2GGPA

Solution structure of the atx1-cu(i)-ccc2a complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
73
structure length
73
Chain Sequence
MAEIKHYQFNVVMTCSGCSGAVNKVLTKLEPDVSKIDISLEKQLVDVYTTLPYDFILEKIKKTGKEVRSGKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metal homeostasis factor ATX1
publication title The Atx1-Ccc2 complex is a metal-mediated protein-protein interaction.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone, metal transport
total genus 20
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ggpA00
5B0DA 3KG0A 3T9NA 1S6OA 5B0CA 1FESA 1FVSA 2AJ0A 2AW0A 3HF5A 2QIFA 2QLXA 1FD8A 3HHLD 4U9RA 4HI1A 1Y3JA 5F0UA 3IWLA 2FIUA 3FGVA 2N7YA 2K7JA 2KKHA 2KYZA 4ZOSA 1MWYA 1TZ0A 1U7LA 2OFHX 4DL0C 4OJHA 1QUPA 2LXFA 2OFGX 3F44A 1OQ3A 3I9ZA 3BR8A 2QYCA 2ZDOA 4OJGA 2PD1A 2HQIA 5B09A 5A6WA 2BJEA 1N5TA 1URRA 3BGUA 3FMBA 2GFFA 1AW0A 3IWXA 4HH1A 1TL5A 4OJ1A 4NPOA 2ROEA 1AFIA 1YJVA 2K2PA 3BM7A 2JDJA 4HH0A 4OIXA 1ULRA 2XMVA 2ROPA 2GA7A 3CJKA 3TRGA 4YDXA 5KAKA 1FE0A 2OKQA 1OSDA 2XMTA 1X8DA 1YRXA 3BB5A 4A4JA 1SI9A 2ROGA 3TOQA 3DCAA 1X0PA 2W4CA 3HHLA 4QOTA 2CRLA 2BBEA 2XMWA 3DXSX 2OD4A 5B08A 3KKFA 2IYGA 1WD6A 2K1RB 1YG0A 2FB0A 2W4PA 4NL5A 2GO8A 2OP5A 5B0BA 2ASYA 1TL4A 2IYIA 2LQBA 1YJUA 2ACYA 1FEEA 4FNIA 1VQYA 2PGCA 3BDEA 2K7KA 1Q53A 2RILA 4A48A 1KVIA 2N4DA 2HLTA 3E8OA 5B0GA 4DPOA 2ZDPA 3HFKA 1Q4RA 2RMLA 1MWZA 4Y2KA 1TR0A 4YEAA 2RU9A 4Y2IA 1XBWA 2BUNA 1OQ6A 5T7LA 1FE4A 2GV1A 4F67A 1GXTA 1K0VA 2GGPB 1KQKA 3WDOA 4Y2MA 5B0AA 4Q2MA 1N5SA 1N5VA 4A47A 1V3ZA 1FVQA 1P8GA 2L3MA 2OMOA 2Q3PA 2FTRA 2FHMA 1IUJA 3QGPA 3LO3A 4A46A 1CPZA 2W4DA 1JWWA 1GXUA 3TNVA 1SB6A 3HDSA 3LGMA 3CJKB 2GCFA 3QMQA 1OPZA 1CC7A 2OD6A 3HX9A 3KG1A 3UDCA 3MZIA 1Y3KA 4OJ3A 3KNGA 3HHLB 1RJJA 2LDIA 2XMUA 2QLWA 1X7VA 2EW9A 1AFJA 1Q8LA 2AJ1A 1Y9OA 2VV5A 1N5QA 1TUVA 3BN7A 4HL9A 4ZA1A 3LGNA 2RSQA 1W2IA 1APSA 2HIQA 2BJDA 2LQ9A 2G9OA 2HFOA 1JK9B 2HFNA 4DN9A 1LQ9A 3K7RA 5B0EA 2GGPA 1P6TA 2KT3A 5IXUA 1KVJA 2OAUA 4Q2LA 2HLUA 1S6UA 1YJRA 2XMJA 1VQSA 3MCSA 5B0FA 5K9FA 4EFAC 1Q8BA 2VH7A 3HHLC 4FNHA 2N4CA 2BYCA 2XMKA 2K1RA 2XMMA 3BF4A 1YJTA 3FRYA 5F0WA 5A6PA 1R6YA 1SQEA 2IFXA 5T7LB 4HI2A 3VTIA 2KT2A 1CC8A 3GZ7A 1Y0HA 2AP6A
chains in the Genus database with same CATH superfamily
4PG6A 2BACA 4OI1A 1SJFA 1HBOB 1N0VC 2E7XA 2VFSA 1H38A 2EKYA 2A18A 5D0EA 4RW8B 2E5GA 1S49A 4KHRA 3VAKA 2E5LJ 1V9OA 4J9OA 2GAGC 3G6XA 3D28A 2DY9A 3UCZP 3UN5A 2VD3A 4ZDNA 5A8RB 4YR2A 1YG0A 3CUNA 4LIRA 5ETTA 2I0XA 1V5IB 2HS4A 4J9MA 3IM9A 5D0RA 3WHIA 4TN2A 3THVA 2A10A 2ALYB 5CCLA 3DHWC 3HKZD 5BYRA 3GG0A 4C9DA 5EHHA 4P2MA 4G65A 3W9IA 1OIAA 2YKPA 4DN0A 1JXEA 5MAOA 2ZOMA 5CD4A 2XS2A 2D3O1 4JI1F 1S9FA 1U1NA 3FFIA 3GZ7A 4DHVA 2IA0A 3RG6A 2MYFA 4LF8J 3TAPA 5ETLA 3W2VA 3PY8A 3NGSA 3WC2A 1U6FA 1S72S 3GCWP 3PCOB 1R3NA 3N9UC 2W4CA 2GMLA 1IM4A 2BVZA 2FPHX 1ACMB 4FN5A 3UN3A 4ES2A 1JX4A 4LF5J 2BV3A 4RW8A 3G8SA 3Q86A 2BKNA 4KBIA 5H1SV 2Q6BA 1NO8A 1JJ2R 4NRTA 4IQMA 4XPCA 4R5PA 3GJQB 4OZJA 3L7UA 1KQFB 2HAIA 1UZHA 3BSNA 1XWLA 4KR0B 5B0EA 4JV5J 5IXUA 1JLBA 5A8KA 2PEHA 3NCRA 2Q66A 3I0SB 3HP6A 3W7BA 1GX5A 4Y34A 1MROB 3QSIA 1FNMA 5KFAA 2OSQA 1YITS 2I8EA 2KN4A 1UEUA 2HVHA 3H20A 4IRDA 4IG3B 3CJ5A 2F5GA 1QM9A 3UVJB 4Z7YA 4BBYA 3UDVA 2IRYA 1RB0A 3RAQA 5E3RA 3CT9A 4X84A 4NXNJ 2OPQB 1T95A 3CNQP 3BO4A 3TZXA 1M5HA 3H7HB 1CJTA 4Y2IA 1Y5IB 3K8WA 1W2BR 4JV0A 1GAOA 4I7FA 4PQAA 2OELA 2DJWA 2OPRB 3TI0A 1LFPA 3HX9A 1X4FA 2CNKB 2ALZA 2DR5A 2B5JB 4YHHJ 1X7VA 3P45B 3QYYA 3IGNA 4BDPA 2GVZA 4USHA 1U1LA 1AZSB 1IN0A 3EPGA 1P6TA 4X4SA 4ZPTR 3B8HA 3CF5Q 3ZZPA 1OSCA 2ZM6F 1RLCL 1EX8A 4J9UE 5AE1A 4JI0J 2AQ4A 3NS6A 4A8SA 3ENVA 4I68A 3JSMB 4DQSA 4CO0A 3DRPA 4JI5J 5J2NB 2OKQA 4RBTA 1WG5A 2RNEA 4PPZA 2VL1A 3MECA 2P8IA 1MROA 3PW5A 3C14B 4NA1A 1HNVB 3OLBA 1LK5A 1Q16B 1L3SA 4KKOA 3MPVA 1D9FA 3DRSB 3OR2B 4ZVEA 1N34J 2KL8A 3S1TA 1TL3B 2GGPB 4FS1A 1TKDA 3UVJA 2H65B 3PYGA 4MFBB 5KFGA 2VODA 4YN3B 1VQNS 2R8JA 2W1BA 3CULA 1X9MA 4DMZA 3JSRA 1HNWF 2V2VA 4DV3J 3VVTA 2RRAA 2OPQA 3M6XA 2AJ1A 3MOJB 2VFRA 4TY8B 1RT6B 3ZTPA 2XULA 1RA6A 2DCUB 2JLEA 2QEXS 4ZS6A 3GR1A 2EBGA 3Q83A 2WVBA 3OHBA 2X1GA 2PMHA 5KT2A 1MWYA 2RH3A 4NYOA 4DV4J 3GE9A 1AW0A 4K7QA 3PR5B 2M8DB 1AFIA 1RAEB 1BQNB 2YKMA 2ROPA 4B3SF 3KLEB 2AYGA 1P9QC 4HYKA 4CTAB 1U0HA 3LAMA 4WXWA 2R7RA 3OHAA 3AH6A 2KHDA 1NU4A 4F4ZA 5J2NA 5ETNA 3TYTA 1HLWA 3CC2S 4WE1A 1JLAA 3LP1A 3BR9A 3QGPA 3C14A 5HVHA 1CQMA 3NXZA 4LR9A 1WOSA 3KWMA 4DR7F 4F7VA 1AUDA 1MMLA 4ZCLA 3IS9B 1RTJB 5F8MA 2J76E 3T6JA 1RZMA 2N3LA 2WTFA 2RQCA 1N0UA 1QDUB 1TL3A 2GGPA 2XMJA 2FJVA 4O3QA 3OUYA 2MGZA 2W01A 2B0GA 2Y8WA 4ECVA 4CO1A 4C3LA 3QWPA 3K8VA 3MM8A 3GG1A 2Z30B 3TJ9A 2NZ4A 2APOA 4ED2A 3NP5A 1BGXT 3SSQA 4AFFA 5HP1B 1VGYA 4CO3A 4DL2A 2HQIA 5DQHA 2EK6A 1Y7PA 2M88A 1TK8A 2OEJA 2QA4S 1JNZB 1D0EA 1CEZA 1F3VA 4LRBA 4H4OB 5KT6A 2YH1A 1BY9A 2LU1A 1PJ7A 1KVIA 2HHVA 1HNXF 1IJEB 5J2QA 4U7UK 2QFJA 1LW2B 1HNZF 1XBWA 4ZITA 1UFWA 1BQNA 4ZK7M 2ZH5A 1FF2A 3H0PA 4HDGA 3EYZA 1W26A 4O3OA 3THPA 3CO9A 4DBQA 1NDPA 3HLUA 1ELOA 4OX8A 4CTAA 2V4JB 1HWIA 2MKSA 2XLJA 2VJUA 4RR5A 5HQMA 4UF4A 1NAQA 1Y9OA 1REGX 1F1BB 5H9EK 2HFOA 4WIIA 4UZCA 1LQ9A 1WJ9A 4RUHA 1Q8BA 5FLXU 2MSSA 2IFXA 3NOCA 2IAJB 3EUNA 2V69A 3LA0A 2OJ3A 3IS9A 4TU7A 1KOHA 3J81U 3D6TB 3RBXA 1VDHA 3I9ZA 1U48A 2DNQA 5HLFB 2HFSA 1Q8KA 4ID8A 2D9OA 1NK5A 1IR2A 3SQGB 1ULRA 4ED3A 3U1MA 1FWLA 3C46A 4L73A 3ET6B 5D6GA 3RW6A 1OSDA 3ZNJ1 4DL6A 3VAMA 1NUEA 2ZOGA 3WIUA 1HWUA 4WJBA 3KK2A 4ED8A 1XNRJ 2XO6A 3MPYA 4P2FA 2MQLA 2UZAA 1Q4RA 3CVKA 4F4XA 1G2EA 2U1AA 1X5SA 4DV7F 3NL0A 4RW7B 2F7VA 4ZLLA 1H6KX 4KPCA 5FJ4A 4TYAA 1VIXA 2X3DA 4AT1B 3MAQA 5KFNA 2KHCA 1WI6A 3DLGB 4QQBA 1UKUA 2KRRA 1LW2A 2CZ9A 3KJVB 1SJQA 2W7OA 4PYAA 1I51B 2HVIA 2K8GA 1DQ9A 4LRDA 5IC4B 4F0KA 4UOFA 2BOPA 3OPKA 3J7A1 2IDLA 3OFFA 1ZTTA 2GHWA 1Y3JA 2E1AA 1F9HA 2NUHA 3OW2R 2VFUA 5I3UA 2K06A 5CA5A 4WCEQ 4LSNB 2RF2A 4X4QA 2IAJA 1H2VZ 2YWEA 3O44A 1VRTB 1ZS6A 5FDLA 2PMWA 1CVJA 2IYIA 4PG8A 2DISA 1FDDA 3E8OA 3CCWA 3K17A 2I9SA 2L9NA 4I6YA 1U1KA 3SQGA 4Z37A 3DOKA 5FLXY 2HGLA 2XQCA 4NI2A 2NXEA 4F26A 3TX0A 2FJXA 2R7TA 4OZ2A 2YNHB 1IBMF 1JLGB 2EI5A 3J81Y 4DG1B 3O6QA 3M8YA 4HHHA 2H4YB 1HHQA 1HYSB 5IC6B 3DRRA 1RWXB 1RAOA 2WW4A 2OGUA 1A7GE 2AJQA 1DTTA 1FERA 3QZ8A 1SQEA 1JJ4A 2KT2A 3AT1B 1RWOB 3J7Z5 3H8YA 2DPJA 1BLUA 2FD2A 3DLGA 3KK1A 2YWWA 4Q0BA 4ZCIA 2ASJA 3AOBA 1HNIB 2NXNA 2V8PA 1DFDA 2IC3B 4MK7A 2DXDA 2XMTA 1SJ3P 4IG0B 1H2UX 1P9YA 1KSPA 5HVGA 3DLEB 3SQOP 3MGJA 5B0GA 4CLZA 4DQQA 3J7YU 1WC1A 1U2CA 1GMWD 2FDNA 2DY1A 2YWFA 4KO0A 1UW4A 3E2EA 4LSNA 1PYTA 3C6TB 1VRTA 2D3UA 4LF4F 2YNIB 3CCSS 2VG5B 3GPAA 3ILLA 3M2RA 2L08A 4IO9Q 1NKEA 3W8PA 2KG1A 2LDIA 4HACA 5AT1B 4MKAA 4HL9A 4OHVA 3LGNA 5DJBA 1NZ8A 3OVAA 5K8MA 2HQDA 2HEKA 2QSWA 4LJMA 1O6XA 2F4FA 3HXMA 2NSBA 1NH7A 3KG0A 2YNHA 2AJ0A 1U25A 2HWHA 1HYSA 1B0VA 2JC0A 3PYDA 2KZMA 5C25A 1NH8A 3IWXA 4TVAB 5EWGA 2BW2A 4UY8T 1CS4B 3N5BA 4QOTA 2W8LA 3KKFA 4NL5A 4X2BA 2B43A 2D69A 4D3HA 3BBFA 1HNIA 1RDRA 3R1HA 1F9FA 2IC3A 5AJ3J 2UXDF 3J81j 3R1LA 1MW7A 5E3PA 1K0TA 4ATNA 1DY3A 3MWBA 2FTRA 2DNMA 5E0OA 2F8MA 3OTEA 2ZJPQ 2AYMA 2L9DA 2R42A 2WONB 2Y1RI 1APSA 4DR2J 2E9RX 2J7UA 3C6TA 5U47A 3VZIA 5A0YB 3JTNA 2BW7A 4GKKF 2F40A 3HI9A 2YNIA 2W9CB 4I6AA 3CMQA 4KRWA 1XR6A 1S77D 3RR7A 5KG5A 2A1BA 3DM2A 1EB0A 3A3NB 2FJDB 3W8GA 4ENOA 2B4OA 4O44B 2ZKUA 1KKHA 4K5RA 1Y11A 2XGQA 1RK8A 2B4PA 1S1UB 1H73A 4NA2A 4LF9F 5CD4H 2CQCA 4CH1A 4KV8A 2FZCB 3AD9C 2YBVA 3R5JB 2B9EA 2BANB 2F1FA 3T5JA 5GADI 4NLYA 4QWDA 3KYLA 1V3ZA 3OTDA 4A8QA 3IRWP 3J7AN 4B02A 2MKKA 1VQ5S 2WZ1A 3ILOA 3LTOA 4NMXA 3TUJC 1RWKB 1HPZB 4LRAA 3CB4A 3IRXA 1NSKL 3CD5A 5C24A 2ZKTA 4WP8A 2W25A 5EUHA 2LXIA 4DPYA 3N6MA 3QZ7A 4YR0A 4DPTA 2VUGA 2DGUA 2VF3A 1OQ3A 2F4VF 4DV1F 2DRAA 1M5PC 4IFVB 4C2MA 3D2WA 4A4JA 1U2FA 3BDPA 3PEJA 2OHDA 1Q53A 2J0SD 3M6UA 3OFGA 4O44A 2J0WA 4C11A 2CQHA 2DGQA 3GP9A 2FJWA 2JEJA 1S1UA 3HVTA 3T1YJ 5KFSA 2QRRA 1JLQB 2BX6A 2ZC3A 2DIUA 3K2YA 3FBEA 5DZ7A 1OYEA 4RNOA 4X66F 5A8WA 2B8PA 4E8UA 4KGKA 2PEBA 3D9BA 5JJBA 4KPYA 4LF6J 5FIIA 1XERA 2BANA 1Y4ZB 2A0FB 3BV8A 3I87A 2ZH9A 4HT5A 3VZHA 5KT3A 4GKJJ 2RHQB 3KLHA 2JJ4D 4JI3F 4KGZB 1U1MA 2HQGA 4F4WA 1OY9A 1TKZB 3G8QA 2HZVA 1RT4B 3AD7C 1RT5A 4PUOA 4WP9A 2AJ2A 4I2PA 3MAAA 3GILA 5L38A 1E6YB 1LWCB 2ROEA 3R6LB 4ZP6A 2K2PA 4KH1B 1ZETA 2R3VA 4X4VA 4TLRA 3FQKA 1IBCB 1RTHA 4FXVA 1SH0A 4HEA9 2K1RB 3G71S 4P9SA 1JNRB 5J1EB 4EZ6A 1VQYA 3THTA 1UJ5A 4NASA 4JYAJ 5K5MA 2UXBF 2VC0A 1C2PA 3HFKA 1YDLA 4NYPA 1W7WA 1NJXA 2JFDA 3GMGA 1R27B 3MUTP 2VOOA 1EP4B 4A8YA 3CJTA 3HT3A 3GIMA 2B3TB 3T41A 2VDHA 2LXUA 1AB8A 4OI3A 3M32B 4RWXA 2UUCJ 2ZUAA 3M1VB 4JI2J 4IR9A 2IM1A 2PN6A 4B3MF 3VHQA 1DURA 5GAHI 3OFEA 2W7PA 1YHQS 2R2RA 4ECRA 1QSYA 4H4MA 4FF2A 1HWLA 3CWJA 3P4UB 4FF1A 3RW7A 1Q78A 4DCOB 1KONA 2C3PA 4EBDA 3SIPB 1NLKL 3OSPA 1GQEA 3KG4A 1YBUA 5HANA 4U8YA 4O4GB 4K4XA 1HI1A 2N7YA 3Q2SC 3SDEA 1VISA 3PFOA 1CJKA 4GO5X 1RT7A 4B9UA 1O5JA 1YVFA 4CLPA 1U1OA 2DNGA 1UPPA 2QFIA 4ZP8A 2CZVC 4DV5F 1TKZA 2HQ3A 1IKVB 1RT4A 2MZRA 3U27A 2GO9A 5B0BA 2MKIA 2CZ4A 1VLOA 1N8RT 5D0GA 3KDOA 4A48A 4FXWA 3KK3B 1QY7A 1NK4A 2GIRA 1WHYA 1LWCA 1UP1A 2AJ4A 3SFUA 4RUCA 2ZE2B 1KQKA 5B0AA 3UR0A 5J2PB 1N5VA 3PYEA 3T1HJ 1CPZA 2Y8YA 1S1XB 1HR0F 3CJKB 1EETB 3UD4P 1ZAVA 3OVBA 1X9WA 1WOOA 2NLWA 4A8OA 1EP4A 4JI8J 3MCOA 1XMQJ 1T02A 3I82A 3CIZA 4OI0A 1T3OA 1RABB 3IAS9 3CD7A 4C8ZA 3C2PA 7AT1B 2A6MA 3TR5A 3ZTSA 3M1VA 3BKUA 2YNGB 5LJ5Y 2W9AA 4ECWA 3QJJA 4F3MA 3NBPA 3IO1A 4N47A 3DYAB 1R89A 3FGVA 4ETZA 4P52A 1RAJA 1T3NA 2FZGB 2FUG9 2R7UA 4WKYA 2J6UA 3JB9k 2E7WA 4OYZA 1S57A 4L3NA 1JLFA 1FJEB 4XO0A 2JLFA 1FT8A 3DCAA 4CO2A 2ACMA 2MJUA 1I5OB 3S6EA 4ANEA 4O4GA 1DHMA 2IYGA 4JI4F 2IRUA 3GJTB 4JOUA 3WBZA 1ZH5A 2R7VA 1V3SA 1XNQF 3PJ9A 1KDNA 4QWEA 4J9LA 4A8FA 1FCAA 1VC5A 4OL8A 4Q2MA 5HI7A 1M1KT 2ZZTA 5M2UA 4QWCA 3MR7A 3RBZA 2R8GA 1TELA 3KK3A 5F9NA 1X5TA 2ADCA 3P96A 3G2XA 3FK4A 1UWBA 2NQPA 1H72C 3KOAA 3BH7B 2AYBA 2OTJS 2E66A 3H5YA 2VQEF 1EJ7L 5J2PA 1IBLF 1U26A 4HT7A 1DTQB 1R6YA 1C0UB 1S1XA 2QLFB 3SI8A 3A8KA 4EEYA 2CQPA 1DQ8A 5KOWA 4B3TF 3DGPA 2HYIB 5F8GA 1G4CA 3KLGB 2B9XA 5C5JA 2PD1A 2RDIA 1HQ2A 1RT3B 1SJ4P 4P10A 3V6HA 1SKRA 4YDXA 4RNNA 4BHQA 2MQMA 3CO0P 3GYGA 4QR1A 3N79A 1X4BA 5KFOA 1ROFA 1TL4A 1KQSR 2Y1JA 4OYXA 5IM0A 2JRSA 1SH3A 3RTVA 1PJ6A 1F60B 1RTIA 1GXTA 2VASA 4FYWB 2VPWB 3QQCD 1YWXA 1S1TA 3IGVA 3I31A 4M5DA 4QBUA 4EYHB 4UW2A 2OD6A 1UJ6A 1C1CA 8RUCA 2QO3A 3SBMA 4WXOA 3D0GE 2QMXA 4BWMA 1N5QA 2EEYA 4F3QA 1F5AA 3IM8A 4WWSA 3DLJA 4OZ0A 4DCPB 4OYMA 1VRUB 3K5MA 1WF2A 2MEWA 5A6PA 4WKRA 4HI2A 1VI7A 4LFBJ 5K8PA 3UCUP 4NEYA 3KLIA 3UW1A 1BQXA 2NXJA 3JS9A 4KC5A 1F2HA 1VQKS 4OFZA 4ZHRA 4ERDA 1FD2A 3PKMA 1Q86T 1FHTA 1N36F 2ZM6J 1B99A 3K59A 4EWTA 3Q23A 1IKYB 1DZ5A 3UR3C 4KGXB 3PW7A 4ZVUB 3RUBL 2C2KB 1YRUA 2M70A 3QPIA 3NRBA 1Q95G 3H5UA 5LMUF 2QL9B 4RJVA 5ETPA 5DG7A 4DSIA 2YX1A 1S6QB 1Q7YT 4CLYA 4QR0A 2ZEJA 1KFDA 2XS7A 1NMEB 3I4HX 4C0BA 1R8AA 4IH5A 2VA2A 3HPOA 3OLAA 3QT5A 4USVA 3R5BA 2UV8G 2UVVA 4FDFA 2HNDB 3DN9A 1KS2A 1VK8A 5DLFA 1GFWB 2N82B 1IR0A 4I1TA 2MZQA 2MLXA 4IFYB 5AXNA 1VQOS 1SL0A 1U7LA 5SUHA 2AX0A 3HFZB 4X62F 3K5NA 4WYWA 1U8WA 4J90A 1VRUA 3R27A 3HD2A 1HW9A 1IQTA 1RE1B 1RYSA 4LR8A 4MYUA 1ZBTA 3OL7A 2FHJA 3X1LB 2J7KA 1NPPA 2P9CA 4CP5A 1UCNA 2R2TA 1TL1A 4QIWD 2Y9HA 2ASYA 3D6HB 1A6LA 4ICLB 4AL5A 2HHQA 1MWZA 1RAFB 3BEGB 1LWXA 1F5CA 2ATLA 3Q8YA 2XSJB 1IKYA 4MYTA 3PIPQ 3ADAC 1JLCA 2CUYA 4DL7A 1IBKJ 1LFWA 1GEHA 1S6QA 2HIQA 1M5OC 4R25A 1K1SA 2CJYB 1S0MA 3NWRA 4IDKA 1SJRA 1WDDA 4FBUA 3KLVA 2G1DA 1SKUB 3MMAA 2QV6A 3SCKE 3CCRS 2BR0A 2BJ3A 2AHOB 4TU8A 2K7JA 2ASLA 4ES1A 3PKYA 5KFIA 1CJVB 5L8RC 9RUBA 3JAMU 5I4MA 2LA6A 3TO8A 1FRLA 3WIVA 2JVOA 1HIYA 3BJYA 1YJUA 1WC4A 1VS3A 3A12A 1KHWA 3WZ0A 2AD9A 3H40A 3ZC4A 2HPUA 5KTQA 2CPDA 4TQSA 1P8GA 3EGWB 1FX4A 1OYDA 4NXMJ 1HNXJ 4UZBA 2KH9A 4Y3CA 2DH7A 3CDAA 3CMAS 4LSLA 3POTA 5SZTA 1HNZJ 4EO8A 2HGMA 3BYRA 2KG0A 2OTLS 4OX7A 3TUPA 4X64J 2UUBF 3M30A 4DF8A 3MFIA 1T05B 2EFOA 2MQOA 4M63A 3BSCA 4USWA 4NRUA 5HROB 4N77A 1X5PA 1Q5VA 3MOZA 3R5DA 4G3IA 2QYGA 3FKBA 4M8LA 1TFYA 1T9XA 2DNLA 2VICA 1S1WA 4K4YA 4OJHA 3CCVS 3E01B 3SV4A 3EGVA 4EZ9A 2Q6CA 1MU2B 2LMIA 4PXDA 2OPSA 1N5YB 4J9VA 3MCNA 2GX8A 2B6AB 1BD6A 2NSCA 4LFAF 3PFEA 3MPWA 3UFCX 3AFGA 3EICA 4CQ1A 2ATCB 1CJVA 1WSVA 3MMBB 4IOAQ 1LOUA 2I2YA 4DV6F 2W2QP 4P7TA 2I6WA 1T7PA 2FLLA 2Y0BB 1RTZA 3MEEB 3TX8A 1N32J 1UWAA 4A8KA 1HHSA 4J9QA 2PA3A 1UPMB 4M5NA 3TQ1A 2O1PA 1PBAA 3G87A 3MAHA 4OZLA 3JAMY 4QW9A 2X1AA 2XB2D 2WHOA 4IOBA 2IMWP 1R8HA 5KFMA 4FVCA 4CLFA 2QLXA 3D3CJ 2V0NA 4NLDA 4AL6A 1KFSA 4PZVA 1S6PB 3HVWA 5LSLA 3RGIA 4PABA 2EFVA 2J7WA 3T19A 3M6WA 5C7PA 4ZLNA 1YJVA 2QN6B 4RU2A 3S7RA 1RISA 1X8DA 2VKRA 1G3OA 3FC9A 1Q82T 2R9LA 4DR3F 2C2NA 1KTVA 4S0MA 5HMYA 4WBFA 4LFCJ 4PXBA 2LQJA 4F2RA 3MI7X 3E01A 2B9YA 3A3OB 1MN7A 3G6VA 1CJUB 3KXDA 3R5AA 2ZH8A 2FVCA 5KFDA 1OQ6A 4OLOA 5CHCB 1V3RA 5AXKA 1HBNA 4LBIA 1HBUB 4FF4A 4LMZA 1SKSA 4A46A 4R0EA 2KDOA 1LWEB 3AA9A 2B6AA 8AT1B 4F4AA 3AOAA 3C3LA 4K4UA 2Q43A 3FVYA 5ADZA 4YUDA 2PT0A 1TAQA 4P7VA 5LMNJ 5T7LB 3MEEA 1Y0HA 1NK0A 3O5TB 1C4AA 2LQ8A 3PVXA 1U2RA 5F0UA 2DGOA 4E98A 1N33F 2OEMA 2B7CB 4PCQA 3H90A 7FDRA 2IBKA 4URQU 4DQRA 4EBCA 2G2YA 4G6VB 5KT7A 4QYZK 3R5GA 4M5IA 2CQ3A 2BJ9A 1K47A 3UO0A 2MLZA 4DFMA 1TVRB 2PA8D 1S6PA 1D1UA 3NS7B 5L46A 1N56A 4OZNA 1SKWA 3QAEA 1R8PA 1VBXA 3I96A 1XMOF 3A8IA 3W65A 3CTRA 3C15B 2Q3PA 2VG7A 5L1KA 3PX6A 4Y65A 1RLDA 2MZ1A 3M8SA 2GCFA 4I2QB 4WZQA 2LLZA 1S1VB 3AB4B 3JQJA 5HMXA 1DLOB 1CJUA 1X31C 2CAJA 3Q8QB 2XSFA 2KM8C 1MG7A 4LF4J 2EC0A 4LUBA 2BYCA 1FKPB 2VB6A 3RB6A 4O0IA 2C42A 2HS0A 1S6OA 1FVSA 1S7HA 2C2EA 3ETMA 3LP0A 1Q8IA 4RW4A 1FFGB 4W4MA 1RXOB 3G4SS 1XQIA 2XS5A 2RDJA 3N0VA 3M2VB 5AE2A 1D9AA 2WVDA 3DMJB 3D4JA 5T14A 2FGOA 4DV2J 3M2UB 3LF0A 4URGA 1RT2A 2N3OA 3B4DA 4N8OA 1JB0C 4FYXB 5DLGA 4KTQA 1RTDA 1XEZA 3HSGA 1VHFA 5GADU 1RHKB 4AXIA 2MY7A 2BXJA 2LCWA 1U1PA 2Z58B 1TV6B 1HQEB 3QMQA 2BE2A 3G8TA 1WTBA 4OHXA 2UXDJ 4DS4A 4DCJB 2IVFB 3CDEA 1S9GB 1XR7A 5BR8J 4B08A 4Q7AA 1XJWB 2E44A 2ZBIA 4CWBA 4LF7J 5KFJA 4GVBB 1FESA 3IBFB 2IM2A 2QG9B 2HWIA 4E0DA 2OFHX 4MK9A 4DR1F 5B09A 4GKKJ 3FCHA 3DC2A 1FKPA 2KT5A 3CCZA 5HL7Q 4ZPDA 4CH7A 2VG6B 4RX6A 3Q8SB 4K0KJ 5K8OA 1HBMA 5EWFA 4X4NA 1FWKA 3DKDA 1RWMB 4N5SA 5GAEI 1A0OB 4ITSA 3C16B 1FJ7A 3DU5A 1I94J 5GMEA 2CPIA 5HK4A 2PDAA 3C6UB 5D3GA 4DUYF 2HNYB 4B3RF 3DMJA 2MTLA 2BQUA 3NGTA 3IR6B 3M9OB 2CJXB 2Y3YA 5DDRC 3EE3A 4C0HA 1JJCB 4L76A 4OMFG 4PQUB 1NNDA 1PAEX 1KVJA 3MEDB 1TMJA 2XMKA 1RWPB 1N6QB 1QSLA 1HQEA 4UUXA 2DNZA 2NCKL 3QIPB 1TUGB 3AXKA 1RU1A 1S9GA 4DSLA 3CDBA 4ZVSB 2J8AA 4WTYA 1NB2A 4YDDB 3ZFVA 2E5LF 3I32A 4XK8C 4X4PA 4J5OA 1GMVA 3HZGA 4J9PA 3IN5A 4N7TA 4Q44A 1ZA2B 4GVBA 3RR8A 5KFUA 3D6MB 2V5HG 2EWHA 2F4VJ 2HLTA 3PHTA 2ZHOA 1XK8A 3UNYA 4ED6A 4I69A 3GJSB 2E1RA 4ED0A 4FZVA 3W9JA 4EUVA 2VG6A 2LECA 4M5LA 5KT4A 2U2FA 4ILLA 2Y1IA 3M9MB 3MR6A 5GAHU 4XPEA 2NS1B 1Q8LA 3D68A 4FVMA 2O3DA 2DK2A 4CT8A 2VH7A 3W5YA 3DLKB 2OH2A 3C6UA 2YNFA 2CQIA 3PIOQ 4BLGA 5DDOC 3VAGA 3ZTQA 1VJWA 2QA4G 1U4BA 3UI3A 3F41A 1PAUB 1FI4A 3IMQJ 2BE9B 1REVB 4LF8F 3H25A 4NLTA 5AE3A 5HVFA 4ZLJA 3OJSA 3WC0A 2MY8A 3I5AA 3F73A 1PSDA 2GMHA 3IA0A 4QPXA 1FKOB 1SCJB 2XO7A 2UVWA 3FJ2A 2RUGA 3L4BC 4LF5F 4YEAA 1WF0A 2JFKA 2BABA 2DNYA 1M5VC 1QAXA 2VBYA 2OMOA 4DPXA 3PXGa 2CQ1A 4DJBA 5LOQA 3ZO7A 1AT1B 3OV7A 3MZIA 3HJVA 1NB7A 4YY3F 4OZ3A 2FC9A 3FCWA 1SBRA 2BKOA 3M4XA 1WACA 5H9FK 4F2SA 4JV5F 4Q2LA 1S6UA 3N6NA 4J7CA 4ZCKA 4M94A 4B3MJ 2H51B 3BPSP 2GHPA 1K1QA 1L3KA 4YB5A 3DRYA 3CEDA 2VA3A 1J5OA 3G9CA 5E3CA 1YBAA 2KJVA 1B64A 1CG2A 2HW3A 1FDAA 1YSJA 1RHMB 3EXCX 4QPTA 2AJFE 3FFIB 5CYQB 4PRFA 2HVZA 1TUWA 2GZOA 3D6FB 4RW6B 3QT6A 2VFVA 5BXIA 2B7BB 4ECZA 4K4WA 2BKPA 3AQPA 4J91A 1SIZA 2ZBQA 3VGSA 1V6HA 1RHJB 1RKJA 1OMSA 4DDFA 3W2VB 3EMTA 3PO5A 1XN9A 3D0HE 2J6TA 1SIWB 4YHHF 4DR6F 2P5VA 1K73T 3Q8VA 4H4KA 3AJ2A 1JXVA 3GIRA 1UZDA 2E1MC 3QFHA 3HHLD 3JTOA 4NYZA 2H9ZA 4DL3A 4R5PB 2Y0SD 3BO2A 2QYCA 1NJZA 5KG4A 1I6JA 4OJ1A 1R6VA 1S79A 1R0AA 3EZUA 4JI5F 1S4FA 3BB5A 3KNAA 3JSBA 1X9SA 3NWGA 5HO4A 2VJVA 3N28A 2ZJRQ 4DF4A 1JLBB 5HN0A 2B4VA 2G2OA 5A8KB 2C2MB 2ACYA 4QU6A 4DR5F 3NGUA 3M8PA 3GFXA 2X1BA 3K5OA 3CC4S 2H48B 1FDBA 4NZ6A 1VIOA 2PFFB 1N34F 5F8LA 3CIMA 1SQFA 4Y2MA 4I4BA 3RRGA 5C42A 4DFPA 2E5HA 1VQPS 5CYQA 1CC7A 2HHHJ 1XNQJ 1F2GA 3CJ3A 1IXKA 3CJSA 4DUZJ 4RW6A 2CPFA 4DV3F 3GV5B 4HHUA 2MHEA 4HLBA 4G1QA 2W8KA 5F8IA 5FD1A 4C0OC 1CJTB 3SV3A 3EGNA 3IG1A 1PIEA 4I7FB 1QLNA 4J9KA 2W24A 3P3DA 1R31A 3VGVA 4USMA 3DI6A 1M1GA 4K2XA 1WG1A 5CZXA 1WTFA 1RAHB 1RACB 2XMAA 3VQSA 2IM3A 1HMVA 4DV4F 2XM3A 3DDIA 2GVZB 3R8YA 1FDNA 3LWLA 6FD1A 2UVUA 4B3TJ 4DSEA 2A2DA 3AAWB 3BBCA 3KHLA 2CPEA 3RAXA 3M6VA 3H4DA 1RKIA 3SXLA 3MMCB 4U67Q 3FMWA 5ITHA 3VAHA 3ENWA 2BEFA 3QGIA 2UU9F 2JOQA 3HHKA 3VALA 3W62A 2AEFA 4GRSA 1GX6A 3VAIA 3L3CA 3DRPB 4ZIVA 5M2RA 4P73A 3KMQA 3MECB 2CVEA 2YWKA 2KFZA 4NZ0A 2PE8A 4ZN3A 4YB1P 1K9MT 2FY1A 2BOAA 3NGDA 2LEPA 3HSDA 3H59A 4KKOB 2GJIA 4JV2A 3O8WA 2ABYA 1FO1A 2OMLA 3LP2A 4EU0A 1TKTB 3MUMP 2KFNA 3A1YG 4U8VA 2V67A 3D54A 2MLYA 1YJWS 5D15A 3R5CA 3P49B 1VBZA 3C66A 3H98A 1B4SA 3CSKA 1F0XA 2DGWA 4TU9A 1TAUA 4NX9A 4NLSA 2WSCC 4LQ3A 4P75A 4F0HA 2ZH3A 2OP5A 2JEIA 3NGRA 4OX9J 1PBUA 1TP7A 2XG8A 3PRBA 3KDNA 1F5BA 3HHEA 4ZPWR 5DQGA 2W2NP 1FVQA 1IVZA 4UUWA 4AYBD 4AQYJ 2YKMB 4ETXA 4F25A 1IWAA 5BYSA 3OL6A 2QLBB 1RJJA 3BPDA 5I42A 3MMCA 4RUBA 2GNKA 4Z7CA 1U0HB 3T6BA 4X65J 4EFAC 2SXLA 4ZP7A 1KBRA 2XMMA 3QJLA 3CCJS 3Q8RB 4ZKAA 2HRUA 1N88A 4LRCA 2ZFHA 2D74B 4HTJA 4WE1B 1JLAB 3LP1B 3TW0A 3S01A 4NE9C 3T9ZA 4Y28C 1BHNA 3KHGA 2WOMA 4IH7A 2X1FA 4LVNP 2R2SA 2VU5A 1SI9A 1TKTA 3HHLA 4USTA 3OUYB 2BRLA 2MGZB 1WD6A 3BO3A 1XNRF 4BC7A 2R8HA 3MM8B 5M2PA 1QUVA 2LFVA 1NHUA 2WK4A 2VPZB 4Q8EA 5CCMA 2DPIA 3RBDA 3DNCA 3BGOP 1HQUB 4ID5B 2ZOFA 5KFXA 2DB1A 4AXJA 3G86A 1ZPVA 4AL7A 2DNRA 1EAYC 1RUSA 1PKUA 1NHVA 5J2QB 3EZOA 3R9LA 1OPIA 1BMQB 3FSYA 2OIHA 1WKLA 3T9NA 1MLAA 2DGTA 2CFXA 4O23A 1NBEB 3HM9A 2ZDOA 4DSJA 1CBKA 1GK8A 5KG3A 2UUAJ 1RU2A 5LM7E 4DV0F 4OIXA 3TWZA 4AD6A 4YMEA 1URNA 1YZ7A 3TZZA 5B08A 2ZH1A 3V6DA 2F65A 4WK3A 1J5EF 2RQKA 2RMLA 3KFWX 4GC6A 1WWHA 3GIJA 2BQRA 2V50A 3B78A 2BUNA 3T5HA 1IKWA 3QRRA 3CD0A 9ATCB 4KFBA 5EGYA 4M1KA 4ECTA 4DQIA 4DZDA 2BM0A 4DX5A 3SYZA 1BWVA 4B3OB 2ZBPA 1WEZA 4RWWA 3KK2B 3G96A 3RBEA 3V2UC 1FK9B 4K5SA 5F0WA 4P2SA 2HMIA 1HQUA 3VTIA 4ID5A 3GWCA 1WEYA 1NEEA 1HA1A 2AP6A 4W98A 2HAFA 2KXNB 1NDCA 2FVPA 2FIUA 2M5YA 4OYIA 3ISND 4YB6A 5IT0A 3AHPA 4P71A 2IJRA 3OXFA 5AXMA 2O01C 4UY85 3VR1A 2HHSA 3AY0A 2GQ2A 3IR7B 5GVQA 4R8UB 3LANA 4Y2KA 3SCIE 1ZAWA 2KYXA 2GW8A 3LH2S 2NUUG 2YKNA 1FX2A 1O8BA 1E6VA 2GJ2A 2JHEA 4IUFA 2BA9A 5I3UB 1SB6A 4LFAJ 1Q81T 4PXCA 4RNHA 4DX6A 4MIWA 2RF2B 3BGRA 3QAUA 3NAIA 2FHOB 5GMKa 1X4EA 5FDLB 3SZ2A 1TUVA 5J2MB 1KC8T 2V2ZA 4MIAA 4CIOA 4P2XA 2CWXA 1DJ0A 4Q8FA 3Q89A 3UDLA 1T9VA 2MMYA 2P9EA 3UWTA 1IR1A 1H74A 3V4IA 2ZHBA 3DOKB 4NI2B 2QIFA 4XDDA 3IWLA 2Z0GA 1VMBA 3OTOJ 4DL0C 4B3OA 2OFGX 2HHXA 1N52B 4WP3A 3FMBA 3MMJA 2G2ZA 1FK9A 1VQ8S 2LU2A 5KAKA 3DRRB 2EFPA 1MMNA 3ICLA 4P6QA 7FD1A 2JEFA 1VCTA 1D3WA 1DTTB 5GMDA 3MM6B 2IBOA 4TKTA 3KK1B 2OO4A 1QSSA 4H4KC 4Q0BB 2YWHA 2Q79A 1FE4A 4B9NA 5AJ3F 4DEZA 1LEOA 2DR9A 3D67A 4PAAA 3CW2C 1HHTP 2G4BA 3OBIA 1X60A 3JQKA 1XTZA 1T03A 2XMUA 4R8UA 4B9MA 1AA1B 3AD8C 3BGFA 3W60A 1YIJS 2ZBCA 1W2IA 4PYDA 2BJDA 2V94A 2HFNA 2DR7A 1ZM9A 4NCBA 3G6YA 4UOHA 1GXLA 3WQPA 4ES3A 4C6AA 4KO0B 5A2QU 2JC1A 3V6KA 2H4WB 2R8KA 5J2MA 3M2RB 4QIGA 1EZZB 3TUIC 4HACB 3LQVA 2ILZA 2XZWA 2YPYA 1HARA 3EM1A 2ZZNA 3KLFA 2QX0A 2VC1A 4LQ9A 1AYEA 5E5NA 4F8RA 3MM5A 4NLPA 4C8LA 5CYMA 2CPZA 1DRZA 1Q1KA 2NREA 2HHWA 4MMOA 4J9NA 1K0VA 2FY8A 4KQZA 1F3FA 5C25B 4IYQA 4L6V3 2FHMA 2MXYA 3MM6A 3VAFA 4WU3A 3OL9A 2FYXA 5C2GA 2LP4A 3GIIA 1RA7A 3R97A 3LOUA 4IQXA 2AGPA 3FSIA 2M9KA 2WBRA 2AU0A 4M5HA 1VQ4S 5B7WA 5LSRA 2FLNA 3FRYA 1U6BA 1YKWA 3NS5A 1UW9A 5IWAJ 1KP6A 4X4TA 3GIKA 4KJIA 1V5VA 3US5A 2RB7A 2VQFF 1HW8A 3RRKA 1KLMA 4PKDB 4WFNQ 4DI6A 2RRNA 3LGHA 1PJ5A 2NXCA 4KGVB 5BJRA 3MR2A 3A8JA 2G0JA 2HBYB 2FJEB 1D9DA 4PWUA 3G6ES 1FRHA 2DEIA 5ETQA 3DXBA 2H3EB 5L39A 2CKWA 4WFZA 1YJ9S 2GHVC 3RYLA 3BBBA 3B6BA 3FNNA 2V68A 3HVRA 3A4TA 2F3JA 2FC8A 2ZD1B 3JQMA 2MKJA 1KVKA 3P8BB 4Y2CA 3R3TA 5GAEU 2BMBA 4RZRA 2J9DE 2XI2A 3DM2B 1R7IA 1QAYA 4I56A 2XYPB 3OJUA 2I5JB 3T1YF 5A2QY 1T8EA 2NR0A 1Y5LB 5ETRA 2XCAA 3IWNC 4M5GA 2E1CA 5K20B 2CQGA 2DRBA 4CYUA 4LF6F 1TFWA 2UUTA 1MN9A 2N4CA 4I64A 2IY5B 4KV8B 4K4ZA 4GKJF 4GVLA 4QIVA 2HRTA 1KD1T 4DPWA 5G0RB 2AGOA 3D1OA 4WZMA 3DLLQ 1SC3B 1FXRA 4OJGA 1VC0A 2HQFA 1N5TA 5E3AA 2VHGA 2EG2A 5ETVA 1FA0A 4YOEA 3TA0A 2VBWA 1FNXH 2MQ8A 3IRXB 2VOPA 4OYOA 2CJ9A 2XMWA 5C24B 2EVZA 3AOCA 5EX3A 4F36A 2XHCA 4YQWA 2WSFC 1DAXA 4JYAF 1UA1A 4YS2A 5CH7B 4ZPCA 2EBEA 3MM7B 1S48A 4U7CA 2KTQA 2R7OA 3LPEA 3O2IA 1VFJA 1BUXA 1YJ7A 4PWDA 3M8WA 1B7FA 5HBMA 1RBAA 1NM2A 1B0PA 3IAM9 3QT8A 1VK3A 3LO3A 4LF1A 2UUCF 4JI2F 5IT9U 2B8QA 1JKHA 1UVJA 1SC1B 2RAQA 2KI2A 2ZD1A 1HFEL 3FCVA 2EW9A 4OYPA 3QFWA 4OZ1A 3QBCA 3OSNA 1FFWB 4QJVA 2I5JA 3HHLC 4C11B 4Y6IA 2WBMA 2J9EA 3HVTB 1BXNA 1AXQA 1VQLS 3F44A 3VVUA 3A8EA 2IHR1 2UUWA 4QZVB 1Y10A 5A8WB 4ZVOB 3BM7A 1NK8A 1KQGB 1SV5B 3PW0A 5G0RA 2DEJA 2ERRA 1S12A 3KLHB 5KG2A 2R7SA 1ZAXA 3W5ZA 4PUOB 1RT5B 1RWUA 2DGSA 4I2PB 3MAAB 4KHPJ 1XIQA 1GH8A 3PNIA 5D4NA 3H2LA 3MM9B 1X4GA 3T1HF 4IO1A 1F6TA 4DLGA 3KNGA 2VPXB 2WB4A 2UXCJ 1RTHB 4N8NA 2CQBA 2POKA 3GTYX 2JWNA 3MM7A 3JSYA 4JI8F 3M8RA 1XMQF 4KE5A 1C4CA 2HNZA 5KFLA 2LYVA 3PX0A 1S10A 2RKIA 2HFZA 4BS2A 4FKXA 4LVOP 2IMOA 1XC9A 2YX7A 3GONA 2HSEB 1URRA 4ZPBA 3FBFA 1S5ZA 2FQQB 2F8HA 4H4MB 1IKXA 1Q79A 1N54B 2VKZG 3TRGA 1W25A 1G1XA 3B4MA 1VQMS 2J9DA 4CLKA 3QT7A 5IT9Y 2HVDA 2XLIA 2LKZA 3PRDA 3AB2B 2JEGA 2B4UA 2W7AA 1YQHA 3SDEB 4NWBA 4F67A 1SV5A 1GNKA 5LXRA 1CJKB 4RO0A 1RT7B 5KG0A 3D66A 2V8GA 1IUJA 1HBOA 1WSRA 1UVMA 1NJWA 4WF9Q 1NK9A 4F02A 4UQGA 1T94A 1NXIA 3CCMS 3ITHB 3PYFA 4NLOA 4WFXA 5F3TA 1WG4A 4UT4A 2WVFA 2KVIA 4GC7A 1BE4A 5A8RA 4CRJA 2DR6A 3K0JA 5CYJA 2CG8A 3MM9A 4JI6F 4MKBA 4EBEA 3TAQA 4YY3J 4A8MP 3BQ0A 1UTAA 5DG8A 2HFUA 1NJYA 4WFYA 1QUPA 4CNYA 2GQCA 4AUKA 2JNJA 1R8BA 1X4CA 1O0PA 5IFMA 1MMDA 3QATA 1K44A 2FLPA 2AYEA 4DS5A 3L9ZA 2EG1A 2EPIA 2QMWA 2R2UA 5KFKA 2GO8A 3BQ1A 2M52A 1QAIA 2P6TA 3N01A 1AROP 1JQGA 3TZYA 2HKEA 5KFVA 4U96A 5F8HA 2JVRA 1EHWA 3NBPB 4K4SA 2M8HA 3GSDA 4M5MA 1N5SA 2HHTA 4HDHA 3BZQA 3OT9A 3IFEA 1OS5A 2CADA 2YQ1A 1L3VA 1HI0P 1JLFB 3IR5B 4N41A 2KXFA 3QJPA 1YZ6A 4ED1A 3FSXA 5ETMA 4O3PA 4FNHA 3IXQA 4LFBF 2PIIA 2VDIA 3ZTRA 1HKAA 4E2FB 4OHZA 4DR6J 1F9EB 4EGLA 3RB0A 1FWPA 3W61A 1FJCA 3ITHA 1OJ4A 1RWVB 2I1RA 4ILMA 3IC1A 1KR4A 1PCAA 1UWBB 3WX4A 2DITA 3RRHA 2WAQD 2HWTA 4QWBA 2RJZA 2ZJQQ 4KB7A 4DR4F 2CQDA 4FKYA 3DGVA 4OZ5A 1U0SA 4C3KA 4JBCA 2W2PP 2LVWA 4IRKA 3QO9B 3J80U 3A13A 4J9SA 4KSEB 2G1HA 1PC5A 3DGPB 3I0SA 2OI2A 2RE1A 4D3GA 4M5KA 4CZCA 3IBWA 3NCQA 5GAGI 1SC6A 2Q1LA 4DR5J 2MKCA 2DHGA 2KM8B 2X3GA 2WB1D 3P5TL 3ZTOA 2VV5A 2FHJD 4IG3A 2VONA 4JI1J 2OUGA 3U1NA 2GIFA 4ELVA 3BQ2A 2Z2MA 1YX2A 1KN6A 1NDKA 1N4LA 3OTBA 5IM0B 3N4WA 1RTIB 2OLWA 3PM9A 2DNPA 1SVDA 2DYAA 2BJ1A 1S1TB 4O3SA 4ECXA 2CDQA 4M5DB 1C1CB 3FBCA 5A6WA 1U02A 4EO6A 2PI4A 2XBPA 1T11A 3QSYB 2OPRA 4EMDA 2HIYA 1SL1A 4O3RA 3D5MA 2B5JA 4F50A 3R2DJ 1ZM3A 2CA9A 4QIFA 5C2CA 1AZSA 2IJFA 1PYSB 4CLTA 3BDEA 2YKAA 4RW9B 4I67A 2ZHAA 1MWQA 3KLIB 2GV1A 1ZPWX 4ZHRB 4KYZA 2YPZA 2YH0A 3FEYB 5DQIA 1FFSB 2KFYA 3LGMA 4JI7F 3PDNA 4OJ3A 4X4OA 3QO9A 2YY3A 3JSMA 1VLYA 1IBKF 4FXDA 3MTJA 2UU9J 3F56A 3M8ZA 1DQAA 3Q22A 3N6LA 2WRMA 1HNVA 3UQSA 3ISNC 3CJ0A 5EWEA 4ER8A 4RBUA 1FD8A 3DRSA 1EQ0A 4HR2A 3OR2A 2EXUA 2MZTA 2KYZA 1GT8A 2HURA 2QT7A 3J80Y 1RWNB 2DTJA 4MFBA 4C8OA 3B82A 4ECUA 3V5RA 4HH0A 1YRTA 4BCAA 5KFBA 1M5SA 1HL6A 4ECYA 2JLGA 4K59A 4GO7X 4TY8A 3T5LA 1RT6A 2N4DA 1S0NA 4F04B 5HQLA 2V6AA 2IM0A 3QIDA 3CGIA 4ZPAA 2MKHA 4DL4A 1IWGA 4A47A 1GXUA 4NXMF 2DCLA 1LNQA 2GVDB 4RW9A 3GYXB 1TL1B 3ILJA 3C8YA 1LWFB 3LWMA 3KLEA 1JMTA 4OLPA 1R0CB 4X64F 3NNHA 4OV6A 3QRPA 3E51A 3ZNUA 4ZN1A 5HAOA 1X4DA 2L41A 3ZXWA 1B70B 2HHUA 1VBYA 1RAIB 3UPFA 1NKBA 4DUTA 2E5JA 1EIYB 2MQPA 1KWMA 1TL7B 1JLCB 2BM1A 4ZMMA 3UN2A 4NPOA 3SFGA 5D4PA 3ULHA 5E7OB 3R6GB 1VBKA 1RTJA 4IDKB 4XTTA 2V2KA 2IJNA 3MMAB 3T3FA 4CNZA 2XHWA 4DWIA 2IRXA 2NPIA 3PX4A 3HZEA 4KGMA 3WDOA 3C19A 4ED7A 3ZZRA 2BJ8A 1WUUA 2DHXA 4DQPA 2W4DA 1HNWJ 5HP1A 2JH3A 1N32F 2GJFA 1UJ4A 3U1LA 4OHWA 1U1QA 5T41A 4C3MA 1YJRA 1VQSA 2OPPB 4H4OA 1O51A 2ZITA 2CPYA 1SC4B 1FEHA 1ZA1B 3CD6S 2GVDA 3QRQA 4ZOSA 1LWFA 2AGQA 4QYRA 1QVFR 2Z4PA 3AODA 2ZZMA 4LSLB 3POTB 3BS9A 4O4RA 4B3SJ 3CCES 1M5KC 2V4JA 4NLQA 3TA2A 4RBVA 3OL8A 3M30B 4NLWA 1QTMA 4LFCF 1SPBP 4FNIA 4NLUA 1CSJA 4B9VA 1TL7A 3Q8UA 4QCLA 4DV0J 2MKYA 2O67A 2RT3A 1S1WB 3CJ8A 4EYIB 4A8XA 3N5FA 4ZJLA 3P5BP 2J5AA 3NOGA 2B9WA 3LPYA 3FZ2A 1J5EJ 4DR7J 1S97A 3R7BB 5HLFA 3I0RB 3MXHP 2OPSB 2HBRB 1YBTA 5LJ3Y 3RAMA 3ZZYA 2LA4A 3ET6A 1FRIA 3CXCR 2O66A 4ELTA 3L7OA 1IM6A 3HT0A 2BJ7A 3KUHA 1IJFB 5LMNF 1S4EA 2ZWOA 2D7SA 4ALZA 3ILIA 3ZZOA 4RW7A 1J2VA 2A6OA 3K5PA 2CIMA 1WHXA 3LAKA 1J27A 1PGZA 2DBBA 2OPPA 2DIVA 3W1YC 4CLWA 3MURP 4L75A 2KZZA 2AEJA 2R7XA 1ZYQA 3KJVA 3FQLA 2J0QD 2QMUB 5DETA 1NZAA 3GFZA 4NOHA 3I5CA 5HJXA 4ED5A 4Q45A 1Z1ZA 1SQGA 4PWWA 2DH8A 3D0IE 1WOPA 3HDSA 3H2VE 5JMNA 2H5JB 4ANCA 2ZNZA 4Y2AA 1B3TA 3CJ2A 5D8HB 3I4PA 4CT9A 1PC4A 3DOLB 2KT3A 1EKRA 2QTWA 5KT5A 2ZH6A 4DSFA 2KRBA 3NEKA 1HBNB 3I0RA 1H7WA 1NJIT 2IVYA 3GQCA 3L7PA 1T9UA 2P6SA 1WHWA 1L3UA 3TAMB 4OQJA 2Z8QA 4NLRA 1JLGA 1X0PA 5KG1A 3CCQS 1RSCA 4DG1A 1ZZFA 1LW0B 1WKKA 2W4PA 3BKTA 2M2BA 5MLCV 1QD1A 4DV2F 2DNHA 1VHIA 4FPRA 4DXLA 4DPOA 3KTQA 4DV7J 2WCXA 1FXLA 4JB8B 4FYVB 1Q7LB 1LK7A 4PR6A 2I38A 3QWUA 2FVSA 5L9XA 2KU7A 1D09B 1HWJA 2B56A 2QLWA 4MAKA 2ZNYA 1I3OB 3U7JA 1U49A 3GYNA 1U45A 1JLEB 3W9HA 5BR8F 4IG0A 2KJWA 2GS8A 4CI0B 2IA6A 3DLEA 4LF7F 5JVGQ 1HD0A 1R43A 4QIEA 2FJBB 3TEGA 1B0TA 2JZ5A 2VG7B 2XZTB 5DGBA 1CLFA 4URSA 5KFYA 4DU8A 1SUQB 2LXFA 1FNOA 1NSAA 4M95A 3DOLA 1M1HA 3KUEA 4FPIA 2AX1A 1FRMA 3F0NA 1U09A 4OYBA 2VG5A 2GA7A 4O0NA 3MUVP 3FBBA 3AA8A 4K0KF 5E41A 4USKA 4ZP9A 1JIHA 3TAMA 1KRPA 3LP0B 4RW4B 2V9KA 4KHMA 5KFWA 1I94F 3HCXA 2RU3A 2FVRA 4Q5VA 1LW0A 5G4DA 1LXJA 4RPFA 3LW5C 1WI8A 4C97A 1IBMJ 2ZH2A 3KG1A 3OQ2A 4USIA 1C0TB 1UMJA 2V4RA 2XC9A 3NLCA 3OD2A 1QE1B 1CS4A 3TQEA 3VF0B 1RT2B 2NXUA 2EK1A 1SL2A 3DOMB 1CC8A 1RTDB 5LL6d 1L3TA 3QGGA 2F9JA 4U9RA 4PG4A 5DDQC 4F4KA 2H5EA 2AMCB 3EVMA 1AUSL 6FDRA 2BE2B 1JLEA 2D1CA 2BJEA 2PMZD 3BYPA 1VYAA 2XMVA 2FLOA 3D1HA 2XNQA 1FE0A 2F9DA 1VR6A 2V8VA 2W2MP 2PI5A 2VQFJ 5D0HA 3P6YC 2WONA 4Z2XA 1YGYA 1VQ6S 5RUBA 4B9TA 1SUQA 2M4MA 5KFRA 2X7IA 5HJYA 5A0YA 2ADBA 3GSIA 3CDUA 3Q24A 1S99A 2W9CA 4CO5A 4DLEA 2LQ5A 3O1LA 1VJQA 1FJGF 3OXLA 2IIHA 3BKFA 3M9NB 3GLJA 2J0XA 2VBZA 4KY3A 1M0SA 2J8SA 3TJAA 1LV5A 4TQRA 3H2UB 2BE7D 3M05A 1DARA 3I55S 4FYYB 2VIHA 2G9OA 3FZBA 2CWKA 3K7RA 2IVMA 3SMZA 1HBMB 3TVYA 5DRKA 4R0JA 2FVQA 3BF4A 3HSZA 5L1IA 3J7ZT 2AV5A 3BN4A 1GMWA 4PXEA 4B9LA 3TP2A 3ZZZA 2F8EX 1C0TA 5D3GB 1Y00A 1QE1A 1HWKA 4HH1A 3Q2TC 1WNEA 3HULA 2XGPA 3DOMA 2ASDA 2QGFB 2CQ4A 1FEEA 3GV8B 1HPZA 5EN1A 1VQ9S 4ANDA 3L09A 1CQNA 5L1JA 2MSTA 5DO2A 2QL5B 3D3BJ 4ZLPA 5LXYA 3QLHB 1RCXB 2BQ3A 2H5IB 5JVHQ 4WFAQ 2PSZA 3PZPA 1BC6A 3KJNB 2COLA 4IFVA 3OTCA 2FJAB 5F8NA 3KUGA 5L9NA 1JK9B 3FEXB 4QWAA 1UFLA 4DSKA 1XMBA 2E5IA 4MT1A 2CJKA 3JTPA 1PILA 1RHRB 4EK2A 4WIQA 2CJBA 2CDRB 3JYTB 2MZJA 4F0MA 4ZJQA 1HD1A 3BR8A 2EFNA 2ILYA 2KVQE 2GFFA 1MSWD 2NYHA 5IT4A 1JLQA 1TTHB 2ROGA 2M7SA 4DX7A 2BBEA 4OYAA 4TNOA 1TK5A 3ZZ0A 2D3OR 4KIAA 2YNFB 2ZC4A 2M0GB 4LF9J 1Q5YA 3EVWA 4ZPVR 1Z2LA 1FRXA 1EQMA 1TR0A 2L48A 5E33A 3EJMA 3HK2A 4CO4A 5IOLA 2E9TA 3PJXA 3UD3P 3FEZA 4V19J 2DXFA 5KFTA 1E6YA 4ZCMA 2IDEA 3BN7A 4ZVQB 2V63A 2DXEA 4ED4A 2NZCA 1OY8A 3ONQA 2XY5A 2KB2A 2XTJP 2K1RA 3QLHA 2HK2A 2WSEC 5J1EA 3MF5A 1NPRA 2WVEA 5KFZA 1WC5A 4NLXA 1PO6A 4ZVGA 2W2OP 1C1BB 1PG5B 2RHSB 1FRJA 1FTCA 5J1NA 3HFVA 4DV1J 2CJAA 3M32A 1Y5NB 4K2JA 2C2OB 2RQMA 1X5OA 1N48A 3DFEA 4KT0C 2GQQA 4ZVHA 3JYTA 1M90T 1OO0B 2FB0A 2CVIA 3MDFA 3VCDA 1IQZA 2DGXA 3M7VA 3Q0AA 1H3DA 4QYZJ 1RGVA 1WDTA 2XI3A 4TY9A 1J5OB 4ZVTB 4QR2A 1UVLA 3RZAA 3K89A 3IBCB 4DFKA 3SSRA 4LBPA 1OWXA 1WC3A 4B9SA 2JSXA 2DNKA 8ATCB 2XY6A 2Z2YB 4NZ7A 3CJQA 2D3ZA 2HHHF 1UEVA 1Q0NA 2CPJA 4DUZF 4X66J 3NG8A 3KHRA 2V2QA 4ELUA 2AZ3A 5D78A 1RAAB 5KFFA 4NLVA 5BYQA 4CM2A 1TQLA 2AZ1A 5K9FA 1IKVA 5HSPA 1X0FA 4ZVFA 3GB0A 3EDRB 2E1PA 4JI3J 3CCTA 5A76A 2ZBRA 2BDPA 3AJDA 1L5UA 2R7WA 4LF2A 2BZ2A 4C8MA 4C48A 4NEZA 1RT1B 3EWGA 2ZE2A 5DM6Q 3PR4A 4C8KA 4WYLA 1NK6A 3CCLS 2DR8A 4W90B 4JI6J 3ELHA 2JDJA 3L95X 3CJKA 4MKVA 1EETA 1UL3A 2HVEA 3DXSX 5JUMA 2OD4A 3S8SA 5IS2A 3GFYA 1C1BA 2LQBA 4LREA 3DHXA 2UXBJ 1R8CA 4C98A 2FGCA 3EZ5A 4DL5A 1VQ7S 2DKOB 2YNGA 2XYGB 4TYBA 1U47A 2RDDA 3HJFA 3FUYA 2A2CA 3DYAA 5GAGU 3GFHA 3TNVA 1R0AB 5EDWA 3PJWA 1OPZA 3D1QA 2DGVA 1WF1A 4LBHA 3W64A 1H7XA 2NPFA 3M8PB 2OAUA 3PTWA 2YVSA 2CPHA 4CDIA 2LEAA 1I1GA 1KTQA 3CE8A 4MH8A 4DPUA 4C8YA 4CH0S 3MEKA 4PG7A 5C42B 4JUZA 5KFQA 1G7CB 2KKHA 1TZ0A 3TUZC 3W5XA 4MIBA 1XR5A 5ETOA 2UV8A 6AT1B 2R7QA 5F8JA 4NXNF 1HI8A 5B0DA 2H54B 4DFJA 3RB3A 2L9WA 4X4RA 4DV5J 4G1QB 4A8WA 1GTEA 2CNNB 3IG1B 1RT1A 4OX9F 3NGKA 1RWWB 1CULB 2AF6A 3DI6B 2AT1B 2DVIA 1DTQA 1C0UA 3TEHB 2C2RA 3SCJE 3KJFB 4DR4J 2ZVIA 1HMVB 2BRKA 3KMSA 1HR0J 3UCGA 4AQYF 4CLUA 3KLGA 4I6WA 3VGTA 5D4OA 3TA1A 1RT3A 1S76D 4KH0B 2RSQA 2Z2ZA 4JI0F 3V81B 1WC0A 3UNGC 1OY6A 4X65F 3BGLA 2XYHB 3MHYA 2V8HA 4DX8H 2RRBA 1YJTA 2LEBA 2MDAA 1KNZA 3NMRA 4HI1A 3I9V9 4LSZB 3GJRB 4RNFA 3HSJA 2HZAA 3CCUS 2QA2A 2K3IA 5IZHA 3JXOA 3AXMA 3Q8PB 3CJ4A 4NCGB 4WPAA 5DZ6A 1U24A 1VOMA 2P2CB 5CAAA 5F9LA 4JI4J 1UVKA 1Z2ZA 2KXHA 3LP2B 3EPIA 5HMZA 4HVZA 1A9NB 2HFVA 2VPYB 5DG9A 2DRDA 3V4MA 3ETOA 4C7QA 4I0WA 4ZVPB 2UVRA 1U8SA 2R8IA 1D8ZA 2QE5A 1X4AA 1CULA 4GMKA 2MQNA 3G82B 3HD1A 2HHPA 3W2WB 3MCSA 2VQEJ 3MD1A 3H4BA 2VZ9A 1IBLJ 4XAKA 2CXEA 4JI7J 3PO4A 4O3NA 1FXDA 1YTYA 2XEXA 4FS2A 1RAGB 4RNMA 2Z57B 3V81A 2UUAF 2C3OA 5I42B 2DO0A 2EFQA 3SCLE 3ZZTA 3BH6B 1UA0A 3HKWA 2V8DA 3GR0A 4G1PA 1WC6A 2DHSA 2HNDA 3U02A 1UAWA 2C2ZB 3RB4A 4USJC 3DLHA 2P9GA 4NCGA 5JXSA 1EARA 3R2CJ 4IFYA 1VRQC 2WOMB 3MR5A 5HQ8A 4UTGA 1JXLA 3HHLB 5KFCA 4UOGA 2CPXA 1FTRA 1FRKA 3RJMB 3W66A 2LQ9A 1KEKA 2QL7B 2E9ZA 4WK1A 2D41A 3FRZA 1P1LA 3V6JA 5H9FJ 2RS8A 4ICLA 5CQGA 3HF5A 1WEXA 4BWJA 1ZM4A 1RP5A 4U6PA 3R7NB 1WELA 4ILRA 3G82A 2CQ2A 2XZDB 4P74A 4OI4A 2XSJA 3W2WA 1N36J 1NKCA 3TARA 2C2DA 3RU0A 3NNAA 4NA3A 1YK9A 1NHKL 2C3UA 2YQ3A 5HMWA 2VFTA 2YKQA 1GTHA 3PW4A 5LMUJ 4ZJOA 4J9RA 1QJHA 2B51A 4CM0A 2HK3A 2GC8A 4NMLA 4OI6A 1KOOA 1U1RA 1RADB 4N56A 3KJQB 3EVOA 2CJQA 1RHUB 1S59A 1Z4UA 2XY7A 4X4UA 4IOCQ 4ZVRB 2PC6A 3V6DB 1NCLA 5DDPC 2CG4A 3AQOA 2CNOB 3DLBA 1KHVA 2OEKA 4V19X 2HLUA 5B0FA 5CZVA 1P27B 1IKWB 2J6SA 3OR1B 2YWGA 4KFBB 1JJHA 1S0OA 2UP1A 3T5KA 1TK0A 3OTOF 2RQ4A 3K5LA 4FP9A 5DS7A 5F3ZA 4X62J 2LDYA 1DBDA 2EKNA 1TKXB 1SJ1A 2IPOB 2ZH7A 2DHAA 3VAJA 2HMIB 2MB0B 5KOXA 3EX7B 4WTOB 3VQTA 4MJKA 1T05A 5KFHA 2RU9A 5HROA 3SEOA 4XDCA 4IKAA 2MZSA 2GAHC 2QJ3A 1ICEB 4HKQA 2N7CA 4AE5A 3IP0A 3K58A 2XWYA 2K3KA 2RD5C 3HO1A 4OX6A 4ZA1A 1BWEA 3I6PA 4L3KA 2ZH4A 3B54A 3NMAA 1MU2A 3OVSA 4L74A 1N5YA 4HHJA 1PYOB 1SH2A 3M8QB 3TZWA 4V1Ak 2HBQB 3PHEA 2G13A 3CPWR 1LXNA 4FBTA 3TVZA 2AW0A 2YKNB 1ITPA 1E6VB 4L72B 3MMBA 3CDWA 2QA1A 3SSSA 3MFHA 2FHKA 3HHNB 4K4VA 4DZ6A 3BGRB 3DRXA 2G0IA 1K8AT 2HG4A 4QW8A 2HS3A 3I5BA 4LT6A 1QVGR 3BREA 1TMMA 5LT5A 2V9WA 3OR1A 3EGZA 2R4FA 2AKWB 2RVJA 2RIJA 3V4IB 4K50A 1T9YA 4WFBQ 2RS2A 2ZDPA 3O3LA 1LKZA 2FZKB 1D8YA 2QLJB 1U6ZA 4F3OA 3HMJG 1NSQA 1H98A 1TKXA 4J37A 2C3MA 2L3MA 2C3YA 4EI2A 2WW8A 1YJNS 4LRFA 4G1IA 4IR1A 3NAHA 3GU0A 1UVNA 3TJ8A 5E2QA 1RQ0A 3W63A 2E29A 4HTIA 3EDQB 2UUBJ 2CYYA 2A3JA 2QSFA 4U7UD 5LSOA 4NCAA 2XCPA 5E3QA 1X4HA 2GIQA 1WORA 3NKYA 4YR3A 1NSPA 3QNWB 5IWAF 1H2TZ 4ECSA 2DHHA 3UDEA 2H1YA 4RL1A 5THWA 1HBUA 1T03B 3T1AA 4W92B 3OXGA 4IH6A 3M8QA 1G6BA 1LWEA 4PG5A 3DDKA 4XIUA 4Y0FA 3HVAA 2PFDA 4RUAA 5KG6A 3ISZA 4ECQA 2GMJA 5T7LA 3WX8A 1RI7A 4C8NA 4DV6J 2X51A 4TLQA 5D4LA 2DH9A 4USUA 2JX2A 2QC3A 3BSAA 2DNNA 1WKJA 3GV7B 4JV1A 2EC2A 2HQCA 3KLFB 2M3DA 3NNCA 3OFHA 5L1LA 4M5JA 3MM5B 1YLXA 5CYMB 1EKSA 3ENQA 1UETA 4BC9A 1SXLA 5HATA 1TVRA 3PACA 3VWSA 5B0CA 4OYWA 3KHHA 1GMUA 3PG9A 3PW2A 3PV8A 3C15A 4QU7A 1FKAF 2MHNA 4NLGA 3CC7S 4I2QA 1YRXA 1S1VA 3TOQA 1S9EB 4DR3J 1DLOA 2YTCA 1UEKA 1RYRA 3R7SB 3H5XA 4N76A 4IRCA 2W9BB 2RILA 3J7YI 1BQMB 3LUYA 4WU2A 1P1TA 3MR3A 1H0HB 1KLMB 2YXLA 2F63A 2JL9A 2AEMA 3VGUA 4DR2F 1UVIA 5K8NA 3GCXP 2EFGA 3MPUB 2V34A 2YKOA 5I3PA 2HBZB 1RCOB 4MKYA 2C22A 3UE2A 2HGNA 3M2VA 4RKUC 2O5DA 4FF3A 3MEGB 5KG7A 3M2UA 2ZWPA 2E7VA 4RU9A 1N33J 4Y00A 3DDNA 4UOCA 4UQTA 2HZCA 2D9PA 2XWXA 2MPUA 3BGUA 4PPDA 2Y1LB 4K8RA 1TV6A 2DT9A 4CYUB 4CLLA 2MQQA 1ZTWA 2NYIA 5K14B 1NRKA 1YI2S 3TVKA 2K7KA 2CQ0A 2J9CA 3MPDA 1XMOJ 4FYDA 2V4QA 4KHPF 3NCPA 1S9EA 2AWZA 5ETSA 3MD3A 2W9BA 1BQMA 2UXCF 1B7YB 3PEHA 1ZZNA 1NK7A 4U95A 1T9TA 3MCMA 1FJGJ 1MNEA 4JP8A 1NDLA 2XLKA 3TANA 5KFPA 3AJ1A 3UD5A 1RBLA 2RUSA 5IQQA 4PWDB 3H42A 1QAJA 5HBMB 3FDSA 5IQ6A 3CMES 3C16A 2CNLB 3NY0A 2AIRB 2YX4A 3W3SA 1JKHB 4B17A 2HNYA 3MEGA 3D7SB 3K57A 3HHDA 5CABA 2CRLA 4K4TA 4PQUA 3DU6A 3VV2B 3MEDA 2Z2LA 4MK8A 1N6QA 4DOZA 5EX0A 4H54A 4C4WA 5ETKA 1JWWA 3QIPA 3EXYA 5K14A 1KLNA 1S7IA 5H9EJ 2MJNA 2OSRA 4KAIA 2WVCA 2PO4A 2VBXA 1UFKA 3ENAA 3E3XA 5DGAA 2QZ8A 3PRVA 2DNOA 1RHQB 1WHVA 2HRYA 2ZVSA 2XNRA 4LR7A 4F4YA 4RLEA 5KFEA 4P72A 1RBOB 4DU7A 1T9WA 4LIWA 4OHYA 4CCHA 4YB7A 3A3PB 4OV1A 4DR1J 3MTKA 1TL5A 3I56S 4PEOA 2G0CA 1ZM2A 3LALA 1VC6A 5CXTA 4YFUA 5J1PA 5I3QA 2HNZB 3H5SA 3BSOA 1AFJA 1S0VA 5F41A 5IV4A 1NPKA 2PGCA 2DD8S 4ZIWA 2RKIB 3DLKA 3X3UA 1R0BG 1QTNB 3QGHA 2C28A 4MTPA 4TXSA 2C1EB 1T0TV 4YP3A 4DUYJ 1IKXB 4B3RJ 5IV3A 3ZZUA 3UDCA 1Y3KA 1REVA 4OI2A 2YQ0A 5D77A 4DN9A 1TU0B 1ZOTA 4Q43A 5DM7Q 4CLSA 3CJRA 2KO1A 5AXLA 1FKOA 2Z56B 2DO4A 2ZUGA
chains in the Genus database with same CATH topology
4PG6A 2BACA 2KXNB 1RTDB 4OI1A 5LL6d 1SJFA 1L3TA 3QGGA 3KLIA 3UW1A 1BQXA 2F9JA 4U9RA 4PG4A 5DDQC 2FVPA 2FIUA 4F4KA 2M5YA 4KC5A 1HBOB 2H5EA 3ISND 1N0VC 1VQKS 2E7XA 4OFZA 4YB6A 6FDRA 4ZHRA 2BE2B 2VFSA 1H38A 1JLEA 2D1CA 2BJEA 2EKYA 2A18A 2PMZD 4RW8B 2E5GA 1S49A 4ERDA 4KHRA 5IT0A 3VAKA 1FD2A 3AHPA 1Q86T 3PKMA 1V9OA 3OXFA 2XMVA 4J9OA 2FLOA 1N36F 3D1HA 1FHTA 3K59A 4EWTA 2XNQA 3Q23A 1FE0A 3G6XA 2F9DA 5AXMA 3D28A 2O01C 2V8VA 3UCZP 4UY85 3VR1A 1IKYB 2PI5A 2VD3A 4ZDNA 5A8RB 1DZ5A 3P6YC 3UR3C 2WONA 4Z2XA 1YGYA 4YR2A 3PW7A 1YG0A 3CUNA 1VQ6S 2HHSA 4LIRA 3AY0A 2GQ2A 3IR7B 1YRUA 1SUQA 2I0XA 2HS4A 2M70A 5GVQA 4J9MA 4B9TA 4R8UB 2M4MA 3QPIA 5KFRA 3NRBA 3LANA 3H5UA 4Y2KA 5A0YA 2ADBA 5LMUF 3SCIE 1ZAWA 5DG7A 2KYXA 3CDUA 3Q24A 4TN2A 2YX1A 1S6QB 2A10A 3THVA 1S99A 2W9CA 1Q7YT 5CCLA 3DHWC 4CO5A 4QR0A 2GW8A 4DLEA 3HKZD 2LQ5A 3O1LA 3LH2S 5BYRA 3GG0A 2NUUG 4C9DA 2YKNA 1FJGF 1O8BA 1E6VA 2GJ2A 3OXLA 1KFDA 2JHEA 4IUFA 2XS7A 2BA9A 5I3UB 5EHHA 1SB6A 3I4HX 4C0BA 1Q81T 1R8AA 4PXCA 4RNHA 4MIWA 3M9NB 2J0XA 4IH5A 1OIAA 2RF2B 2VBZA 2YKPA 4DN0A 1M0SA 1JXEA 3BGRA 3QAUA 2VA2A 3HPOA 3NAIA 3OLAA 2FHOB 5GMKa 1X4EA 5FDLB 5MAOA 3SZ2A 1TUVA 1LV5A 5J2MB 4TQRA 3H2UB 1KC8T 3M05A 1DARA 2ZOMA 4MIAA 2XS2A 3I55S 4CIOA 2G9OA 3FZBA 3K7RA 1DJ0A 2IVMA 4JI1F 3SMZA 1S9FA 1HBMB 2UV8G 3R5BA 3TVYA 4Q8FA 5DRKA 3UDLA 1U1NA 2UVVA 2HNDB 3DN9A 2MMYA 4R0JA 3FFIA 1KS2A 2FVQA 2P9EA 3BF4A 1VK8A 3UWTA 5L1IA 3GZ7A 4DHVA 3J7ZT 5DLFA 2AV5A 3BN4A 3V4IA 2ZHBA 3DOKB 2N82B 1IR0A 4I1TA 2IA0A 4PXEA 2MZQA 4IFYB 5AXNA 2QIFA 4B9LA 3TP2A 1VQOS 1SL0A 3ZZZA 2F8EX 1C0TA 4XDDA 3IWLA 2Z0GA 5D3GB 1VMBA 4DL0C 1U7LA 4B3OA 1Y00A 2OFGX 5SUHA 2HHXA 2MYFA 1N52B 1QE1A 1HWKA 2AX0A 3FMBA 3MMJA 4X62F 4HH1A 3TAPA 3K5NA 4WYWA 3Q2TC 3W2VA 3PY8A 1WNEA 3WC2A 1VRUA 3R27A 1U6FA 1FK9A 1S72S 1VQ8S 1HW9A 2LU2A 5KAKA 2XGPA 1IQTA 1R3NA 3DOMA 3DRRB 3N9UC 1RYSA 2EFPA 2ASDA 4MYUA 1ZBTA 1MMNA 2W4CA 3ICLA 4P6QA 3OL7A 7FD1A 2FHJA 3X1LB 2J7KA 2P9CA 2JEFA 2R2TA 1TL1A 1D3WA 1DTTB 2GMLA 4QIWD 2CQ4A 3MM6B 1IM4A 2ASYA 2BVZA 1FEEA 2IBOA 1A6LA 1HPZA 2FPHX 4TKTA 3GV8B 5EN1A 4FN5A 1VQ9S 4ES2A 4ICLB 4AL5A 1JX4A 2HHQA 3KK1B 2OO4A 1MWZA 3L09A 1CQNA 2BV3A 4RW8A 3G8SA 1QSSA 5L1JA 4H4KC 4Q0BB 3BEGB 2YWHA 2Q79A 1FE4A 4B9NA 5AJ3F 1F5CA 2MSTA 2ATLA 4KBIA 4DEZA 5DO2A 2DR9A 5H1SV 2XSJB 1IKYA 2Q6BA 1NO8A 4ZLPA 4MYTA 5LXYA 3QLHB 1JJ2R 3PIPQ 4NRTA 2BQ3A 1HHTP 2G4BA 5JVHQ 4WFAQ 2PSZA 4IQMA 4XPCA 3OBIA 4R5PA 1JLCA 3PZPA 4OZJA 4DL7A 1XTZA 1T03A 2XMUA 4R8UA 1KQFB 1BC6A 4B9MA 2HAIA 2COLA 3BGFA 4IFVA 3OTCA 2FJAB 5F8NA 1LFWA 5L9NA 3BSNA 1YIJS 2ZBCA 1XWLA 4KR0B 1S6QA 1W2IA 2HIQA 2BJDA 2V94A 1JK9B 1M5OC 2HFNA 4R25A 1K1SA 3FEXB 5B0EA 2DR7A 4QWAA 1UFLA 1ZM9A 5IXUA 4DSKA 4NCBA 1XMBA 2E5IA 3G6YA 1S0MA 2CJKA 3JTPA 1GXLA 4IDKA 1JLBA 1PILA 1SJRA 2CJBA 5A8KA 4FBUA 4ES3A 2PEHA 2G1DA 2DO4A 3KLVA 4KO0B 3NCRA 2Q66A 3I0SB 3HP6A 3MMAA 2QV6A 3W7BA 3SCKE 1GX5A 2JC1A 4Y34A 1MROB 3V6KA 1FNMA 3JYTB 2MZJA 3CCRS 5KFAA 2OSQA 2BR0A 2R8KA 4TU8A 2K7JA 5J2MA 3M2RB 2ASLA 4QIGA 4ES1A 1HD1A 3PKYA 1YITS 2I8EA 3BR8A 2EFNA 2ILYA 5KFIA 2KN4A 3TUIC 3LQVA 1UEUA 2GFFA 2HVHA 1MSWD 3H20A 4IRDA 5IT4A 2ILZA 5L8RC 4IG3B 2XZWA 1JLQA 1HARA 3CJ5A 2ROGA 2ZZNA 1QM9A 5I4MA 3KLFA 2M7SA 2VC1A 4BBYA 2BBEA 2LA6A 4LQ9A 3TO8A 1FRLA 4TNOA 2JVOA 1TK5A 3ZZ0A 2IRYA 5E5NA 4F8RA 3MM5A 3BJYA 2D3OR 4NLPA 4KIAA 1YJUA 2YNFB 2M0GB 2ZC4A 3RAQA 1VS3A 5E3RA 4C8LA 3CT9A 5CYMA 1KHWA 2CPZA 4X84A 4ZPVR 3WZ0A 1Z2LA 2OPQB 2AD9A 1T95A 1DRZA 1FRXA 3BO4A 1Q1KA 1M5HA 2NREA 1TR0A 2HHWA 3H40A 2L48A 4Y2IA 1Y5IB 4MMOA 3ZC4A 3K8WA 5E33A 1W2BR 4JV0A 1GAOA 4I7FA 4J9NA 1K0VA 3HK2A 2HPUA 5KTQA 2CPDA 4PQAA 4CO4A 4KQZA 2E9TA 3PJXA 4TQSA 1P8GA 3EGWB 2DJWA 4IYQA 4L6V3 5C25B 2FHMA 2MXYA 2OPRB 3UD3P 3FEZA 4V19J 3MM6A 1LFPA 3TI0A 3VAFA 2KH9A 5KFTA 4Y3CA 2DH7A 3CDAA 3HX9A 1X4FA 1E6YA 4WU3A 3CMAS 4LSLA 3POTA 2B5JB 4ZCMA 5SZTA 2ALZA 2DR5A 1X7VA 4EO8A 3GIIA 3OL9A 3QYYA 3IGNA 4BDPA 1RA7A 3BN7A 2HGMA 4USHA 1U1LA 3LOUA 2KG0A 4IQXA 2AGPA 1IN0A 3FSIA 2M9KA 2OTLS 2WBRA 3EPGA 1P6TA 3ONQA 4ZPTR 4OX7A 4X4SA 2XY5A 2AU0A 2UUBF 3B8HA 3CF5Q 2KB2A 1VQ4S 3M30A 5B7WA 4DF8A 3MFIA 1T05B 2K1RA 3QLHA 2EFOA 2WSEC 3ZZPA 5J1EA 4M63A 1OSCA 3BSCA 5LSRA 3FRYA 4NRUA 2MQOA 2FLNA 1U6BA 5HROB 3MF5A 4N77A 3NS5A 5KFZA 1X5PA 4NLXA 2ZM6F 1PO6A 3MOZA 3R5DA 4X4TA 3GIKA 4ZVGA 4KJIA 4G3IA 3US5A 2RB7A 2VQFF 1HW8A 4M8LA 1TFYA 5AE1A 1C1BB 3RRKA 2DNLA 1S1WA 1KLMA 4PKDB 4WFNQ 1FRJA 1FTCA 5J1NA 2RRNA 4K4YA 4OJHA 2AQ4A 3CCVS 3E01B 3NS6A 4A8SA 3SV4A 3ENVA 5BJRA 3MR2A 2CJAA 4I68A 3JSMB 3M32A 4DQSA 4CO0A 1Y5NB 3DRPA 2FJEB 1D9DA 4EZ9A 4PWUA 2RQMA 3G6ES 2Q6CA 1FRHA 1MU2B 1X5OA 5J2NB 2LMIA 2OKQA 4RBTA 3DXBA 1N48A 4PXDA 1WG5A 2RNEA 3DFEA 4KT0C 4PPZA 2OPSA 1N5YB 2GQQA 2VL1A 3MECA 5L39A 1MROA 2CKWA 4WFZA 1YJ9S 4ZVHA 3JYTA 3PW5A 2GHVC 3RYLA 4NA1A 1OO0B 1M90T 2FB0A 2CVIA 1HNVB 2GX8A 3MDFA 3VCDA 3OLBA 1LK5A 1BD6A 2B6AB 1Q16B 1IQZA 2NSCA 3FNNA 3HVRA 4LFAF 3PFEA 3MPWA 3UFCX 2F3JA 2FC8A 2DGXA 2ZD1B 1H3DA 3Q0AA 1L3SA 4QYZJ 1RGVA 4KKOA 2MKJA 2XI3A 3MPVA 1D9FA 3DRSB 4TY9A 4CQ1A 1J5OB 4Y2CA 3OR2B 3R3TA 4ZVEA 5GAEU 4QR2A 4RZRA 2J9DE 3MMBB 3RZAA 3S1TA 2XI2A 1UVLA 4IOAQ 1LOUA 1TL3B 2GGPB 3DM2B 4FS1A 4DFKA 1R7IA 2I2YA 1QAYA 3SSRA 1TKDA 4DV6F 4I56A 1OWXA 3OJUA 4P7TA 2I5JB 4MFBB 5KFGA 4B9SA 1T7PA 2JSXA 2FLLA 2DNKA 2VODA 3T1YF 2XY6A 5A2QY 1T8EA 1VQNS 4NZ7A 2R8JA 3MEEB 2D3ZA 2NR0A 3TX8A 1X9MA 4DMZA 1Y5LB 3JSRA 2XCAA 1HNWF 3CULA 4A8KA 2HHHF 1HHSA 1UEVA 4J9QA 2PA3A 3IWNC 2CPJA 4DUZF 2RRAA 3TQ1A 2E1CA 2OPQA 3M6XA 3NG8A 2AJ1A 3KHRA 2O1PA 4ELUA 3MOJB 2VFRA 5D78A 4TY8B 5KFFA 2CQGA 4NLVA 2DRBA 4LF6F 1TFWA 5BYQA 1RT6B 3MAHA 1TQLA 2UUTA 5K9FA 4OZLA 3JAMY 1IKVA 4QW9A 1X0FA 2X1AA 2XB2D 2N4CA 4I64A 4ZVFA 3GB0A 2XULA 4KV8B 2WHOA 4IOBA 4K4ZA 2IMWP 4GKJF 1R8HA 1RA6A 4QIVA 2DCUB 2JLEA 3CCTA 5KFMA 1KD1T 2QEXS 4FVCA 4ZS6A 3GR1A 2EBGA 5G0RB 2AGOA 2BDPA 1L5UA 3D1OA 4WZMA 2QLXA 2R7WA 3DLLQ 3OHBA 2BZ2A 4C8MA 2X1GA 2V0NA 2PMHA 4NLDA 5KT2A 4AL6A 1RT1B 1MWYA 1KFSA 1S6PB 3HVWA 2RH3A 2ZE2A 5LSLA 5DM6Q 3PR4A 1FXRA 4C8KA 4WYLA 1NK6A 4OJGA 2EFVA 3CCLS 1VC0A 4NYOA 2J7WA 1N5TA 2DR8A 3GE9A 5E3AA 1AW0A 3T19A 3M6WA 2EG2A 3PR5B 2M8DB 1FA0A 4W90B 1AFIA 1BQNB 1YJVA 2YKMA 3TA0A 4YOEA 2JDJA 2ROPA 3L95X 3CJKA 4B3SF 3KLEB 1EETA 2VBWA 4RU2A 1FNXH 1UL3A 1RISA 1X8DA 3S7RA 2VKRA 2AYGA 1G3OA 3IRXB 1Q82T 2R9LA 4DR3F 2VOPA 2CJ9A 2XMWA 3DXSX 5JUMA 1P9QC 2OD4A 1KTVA 5C24B 3S8SA 2EVZA 5IS2A 5HMYA 3GFYA 1C1BA 4PXBA 5EX3A 4CTAB 4HYKA 2LQBA 3LAMA 4WXWA 3DHXA 2LQJA 4F2RA 4YQWA 3MI7X 2R7RA 3E01A 2WSFC 3OHAA 3AH6A 1DAXA 2B9YA 4JYAF 1R8CA 3G6VA 4C98A 1UA1A 2FGCA 3R5AA 2ZH8A 2KHDA 2FVCA 5CH7B 4ZPCA 5KFDA 1OQ6A 4OLOA 5CHCB 3EZ5A 1V3RA 4DL5A 1VQ7S 2EBEA 3MM7B 1S48A 5AXKA 4U7CA 1NU4A 2KTQA 4F4ZA 2R7OA 2YNGA 3O2IA 1VFJA 3TYTA 5J2NA 4PWDA 1HBNA 3CC2S 1HBUB 4TYBA 4FF4A 5HBMA 4LMZA 1U47A 4WE1A 1B7FA 3HJFA 1JLAA 1B0PA 3LP1A 1SKSA 3BR9A 3IAM9 2A2CA 1VK3A 3QGPA 3LO3A 4A46A 3DYAA 5GAGU 3GFHA 1CQMA 4R0EA 3TNVA 2UUCF 1R0AB 5EDWA 2KDOA 1LWEB 4JI2F 3PJWA 1OPZA 3AA9A 2B6AA 3KWMA 4DR7F 1AUDA 1JKHA 1MMLA 4ZCLA 1UVJA 3IS9B 2KI2A 3D1QA 2ZD1A 1RTJB 2DGVA 1HFEL