2GGPA

Solution structure of the atx1-cu(i)-ccc2a complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
73
structure length
73
Chain Sequence
MAEIKHYQFNVVMTCSGCSGAVNKVLTKLEPDVSKIDISLEKQLVDVYTTLPYDFILEKIKKTGKEVRSGKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone, metal transport
molecule keywords Metal homeostasis factor ATX1
publication title The Atx1-Ccc2 complex is a metal-mediated protein-protein interaction.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 20
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ggpA00
4EFAC 1AFIA 4A46A 3HHLC 1P6TA 1R6YA 3HX9A 2K2PA 1IUJA 1JWWA 2G9OA 2AJ1A 4F67A 1X8DA 3HF5A 1AW0A 5B0AA 2OD6A 2OMOA 2N7YA 1GXUA 1YJUA 2GO8A 2N4DA 3QGPA 1Y3KA 2XMMA 4Q2MA 2W4DA 2KYZA 4DPOA 4OJ1A 1N5VA 1FVSA 3UDCA 1XBWA 3IWLA 1N5SA 2AW0A 2BBEA 1FESA 1MWYA 3DCAA 2GV1A 1LQ9A 1TZ0A 1YG0A 1URRA 2N4CA 3LGMA 3TOQA 1QUPA 1SB6A 5K9FA 2LQ9A 4Y2IA 4OJGA 4OJ3A 1X0PA 2KT2A 4YEAA 2ACYA 1SI9A 2RILA 1TUVA 2QLWA 2XMKA 2FHMA 3BF4A 2FB0A 1V3ZA 1KVIA 1FEEA 2ROGA 3BDEA 3MCSA 4NPOA 1ULRA 2K7KA 4FNIA 2IFXA 3TNVA 5B0CA 4NL5A 1Y3JA 2JDJA 1Q8LA 4A4JA 1JK9B 1Q53A 3F44A 1CC7A 5F0UA 2CRLA 2BUNA 1WD6A 2QYCA 1Q8BA 4QOTA 2LDIA 5A6PA 1VQSA 4HI2A 5KAKA 2AJ0A 2XMJA 4HI1A 1KQKA 2GA7A 4HH0A 2GGPB 2L3MA 2OKQA 4HL9A 2HLUA 2RMLA 2ROPA 1FE0A 1OSDA 1Q4RA 1FE4A 2GGPA 1FD8A 3BN7A 1SQEA 1AFJA 2ZDPA 4DN9A 2XMVA 3HDSA 1N5QA 1APSA 2ZDOA 5B0DA 1YJRA 3KKFA 1U7LA 2OFGX 2BJEA 2XMWA 3T9NA 1P8GA 2XMUA 1YJVA 2PGCA 3MZIA 1S6OA 1W2IA 3BB5A 5F0WA 5T7LB 1KVJA 1OQ3A 2HLTA 2W4CA 3BGUA 3HHLD 2OAUA 5T7LA 2LQBA 3IWXA 2HQIA 2GCFA 2OP5A 1RJJA 2GFFA 3LGNA 1MWZA 3TRGA 2HFNA 3FMBA 5A6WA 1Y9OA 4ZOSA 4Y2MA 4A47A 5B09A 4Y2KA 3KG0A 1YRXA 4FNHA 1VQYA 2HFOA 5B0BA 1CPZA 2QIFA 5B08A 3HHLB 1TR0A 2BJDA 5B0FA 2K1RA 2QLXA 1X7VA 3HHLA 1TL4A 3KG1A 2KT3A 3BM7A 3GZ7A 3KNGA 1YJTA 4HH1A 2W4PA 4ZA1A 4U9RA 3HFKA 2ASYA 2ROEA 4OJHA 4YDXA 2BYCA 1Y0HA 1GXTA 5IXUA 1TL5A 5B0EA 2LXFA 1OPZA 3DXSX 2K7JA 2OFHX 3E8OA 2Q3PA 2IYGA 1K0VA 2FIUA 1CC8A 3BR8A 2XMTA 2RSQA 4DL0C 4A48A 1OQ6A 4OIXA 2IYIA 3WDOA 2KKHA 5B0GA 3CJKB 1S6UA 2K1RB 4Q2LA 3CJKA 2AP6A 3QMQA 1N5TA 3K7RA 3LO3A 3FGVA 2FTRA 2VV5A 1FVQA 2OD4A 3I9ZA 2VH7A 2PD1A 2RU9A 3VTIA 3FRYA 2HIQA 2EW9A
chains in the Genus database with same CATH superfamily
4EFAC 2DNKA 2AWZA 4TYBA 5M2PA 1RTHA 1RYSA 3JQKA 4CO1A 4GO5X 2JX2A 4L6V3 2LLZA 3Q2TC 1MWQA 3CJTA 1Q86T 2DISA 3WC0A 1L3SA 2FYXA 5K5MA 4MYTA 1WHVA 2KHDA 4DWIA 1JKHB 3R5JB 1PO6A 3QQCD 3ET6B 2ZZNA 4IO1A 1P9QC 1I51B 3K8WA 5J2QA 4LF5J 4KV8A 5CAAA 1J5OB 1QTMA 3VAFA 2Z58B 3MPWA 5DO2A 2ASDA 5L38A 1WOPA 2CDQA 1JXVA 3W2VB 3QLHA 3RGIA 5J2PB 2QFJA 1RWMB 2AGPA 2KFYA 4GKKJ 1VISA 4YR0A 2DHAA 1U45A 2RB7A 2M70A 4PG6A 4N47A 2VBWA 3NGKA 4AL5A 3TX0A 3C66A 3LO3A 3VZHA 4DN0A 4X4PA 1C4CA 4CYUA 3CJ0A 3MMAB 4LF9J 2MQOA 2N4DA 4ICLB 3NXZA 5LT5A 2F8HA 3THPA 2XS7A 3N6NA 4B3OB 2J9EA 5RUBA 3ONQA 2BE2B 3MPDA 2VZ9A 1LXJA 4LREA 4RNNA 1Q0NA 2KG1A 3R6LB 1M5HA 3DLEA 3P3DA 2LFVA 4PXCA 2MSTA 1FE0A 1JLAB 2GVZB 2QJ3A 4LF1A 2CAJA 2XHCA 3KUGA 3D6TB 2AEMA 2V67A 2ZITA 4LJMA 5IT4A 4YDXA 4DLGA 1OY9A 3BBBA 1FF2A 4X64J 5H9FJ 3BV8A 5KG3A 4OIXA 1JLBB 4J7CA 3M8QB 1WSVA 5KG0A 3GR0A 3DLJA 5D77A 1KHVA 2KYZA 2MGZB 4KPYA 1U0HA 1WC1A 1VOMA 5DDRC 3H0PA 2RRBA 3K0JA 1D1UA 4RW6A 2CDRB 1T11A 2UUAJ 1PJ6A 5KFQA 3B6BA 5H9FK 5DDOC 3SV3A 2H5IB 3AT1B 1HQEA 1PAEX 4EI2A 3M1VB 4EYHB 3K5PA 3GV5B 3UI3A 5F41A 4FXDA 1HBMA 3OT9A 1O6XA 3UN5A 5D3GB 1JJ2R 4QYRA 4U9RA 3HFKA 4NLYA 2MQLA 2JSXA 2DH9A 1R8BA 1KFDA 4URGA 5C25A 3THTA 4M5JA 4DR7F 4K7QA 4KQZA 4TLQA 2YNFA 1KTQA 2F5GA 2GIQA 3UN2A 3HHLC 1IVZA 2NYIA 1RTHB 2DGTA 3K8VA 1H0HB 4ZKAA 4RU2A 4OX9J 2Z56B 2DRAA 1RAEB 3FEYB 4DUZF 2OJ3A 1E6YA 2B6AA 4I64A 5E3QA 4PRFA 3HLUA 1YJWS 3TNVA 3OBIA 1URNA 2LEBA 1KLMA 2B0GA 2JEGA 2RH3A 5J2QB 2XC9A 2FUG9 4KV8B 2EG1A 1KVJA 3T5HA 5GMEA 4E2FB 2QN6B 5KT3A 1UWBB 2MEWA 1P27B 2CQ3A 4M63A 3QLHB 2ZH5A 2B9EA 1AUSL 2ROEA 1IKVB 3I5CA 4RWXA 4JI5J 4A8XA 5I4MA 4DV3F 1GXTA 3NGSA 2JC1A 3Q8SB 1LW0A 4DX7A 4C48A 2HQGA 3AY0A 5EGYA 1WG4A 4ZN1A 3T19A 4HT7A 1IKWA 4CYUB 3BEGB 2UU9F 1RADB 2BOAA 3UR0A 1FEHA 4TLRA 4NMLA 3FQLA 4JI7J 1BGXT 2UUBJ 1WSRA 1XTZA 2LQ9A 3CJSA 3UDLA 4ERDA 3W8GA 3GR1A 1CC7A 3K89A 2NXCA 5F8IA 2QE5A 3R5BA 3ITHA 4Y34A 4DEZA 3NS7B 3TA2A 1D9FA 4C4WA 2JOQA 3LP1B 2XI3A 3NWGA 4A8SA 1ACMB 2CFXA 3OR1B 2C2NA 1VRUA 1TVRA 1VBZA 2GJFA 5LSOA 1TL4A 2PDAA 1R31A 4KY3A 1HLWA 2DHHA 3CIMA 1TFYA 5KFHA 4NYPA 1RAAB 4JI3F 1QUVA 4EK2A 1NK6A 3CW2C 2IRUA 4ETXA 4ZJOA 2PC6A 5M2UA 1WNEA 1WDDA 2B9WA 2IPOB 2RAQA 3HF5A 2IVYA 2BKOA 2M52A 1U0HB 1ZM2A 3DMJA 5IQ6A 1TZ0A 1F0XA 1FA0A 4ZLJA 4OJ3A 2DXFA 4LF8J 2ILYA 5DS7A 4LFCJ 4RW6B 2KT5A 2DHGA 2V69A 2RQMA 3JQMA 2EVZA 5L9NA 1LFPA 4Q7AA 1HQEB 3PY8A 1N4LA 2W01A 3VQSA 5B0DA 1NRKA 2ZJQQ 4ID5B 1GH8A 4GC7A 3TRGA 1HBMB 5A6WA 1Q8KA 3EZUA 3CWJA 2XG8A 1KBRA 1X7VA 1X5OA 4K4VA 4OYOA 5HMYA 3W3SA 5DQIA 5AXLA 5C25B 4DQQA 3S1TA 1Y5LB 3ZZOA 4FKXA 1S97A 2BJ3A 2YNFB 2MQMA 2BRKA 1DZ5A 2PE8A 4I56A 5LXRA 4XAKA 5GADI 2E7VA 1VYAA 2RS8A 4YN3B 3CUNA 2HWTA 3ZTSA 2HS0A 2BR0A 2AZ3A 2X1FA 1UZHA 4LRCA 4JV5J 1VBYA 5E2QA 1LWEB 1E6YB 2B6AB 2KH9A 4Y2IA 2GNKA 1NPRA 2D69A 1GMUA 4PKDB 3K57A 3RB3A 1NH7A 3NP5A 3AXMA 3W66A 4ED2A 1W2IA 1NPPA 2E66A 1JLQA 2VBXA 3U27A 1WEYA 2RU3A 4WE1A 4F4KA 3TZXA 1S9GA 5DETA 4U8VA 3OQ2A 2KFNA 1QAIA 4QR1A 3QAUA 2FLPA 2DNRA 1O51A 3HSGA 1C4AA 4WFBQ 4RJVA 2JRSA 3K7RA 1IKWB 1BD6A 3AH6A 9ATCB 3L9ZA 2J8AA 5ETTA 3U1MA 4KJIA 2VG6B 1P1TA 3CT9A 4P7VA 1VMBA 1FJEB 2A3JA 1VQNS 7AT1B 4ZPWR 4E98A 5EWFA 1X0FA 2PI5A 1AZSA 3TJ9A 4DL6A 1FNOA 1F6TA 4DMZA 1B0VA 3PJXA 1VCTA 2ADCA 3LPEA 3D3CJ 4LF5F 2XY7A 3G6YA 5AXMA 4DU7A 3D68A 4MKYA 3ISZA 3N01A 5G0RA 3KG4A 1V5IB 2P6SA 4TQRA 1AA1B 1FD2A 4BWJA 2E9RX 1VRUB 1TVRB 4GKKF 1OWXA 1B0TA 3SBMA 1GT8A 2GQQA 4IH7A 4QCLA 1CJTB 2HW3A 2IBKA 1X60A 2GMHA 4F26A 3HT3A 4LSZB 2MDAA 4LF9F 2WBMA 4NLOA 2GAHC 3H5XA 4I69A 1Q16B 3GFZA 4FYVB 3DMJB 1MN7A 2I6WA 1W25A 3ZZRA 2N82B 1B64A 2F4FA 1NKBA 1M90T 4IO9Q 3BF4A 3ISNC 2W8LA 2NSBA 3R7SB 3IBCB 1F3VA 2XEXA 1NHKL 4Y6IA 5D4LA 4IFYB 1RT6A 1T9XA 1FK9B 2DTJA 1Y7PA 3V6DA 4TQSA 3RR7A 2QL9B 2E5LJ 1HYSA 2GCFA 2OP5A 4WPAA 4ZPVR 3UDVA 4WTYA 1KTVA 2CJKA 3CCLS 5CYMA 3Q24A 4M5LA 3CPWR 2HHWA 4GMKA 2XSFA 3NCRA 4X4VA 4MIBA 4YDDB 1R0AB 1PAUB 3HT0A 3K5MA 3WQPA 5CZXA 2FIUA 4UQGA 2BACA 4LF2A 3H2LA 2Z2LA 4KYZA 4F3QA 1EIYB 1T02A 3TARA 1U26A 3MMBB 1JIHA 3CJ4A 2PD1A 4ANCA 4WJBA 3JQJA 3OV7A 1HKAA 5D0GA 5A2QY 3F56A 2CWXA 2VKZG 4FF2A 2ZBRA 4UZCA 2MJNA 1J5EJ 2YKOA 2LECA 1VI7A 2LYVA 2UUAF 1SC4B 3OLAA 1NXIA 3TJAA 1L3KA 4CLLA 5AE1A 2QLWA 4P10A 2BKNA 1F5AA 2Z2YB 1NK4A 1OSCA 3PDNA 3M8YA 4O0IA 2IJNA 4QOTA 4IQXA 2HGMA 2JVOA 1HA1A 1S79A 5SZTA 3EYZA 2VQFJ 1U1QA 1VDHA 3WIUA 2CA9A 1ZBTA 1H2VZ 4IOCQ 1JLQB 3DXBA 1VQYA 1TELA 3DRRA 3KG1A 3K58A 3CJ3A 1UFKA 3ZNJ1 3ENVA 2BQUA 4C3LA 3N9UC 3U1LA 1GNKA 1LWFB 2J7WA 5EDWA 4WZQA 2IRYA 3EE3A 2LQ5A 4PG4A 5GAGI 2FJAB 1T3OA 3VTIA 2X3GA 1Z4UA 4OX9F 4RX6A 5KFVA 2E29A 1Q79A 2DY1A 3BN4A 2KJWA 2WB4A 3DKDA 4JP8A 2R2SA 3PKYA 4EO6A 3MAHA 1RHQB 3E51A 1AZSB 1QUPA 1X0PA 1NZ8A 1NB7A 3KJQB 2HBRB 5CZVA 3MF5A 2J9DA 3B8HA 3TAMA 3I55S 1VRQC 4WFXA 4GRSA 2G13A 4HI1A 1XR6A 3CDUA 3FK4A 4OI2A 4OHXA 4MIWA 4K0KJ 2N3LA 4ECZA 1FTRA 1FRLA 2E44A 3LGNA 3RYLA 3PRBA 4JI5F 1YRXA 2AYMA 4HT5A 4DV7J 5IM0A 1RAFB 5KFOA 3JYTA 1T05A 1KOOA 3H4DA 4L75A 5DGAA 2EFQA 2CNOB 2R7WA 3GJSB 5DLFA 2Y0BB 2AZ1A 4PEOA 4R5PA 2EFVA 2Q66A 3LF0A 2CVEA 1ZH5A 4JI7F 2UUBF 5DGBA 4V19X 4ECUA 3BSOA 1S6QB 3UD3P 2YVSA 5IT9Y 4B9LA 1LXNA 2E9TA 2ZOFA 1TMJA 2XZDB 2PMWA 2DRBA 4OLOA 2GZOA 4ZVEA 2FB0A 2EG2A 1S72S 4J9LA 1LWCA 3GIRA 4I6YA 1ZPVA 4PG7A 4RZRA 1RT6B 2ZOGA 4ZCKA 5U47A 1TL7B 3N6LA 2DXDA 2W7OA 2UP1A 1QSYA 2B5JA 3Q83A 1KWMA 4DXLA 2Z0GA 3B82A 5F8NA 5AJ3J 2G2YA 1UJ5A 2KB2A 4N7TA 5CYMB 3BSCA 3EICA 2V9WA 4E8UA 1IKXA 2MSSA 1T9WA 3GP9A 3KJFB 2D3OR 4OX7A 1BMQB 1K0VA 2NZ4A 3KWMA 5CCLA 4C98A 3GCWP 2PA3A 2RDIA 3DDNA 4OI0A 3HULA 2XMAA 2QL7B 2LU1A 2V2QA 4TN2A 3MUTP 4IRCA 2VKRA 5C24A 3NGTA 4F0HA 4LR9A 2A6MA 4LF8F 4LFCF 3FCHA 5AXKA 3NS6A 4ES2A 1IBMJ 2YQ0A 3PO4A 4TU9A 3M8SA 4DV0J 4TY9A 3MCSA 2P8IA 3TVYA 2G1DA 2FLLA 4G6VB 3C2PA 1V5VA 1MW7A 4ZS6A 4QR2A 2WVFA 2XY6A 4NZ7A 2FHJD 1HI0P 2EFNA 4O3SA 1YRUA 3IWXA 3CEDA 2IM3A 3PEHA 4LR8A 1E6VA 3DYAA 2K06A 1JJ4A 4F50A 4YHHJ 4DX6A 3DRRB 2IHR1 2R8KA 1U6BA 1DY3A 1KQFB 4USKA 1VHFA 2C22A 4LSLA 2A2CA 4A48A 4JYAJ 2DB1A 3PJWA 3MM5A 3BH6B 5DG7A 1T94A 1N5YA 4JV5F 5I3QA 4A8QA 2YKMB 3LWLA 1KS2A 2R8HA 3KTQA 2GJ2A 4OYBA 2W4DA 3C19A 4FPIA 1RXOB 1WTFA 4HR2A 1RWPB 4DR6J 1KD1T 3AD7C 4PAAA 2YQ3A 4DS4A 3SEOA 3KLFA 2A2DA 3TAMB 2Y1RI 3RW7A 3PACA 1RK8A 2F8MA 2B51A 2RMLA 4YOEA 3PYFA 2CQDA 1APSA 5H9EJ 5HSPA 4K5SA 3CXCR 3NWRA 4NWBA 5IFMA 1OO0B 2DHXA 1T05B 2X7IA 3Q23A 5GAEI 1Z2ZA 4Z2XA 3IN5A 5ETPA 3BO3A 1IR2A 1R0BG 5KT6A 1HWLA 3HFZB 4CO5A 1ZAWA 2VQEF 3W65A 4DSEA 2CNKB 4R5PB 4K4ZA 3DRXA 5E7OB 1QTNB 5HI7A 4NA2A 5H9EK 2N7CA 2AX0A 3GG0A 1FVSA 1RHJB 2PO4A 3DHXA 1CEZA 3N5FA 4X84A 1KQGB 5LM7E 3D4JA 4BHQA 5GADU 2CJXB 2AYGA 4NRUA 1QVGR 1MSWD 3SIPB 5IQQA 2AYEA 5D0RA 3OUYB 1WELA 4MJKA 4OI6A 4TYAA 3KK3A 1ZM9A 2B5JB 2JC0A 4WKYA 2F40A 1UEUA 3BQ0A 1IN0A 1XQIA 5KFGA 2EBEA 3HHNB 3OTDA 1IKXB 3BKFA 3TQEA 2XYGB 3OSPA 2PEBA 2PA8D 1C2PA 1FX2A 2FJWA 4USJC 3N79A 2ZHBA 1H2TZ 2BRLA 3T1HJ 2HHPA 2P9GA 4AUKA 4CI0B 4C11A 3KHHA 2CJBA 3KMSA 4YUDA 1GX5A 1YX2A 1SH2A 2G9OA 2XM3A 3U02A 3VZIA 5JUMA 4UOGA 4O3PA 3GG1A 1VQ9S 5C42B 4I0WA 1SB6A 4C97A 3LAMA 3Q0AA 3KMQA 2FHMA 2V4JB 1VC0A 4L74A 5F3TA 3BPDA 4M1KA 1IWAA 2E5LF 4U7UD 4IOBA 4EZ6A 1U24A 1ELOA 3RUBL 1C1CB 1S6OA 4NXMJ 5T7LA 5GMKa 2FJEB 1RJJA 1X4FA 1E6VB 4M5GA 3DYAB 1WC0A 2D7SA 4MKVA 4ZVOB 3NGDA 2HHTA 3M9OB 3MWBA 4LSLB 3OXFA 4QU7A 2KVQE 2G4BA 1KR4A 2B8QA 3U1NA 2QA2A 3MUVP 4ZP6A 2J7UA 3KHLA 4ED4A 3WDOA 1RT2A 4DLEA 3MM5B 4XIUA 1N5TA 1ZS6A 4QIWD 5J1PA 3RB0A 1J5EF 3Q22A 4WZMA 3G2XA 1VGYA 4B3TJ 1Q78A 4NX9A 1YBTA 1JX4A 2IMOA 2YKNA 5J1EA 1NKCA 1WHYA 1YBAA 3M8PA 2J9CA 3KLFB 2CXEA 2VFRA 3LP0B 2CPDA 4DL5A 4RNFA 4WCEQ 4J90A 1TAQA 4NL5A 2G0JA 4F36A 1K1QA 2VQFF 4FF1A 4OYZA 1LK5A 3VAMA 4ZIWA 2KRRA 3M9MB 2UVVA 2B9XA 4ANEA 1TKTB 1UJ6A 5DDPC 3OSNA 3TZWA 2UZAA 4U96A 4IQMA 2FJVA 1U1KA 2CPFA 4ZOSA 3UCZP 3X3UA 1CPZA 4C8NA 5IT0A 2K1RA 4L73A 4RW8A 3KNGA 1VQLS 3VAKA 3V2UC 2MZ1A 3HVRA 3E8OA 1FTCA 2Q3PA 4OV6A 3R2DJ 2YNIA 2LEAA 2DH8A 1VBXA 1G7CB 2FJDB 4OX6A 4ID8A 1B99A 2WRMA 1EKSA 2OPQB 3MM9A 1U49A 4PWDA 2AJ1A 3SCIE 4GO7X 3QWUA 3J81Y 3QGPA 4P73A 3HK2A 3IWLA 4HHHA 1DQ8A 3KLVA 1ZA1B 2DNPA 1GX6A 1DURA 1HBNA 1PYOB 3GMGA 1EQMA 2BV3A 4A8YA 1XK8A 1D09B 2J0XA 1IBKJ 4FXWA 2MPUA 2DR5A 1HHSA 2GC8A 3DGVA 4V19J 2EWHA 3VQTA 4K0KF 2BUNA 2LDIA 5KAKA 3ZTQA 3KK3B 4F0KA 1ZA2B 4CNZA 4ZCMA 2QX0A 1YJVA 4DV7F 4A8OA 2WZ1A 3D54A 3M9NB 3TUIC 2R8GA 3NNAA 2H9ZA 4AQYJ 3FKBA 4DHVA 3KLIA 5HVHA 5BYSA 3J80Y 1U1LA 3HVTA 3KNAA 2Y1JA 4CO2A 4L3NA 3WC2A 2CZ9A 1GK8A 1KEKA 4C11B 3OL9A 4U95A 1WKKA 2HNDB 5CABA 1N32F 2YWFA 5ETSA 3H5SA 4C8MA 2B4VA 4HKQA 2GV1A 1HMVA 2BQ3A 1RTIA 3AXKA 3BO4A 1YVFA 2KT2A 1D8YA 1S76D 4N76A 5CH7B 2BZ2A 3CCJS 5IC6B 1NM2A 2HFUA 4DR4J 2OMLA 2OKQA 2L3MA 1VHIA 1WJ9A 4TU7A 5HVFA 4DCPB 2HK2A 5T7LB 2ZJPQ 3IA0A 5HMZA 3HHLD 1FDDA 3R1LA 3E01A 5AE2A 4N56A 2Y8WA 4NLUA 3ULHA 3HHLA 1T95A 2HHXA 2I9SA 3G9CA 3M4XA 4OYIA 1NH8A 4LUBA 4DV4J 1DJ0A 3THVA 4JI0J 1RT2B 4QIFA 1OQ6A 1SV5B 5B0GA 2VG7A 1FJGJ 3MAAA 2L48A 4C0OC 2J6SA 2L41A 3RRHA 2KYXA 1ZTTA 2CQHA 2I5JA 2R7SA 4O4GA 2FVCA 1FRXA 1IBMF 4RW7A 5J1EB 3V81B 4DV0F 3Q8PB 3RAQA 3UCUP 3M8PB 3QYYA 4DSFA 2JVRA 3I4PA 1Y5IB 2E1AA 3IM8A 2VPWB 2Q6CA 2E1CA 4IYQA 3R5AA 4ZJLA 4RKUC 5C5JA 1PC4A 1Q81T 4HHUA 4YHHF 2BJ8A 2W4CA 2EXUA 4AL6A 2RD5C 1YJ9S 4WXWA 3V6KA 1LV5A 3W9HA 2NLWA 4Q5VA 4B3SJ 3G82A 5EN1A 1IR1A 4M5NA 4CIOA 3QIPA 3HZGA 4P2SA 3GQCA 4JYAF 4GVLA 1LW2A 5EUHA 1RQ0A 3H2UB 2LXFA 3HSDA 3A8KA 4UT4A 4QR0A 3J7YI 1FFSB 1VQKS 5HROA 3MM9B 2RRAA 2QG9B 4DPWA 5D8HB 2MZRA 4M5DA 1FT8A 5HLFB 2J7KA 2OD6A 3CCZA 1F5CA 4DR6F 1IKYA 4RBUA 2YWEA 1A0OB 3G6ES 2H1YA 2E5IA 1T9UA 3CCTA 4BLGA 2Y9HA 5DQGA 3GSIA 3H5UA 2ZKUA 1C1BA 1IXKA 4C3KA 1HD1A 2IJRA 4GVBA 4CWBA 4K50A 2DD8S 3ADAC 1UA0A 1JLCA 3SFGA 1NDKA 2WONA 2NPIA 3O6QA 1DTTB 4DN9A 3KDNA 1FXDA 2CZ4A 2H5EA 3BGRA 3CD0A 4KGMA 3PJ9A 4I4BA 3KJVA 1REGX 3KLIB 1K8AT 2FLNA 5ETNA 4DDFA 1N34J 2O3DA 3NBPA 3M8ZA 4EUVA 3HVTB 2R9LA 3AD8C 4DSIA 2WAQD 2XWXA 3ZFVA 2M5YA 3OFFA 1HHQA 3CDBA 3RJMB 1WC5A 4UTGA 2KKHA 3AB4B 3HVAA 3M2UA 2ZFHA 2CG4A 4RPFA 3J7Z5 1TFWA 3QRQA 3HSJA 1Y00A 5LMUF 1FESA 1HMVB 4EBCA 1RTIB 3T3FA 1DHMA 1HNXJ 3PO5A 3NMRA 1WC3A 1QY7A 2ACYA 1VQPS 1G2EA 3KK1A 4QW8A 3LWMA 2OTLS 2DJWA 4LF4J 3DGPA 2W9BA 4NASA 1RP5A 5HN0A 3KUHA 2KTQA 2XS5A 2KDOA 1HD0A 4KGKA 1ZOTA 2FC8A 4X4SA 1WUUA 2DH7A 2XO6A 2J5AA 4K4XA 1EJ7L 3E01B 2ASJA 2VPYB 1MMNA 2FGOA 3FNNA 5B08A 3HHLB 2DIVA 3QT8A 2VFUA 5BJRA 3DU5A 2OPPB 2Z2MA 3MPUB 3Q89A 2ZH8A 3T1HF 3K5LA 3IWNC 4WIIA 1GEHA 4WU3A 4RW9A 1ZAXA 3MAAB 2GIFA 3PZPA 2BW2A 2AGQA 4UQTA 3ILOA 5GAEU 1WF0A 3KLGA 2OPRA 2Q43A 4O44A 5D0EA 2VC0A 3DU6A 4HDGA 2CPJA 1EZZB 2BX6A 3IO1A 3CTRA 3MUMP 1H73A 5D0HA 3PV8A 2C2ZB 3MPVA 1SKUB 2HNZA 1HFEL 3GFYA 4C8YA 2D9OA 3EGNA 2OH2A 1JK9B 2NZCA 3MR7A 4ZPAA 4QYZJ 4NXMF 1RTZA 3CJQA 4KC5A 1Q4RA 4RNOA 4ZPBA 1UZDA 2XMWA 4C8LA 3H8YA 3NCQA 2Z57B 1R8HA 3A3PB 1S9EA 3QIPB 1RT3A 2XZWA 3H42A 2V2ZA 5HANA 3PYGA 1TKZA 1JLEA 1ZYQA 1JNZB 1YIJS 3IC1A 1C0TB 5KFDA 4DF8A 2XGQA 4ECXA 4NA1A 5HROB 3V5RA 4B3TF 1S4EA 3KLEA 4Q45A 1HBOA 3FSIA 5CXTA 4M5DB 1GTHA 2EW9A 1TKDA 3PFEA 2XB2D 1IKYB 2KZZA 4I6AA 1NK0A 2XNRA 2HVDA 1EETB 1KP6A 4O3OA 3MMCA 3LGMA 3ILJA 2FJBB 1VQ5S 3MXHP 1EB0A 5KFJA 2AHOB 1V3ZA 2ASLA 3FSXA 2LU2A 4GVBB 2NXEA 1CQNA 1RWVB 3LW5C 4F4ZA 4LBIA 4B9MA 1NK8A 4RWWA 1JLCB 2DO0A 1R0CB 2WVBA 4KR0B 4KFBA 1NEEA 3BR9A 3RW6A 1Y10A 2ZHAA 4ZHRA 1SUQB 4A47A 1V3RA 3BJYA 2DXEA 2R2UA 3NBPB 2KT3A 2HQ3A 1UAWA 3EGZA 2UVUA 5IXUA 4KH0B 3ISND 1SC3B 1MN9A 1H7WA 3M2UB 2CJYB 3CJKA 4QBUA 1G1XA 4FP9A 1XNQJ 3R6GB 3TAQA 1UP1A 4KRWA 2LMIA 2V63A 4ES1A 5B0AA 3EXCX 1VQ7S 2FDNA 3OXGA 4K4YA 2QFIA 3KK1B 3M32A 4JOUA 2F8EX 4TVAB 4DR1J 3DGPB 2KU7A 2W9BB 2CG8A 3R8YA 4WP3A 3CO0P 3T6JA 1LFWA 2RF2B 4O0NA 5IV3A 2BMBA 4CNYA 3T5KA 4DPUA 2GGPA 4ZVSB 4AQYF 1RU2A 4OI3A 4P2XA 3N4WA 1NKEA 4ZVGA 2WSFC 5KFCA 1IM4A 4RNHA 1U6FA 1NSQA 4DQPA 3CCRS 1I5OB 1XJWB 3W60A 5THWA 3AOCA 1REVB 3NKYA 1SH0A 3QFHA 3BBCA 3MMAA 5KFFA 4RW9B 2R42A 1TUGB 2MKCA 4ZVFA 1WKLA 2XLKA 1J27A 4EGLA 5JMNA 1IBCB 3IFEA 3TR5A 4DV6J 1IUJA 4ZCLA 2QMXA 2OPRB 4O44B 2MQNA 2CQ2A 2XQCA 3DLHA 5A8WA 1XBWA 1VBKA 1YJNS 4WF9Q 1DRZA 1OJ4A 3TEHB 2HNZB 4ED8A 4PCQA 4DR4F 1M1HA 3ENAA 1N48A 2K7KA 2M0GB 2JLGA 2YX1A 3D2WA 3MTKA 4JV2A 1N54B 4RR5A 2FJXA 2M2BA 3IR6B 1FERA 4LQ9A 3GE9A 2Q79A 4H4KC 5KFZA 4WP9A 1K0TA 1JQGA 2YWKA 4WFYA 4N41A 1S9EB 1JLBA 1VK3A 4DU8A 2LQJA 4WYLA 4C8OA 4DV4F 3M8QA 2MHEA 4P52A 4F0MA 1RT3B 2DNYA 3EDQB 1S0OA 4JI0F 4HH1A 4QIGA 1RKJA 1H98A 5KFSA 1TKZB 1JLEB 1NDCA 1FJGF 1P1LA 4OL8A 4ZVRB 3UWTA 2MGZA 2MZJA 1S6UA 3KLEB 1OY8A 1UEKA 4P75A 1HBOB 4ES3A 3A12A 4KO0A 2LVWA 2NSCA 3SI8A 3HMJG 1NJWA 2BJ9A 5L39A 4Q2MA 5IV4A 1FNXH 1UVKA 3RRGA 4RW4B 2AF6A 4O3QA 4K4WA 1KHWA 1RT5B 2YWWA 2V4QA 1CQMA 3EVOA 4X4NA 3CMES 3G8TA 4ECRA 4G1IA 2ROGA 2V8GA 1BE4A 2B43A 4U6PA 4X66J 5D3GA 1N33F 2MY8A 4KFBB 3M2VA 1N6QB 4LMZA 4B3SF 4RNMA 5GVQA 2AX1A 4LQ3A 4LVOP 1KSPA 4J37A 3DM2A 4ZHRB 2DGSA 4LRAA 4YMEA 3IAM9 3SCJE 3AB2B 3BZQA 2ZM6F 3SV4A 2ZVSA 1WF1A 1DARA 1T3NA 2DBBA 4OI4A 3EX7B 4O3RA 4NCGB 4FVMA 5HBMA 4BC9A 4FYDA 4DSLA 1CC8A 2VOPA 3W9JA 3CJKB 3VVTA 4YFUA 4W4MA 3H90A 1G6BA 3QMQA 2YKPA 4FVCA 4H4OA 2CPEA 1PSDA 1WDTA 2Q6BA 2ILZA 4WTOB 3FEXB 3I31A 1VQ8S 1ZZNA 2PFFB 2DHSA 1YJUA 3IRXA 1H3DA 3JS9A 4O3NA 1T03B 3UDCA 1FKAF 4JV0A 4B3RJ 4DFPA 1X9MA 3D0IE 2QTWA 3AJDA 1KRPA 2OELA 3DNCA 1XNRJ 1RCXB 3RR8A 3M32B 1TUVA 1HBUA 1HWUA 4KGVB 5I3UB 2DGWA 4OHZA 5H1SV 2JZ5A 1S49A 2XGPA 4J9VA 4ZDNA 4X2BA 1UWBA 2NXNA 4KAIA 3RBDA 3C8YA 4J9PA 2DNLA 2GGPB 3SYZA 4CCHA 2PFDA 1U1PA 3HDSA 1SH3A 2CQ0A 1IKVA 1P8GA 2MKYA 4DV5J 3BGUA 1N34F 2DITA 1HNWJ 2XS2A 3US5A 1IQZA 1IQTA 2PIIA 3ETMA 3QAEA 4OX8A 3D28A 2KRBA 1X4AA 2VC1A 3D3BJ 1TL1B 2SXLA 1TL5A 4MFBA 3CJRA 3EGVA 3CDWA 3UFCX 5E3RA 1SJ3P 5KG2A 1VIXA 3MD1A 3Q8RB 2GMJA 2OD4A 2DGXA 1JB0C 1S7HA 2CQBA 1U1MA 2QLBB 3P6YC 4DCOB 3NL0A 2VG5B 1HNXF 1X4GA 4OZ5A 2C1EB 2FZKB 5A8WB 2VDIA 1KVKA 3J7YU 1S6PB 1HIYA 2VPZB 4GKJF 3EM1A 4LF4F 4YEAA 3LP1A 4Y2AA 2V8DA 2HEKA 3OR1A 1Y3JA 1F1BB 2FC9A 5IOLA 3ZZYA 4MKAA 4HVZA 3WBZA 4DBQA 1FD8A 1SQEA 4I2QA 4JBCA 1N52B 4HEA9 3HHEA 1RKIA 4DJBA 2HFNA 3L09A 3VGSA 1R6VA 1UVMA 4ELTA 5L1JA 3UD4P 3RU0A 2YX4A 1VS3A 2W1BA 4NOHA 3EUNA 2QC3A 4ELVA 2W9CB 4B08A 2VPXB 4LR7A 3S01A 2HIQA 2AEJA 4KO0B 1R6YA 1SCJB 2I2YA 4PYAA 2HIYA 2VONA 3HD1A 2DGVA 2YKAA 2P2CB 5KFIA 1HR0J 1CG2A 5CYJA 2OEJA 4DFJA 5D4NA 2LXIA 2DT9A 2WW4A 3BREA 1NZAA 4ID5A 1BC6A 3CD7A 4IRKA 4F3MA 4HTIA 3T5JA 1NK5A 2H4YB 5FJ4A 5DZ6A 3M2VB 1I3OB 4K5RA 4R0JA 2ZDPA 2MZSA 4DSKA 1X5TA 3DM2B 2LQBA 1MWZA 2VA2A 4YP3A 1FRKA 4H54A 3A3NB 4YY3J 1SJQA 3R9LA 5D4OA 3JTPA 4DQSA 4KB7A 3PCOB 5HBMB 3OTEA 4C3MA 4HHJA 2GHVC 1RTJA 3MHYA 3HO1A 1LWEA 3GONA 4H4OB 5A8RB 1PJ5A 1R8AA 4PWUA 3JTNA 3VAHA 3IRXB 4BDPA 2J9DE 1GMVA 4C8ZA 2HZVA 4CRJA 1NK7A 4DL7A 2QL5B 3CCQS 4JI4J 1HBUB 3L95X 1SI9A 2HK3A 2NREA 2FHKA 4MT1A 3S6EA 4F4WA 4PZVA 3LPYA 3VGVA 3JSBA 4HL9A 1RT4A 3HVWA 1U7LA 1OQ3A 3TP2A 1MNEA 4U8YA 1HWJA 2HRYA 4F3OA 3ILIA 3QWPA 4JI1J 2K3IA 4AXIA 3TVKA 2ACMA 3BM7A 1RACB 3DOKA 2VG6A 4MFBB 5CD4A 1MMLA 3QBCA 4ANDA 5LOQA 3RAXA 4DFMA 1RUSA 1XNQF 2BE9B 4IUFA 5CD4H 2MLZA 4UY8T 4Q43A 4QIVA 5K20B 3OR2A 2HGNA 1VIOA 3W2WB 1I1GA 2WBRA 1JLFA 3PYEA 2U1AA 3K59A 2BOPA 1FXRA 3C14A 3PX6A 1YITS 3QJPA 2MZQA 4I68A 4DR1F 3MEDA 1NO8A 5MAOA 2XCAA 3MOJB 2UXBJ 4CLSA 2D74B 1FXLA 1WD6A 1YK9A 2QO3A 4FF4A 4I2QB 5AE3A 3ELHA 4KKOA 3K2YA 3T1YJ 4NLTA 2VDHA 6FDRA 1CJTA 3CD6S 3D6FB 3C3LA 1TTHB 3FMBA 5B09A 1Q5YA 1ROFA 1KC8T 2ZH1A 4CH0S 1EP4A 2HBQB 1WOSA 1WG1A 5LJ3Y 3DXSX 4UW2A 3A13A 4ZVHA 2JNJA 1HW8A 4DV6F 4ZITA 4G3IA 2B4OA 1R7IA 3CMAS 3V6HA 1AW0A 3HXMA 2WHOA 3MFIA 2DR9A 3VV2B 4IFYA 3NMAA 1UEVA 1WI6A 1FK9A 2K8GA 2QA4G 3CDEA 4X65J 4RBTA 2WVEA 5K8PA 5ETRA 4CLTA 1FEEA 2ZUAA 3FFIA 1KFSA 4DR2J 2G2ZA 1VQSA 3UPFA 2MLYA 3P5TL 3PTWA 4XPEA 2W2OP 2ZDOA 3T9NA 1L3TA 1WORA 1R0AA 3FSYA 4QWCA 2YH0A 2C3PA 3W64A 3MMBA 5EWGA 2W7AA 2QLJB 3GYXB 1R8CA 3CCVS 3OTCA 1YSJA 4FYXB 1RTJB 1HQUA 3MM6B 2DGUA 3BR8A 1D9AA 5IS2A 2RSQA 3VAGA 1VQOS 2ZZTA 3LH2S 2EI5A 3HI9A 3FBFA 1S99A 2JFDA 4YB1P 2XI2A 3P45B 4NZ6A 3QGHA 3PVXA 3OW2R 2H51B 1CJUA 7FD1A 5E0OA 2R3VA 2QA4S 2OEKA 5K8NA 1FWLA 2HHHJ 4WFAQ 5L46A 1PKUA 3BBFA 4ZJQA 4OZ1A 3PIOQ 4X66F 1LNQA 2CJ9A 2BANA 5KG1A 2XY5A 3SQOP 2ZWPA 2HNYA 2CQ4A 1X4CA 3HHDA 3CO9A 3K17A 4OZ3A 1RT4B 4KIAA 4N8NA 3G8QA 2EFGA 3JXOA 5DLGA 3MM7B 4OQJA 1RWWB 2D1CA 2X1GA 3PEJA 1LWFA 2A18A 4LBPA 5D78A 1S1VA 3M6XA 1K47A 3K5OA 1A9NB 2VJVA 1X9SA 1X4DA 4CTAB 3W9IA 3DOKB 3DLGB 3M6UA 2VQEJ 2E1RA 3PYDA 2RE1A 4R25A 3ENQA 3N5BA 2HQCA 2U2FA 2HMIA 4K2JA 2PN6A 1S4FA 2WW8A 1BHNA 3OR2B 5JVHQ 4B3RF 1I6JA 3T5LA 3D1HA 1UJ4A 1JLFB 2OMOA 5C7PA 3HPOA 1N8RT 4F8RA 1XNRF 2GW8A 3C14B 3SSRA 2BBEA 3ZTOA 3H2VE 3MEDB 5KTQA 2HQFA 2XSJB 2OSRA 2HRUA 1T7PA 2V0NA 1U09A 3R5DA 2UV8G 2JDJA 4DV5F 4QPXA 4KKOB 1HNWF 1OSDA 3MR3A 1RAGB 1SJRA 4WIQA 2MKHA 3AD9C 1PCAA 2E1MC 1QE1A 3GWCA 2XZTB 3DN9A 4W98A 3JAMU 1H38A 1YBUA 1IJFB 1EP4B 5HL7Q 3WZ0A 2PMHA 5K14A 1EX8A 4N77A 3BYPA 4EBDA 2DNGA 3VAIA 5EX0A 3J81U 1S6QA 4DL0C 4FS1A 2UV8A 3UE2A 1U1NA 3D66A 5C2GA 4NRTA 1IM6A 1FI4A 3FRYA 2ADBA 5EX3A 2R2RA 1JWWA 3AFGA 4J9MA 3V4IB 4DV2J 1GXUA 4PXEA 2R7VA 1C0UA 3CCSS 2YQ1A 4USIA 3CCES 2GQ2A 2IVFB 4JI8J 4KH1B 4CO4A 2NUHA 1XIQA 4IOAQ 1TL7A 2J6UA 3F41A 4WFNQ 2HVEA 3M8WA 3AHPA 3FFIB 2UXDJ 2AV5A 2HS3A 2LA6A 1YGYA 3KJNB 2G0CA 3BO2A 2BKPA 3OTOJ 1RAIB 2AGOA 4P72A 4MK7A 5HVGA 2Z8QA 2WK4A 2V8PA 2QZ8A 3KKFA 3MEGA 4ZP8A 3IP0A 4X4QA 1UTAA 1L3UA 3JB9k 2IC3A 1Y4ZB 4TU8A 3VGTA 4ED7A 1WEZA 3M30A 3FZBA 4CDIA 1HQUB 5L1IA 1HNVA 3H59A 4DF4A 3DRSA 2HVIA 3PFOA 1BQNA 5AXNA 3RB4A 4M94A 4IG3A 2CPHA 2MKKA 2M8HA 1DTQB 5KG7A 3CSKA 4J9UE 1HR0F 1YRTA 2ZD1A 4KHPJ 3W7BA 1XR7A 1CJUB 4YB5A 1D9DA 2ZBQA 3S7RA 1MWYA 2Z30B 2BDPA 2CKWA 2BANB 3HCXA 1FFWB 1WHWA 2CJAA 4F04B 2HNYB 4PPZA 5KT7A 2AJQA 1BWVA 2PI4A 4NXNJ 3W8PA 3BN7A 3CGIA 3FBEA 4ZMMA 4YY3F 4H4MB 4Z37A 1S1VB 1WC6A 2R2TA 2Y0SD 3SFUA 3I87A 4NLDA 4FN5A 2IDLA 3DLKB 2YKMA 3MPYA 2F65A 3TYTA 3L7PA 4ENOA 2HMIB 2APOA 2YXLA 3W5ZA 2XBPA 2OEMA 1GAOA 1RTDA 4IG0A 2C3UA 3I0SB 5KT5A 2KI2A 3C16A 4JI4F 4UOCA 2ZJRQ 2RRNA 1UPMB 2CQPA 2F63A 3DRYA 1BQMB 1YTYA 2V8VA 2OIHA 5DM6Q 4KHMA 5CA5A 4WFZA 5KOWA 2G0IA 1VC6A 1EQ0A 1FKPA 3VVUA 1AT1B 3PRVA 5A0YA 1U47A 2FPHX 3MECA 5F8LA 1AFJA 4EZ9A 2COLA 2NYHA 4LSNB 4ZVTB 3EPIA 4JI1F 1QE1B 2WSEC 2JWNA 2H3EB 5EWEA 2HFOA 3ZZ0A 2IIHA 3NNHA 4ATNA 5K14B 3BS9A 4NLRA 1BLUA 3A8JA 4JUZA 2BA9A 2P9EA 3M05A 3M8RA 2ZH4A 3I82A 3F73A 4B9UA 2EBGA 1N32J 4PUOA 1T0TV 5FLXU 2IDEA 2IAJA 2O66A 2CPXA 2ZC3A 4P71A 4X4TA 2V94A 1AFIA 2BJ1A 5T14A 1X8DA 2FY1A 1YKWA 3FCVA 3GFXA 1Y3KA 4XDCA 1X31C 1C0UB 4PQAA 4DPOA 1N5SA 3DHWC 2DY9A 3TA1A 3OUYA 2FVPA 4MH8A 2UXBF 4MK8A 1VJQA 1DQAA 3MCMA 3B54A 3CD5A 3V6JA 4ZPDA 3O3LA 3D1OA 4Q0BA 3H40A 2YTCA 3DRPB 3T1YF 5J1NA 4KSEB 4QWBA 4YS2A 1HARA 3FQKA 4HI2A 3MGJA 1KQKA 2FZGB 2OUGA 1Q95G 2EKYA 5HAOA 3RRKA 2OPSA 3SCLE 3MEGB 2RQ4A 1P9YA 2FVRA 1DLOA 3IG1B 3LQVA 1DFDA 1MU2A 4XPCA 2IC3B 4IH6A 3M30B 3ZNUA 2JEIA 3KFWX 4I67A 3MM8A 1T8EA 2O1PA 1SXLA 3OJSA 2YPYA 3OJUA 5HP1A 1HNVB 4RUBA 4FZVA 4Y65A 3DRSB 3KUEA 3R3TA 1M5PC 5KG6A 3LTOA 1BQNB 5KFYA 1MG7A 3D7SB 4HACA 5C42A 4IG3B 1S1UA 4QZVB 3M6WA 1TV6A 3UVJB 4ZLNA 4NCBA 3NS5A 4F4YA 2ZD1B 2QEXS 3UR3C 3FDSA 3CF5Q 2V4JA 2F9JA 1QSSA 4X65F 2CQCA 3IRWP 3TUZC 3ZZUA 5IC4B 2IM0A 3P4UB 4NLGA 4DR2F 4ED5A 2RILA 3KLHB 1C1CA 3R97A 3TWZA 3CB4A 5FD1A 3CJ2A 1Q8LA 4QWEA 3Q86A 2FHJA 3SSQA 1FRIA 8RUCA 1EARA 4V1Ak 1EAYC 4HYKA 1F3FA 5KG5A 3IGNA 3DOMA 3NCPA 2AT1B 2GFFA 3FVYA 1UW4A 1Y9OA 3I0RA 3MD3A 4M5IA 1RI7A 2XTJP 5F8MA 1FNMA 4ED6A 4OZJA 3G6VA 4EYIB 1RU1A 3D9BA 4ZA1A 2NCKL 2E5HA 2R7UA 5E3AA 4LIRA 1M1GA 3I56S 1HNZJ 4IFVB 1RTDB 4IG0B 2V6AA 3VGUA 2HRTA 4PYDA 2HHHF 3C16B 3LP0A 3NOGA 4WWSA 2ZH2A 3DDIA 4DFKA 2QYGA 4Y00A 4J9NA 1TKTA 1IBLJ 4ECYA 2V4RA 1LEOA 4PPDA 2RJZA 4ECTA 1FKPB 5A0YB 4KGZB 3MECB 1UW9A 2W2QP 4F7VA 1SL2A 2XMVA 2DO4A 3CCWA 3CE8A 3EZ5A 2I8EA 1TK8A 1PBAA 2ZNYA 1B7YB 1SC6A 3MR5A 4RUAA 4FNHA 3O5TB 4UF4A 4C7QA 2G1HA 3GIKA 2QLXA 5J2NA 2VUGA 3FJ2A 1U2FA 2OPQA 3IMQJ 2R7TA 1RT1A 1NJYA 4L76A 3J81j 2CQIA 3C6TA 4PUOB 2HHQA 1S0VA 2VICA 1UL3A 2HS4A 2IY5B 2R7QA 4NEZA 2IAJB 4AXJA 3LGHA 2N3OA 5LMUJ 3HKWA 2XULA 2UUCF 3A8EA 1JLGA 4ZP9A 2VBYA 4TY8A 2RUGA 1SKSA 4ECSA 1S10A 1LWXA 4H4KA 1KONA 2VFSA 5EHHA 2C2MB 2WOMA 4Q0BB 3VCDA 2HAFA 1MMDA 3GSDA 2RUSA 1U2CA 2RVJA 4B9NA 4CO0A 4CLPA 1N88A 2OPSB 1KLNA 2ROPA 4X4UA 1DLOB 3PW7A 4W92B 1MU2B 1UPPA 2HAIA 2DNOA 2LXUA 2MXYA 3VALA 5M2RA 3DLEB 2RNEA 2C2DA 3MM8B 1UVJA 2R8JA 2JH3A 4CQ1A 4YB7A 3CIZA 4YQWA 1SPBP 2NPFA 2HNDA 4MK9A 5HP1B 1H2UX 2M4MA 3QZ7A 5ETOA 5F8GA 4HACB 3AOAA 1S1UB 3M2RA 1HW9A 1TV6B 3MR2A 4DV2F 3O2IA 4ZLPA 4JI8F 2DVIA 4Q8EA 2V50A 2FD2A 2J8SA 4NA3A 5KFMA 4A8FA 4D3HA 1LKZA 1KN6A 1U48A 1NLKL 3I6PA 2UXDF 5F8HA 4JI2J 5BR8F 5JVGQ 4NEYA 5KFXA 5G4DA 4X62F 3D67A 3IAS9 3OTOF 4NLQA 1ULRA 3GCXP 4X4OA 4CH1A 4NLWA 3TJ8A 2BABA 3DLBA 2QLFB 1S1WA 3IM9A 4DX8H 3G6XA 4OV1A 1NMEB 2MJUA 2KL8A 2E5JA 1U4BA 2JLFA 2F1FA 5DJBA 5ETVA 4LT6A 3QIDA 3DOMB 3GLJA 2C2KB 1T9VA 5HO4A 3EVWA 1XMBA 2GHPA 3I0RB 2CPYA 3PW4A 1SV5A 2R4FA 1FJ7A 3EJMA 2KM8C 2LCWA 2W4PA 2B9YA 3MMJA 1Y11A 4OYPA 2RS2A 3ZZPA 5LXYA 3CNQP 4B3MJ 3MFHA 4KHPF 4NYZA 2DNQA 3V81A 1UVLA 1J2VA 3AOBA 3L3CA 3W5XA 1U25A 3CCUS 1W26A 4AFFA 4N5SA 1Q82T 1F9EB 2CPZA 4LVNP 1S77D 1RWNB 2CVIA 2M7SA 3HFVA 4FYWB 2F9DA 2ALZA 2GS8A 4OLPA 1CBKA 1FDNA 2DNZA 1VFJA 4NXNF 3CVKA 1KDNA 2L9WA 4BS2A 2YPZA 1B3TA 4ZP7A 1CJVA 2KN4A 4ZVUB 5A8KA 1R89A 2UUTA 2OI2A 2JL9A 2BJEA 3HKZD 3FEZA 5HMXA 3T9ZA 1EHWA 3H25A 3FUYA 1RWUA 2LEPA 2QIFA 1KLMB 5GMDA 5J2NB 4OZ2A 4EBEA 1ZTWA 4CM2A 4C0BA 1X5PA 1RT1B 2HHSA 1U1OA 5HLFA 2MYFA 5B0EA 3C6TB 1GFWB 4RO0A 5E41A 4L3KA 1MLAA 3UO0A 4TKTA 3PG9A 4RUHA 2W9AA 4XTTA 2FVQA 2B3TB 3JSMA 5MLCV 5DG9A 1KVIA 2AD9A 4W90B 1JLGB 2KHCA 4J9KA 1B4SA 3BKUA 3D6MB 1LW0B 1SKRA 4TY8B 1I94J 2DRDA 2VF3A 3Q2SC 2A10A 1K73T 1N5VA 4O23A 1T9TA 2AMCB 3Q8VA 2EC2A 5DRKA 1PGZA 2JEFA 1DTTA 2DGQA 2WOMB 1D0EA 5J2MA 3ENWA 5ITHA 3OL7A 2I38A 4CLYA 1RISA 3PNIA 3BYRA 4WK3A 3H7HB 1RHKB 1HQ2A 1Q1KA 1KKHA 1RDRA 4YB6A 4HH0A 3B4DA 2HWIA 3GYNA 4Z7YA 4J9OA 5HK4A 3HP6A 2BXJA 1R27B 1BY9A 2F4VJ 2C3OA 3LALA 2EK1A 1CULA 4WXOA 3B78A 1TL3A 1RHRB 3ITHB 2HYIB 1JNRB 2E5GA 2V5HG 3NEKA 3AQPA 4OHWA 4NYOA 2D3ZA 3MOZA 2DEJA 4ZK7M 1TAUA 1SKWA 4USWA 2IYIA 2FLOA 4QPTA 3GV7B 3M2RB 2ATLA 3L7OA 4FF3A 3FGVA 5F9LA 4P2MA 1XERA 4FS2A 3SSSA 4C6AA 2KZMA 4CT9A 2N7YA 2GVDA 4OZNA 4WYWA 2XLJA 4F4AA 3FBBA 4CLUA 1H72C 3J7AN 3QT7A 5F8JA 2KXNB 3CULA 3AQOA 2VFTA 5K8OA 3QJLA 1F9FA 3O1LA 3L4BC 4USMA 3NY0A 4Q8FA 4ZPTR 3TW0A 1S1WB 4LRFA 1Q53A 3SCKE 4ZCIA 2HQDA 4MIAA 2OPPA 4WK1A 5GAHI 4TXSA 2OAUA 1PILA 1NUEA 5ADZA 4M5KA 1L3VA 1FKOA 4ELUA 2P9CA 5B0FA 2FVSA 4WKRA 1VLOA 5LMNJ 2O67A 3W63A 4BCAA 2ASYA 1NSKL 2AJFE 2OFHX 2IJFA 1N36J 3O8WA 1UVIA 1ITPA 2ZE2A 1HHTP 1RGVA 3HJVA 4X64F 4F67A 2MMYA 2HPUA 2MLXA 2Y3YA 4JI6J 4OJ1A 4U7UK 2EFOA 4DQRA 1YG0A 3TOQA 2POKA 3T1AA 2CNLB 2ALYB 1O0PA 3QT6A 3W61A 1N33J 3MCOA 5E33A 4NLSA 3UDEA 1NSAA 2MHNA 1U02A 1CJVB 1F5BA 3RG6A 4KE5A 5A8KB 2V2VA 3QJJA 3RTVA 2VB6A 2XMJA 3DOLA 4EWTA 2ZM6J 1G4CA 3LAKA 1NHVA 1C0TA 3RAMA 4ILMA 1YJTA 3AODA 2VOOA 1RBLA 2ZBCA 4XDDA 3QT5A 1HNZF 2EK6A 3AJ1A 4AL7A 1QAJA 1EETA 4WE1B 5KFUA 1S9GB 3JSMB 3VF0B 4DZDA 3BSAA 2HHUA 5IZHA 1PJ7A 2QMWA 3CC2S 3VHQA 1ZPWX 1IBLF 2RHQB 3ZZTA 3QRPA 4AT1B 1FRHA 2VL1A 4OJGA 5J2MB 2QSWA 2EKNA 2Y8YA 1O8BA 4FDFA 2HZCA 4NPOA 3IR7B 3FZ2A 1OYEA 3RBEA 1DBDA 1SUQA 3BSNA 2H54B 3H98A 1FDBA 4Q44A 3SMZA 1NB2A 1XEZA 5KFKA 2IM1A 2LP4A 3WIVA 5L1KA 2MY7A 2HHVA 1DAXA 2HURA 5F0WA 2R7XA 1WF2A 1H6KX 4MKBA 1CULB 3MEEA 1TL3B 2BJDA 2Y1LB 3NG8A 4PXDA 4DL4A 1U6ZA 3C6UA 1NU4A 5G0RB 4C8KA 4YR3A 2YKQA 3KK2A 2EFPA 4QQBA 1R3NA 5DQHA 3MTJA 4ZVPB 2AP6A 2J76E 3MURP 4UZBA 4LF6J 4KHRA 5KOXA 4A46A 2QV6A 4GKJJ 2GVDB 2A1BA 1XR5A 5LL6d 2JEJA 4ILLA 2RF2A 3W1YC 1TMMA 1K9MT 4G1PA 3BQ2A 4I2PA 1HWIA 4ED3A 3QGGA 3OFGA 4BWMA 4HLBA 3A8IA 1FWPA 4A4JA 1K44A 3D1QA 2VA3A 4DQIA 2V2KA 1IR0A 3G87A 3IR5B 3G96A 3GV8B 2CZVC 1U0SA 5HJXA 1REVA 4YR2A 4DI6A 4URQU 3BGLA 4D3GA 2HLTA 4E0DA 4JB8B 2OLWA 2XCPA 1NJIT 1FKOB 4Y2KA 1FCAA 1MROA 4ZVQB 1WKJA 1SQGA 4DPYA 3UD5A 1IWGA 2CUYA 3V6DB 1PC5A 3LP2A 2KXHA 2MKSA 1X4BA 2W7PA 1HYSB 4NCAA 2UXCJ 2ZE2B 3PW5A 4P9SA 2XO7A 1CLFA 4FXVA 3L7UA 2NXUA 1TKXA 4AYBD 4DV1J 3AA8A 2EPIA 2H65B 4PWWA 3IBFB 4JI2F 2X51A 5ETMA 2YWHA 4IH5A 5L8RC 3OHAA 1QAYA 4USVA 4U7CA 4G65A 1WOOA 3IXQA 2N4CA 2KVIA 2ABYA 2M88A 3WHIA 2AIRB 3TUPA 5HQLA 1RZMA 4A8KA 1SL1A 5A6PA 4FBTA 2UVWA 1YZ7A 3DOLB 2RDDA 4LRBA 4OZLA 1BQXA 1A7GE 2J0SD 1N5QA 2EEYA 1YHQS 2OTJS 5JXSA 1OIAA 4GC6A 3KG0A 4ED0A 3H4BA 2CQGA 4QYZK 4O4RA 1WACA 4F02A 2E7XA 4B3MF 1NNDA 4UUWA 3TI0A 4P7TA 1YI2S 1RYRA 3MDFA 1VR6A 3Q8YA 4RW4A 4ILRA 2CIMA 3D0GE 2C42A 2RQKA 1JJCB 2I0XA 4ITSA 1QSLA 2YBVA 4PG8A 1HNIA 1RT5A 2ZH3A 2VV5A 1AB8A 1WTBA 4I1TA 5FDLA 2DNNA 3GB0A 2DR7A 3FMWA 2ZEJA 2GO8A 5DM7Q 4DPTA 2ZC4A 4EO8A 1WI8A 2H4WB 2MTLA 3D0HE 3MI7X 5CCMA 3I32A 5KFRA 1N6QA 2PSZA 1OYDA 4DX5A 2F3JA 1RHUB 2X1AA 2BM0A 2DK2A 4HTJA 4KPCA 4HDHA 1PYTA 3UN3A 4NCGA 1N0UA 3BB5A 3R1HA 1WG5A 3HD2A 4LFAJ 4G1QA 3MEEB 1S1TA 2CWKA 5HJYA 3C6UB 4KTQA 4NLXA 1M0SA 3KYLA 3KK2B 4B9VA 4NMXA 4JV1A 2V8HA 2W24A 1T03A 5IM0B 1I94F 3EZOA 1S0NA 3DI6A 1Y5NB 3JYTB 3QGIA 1P6TA 1HPZA 5I3UA 4OYXA 3BQ1A 5LJ5Y 3GIJA 2HKEA 3EPGA 1S59A 4I2PB 2CQ1A 4NLPA 2MZTA 5KT2A 3ILLA 5B0CA 1A6LA 2WTFA 5F0UA 5KFAA 3TAPA 1VQ6S 1JMTA 5B7WA 1NPKA 2G2OA 2F4VF 2R7RA 2OFGX 1RB0A 2XMUA 1TL1A 1K1SA 3WX4A 1MROB 1LWCB 2MB0B 1SQFA 2B4PA 2VFVA 4OI1A 1WEXA 3PKMA 2DR8A 2C2RA 3LP2B 8AT1B 3GZ7A 4ZN3A 3E3XA 2HBZB 4CT8A 3SDEA 3QO9A 2VG5A 2W2PP 3DFEA 2B56A 1S6PA 2XNQA 1TKXB 1RT7A 2AJ2A 4KBIA 2DPIA 5BYRA 3SZ2A 3HJFA 3EMTA 1VC5A 4M8LA 2M8DB 2Y1IA 4J9SA 1F2GA 3AA9A 3FCWA 4CO3A 3E2EA 3G4SS 1RWKB 2VJUA 3NGUA 3R5CA 3J7ZT 8ATCB 3TZYA 3QPIA 3BDEA 3EWGA 5C24B 2RKIA 4R8UA 2HVZA 2HG4A 2O01C 4ZIVA 3X1LB 3O44A 2HWHA 2YH1A 3N28A 4CH7A 1SBRA 5KFBA 1OPIA 1UETA 3FBCA 1RCOB 5LMNF 2W9CA 1YZ6A 4J5OA 1TR0A 5D4PA 4OYMA 1N36F 1G3OA 1S0MA 1SIWB 1JXEA 3HSZA 2BYCA 3CCMS 2FQQB 2IMWP 4C9DA 2XMTA 1XMQJ 1VLYA 2M9KA 3GU0A 1HNIB 5BYQA 2VIHA 3DDKA 5FDLB 4ER8A 4JI6F 1U1RA 4DL3A 3D5MA 2YNGA 5D6GA 5D15A 3HX9A 4ALZA 4F2SA 1B70B 4C2MA 5L1LA 1NJZA 2DNHA 5E3CA 2B4UA 4AE5A 2L08A 5DZ7A 5IWAJ 1D8ZA 1QVFR 4KT0C 3WX8A 1N5YB 3GJRB 2MQ8A 2KG0A 2BJ7A 1N0VC 2Q1LA 2AU0A 2BE7D 2P6TA 4LF7J 3QFWA 2HFZA 2VU5A 2W2MP 2AJ0A 2AEFA 3PIPQ 3N0VA 3NOCA 1VJWA 3MZIA 2CNNB 9RUBA 1AYEA 4G1QB 3ICLA 5A2QU 1S1TB 2D3O1 2X3DA 3GFHA 2CYYA 1Q5VA 5A8RA 5GAHU 2I1RA 1YDLA 2ERRA 3QSYB 2NQPA 4OJHA 3ETOA 1SJ4P 2XYHB 1Y0HA 1M5SA 3OD2A 1SVDA 1FRMA 3ZTPA 5HQMA 2LKZA 2YX7A 4UOHA 3HHKA 4B17A 2H48B 3DI6B 1D3WA 4NZ0A 4OYWA 1HPZB 2WSCC 4FKYA 1R43A 2WCXA 2VODA 1V6HA 3JAMY 1ZM3A 1W7WA 1URRA 1R8PA 4LRDA 5ETKA 1XWLA 3OTBA 2ZVIA 1NBEB 1L5UA 5KFLA 4MAKA 2FZCB 2LA4A 4EU0A 4TNOA 3OVAA 3GJQB 1FFGB 1O5JA 3A3OB 2VBZA 3I96A 1JXLA 4LFBJ 1RE1B 1RHMB 4ECVA 1QD1A 4MYUA 2PGCA 2QSFA 2RT3A 3QATA 3OVBA 1Q8IA 1QJHA 3PW2A 2D41A 1XC9A 2K3KA 4M95A 1RAJA 3MAQA 3SDEB 3VR1A 3QO9B 4NLVA 1KNZA 3W2WA 4DR3J 4LF6F 4ETZA 3POTA 1CJKA 4DUYJ 4FBUA 3OHBA 4RLEA 1RT7B 4USUA 3DC2A 1S1XA 3LUYA 1XMOJ 1BXNA 3IGVA 2XLIA 2C28A 5AT1B 2HZAA 4S0MA 2ZZMA 2FGCA 1NAQA 3GPAA 4R0EA 2RQCA 2RKIB 2HBYB 2IFXA 4R8UB 3I5BA 4MTPA 2ZNZA 3PM9A 4K4TA 1VRTA 4CP5A 3RBZA 2YNHA 2IVMA 5GAGU 1S12A 3FRZA 1NCLA 1S48A 1SJ1A 5ETQA 4CLKA 3TZZA 1S9FA 1FX4A 5IT9U 2NS1B 1Q7LB 2UXCF 5ETLA 5AJ3F 5LSRA 2J0QD 4P74A 1AROP 4DV1F 4IR9A 3CC4S 4K4UA 3Q8UA 3Q8QB 2QMUB 1VQMS 4URSA 5I3PA 2YNGB 2FHOB 2VH7A 2RU9A 5K8MA 5F9NA 5E3PA 3CJ5A 4NI2A 4CLWA 1F9HA 1DQ9A 2ATCB 2ZH7A 2Z4PA 3TEGA 2LQ8A 4Y3CA 4EEYA 4RUCA 4DR5J 2BEFA 2BM1A 1QLNA 2HVHA 2FY8A 1GXLA 4F25A 2VHGA 2DR6A 3CJ8A 2R8IA 2YKNB 1CS4A 3NLCA 2L9DA 2MKJA 4AD6A 3M7VA 1S5ZA 4M5MA 4I6WA 3QRRA 3CMQA 4PR6A 3DLLQ 3MM6A 4QW9A 2PMZD 3NGRA 2GHWA 5B0BA 1LOUA 2LDYA 3ZXWA 1ZETA 5C2CA 2GO9A 3B4MA 2IRXA 3LOUA 3SXLA 5CYQA 2GMLA 3OFEA 3PHTA 2ZUGA 1ZAVA 2K1RB 4RW8B 3IS9A 1CVJA 3KOAA 2ZHOA 3I5AA 4DOZA 3G71S 1ZZFA 2OHDA 2YNIB 5HQ8A 3ZO7A 4U67Q 3VWSA 3UW1A 1RA7A 3JSYA 1UVNA 1TK0A 3D6HB 1CSJA 1HI1A 3MM7A 2JHEA 3SQGA 4PWDB 1U8SA 1M5VC 3NNCA 4N8OA 5FLXY 1UA1A 1U8WA 2D3UA 2IBOA 4KGXB 2WVDA 2GA7A 6FD1A 1HBNB 1RAHB 3PR4A 3R27A 2GAGC 4LFAF 1FE4A 4CTAA 2XHWA 1B7FA 3DLGA 3R5GA 2DGOA 2NUUG 1AUDA 4CM0A 4B02A 3T41A 1V3SA 4RU9A 3A1YG 3MEKA 1TK5A 2A6OA 3POTB 1CJKB 1FO1A 5HMWA 2HFVA 2DYAA 1YLXA 4Q2LA 1VQ4S 2IM2A 1S1XB 2UVRA 3RBXA 1WC4A 2XSJA 3P8BB 3KHGA 2VD3A 1H7XA 2GJIA 4BBYA 2NXJA 1SJFA 3P49B 4OZ0A 3K5NA 3PX0A 2JJ4D 3ZC4A 2P5VA 5F3ZA 2HSEB 3H20A 4CLZA 2OSQA 2XWYA 3CC7S 2KXFA 5SUHA 1JJHA 1TU0B 4FNIA 1OS5A 5L9XA 1HL6A 1RWXB 2CRLA 3HM9A 1VRTB 1VK8A 3BGOP 2YNHB 3GILA 2W2NP 3F0NA 4I7FA 1UMJA 3EDRB 5BXIA 4Y2MA 1XN9A 2YWGA 3HZEA 4IDKA 4EMDA 2OGUA 2A0FB 4DS5A 5I42A 1KOHA 3GIIA 3V4IA 3C15A 4ED1A 2JLEA 4OHVA 1X5SA 3N6MA 1BWEA 4NI2B 4WU2A 4DSJA 4K4SA 2DCUB 1HI8A 4IRDA 1EKRA 1M5OC 3MR6A 3TO8A 4UUXA 4DCJB 2VG7B 1Z2LA 2XYPB 1FRJA 3G8SA 3JSRA 1S57A 2HFSA 2CPIA 2ZWOA 4UOFA 7FDRA 3H5YA 1OMSA 2I5JB 1PYSB 4X4RA 4O4GB 4J91A 2V68A 3OL8A 2ZBPA 4PABA 1FDAA 1NHUA 1CS4B 1YQHA 2GX8A 4RW7B 3F44A 3EVMA 1NSPA 5KFWA 3CDAA 4K8RA 4DG1A 2PEHA 1S7IA 3PW0A 2AKWB 1RSCA 2BW7A 1RBAA 2GIRA 1LK7A 3W5YA 4QIEA 4DL2A 4NE9C 1PBUA 2KJVA 1SC1B 2J0WA 1DTQA 1XMQF 3GJTB 3TVZA 2AYBA 5CYQB 4PG5A 1V9OA 1NK9A 4CLFA 4ZLLA 5CHCB 1AXQA 1RBOB 3G82B 3U7JA 4LBHA 2QGFB 4P2FA 3AJ2A 3IS9B 4QJVA 3R7BB 2WVCA 5FIIA 2FTRA 1HWKA 1NDPA 3M6VA 3TANA 4DR7J 5IWAF 3KXDA 2Z2ZA 1LW2B 1TUWA 4RL1A 1X9WA 1WHXA 3UNYA 3A4TA 1NJXA 3DCAA 3R2CJ 4LF7F 4IR1A 4F4XA 1OY6A 4PQUA 2M3DA 3SQGB 2XMKA 1UWAA 4DUTA 1X4EA 2C3YA 4DUZJ 4H4MA 1QM9A 2MKIA 1UKUA 5KT4A 3W62A 1M5KC 2AQ4A 1YWXA 4B9SA 1F2HA 2HLUA 1T9YA 3QNWB 4K2XA 3LA0A 3TX8A 1RA6A 4PXBA 3OL6A 3DLKA 4WBFA 1C1BB 3BKTA 3GTYX 4XK8C 3RB6A 1YJ7A 2WONB 4L72B 5DG8A 2QA1A 3KDOA 3BGRB 2V9KA 2BVZA 5A76A 3OLBA 4USTA 3I0SA 3QSIA 2E9ZA 1GQEA 1OPZA 2K7JA 3NAIA 3KJVB 5E5NA 2UUCJ 2JFKA 3TA0A 4DV3J 4ECQA 3BDPA 4FPRA 3IBWA 3J7A1 1BQMA 2DPJA 3C46A 2K2PA 4QWAA 5KFTA 1TP7A 5KG4A 4OMFG 4M5HA 4DZ6A 2XMMA 2MQPA 1LQ9A 2UU9J 2HGLA 1N56A 2QRRA 2PT0A 1IJEB 2EC0A 1Z1ZA 4WP8A 3AAWB 3R7NB 2UUWA 4LFBF 2NR0A 1WWHA 4LSNA 1FWKA 3BPSP 1H74A 2ZOMA 1BUXA 3NRBA 4P6QA 4F2RA 1QDUB 2KM8B 1JKHA 3V4MA 1IBKF 4XO0A 3ET6A 5T41A 4Y28C 2C3MA 4I7FB 1SL0A 1W2BR 4RBVA 2DKOB 5KFNA 4Y2CA 2C2EA 4A8WA 1J5OA 4QU6A 3PR5B 3UQSA 1U2RA 3PXGa 4IDKB 2L9NA 2RIJA 2KO1A 4IKAA 4J9QA 2ZBIA 4DR3F 3KHRA 5I42B 3W2VA 2ZKTA 1FHTA 4DUYF 4DPXA 1RAOA 4OFZA 4Y0FA 3UNGC 5J2PA 4ZPCA 3C15B 1M1KT 3TQ1A 4JI3J 1XMOF 2IA6A 4CZCA 1RWOB 3PRDA 4J9RA 4OYAA 4C0HA 2CJQA 1NDLA 1FVQA 5CQGA 2H5JB 3TUJC 3T6BA 3RZAA 2C2OB 5LSLA 2BQRA 5KFEA 1UFWA 5BR8J 3DRPA 3NAHA 4ICLA 2DIUA 4X62J 2O5DA 2RDJA 3J80U 4BC7A 4B3OA 3I9V9 4FYYB 3IG1A 3P5BP 3P96A 3QZ8A 3G86A 4A8MP 3KLGB 2BE2A 2X1BA 2WB1D 5KFPA 4LIWA 4DG1B 1Q8BA 3LANA 3I4HX 1PIEA 3BGFA 1JLAA 2B8PA 3VAJA 2GVZA 1UFLA 4QWDA 1TQLA 2W8KA 2DNMA 2HQIA 1ZM4A 2J6TA 3OVSA 3GIMA 2CADA 3ZTRA 2ZH6A 3PHEA 2IA0A 3UVJA 3ZZZA 1X4HA 4B9TA 3EGWB 2RHSB 2IYGA 3GYGA 1QAXA 2MQQA 4ECWA 2KFZA 2OO4A 2DCLA 3EXYA 2DEIA 3MCNA 3OFHA 6AT1B 3KLHA 4DR5F 1GTEA 2AW0A 2VASA 5K9FA 4PQUB 3JTOA 3FC9A 4MMOA 1Q7YT 1KQSR 1RABB 3S8SA 2AJ4A 1UCNA 2QYCA 3MMCB 2W25A 1ICEB 5DDQC 5HATA 1FJCA 4Z7CA 2B7BB 2B7CB 2V34A 1YJRA 3M1VA 2ZH9A 1PG5B 2D9PA 3OPKA 1F60B 3BH7B 4OHYA 1RLDA 1GMWD 4USHA 2R7OA 4UY85 3UCGA 2E1PA 1B0PA 4IFVA 2YY3A 4K59A 1SIZA 3OXLA 1GMWA 1RLCL 2GQCA 3PX4A 2E7WA 2QT7A 5JJBA 2F7VA 3I9ZA
chains in the Genus database with same CATH topology
5KOXA 4EFAC 3CMAS 4A46A 1J5EF 3Q22A 4WZMA 3V6HA 2QV6A 1AW0A 1VGYA 2DNKA 2A1BA 1Q78A 1XR5A 2AWZA 4NX9A 4TYBA 5LL6d 5M2PA 3HXMA 1RTHA 1RYSA 1JX4A 2WHOA 2IMOA 2JEJA 2YKNA 4ILLA 2RF2A 3MFIA 2DR9A 5J1EA 1NKCA 4CO1A 4GO5X 2JX2A 4L6V3 4IFYA 2LLZA 3NMAA 3Q2TC 1UEVA 1K9MT 1WHYA 1WI6A 1YBAA 1FK9A 2K8GA 4G1PA 3M8PA 2QA4G 3CDEA 4RBTA 1Q86T 2DISA 3BQ2A 4I2PA 1HWIA 5K8PA 2J9CA 3KLFB 4ED3A 2VFRA 3WC0A 3QGGA 3OFGA 4BWMA 1L3SA 3LP0B 2CPDA 4HLBA 1FEEA 5K5MA 4RNFA 4DL5A 4WCEQ 1TAQA 4MYTA 3FFIA 1KFSA 1WHVA 2KHDA 4NL5A 4DWIA 4A4JA 1K1QA 2VQFF 1JKHB 3D1QA 2VA3A 4DQIA 2V2KA 4FF1A 1IR0A 1VQSA 3UPFA 1PO6A 1LK5A 3VAMA 2ZZNA 2KRRA 3IR5B 3G96A 3M9MB 3P5TL 2B9XA 3GV8B 1TKTB 2UVVA 1UJ6A 4IO1A 4XPEA 1P9QC 5DDPC 2CZVC 3OSNA 2ZDOA 3K8WA 1REVA 4YR2A 2UZAA 3T9NA 5J2QA 4IQMA 4URQU 3BGLA 4KV8A 4D3GA 2HLTA 1L3TA 4E0DA 1R0AA 2FJVA 1J5OB 1QTMA 3VAFA 1U1KA 2CPFA 2OLWA 4ZOSA 3FSYA 4QWCA 2XCPA 3X3UA 3UCZP 1FKOB 4Y2KA 1FCAA 1MROA 2YH0A 3MPWA 5DO2A 2ASDA 1CPZA 4C8NA 2C3PA 5L38A 2CDQA 5IT0A 2K1RA 4RW8A 3MMBA 5EWGA 3W2VB 2W7AA 3V6DB 3KNGA 1PC5A 3LP2A 3GYXB 1VQLS 3QLHA 2KXHA 5J2PB 2QFJA 3VAKA 1R8CA 3CCVS 2MKSA 3V2UC 2AGPA 2KFYA 4YR0A 3OTCA 1X4BA 2DHAA 2W7PA 2RB7A 2MZ1A 1YSJA 1U45A 1HYSB 3HVRA 1RTJB 3E8OA 1HQUA 1FTCA 2M70A 4NCAA 3MM6B 2Q3PA 4PG6A 2ZE2B 4N47A 2YNIA 2DGUA 2VBWA 1D9AA 3BR8A 3NGKA 2RSQA 5IS2A 2LEAA 3VAGA 3PW5A 1VQOS 3LH2S 4AL5A 2DH8A 2XO7A 1VBXA 1G7CB 2FJDB 4OX6A 2EI5A 3HI9A 1CLFA 3C66A 4FXVA 2NXUA 4ID8A 3LO3A 1TKXA 1S99A 2JFDA 2WRMA 4AYBD 3VZHA 2XI2A 4YB1P 4DN0A 2OPQB 2EPIA 3AA8A 3MM9A 4NZ6A 4X4PA 1U49A 1C4CA 3QGHA 3PVXA 3CJ0A 3MMAB 4PWDA 2AJ1A 3SCIE 4GO7X 3QWUA 3J81Y 3OW2R 2MQOA 7FD1A 2N4DA 3QGPA 5E0OA 4ICLB 4JI2F 3HK2A 2QA4S 5LT5A 2F8HA 3THPA 2X51A 2YWHA 3IWLA 4IH5A 5L8RC 3OHAA 2XS7A 1QAYA 5K8NA 1DQ8A 3KLVA 2DNPA 4U7CA 1GX6A 3IXQA 2N4CA 3N6NA 1DURA 1HBNA 4WFAQ 4B3OB 2J9EA 2KVIA 3GMGA 4OZ1A 3PIOQ 2ABYA 2M88A 2BV3A 3ONQA 2CJ9A 4X66F 4A8YA 1XK8A 2BANA 5KG1A 2XY5A 2BE2B 2J0XA 4FXWA 2VZ9A 2MPUA 1LXJA 2DR5A 1HHSA 2HNYA 2CQ4A 4RNNA 1X4CA 2GC8A 4V19J 2EWHA 3VQTA 3HHDA 2BUNA 4A8KA 2KG1A 4K0KF 3CO9A 1SL1A 2LDIA 1M5HA 5A6PA 3DLEA 3P3DA 5KAKA 4FBTA 1RT4B 4KIAA 4N8NA 3KK3B 4PXCA 2UVWA 2MSTA 3DOLB 1FE0A 3G8QA 4OZLA 1BQXA 1JLAB 1A7GE 2EFGA 2J0SD 4CNZA 1N5QA 4ZCMA 5DLGA 3MM7B 4OQJA 1YJVA 4DV7F 2D1CA 4A8OA 1YHQS 2X1GA 3D54A 3M9NB 3PEJA 2OTJS 3TUIC 2R8GA 3NNAA 1LWFA 2A18A 5JXSA 5D78A 2H9ZA 1OIAA 1S1VA 3M6XA 3KG0A 4GC6A 4DHVA 3K5OA 4ED0A 1A9NB 3KLIA 3H4BA 5BYSA 2CQGA 3J80Y 1X9SA 4O4RA 1X4DA 4CTAB 1WACA 1U1LA 4F02A 2E7XA 2ZITA 4LJMA 5IT4A 3DOKB 4YDXA 3DLGB 3HVTA 4B3MF 1NNDA 4DLGA 4UUWA 3KNAA 3TI0A 2Y1JA 3M6UA 4P7TA 1YI2S 2E1RA 4CO2A 1FF2A 1RYRA 4L3NA 5H9FJ 2RE1A 3WC2A 5KG3A 4R25A 3MDFA 4OIXA 1KEKA 3ENQA 1JLBB 4C11B 3N5BA 4RW4A 2U2FA 4ILRA 2HMIA 2CIMA 3M8QB 2PN6A 1S4FA 2C42A 2WW8A 2I0XA 2RQKA 3D0GE 4ITSA 1QSLA 4PG8A 1HNIA 1RT5A 5KG0A 2ZH3A 2VV5A 3GR0A 3OR2B 1WTBA 4I1TA 5FDLA 2HNDB 5JVHQ 2DNNA 4B3RF 1N32F 3GB0A 2DR7A 2YWFA 1I6JA 3FMWA 3T5LA 3D1HA 1UJ4A 1JLFB 2OMOA 3DLJA 3HPOA 2GO8A 1N8RT 4F8RA 5D77A 1KHVA 3H5SA 5DM7Q 2KYZA 1XNRF 2GW8A 4C8MA 2B4VA 2MGZB 4HKQA 3SSRA 2BBEA 2ZC4A 4KPYA 3H2VE 2GV1A 3MEDB 1HMVA 1VOMA 4EO8A 2BQ3A 1WI8A 1RTIA 5KTQA 5DDRC 2XSJB 3D0HE 3BO4A 1YVFA 2KT2A 1D8YA 3MI7X 5CCMA 2OSRA 3I32A 5KFRA 2HRUA 1N6QA 2RRBA 1S76D 1T7PA 4N76A 2V0NA 3K0JA 1D1UA 5CH7B 4RW6A 2BZ2A 2PSZA 3CCJS 1U09A 3R5DA 2UV8G 2JDJA 5KFQA 2F3JA 5DDOC 4DV5F 3SV3A 2OMLA 2OKQA 2L3MA 1HQEA 4QPXA 4KKOB 1HNWF 2X1AA 2BM0A 1OSDA 3MR3A 4TU7A 3M1VB 1SJRA 2DK2A 4HTJA 4HDHA 2MKHA 4NCGA 1N0UA 5T7LB 3BB5A 3K5PA 2ZJPQ 4EYHB 3IA0A 2E1MC 5HMZA 3HHLD 3UI3A 1FDDA 1WG5A 3GV5B 3R1HA 1QE1A 3GWCA 3DN9A 3R1LA 5F41A 4FXDA 3E01A 5AE2A 4G1QA 1HBMA 3MEEB 4N56A 1S1TA 5D3GB 1H38A 4NLUA 3ULHA 1JJ2R 1IJFB 1EP4B 1T95A 3HHLA 5HL7Q 2HHXA 3C6UB 3WZ0A 4KTQA 2I9SA 2PMHA 5K14A 3G9CA 4QYRA 4NLXA 4U9RA 3HFKA 3M4XA 4NLYA 1NH8A 1M0SA 2MQLA 4N77A 3KYLA 2JSXA 4LUBA 2DH9A 3KK2B 4B9VA 1R8BA 1DJ0A 4JV1A 4EBDA 2DNGA 1KFDA 3VAIA 3THVA 4URGA 5EX0A 1S6QA 1RT2B 2V8HA 4DL0C 5C25A 4QIFA 2W24A 3THTA 4FS1A 1OQ6A 1T03A 4DR7F 4KQZA 2UV8A 4TLQA 3UE2A 1U1NA 1SV5B 5B0GA 2YNFA 2VG7A 5IM0B 2L48A 4NRTA 4C0OC 1I94F 2J6SA 1KTQA 1S0NA 2L41A 2GIQA 3DI6A 3RRHA 3FRYA 1Y5NB 2ADBA 3JYTB 5EX3A 3HHLC 3QGIA 2R2RA 2KYXA 1P6TA 1ZTTA 1JWWA 2CQHA 2I5JA 4J9MA 1HPZA 5I3UA 2R7SA 4O4GA 3V4IB 2NYIA 2FVCA 1GXUA 1FRXA 1RTHB 1IBMF 2DGTA 4PXEA 3K8VA 3BQ1A 1H0HB 4ZKAA 5LJ5Y 3GIJA 2R7VA 1C0UA 4RW7A 5J1EB 3CCSS 4USIA 4RU2A 3CCES 2GQ2A 2IVFB 3V81B 4DV0F 2DRAA 3FEYB 3Q8PB 4DUZF 4CO4A 2NUHA 3UCUP 3RAQA 2OJ3A 3M8PB 3QYYA 3EPGA 4IOAQ 1E6YA 4DSFA 2J6UA 2B6AA 2JVRA 4I2PB 3F41A 4WFNQ 3I4PA 2CQ1A 4I64A 4NLPA 1Y5IB 5E3QA 2MZTA 4PRFA 5KT2A 3HLUA 1YJWS 2E1AA 3AHPA 2VPWB 3FFIB 2Q6CA 3TNVA 5B0CA 1A6LA 2AV5A 3OBIA 2E1CA 2HS3A 2LA6A 1YGYA 5F0UA 5KFAA 2WTFA 3TAPA 1URNA 4IYQA 2LEBA 3R5AA 1KLMA 2B0GA 2G0CA 3BO2A 2JEGA 4RKUC 1VQ6S 5C5JA 1JMTA 5B7WA 2AGOA 2F4VF 4MK7A 2RH3A 1PC4A 1Q81T 2Z8QA 5J2QB 2XC9A 2R7RA 2WK4A 2QZ8A 2FUG9 3KKFA 3MEGA 4ZP8A 2OFGX 4KV8B 4X4QA 4YHHF 2EG1A 2XMUA 1TL1A 1KVJA 2W4CA 1L3UA 1K1SA 3WX4A 4AL6A 3JB9k 2RD5C 3T5HA 4WXWA 1YJ9S 3V6KA 1MROB 1LV5A 1LWCB 2IC3A 2MB0B 1Y4ZB 2NLWA 4Q5VA 4TU8A 2B4PA 5KT3A 1UWBB 4ED7A 5EN1A 2VFVA 1WEZA 4OI1A 3M30A 1WEXA 1P27B 3PKMA 2CQ3A 2DR8A 2C2RA 3LP2B 3GZ7A 4M63A 4CIOA 3QLHB 3QIPA 2ZH5A 3HZGA 4P2SA 3E3XA 3GQCA 4JYAF 3FZBA 2ROEA 1IKVB 3I5CA 4RWXA 4A8XA 5I4MA 4CT8A 4DV3F 3SDEA 1GXTA 5EUHA 1LW2A 2JC1A 3Q8SB 3QO9A 1HQUB 1RQ0A 2VG5A 5L1IA 3H2UB 2LXFA 1HNVA 1LW0A 3DFEA 3H59A 2B56A 4DF4A 3DRSA 2HVIA 3J7YI 4QR0A 3PFOA 3AY0A 1BQNA 1S6PA 2XNQA 1VQKS 5HROA 5AXNA 1TKXB 1RT7A 5EGYA 1WG4A 3T19A 3RB4A 3MM9B 4IG3A 4HT7A 4KBIA 2RRAA 4M94A 1IKWA 2CPHA 2DPIA 2MKKA 5D8HB 2MZRA 2M8HA 1DTQB 5BYRA 5KG7A 3SZ2A 4M5DA 3HJFA 1FT8A 3CSKA 1HR0F 3BEGB 1YRTA 1VC5A 2ZD1A 5HLFB 2UU9F 4M8LA 2J7KA 3W7BA 1XR7A 2OD6A 4YB5A 2M8DB 2Y1IA 3CCZA 1F5CA 4J9SA 1D9DA 4DR6F 1IKYA 4RBUA 1F2GA 3AA9A 3UR0A 2YWEA 4CO3A 3G6ES 3S7RA 1FEHA 3E2EA 1MWYA 4TLRA 3G4SS 4NMLA 2E5IA 3FQLA 2BDPA 3CCTA 1BGXT 1XTZA 2LQ9A 2CKWA 3R5CA 5DQGA 3J7ZT 2BANB 3H5UA 2ZKUA 3UDLA 1WHWA 4ERDA 1C1BA 2CJAA 1IXKA 3GR1A 3QPIA 4C3KA 1HD1A 3BDEA 2HNYB 5C24B 4PPZA 2RKIA 5KT7A 4R8UA 4K50A 2HVZA 2HG4A 2O01C 3X1LB 3O44A 1CC7A 2AJQA 2HWHA 2DD8S 2YH1A 1UA0A 3N28A 5F8IA 2QE5A 4CH7A 2PI4A 1JLCA 3SFGA 2WONA 2NPIA 3BN7A 3ITHA 3CGIA 3O6QA 3R5BA 4Y34A 4DEZA 1DTTB 4DN9A 1SBRA 3TA2A 5KFBA 1D9FA 4C4WA 2JOQA 3LP1B 1FXDA 2CZ4A 2H5EA 1OPIA 1UETA 4ZMMA 3BGRA 4YY3F 3CD0A 4H4MB 2XI3A 3NWGA 4A8SA 4KGMA 2CFXA 5LMNF 3OR1B 4Z37A 2W9CA 1S1VB 4I4BA 3KJVA 1VRUA 1TVRA 2R2TA 3KLIB 1K8AT 2Y0SD 2FLNA 4J5OA 1VBZA 5LSOA 1TR0A 5D4PA 3SFUA 4DDFA 2O3DA 1TL4A 2PDAA 3NBPA 1R31A 3I87A 1G3OA 1N36F 3CIMA 4EUVA 1TFYA 4NLDA 3HVTB 4FN5A 5KFHA 2R9LA 4NYPA 1SIWB 3DLKB 1S0MA 1JXEA 4JI3F 2YKMA 2BYCA 4DSIA 3CCMS 2WAQD 2XWXA 3ZFVA 3MPYA 2M5YA 1QUVA 1NK6A 3OFFA 3L7PA 3TYTA 2IMWP 4C9DA 2IRUA 3CDBA 2XMTA 4ETXA 2HMIB 1VLYA 2PC6A 2M9KA 2KKHA 3AB4B 5M2UA 3HVAA 2APOA 1WNEA 1HNIB 5BYQA 2XBPA 3M2UA 2B9WA 2CG4A 2ZFHA 3DDKA 5FDLB 4JI6F