FRIA 2UXBJ 1I94F 1P9YA 2CPHA 4O0IA 1X8DA 2W9CA 4KB7A 3RB4A 3PRBA 2GO8A 3FEYB 2X51A 3MM7B 5KT7A 4ECSA 1IBMF 2RU3A 3QZ8A 2I5JA 1KOHA 3KK1B 1S0NA 1K0TA 5F41A 3M6XA 3OVSA 5C24A 2EPIA 2X1BA 4P73A 5L9NA 1RAJA 3RG6A 4IFYA 4ZN3A 1RKJA 2J6SA 1FEHA 1N5SA 2RQMA 3HSZA 3DXSX 1QUPA 5KFUA 4C3LA 3ZTRA 2R2SA 2PFFB 3AAWB 3VGUA 4HVZA 1Q95G 2K1RB 3FBCA 3O5TB 3MEEB 3MPYA 2DGSA 3U1NA 2MGZA 1RT1B 3KJVB 1U1OA 1TFYA 2VOOA 3Q2SC 3NAIA 4DV4J 4DSJA 1H72C 2XZTB 3MEKA 2B9YA 2F8MA 2ROGA 3L09A 4KIAA 1QTMA 4JI1F 4NOHA 1U0SA 2G0IA 4LUBA 4ELVA 3PKMA 5HK4A 4RUCA 4ZITA 3DRSA 3ZNUA 3M9NB 1WUUA 3NRBA 4OX9J 2OSRA 5IXUA 4KV8B 2EWHA 3FBBA 3BSCA 3CWJA 2NXJA 2A10A 3KK3B 1SC1B 3RBDA 4RW7A 4FZVA 1VRTB 3FCVA 5KFSA 4J9MA 4UQGA 3P5TL 1WORA 1H2UX 2KB2A 1ZPWX 4FXWA 4L76A 4OLOA 3HSDA 4DX8H 3OUYB 3RYLA 4K5SA 1N6QA 4TU9A 2Z30B 1ZTWA 3HFKA 3K5NA 1OQ3A 1W7WA 4DS5A 3CJKA 4O4RA 3M6VA 3AOCA 5B0AA 1RYSA 1O6XA 2WOMA 5BYSA 5B7WA 5MLCV 3TQ1A 3LUYA 5F8JA 2JVOA 2KXHA 3M9MB 3H4BA 4ED0A 3OTOF 4CWBA 5HP1B 1NBEB 1S97A 4UY8T 3DMJB 4K0KF 1FX2A 4C0HA 4P52A 4PXDA 2CJYB 4RZRA 4ECUA 2OEMA 1LWEB 1S1XA 2DR6A 2PO4A 2RKIB 4NLPA 1J5OB 4X64F 3CMES 1ELOA 1LXJA 1HWKA 3UVJA 2YQ0A 4WK1A 2LECA 1AFJA 3D67A 1KTVA 5FLXU 4RX6A 1WJ9A 1XR6A 3M1VB 3EGNA 1B3TA 1RHRB 1NB7A 2K1RA 3D54A 4A8WA 1IR2A 2V4RA 3FZ2A 3QLHB 3KHHA 1QVFR 4URGA 5ETNA 5IM0A 3MPDA 3K8WA 2HHSA 3QNWB 1CVJA 2DNPA 3QT8A 1HNIB 4LF6J 1F1BB 3HHLD 2MLYA 2VZ9A 3KG1A 2X1AA 1VYAA 4XO0A 5EHHA 4FF3A 2VPWB 2CVEA 2VBZA 2HRTA 3R7BB 2LLZA 2YNHA 4WKYA 4YFUA 3PW0A 2RQ4A 4LBPA 3KTQA 4WTYA 1KVIA 1WOOA 1FWPA 3CB4A 3D0HE 3W7BA 3KLVA 4K4XA 4I6YA 1BQNB 1WG1A 2CQIA 3HZGA 3KDNA 2NSCA 2MY8A 5DQGA 5KG2A 4Q0BB 3GFYA 1VRTA 1VLYA 2BE2B 2GNKA 4QIEA 3CCTA 4RLEA 5J2PA 2WSCC 4NEZA 4O44B 3CCES 3KHRA 3FQKA 3CVKA 5T7LB 1IKXA 4CH0S 2ZH5A 2ZBCA 3QSYB 2DCUB 1IBKF 4OI0A 2HRUA 3AD8C 2R9LA 1XERA 1Z2LA 3HM9A 3OVAA 1SC6A 4ZVGA 2VQEF 1ULRA 4DFMA 2LQ9A 2BOPA 3PZPA 1HYSB 1MMNA 1NSAA 3ILJA 2M4MA 4BWMA 3MR2A 4DV5F 4B9TA 3EDRB 2EKYA 4QWEA 3CGIA 4DQSA 2UUBF 3RAXA 2VFRA 3C6UA 3CJQA 3IR5B 2RB7A 1RAAB 1VQ6S 3HFVA 2V6AA 1V6HA 2FHKA 2Y1RI 3GTYX 4TN2A 1R0AB 1HI0P 3GG0A 4JI1J 3LOUA 2OO4A 2AYEA 3I5AA 4WFXA 5HMWA 4RU2A 2F9JA 2Q6CA 1RSCA 4Q2LA 1FK9A 2ZFHA 4C11B 1JB0C 2RRAA 4WZQA 2YWGA 1YQHA 1TKDA 4JP8A 2I5JB 3MMAB 1NJYA 3D1HA 2HG4A 3MM7A 4Y28C 2Y3YA 3Q8PB 2DGXA 5CXTA 2UVUA 3OR1B 2KI2A 3ONQA 5AXNA 1C1CA 4UUWA 3MR3A 4J9LA 4DR2F 2FHMA 2YKNA 1NM2A 1PYOB 2OPQB 4YDXA 3MCNA 4WK3A 4UT4A 3MD1A 1T9WA 1UFWA 1Y3JA 1H3DA 4Y34A 2HNDB 4HI2A 3SIPB 1SJ3P 2VC0A 5KFBA 5KFPA 4GKJJ 2DNGA 4BS2A 4ENOA 4YUDA 4D3HA 1H73A 4NLOA 3TJ9A 1WWHA 2H4WB 5HJXA 4IOAQ 2MZ1A 4URSA 3UR3C 2LA6A 1GXUA 1TZ0A 4YB1P 5CCLA 3D6FB 2ASJA 2DPJA 4ZIVA 2M88A 4RPFA 3IG1B 2W2QP 2Z8QA 2YWEA 1Y10A 4NA3A 2KFYA 2MKCA 3KKFA 2NUUG 3PEHA 3QIDA 2AX1A 4QW8A 3SEOA 4DDFA 1BQXA 3CC2S 1X5TA 5ETMA 1OS5A 2CXEA 3NP5A 3VAKA 1FJEB 1VJQA 1SJ1A 2YNHB 2ZH9A 4MAKA 1IXKA 3MZIA 1Q86T 3DLEB 2W8LA 3RRKA 3MXHP 3P8BB 1AB8A 3HF5A 2OELA 3CJ3A 2I6WA 4CH7A 5IT9U 3HHLC 2J7UA 2E5JA 3K2YA 4ZPCA 4F4YA 3V6HA 3NBPA 1IVZA 2QFJA 5IC6B 4L74A 2CZ9A 2OLWA 3DRSB 3QIPA 4KGKA 1NJWA 3S7RA 5HLFA 3SV3A 4Y2IA 4U95A 1X4BA 5CYMB 4I6WA 2VUGA 1X31C 4X65F 5A8WA 2VA3A 4ECTA 2JEFA 2E5HA 1J27A 1C0UB 2DHXA 1RAEB 3FEZA 3V4MA 3VF0B 4CLPA 2YVSA 4DFJA 3G71S 1APSA 2QLWA 4ZVHA 3AD9C 3MEGA 4ZPAA 2XS5A 1WSRA 4HTJA 4LVNP 4RO0A 5M2UA 1U2CA 3SQGA 2Q6BA 1EKSA 1S1WA 3MM6B 3MR5A 1S7HA 3R97A 2KVQE 3SCJE 4M95A 4FPIA 5GAHU 1XMBA 1KLMB 2KKHA 3W9IA 1U09A 3JYTA 3NNHA 3P45B 1WSVA 2BX6A 4OYPA 1TKTB 2A6MA 4I0WA 4ETZA 1RB0A 4TLQA 1HBNB 4QWDA 4DUYJ 1LW2B 2IPOB 2GFFA 5LJ5Y 1KC8T 5GAEU 1FE0A 1TKZB 5BYRA 1EB0A 3AY0A 2BEFA 3FJ2A 2L3MA 3GPAA 4WFYA 3ZNJ1 4DL6A 3UCUP 2HBRB 2VQEJ 1F60B 4OZNA 1AUDA 1RKIA 3D7SB 3C16A 4NA1A 1CLFA 3GIRA 1MLAA 1U1NA 1MU2A 4RNNA 2DR5A 1PBAA 2D74B 2FHJD 1NLKL 2B4UA 3FBEA 4B9VA 1LNQA 3SQOP 4ZPWR 2MHNA 2HHXA 1HHTP 1Q82T 3K0JA 2LFVA 2WVDA 2F5GA 1RXOB 3E01A 1DY3A 1NHUA 2H9ZA 1DTQB 2FD2A 4KGXB 1VRQC 3MAAA 3W8GA 3KLGB 1EETA 1S5ZA 3HZEA 2UXDJ 1KHWA 2H5JB 4IG0A 4K8RA 4J9VA 1S1UB 2QA4G 4DQIA 4C9DA 1HIYA 1UEKA 2CPXA 1JLEB 3KMSA 3E3XA 3GSIA 4DJBA 1Q7LB 5L46A 3TAMA 1T95A 3BR9A 1RQ0A 5MAOA 3TZZA 3B4DA 3VAFA 2D3O1 4ILLA 2HQIA 1AZSB 4H4OA 5E3PA 2YPYA 4I2PB 2V8GA 4KH1B 3GYNA 3QAEA 2R7QA 2DH7A 3Q23A 1M1GA 1YZ7A 3TO8A 5HN0A 3RTVA 2I8EA 2FY1A 1S9GA 2AEJA 1ZAXA 3Q8YA 4RBUA 3RW6A 2B5JA 1SUQB 3CCWA 4Q8EA 3HHLB 5ETKA 3D4JA 1LXNA 5THWA 4ZIWA 4J9UE 1NK9A 1S76D 4FKYA 5KT6A 5L1JA 1HNXJ 1Q8KA 1UFLA 4ID5B 4ALZA 5GAEI 2R8GA 3WHIA 1B7YB 4TY9A 2RMLA 2RUGA 3FDSA 5BYQA 4DXLA 3D6MB 1S4EA 5AJ3J 1JK9B 1WEXA 2B8QA 4PPZA 4RW6A 1TK5A 4B3MJ 4DSIA 2KYXA 2AWZA 2R4FA 4CZCA 4AL7A 3OSPA 2EFPA 2Z58B 2DRDA 4CYUA 4QU7A 3G6VA 1TU0B 1WEZA 2OP5A 4IYQA 2C42A 3QRQA 1U6FA 4K2JA 4G3IA 1T7PA 5KT5A 5DZ7A 4QWBA 3RGIA 2CNKB 2OSQA 1HBOA 4C7QA 1N32J 1F6TA 2YX1A 4I67A 4FVMA 3HX9A 5AE2A 2VIHA 1VQYA 2IJNA 1FXRA 4O4GA 3NY0A 1IKWB 2BJ8A 4JYAF 3TX0A 2L9NA 1X9SA 1W25A 3U1MA 4WZMA 3V5RA 3HKWA 2O01C 5ETVA 3OT9A 2C2ZB 4I2QB 4MK8A 3V6KA 5GADI 3IR7B 2UP1A 4KGZB 4ECWA 3GYGA 2Z57B 4ZHRA 4PQAA 4NWBA 3CF5Q 2QFIA 1P6TA 3PFOA 5A76A 1TL5A 2V8HA 1ZA2B 3KLFA 2ZH1A 1KFSA 1IQTA 5ITHA 1UEVA 2DKOB 3DXBA 3EVOA 3PRDA 4NLSA 1VQNS 1FKOB 2QMWA 2HGLA 5G0RB 3GIIA 2G2ZA 1NCLA 4X4VA 3HLUA 5ETRA 2CWXA 4LFBF 3MUMP 1ZYQA 2EFOA 2LKZA 1F9EB 4KFBA 3F0NA 4NLTA 3UFCX 3BYRA 3BF4A 1RBAA 1RA7A 3AJDA 3G6YA 4RUBA 1S4FA 1DFDA 2EC2A 3JTOA 2DNHA 1NK0A 1MMLA 1NZ8A 4KRWA 4P2FA 5LL6d 5RUBA 1NJXA 3MWBA 2PT0A 3MTJA 2CZ4A 3ZTPA 1S1UA 1ZM4A 4DL0C 2HIQA 1P27B 2BOAA 2XGQA 3DOMA 2C2EA 1IKYB 2KHDA 2UUTA 4I4BA 4FN5A 4TNOA 1FWLA 3LO3A 3OXLA 4GVLA 4IDKA 4U9RA 2KG1A 3NAHA 4ZPTR 4YY3J 2DGQA 2ADBA 1SH2A 2C28A 3NWGA 2FJDB 2OGUA 3CSKA 2MKHA 4YR2A 3SBMA 2M52A 3DOKB 3DOKA 1RU2A 4FDFA 4ES2A 1IN0A 4ZCLA 3NS6A 3BGLA 4HACA 4JV5J 1WKKA 2AKWB 1RWPB 2GMJA 3PJXA 4USVA 4XDDA 1R0CB 4RJVA 4DR5J 1TR0A 2ACYA 4YHHJ 4DX5A 3W2VB 1UVJA 1WI8A 2QA2A 3DOMB 2AT1B 4R0JA 3VTIA 4LFAF 1FERA 1VRUA 1QLNA 5JVGQ 1SUQA 4DCPB 3R6LB 1VOMA 1RI7A 1RT3A 2UUAJ 3WX4A 2OMOA 3A3NB 3PIPQ 3OLBA 1BLUA 1FDNA 1HBUA 1FJGF 2ZVSA 3VGVA 1S99A 3GV5B 2CDRB 4J9SA 3Q24A 2MZJA 2E1MC 2AMCB 5C25A 4ANDA 2UUAF 1OO0B 1D09B 2ROEA 2G0JA 1VQSA 2KL8A 4KFBB 3ZXWA 4DZ6A 3RBEA 2IDEA 2W4CA 2HQ3A 3B82A 3HFZB 3QYYA 2XS2A 1VJWA 2G1HA 3M6UA 4E0DA 1FKOA 2E9RX 4HT5A 3NEKA 4P74A 4K4TA 5KFAA 4JI7J 2E1CA 1U24A 3IBWA 3KJNB 1T11A 1KOOA 2BM1A 2HK3A 4RW4B 1RK8A 1B0PA 2BYCA 4JBCA 4JI0J 2EK6A 4M1KA 3PW5A 4IQXA 2APOA 4JI4F 5F8NA 4MYTA 4DV1F 3V81B 5K20B 3Q86A 3D6HB 2CIMA 3M30B 4CTAA 1WOPA 5KG0A 4YB7A 1O51A 4IDKB 4EO8A 2FYXA 4QPXA 3IGVA 5DQHA 4EU0A 3CTRA 2E1AA 2MKIA 2HVHA 1RAFB 2BW2A 4P7VA 3W2WA 2R2TA 2R8IA 3UD4P 4I7FA 1K44A 1I1GA 2FC9A 3IWXA 2UV8A 1RTIA 1S6UA 2E66A 4OZ0A 4DR1F 4IKAA 1N36F 1DBDA 2YNGA 2DH8A 2I38A 4RNMA 4N8NA 5L1KA 1OJ4A 4O23A 2R3VA 2FJXA 5H9EK 2LVWA 4DX7A 2V5HG 3Q8SB 3T1HJ 2W9AA 2IHR1 4DHVA 1U8WA 3GJTB 4EWTA 4EFAC 2FGOA 4CI0B 1RA6A 5A8KA 1TL7B 1FFWB 1T9VA 1XK8A 2R8KA 4JI7F 1XNQF 1GT8A 2XYHB 4JYAJ 2F8HA 5B0DA 1JJ2R 4EEYA 4F50A 2BMBA 1JLFA 2JOQA 2MSTA 4G1IA 5CYMA 4K4YA 3D6TB 1CULB 1S49A 1C1CB 2A2CA 2DNZA 2WVCA 4NRUA 4WPAA 2HQFA 3NXZA 1N56A 1LWCA 1REVB 5D0RA 1UPMB 4YR3A 1KVKA 1VIOA 3NBPB 2W2MP 2CPYA 2YNIB 3IM9A 5JXSA 2KM8B 2J76E 3KNAA 2WW4A 4WP8A 2VJVA 3Q83A 3BGFA 1HQEB 3R7SB 5IS2A 4PUOB 2IRYA 4IO9Q 1YJ9S 3GCWP 2IBOA 3DN9A 3GFXA 3DLBA 5J1NA 4OL8A 2WONA 4OZ1A 1MROA 4FPRA 2VOPA 2AX0A 4JUZA 4IH6A 2RDDA 5T41A 3AH6A 5G4DA 4Z7CA 3HD1A 1N33J 2IMWP 3DYAA 2L48A 1DTQA 2K8GA 4H4KC 1YDLA 3PNIA 2XMVA 2HVIA 3US5A 4IG3A 1XC9A 2POKA 2K2PA 3D66A 1QTNB 5CH7B 3VWSA 4CYUB 4DFKA 3JSYA 3ZZTA 2ZBPA 3I9V9 3Q2TC 4QR1A 1XMOJ 1JXEA 2RVJA 2BKOA 3ISZA 4DU8A 3VHQA 9ATCB 3LTOA 2NLWA 1IM6A 2QE5A 3BKFA 1HMVB 4QR2A 4BHQA 1G2EA 1FRJA 2LQJA 2QO3A 1M5SA 2WSEC 3MECA 1KONA 2HFSA 4AE5A 3PVXA 3OQ2A 3JXOA 2DNRA 2AZ1A 5HVHA 4ZVRB 2VG6A 4E2FB 3HMJG 4ECZA 4DF4A 4NXMF 1NO8A 3HHLA 1QE1A 3PM9A 5K8OA 2DNOA 4AXJA 4YDDB 3FC9A 3NS5A 1ZM9A 3MMAA 1C1BB 2QV6A 1T9XA 3DHWC 2C2KB 3W5YA 2XC9A 2BJ9A 3GFZA 4M5HA 1LK5A 5FDLA 1SJFA 4QW9A 2V2VA 4QIVA 4C4WA 1HNIA 2C2DA 4FYYB 4IRKA 4FXDA 4X66J 1JKHA 3T41A 3UW1A 4F25A 2BXJA 3FK4A 3NOCA 4USJC 1VC6A 1RBOB 2IMOA 3GCXP 4OI4A 3T19A 1G3OA 4WKRA 4X2BA 4QWAA 5K8MA 5H9EJ 2ATLA 1DZ5A 3M2VA 5D6GA 4M5GA 4IRDA 4DN9A 3BSOA 3H4DA 1U2RA 2JL9A 3I32A 1GFWB 1X4HA 4OYOA 3J80Y 2F4FA 1CS4B 4HLBA 4XK8C 4LF8F 2MSSA 2OH2A 2GJFA 3QWPA 1SXLA 2JEIA 3UVJB 2ZKTA 1CJKA 2RKIA 2HHWA 3H20A 1Z1ZA 3QIPB 1OY9A 1Y00A 2UVWA 3KLIA 2LDYA 3W9HA 2VPYB 3FMWA 4Y2MA 1RUSA 2FUG9 2ZKUA 2BJ3A 2JLGA 3AB4B 2IM0A 5KG6A 4DX6A 1FA0A 2AEMA 2HVDA 2Z4PA 4C3KA 3AA8A 5B0CA 1TL3A 5C42A 3C3LA 3HHNB 2ZE2A 1SQGA 3X1LB 4Q0BA 4TYBA 4N5SA 2BZ2A 2GMHA 4OJ1A 2CFXA 4AUKA 2CJBA 4CLYA 2C3PA 1NKBA 4IR1A 2QSFA 1VQ9S 3HVTB 3VALA 1TKTA 3EM1A 5B0GA 4HTIA 2QYGA 3M8PA 1URNA 1FJ7A 1FRXA 2DJWA 2HW3A 3EZOA 2CPJA 2YWWA 3BPSP 3FZBA 4KYZA 1HNVA 2PN6A 3DCAA 4O3SA 2ZH4A 4WFBQ 2PMWA 3LA0A 3MFIA 2DGOA 1YJ7A 3FVYA 3GJRB 2YQ3A 5AJ3F 4DR7J 2XMTA 3MF5A 5JUMA 1C0UA 4F0HA 5HQLA 2XSFA 1OYEA 4F3QA 4CIOA 4OHVA 5JJBA 5A0YB 4LF8J 4YQWA 2CDQA 2J0WA 3MGJA 4NL5A 4OJGA 4ZJQA 1AXQA 3R27A 3BB5A 1SQEA 1XWLA 3K8VA 1J5EF 4TU8A 2B4PA 2GIQA 3G8QA 5EX0A 1FJCA 4GO7X 5AE3A 4RBTA 2K3KA 3NMAA 3D28A 4NLRA 4NXNF 5B0BA 2R2UA 3HHDA 2ADCA 3MM9A 2VL1A 3T1HF 1SL1A 4DR4J 3PHTA 5FDLB 2YKMA 4HEA9 3R3TA 4FVCA 4DS4A 3TARA 4WXOA 1MWQA 5KFYA 2DISA 2R8HA 3MOJB 3ENQA 1UEUA 3H42A 3OUYA 4JI5F 4M8LA 1FWKA 3BGUA 2ZE2B 3PHEA 3Q8RB 2XLIA 3MR6A 1Y3KA 3GR1A 4EZ6A 1AA1B 1FDBA 1VC0A 2Y1LB 4PRFA 2XMMA 4EGLA 1RT4A 3DHXA 1IUJA 3IM8A 2LEAA 2PFDA 4U96A 4CM0A 2F40A 2JEGA 3R5GA 3NNCA 4JI2J 3OFGA 2XCAA 4N76A 3KHLA 2GQCA 4DR3J 1L3KA 2JHEA 3A12A 4ZS6A 3TW0A 2ZM6F 5JVHQ 2ZWOA 4RBVA 2D1CA 2BJDA 4KSEB 2BE2A 4BLGA 1Q0NA 3M32A 4Q7AA 4UZCA 5F8GA 3P49B 4ES3A 3I55S 2DB1A 5J2MA 1FO1A 5SZTA 2IFXA 3IC1A 2FHOB 4PR6A 4A8OA 1BWVA 2F9DA 2VPXB 3CCRS 1TKXA 2IYIA 2G4BA 5C24B 2HGNA 5KG5A 2QA4S 1D9DA 3AHPA 2J6UA 2LYVA 5M2PA 1KDNA 3MM9B 2P6TA 3I87A 4N77A 4OYZA 4CDIA 2DYAA 1S10A 2HPUA 4GKKF 1L5UA 2FJVA 1GMVA 5KOWA 4A46A 5DDOC 3MPVA 3ITHA 5KG1A 2H65B 3TR5A 1NHKL 2Q1LA 5J2MB 3GIJA 1YWXA 3BO3A 3N0VA 4IRCA 3NGTA 5CA5A 3OL7A 1WHYA 3MECB 2WBMA 3BV8A 1BMQB 2AF6A 1JJCB 2XI3A 4MIAA 5A0YA 4Y6IA 2UUCF 3OFHA 2B3TB 2ZUGA 3BN4A 4ZPDA 4DFPA 5FLXY 2O67A 3U27A 4WE1A 3SV4A 1A7GE 1JIHA 2DO0A 2IRUA 2OI2A 1HWLA 2DEIA 2W4DA 1IKXB 3D3CJ 4FNHA 5T7LA 3LALA 3FUYA 2HRYA 3LH2S 3IO1A 1Q8LA 3O6QA 3S8SA 1AFIA 3H5SA 1IJEB 5D4LA 4YY3F 3R5BA 4PG6A 4LQ3A 3I4PA 4DMZA 1WTBA 1JLAA 2MZTA 4DR1J 4YMEA 1NSPA 1R31A 2IC3A 2V2KA 5KOXA 1RP5A 1NSQA 3F73A 1O8BA 1TL4A 3N5BA 4RWWA 2N3OA 4C8ZA 4NPOA 2QLJB 1YJUA 3DDNA 3DRRA 3O3LA 5ETQA 1UETA 5GMEA 5KG4A 3H59A 3JQMA 2VHGA 4ZVOB 3GILA 2HHHJ 4HR2A 2WK4A 2KFZA 4DPUA 1YBAA 1QSYA 2W7OA 4CO4A 3D2WA 2GV1A 1XN9A 2KYZA 2ZH3A 2FB0A 3ADAC 4LREA 1HA1A 2RQKA 4C48A 2VBXA 3R2DJ 3UDLA 3OJSA 2ZH6A 4OZ2A 1LK7A 1EP4B 1A9NB 2FZCB 4RW4A 2VICA 1NK5A 2J0SD 3FQLA 1VQMS 4B3TJ 2M9KA 2XTJP 1CS4A 1Q79A 1F9HA 2ILYA 4OI1A 2RDJA 3KUEA 3CJSA 4WJBA 5A6PA 1YJTA 2B51A 3OHBA 4EZ9A 1U6BA 2AJ0A 1LWEA 1S1XB 4O3NA 3RU0A 1WHWA 2WB4A 4ZP9A 1S12A 1N5TA 4K0KJ 4DL7A 3M8QA 1RTJA 3K5OA 2C3UA 1UW4A 3LP0B 5IQ6A 4G1PA 1SV5A 1RAGB 2BE9B 3NMRA 1NDPA 1C1BA 4ED7A 2L9WA 3SFUA 2VJUA 4M5DA 4DG1A 2NYHA 4OV1A 3H2VE 3VAIA 2OEKA 2EFNA 1U47A 3R5DA 2HLUA 4WIIA 1RCXB 2CQPA 3PYEA 2OPRB 4P6QA 4TKTA 5CQGA 1CC8A 5HAOA 4DR5F 5JMNA 1P1TA 2OPSB 2MXYA 1N32F 2MJUA 1TL3B 1DLOB 1RHMB 5ADZA 4NLQA 5AT1B 1HQUA 4MIBA 5IQQA 1D8ZA 1Q5VA 3BREA 3UQSA 2E9TA 4KV8A 4A8KA 4H4MA 1T9TA 3NGRA 3AA9A 1SCJB 4G6VB 1MSWD 1CJKB 2WB1D 3H40A 4D3GA 3KG4A 1EHWA 1VHFA 4ITSA 2CJKA 1HW8A 4C8KA 1R6YA 2ROPA 3EMTA 4FS2A 5HROB 1TK0A 1T03A 4C8MA 3ZTQA 2HAIA 2OPPA 3L9ZA 3M2UB 2GGPA 1RT1A 3EX7B 4UOGA 4A47A 1OWXA 3FCWA 1S59A 4DSLA 1FX4A 4B3OB 3A8IA 3CCJS 2LEBA 1JWWA 3ETOA 1DTTA 2CG8A 2RF2A 3I96A 2XYGB 2EFQA 4PYDA 5C25B 2HBYB 1VQPS 2YH0A 2G1DA 5KFKA 4NA2A 3EZUA 5CCMA 4OHXA 4X4RA 5HVGA 3J81j 1P1LA 3G82A 1RTHB 2CJAA 2CUYA 2IJRA 3P4UB 2W8KA 4OYAA 1OPIA 2ZOMA 2R7RA 4CM2A 1GX5A 1U25A 1JLQA 3H7HB 2CADA 2QT7A 1QJHA 4RR5A 2DK2A 3H0PA 4OJ3A 4WBFA 1F5CA 2VG6B 4C6AA 4DBQA 4WP3A 4UOCA 1JLGB 5KTQA 4EBDA 2ZDOA 4Y0FA 4MK9A 3GQCA 1FVSA 4GMKA 1NB2A 5J2QB 3G6XA 3QGIA 4QPTA 4NLYA 1FFGB 1VC5A 4WFAQ 2DNMA 2VKRA 4ED2A 4ED3A 1RAOA 1RT5A 1XIQA 3CJ0A 4OFZA 4F3OA 1YSJA 4UZBA 2QLBB 4EBEA 2B0GA 4BWJA 2YBVA 3GE9A 5A8RA 1TP7A 2OFHX 3IP0A 1UA0A 2MHEA 2V4QA 4IG3B 3K7RA 3NGDA 2N4DA 2G13A 4LFBJ 3MPUB 2E44A 1UVLA 3PYFA 1FXLA 4DOZA 2GHPA 3KWMA 3KXDA 3ENVA 4YB5A 1IKYA 4ZVEA 4WWSA 5AXMA 2AYMA 3NL0A 2JRSA 1IKWA 2UVVA 3DU6A 3LPEA 3NOGA 3Q8QB 1NK6A 2O3DA 3C15A 3T3FA 1TUGB 1I5OB 3Q22A 2WONB
chains in the Genus database with same CATH topology
2MQMA 1YTYA 1F9FA 2LXUA 3I0RA 2ZITA 3NCPA 1HBMA 2J0QD 2B9WA 1TK8A 4Q44A 2BRLA 1V3ZA 2DNKA 3SZ2A 4FF1A 1DRZA 2YNFB 2W9BB 1SB6A 2R8JA 5IZHA 4B3MF 3PFEA 3QO9B 4X62F 3T5KA 1RJJA 4OZJA 3V81A 1U1KA 5EN1A 3N01A 4CO5A 3EZ5A 3KG0A 3MEDB 7FD1A 2ZZMA 1FNMA 1KRPA 5G0RA 3IWNC 2PIIA 3NLCA 3DRPB 5E3CA 2JLEA 2FHJA 1QSLA 2MQLA 2PE8A 4MTPA 4QIFA 2KO1A 3DDKA 2XO7A 3M8SA 1F5BA 1GNKA 2MZQA 3SSSA 1N6QB 2AW0A 4ZHRB 4Z2XA 2AJ4A 3LGMA 1URRA 1NNDA 1Y0HA 2ZNYA 4LIRA 1UL3A 2KT5A 1DURA 2JSXA 2B9XA 1JNRB 5KFHA 2A18A 3EPIA 2XHWA 4HH0A 2P9CA 3FGVA 4PWDB 3KLEB 5LSOA 2A1BA 4L3NA 4KO0A 4OX6A 1VQ5S 4IR9A 2PMZD 1N48A 1HHSA 2VPZB 2PA8D 4B3OA 3DRXA 1YJNS 2LMIA 4V19J 4ECXA 1F2GA 5E3AA 1FXDA 1QUVA 1FD2A 2KXNB 1YI2S 3TVKA 2J0XA 5E7OB 1VI7A 3PR5B 3H5UA 5D4OA 3I0SA 2DR7A 2D41A 4A48A 4BC7A 2RD5C 4CTAB 1S9EA 1GX6A 5HI7A 4RW6B 2G0CA 4TY8B 4TY8A 3NG8A 5KFVA 3BO2A 1ZM3A 4A8QA 2CQ3A 4RW9B 1X5PA 1K1SA 2J7WA 3F56A 4LQ9A 3SMZA 4ILRA 1HQUB 4GKJF 1TVRA 2ZHBA 3I0SB 1N5QA 2C3OA 3CC4S 5D4NA 1OSCA 5J2QA 2DGUA 2JZ5A 2Q3PA 4RNHA 4EBCA 3BSAA 2D3UA 3OR2B 1S9GB 2B4VA 1RTDB 3WC2A 4KT0C 3TYTA 3TRGA 4DSFA 2M3DA 1LKZA 1G1XA 1BGXT 4IO1A 1NKEA 4JI2F 2IRXA 4F8RA 3CJ2A 3BJYA 4B17A 1T05A 4JI6F 4X4PA 4HHJA 3VQSA 5DLGA 4F4WA 4NYPA 3R5CA 2CQ1A 5DG7A 1V3RA 1S1TB 1N34F 2IVMA 2WHOA 4U6PA 3GB0A 4NLDA 5F9LA 2GHVC 3UR0A 1JLBA 1S72S 2KVIA 2MY7A 4I68A 4QZVB 1LFPA 2XB2D 1ZPVA 3E8OA 4L72B 1U26A 4ZVFA 1MU2B 3UWTA 3ENWA 3G4SS 2VV5A 2CPIA 4X4QA 4H54A 1B0VA 1T3NA 2GCFA 2XSJB 1YIJS 2X3GA 1DLOA 4K4ZA 5F0UA 3A1YG 5DRKA 4QCLA 1HPZA 1MWYA 2XMWA 4HKQA 2VH7A 3DRRB 4O4GB 1Q78A 2O66A 4A8XA 4KO0B 3MUTP 2IC3B 1KLMA 1CSJA 4LIWA 5K9FA 3JYTB 2OKQA 2DNYA 1NK8A 2J8AA 2M0GB 4WU2A 2V94A 3J7ZT 3MI7X 2K7KA 3TUIC 1SJQA 3M8QB 4OMFG 3MURP 4LF9F 4NCAA 4J37A 2DBBA 2MQQA 1HWIA 3GZ7A 1KR4A 2VG7A 4NCGA 2HHHF 4Q45A 1PC4A 2KZZA 3TOQA 2FGCA 4FBTA 2P5VA 4HI1A 3OXGA 2IA0A 3BN7A 2HNDA 4KJIA 2HHTA 7FDRA 3J7YU 3DFEA 5E33A 3I5CA 3ULHA 3U7JA 2XCPA 1TQLA 3HKZD 1YRTA 5HBMA 1FRKA 2UZAA 3NCRA 4FXVA 1QVGR 1WD6A 3MFHA 2YTCA 2MQPA 2W9BA 2FLPA 4IH7A 2NS1B 3V4IA 1SJ4P 3J81Y 4OHWA 3UPFA 1YG0A 3T5LA 3DLEA 3IWLA 3QWUA 5E0OA 4OIXA 4U7CA 1HD0A 3JSMA 5M2RA 1G6BA 3NCQA 4KKOB 2FVQA 4J9OA 1HNWF 1JLAB 4OZLA 2W7AA 5HROA 5KFWA 4XDCA 1D0EA 3FSXA 5FIIA 4NLGA 1S0VA 5A6WA 1U7LA 5F8MA 2O1PA 4KR0B 2UV8G 3HPOA 2PD1A 1Q16B 3RRGA 4X66F 2BQUA 1XMQF 4FBUA 1WEYA 2AV5A 2CQCA 1RT4B 4IUFA 1JJ4A 5L9XA 4ZPBA 5KFLA 4OZ5A 3CCQS 4DLEA 4TQSA 2CQHA 2MKKA 3FFIA 1XR5A 4QWCA 5T14A 3KLHB 2B43A 2DHAA 2J9DE 4M5DB 4DG1B 2IYGA 2NUHA 4I56A 4A8FA 2E9ZA 3OXFA 5J1EA 1WG5A 3ISNC 2GO9A 5IT0A 1SV5B 2HVZA 3BM7A 1HWUA 1RTHA 3HHKA 2YKMB 3RR7A 1VQ4S 4I2PA 3PKMA 1XMOF 1Q53A 1FVQA 2CJ9A 5D77A 5E3RA 4X4OA 1JLEA 2RS8A 4YEAA 4F4ZA 2YX4A 1VQOS 2M2BA 2HMIA 4IG0B 3JSRA 2FVCA 3D0GE 3M32B 3N79A 3CDWA 2KN4A 3LQVA 3BQ1A 4DL5A 2FLOA 2RIJA 3UDCA 5H9FJ 4OLPA 1VBYA 1J5OA 5FJ4A 1VK8A 4N56A 3TX8A 4M94A 4F02A 2ZHAA 2MDAA 1KHVA 3I9ZA 3MMCB 5B09A 2J5AA 3I82A 3CDUA 3MOZA 3N5FA 4G1QB 4L6V3 4J9NA 1M5KC 3C46A 3CDEA 1LW2A 2VG5B 4R0EA 1HL6A 3ZZPA 2UXDF 2E5GA 4X84A 3DM2B 2FVPA 1O5JA 4HYKA 3IR6B 1T94A 2GQ2A 1S48A 4KAIA 1S1WB 3HT3A 1MMDA 1QSSA 1FEEA 1QY7A 1R3NA 5CZXA 4NZ7A 4MJKA 3GV7B 3VAJA 1D1UA 1QAIA 4B9UA 1FT8A 1NK7A 4QOTA 2ZOFA 2F7VA 5HL7Q 1IM4A 2XI2A 3FEXB 2EFGA 2J9CA 5K8NA 4Y2AA 3VR1A 4DQPA 5IWAF 3OV7A 3PW7A 2XY7A 4WF9Q 2CQ4A 1NJZA 2MQNA 2EK1A 3D0IE 1A6LA 4YP3A 4ZDNA 1VMBA 5EDWA 2FLLA 4A8YA 4JV1A 3QAUA 3VCDA 2N7CA 4Y00A 4NZ6A 3EXCX 1ROFA 4EO6A 3M05A 1NHVA 3H2LA 1ZZFA 1TKXB 1VQ8S 3DM2A 1MNEA 1TUVA 2UUWA 3MAHA 4ID8A 1M90T 1B7FA 3SDEB 1S0OA 3CJKB 2IM3A 2XWXA 4KHRA 4K2XA 2W9CB 1CC7A 4WFNQ 4DV4F 2KU7A 5LXRA 1LQ9A 4URQU 3CCMS 4I6AA 1KNZA 3C8YA 3PW4A 3QGGA 3KHGA 1UJ6A 2VFVA 3CCUS 2MZRA 5C42B 3CEDA 1HMVA 1X5OA 1ZM2A 3ISND 4Y2KA 4IOCQ 3O8WA 3AJ2A 3CPWR 2GJIA 3MMCA 1WHXA 3MM8B 4DEZA 1N5YB 5GVQA 3PX0A 1D9FA 3SSRA 2VFTA 3DLJA 3RB0A 4LVOP 3CJ5A 2VODA 3CT9A 4MH8A 3TP2A 4DSKA 3FSIA 3IA0A 2BBEA 1UKUA 5KFRA 4ED8A 4ETXA 2DRBA 3OVBA 2M5YA 1FKAF 2LU1A 2JFDA 4TU7A 1AROP 4KKOA 2LDIA 4WYWA 3ITHB 2HZCA 5HMXA 5BR8F 2OIHA 3S01A 3S1TA 3PJWA 4YHHF 1GH8A 3SDEA 4JV2A 1RYRA 3G86A 4ZP8A 2DD8S 4B9NA 1FK9B 2F8EX 2KT2A 4KC5A 4LF7F 2SXLA 4IFVB 4FF2A 3KK1A 1CQNA 2ZH8A 1NJIT 4W90B 3HP6A 1T02A 4OI2A 1JWWA 1OIAA 5IM0B 4K4UA 2RH3A 3OW2R 2WRMA 3VAGA 3JTNA 2DRAA 1K8AT 1KEKA 5HMZA 2N3LA 4EYHB 1R8BA 5E41A 1KTQA 2PSZA 4PQUA 1TL1B 2EVZA 2DIUA 3CMAS 5DG8A 4O3PA 3H25A 3E51A 4JV5F 2XZWA 3KK2B 2C22A 3MMBA 1UA1A 1N5YA 1W2IA 2AGQA 5AXKA 2IAJB 4NMLA 5HP1A 2FJAB 3O44A 4MYUA 4O44A 4ZA1A 2VA2A 2CQDA 1YGYA 3CDAA 3T1AA 3ZFVA 5EWEA 3SSQA 4ED1A 2HWIA 4B08A 2R7VA 1V9OA 4B3TF 4WFZA 1YJRA 3HVWA 2BQ3A 2P6SA 1M5VC 2RT3A 4O3QA 1RDRA 2MB0B 3THVA 4DL4A 2OAUA 3MD3A 4HH1A 1UVKA 2HWTA 2XSJA 4BC9A 2J7KA 2MPUA 2PI5A 4OHYA 1AW0A 2JFKA 4RU9A 4HDHA 4CO0A