4KIAA

Crystal structure of lmhde, heme-degrading enzyme, from listeria monocytogenes
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
159
structure length
153
Chain Sequence
b'KKVFITTGTEHYLRQLMANYTGGNVTLLQNFSQSLLYQESTGGAEYRVLQSSGSIKGFGVVVFEYIHLRDEEIPIFLQMYQRASLHFSETPGLQSTKLTKAMNMNKFLIISFWDSEVFFHDWKKSPLSKEITNIMRKNNTQSGFSHEDIYHYP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lmo2213 protein
publication title Structural and functional characterization of an Isd-type haem-degradation enzyme from Listeria monocytogenes
doi rcsb
source organism Listeria monocytogenes
molecule tags Oxidoreductase
total genus 33
structure length 153
sequence length 159
ec nomenclature
pdb deposition date 2013-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3430 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kiaA00
4FVCA 3TVZA 3FJ2A 4KIAA 3FEZA 4AE5A 4JOUA 4OZ5A
chains in the Genus database with same CATH superfamily
4J91A 3VGSA 1RT6B 1SC1B 1WI6A 3DXBA 2WBRA 1JIHA 2B4OA 4DQSA 3UD4P 4LIWA 1XTZA 1VQ8S 3KDNA 1TK8A 4USKA 3WC0A 3EVWA 3FJ2A 2HG4A 5B0EA 3CF5Q 1RAOA 2YNGA 2RHQB 1ZTTA 3PTWA 3BBFA 2Z2YB 4IDKA 1RWVB 3JSMA 2EFGA 4NA1A 3PACA 1UVNA 3QRPA 1NK8A 3PIPQ 4F0KA 3FGVA 2PSZA 3HT0A 2AX1A 1M5SA 3IRWP 4H4OA 2QMWA 1N33J 1ZAWA 1VQ5S 3MM8B 4MH8A 4KR0B 1CJKB 2M7SA 4B9UA 1IBKJ 5KTQA 5LJ5Y 3DOLA 2UXCF 2YH0A 2PGCA 5ETVA 4ZVEA 4DUZF 1YJTA 4K0KJ 1DTQA 3MR6A 4FYDA 3RB0A 2B4PA 1LWEB 1WC1A 4EZ9A 1SC4B 1R8BA 2ZC3A 1G6BA 2JNJA 5FLXY 2WSCC 3KJQB 4DN0A 3UCZP 4I6AA 2Q6BA 3DRRB 4CO4A 2GJ2A 4IQXA 3BKUA 1V3RA 4NCGA 3PCOB 3T19A 3QATA 2QTWA 3CC7S 2J5AA 2FGOA 3CDWA 2I5JB 2ZZMA 1C0UB 3MDFA 4DV2J 1N5QA 2YKMA 2YNIA 3M32A 4USVA 3ET6A 3GSDA 1UJ6A 3DOKA 4ID8A 5HMWA 1AUSL 4F67A 2FJBB 4ATNA 3IGVA 4HVZA 2WVBA 5J2NB 2A18A 5A8KB 4ELVA 1D09B 4CYUB 1HW8A 4B3MF 2DPJA 4GKKJ 1WOOA 2KRRA 4DSLA 1TK0A 2VQFJ 2JZ5A 2AV5A 3A8KA 3B4MA 2WRMA 2CQDA 1UA0A 1W7WA 4RR5A 3E3XA 3R97A 2O01C 2M8DB 3BQ2A 1U6BA 1V5VA 1NU4A 2HHXA 3GIRA 1N88A 1NK6A 3H25A 2CJQA 4DV3J 3QT8A 5LMUJ 4USTA 1FVQA 2F4VJ 5L1IA 5B0BA 3JSMB 2WVCA 5G4DA 4DL0C 4UY8T 4CO2A 4QPTA 2FHKA 3MM5A 2MLZA 5E3CA 1RT4A 1FA0A 1NDLA 1HI8A 4H4OB 1RAHB 1KVKA 1DLOA 4O3RA 1UP1A 1HWKA 5AJ3J 1IBMJ 2V63A 2UXBF 2QA1A 2OFHX 3MPUB 3FZ2A 3MHYA 1YQHA 4JI6J 4LF5F 4F3OA 4KGMA 1GFWB 5J2MB 2ASDA 4ZVUB 1U1KA 4UOHA 2MXYA 1IWAA 1MLAA 3OJSA 1DTQB 2AF6A 1T03B 1F1BB 4J9LA 2F65A 1UEUA 2GHPA 4WWSA 3ZZUA 1SCJB 2QA2A 4NLTA 2EFPA 1I5OB 4RJVA 4RNNA 1VS3A 1SH3A 3RBEA 1XWLA 2R7UA 2KI2A 1WORA 1R89A 4YB1P 1IKYA 3EYZA 2K1RA 1Q5VA 4MK9A 3OHAA 1NK4A 4GO5X 1EAYC 3M6WA 3TZXA 1RA6A 4OFZA 5KFVA 3T1AA 2YBVA 3ZNUA 3MEEB 1CULB 2HZCA 1VQ4S 4LF9F 3RU0A 2YNIB 2OEMA 2XMUA 2YTCA 2OPQA 1RYSA 2IM1A 4WCEQ 4JI8J 3VZHA 4GVBA 3EDQB 4N77A 1BQNA 1XBWA 5E3AA 2GS8A 4M5DA 3PFEA 1HR0F 4YUDA 2ERRA 3E2EA 3M8PB 3RRKA 3VAKA 4LVOP 5HSPA 5DG7A 5ETRA 4X4TA 2BE2A 3EX7B 3G8QA 4CLWA 1PKUA 3D54A 3QSIA 1CLFA 1KOOA 4OV1A 3F41A 3ETMA 3D66A 2JEIA 2VV5A 4DG1A 2V4RA 2E7VA 3H40A 4I7FB 1E6YA 3NS5A 1YJ9S 3KUGA 1RQ0A 2WVDA 3RBDA 2I8EA 1NSAA 1WJ9A 1X8DA 4R5PA 2IBOA 1VC0A 3BSCA 2LCWA 3GJQB 2ZVIA 1RYRA 1FJ7A 1TV6A 1VJWA 4ZVRB 2MPUA 2K7JA 3SCKE 3AA8A 4WE1A 2GQ2A 1RT4B 4LF8F 2AX0A 1D9AA 1OQ3A 4DL6A 2B5JB 3M2RA 5HVGA 1X5SA 1U2FA 4O44A 4DV1F 2CQCA 4P2XA 3TUZC 3M6XA 2P5VA 4CH0S 4Z7CA 1WEYA 4C3LA 2HLUA 1RDRA 3FRZA 1UCNA 4QWDA 1S9EB 2F1FA 4UOFA 3OW2R 3P6YC 1RT1A 1EZZB 2AEFA 4EBEA 3UW1A 4L3KA 1OMSA 1RWMB 5I3UA 1TVRA 3R8YA 3LWLA 2ZWPA 1IJFB 2HFNA 1O0PA 5HQMA 3AQOA 1TKTA 3I31A 5DJBA 2R4FA 1IKYB 1X5OA 1WEZA 2K1RB 4JB8B 2NXUA 3UN2A 5T14A 1QLNA 4DEZA 1NBEB 3CCWA 2HFUA 3M2UB 1TFWA 2BKOA 1ZPWX 4ZVOB 3V6DB 1BC6A 3ENWA 1KVJA 2FHMA 1F9FA 3KK2A 3TQ1A 1TL7A 1PJ7A 2ZE2B 3BN7A 3HZGA 2HHWA 1OY6A 4CH1A 3BM7A 2QIFA 5DLGA 4HEA9 3EPIA 4CT9A 4G1QA 4IO1A 2J7KA 4NLWA 4QU6A 1U8WA 3WBZA 4IRCA 1ZZNA 5E3PA 2PMHA 1TP7A 4QQBA 1NO8A 5LMNJ 2BE2B 4U9RA 5D0RA 2V9WA 1NZAA 2BBEA 1N4LA 4C8ZA 4WP3A 4DR2F 2IY5B 1KTVA 3ILJA 1J5OA 4LSNB 3CCES 1LV5A 1SUQB 2HQCA 1E6YB 4E98A 2KHDA 2ZH8A 3CUNA 2DNOA 1S49A 2Y1LB 4LSLA 2NUHA 2F5GA 4Y0FA 4LFBF 3P96A 4NLYA 5D77A 4MK7A 3TVYA 4W92B 3H2LA 4KGKA 2XMKA 1NSPA 3HPOA 3PKMA 2YNHB 5KFMA 3TVKA 5HVHA 4ITSA 4IO9Q 3KG4A 1XK8A 4MIWA 2XYHB 1X4FA 1SH0A 2V2QA 1LW0B 1S10A 4O44B 4OHZA 1UPMB 1B99A 4ED1A 4CTAA 4C98A 3CMQA 2UXCJ 1RT5B 3GJTB 3MF5A 3IMQJ 3V6JA 4DUZJ 3LP0B 1F5CA 4O23A 5MAOA 1RT1B 5ADZA 4M5GA 2I6WA 2AJQA 4L74A 2J0SD 3UD3P 2VJVA 3ETOA 3UN5A 1TKTB 1A0OB 3SI8A 1EETB 1WSVA 4C7QA 5HBMA 2C1EB 3UD5A 2AW0A 2N7CA 1YX2A 2UUWA 4XDDA 2CWXA 3KKFA 4NYPA 2QC3A 3FUYA 1KEKA 2OIHA 2MQNA 1DTTA 3GIMA 2A2DA 2BQUA 3T5LA 4I2QA 2YX1A 2B51A 3KK2B 2E44A 2MSTA 4DFMA 3TZZA 1TL7B 2ROGA 4HTIA 2L9DA 1RKIA 1SKRA 4CLFA 2NUUG 2J6SA 2PN6A 2E9TA 1ITPA 5A8RA 5CA5A 5KFUA 2DNPA 3W9IA 4USIA 1F2GA 3NXZA 2IIHA 2DYAA 2DIVA 1J5OB 1UZHA 3MMAA 1F2HA 1HNVA 4UZCA 1DURA 4ZLPA 2EFVA 4RX6A 3RR7A 4ETXA 1UWAA 2CPXA 4I67A 3M4XA 2QRRA 1HNXF 1GXUA 2JH3A 4Q8EA 3DLJA 2EG1A 1YG0A 2XMMA 4HT7A 2DGWA 5E3QA 3M2VB 1S1WA 3TEHB 1YBTA 2LXUA 1OY8A 3TNVA 2DXFA 5KFWA 3BPDA 3QWPA 4ZVSB 4DI6A 3BQ0A 3R5BA 3N5FA 5K20B 2UXBJ 4ZS6A 1REGX 3OVAA 2WBMA 2V2VA 2EXUA 4LF7J 4LF5J 1ZA1B 4DR3F 1BE4A 3PHTA 1JLQA 2PEHA 4HDGA 2GNKA 1ZM2A 1HD1A 1N5VA 1T9YA 3V4MA 1I3OB 1UEVA 3D1QA 5L1LA 3AJDA 5D6GA 3HSDA 1IVZA 4TYAA 3KNGA 2BZ2A 3W5YA 1MSWD 3CJ4A 4ED7A 2JLEA 3W5ZA 3FK4A 2VC1A 2LVWA 5A0YB 1TL1B 1U48A 2UV8A 2HNZA 1PBAA 2G1DA 2RIJA 4CCHA 1QDUB 4Y34A 4LJMA 4LF9J 2JDJA 2IM0A 2E7WA 3I5CA 3Q2SC 4A48A 3DNCA 3Q8RB 4PQUA 1SH2A 5KG2A 2WZ1A 1Y00A 3DI6A 2VFUA 3G8TA 5ETPA 2B9EA 2XEXA 3FMWA 4AL5A 1M0SA 1H6KX 5ETMA 4RW7A 4CM0A 4OYOA 5F8GA 1LWCA 1WF2A 2P9EA 5HLFA 3PXGa 1CQNA 4DX6A 4EO6A 2GVDA 2K2PA 2MQQA 2D69A 6FDRA 4IH5A 3J80U 3U27A 1WG1A 1HNVB 5FD1A 4BDPA 2FZGB 2GAGC 3SIPB 4M8LA 3D1HA 3IM9A 3OVBA 1QSYA 1UETA 3MPDA 2B9XA 2MYFA 1Q0NA 2RKIA 4K4WA 4W98A 1U02A 2RRAA 4FNHA 4ZOSA 1TTHB 3CNQP 4FBUA 4F7VA 3GCWP 5IT9U 1KRPA 3FQKA 4DMZA 3OUYA 2OSQA 1E6VA 5D0EA 1IKWB 3GFZA 2LQJA 1YJUA 3MEGB 3L4BC 4LF8J 2ZZNA 3BDEA 3M8QA 4P52A 4DL7A 4QR2A 3CC2S 2V69A 5LJ3Y 1JX4A 2VB6A 1IN0A 4DV1J 2ZBQA 4HL9A 4OX7A 4DHVA 1U1RA 3HT3A 1HNIA 1Q8IA 1Z4UA 4F02A 1BUXA 1R8AA 3MAQA 4B9NA 3GYGA 5FDLB 3LP1A 4DLGA 2NR0A 1L5UA 1L3TA 3KNAA 2VH7A 1NNDA 1RHQB 4NA2A 2KFYA 4DR5F 3GIKA 2DXDA 3RR8A 2E5HA 2CQ1A 3KYLA 2AJFE 4WTOB 5IV4A 2XMJA 4DV7F 5C24A 4OLOA 2W8KA 2ZD1A 1FEHA 5IQQA 1YSJA 2HNZB 4H4KC 4TQSA 3EVOA 1WG5A 4FN5A 1MWZA 3TAMA 1BGXT 5KT6A 2DH9A 4RBUA 3VQSA 4CLUA 3FKBA 2ZHBA 1S6PA 5A2QY 2W2NP 4AXJA 2W9BA 3IR6B 3MI7X 3LOUA 2GMJA 4DV5F 3I87A 3TO8A 1TQLA 3AXKA 2E5IA 3LGMA 3C16A 2V4JB 1LWCB 1S6QA 3SSSA 3BGLA 2LFVA 2VHGA 5HLFB 1YRTA 5KT7A 4PQAA 5HO4A 4JBCA 4RW4A 2GVDB 4LBHA 3NL0A 3AXMA 1O5JA 3MMBA 4EYIB 3ULHA 2GJIA 1XR7A 2BRLA 3DGVA 5KG3A 2DR8A 1CEZA 2Y9HA 1U1PA 1EKSA 2AMCB 4LFBJ 5BYRA 1OS5A 2Q1LA 3W2WB 4CO5A 1NXIA 1PYOB 4OI0A 2PC6A 3AODA 2AYMA 3OV7A 1IR0A 1APSA 2YKNA 2KYZA 3M8QB 2DT9A 2AJ4A 3NNHA 1YZ6A 1W25A 2HVZA 3G9CA 2VBZA 3AH6A 3X3UA 3RW6A 2B43A 4DF4A 1Y5LB 3TUPA 3DKDA 1D8ZA 3O1LA 1L3VA 4C8MA 3VR1A 3GV8B 2PMZD 1WF0A 5F3ZA 3OPKA 2EBEA 2NYHA 2ZBCA 4CLYA 4ZPVR 5KFIA 3OL8A 1RABB 2K8GA 1YI2S 1EHWA 3LP1B 5ETNA 1FTCA 4LQ9A 4OZNA 1S9GA 4KB7A 1Z1ZA 2A1BA 2RMLA 1PILA 3D1OA 3T5KA 4I1TA 4CLLA 4Y2AA 4J9MA 3PEJA 4CWBA 4C8YA 3MCOA 1SV5A 1M5HA 1NSKL 2ALZA 2HQIA 1PC4A 3PJ9A 4KQZA 2VPZB 2WSEC 3PO4A 2ZH1A 2XB2D 3HX9A 1QM9A 4QPXA 4F36A 4DS4A 1K8AT 1CJTA 3TAMB 2WTFA 1WC3A 2RUSA 4MKBA 2B7BB 3QYYA 5KOWA 2PE8A 3IXQA 1S6PB 3FMBA 4DS5A 2DEJA 1RBOB 1VRTB 4A8XA 4E0DA 2X3DA 5DDRC 3PZPA 2RQ4A 3KXDA 1DY3A 1EIYB 3C16B 1S48A 3MCNA 4N5SA 1RWPB 2OMLA 3BPSP 2BUNA 1O6XA 2XZTB 2R7WA 1FKPB 3M8SA 2YVSA 4NLOA 4RW4B 3W1YC 1SQGA 4GO7X 2HHHF 1Q5YA 2OFGX 2XS2A 1UVKA 3IWNC 2CVIA 3MMBB 3O5TB 1WKJA 3DGPB 2IM2A 1TL3B 3W5XA 1HIYA 4I56A 1TAQA 4ILRA 3VQTA 2IAJA 2AGPA 4ZPTR 2GC8A 2HYIB 2A0FB 4J9VA 2CPHA 2G2YA 1HNXJ 4MJKA 2XLJA 1DFDA 2KJVA 3CCZA 3BS9A 1UL3A 4V19J 4ANCA 2PD1A 4YFUA 2MJUA 1RKJA 3U7JA 2GO9A 1TKXA 3JYTA 4ECTA 8RUCA 3M9NB 1P1TA 1RE1B 2CJ9A 3NMAA 2ZH2A 1WOPA 4MFBA 3JSRA 4QIWD 2YX7A 2HBYB 2W7OA 4NLPA 1D8YA 1N52B 2LU1A 4USWA 2JEJA 5IT0A 2NPFA 2KH9A 1O8BA 2ZH4A 3AD7C 5E2QA 4CO3A 3DLEA 1FD8A 2A6OA 1UEKA 1SKUB 5L1KA 5F8IA 2AEJA 4C48A 2R8IA 5I42A 2R2TA 3L09A 3CDUA 4O3NA 3RRHA 1C1BA 1SV5B 4LRAA 1XEZA 1BQMA 3QQCD 2IHR1 2QE5A 2CFXA 3EGVA 1B0VA 2EW9A 5B0DA 3U1LA 3EVMA 1LQ9A 3R6LB 2YKPA 2N4DA 4OYBA 4PXDA 3SDEA 5C25A 3T9ZA 2Y0BB 3HHLA 3W64A 3CWJA 4J9QA 3ILLA 2DH8A 2UVUA 4LR7A 1JLCA 2DH7A 2JSXA 3GFYA 6FD1A 5KFYA 2V4QA 3BZQA 3CDAA 2CZVC 3H5UA 3LALA 5GVQA 3NNCA 3DXSX 3ZZTA 2YQ3A 3GTYX 1HBUB 2HRUA 4OJ1A 4A8MP 2BOPA 3M1VA 1UMJA 4IG0A 3OTBA 4YY3F 4OJHA 4ZCIA 3NAHA 5H9FK 1EP4B 4FYVB 4BLGA 3M8WA 3AHPA 4B9SA 2HAIA 4PYDA 4WIQA 3DRPB 2NZ4A 4QU7A 4DV6F 2IAJB 3PR5B 2UZAA 5CABA 4N41A 3QLHA 3K58A 3JAMY 3H0PA 3OR1A 1CS4B 2E9RX 2WVFA 3O6QA 2ZOMA 5D4PA 5IC4B 1TKXB 3JYTB 2KYXA 5KFRA 2J76E 1YJNS 3L3CA 1WACA 2MLXA 4DR4F 1SL1A 1OYEA 4MFBB 1NCLA 3MUTP 2DNRA 2I38A 1RT3A 2J8SA 3E01B 4USMA 2BJ7A 2QL9B 1Z2ZA 2QFJA 5E33A 1MMLA 4OZJA 2WAQD 3DC2A 1X5TA 5A8WB 5DG9A 3PR4A 1JKHB 3ENAA 1I6JA 2DCLA 2CZ4A 2FJEB 1U4BA 5ETOA 3FEYB 3D7SB 3DDKA 2A6MA 4FVMA 4U96A 1WEXA 4URSA 4P2SA 4DR5J 3GSIA 1NKEA 2HRYA 3MZIA 2VICA 1NDKA 1BQMB 2W7PA 4Q44A 2FHJD 3JXOA 4DV7J 1KSPA 3K5OA 2HQGA 3W60A 3RB4A 2L48A 2LQ9A 3A4TA 2D1CA 2RU9A 3CXCR 1R8HA 3ENQA 4M63A 1ZAVA 3OTDA 5H9EJ 3KLGA 3IS9A 5HANA 1RT2B 3HHLB 3W66A 2BVZA 3QJLA 4CM2A 2BV3A 1U0HB 3TYTA 4KFBB 2C3MA 5F8JA 4C2MA 3GJRB 1S6OA 4CO0A 3AFGA 3G86A 5LSOA 3QGIA 3SCJE 4ELUA 4DV5J 1FXDA 5KFGA 4OZLA 1UVMA 1X31C 3GV5B 1YKWA 5DRKA 4QCLA 2Y1JA 3AD8C 3AAWB 4KH0B 2GJFA 2BJEA 2ACMA 1HBMB 3P5BP 1K44A 2CADA 4OYWA 4MTPA 2GQQA 1BWVA 4FYXB 1QTMA 3QT6A 4KTQA 5HQLA 4LSZB 4LMZA 1VRUB 1HWIA 3MURP 1ZM3A 4RW6B 1JNZB 1REVA 4NZ7A 4A8KA 3VAJA 4DR1J 3DLBA 2PI4A 2WOMA 1LWFA 3K8WA 1X4GA 5JXSA 2RQMA 2MZSA 1V6HA 3OR1B 3B8HA 5KG4A 1SC6A 5KFEA 1GTHA 1GQEA 3PW0A 1Q7YT 1RCOB 4PYAA 2QLFB 1RJJA 3VGTA 2G0IA 1XN9A 3US5A 1M1HA 5I3QA 2ZEJA 1ICEB 2C42A 4UY85 4L72B 4I69A 1EQ0A 2OGUA 4PWDA 4ED2A 2HIYA 4OZ3A 2V50A 3KJNB 2XLIA 1SJFA 2AWZA 3C14B 1P9QC 2DVIA 4FDFA 2D9OA 1D0EA 2NPIA 1VI7A 3FBCA 4ZPWR 1FX2A 2RF2A 2Z58B 4JV0A 4RUHA 1NMEB 3I32A 4CI0B 3NS7B 2DXEA 1S0VA 5CYQA 4WFYA 1RAFB 2OD4A 4OX6A 5C42A 4B9LA 4OV6A 4RW9A 5E7OB 4CZCA 2VPYB 2XO6A 3QZ8A 2F8HA 4IRKA 1X9SA 3TJ9A 1BWEA 5F3TA 2XMTA 4BS2A 4EUVA 4PR6A 3M05A 3TRGA 4F04B 3H2VE 1VQ6S 5F8HA 3I9V9 4P75A 1XNRF 2CUYA 2DISA 3UN3A 4IH6A 1RAAB 3MUMP 3MECB 1DZ5A 1K0TA 1R6YA 2LECA 2DR7A 4AL7A 3QRQA 2CJBA 1R0CB 3CJKA 4U7UD 4F4AA 2JFDA 3CEDA 3GPAA 1HKAA 4PG7A 2VOPA 4P10A 1CQMA 4NRTA 4DZ6A 3CJ0A 4RW8A 4Y28C 2XMWA 5G0RA 1RBAA 3CCVS 3MFHA 3M30A 5FJ4A 3POTA 4NMLA 3HCXA 3TUJC 4M5HA 4ICLA 2O67A 1Q16B 2XZWA 1D9DA 2B56A 2HZAA 4WU3A 1M1KT 1LWFB 2MKIA 3JB9k 4OHYA 3G87A 3VGUA 2XCPA 1AA1B 1N54B 1FTRA 4RLEA 5KT3A 4ZVQB 4EEYA 2C2MB 2ZNZA 2W1BA 1N5YB 2C22A 4QJVA 3LP2A 4USHA 1UA1A 2HFOA 1TFYA 4DUYF 2VODA 3CJ8A 1RAJA 3NNAA 4W90B 1YTYA 3PNIA 3MD3A 1KLMA 5L1JA 1LNQA 1S0NA 5SUHA 2CNLB 1EARA 3G6ES 3D9BA 2E29A 1S76D 4FPIA 1VHIA 2UVVA 2HGLA 1NPRA 2NXNA 2PDAA 3SV3A 3ZZYA 2P9CA 4O3PA 1IM4A 3OTCA 2VL1A 4KGXB 3FEZA 4P6QA 2RF2B 2RAQA 3LQVA 2CZ9A 3TJ8A 4DF8A 1FE4A 5HK4A 2VQEF 2FZCB 5C42B 3GP9A 4RW9B 4WP9A 1RADB 1O51A 2EK1A 2K7KA 4Q0BA 5ETQA 4DU8A 1N6QA 1L3SA 4GMKA 1RGVA 3BYPA 2DHGA 2W9CB 2YWHA 4IOAQ 3BBCA 1K9MT 2OO4A 3QMQA 2B8PA 2LXFA 3QO9B 3MTKA 5B0CA 1NHKL 3BGFA 3C3LA 1UJ4A 1NPKA 2PA3A 2MB0B 3BREA 4B3TF 2KFZA 5F9NA 3VAHA 3NBPA 2HLTA 2MGZA 3CJKB 2IPOB 9ATCB 5KG6A 4TU8A 2BJ1A 4ZVGA 4HLBA 3THVA 2F4FA 4YB7A 4X4PA 3BSOA 1JQGA 3V81A 4M5KA 4L6V3 2ROEA 3DHXA 4YY3J 2V2KA 4X4VA 4OHVA 3M30B 1OSCA 1XIQA 4DFJA 4P71A 4YB5A 4ICLB 2W4PA 2CAJA 3F0NA 2DNQA 4OI1A 3NMRA 3ZTRA 2X1GA 2B4VA 4DV6J 3HFVA 2B7CB 2VBYA 1KLNA 5KFLA 1S1TB 4CNZA 3HSGA 4TY9A 2Q79A 8ATCB 1RTHB 1LFWA 3LP2B 1RP5A 1AXQA 5KFXA 3A8EA 2ILZA 3L7PA 1EX8A 4K59A 2LLZA 2DD8S 2XNQA 3AQPA 2JOQA 5THWA 3O3LA 3VVUA 4P74A 1R8CA 4FKXA 5ETKA 5GAGU 4DQPA 3M9MB 2ASJA 2IDEA 2FC9A 1RHJB 2LEPA 3J7YI 4IG3B 2X1FA 1FESA 1IBLF 3SSRA 4DSJA 2RQCA 1FNXH 2HK3A 3PW2A 3D5MA 5D0HA 2HMIA 4KGZB 3TAPA 1UAWA 1X60A 2PT0A 4OYAA 3UCGA 1K1QA 1PYTA 3S8SA 4IRDA 1N6QB 1QAJA 3PYFA 2NZCA 4ELTA 4KV8B 2IVFB 1T7PA 3Q8PB 4DCOB 3W9HA 3IN5A 1B64A 1U45A 3HVRA 2QSFA 4PWUA 4QYZK 4DV3F 3H7HB 2EG2A 1R31A 2DRDA 4QWCA 2PI5A 1KKHA 3R5DA 2VG7B 4CH7A 2ASYA 1K73T 4J9UE 2YQ1A 3DLGB 3EZ5A 2MGZB 5M2PA 4B3RF 3THPA 3BKFA 4EGLA 3R5GA 3FFIA 3PVXA 1PAEX 2MDAA 4XIUA 2ZDPA 8AT1B 3V81B 4KO0B 3ICLA 1VQLS 3H4BA 4B08A 3KFWX 2B6AB 3DDIA 5B0AA 1A6LA 2GVZB 1W2BR 1EB0A 4JI6F 3HHLD 3J7A1 1C0TA 1SXLA 1UKUA 2BJ8A 1JJ2R 4ZLLA 3I5AA 2RDDA 1S72S 3W2VA 3TANA 3H5XA 2IJRA 5D8HB 1HYSB 4NL5A 2XSJB 1KN6A 2IRUA 4IUFA 3I5BA 2WB4A 3N0VA 1Z2LA 4H54A 3SMZA 1NK0A 2GX8A 5F0UA 1S6UA 5JVHQ 2OSRA 1HQUA 2BANB 3L7OA 1RB0A 3HM9A 3ENVA 1GEHA 5DQHA 3KJVA 2XTJP 4DU7A 2HAFA 4XK8C 4IQMA 2NXCA 4C97A 1P6TA 2ZH6A 3I0RA 1U1OA 4ZCKA 1VHFA 1ZBTA 3RJMB 4MMOA 2HWHA 2IVMA 3DOMA 1RWUA 2VDIA 5D78A 2M70A 4FYWB 2Y1IA 4DR7F 4IR9A 2CDQA 4Y65A 4O0NA 1R0BG 3Q83A 4M5JA 2DGVA 1I94F 1ZA2B 4AE5A 4X66F 4AL6A 3MUVP 3AT1B 4R8UA 3D0HE 4ZP8A 1RA7A 2W7AA 4ZPCA 1AZSB 1FF2A 4OI3A 1FFWB 1GX6A 3RYLA 2MKYA 1T11A 1T8EA 3QIPA 1L3UA 1YDLA 5K8PA 1Q78A 5IT4A 5LT5A 3HI9A 5KOXA 3P8BB 2QG9B 5EGYA 2KG0A 4KE5A 3EGZA 4J9NA 2R2RA 2NREA 3LO3A 2UVRA 4FF2A 2GO8A 4KPYA 5IFMA 1Q79A 4EFAC 4QIEA 4CLSA 1TUVA 1CJVA 3R5CA 1ZYQA 3OLAA 1FI4A 3OFEA 4U95A 3IM8A 4WIIA 2ABYA 2R9LA 5DETA 3Q2TC 1NDCA 1OJ4A 3A3PB 2R7QA 4YDDB 2QSWA 1T05A 5SZTA 2FVRA 1NK5A 4NXNF 2XULA 4WFXA 1RSCA 4OHWA 1GAOA 3N28A 4O4GA 3W2VB 1MWQA 4F0MA 3OR2A 3V4IA 2RH3A 2G2ZA 4NLGA 4ECXA 4NLUA 3KLFB 5CH7B 4M5NA 3R6GB 1KNZA 4ANDA 3IC1A 2OP5A 1SKWA 1XERA 5HVFA 1FRHA 1SVDA 1HQUB 4DL5A 1QJHA 2HBZB 1UTAA 3DLKA 2M52A 3B78A 1RK8A 4MYTA 5KFAA 3KJVB 4DPTA 4DUYJ 2YKQA 3PW5A 1X7VA 4K4YA 1FKOB 1FT8A 3C6TA 2DR5A 3R7SB 4HHUA 3PX6A 5CAAA 3VZIA 4A8WA 3NGSA 4K7QA 2N7YA 2C3OA 4V19X 3CCMS 3M6UA 2MMYA 3LA0A 1NKCA 4EO8A 2J9DA 1HBOA 4ZLJA 2WVEA 4IKAA 3KHGA 2Z56B 1PCAA 1RTDA 5AXLA 5FLXU 1U1QA 1WG4A 4C8NA 5BYSA 4F3QA 5I4MA 2G1HA 5DM7Q 3VAMA 2CRLA 5T7LA 2BM1A 4Y2KA 3T5HA 4PG5A 1C4AA 4R8UB 3A3OB 2F9JA 1V3ZA 1QE1A 1N32F 3QT5A 2WSFC 1IQZA 1KD1T 4UF4A 5DS7A 2WK4A 3K5MA 3QIPB 2C2KB 4YHHJ 3BF4A 1UPPA 2FY1A 2DGSA 2LP4A 1RI7A 3QIDA 1VK8A 4LBIA 3RW7A 6AT1B 1KS2A 2BM0A 3TWZA 2IYGA 3UCUP 3KHLA 1FX4A 1GMWA 2OPRA 4ZITA 4B3TJ 1CJVB 3DRSA 3LUYA 4IFYB 2I0XA 4ID5A 3A8JA 5B0FA 2KM8C 2QV6A 1PBUA 4OYIA 1WC6A 1Q81T 1VK3A 1TL4A 4RWWA 5KT5A 5LSRA 1V5IB 3HHNB 1UVJA 4P7TA 3G82A 2CQPA 3PG9A 2ASLA 3KLIA 2UUCF 2XG8A 5CZVA 3DMJA 3UDEA 4OZ1A 4YB6A 2ZH5A 4O4GB 5HMZA 2EEYA 3V4IB 2AYGA 2V68A 3RBXA 3V2UC 4PEOA 3A13A 4NEYA 1A7GE 2DNGA 2OLWA 3NOCA 4JI1F 3QPIA 3HO1A 2HFSA 4RNHA 1K0VA 5KFQA 3C46A 3CMES 3J81Y 4CT8A 1Q82T 1T95A 3PJWA 2HRTA 3MWBA 2SXLA 3FBBA 4HTJA 2ZH9A 3C6TB 4IFVB 5BXIA 3KLEA 1AFJA 4OYZA 4BC7A 2HPUA 2FHOB 4K2JA 4ILMA 2MTLA 3FSYA 3HSJA 3PHEA 4YN3B 2OELA 2MHEA 3M6VA 3VV2B 1F9HA 2MQPA 1AT1B 2XYPB 2GV1A 4I6YA 3DM2A 2G2OA 3QGHA 3FNNA 4CNYA 1IBLJ 4Z2XA 2RRNA 1RTDB 4G6VB 2JEFA 3JTNA 4K5RA 1K47A 2WW8A 4DCPB 1HHSA 4YR0A 4RKUC 4PCQA 2YY3A 2RNEA 2WCXA 5IS2A 2A10A 3ZZZA 4JV5J 4UQGA 1DRZA 4UTGA 4J90A 4OMFG 4B9MA 3AD9C 3UDVA 4NEZA 5K8MA 3VF0B 3RUBL 4CIOA 4GC7A 3GR1A 1IBCB 3PYEA 2CQ3A 4R0JA 3CJQA 5CYJA 3SQGA 1HWLA 3BKTA 4LREA 2IA6A 2YNGB 1MROA 2HVDA 1C1CA 1W26A 3EJMA 3KLHA 3H98A 4IDKB 2KU7A 1WHWA 1BLUA 2UUTA 1HHTP 1FDNA 3DRSB 3G2XA 1T9XA 4MIBA 4B3RJ 1KONA 2HGMA 2F7VA 5DZ7A 2DGOA 3D28A 5HMXA 3ISZA 1H0HB 3MEDA 1RT7A 3CJRA 5JVGQ 3KLIB 3DOLB 2PO4A 4AUKA 4LF7F 3TA2A 3G96A 5LSLA 3GV7B 2JC0A 1RCXB 1H2VZ 4Y3CA 2CPDA 3GYXB 2D3O1 1U1MA 4RWXA 4DDFA 2EFQA 3K17A 4BWMA 3C6UA 4ECQA 5AE2A 2RQKA 4ZJQA 4AT1B 1ULRA 2DHXA 2FJXA 1JXEA 2P6TA 2M4MA 4FP9A 4J5OA 5GADU 2PIIA 1G1XA 2KT3A 3KG0A 2FC8A 4NCGB 4CP5A 3KLEB 4D3GA 3RBZA 2LEAA 3PRDA 3IRXA 1SKSA 2M5YA 1QUPA 2GHVC 5KAKA 5F41A 2YKMB 2XBPA 3M32B 3DHWC 1T9TA 3ET6B 3DOKB 1H72C 4DR7J 2R7XA 1YITS 5IM0A 1I94J 3AJ2A 4LFAF 4J7CA 1GX5A 4X66J 1T9WA 1K1SA 2C28A 2HNYA 4FF3A 2DEIA 4TN2A 3CDBA 3K57A 3ZZPA 3OTOF 4ES2A 1P8GA 2APOA 1F5AA 1S7IA 3BBBA 4FZVA 1Y3JA 2FVSA 2MKJA 5H1SV 1JJCB 1VQSA 4N47A 3M7VA 3QZ7A 4CLPA 2CPFA 4HHHA 3BV8A 2OPSA 1TMJA 3KLHB 2AU0A 4PZVA 2XMVA 4XTTA 1NH8A 3C19A 3I4PA 1RLCL 2OAUA 1LW2A 3GCXP 3MM5B 2HGNA 2QLJB 1QAIA 4EMDA 3CW2C 1OIAA 4A47A 4IR1A 1WDTA 3IBFB 2ALYB 1T9VA 4EYHB 4N7TA 1DLOB 3MEDB 5HJXA 2FLPA 3TOQA 1RT7B 3R2CJ 1PIEA 1TUGB 3MMCA 3MR5A 4NXNJ 3BO2A 4QWAA 5HL7Q 1X4CA 5GAGI 2VG5A 2P6SA 2Z2LA 2EI5A 1QY7A 3QAUA 3CCSS 2QJ3A 5FIIA 1PGZA 3ZC4A 2HHQA 2VONA 3GONA 2HVEA 4PUOA 2A3JA 1CPZA 3BGRA 5JJBA 4TVAB 2IMOA 3I6PA 4FXWA 3RZAA 3MCMA 3H90A 1S0OA 1YRXA 2IC3A 3BGUA 3DFEA 2ZJRQ 1Q8BA 2M3DA 3LW5C 3IRXB 1WD6A 3PX0A 4TY8A 3N6MA 2H5IB 4ALZA 3ELHA 3DU6A 5C2CA 2OPQB 4FS1A 3HVTA 1KHWA 4PXBA 2BMBA 4GVBB 3HJFA 3ILIA 1BQNB 4L3NA 3SEOA 5IM0B 4F2RA 2J9DE 1JXVA 4M5DB 2V2ZA 4EU0A 4RU2A 4FF4A 2W24A 2HNYB 2YWFA 2EFNA 2Y3YA 5L9XA 1XJWB 2NCKL 4ZCMA 1S7HA 1ZM9A 2CPIA 1N32J 3OBIA 4NCBA 2FYXA 2KTQA 3WHIA 2FJVA 1F9EB 3PIOQ 4DG1B 2PFFB 4PKDB 3SV4A 1FE0A 1IKXA 3H59A 4B9TA 1RBLA 1FWKA 2A2CA 1S97A 3A12A 3S1TA 1SIZA 4Q7AA 2L9WA 4R5PB 2QA4S 2OPSB 3QNWB 4XPEA 2AKWB 2M9KA 2FLNA 4K4TA 4C11A 2KXFA 3HJVA 2Q3PA 1KQGB 1JJ4A 3EMTA 3EE3A 3EPGA 1TV6B 1KFSA 4EZ6A 4WE1B 2LQ8A 1SPBP 3M2RB 1GMVA 2IM3A 3R1HA 5H9FJ 1WSRA 4ENOA 2VJUA 4ZVFA 1KP6A 1RTZA 3KK3A 3OFFA 1ROFA 2UUCJ 3BYRA 2VG5B 4UOCA 1OO0B 4C3KA 2V8VA 1KHVA 1KFDA 2R2UA 3I96A 1XQIA 4WPAA 5HATA 3JSYA 1WC5A 4OHXA 7FD1A 3Q24A 1Q8KA 3GIIA 2ZITA 1TVRB 5I3UB 1IXKA 1OQ6A 4JI1J 2P8IA 3HFZB 4B17A 2MEWA 3KUEA 1HNWF 4WYLA 3T1YF 4TLRA 5ETTA 2RS2A 4BCAA 3T41A 1FCAA 3TVZA 4O3OA 1SL0A 2NSCA 3N6NA 1U7LA 1S77D 3EICA 4JV1A 3FCVA 1TZ0A 1FFGB 3HD1A 3CULA 3P49B 1H74A 4RU9A 4KHMA 3L7UA 3D67A 1KTQA 4OLPA 2F9DA 2QGFB 3HVTB 4WTYA 4J37A 1NH7A 2XI3A 4GRSA 2IDLA 2HVHA 3HP6A 1RTJA 3GR0A 4UQTA 2K3IA 3PY8A 1R3NA 3KK1A 3ZZ0A 1YHQS 2VU5A 1MW7A 3HZEA 2YWEA 3AA9A 4FF1A 4G1QB 3TAQA 3SQOP 4F26A 1NJIT 1Y10A 2WW4A 5CYMA 2H9ZA 2YKAA 1UWBA 5AXMA 3GZ7A 3D6MB 2J7UA 2MZRA 3NGKA 2H4WB 1SL2A 4HYKA 1RHKB 2RS8A 1U47A 3H20A 4U7UK 4JI4F 4PPDA 5HN0A 5EWGA 4ECYA 3QFWA 3UWTA 4DSFA 4LSLB 2DHSA 2VPXB 2BE9B 3RAXA 4EBCA 3BO4A 1D9FA 3RAQA 3GB0A 4HACA 4NYZA 2VIHA 2ATCB 4JUZA 2VOOA 2OEJA 1NJXA 5KG0A 2OD6A 2IVYA 4ZA1A 4HDHA 1OPIA 2XSFA 5ETSA 2AZ1A 4CTAB 1RT6A 2NSBA 3OSNA 2XY5A 4FYYB 2Z4PA 4U8VA 4F0HA 3ZXWA 2V6AA 1NRKA 3EGWB 1VJQA 2IYIA 3KOAA 2CJKA 1FDAA 3KLVA 2MQMA 1G4CA 4C8LA 3CCQS 4TNOA 2WONA 5HBMB 2XS7A 3I55S 3OFGA 4OX8A 1VMBA 1Y5IB 5AE3A 2DNNA 3AOAA 1FJGJ 2V34A 1WC4A 2OMOA 4R25A 3MM8A 4O0IA 1CJKA 2RB7A 2R2SA 4OI4A 1DTTB 3HSZA 5KT2A 1B70B 1WHYA 1NEEA 3J7ZT 3M8RA 1PJ6A 4I2QB 5F8MA 3IGNA 5E3RA 3JQKA 1AFIA 3MGJA 4ZPAA 4X4RA 1KBRA 1VOMA 3HKZD 4X62F 2XGPA 2BKPA 3KK1B 3WX4A 1PG5B 5AT1B 2VPWB 1RHUB 1AUDA 3VHQA 1Y0HA 4M5LA 1LWEA 4LFAJ 2R3VA 3HMJG 1VQKS 2VA3A 3ADAC 3FSIA 1ZM4A 5A8RB 5EWFA 2V8PA 1DBDA 1VC5A 4EWTA 1FRMA 2M8HA 2OKQA 2KL8A 1KQSR 4USUA 3DRRA 1F3VA 2RJZA 3MMAB 1HI0P 3OTOJ 2DCUB 3THTA 1P27B 2AJ2A 5A2QU 2UP1A 2D3ZA 3LTOA 3MM9A 4I2PA 4I68A 2YPZA 3IWXA 2HHSA 4NOHA 4E2FB 1TU0B 5L39A 2ZJPQ 1S1WB 4HACB 2H65B 3CT9A 4QR0A 2KT5A 4W4MA 3PW4A 4NPOA 4YEAA 4K4ZA 3SBMA 4CYUA 4KBIA 4P2MA 2QLXA 4KC5A 3R5AA 3CD0A 1MN9A 2ZFHA 2P2CB 1X9WA 3HFKA 2YWKA 4LRBA 4KH1B 4OIXA 1U2CA 4N8OA 3MFIA 2BQRA 1EKRA 3CGIA 2QLWA 4WBFA 3N01A 1JLQB 2BKNA 2KVIA 2U1AA 2LMIA 3JTPA 1RHRB 3AOBA 4ZHRA 2W9AA 4YR2A 4HI1A 4AQYF 2WONB 3HHKA 2MKCA 4QR1A 2FDNA 3RGIA 1NB7A 5C7PA 2H51B 3KMQA 1N5SA 3BSAA 3DCAA 2GW8A 1WHXA 4LRCA 4YP3A 4BC9A 3Q8VA 2Y0SD 1EQMA 2DBBA 1MMNA 3CD6S 1S12A 1LXNA 3BO3A 4MKVA 1SBRA 5EWEA 5KFFA 3N9UC 4LRDA 5KG1A 4P9SA 1NZ8A 5J2MA 3MR2A 1TUWA 4UOGA 3D4JA 3NEKA 2HWIA 1X4EA 2H54B 4PQUB 3DI6B 1T03A 2FGCA 4GKJF 4J9SA 5KFHA 2KFNA 4EK2A 4RW7B 3IP0A 2QMXA 4DOZA 3RTVA 1CSJA 2HQ3A 3F56A 2QX0A 3C15A 4ZVPB 1B3TA 4O3SA 1U2RA 1FXRA 3ZTSA 2PEBA 2B3TB 3R7BB 5LOQA 4A8OA 2MSSA 3VALA 4ZJOA 3QT7A 1BY9A 4EBDA 2DNKA 1B0PA 4RBTA 3PV8A 3MM9B 1JXLA 2YH1A 3MEEA 3SCLE 4I2PB 1CULA 3T9NA 1FRKA 4HR2A 4DR1F 2V0NA 2RKIB 2DJWA 4I64A 2V67A 3FC9A 2GMHA 2MZQA 2V8DA 2ZNYA 2XGQA 2JL9A 5F0WA 3OL7A 1S59A 5E0OA 4ES3A 4G3IA 3OUYB 1E6VB 4ED3A 2BJ3A 4RL1A 1M5OC 1U49A 3M8PA 1T9UA 4ZVTB 1KOHA 2MQ8A 3LF0A 5GAEU 5GADI 3T5JA 3CIMA 3FRYA 5EHHA 2CNKB 1HW9A 2ACYA 3BR9A 3PRBA 4FKYA 1HNIB 1FRLA 4DQQA 2DY1A 1YWXA 5D4OA 4I7FA 3OT9A 4ZK7M 4LFCF 3K8VA 3QAEA 4ETZA 3QWUA 2YWWA 3UO0A 2MQOA 1Q53A 2VF3A 4C0HA 3RB3A 3QRRA 4ZHRB 5KG5A 4L76A 2KHCA 4TU9A 1NLKL 4ZVHA 3DRYA 4C0OC 1HNWJ 1ZAXA 1YJVA 2UUAF 3T1YJ 3EXYA 3A1YG 4NASA 1WTBA 2H1YA 1NJYA 5C24B 2GFFA 2ZD1B 1Q1KA 4IYQA 3BN4A 2GCFA 2B5JA 3JQJA 3J7YU 3OSPA 3BEGB 3VGVA 2RT3A 3IA0A 3H8YA 1TKDA 1H2TZ 3W7BA 2X1AA 5DO2A 4ZPBA 4FPRA 4RUBA 3MM6A 2W9BB 1S9EA 4LVNP 4URQU 1QAYA 1HLWA 3D6FB 1S6QB 5CQGA 3H42A 2BE7D 2Y1RI 3C15B 1IR1A 3E8OA 4NWBA 5GAHI 1QUVA 3CD7A 4QYZJ 1U25A 3OXGA 2E5GA 1KR4A 3VCDA 4JI4J 5HI7A 2AT1B 3TEGA 2VFTA 3M2UA 1HD0A 3DRXA 5B7WA 3R2DJ 1U0SA 2DNZA 3V6DA 1FWPA 5KFSA 4HHJA 1KQFB 2HKEA 5KFDA 4LF4F 4LF6F 3B4DA 3WZ0A 4M94A 2ZE2A 2Q6CA 2FUG9 1FD2A 2YKNB 2GZOA 1M1GA 5DM6Q 4CDIA 3ISNC 3WIUA 2CQ2A 2UU9F 1RAIB 4FVCA 1XR5A 5JMNA 4OI6A 5KFOA 3PEHA 4TXSA 3R7NB 1JLGA 4B9VA 2H5JB 5HJYA 4Y00A 4F4YA 4LSNA 3JAMU 3CD5A 1SUQA 4C4WA 2OH2A 1HQEA 1PSDA 1GT8A 2RDIA 2ATLA 3FDSA 5AE1A 1S9GB 4OJ3A 4Y6IA 4RUAA 2V8GA 2BOAA 2DO4A 2X1BA 4JP8A 2AGQA 5CCMA 1N5TA 2XY7A 1T0TV 4WP8A 5HAOA 1NB2A 4DX7A 4CRJA 2YNHA 4NLVA 1SQFA 2QO3A 1F60B 3LWMA 1RWOB 2E1PA 2B0GA 4A8YA 2JEGA 1LW0A 1CJTB 2ZKTA 3MR7A 2HURA 5T41A 2FQQB 2MZ1A 3CVKA 1L3KA 2X51A 2FVCA 2HBRB 5K5MA 3OXFA 5DDQC 1RT5A 3SZ2A 2KJWA 2HFVA 3MM6B 2J6UA 4QW8A 4DPUA 2YXLA 3LP0A 4DSKA 1RU2A 3CJTA 4X62J 1JNRB 1U6FA 1T02A 3HVAA 4X65F 4ZN1A 5HP1A 4MYUA 1WKLA 1H98A 2O3DA 2ZH7A 2CA9A 1EETA 1ZH5A 1GNKA 1UZDA 1JLBA 3R5JB 1UVLA 5GMEA 2DGXA 3FEXB 4QW9A 3ITHA 4DXLA 4Z7YA 2EC2A 2N82B 1HI1A 1QD1A 3EDRB 2GGPA 1SJ4P 4V1Ak 3LH2S 4WYWA 2G0CA 3OQ2A 4UW2A 4NLXA 1LXJA 3FBFA 2KRBA 4Q45A 4ECWA 1MG7A 4O3QA 3W8GA 3FCWA 3MPVA 4JYAF 1QVGR 2GIQA 3IR7B 1SJ3P 4LUBA 2AZ3A 4C9DA 2BACA 1H73A 2ZUGA 4DWIA 1FRIA 2BYCA 2Q66A 4DJBA 4Y2CA 1FDBA 2AHOB 1S0MA 4PWWA 4H4KA 1UFWA 1JLGB 2DB1A 1NAQA 3LANA 7AT1B 5GMDA 1TR0A 1URRA 3DLEB 2MY7A 1HQEB 3TI0A 5JUMA 2MLYA 2ZBIA 4S0MA 3D0IE 1VIXA 3NGRA 2R7SA 2R7RA 2Q43A 1U09A 3G6XA 3EUNA 1A9NB 5I42B 2Z30B 1EJ7L 2M0GB 2FIUA 4AQYJ 1C1BB 1WNEA 4YOEA 2EKYA 3M2VA 2LQBA 2D9PA 2O5DA 4OYXA 4OYPA 2DGQA 4PAAA 3U1MA 3HLUA 3I9ZA 1VQ7S 3TA0A 4DR6F 5EDWA 3SDEB 5C25B 4EI2A 1NKBA 3HULA 3MAAA 5CD4H 1SI9A 3HKWA 1JLCB 4K4XA 5B08A 1IM6A 3IFEA 4E8UA 3CTRA 1ZTWA 1JLFA 1G2EA 4GKJJ 1OSDA 3BDPA 3W8PA 3A8IA 5HP1B 1CG2A 3ISND 1HARA 1UJ5A 5U47A 4A8QA 3EZOA 3M1VB 4IG0B 1JLBB 5IV3A 3J7AN 1B7FA 2DKOB 1QSLA 5A0YA 1TL1A 3ITHB 2BDPA 3KHRA 2C2EA 2VKRA 3TQEA 3P3DA 4RUCA 2GGPB 3D0GE 3NWRA 3RB6A 2KVQE 4F25A 3W62A 3QLHB 3GYNA 2B9WA 3PYDA 4B02A 5IQ6A 2ADBA 1DQ9A 1GK8A 3MAHA 3GJSB 2HK2A 3MEKA 2YNFA 1FVSA 2J0XA 1FO1A 2J9EA 1JJHA 4PPZA 1MU2A 5K8NA 1XMOF 2V5HG 2H5EA 1RT3B 4B3MJ 2C3YA 1BD6A 2VZ9A 2R42A 3CIZA 4PG6A 5EX3A 1VQPS 2YPYA 2AQ4A 2ZDOA 5DDOC 2CIMA 1PO6A 4IOCQ 2H4YB 4DSEA 3K5PA 1VIOA 4LFCJ 2KXNB 4Z37A 5L38A 3U1NA 1HNZF 1TKZA 4F4ZA 1RWWB 4FXVA 4UUWA 5CD4A 2GQCA 4DL3A 2BQ3A 2CNOB 2X3GA 4ZN3A 4G1PA 1WOSA 1J5EF 1RISA 5D0GA 4Q5VA 4FBTA 2UUAJ 3B82A 2B8QA 1IKWA 1FNOA 3MEGA 1VBKA 2FHJA 3K5LA 1T3OA 4NXMF 1J2VA 3KLGB 3IS9B 3JSBA 3FQLA 3MAAB 5BR8F 3B6BA 3G71S 3W9JA 4BHQA 3IR5B 5M2UA 1RWXB 3GLJA 1HL6A 5FDLA 2XYGB 1JLFB 1F0XA 4L75A 2LXIA 2MKKA 4DUTA 2YX4A 4U67Q 3Q8QB 2IMWP 4R0EA 2BJDA 3ZNJ1 3AJ1A 3CSKA 1WHVA 3NWGA 2NS1B 4C3MA 3HXMA 1Q86T 1CVJA 2N3LA 3IBWA 1FERA 1N36F 2HSEB 1REVB 1Y9OA 3G6VA 5LXYA 2WOMB 5B0GA 3NOGA 1S1UA 1CJUA 4HI2A 3KDOA 4XAKA 3UI3A 2YNFB 1H2UX 1XMBA 1FJEB 4LF4J 1D1UA 4A8SA 4DV4F 4LF6J 2FZKB 4J9KA 2VG6A 5KFTA 5CZXA 2RU3A 1MU2B 2NXEA 4OX9F 1VFJA 3CCRS 2G4BA 3FVYA 1HR0J 3R3TA 2FVPA 2V4JA 4PWDB 2UU9J 1UW9A 2MQLA 4LBPA 2KKHA 2QZ8A 3UDCA 3BGOP 3K5NA 4J9RA 3UNYA 4DV0F 3HHLC 3LGHA 2UUBF 3BH7B 1S1VA 1KVIA 3S6EA 1SIWB 1R8PA 2DTJA 1TKZB 3PFOA 3CCUS 5CYQB 2RSQA 3W2WA 3D2WA 3GQCA 4JI2F 3UQSA 2RD5C 1NPPA 4F4KA 2JHEA 4JI5F 3LPYA 4DBQA 4KJIA 4JV2A 3OTEA 2AD9A 2R8KA 1TMMA 1XNQF 5D4NA 4ZJLA 1SJQA 2L9NA 4ZP6A 1DJ0A 1VISA 3K59A 2HHVA 2LKZA 4YHHF 2W4DA 3HVWA 2NQPA 2XZDB 2K3KA 4DPXA 3W3SA 4WXWA 1P9YA 3PO5A 3BR8A 4KRWA 4FNIA 2YWGA 1WC0A 1VCTA 4X2BA 2OI2A 2FLLA 1PYSB 3T1HF 3MPYA 4WKRA 1OWXA 4DX5A 3GWCA 2IJNA 3K2YA 3GG1A 2YQ0A 1AW0A 4U6PA 4X65J 5J2PA 4QIGA 1VLOA 4OYMA 4RW8B 4B3SF 1X4AA 1NHUA 5G0RB 1F3FA 1DQ8A 4PG8A 2F8EX 4DFKA 5GAEI 2I9SA 3POTB 1PJ5A 5EX0A 2PFDA 4GC6A 1B4SA 3IAM9 4KT0C 1FEEA 2ZZTA 4MKAA 3SSQA 2Z2MA 2B4UA 4QIVA 3J80Y 4B3OA 2QLBB 1JK9B 4DZDA 1S1UB 2QMUB 4KPCA 1CJUB 4RBVA 4RO0A 2VG6B 4JYAJ 1VRTA 2BEFA 4WFNQ 1U8SA 4ZP9A 4DL2A 1NSQA 3NGTA 1S57A 2CPZA 2G9OA 1I1GA 5IT9Y 3T6BA 4WFAQ 3R1LA 1KLMB 3H5SA 3CPWR 2R8GA 1NM2A 1FKPA 3OLBA 4DR2J 4F8RA 2MHNA 3UR3C 2XM3A 5HROA 1HHQA 1U1NA 3DGPA 2GA7A 1TL3A 1S1VB 1S99A 5BJRA 4NZ6A 4FXDA 2CQHA 3MCSA 3KG1A 5K14A 2HS4A 3ONQA 3RAMA 5F8NA 2W01A 4X64F 4K4UA 4ED6A 5AXNA 2DITA 2RILA 5IC6B 1D3WA 4JV5F 2XWYA 4KHPF 1ZPVA 4Q0BB 2HQDA 1HA1A 1Y11A 2OHDA 2F3JA 4RNOA 2ZJQQ 2HEKA 2V8HA 1OPZA 3K7RA 5C2GA 2D41A 5F9LA 1X9MA 4DR6J 2MZJA 3QBCA 2CDRB 4M5IA 1CC8A 4RPFA 3FCHA 2E1MC 3OFHA 1MWYA 2CG4A 2IRYA 3K0JA 1LKZA 4ILLA 3H4DA 1YK9A 2W2OP 4A8FA 2P9GA 3NBPB 4LF1A 1VQ9S 1N0VC 4N56A 1X4HA 4NZ0A 3HK2A 1T94A 1YIJS 2AP6A 3VAGA 5J2PB 4WF9Q 5DDPC 1JWWA 3EXCX 3NP5A 1WWHA 3O8WA 2H48B 2JLFA 2LDIA 4M95A 1H7XA 3ZFVA 3DDNA 1JB0C 4LR8A 3CMAS 4DN9A 2DK2A 2WHOA 4B3OB 3KUHA 2CJXB 2CJYB 3NGDA 3F44A 4M5MA 3UNGC 3HHDA 2DRAA 2FD2A 1SB6A 2JVRA 4P2FA 1YVFA 4NYOA 2CVEA 4KKOA 3N79A 4U7CA 4RNMA 4TLQA 1XMOJ 4DL4A 2GIRA 1HBUA 1UFLA 2L08A 3CC4S 3CB4A 1VBXA 3C2PA 1S4EA 5IXUA 2CJAA 4XO0A 2VASA 4N76A 5F8LA 3U02A 4MKYA 2HHTA 1EP4A 3GG0A 4ANEA 2U2FA 3TZYA 5HROB 4OZ5A 4Q8FA 4C6AA 4KHRA 4QWEA 4JI0F 4OI2A 3DRPA 1X4DA 3NRBA 2ILYA 1B0TA 3I4HX 4ERDA 5K14B 2CNNB 2HMIB 1HNZJ 2KZMA 1VQMS 2FTRA 3Q0AA 3ZTPA 1CS4A 3CJ2A 1RWNB 4I6WA 3NAIA 5DG8A 2CKWA 1J5EJ 2MZTA 2I2YA 3J81j 3UE2A 2Y8WA 1JLEA 1VGYA 4YR3A 2HZVA 2WB1D 5ETLA 3G8SA 3DLHA 3CJ3A 3E01A 2W2PP 2ZH3A 3K89A 2R7TA 3QGPA 2HW3A 4ED4A 2C2DA 1Q7LB 4NXMJ 4OJGA 4TYBA 5L46A 5BR8J 2VKZG 3Q22A 1UFKA 5A8WA 1UW4A 4DR3J 3Q23A 2IJFA 3CCLS 2HQFA 3FBEA 1WF1A 4WK3A 1JKHA 1WUUA 1VYAA 2RRBA 1URNA 1RACB 3J7Z5 5L8RC 4YMEA 3NG8A 1TAUA 4K8RA 2DHHA 2V9KA 3FFIB 3ILOA 4A4JA 3X1LB 3GIJA 1HMVA 2IA0A 1ZS6A 1YGYA 5DZ6A 1C0TB 2LA6A 1TL5A 3MXHP 3ZTQA 1BMQB 2QYGA 1N36J 5A6WA 1VQOS 1RT2A 1IWGA 2J6TA 4O4RA 3EGNA 5EN1A 3JQMA 1T3NA 1VDHA 1U0HA 4KFBA 5CHCB 3NCRA 2CXEA 3NY0A 2IRXA 4DV4J 1N0UA 4KKOB 2DR9A 1N34F 3A3NB 3ZTOA 2ZBPA 4OX9J 3HF5A 2Z57B 1Y4ZB 2E5JA 2W2MP 2J0QD 1WTFA 5L9NA 4QOTA 2JC1A 3I0RB 3CO0P 5J1NA 1HBMA 4X4NA 3FZBA 1VQYA 4DV0J 3DOMB 4J9PA 2UUBJ 2ZKUA 1VRUA 4NLDA 4XPCA 4J9OA 4RW6A 1ZOTA 3KWMA 4F2SA 3O2IA 1JMTA 4USJC 2KB2A 3J81U 1LWXA 2AJ1A 2E66A 2VDHA 1DQAA 3DN9A 4JI2J 4CQ1A 2W8LA 5KFJA 4JI5J 2FJDB 4G1IA 3ZZRA 3AB2B 2EVZA 1VRQC 1JLEB 2AIRB 1XMQF 1XNQJ 2N4CA 4MAKA 2MJNA 2DGTA 3H2UB 2XC9A 1M90T 3WDOA 2QYCA 4F50A 2DRBA 3WQPA 2FJAB 3C14A 3QFHA 4C8OA 4WJBA 1RAGB 3T1HJ 1GTEA 2JLGA 4Q2LA 3PYGA 3L9ZA 3PM9A 4PG4A 2GMLA 4CO1A 3LGNA 1R0AA 1XC9A 4OQJA 3M8YA 4AXIA 3KTQA 1YJRA 4NMXA 1KWMA 1C4CA 3V6KA 2AYBA 4B3SJ 1YRUA 5LL6d 1T05B 1HMVB 4LT6A 3IO1A 2DO0A 1NJWA 3E51A 4K4VA 4WXOA 1FK9A 4YQWA 2HIQA 1KC8T 2HS3A 1KDNA 2CQIA 2XHCA 2LEBA 3BB5A 1RLDA 2VFRA 3OR2B 2Z0GA 4URGA 1VQNS 3VVTA 2FPHX 2JX2A 2QT7A 2RE1A 5J2QA 1HPZA 1BQXA 2N3OA 3MECA 1VR6A 4ECUA 4C0BA 1Y5NB 1YJWS 2IFXA 2LYVA 5DQGA 3DLKB 4RZRA 2POKA 2PMWA 2ZUAA 3VAFA 1S79A 1IKVA 1FRXA 4QWBA 2FVQA 2GAHC 2R8JA 2HBQB 4TQRA 3RRGA 4PABA 4OZ0A 2C3PA 1WI8A 4DPOA 3QSYB 3S01A 3NGUA 1TK5A 3W65A 2QEXS 3JTOA 1S5ZA 1U6ZA 1HBOB 1FDDA 2DNLA 3R27A 2DIUA 4TU7A 5DQIA 2NXJA 2JVOA 4QZVB 4BWJA 2MKHA 4AYBD 2XHWA 2LA4A 4X64J 7FDRA 2UXDF 4G65A 5T7LB 1RUSA 1RHMB 4KHPJ 5KFNA 3LAMA 2ZC4A 1QVFR 1N5YA 1QE1B 2KDOA 2EKNA 4Y2MA 2DNMA 3T6JA 3SFGA 3QJJA 1XR6A 2CPJA 4DSIA 1QTNB 2EFOA 2VD3A 2YKOA 5GMKa 1RAEB 5E41A 2LU2A 3VAIA 1WELA 1HWUA 2FJWA 3M9OB 1I51B 3SXLA 1FJCA 2JJ4D 4XDCA 1Q8LA 2XNRA 2I1RA 2BJ9A 3VTIA 2M88A 2OPRB 1Q4RA 4A46A 2JWNA 1C2PA 4ID5B 1R0AB 2W4CA 1YBAA 5KFZA 5KT4A 4LIRA 2IBKA 5LM7E 2D3OR 2HHPA 2KG1A 3CDEA 3EWGA 3MTJA 4NA3A 4F4WA 2W9CA 3G82B 2OEKA 4NLRA 4PXEA 3UFCX 3DMJB 3AY0A 2Y8YA 1FK9B 3UDLA 2BW7A 2J9CA 2JFKA 4ZIVA 3TUIC 4L73A 4NRUA 1HWJA 2VFVA 3GILA 2E5LF 3G6YA 3I0SA 5J2QB 1HPZB 2J8AA 3QO9A 2EPIA 3O44A 5M2RA 3G4SS 4KGVB 2EWHA 5IWAF 1DARA 3SYZA 4WZQA 3Q8SB 1NDPA 4LQ3A 1S1XA 1RU1A 3TARA 2KN4A 1V3SA 1HBNA 1IKVB 2X7IA 1QSSA 1FHTA 2XI2A 1FJGF 2MY8A 3EM1A 2G0JA 4KAIA 9RUBA 2AGOA 1H38A 2NYIA 1IR2A 5ITHA 1R7IA 2O66A 3CE8A 2HHHJ 1Y3KA 4JI7F 4X4QA 2XCAA 2ZVSA 3PRVA 4WK1A 3DM2B 3R9LA 2BW2A 4JI0J 5KG7A 2ZOFA 1NUEA 2CPYA 4OL8A 3IWLA 4GVLA 3KHHA 1HQ2A 4ES1A 2KZZA 1S1TA 5D15A 3TR5A 1YJ7A 2ZOGA 3WIVA 2ZHAA 1IUJA 2ZM6F 2E1CA 4HH0A 3ZZOA 1RTHA 2L3MA 3MD1A 2ZWOA 2E9ZA 2C2ZB 3PX4A 3D68A 3NKYA 4WKYA 5KFBA 2XWXA 3CO9A 4NI2A 3SQGB 1IJEB 2VUGA 4WFBQ 4NE9C 2RUGA 4MK8A 3HHEA 1VBZA 2M2BA 1MROB 1C1CB 3D3BJ 4JI3F 4K4SA 4IG3A 2D7SA 3GFXA 2HNDA 5J1PA 4K2XA 3CJSA 3I82A 2QL5B 4YS2A 3V5RA 4QBUA 4ECSA 4M1KA 1KQKA 4BBYA 3UPFA 2RDJA 4KIAA 4I4BA 5GAHU 4IH7A 3I56S 3TJAA 4C8KA 3C66A 4Q43A 2GHWA 3TX0A 1R6VA 1PC5A 4KV8A 2XS5A 4DQRA 5K9FA 1DAXA 4K5SA 1CC7A 2D74B 3CCTA 2DR6A 3MM7A 4I0WA 3MPWA 1M5PC 2C2RA 3I0SB 4TKTA 5D3GA 5D4LA 3DYAA 5K8OA 1W2IA 3WC2A 5C5JA 2VG7A 3F73A 4AD6A 1AB8A 1BHNA 2BABA 4D3HA 3DLGA 1GXLA 1S1XB 1U1LA 1SQEA 2FY8A 3UR0A 2K06A 3C6UB 2XY6A 3IBCB 1N34J 1HBNB 4WU2A 4ZLNA 5A76A 2CQBA 1IQTA 1RZMA 3AOCA 3Q8YA 2DNYA 3TP2A 1DHMA 2UVWA 3UVJA 3P4UB 4ECRA 1P1LA 2DNHA 4KO0A 1N33F 4HT5A 4LF2A 4F3MA 2B6AA 1IBKF 2F63A 4MIAA 2GVZA 2Z8QA 3BSNA 1ELOA 1TELA 3AB4B 3D3CJ 2GIFA 2BXJA 4X4OA 3H5YA 4ZKAA 3TX8A 1HYSA 1MMDA 4K0KF 1FRJA 2R7VA 3GFHA 3W63A 2XSJA 4MT1A 1VC6A 2LDYA 2OPPA 2JRSA 1ACMB 2OJ3A 5KFCA 5DGAA 4CLKA 2BANA 3MMJA 3N6LA 2NLWA 1XMQJ 5BYQA 4QYRA 4Y2IA 4DR4J 2CQ0A 4P72A 1Q95G 2BX6A 5HQ8A 2CG8A 2OUGA 4NI2B 1WDDA 2C3UA 5J1EA 4DV2F 3D6TB 4ZMMA 1YLXA 2EBGA 2XMAA 3SFUA 1NJZA 1GXTA 2HNDB 4NCAA 4HH1A 1LW2B 2DY9A 2EK6A 4FS2A 1V9OA 2VBWA 1VBYA 1X0FA 2B9YA 4GKKF 2E1RA 1X0PA 2UV8G 2VQFF 2OTJS 3MMCB 1F5BA 5LXRA 3CJ5A 2E1AA 1AZSA 5IZHA 4KY3A 3WX8A 5HMYA 2VA2A 3MM7B 2BA9A 4K50A 4UUXA 5D3GB 3DYAB 5LMUF 1GH8A 4PUOB 4ZP7A 3BGRB 2QFIA 2F4VF 3KMSA 4DLEA 5DGBA 1X4BA 5CCLA 2BRKA 4X84A 3HD2A 3L95X 1G7CB 3W61A 2HS0A 4PRFA 1RXOB 2V94A 4WFZA 2IC3B 1H3DA 1SJ1A 2ROPA 3LPEA 3UVJB 3OD2A 4IOBA 4ER8A 2W2QP 1SC3B 4DQIA 5AJ3F 4TY8B 1IBMF 3BJYA 2Z2ZA 1JLAA 1FFSB 4DPYA 3KJFB 2BR0A 4ZCLA 3MOJB 1BXNA 3IG1A 4DCJB 1B7YB 4NLSA 4PXCA 5KFPA 1J27A 2FB0A 3HDSA 3KLFA 3GMGA 2OPPB 2ZBRA 3LAKA 2UXDJ 2COLA 5B09A 2KM8B 2XO7A 2XQCA 3RG6A 3SCIE 1S4FA 5EUHA 1RTIA 3BQ1A 3OVSA 3N4WA 3ZO7A 2VC0A 1M5KC 3NS6A 1FKOA 2XLKA 2DGUA 2OTLS 4KSEB 1OYDA 4KYZA 3QJPA 2J0WA 2DPIA 1IKXB 3C8YA 3PJXA 3PKYA 1N56A 1U26A 3Q8UA 5J1EB 3S7RA 2ADCA 4N8NA 1R27B 4CLTA 1R43A 1OY9A 3V6HA 2KXHA 4JOUA 4JI8F 2EC0A 4C11B 1FXLA 5A6PA 3NCQA 1HFEL 2QN6B 5CXTA 5DLFA 3PW7A 1PAUB 3DU5A 2CYYA 1FWLA 2AEMA 2VBXA 4H4MA 4ZIWA 3MOZA 3KK3B 1UVIA 2O1PA 4YDXA 4ED8A 4ED0A 2E7XA 1ZZFA 1X5PA 5KFKA 4X4SA 2QA4G 2R7OA 2G13A 3TA1A 1YZ7A 1CBKA 2CQGA 1XNRJ 4UT4A 5IOLA 1GMWD 2KO1A 1RWKB 1N8RT 1QAXA 2E5LJ 2J7WA 1LFPA 3CCJS 3M8ZA 5I3PA 4NLQA 5E5NA 3Q89A 4AFFA 5IWAJ 1LK7A 4DFPA 4P7VA 1N48A 2MKSA 4DPWA 1GMUA 4IFYA 3QGGA 1F6TA 1G3OA 5MLCV 1LK5A 3Q86A 5RUBA 4U8YA 3D6HB 4ECVA 4QIFA 4RNFA 2CWKA 2RVJA 3N5BA 4Q2MA 2AYEA 3GU0A 2HWTA 1FNMA 1Y7PA 1M5VC 1MNEA 1JLAB 4JI7J 4HKQA 3DLLQ 1U24A 4WZMA 2C2OB 3TW0A 2ZHOA 4ZDNA 3IG1B 3OXLA 3JS9A 2QL7B 1RTJB 3OJUA 3EZUA 1H7WA 2DHAA 3PDNA 1NK7A 3GE9A 4LR9A 4ECZA 3VWSA 5CYMB 1YBUA 1SJRA 1UWBB 4LRFA 2ZM6J 4F4XA 2AJ0A 2LQ5A 3BH6B 2C2NA 1NK9A 4DX8H 1RTIB 3P5TL 2FLOA 4IFVA 3TZWA 2W25A 2CPEA 4NX9A 2HFZA 1LEOA 4ED5A 2RHSB 3FSXA 2HHUA 4X4UA 3IAS9 3NCPA 3T3FA 2VFSA 2I5JA 1AYEA 1C0UA 4ZPDA 4OZ2A 4UZBA 5AXKA 4JI3J 5H9EK 3B54A 1VLYA 3OHBA 2F40A 3OL6A 1AROP 1ZETA 3P45B 3NLCA 2PA8D 2CQ4A 1WKKA 2H3EB 1S9FA 2HVIA 5J2NA 2L41A 1MN7A 5A8KA 4CLZA 2D3UA 2VQEJ 2R8HA 3OL9A 1NHVA 3MR3A 4P73A 2F8MA 4H4MB 1FKAF 1LOUA 5LMNF 2KT2A
chains in the Genus database with same CATH topology
1OWXA 3DFEA 3JAMY 2ZJRQ 1RT6B 3GWCA 1Q8BA 2M3DA 1WI6A 3OR1A 3LW5C 2IJNA 3K2YA 3DXBA 3GG1A 2WBRA 1JIHA 2B4OA 2E9RX 4DQSA 3IRXB 1WD6A 3O6QA 2ZOMA 5D4PA 3PX0A 4TY8A 1TKXB 3JYTB 2KYXA 5KFRA 3UD4P 4U6PA 1AW0A 3N6MA 4LIWA 2J76E 5J2PA 1YJNS 4ALZA 1XTZA 1VQ8S 4QIGA 3L3CA 1WACA 1TK8A 3WC0A 3DU6A 4RW8B 4B3SF 1X4AA 4DR4F 1NHUA 2HG4A 3FJ2A 5B0EA 5G0RB 1SL1A 2OPQB 1DQ8A 4FS1A 4MFBB 3HVTA 3CF5Q 3MUTP 2DNRA 2I38A 1KHWA 4PG8A 2F8EX 1RT3A 2YNGA 3E01B 4PXBA 4DFKA 1ZTTA 3HJFA 5GAEI 2I9SA 4IDKA 3POTB 3JSMA 2EFGA 4NA1A 3PACA 1Z2ZA 2QFJA 1BQNB 1UVNA 4L3NA 5E33A 5EX0A 3SEOA 5IM0B 4F2RA 2J9DE 1MMLA 4GC6A 3IAM9 4M5DB 4KT0C 1FEEA 4OZJA 2WAQD 4EU0A 1NK8A 3DC2A 4MKAA 3PIPQ 3SSQA 4RU2A 2Z2MA 1X5TA 2B4UA 4QIVA 5A8WB 5DG9A 3J80Y 4B3OA 4FF4A 2W24A 2HNYB 2YWFA 3FGVA 2EFNA 5L9XA 1JK9B 2PSZA 4ZCMA 2AX1A 1S1UB 1S7HA 1ZM9A 1M5SA 2CPIA 3PR4A 4H4OA 3IRWP 1JKHB 3OBIA 2QMWA 4NCBA 1I6JA 4RBVA 2KTQA 2DCLA 2CZ4A 2FJEB 1U4BA 1ZAWA 3FEYB 1VQ5S 2FJVA 3MM8B 4MH8A 3DDKA 3PIOQ 4FVMA 1WEXA 4KR0B 2VG6B 4URSA 4B9UA 2M7SA 4DG1B 4P2SA 5KTQA 2PFFB 4PKDB 1NKEA 2HRYA 5LJ5Y 1VRTA 3DOLA 3SV4A 3MZIA 1FE0A 1IKXA 2UXCF 2YH0A 3H59A 4B9TA 4WFNQ 2PGCA 2A2CA 1U8SA 4ZP9A 1S97A 4DL2A 3S1TA 4ZVEA 1SIZA 4Q7AA 1BQMB 4DUZF 1YJTA 2W7PA 4Q44A 2L9WA 2CPZA 2FHJD 4R5PB 2OPSB 2QA4S 2G9OA 1I1GA 5IT9Y 3T6BA 3K5OA 4XPEA 1KSPA 3RB4A 2L48A 2LQ9A 4WFAQ 3R1LA 1KLMB 1DTQA 3H5SA 3MR6A 3CPWR 2D1CA 2R8GA 1FKPA 4FYDA 2M9KA 3RB0A 2B4PA 2RU9A 2FLNA 4K4TA 3CXCR 1R8HA 4C11A 2KXFA 3ENQA 2Q3PA 3OLBA 1KQGB 1LWEB 1JJ4A 4F8RA 3EPGA 2MHNA 4M63A 4EZ9A 1ZAVA 3UR3C 3OTDA 5H9EJ 1R8BA 1TV6B 2ZC3A 5HROA 1G6BA 3KLGA 3IS9A 1KFSA 1RT2B 3HHLB 5FLXY 4EZ6A 4WE1B 1U1NA 2WSCC 3DGPA 2GA7A 1TL3A 1S1VB 2BVZA 1S99A 3QJLA 4DN0A 3M2RB 5BJRA 4I6AA 2IM3A 2BV3A 3UCZP 3R1HA 4NZ6A 3TYTA 4KFBB 2C3MA 5H9FJ 2Q6BA 3DRRB 4C2MA 1S6OA 5F8JA 4CO0A 4FXDA 2CQHA 3MCSA 4CO4A 4ZVFA 2GJ2A 3KG1A 5K14A 4IQXA 2HS4A 3ONQA 3RAMA 3KK3A 1V3RA 5F8NA 3G86A 4NCGA 3OFFA 1ROFA 4X64F 4K4UA 4ED6A 5LSOA 3QGIA 3T19A 3SCJE 5AXNA 4ELUA 2DITA 2RILA 1FXDA 3CC7S 2J5AA 1D3WA 4JV5F 2FGOA 2XWYA 3CDWA 2VG5B 2I5JB 5KFGA 4KHPF 1ZPVA 4OZLA 1UVMA 2ZZMA 4UOCA 1OO0B 4Q0BB 1C0UB 3GV5B 4C3KA 2V8VA 3MDFA 1HA1A 1N5QA 5DRKA 4QCLA 1KHVA 2Y1JA 2F3JA 2YKMA 1KFDA 2YNIA 4RNOA 3M32A 3I96A 2R2UA 2ZJQQ 2V8HA 3AAWB 3GSDA 3JSYA 1UJ6A 1OPZA 3DOKA 4OHXA 4ID8A 5HMWA 7FD1A 2BJEA 3Q24A 3K7RA 1HBMB 2ZITA 1TVRB 5I3UB 3GIIA 1IXKA 4F67A 2D41A 1QTMA 4MTPA 2GQQA 2FJBB 5F9LA 2MZJA 4ATNA 1OQ6A 1X9MA 3IGVA 4KTQA 4HVZA 1CC8A 5J2NB 4LMZA 4B17A 1VRUB 2A18A 5A8KB 1HWIA 3MURP 1ZM3A 3FCHA 4ELVA 1HNWF 4RW6B 2E1MC 3OFHA 1MWYA 2CG4A 4WYLA 2IRYA 1HW8A 3T1YF 1JNZB 3K0JA 4TLRA 4B3MF 1REVA 4NZ7A 2DPJA 4A8KA 2KRRA 1LKZA 4DSLA 3VAJA 4ILLA 1TK0A 2RS2A 4BCAA 3H4DA 3DLBA 2PI4A 1FCAA 2JZ5A 3TVZA 2WOMA 1LWFA 2AV5A 3B4MA 3K8WA 4O3OA 2WRMA 2CQDA 1X4GA 5JXSA 2RQMA 1UA0A 2P9GA 2NSCA 2MZSA 1SL0A 3NBPB 4A8FA 1V6HA 1VQ9S 3N6NA 1U7LA 3OR1B 1N0VC 3B8HA 5KG4A 3E3XA 4N56A 1SC6A 5KFEA 1S77D 1GTHA 1GQEA 1X4HA 4JV1A 4NZ0A 3HK2A 2O01C 2M8DB 3PW0A 1TZ0A 3BQ2A 1Q7YT 1U6BA 1T94A 3CULA 1YIJS 1RJJA 3P49B 4RU9A 2AP6A 3VAGA 1NU4A 5J2PB 2HHXA 1N88A 1NK6A 4KHMA 4WF9Q 3H25A 1XN9A 3US5A 1KTQA 5DDPC 2CJQA 4OLPA 5I3QA 1JWWA 3EXCX 2F9DA 3NP5A 1WWHA 3O8WA 2C42A 4UY85 3HVTB 4L72B 4WTYA 4I69A 4J37A 1NH7A 2XI3A 2JLFA 2HVHA 3HP6A 1RTJA 4PWDA 3GR0A 4UQTA 1FVQA 2LDIA 4ED2A 5L1IA 2K3IA 3PY8A 5B0BA 1R3NA 3KK1A 3JSMB 4M95A 1H7XA 5G4DA 3ZZ0A 4DL0C 1YHQS 3ZFVA 1MW7A 4CO2A 4UY8T 3HZEA 2YWEA 3AA9A 4FF1A 4G1QB 3DDNA 2XLIA 1JB0C 4QPTA 3TAQA 2FHKA 3CMAS 2AWZA 4DN9A 2DK2A 4F26A 1SJFA 1NJIT 1P9QC 2WHOA 3MM5A 5CYMA 2DVIA 2H9ZA 4B3OB 2YKAA 2D9OA 1D0EA 1UWBA 2NPIA 5E3CA 5AXMA 1VI7A 3GZ7A 1RT4A 1FA0A 1HI8A 4H4OB 3NGDA 3F44A 3UNGC 4ZPWR 2RF2A 3HHDA 2DRAA 2FD2A 2J7UA 2MZRA 4JV0A 1DLOA 3NGKA 4RUHA 1SL2A 1SB6A 4HYKA 2RS8A 2JVRA 1U47A 4O3RA 1YVFA 4NYOA 1UP1A 2CVEA 3H20A 3I32A 4CI0B 1HWKA 4U7UK 4JI4F 4PPDA 5HN0A 5EWGA 2UXBF 4ECYA 1S0VA 2QA1A 5CYQA 4KKOA 2OFHX 2OD4A 4WFYA 3FZ2A 3UWTA 3MHYA 1YQHA 4OX6A 5C42A 4B9LA 4LF5F 4F3OA 4RW9A 3N79A 4KGMA 4U7CA 4DSFA 4RNMA 4TLQA 5E7OB 4LSLB 5J2MB 4CZCA 2DHSA 2VPYB 4DL4A 2ASDA 3QZ8A 2GIRA 1HBUA 1UFLA 2F8HA 2L08A 3CC4S 1X9SA 4IRKA 1BWEA 3CB4A 1VBXA 1U1KA 5F3TA 2XMTA 2MXYA 4BS2A 2VPXB 3C2PA 4EUVA 5IXUA 3OJSA 4PR6A 1DTQB 2AF6A 2CJAA 3M05A 3RAXA 4XO0A 1T03B 2VASA 4J9LA 4N76A 3TRGA 4EBCA 3BO4A 3H2VE 1D9FA 5F8LA 1VQ6S 1UEUA 2GHPA 3U02A 5F8HA 3I9V9 3ZZUA 3GB0A 3RAQA 4MKYA 2HHTA 2QA2A 4NLTA 1EP4A 3GG0A 2U2FA 4NYZA 5HROB 2EFPA 1XNRF 2DISA 4OZ5A 4JUZA 4RNNA 1VS3A 4Q8FA 4IH6A 1SH3A 3RBEA 1XWLA 2R7UA 3MUMP 2VOOA 4KHRA 2KI2A 4JI0F 4QWEA 1NJXA 1R89A 4YB1P 4OI2A 3DRPA 1X4DA 5KG0A 2OD6A 1IKYA 2IVYA 3NRBA 4ZA1A 3MECB 2ILYA 1DZ5A 3EYZA 1B0TA 1K0TA 3I4HX 4ERDA 5K14B 2K1RA 4HDHA 1R6YA 1OPIA 2LECA 2DR7A 2XSFA 4MK9A 3OHAA 4AL7A 2HMIB 1NK4A 2CJBA 2KZMA 1VQMS 2FTRA 1RT6A 2NSBA 4GO5X 4CTAB 3OSNA 3Q0AA 3M6WA 3CJKA 2XY5A 1RA6A 4OFZA 5KFVA 2JFDA 3CEDA 3T1AA 3CJ2A 2Z4PA 4I6WA 4PG7A 3MEEB 3NAIA 5DG8A 2CKWA 2VOPA 2MZTA 2HZCA 1VQ4S 2I2YA 3UE2A 4LF9F 1CQMA 3RU0A 1JLEA 2YNIB 4NRTA 1NRKA 2XMUA 1VGYA 3CJ0A 3EGWB 4YR3A 4RW8A 4Y28C 2YTCA 2WB1D 2XMWA 3G8SA 5G0RA 2OPQA 1RYSA 3CCVS 2IM1A 2IYIA 4WCEQ 3DLHA 2CJKA 3KOAA 3CJ3A 1FDAA 3E01A 3KLVA 2ZH3A 2R7TA 3VZHA 3MFHA 3QGPA 3M30A 2HW3A 5FJ4A 2C2DA 3POTA 4N77A 1Q7LB 4NMLA 1BQNA 2MQMA 4OJGA 3TUJC 4TYBA 1XBWA 5E3AA 4C8LA 4M5DA 3CCQS 3PFEA 4ICLA 4TNOA 1HR0F 2WONA 4YUDA 2VKZG 2ERRA 3E2EA 3Q22A 3M8PB 2O67A 3RRKA 1Q16B 5HBMB 3VAKA 2XS7A 4LVOP 2XZWA 3OFGA 3I55S 4OX8A 1D9DA 2B56A 5A8WA 1VMBA 1Y5IB 4WU3A 5AE3A 1UW4A 5DG7A 1M1KT 3Q23A 2IJFA 3CCLS 2DNNA 1LWFB 4X4TA 1WF1A 4WK3A 2MKIA 2BE2A 3EX7B 3G8QA 3JB9k 1JKHA 3D54A 2OMOA 4OHYA 4R25A 1CLFA 2RRBA 2XCPA 1URNA 1KOOA 1N54B 4OV1A 3F41A 1FTRA 5L8RC 4YMEA 3NG8A 3MM8A 4RLEA 4O0IA 1TAUA 5KT3A 4EEYA 2V9KA 2VV5A 3FFIB 4DG1A 2V4RA 2JEIA 2RB7A 2R2SA 4OI4A 3H40A 2ZNZA 1DTTB 1N5YB 2C22A 4I7FB 1E6YA 5KT2A 4QJVA 1WHYA 4A4JA 3LP2A 4USHA 1NEEA 1UA1A 3J7ZT 3NS5A 3X1LB 1YJ9S 3M8RA 2HFOA 4I2QB 1RQ0A 4DUYF 1TFYA 5F8MA 3RBDA 3IGNA 2I8EA 1X8DA 5E3RA 2VODA 1AFIA 3GIJA 3MGJA 1RAJA 1HMVA 2IA0A 3NNAA 4ZPAA 4R5PA 4W90B 1YTYA 4X4RA 2IBOA 3PNIA 1VOMA 3HKZD 3MD3A 4X62F 2XGPA 1YGYA 3KK1B 3WX4A 2VPWB 1KLMA 5L1JA 3BSCA 1VC0A 1S0NA 1C0TB 5SUHA 1AUDA 2LA6A 1TL5A 3MXHP 3G6ES 2LCWA 1Y0HA 1LWEA 2E29A 1S76D 3HMJG 2UVVA 2HGLA 5A6WA 1RYRA 1VQKS 1FJ7A 2VA3A 3FSIA 1TV6A 2PDAA 1ZM4A 1VJWA 3SV3A 3ZZYA 2P9CA 5A8RB 1VQOS 1RT2A 2K7JA 2MPUA 3SCKE 3AA8A 5EWFA 2J6TA 4O4RA 4WE1A 1IM4A 2GQ2A 3OTCA 2VL1A 4O3PA 1RT4B 4LF8F 1DBDA 1D9AA 1OQ3A 2AX0A 3EGNA 3FEZA 4DL6A 1VC5A 4P6QA 4EWTA 5EN1A 1FRMA 2B5JB 2RF2B 3M2RA 1T3NA 2M8HA 2OKQA 1KQSR 1X5SA 4KFBA 3DRRA 3LQVA 5CHCB 3NCRA 1U2FA 4O44A 2RJZA 3MMAB 1HI0P 2IRXA 4DF8A 4DV1F 2DCUB 2CQCA 3TUZC 1FE4A 1N0UA 3THTA 3M6XA 1P27B 4KKOB 2VQEF 2P5VA 2DR9A 1N34F 2UP1A 5C42B 4RW9B 2D3ZA 4CH0S 3HF5A 1WEYA 1O51A 2EK1A 3MM9A 4C3LA 1Y4ZB 2K7KA 4I2PA 4Q0BA 2E5JA 2J0QD 2HLUA 1N6QA 4I68A 1L3SA 1RDRA 3FRZA 3IWXA 1WTFA 4GMKA 1RGVA 1S9EB 2F1FA 4QWDA 3OW2R 5L9NA 2DHGA 2W9CB 3P6YC 4NOHA 2HHSA 1RT1A 2YWHA 4QOTA 4EBEA 2JC1A 3UW1A 3I0RB 5L39A 4IOAQ 5J1NA 2ZJPQ 1HBMA 5I3UA 1S1WB 1TVRA 4X4NA 1K9MT 2OO4A 3FZBA 3LWLA 1IJFB 3CT9A 2HFNA 1O0PA 1VQYA 4QR0A 2KT5A 2ZKUA 1VRUA 3AQOA 1TKTA 3QMQA 4NLDA 4XPCA 3I31A 4J9OA 3PW4A 5DJBA 4NPOA 4YEAA 4RW6A 2LXFA 4K4ZA 1ZOTA 3QO9B 4KBIA 2QLXA 2R4FA 4KC5A 3MTKA 3R5AA 5B0CA 3BGFA 1IKYB 3CD0A 1UJ4A 3KWMA 3C3LA 2ZFHA 1X5OA 4F2SA 3O2IA 1X9WA 1WEZA 2K1RB 2NXUA 2PA3A 1JMTA 3HFKA 2KB2A 4USJC 5T14A 2YWKA 2MB0B 3BREA 2AJ1A 4B3TF 2KFZA 1QLNA 5F9NA 3VAHA 2E66A 3NBPA 4DEZA 2HLTA 1DQAA 3DN9A 2MGZA 3CJKB 4OIXA 3CCWA 4CQ1A 2W8LA 5KG6A 4TU8A 4N8OA 3M2UB 1TFWA 5KFJA 3MFIA 2BQRA 4ZVGA 1ZPWX 3CGIA 4HLBA 2QLWA 2FJDB 3THVA 4G1IA 3V6DB 4YB7A 1BC6A 3ZZRA 3AB2B 2EVZA 3N01A 1JLQB 1JLEB 1XMQF 4X4PA 3BSOA 3ENWA 2N4CA 4MAKA 2KVIA 1KVJA 3V81A 2FHMA 2MJNA 2DGTA 1F9FA 2U1AA 3KK2A 3TQ1A 2LMIA 3H2UB 4L6V3 2ROEA 3DHXA 3JTPA 2XC9A 2ZE2B 3BN7A 3HZGA 2V2KA 4ZHRA 1M90T 4X4VA 2HHWA 4OHVA 2W9AA 3M30B 1OSCA 3WDOA 2QYCA 4CH1A 3BM7A 4DFJA 2QIFA 5DLGA 4YR2A 4F50A 4HEA9 4HI1A 2DRBA 4AQYF 3EPIA 4YB5A 4ICLB 4CT9A 4G1QA 2WONB 3HHKA 2MKCA 2W4PA 4IO1A 4QR1A 2FJAB 2J7KA 2FDNA 1NB7A 4NLWA 4QU6A 2DNQA 4OI1A 3WBZA 3NMRA 4C8OA 4IRCA 2X1GA 2B4VA 1ZZNA 3KMQA 5E3PA 2PMHA 4WJBA 1TP7A 4QQBA 2B7CB 1NO8A 1N5SA 1GTEA 2BE2B 3BSAA 2GW8A 3DCAA 1WHXA 4U9RA 2V9WA 1NZAA 4YP3A 2JLGA 2BBEA 1N4LA 4Q2LA 4C8ZA 2VBYA 4BC9A 3PM9A 4PG4A 2Y0SD 4DR2F 1KLNA 2GMLA 5KFLA 1KTVA 2DBBA 4CO1A 1MMNA 1S1TB 4CNZA 3CD6S 4TY9A 2Q79A 1LXNA 1J5OA 3LGNA 1R0AA 1XC9A 4LSNB 4OQJA 3BO3A 3CCES 4AXIA 3KTQA 1LV5A 1SBRA 1YJRA 5EWEA 1RTHB 1SUQB 1E6YB 4E98A 1C4CA 1LFWA 5KFFA 3LP2B 2KHDA 3N9UC