4KIAA

Crystal structure of lmhde, heme-degrading enzyme, from listeria monocytogenes
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
159
structure length
153
Chain Sequence
KKVFITTGTEHYLRQLMANYTGGNVTLLQNFSQSLLYQESTGGAEYRVLQSSGSIKGFGVVVFEYIHLRDEEIPIFLQMYQRASLHFSETPGLQSTKLTKAMNMNKFLIISFWDSEVFFHDWKKSPLSKEITNIMRKNNTQSGFSHEDIYHYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional characterization of an Isd-type haem-degradation enzyme from Listeria monocytogenes
doi rcsb
source organism Listeria monocytogenes
molecule tags Oxidoreductase
molecule keywords Lmo2213 protein
total genus 33
structure length 153
sequence length 159
ec nomenclature
pdb deposition date 2013-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3430 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kiaA00
3FEZA 4FVCA 3TVZA 4AE5A 4KIAA 4JOUA 3FJ2A 4OZ5A
chains in the Genus database with same CATH superfamily
2AJ0A 5K8OA 4DSLA 3NNAA 2YX4A 4DUZF 4PWDA 2EXUA 4IFYA 4Q0BA 2N3LA 4ALZA 2GQQA 5F0UA 3HSZA 1RWXB 2FLOA 1OJ4A 2XY7A 3A3OB 3ICLA 4ECVA 2U2FA 3PJWA 2RQMA 2ZHBA 2ZC4A 2LXFA 2MLZA 3KJVA 4ZP6A 4QWBA 4JI5J 4UUWA 2YBVA 2XMJA 3OV7A 4PG6A 5B09A 3AB2B 1FNOA 3V4IA 1CJKB 3NRBA 4K2JA 2O3DA 5T7LB 4NLPA 1HNXJ 2UXBF 4I1TA 4CH1A 1URRA 4OIXA 3CCSS 5EWEA 3TUIC 2VC0A 4LVNP 4X64J 2C2MB 2F7VA 4KB7A 2HIYA 4NLXA 9RUBA 2EC2A 1JLGB 3FKBA 3OR2B 1GX6A 2MQPA 4CLSA 2QT7A 2XSJB 2VONA 4NASA 1ZAWA 3R8YA 2CQCA 4RW7B 4BLGA 1Q82T 4OJ1A 3RR7A 5JMNA 1NU4A 4DS4A 1JLGA 1OIAA 2H3EB 2HWHA 2B6AB 3DLEB 2BQRA 4ICLA 2J8AA 5DQGA 5J1EA 2Q6BA 2UXCF 1LWFA 3OVBA 1IBKF 5IC6B 4PWWA 4A8FA 1JXLA 4UY8T 3V6HA 4QR0A 1CJUB 4CI0B 3O1LA 2WTFA 4MFBA 1WC5A 1TV6B 4TKTA 4ZHRB 3ZTOA 3OSNA 1N5VA 4ZLJA 4KFBA 4YDXA 1NSAA 4Y3CA 5IT9Y 4OYPA 2UXDF 2W2MP 1SL1A 2RH3A 1VC0A 2RRBA 3IM8A 5CYQB 2JEGA 2PEHA 4ED3A 2L9WA 1N48A 2HWTA 3ENVA 4QIFA 2P6TA 2W4PA 1TVRB 4USJC 3UDVA 3QGIA 4OZ3A 4K5RA 4F4ZA 4DQQA 1C0TA 2E66A 2J9DA 3QZ8A 3KK2B 2VOOA 1QUVA 2IA0A 4OZLA 2SXLA 5C5JA 1XR6A 3E51A 4WKYA 1YTYA 2BRLA 2IMOA 3MMCA 3GMGA 4N8OA 1UP1A 2XTJP 4FN5A 1C2PA 3FBEA 1RCXB 4P7TA 3UVJA 1H7XA 2AMCB 3G82A 4K4XA 2P9EA 1KFSA 1B99A 1V3SA 1UJ5A 3SQGA 4Q2MA 1RE1B 4UUXA 3KLGB 3QT7A 4QIWD 4MK9A 3IM9A 2PDAA 2AEFA 4ED4A 4ZN1A 2JZ5A 2XZWA 2ZD1B 4OHZA 4JI0F 4X64F 3MTJA 2ZITA 3NS5A 2L3MA 4DL0C 3MR3A 3AD8C 3MF5A 4KH1B 1U4BA 3WBZA 3HFZB 4ANEA 3J7Z5 2ZJRQ 4F4XA 3RBDA 1VBZA 5J2MA 2NR0A 1CJTB 5CZXA 3NGSA 2HFVA 2ACMA 3BH6B 3W65A 3G71S 3FFIB 4F4WA 3FEZA 5GAGI 3DU5A 4IO9Q 1S9EB 4WWSA 2B7CB 3JTPA 4RW7A 2EKNA 1RYSA 3S6EA 3HHKA 4HT7A 1UVJA 3J7A1 4FYXB 2Z57B 5IT4A 4ELUA 5F41A 3WX4A 2DR8A 1TAUA 1JLQB 1IN0A 3W60A 5M2UA 3ETMA 1DQ8A 3HD2A 4GMKA 3VAFA 2WVBA 2HAFA 1YK9A 2LA6A 1ZS6A 4J9LA 1TK5A 4KPYA 2WOMA 4I2PA 4DR2F 1S12A 3W9IA 1N34J 2QLFB 3DMJB 3HKZD 3SV3A 4I67A 4WFZA 1JLBA 2KU7A 3CULA 2FVPA 1U26A 2E5GA 3L9ZA 2YQ1A 3OTBA 5C42B 3E01B 5F3TA 5I3UA 1GK8A 1FRJA 4RW8A 4P10A 4USTA 3DMJA 1X31C 4DV5J 2OLWA 4A8OA 1JLBB 1MWQA 2LCWA 5K8PA 3RZAA 4MIWA 2C2DA 3CCES 1S57A 1DJ0A 1SPBP 4IDKA 3DHXA 3I5BA 2MDAA 2RT3A 1O8BA 1PSDA 3IA0A 3NXZA 5KG0A 2X1BA 4AFFA 4C0HA 5CQGA 1JKHA 1LW2A 3L09A 5F0WA 5EWGA 1SUQB 2DHGA 3OVSA 5ITHA 5HSPA 3TX8A 4PQAA 1Z4UA 4QW8A 2GMJA 2DH9A 1KBRA 9ATCB 3N9UC 1S6QA 3LO3A 3DCAA 4OI1A 3PHEA 1AROP 4TU9A 4N5SA 2J9EA 5LMNJ 2X1AA 2B4VA 3IS9A 4KGKA 1YIJS 5DQHA 3GJRB 1VHFA 1SJ4P 1TMMA 2H9ZA 3OLAA 2NUUG 2KT2A 4C97A 1RHKB 4ZCKA 3TI0A 2MQQA 3VQSA 3MDFA 3C16A 3AB4B 3DFEA 1PG5B 2XC9A 4HKQA 2R8JA 1H74A 2R7QA 2YQ0A 3QT6A 2XCAA 4RW6A 2X3DA 2ZZTA 1SKSA 1TL7A 1K73T 1JLFB 2A2DA 3CJ3A 1YZ6A 4KH0B 2MKSA 3S7RA 2NS1B 2OMLA 3ONQA 4LR7A 4M1KA 1WOOA 3TUZC 5A2QU 5DJBA 2GGPB 1YWXA 3BGFA 2O67A 2WVCA 5A8RB 4HI2A 2DBBA 1H2UX 3SMZA 4ZDNA 2W24A 4MIAA 4AT1B 5HVGA 5FIIA 4ED2A 1EJ7L 1S9GA 2PT0A 1FX4A 2CZ4A 3LA0A 3MPWA 4LQ9A 4R25A 3S1TA 4CP5A 2RS2A 3G6YA 2KVQE 3N79A 1XNRF 3KDNA 3M9NB 3UR3C 1JLCB 1WOPA 1S59A 1ACMB 2D69A 2IVYA 2KHCA 3I4HX 3CDEA 8ATCB 1RU2A 5GAHI 2J0QD 4M8LA 4UF4A 2R2SA 2OPRB 3BKFA 1IKVA 3ZZ0A 2Y1JA 2Z2LA 1RT5A 1XWLA 2H1YA 4IUFA 3BR9A 2RJZA 1TFYA 3F44A 3NS7B 1YQHA 1MWZA 1LKZA 3GP9A 1VRTA 3K5OA 4KHMA 1VK3A 3HVTB 3SCIE 5I4MA 3I96A 5DZ6A 3MMJA 1GXUA 3PG9A 3PKYA 4A8KA 2MZ1A 1FJEB 1B64A 3GJSB 3Q22A 2Z56B 3IC1A 4WF9Q 1XMOF 1L3VA 1P9YA 4I7FB 5CYMA 4TY8B 3NGKA 3GR0A 4LRDA 3PKMA 1S1TB 1S6OA 1JJHA 2VICA 1NKBA 1C1CA 1HHTP 1K9MT 1MN9A 4ID5A 3J7AN 1RQ0A 4XK8C 2MKYA 2AEMA 2MMYA 3H2LA 1R6VA 2CNNB 4KR0B 2Z4PA 4X4OA 2OJ3A 1BC6A 3T1HF 4OZ5A 1RAGB 7FDRA 5MAOA 3UD3P 3CDWA 3CJ2A 3PYDA 3UE2A 2YWGA 1S48A 2VBWA 3DHWC 4C7QA 5DG7A 1X0FA 3N4WA 5K14A 4HTIA 1WC4A 2IM3A 2BYCA 5A0YB 1MG7A 2XS5A 4ED8A 2DRDA 2JWNA 4FVMA 2MTLA 1FRXA 4WKRA 4R5PB 4MKYA 3LF0A 2E1AA 2QJ3A 3NWGA 3PW0A 1S5ZA 1RWKB 1G2EA 1JWWA 3QLHA 3DGPB 2J0WA 2A2CA 2EFOA 3DXSX 1HD1A 1WSVA 4E0DA 4JI2F 2WW4A 3A4TA 2M7SA 1YJRA 2CPIA 4KBIA 1VQOS 1SIZA 5IQQA 3R2CJ 4U6PA 3PYGA 1X4DA 3G82B 1F9FA 5H9EJ 2VG6A 1NLKL 3IG1A 1KONA 1FF2A 4URQU 4YHHJ 1SUQA 2JOQA 3B4DA 4CLFA 4JOUA 4O3PA 3TZWA 3HHLB 2VPZB 1HQEA 2OP5A 2OSQA 4Y2IA 3PR4A 3ZZZA 1HI8A 3JTOA 3MM7B 5ETVA 2J6TA 3RU0A 2L9DA 1RTIA 3MAAA 3M05A 1CVJA 5F8MA 3JXOA 5BYQA 4DX6A 3R5BA 4NXNJ 1WTFA 1EZZB 1VRTB 4I69A 5ETLA 3DI6B 2BXJA 4IG3A 3HK2A 1WC0A 1FESA 4DV3F 3WIVA 2M8DB 2IJNA 4NCGA 2L08A 2NSCA 3HFKA 3HLUA 5F9LA 2DXFA 3T5JA 4DL7A 1VQNS 2RDDA 4F0HA 1EHWA 3AQOA 2XGQA 2UVWA 2KFNA 1Y5IB 2DT9A 2M3DA 1RLDA 2CPXA 4I2PB 1EQ0A 1Y5NB 2BJ1A 4IG0A 4ZVPB 5HATA 3SCKE 4O44B 2R7UA 1BXNA 3W5XA 2CIMA 1IBCB 1PIEA 1W2IA 2IJFA 3SDEB 4CIOA 3RBXA 1U45A 1BQNB 4QYRA 1EKRA 2M70A 3DLEA 4DX5A 4K50A 1MU2B 1Z2ZA 3VV2B 3D0IE 2NPIA 1REVB 1S9GB 1UWBA 3MM9B 3M6XA 2P9CA 1WEZA 3M4XA 1N32F 1O5JA 4AXIA 4ECSA 4C8OA 1V3ZA 2HGMA 4KE5A 1DQAA 4KV8B 1VQPS 2D1CA 2M0GB 3OTEA 2QA4G 1LW2B 1WHWA 2LEPA 3N28A 1JIHA 1QAJA 2PIIA 1CJVB 2XG8A 4LFBJ 2LKZA 2GAGC 2CQ4A 3HJVA 1YBAA 3HDSA 2V6AA 5CCMA 4F3QA 1RHMB 3EYZA 2CNKB 4MMOA 2V5HG 4P72A 3J7YI 2V4JB 2OPQB 2K1RB 1FE0A 1H2TZ 2OPPA 4H4MA 3PVXA 3MOJB 4LR9A 3KK3B 2CA9A 5AE3A 1SQEA 2RSQA 4OHXA 4WE1A 4J37A 4Y6IA 4DV3J 2C22A 1NJXA 1JJ4A 2IBOA 5A8KA 3KLVA 1IKYB 1TKZA 1OY6A 2AZ3A 2LMIA 4RWWA 5F8JA 1RAOA 1N54B 1S72S 3WZ0A 4ZP9A 2E9RX 3D6FB 4WYLA 1VJWA 2GX8A 1XR7A 2BJ9A 1B0TA 2AW0A 1RT7A 2RU3A 4I2QB 2V4RA 1WNEA 1FJ7A 4OYOA 5CAAA 4IFVB 2XI3A 5LSOA 3GFZA 3FBCA 3LQVA 3CJRA 2YQ3A 3JQMA 3QWUA 1YRXA 2AGPA 4Y2KA 4KT0C 2CPFA 1SJQA 1EARA 1UPMB 3IR7B 4F7VA 4PG4A 5F8HA 4RNOA 4OX8A 3T41A 1QE1A 4ED6A 2FUG9 2DB1A 1SKUB 1DTTA 4WTOB 1KS2A 1K47A 4V1Ak 4DQIA 2Y1RI 2UV8A 1IKYA 1U02A 3LOUA 1OY8A 2XMAA 4B08A 1VC6A 3MMBB 1U2RA 1DQ9A 3NWRA 4AQYF 3BZQA 4HTJA 3CJKA 1CJTA 3FK4A 2HHSA 4DLGA 4YUDA 2CJQA 3BBBA 5I3QA 3C46A 3EPGA 4J7CA 3GIJA 2VKZG 3OL9A 1T9UA 3SCLE 3OL7A 4LF4F 3CGIA 1RT2A 1TUWA 2B4PA 4PZVA 5D4LA 2MXYA 4L74A 2EVZA 4NLOA 2ADBA 2HNDB 5KG7A 2JFDA 5A76A 2DO4A 4RNNA 1Q5VA 2HFZA 4X4PA 1UVIA 3MMBA 2RNEA 2V67A 2KG0A 3CMQA 3S8SA 3H5YA 4DL3A 5HROA 2E29A 4YR2A 3OR2A 1FEHA 4KHPF 3R1LA 1KR4A 1RTZA 2F4FA 2KYZA 3ZNJ1 3G8TA 3KHRA 1R0AB 3QRRA 4RUBA 1UAWA 2IYGA 3GSIA 3AXKA 3CJ8A 4OV1A 3NOGA 4NE9C 4X2BA 4LF1A 2RE1A 4U9RA 3IP0A 2V34A 2YVSA 3BB5A 1E6YB 3OJUA 1DBDA 1GMVA 1M1HA 2B9EA 3HI9A 3MOZA 2V0NA 2DGVA 4QR1A 4EBCA 1NJYA 5AT1B 3A8IA 1HNZF 2CNOB 4O3OA 5KG2A 1VS3A 2KHDA 3IMQJ 5CABA 3UCZP 2JH3A 1U1PA 5J1EB 2YWEA 3HFVA 4PG8A 3D3CJ 1RT5B 2XHWA 1RCOB 2ATCB 3IGNA 5L9XA 3GYXB 1TV6A 4F3OA 2VOPA 1T3NA 1VFJA 1G4CA 5AJ3J 1CULB 1HL6A 1REVA 1MMNA 2DD8S 2C3UA 2FJBB 1FCAA 2BBEA 4NYZA 4PAAA 3SFGA 3W9JA 2J7WA 4DBQA 4EMDA 3T5KA 3PX0A 1NK8A 1KHVA 3SSRA 4WIIA 1SQGA 2FYXA 3U1LA 4AXJA 4OZJA 1UJ4A 1YJNS 4B9LA 5CYMB 3MEGA 1FFWB 3FNNA 3M8QB 4H4KA 3TP2A 3UDLA 4EEYA 1MMLA 2V9WA 2QN6B 1XERA 2DNHA 1F6TA 4DV5F 3F56A 3OR1B 2JLGA 1SXLA 4NRUA 3D6MB 1B0VA 4C2MA 2IM1A 3M1VB 3W62A 5E33A 3UCUP 1KQSR 1NHUA 4NZ7A 3GG1A 2CAJA 1YI2S 1WI6A 2CQ2A 2IJRA 2FTRA 2R7WA 4ECTA 2IMWP 2EFQA 2Y3YA 5E3AA 3TVYA 5KFDA 1XK8A 1T9XA 2BUNA 1R8BA 4JB8B 3F41A 4YS2A 4W4MA 3FCHA 4P7VA 4OX9F 5LOQA 1IBLF 3PFOA 1JLCA 5KFNA 2VBYA 4ZITA 3PV8A 4DV4F 4ZVFA 3HULA 2IBKA 1RWPB 1U0HB 2AJ1A 2CG4A 2XULA 5AXNA 3N01A 2BZ2A 3AODA 2MLYA 4CLUA 1T11A 4NPOA 5DLGA 2XLJA 3QJPA 4FYDA 1U49A 2UXBJ 3R5DA 4YR3A 4ZVHA 3H20A 4FS1A 4TQSA 3BDEA 2HW3A 2VPWB 1BY9A 4EYHB 2MKJA 2G1DA 1RDRA 2JC0A 2R42A 4LR8A 2HZCA 4NMXA 4USHA 4EO8A 1EB0A 2XYHB 1U47A 4LF5J 3Q0AA 1VQ4S 2IM0A 3TVZA 2WBRA 4F2RA 4MKVA 4LF8J 1FK9B 3BPDA 5KFBA 3GV7B 4QIEA 1GNKA 5A2QY 4MTPA 3DRPA 3MCOA 2BOPA 2EK1A 5K8MA 3GQCA 3RRHA 2AYGA 1S1VB 5B0CA 2DR6A 3CUNA 3DLGA 1OY9A 3E3XA 3RW7A 3ZO7A 4CTAA 4DUYF 3Q2SC 1KLNA 3K8VA 2FLLA 2NZ4A 3DNCA 2GCFA 4LBPA 2YWWA 4PQUB 4CO5A 4DSEA 1H0HB 2MZSA 2XZTB 1X4CA 2VC1A 4C48A 2DHSA 4YQWA 3M8SA 1U1LA 4WP8A 4TY9A 2AJ2A 1YSJA 4WXWA 1HR0J 3N6LA 1KC8T 1EIYB 4DSIA 4NRTA 2W9AA 1N34F 1U6BA 3FQKA 1E6VB 2LQ9A 3OL8A 2GJ2A 2KVIA 4J90A 1WF2A 1KLMB 5E3CA 3RB0A 3LPEA 3B4MA 3DU6A 1IWGA 4OHWA 1HQUB 4O0IA 3EICA 1TKTA 2MKCA 4DL5A 1N5YB 4N8NA 4B9UA 1MU2A 3X1LB 1TKZB 2HNZB 2PC6A 4Q2LA 2I1RA 3POTB 2CVIA 1OWXA 3MPDA 1S0NA 3FRZA 2BW2A 3VHQA 2BDPA 2WAQD 2BX6A 3M8WA 2KTQA 2P2CB 2BQUA 2UVUA 2BM0A 2K7JA 4OYAA 4LQ3A 3ET6A 2ZH9A 3M2UA 2WOMB 3MHYA 1S1WB 3PYFA 3RGIA 5CA5A 1RAFB 4FBUA 4ZMMA 2CJAA 4XPEA 2OEKA 3H4DA 2G0JA 3CO0P 3I6PA 4A8WA 2BM1A 3M8YA 4LSNB 3GFHA 1S77D 3BN7A 2ZVIA 3FCVA 3R5CA 3BYRA 3GPAA 4HH1A 1RWWB 4P2XA 4ZPTR 4L75A 1HNVA 2B0GA 3MAAB 1RWVB 4DV1F 4NXMJ 2D3ZA 3CD0A 3MMCB 1D0EA 1PBUA 4ID8A 1MROA 1F0XA 4GKJJ 2V2KA 3P5TL 4M5GA 2K2PA 3BSAA 3D28A 3G87A 4IDKB 2EG2A 4P2FA 4YB6A 4JUZA 4JV0A 5HVHA 4RR5A 5KAKA 3M2RB 4QWDA 2DR7A 2HLUA 3P6YC 2C3OA 4CNZA 1NJIT 4I6WA 2BVZA 5IWAF 3HVWA 1F3VA 2E9ZA 3I0RA 3D2WA 3Q2TC 1BQXA 1QSYA 4LF6J 1HD0A 2HHPA 1UL3A 3D1HA 1M90T 4R8UA 5M2PA 2FJXA 2MZQA 2OH2A 1N33J 4CH7A 5IT9U 4DUYJ 2NQPA 1RGVA 4P52A 4UOHA 5KFPA 3QJJA 1VK8A 2DXDA 3W61A 3FRYA 2VH7A 2VA2A 3ENQA 2HHXA 4ECWA 4R8UB 3PFEA 2P8IA 2DO0A 3M6WA 4BC7A 4YP3A 3HPOA 4DS5A 1U1QA 1OO0B 4JV1A 1HFEL 1PC4A 3KMQA 4PRFA 1S97A 3IRWP 2DGSA 3JYTB 1SH3A 3CDUA 2OKQA 4X4NA 1M0SA 2BABA 5JVGQ 1UVKA 2DIUA 2DNPA 2HBRB 2JL9A 3KJQB 4HHHA 3W2VA 4ZJLA 4FF1A 1WACA 2Y8WA 1GMWA 1NHKL 1U8WA 1PJ5A 2I9SA 1HMVB 2WONA 2CQDA 5G0RA 4RW4B 3GSDA 5D0RA 1FFGB 1HARA 4RJVA 3C15A 5M2RA 2HNYB 3QT5A 5IFMA 2LFVA 3C6UA 2YKNA 1HW8A 2MGZB 4DSKA 4K0KJ 4C9DA 3J81Y 2QSWA 1LW0A 2M5YA 3SCJE 3ZNUA 1FNXH 3WX8A 3W2WB 2QLXA 1HNIB 2HHQA 2JDJA 1PCAA 2PMWA 2UZAA 3O6QA 2DNNA 2LQ8A 4FXDA 5F8NA 1BD6A 1Y4ZB 2EFVA 3ILJA 2NPFA 1FX2A 1XMOJ 3D7SB 1I51B 3F73A 3DRSB 5CXTA 1DTQA 1UMJA 2XNQA 3H0PA 4P74A 2OPSB 2QTWA 4C0BA 2AT1B 1S1WA 3MM6A 4ECXA 1EQMA 4P2MA 2V4JA 4NLUA 3W5YA 2OPRA 4LF9J 5E2QA 1TR0A 4QW9A 2UUAJ 2V9KA 2YWFA 3OBIA 1CJUA 1Y10A 3DRSA 5C25A 5LSLA 1NRKA 1FKPB 2VD3A 4DG1B 1HNIA 5EX3A 5JJBA 1D1UA 1UKUA 3NMRA 1NUEA 1LEOA 3QYYA 1GEHA 1UVMA 2MB0B 2ZDOA 3D0HE 1NPKA 5ETOA 1S6PB 1QTNB 5HN0A 2CVEA 3PACA 4GRSA 4AQYJ 3OSPA 4IR1A 1KN6A 2FHOB 2KO1A 1M5VC 4DU8A 1BMQB 1RA6A 2V8GA 1NBEB 4UOGA 3BQ1A 3QRPA 4J9OA 2IM2A 4RW9B 2JSXA 4RW6B 1ICEB 1NZ8A 3MEEA 4DV2F 1NK4A 4IQXA 3LP0A 2JEIA 1Q4RA 2CG8A 4HHUA 2C2RA 3FSIA 4DR5J 2QX0A 1U8SA 4DPTA 3TX0A 5BR8F 3MM5B 4B3MJ 3OQ2A 3FBBA 1J27A 3CCMS 4L3NA 5KFIA 5KFFA 2JEFA 2ZM6J 5AXMA 5I42B 4CLZA 4U8VA 1NK7A 2NZCA 3ZTRA 1G7CB 4XO0A 1FRMA 1X4GA 3GFXA 5HMWA 1GTHA 2J0XA 2QG9B 3MR6A 1H2VZ 3M8QA 3KLGA 2MJUA 1VC5A 3C3LA 1EETA 3DLHA 2CZVC 3L4BC 4DPXA 3CWJA 2Q43A 2ZD1A 3M9MB 4GC7A 1GX5A 2I2YA 4ICLB 1QAYA 1RWUA 1X8DA 2OMOA 4ZCIA 4X4RA 3KHHA 1SJFA 4RW4A 4ZOSA 3P96A 4EO6A 4H4OA 5B7WA 2V94A 3T9NA 1AA1B 3FJ2A 5J2NB 4B02A 5LT5A 1XTZA 2FJAB 2YY3A 2C2NA 2FJVA 1IM4A 3L7UA 3N6NA 4RBVA 2VG6B 3PRVA 2FJDB 5HL7Q 2VG5B 2FHMA 4DR6J 2FJEB 2B51A 2EFNA 2EW9A 3PIOQ 3KUEA 3UN2A 2UU9J 4USKA 2K3KA 2IFXA 2Z30B 2PO4A 1NJZA 4IRKA 1KQGB 4ZVRB 2ZE2B 2E5HA 1WHXA 5D78A 1E6YA 3AJ1A 5HP1B 4U96A 1IR1A 2E5LF 2GIRA 1XNRJ 1GMUA 1TUVA 4TLRA 5C42A 4L73A 1MMDA 5C7PA 4LF2A 4B3OA 5E3RA 1NMEB 2HNZA 4HH0A 3N6MA 4Y00A 2YNHA 5DLFA 2D3UA 1B0PA 3TNVA 4K4YA 2KKHA 4ZJOA 1D8ZA 1WKKA 4LUBA 3FDSA 4DWIA 3CC4S 2MZTA 2LECA 3P8BB 4MK8A 6FDRA 1NH7A 3TA1A 1SC1B 1O51A 1R3NA 3K8WA 4OI6A 1KQKA 3EDRB 3QNWB 5K8NA 1BQNA 2QZ8A 4DFPA 4JI2J 5ETKA 4IFVA 2KXFA 1HNZJ 2RVJA 4LSZB 2IVFB 4CTAB 5F9NA 1M5HA 5AE2A 2MPUA 4HEA9 4YFUA 1H73A 1T9TA 4WIQA 2FY8A 4NLVA 2GIQA 1DTQB 3C19A 2ZH3A 1S76D 2GVZA 2EKYA 3KUGA 1FVSA 4OYBA 3SSQA 5IV4A 1A9NB 5KG4A 2OEJA 2WW8A 2VQEJ 2ZC3A 3ENWA 2QL9B 3M6UA 1BQMA 3BGRA 4X84A 2R8GA 4C8KA 1T3OA 4U67Q 2AX0A 1QE1B 1HQUA 2KN4A 4Y34A 3QIPB 2X1GA 3TRGA 4UQTA 1SCJB 3QBCA 5CHCB 3T1HJ 4JBCA 1ZYQA 1UFLA 2CADA 2IRUA 1SC4B 2IHR1 4NLDA 4QOTA 3D1OA 1R27B 3EM1A 5GMEA 1S7IA 3ISZA 1XIQA 3PR5B 2V50A 4HL9A 3VVTA 2B43A 2C3MA 3ZZRA 2MLXA 4J9NA 2IAJB 2NREA 1U0HA 2CJ9A 1VQSA 4GC6A 1XMBA 4E2FB 3GB0A 3HHDA 1G3OA 5A8RA 2GO9A 3RJMB 1U6FA 1WG1A 2CXEA 2VDIA 2YPZA 4CO2A 3CCJS 3W8PA 2UUBF 1UFKA 3TUPA 1PO6A 4IOAQ 4NYOA 3DRPB 4RO0A 5L1JA 4Q8EA 2CPDA 2F9JA 4LREA 3P3DA 3J7YU 2AKWB 4OYWA 3V6KA 1H3DA 1FD2A 2VFSA 3TQEA 4ILRA 4ECUA 3M2RA 1V5IB 2R7SA 1J5OB 1JLEB 3TZZA 4DR3F 2DIVA 1FXLA 2ZBCA 3AJDA 3VTIA 2R7RA 3DOKB 4C3LA 3BYPA 5L1LA 1AT1B 3I32A 4FS2A 2YX1A 4FVCA 3RUBL 2Y0BB 1RAAB 1SC6A 2DXEA 1D09B 4DUTA 4QCLA 3PYEA 2B6AA 1RK8A 3IR6B 3IO1A 3TJAA 4NWBA 4I7FA 2DH7A 2N82B 4G3IA 4FYVB 3TAQA 3QJLA 2XLKA 2COLA 1S1UA 1X5SA 3KLIB 4PEOA 1LWEB 2YH1A 5BYRA 1Q8BA 3EZUA 1H72C 1RTHB 3Q8SB 3BJYA 2QYCA 3J81U 1NJWA 2YNGA 4O3QA 3ISNC 3IBWA 5L38A 3A8EA 4KGVB 3DGVA 4RW8B 1RP5A 1RB0A 2HFSA 1W2BR 2ZH4A 3RYLA 2VQFF 3P5BP 1BGXT 1ZA2B 2LVWA 3H98A 3IWLA 2YNGB 2BA9A 4K8RA 2AJ4A 5AJ3F 2GIFA 4WFBQ 3RB3A 2HQDA 2OFHX 3PIPQ 3W2WA 2CFXA 3BO3A 3QSYB 3CD7A 2OTLS 4ZLPA 2VPXB 4CWBA 5D6GA 2E1RA 4U7CA 4C8ZA 4DX7A 5J1PA 1BE4A 2LDYA 3DLKA 3DRYA 4HHJA 2PD1A 3J80Y 4D3GA 2XO6A 3K59A 5KOWA 3HKWA 4JI8J 3OL6A 2DH8A 5ETNA 3K5MA 1N8RT 5IM0B 3I87A 2DGXA 2V4QA 1Q53A 1ELOA 4PUOB 5KFLA 4J9UE 5D4PA 1RI7A 3MFIA 3AD7C 2J6UA 1IVZA 2ASDA 1NAQA 2UVRA 3JQKA 3B54A 4X66J 3L3CA 2UV8G 4FDFA 1XMQJ 3UNGC 1CG2A 1WSRA 1H7WA 2B4UA 4NA1A 1QSLA 4KPCA 2QC3A 4OI4A 1B7YB 3W3SA 1JNZB 1QD1A 2Q1LA 1UZDA 2F3JA 2NXNA 3W7BA 4JYAJ 2W2QP 4NMLA 1RWNB 1RT3A 4FPIA 1PILA 2ILZA 3SFUA 1RLCL 2CQHA 2ZUGA 2V8HA 4GO5X 5CCLA 4X66F 4LBHA 5DG9A 4FBTA 1T8EA 1QAXA 1V5VA 4IQMA 3G4SS 5L1IA 2H48B 3TZXA 1SJRA 4P71A 2YKPA 1SIWB 3DI6A 2HHWA 1N56A 1L3KA 1FNMA 2C28A 4PWDB 2V68A 1DURA 3AH6A 1HPZB 3LPYA 1KSPA 2BE2B 4E98A 4TLQA 5ADZA 5ETSA 2Z0GA 2AJFE 1RT6B 4OYMA 2ROGA 4UQGA 2GV1A 1JLAA 1S6UA 2H5IB 1HMVA 3HZEA 5G0RB 2UUAF 1XC9A 3GYNA 1RT1A 4M5MA 2RDJA 4DQRA 5MLCV 3BH7B 1G1XA 3HX9A 4OX6A 1KOOA 1WOSA 1L3SA 4GKKJ 2HYIB 2J76E 1Y3KA 4ED5A 5RUBA 2JLEA 3NBPB 3CE8A 3C14B 4O23A 4CLPA 4NLTA 1K1QA 2LEAA 3QRQA 2IA6A 2W7OA 4B17A 4DSJA 4G65A 1A0OB 2FGCA 3R27A 2WCXA 2A6OA 1NSKL 3VGUA 3HVAA 3H25A 5KFYA 2OPQA 1UTAA 1U7LA 2MY8A 2VB6A 2CJBA 3MM6B 3Q8VA 4UZBA 1TK0A 1O0PA 3M32A 4NX9A 4ZVTB 4I56A 4GKKF 3CDBA 2RRNA 2MSTA 4O0NA 2ATLA 1N32J 3DM2A 3ZFVA 5DM6Q 3IXQA 4NLSA 4QPTA 3GONA 5HQLA 1IR2A 4QIVA 3IBCB 3TWZA 5BR8J 1LWFB 2WSEC 5A6PA 3SV4A 3GV8B 1ZA1B 2CJKA 2HQGA 1VBXA 2ALYB 3N5FA 5HQ8A 4U8YA 4Q5VA 2YKNB 3VGTA 1TELA 1TL1B 1LQ9A 2Y1LB 1IJEB 1B7FA 3DLGB 2GW8A 2W01A 3D3BJ 4C4WA 1IBLJ 4OX9J 1X4BA 1HBUB 3D66A 4WBFA 3AA8A 4YB5A 2QMWA 3G8QA 1HBMA 2I0XA 2AQ4A 1S10A 4LF7J 4DV4J 2CQ3A 4YOEA 1JMTA 3F0NA 2DNZA 3T1AA 4Z7YA 2OI2A 2H5EA 2DHAA 1RKIA 1FTCA 2O1PA 2ROPA 2VJUA 2DR5A 1PKUA 2FHKA 1GT8A 1F9EB 4ZIVA 2W4DA 4EK2A 2QYGA 5SUHA 1IBMJ 1FDBA 3IBFB 5HBMA 1HHQA 4YB1P 4DV7F 3CJKB 3I31A 3KDOA 4OLPA 2RILA 4F04B 2MZRA 4C6AA 3Q8UA 2BKPA 4TXSA 3TZYA 3H5UA 4FF4A 3DYAB 3I55S 1PAUB 3B6BA 4JV5F 3HXMA 3BGUA 5DG8A 4K4VA 2R7XA 1LWCB 2VBZA 3KLHA 2NSBA 2NXUA 5HI7A 5F8GA 3IWNC 4UY85 2MEWA 3DN9A 2F5GA 4LFCJ 4DPWA 5AE1A 4DV6F 2VFRA 4C98A 1I94F 4X4TA 3CD5A 1WKJA 1GXTA 4ECQA 1U09A 1VLYA 3I56S 1N33F 3MZIA 1IXKA 2FB0A 5EDWA 2PE8A 3BREA 2LYVA 3TANA 3CW2C 5T41A 2J6SA 1RBOB 4WFYA 2DEJA 1S1VA 1JLEA 5J1NA 3IFEA 2CUYA 1JNRB 4BWMA 3ILLA 4EI2A 5KFOA 3DOMA 4NA2A 2EBGA 4J9QA 4HYKA 4R0JA 2RUGA 3NGRA 5F8LA 3QSIA 3RAQA 4KFBB 1T03A 4WFNQ 4QWEA 1VQMS 2G0IA 3U1MA 2DNGA 2CKWA 2BRKA 1V3RA 5D0HA 4CT9A 1HWKA 1SQFA 3B82A 3DDIA 1AZSA 2P5VA 3I0RB 2ADCA 2OHDA 2B3TB 3CJSA 3FZ2A 3MECB 3EGVA 3DRRB 3JAMY 1YVFA 1RHUB 1L5UA 2WSCC 1Q79A 4RNMA 1VQ9S 4K4TA 3KHLA 1EKSA 4KO0A 5J2MB 5K9FA 1E6VA 3CSKA 4Y28C 2XO7A 2P9GA 4EBEA 4W92B 1Z1ZA 2UP1A 2Y8YA 3GCWP 2FHJD 2H5JB 4F25A 2HRUA 3KYLA 1N6QB 2BKNA 1S7HA 4LF8F 5B0FA 5HJXA 3VR1A 1OSDA 4F26A 5C25B 1NK0A 1KD1T 3E2EA 1HYSA 2RB7A 3DC2A 4FXVA 1VIOA 3M9OB 1MNEA 3M8PA 4X65J 2K1RA 3AJ2A 3PRBA 4H4MB 4YB7A 4YY3J 4F50A 2KL8A 3OLBA 4I0WA 2GO8A 4OV6A 4V19X 1VRUB 1WEXA 5KFMA 2A3JA 3IN5A 2F65A 3QIPA 4K7QA 1VR6A 5L39A 3JSMB 4OJHA 5E5NA 4EWTA 3MUTP 4A4JA 2CPYA 3KK1A 1VISA 2YNIA 4R5PA 1RHRB 3UD4P 2HQ3A 4X65F 4NXNF 1LK5A 2ZWOA 4DJBA 5FLXY 2R3VA 3PEJA 5EWFA 2XZDB 4RKUC 2GVDA 3MGJA 2MHEA 3BBFA 5A6WA 1ZTWA 4JI1J 4ZKAA 2WHOA 4ZPBA 4CYUB 1JB0C 4FXWA 3NCRA 3TA2A 2VFUA 4ZN3A 3MM8A 1U48A 4EZ9A 3VAKA 1NXIA 4DCPB 3MURP 4JYAF 3MEDA 1WHYA 2A6MA 5KTQA 2YKQA 3ITHB 3I0SB 1FJCA 2HFNA 3KWMA 2H54B 4MKBA 3GCXP 4PWUA 3V2UC 2RHQB 4XIUA 4IRDA 3CJ4A 3D67A 4HR2A 1ZETA 3FVYA 3T5LA 3CCQS 1R7IA 2AIRB 2QMUB 3VWSA 5HMXA 3EX7B 2DNKA 3AOBA 2W9CB 1JLFA 1K44A 2WRMA 1N0UA 3I9V9 3QWPA 4OZ2A 4FNIA 2C3YA 4ZPWR 4B3RF 3UN3A 2VF3A 3VAJA 4WYWA 2FC9A 3PJXA 3ZTPA 2IY5B 3TJ8A 3V81A 3GIKA 1AW0A 2R4FA 2BKOA 1IKVB 3LWLA 2N4CA 1Q86T 2PEBA 1WD6A 2UUCF 3DOLB 5L46A 1WI8A 4KGXB 3NCQA 3AD9C 3TJ9A 1GH8A 5DGAA 2KG1A 1PC5A 5J2PB 2R9LA 1APSA 3X3UA 1M5KC 4KRWA 2VKRA 4DFJA 5BYSA 3FBFA 2C2ZB 2VL1A 4URGA 5FLXU 3NLCA 4LSLB 2WZ1A 2LU2A 3CXCR 2J9DE 2AHOB 4PG5A 4NA3A 4AL7A 2CQ0A 4C3MA 3PW4A 3KJFB 1TVRA 2JLFA 5HANA 2W2NP 3K5PA 4EYIB 2F8HA 1FXRA 5KG6A 1U0SA 4ER8A 2B9WA 3QAEA 3UO0A 4QPXA 5KOXA 3J81j 2HVEA 3CT9A 3H90A 3QO9B 1IJFB 1IBKJ 1NK5A 1CJVA 4WE1B 5KFCA 4PYAA 2EC0A 2OELA 3NNCA 1LWXA 3KNGA 4L6V3 1K1SA 1LFPA 2HPUA 2RUSA 3BGLA 1U2CA 3K2YA 3IR5B 4MK7A 5IZHA 1ZZNA 3QGHA 2ZEJA 2KH9A 1XMQF 4OYZA 1P6TA 4LF7F 3GYGA 2MKIA 1N5YA 3PZPA 3Q86A 3WC0A 5JVHQ 2DITA 4DL6A 3PDNA 4LRAA 3ITHA 5J2QB 1NH8A 3EZ5A 2ZOFA 5KFEA 4ZIWA 4DL2A 4DI6A 2XCPA 3CIZA 4DR4J 1SB6A 4KQZA 4ZPDA 1RWMB 4BBYA 4EUVA 3BKTA 4ECRA 2HK2A 3H4BA 1HNXF 1P27B 1R8CA 3A3NB 5U47A 1YGYA 2VQEF 5DZ7A 1KFDA 1VCTA 2GHWA 1IQTA 3KFWX 4LT6A 2FVQA 1R31A 2HHVA 4I6YA 2C3PA 3AAWB 5HVFA 4DR7F 3CDAA 3JSMA 2O01C 5KFZA 5DDQC 1X9SA 1WORA 4DV0J 5DETA 1XNQF 3KG0A 2CPZA 3OVAA 3UCGA 1YBUA 1Y11A 4ILLA 4ZLLA 4DR7J 1ULRA 3G6XA 4IYQA 2ZWPA 1JLAB 4IG3B 2DHXA 1X4HA 3WQPA 5A8WB 2BR0A 3RR8A 4NLGA 2VG5A 3H5XA 3ELHA 4PUOA 1TQLA 5GAGU 1C0UA 3CCZA 4QYZJ 3PJ9A 5HROB 1UW9A 3O2IA 2PI4A 2DNQA 3NAIA 1I6JA 5A8WA 2M9KA 2JEJA 4IKAA 4N41A 6AT1B 4G1IA 2M4MA 3D4JA 3BQ0A 1YRTA 1VQ8S 1DARA 2AYBA 4DPYA 3C8YA 3KG1A 1R89A 2B8QA 3RAXA 1LWCA 3ET6B 1Q8LA 2V2QA 1NK9A 2MQMA 1KEKA 3KTQA 3Q23A 1YKWA 1GXLA 1R43A 3R7SB 2ZH2A 2XWXA 2LDIA 4ZVUB 5HMZA 5IXUA 2MHNA 2XS7A 2VFVA 3AQPA 4O4GA 1KQFB 1P9QC 2Z8QA 2X1FA 1KDNA 2AV5A 2KM8B 2R8HA 3E8OA 3Q8PB 1O6XA 2C42A 1N52B 2PA8D 2RKIB 4AYBD 5KG5A 1M1GA 4G1QB 1TAQA 3Q8RB 4X4UA 2GQ2A 4DZ6A 4CLKA 1VIXA 4AD6A 2JVOA 3A12A 3W1YC 1QM9A 4K4UA 1ZPVA 5C2CA 2YH0A 4JI0J 1PJ6A 4WTYA 4QQBA 4Q43A 3UNYA 2R2RA 1U24A 2RQKA 3SQOP 1TL1A 4CLTA 1QAIA 3DLLQ 5FDLB 3LP1B 3D1QA 4M5DA 3VF0B 4YR0A 5HLFA 2HVZA 4ERDA 4ENOA 1R0CB 1Q16B 4DFMA 4YMEA 4ETXA 1RAJA 1NKEA 3NGUA 1Y3JA 4LRCA 4WFXA 1R8AA 2CPHA 1Q81T 1AUDA 3T5HA 4JI3F 2E9TA 4OL8A 4Z7CA 2HQFA 4Y2AA 2GVZB 2CQPA 4LFCF 4OFZA 2RF2B 2IC3B 3IRXB 4DXLA 2K06A 1RAHB 4DLEA 2PFFB 1H98A 1WJ9A 1FDNA 5D0EA 5KFXA 1OPZA 2LXIA 4DZDA 4FZVA 4OJ3A 5KT4A 2PSZA 1A7GE 1MW7A 1YLXA 4K4SA 3CIMA 2NLWA 4IFYB 4NLYA 4QZVB 3THPA 1DAXA 2ZNYA 5LL6d 4BHQA 1PAEX 4DCJB 2EBEA 5CD4H 1X9WA 4CCHA 2E5JA 3DDKA 3QFWA 4DCOB 3V5RA 1FI4A 2JC1A 2XGPA 2HHUA 4CH0S 2XM3A 1Q95G 3ZTSA 3THTA 2AWZA 2BE2A 2IDLA 2BV3A 4KSEB 4NI2B 2F4VJ 3D6HB 1B3TA 1TL7B 4ZVGA 3H2VE 4DR3J 1G6BA 4X62F 1S1TA 1TL3A 2R7VA 4CDIA 1H6KX 1RHQB 3JYTA 2R2TA 1FDAA 4B9SA 1F2GA 5HAOA 3QMQA 1AUSL 1UEUA 1IR0A 2E1PA 2WK4A 3BV8A 4PXDA 4M5LA 3NS6A 4N47A 1CS4B 2MSSA 2FZCB 3GE9A 1T03B 3AA9A 2ABYA 4M5HA 2ZBRA 4F0MA 1YJTA 3C2PA 4OLOA 2F8EX 3HZGA 4NI2A 2R2UA 3L95X 4DF4A 4MIBA 1WF1A 1D9DA 2XMKA 1X5TA 2DHHA 1WEYA 4ES3A 4PR6A 4RLEA 4A8SA 3T1YJ 1KTQA 4N56A 2F8MA 3FZBA 1BLUA 5K14B 1NCLA 1RT7B 1IKXA 3H59A 4L72B 3SBMA 4J9RA 2MKHA 2VQFJ 2AF6A 1K8AT 1FWKA 3LGMA 3CJ0A 3TUJC 4IR9A 4ATNA 2Y0SD 1KVJA 1HNVB 4URSA 2ZJPQ 2WBMA 5KFRA 1HI1A 1WF0A 3EDQB 3M30A 3EE3A 3Q8YA 3TAMB 4DR1F 4F3MA 1Y0HA 2X3GA 4FYYB 2GS8A 2DGUA 1C0TB 3VAGA 2MKKA 4Y2CA 3Q83A 4TY8A 4GVBB 1M5OC 1NDLA 5LMUF 1N4LA 4BCAA 3KK3A 2QO3A 2POKA 3M2VA 2HS3A 4P73A 5HQMA 3G8SA 3GIIA 1EP4A 1BHNA 1SV5A 2RHSB 4ZPVR 1UVNA 3H7HB 3DDNA 1QY7A 4Y65A 1NNDA 1TP7A 1RHJB 2GMLA 4DR4F 1VDHA 4MKAA 3KK1B 3RG6A 3POTA 2D3O1 2VZ9A 1UW4A 4DX8H 2HVHA 2E44A 3PM9A 5A0YA 2BE7D 4AE5A 2QLBB 4NEYA 3PXGa 5B0BA 4ZHRA 3CCUS 3TARA 2J0SD 3R97A 4KO0B 3MEGB 4NLWA 1HLWA 3CMAS 3EGNA 4HACB 3AOCA 4RW9A 4EU0A 5KFGA 5D4OA 4LIWA 4JI6F 1Q1KA 1S79A 1AFJA 3I0SA 2QLWA 4O44A 2VASA 2D9PA 4C8YA 1AXQA 3U1NA 4BDPA 4HACA 4DSFA 2XY5A 4RU2A 1RTJA 4I64A 4JI7J 1WWHA 3H2UB 2CWKA 3M8ZA 3NL0A 2OD6A 1D9AA 3KLHB 4YDDB 4P75A 2I8EA 2ZH6A 3FFIA 2DTJA 3OFFA 4RBTA 4CO4A 2AU0A 2Z2MA 2XWYA 5DDOC 5AXKA 4NXMF 2HEKA 4RNHA 3I5AA 2BACA 4EBDA 3MUMP 3A3PB 1RYRA 4YEAA 1VQLS 1URNA 2UU9F 4DEZA 2XI2A 3PCOB 4KGZB 3PW2A 2UXCJ 1S4EA 3QGPA 1UCNA 1UJ6A 3OUYA 3RBEA 2BJDA 2WSFC 1ZOTA 1AYEA 4LSLA 1CEZA 3NOCA 2X51A 4F67A 3SXLA 3HVRA 2G2OA 2B5JB 3HM9A 1RT6A 1WUUA 2JRSA 3OTOJ 1XBWA 2FLPA 2HVIA 3M30B 4NLQA 4UOFA 2RRAA 2E1MC 2W2OP 4J9SA 4O3RA 4ILMA 3C66A 2Q6CA 1OYDA 5IS2A 1HW9A 5JXSA 4DF8A 1U6ZA 1WC6A 3D54A 4O3NA 1U1NA 4F2SA 4O3SA 2CQGA 2F40A 2ZH1A 3VALA 2RDIA 4Q44A 4LMZA 2IYIA 3OXLA 1MSWD 2B56A 3DM2B 4DU7A 4C8LA 1FRLA 3LWMA 4CLLA 3OTOF 2NXEA 3UW1A 5CYQA 1M5PC 2YWHA 2A0FB 2AP6A 1LFWA 3OFHA 4MJKA 4OJGA 4BC9A 4PCQA 5KG1A 4KHPJ 3LGHA 1V6HA 3VGSA 1FRHA 4DV2J 1YJWS 1JJ2R 2D74B 2IDEA 2M52A 1X4FA 2UUWA 2BANA 2N4DA 3H42A 4PPZA 3LP1A 4M5DB 4RX6A 3DLJA 4S0MA 5KFTA 4Z2XA 3FGVA 3P45B 2FIUA 2QL5B 3A8KA 1WELA 2XMUA 4HVZA 3HCXA 4UZCA 3IAS9 3ZTQA 1UEKA 1F1BB 1VHIA 4CM2A 4NCAA 3AHPA 4KJIA 2EFGA 3UN5A 2VV5A 5H9FJ 3VAHA 1HBUA 2MZJA 2YWKA 4CYUA 3CCTA 4EZ6A 2A10A 2K3IA 4LJMA 2KZMA 5EGYA 1BUXA 1S6PA 5CZVA 3BF4A 2BW7A 4G6VB 3H5SA 4USVA 5EHHA 3T1YF 3ENAA 2FZGB 2GVDB 2BJEA 8AT1B 2KXHA 3HSGA 3DYAA 4ZCMA 1DZ5A 1XR5A 3QO9A 3HSJA 1AB8A 2KJVA 4WP9A 1CLFA 4K4ZA 2FQQB 3OFGA 2FVCA 1FK9A 5DGBA 1W7WA 1C4CA 2ILYA 2QE5A 5HJYA 5T14A 4KHRA 4NCBA 5E3PA 1HIYA 1Y9OA 2HFOA 3MTKA 4P9SA 3UR0A 4J9PA 1N36J 4A8XA 5GAEI 4ETZA 2LP4A 1OYEA 2RIJA 5L9NA 3EUNA 2G2YA 2Y1IA 1VRQC 1Q0NA 1VLOA 3NY0A 4O4RA 4A48A 3QATA 1VQ7S 3DLBA 2PA3A 1DHMA 1TFWA 2DCLA 2EWHA 4W98A 3N5BA 1R0AA 4DQSA 3PO4A 2VODA 2XSFA 3ZZPA 3ISND 2NUHA 3IG1B 1C0UB 1LXJA 4M5JA 4ECZA 3THVA 2YKOA 2XMTA 3AFGA 2UXDJ 5J2PA 1VOMA 1F9HA 2FVSA 4L76A 3MM9A 2JVRA 3RB6A 2DGOA 4OMFG 2GGPA 1FA0A 4WK3A 2YNFA 4Z37A 3GV5B 1U1OA 1HBOB 1KVIA 1FKPA 2HNDA 3VZIA 4DG1A 1P1TA 2RMLA 4DN9A 2DRBA 2ZFHA 1FKAF 3HMJG 3NP5A 2YKMB 3CJ5A 2DEIA 4FKXA 1CBKA 4G1QA 5KT3A 3FMWA 1JXEA 4QR2A 2E7XA 4ZS6A 2CWXA 5KFWA 2F4VF 4LFAJ 2OGUA 1HBOA 3ETOA 3BBCA 4RPFA 1F2HA 3GTYX 2W9CA 3MCSA 2L48A 2KM8C 1EX8A 5LXYA 1SJ1A 3D68A 4JI3J 4GKJF 2W9BA 4HI1A 1TKDA 4R0EA 4RZRA 2MQNA 4Q45A 5HMYA 3K57A 3RB4A 1KTVA 2QFIA 4D3HA 5JUMA 3NEKA 4ZVOB 4LF9F 1VQ6S 1ZTTA 3GR1A 2VHGA 2VG7A 3DOLA 1FRKA 1RBAA 1UETA 5F8IA 2I5JB 4CO1A 4I2QA 3LALA 4RWXA 5KFQA 1Y5LB 5SZTA 1RWOB 1PGZA 2QA1A 4MAKA 7AT1B 4HDHA 4PABA 3MR5A 2BE9B 2CPJA 3I5CA 5IQ6A 5D0GA 2QRRA 1FDDA 4XDCA 5GADI 2FD2A 1NB7A 2OIHA 3BKUA 3KLEA 1DLOB 2V2VA 4FYWB 4UW2A 2HK3A 2FY1A 3GLJA 2JX2A 2FZKB 1MLAA 2XLIA 3GILA 2W8LA 2HZVA 1CC7A 2OPPB 2UUCJ 4M63A 1R0BG 3EPIA 1RTJB 3JB9k 1N5SA 3WC2A 2XHCA 3FCWA 4Y2MA 4PKDB 4MFBB 2DJWA 2D41A 1FERA 4JI4F 3M1VA 4J9KA 4I6AA 3RRKA 4C3KA 4QIGA 4DR2J 2DNOA 1ZM3A 2B9YA 2CDRB 2FGOA 1NHVA 1X60A 3MM8B 2L9NA 1K0VA 3LP2B 3ZZOA 1MN7A 2HBQB 1I5OB 4YN3B 3ZZUA 4WFAQ 4A8YA 3EGWB 4JI5F 2VBXA 3MD1A 2VU5A 1S6QB 4YY3F 2AD9A 2Z58B 3R2DJ 5EN1A 2DR9A 3PX6A 4AL5A 5DRKA 3LP2A 3KLFB 2FC8A 4ED7A 3K7RA 5K20B 3I82A 2B5JA 5J2QA 3V81B 1FTRA 2DISA 1DY3A 1PYTA 1RXOB 4YHHF 2C2EA 3GWCA 3M32B 1VI7A 4PQUA 3C16B 3CF5Q 2QV6A 1T05B 3KG4A 3MWBA 4ANDA 4QU6A 4QYZK 3DOMB 4FPRA 5EX0A 1QUPA 5B0GA 4CM0A 4CT8A 4Y0FA 3HT3A 4DL4A 3V6DB 4E8UA 2EFPA 3SQGB 1TU0B 5ETMA 3TQ1A 5GMKa 2ZOGA 3D5MA 3MEKA 4C11B 4WK1A 4OX7A 2X7IA 1NSQA 4KTQA 1N0VC 1YG0A 4KGMA 3NBPA 2VJVA 2HFUA 3ILOA 4NEZA 5LMUJ 4B9VA 1F5AA 2ZZNA 2R8IA 1S49A 3CCLS 4WZMA 3C15B 2MGZA 1KLMA 2WVEA 2QA4S 2HZAA 5DDRC 3UDCA 3EGZA 3OTDA 5D8HB 1ZAVA 1N36F 2G2ZA 1FWLA 4QWAA 3PW5A 4FNHA 4IRCA 4K2XA 2FLNA 4DR5F 5KFKA 2OEMA 3LUYA 1Q8KA 7FD1A 4M5KA 5D4NA 4ITSA 4B9TA 2AZ1A 2H65B 2E1CA 2EG1A 3OW2R 3NNHA 2PI5A 4TQRA 1X5OA 4KC5A 1U1RA 3TW0A 3AXMA 3UWTA 4UT4A 2W7AA 1FXDA 2BANB 1UWAA 2HURA 1HWJA 2Q66A 3K17A 3T3FA 4EFAC 1RAIB 1R8PA 1X0PA 3HHEA 4F4YA 3PO5A 4WZQA 1HBNA 1RSCA 4I4BA 2W7PA 4QWCA 3GIMA 3BQ2A 2BQ3A 1WKLA 2NYHA 2HHTA 4DV1J 1YBTA 3QAUA 2KT3A 2GHVC 1HBMB 3V4MA 1N5TA 3OT9A 3DRXA 3KXDA 2KI2A 3LAMA 3M6VA 2GNKA 1W26A 3IS9B 5EUHA 5KFJA 3TAPA 1F60B 2R8KA 4JI7F 4QU7A 4GO7X 1NDCA 4OI2A 4USUA 1UA0A 1S9FA 2HQIA 4XTTA 1CULA 2GQCA 3QPIA 3TVKA 2WB1D 1NDKA 2FDNA 2R7OA 5LM7E 1S0VA 1YJUA 3QFHA 2ZJQQ 2R7TA 3IAM9 5KFAA 3EVOA 2RS8A 2RAQA 2DGQA 2O66A 3GG0A 1JKHB 5ETTA 2G4BA 3D9BA 5H9FK 4N7TA 4PXCA 1SV5B 2DK2A 1GTEA 3O3LA 2W8KA 2IRYA 3PNIA 1TKXA 4TN2A 2HMIB 1VYAA 3G86A 4C11A 2A1BA 3GJQB 1VJQA 1CQNA 1PBAA 3ADAC 3CO9A 3CB4A 4L3KA 1FE4A 4Q0BB 3NGTA 3EZOA 1IQZA 5I42A 2I38A 1DTTB 1OQ6A 1QVGR 1CS4A 3K5NA 2LEBA 4LF6F 3WHIA 1TKXB 4IO1A 4A46A 5IWAJ 2PGCA 4ED0A 2GC8A 2RF2A 3KLIA 4CO3A 4F4KA 2AJQA 2PFDA 1TTHB 4M95A 1X4AA 3C6UB 2ERRA 4B3MF 2WB4A 1HYSB 4U7UK 1FEEA 5E3QA 5BJRA 1U2FA 3VGVA 4PXBA 4KY3A 2H4YB 2W9BB 1UFWA 3KOAA 2GZOA 5KFVA 5FJ4A 3MD3A 3R5AA 3DOKA 2RKIA 5FD1A 3SZ2A 3OXGA 5G4DA 2KFYA 2DGWA 5D3GB 3KMSA 2U1AA 4C0OC 4X4VA 5ETRA 3U02A 1RZMA 2CNLB 1FHTA 1C4AA 3Q8QB 2QGFB 4O4GB 1AZSB 2IIHA 3UQSA 3MAQA 3NGDA 3D0GE 2CQIA 3BEGB 4ZVSB 2QMXA 3HHLC 2C2KB 3W9HA 5IV3A 3MR2A 2DNLA 4FP9A 5HP1A 1YJ9S 1HBNB 5KT5A 1NKCA 2YNFB 4M5IA 4WJBA 3TYTA 3CC2S 2M2BA 4A47A 1XN9A 5D3GA 1X9MA 2RQCA 2E5IA 3UD5A 3MXHP 4CQ1A 2J5AA 3H40A 5KFUA 3U7JA 4MYTA 2AGQA 4BS2A 4LF4J 3PEHA 3D6TB 3CMES 1U25A 1KNZA 2YX7A 2DVIA 2MYFA 3DLKB 4M94A 3VVUA 2ZM6F 1RAEB 1TUGB 4NOHA 4F4AA 4HDGA 4XDDA 1CJKA 2XMVA 3RAMA 3MPYA 1YRUA 2K7KA 1F5BA 1X4EA 2LA4A 1FKOB 1Y7PA 3GFYA 4WXOA 3UDEA 4Q7AA 4DDFA 4IOCQ 2DRAA 2IC3A 1DRZA 3BGRB 3BSNA 1ZH5A 1LNQA 1BWEA 3L7OA 4TU8A 3PX4A 3KUHA 1RTDA 2Q79A 2V69A 4USWA 1FFSB 2QSFA 3MM5A 1SKRA 2UVVA 1NSPA 4TNOA 3FSXA 2I6WA 2HGNA 2M88A 3VZHA 1T05A 2QEXS 4B3TF 4QBUA 3OD2A 3PW7A 4RUHA 3MEEB 1RACB 1ZM4A 2IVMA 4NZ0A 2RU9A 2WONB 4ZP8A 1U1KA 3W5ZA 1KOHA 2APOA 2HBYB 2EPIA 4I68A 1VQ5S 4K59A 1QJHA 4H54A 2HKEA 5K5MA 3GU0A 3CNQP 1LW0B 1REGX 2DY9A 1EAYC 1MROB 2M8HA 3RRGA 3MMAA 1VBYA 3SYZA 1RUSA 3OHAA 1NPPA 5KFHA 1M1KT 1IUJA 1ZBTA 2Z2ZA 1Z2LA 2YNHB 3A13A 4EGLA 1SJ3P 1SKWA 3VAIA 1P8GA 2V8VA 2ZOMA 3LH2S 2ZH8A 1OSCA 2LQ5A 3SDEA 2B8PA 3HD1A 5GMDA 3TOQA 1ZM9A 3US5A 4OZ0A 1HWIA 4CRJA 1VBKA 2YKMA 1U1MA 4ZJQA 2HMIA 1T9VA 4KKOB 3IGVA 1VRUA 1YJVA 3PRDA 3MCMA 4F36A 1RT4B 5C24A 2KXNB 3HHNB 5B0EA 4F0KA 3UPFA 3EXCX 3EVMA 4ZLNA 2OPSA 5B08A 1I3OB 2CPEA 2NXJA 3TR5A 3KKFA 5B0DA 4DPUA 2YKAA 2AEJA 2HHHJ 4LVOP 4WCEQ 2QIFA 3TAMA 1QDUB 3G96A 3O5TB 4A8MP 3R5GA 3BPSP 1D8YA 1F5CA 2HRTA 2XBPA 3LGNA 4RBUA 1TKTB 1ZZFA 1FRIA 2XMWA 1ROFA 1N88A 2DCUB 5D15A 2QA2A 5ETPA 2V8PA 3J7ZT 2XQCA 1S1UB 1TL5A 2HG4A 1B4SA 3DKDA 3FEXB 4ZK7M 1CPZA 2GFFA 3PY8A 2HNYA 1T95A 2YPYA 3OUYB 2Z2YB 5DQIA 3CD6S 1RJJA 2KYXA 4DV7J 2D3OR 4LFAF 4PPDA 2CJYB 5D77A 3R9LA 2ZBIA 4IH6A 3OFEA 2LQJA 4CLYA 5LXRA 3R3TA 3W8GA 2GHPA 3QZ7A 4ELVA 1S1XA 3ZZTA 5CD4A 1GAOA 3ZXWA 4B3TJ 4DMZA 2AYEA 5CYJA 3FQLA 2MQ8A 4DN0A 1TK8A 4ES1A 2B9XA 2VFTA 2P6SA 2E7WA 2ZUAA 4ZVEA 2K8GA 4ZCLA 4RUCA 3Q24A 5I3PA 2EI5A 2GA7A 2XNRA 2CQBA 1LK7A 1PYSB 2DPJA 1RABB 2XS2A 3ZZYA 3ZC4A 4LF5F 4FKYA 2FVRA 3TO8A 1XEZA 1RTIB 1BWVA 4B9MA 1X5PA 3CCWA 2WVFA 4B9NA 2ALZA 3KLFA 5KT7A 1HWUA 1XQIA 3MEDB 3CCVS 3G6ES 2ASJA 4PXEA 3U27A 8RUCA 1NO8A 3AOAA 4P2SA 3M8RA 2RQ4A 2XSJA 4J5OA 2JHEA 2IPOB 2JNJA 3A8JA 3MPUB 2DKOB 4MT1A 5KFSA 3A1YG 4TYAA 3R7NB 2GJFA 3EWGA 2CDQA 1FJGF 4CNYA 4F02A 2BOAA 2YTCA 3R6LB 4LSNA 3E01A 4TYBA 3MECA 5I3UB 2HHHF 2GMHA 4BWJA 1NDPA 1S4FA 1S0OA 5E0OA 1KRPA 2VA3A 2G0CA 3CJTA 3ILIA 2HS4A 4HLBA 1YDLA 4ZPAA 1RT4A 1OPIA 3LANA 5C24B 4IH7A 3FC9A 3V4IB 1NB2A 1YZ7A 2ZH7A 3KJNB 3HVTA 2BJ8A 4OHVA 2UUBJ 2EK6A 3B78A 4FF2A 2XB2D 1WC1A 1NK6A 1JJCB 4K0KF 1N6QA 2MY7A 1FVQA 1V9OA 2ZDPA 4NYPA 4ZPCA 1HI0P 2V8DA 1TZ0A 1RA7A 4UTGA 1ZPWX 3MPVA 3NG8A 3G2XA 1IWAA 1RKJA 4X62J 2DYAA 3BM7A 3MAHA 2ACYA 1R6YA 1LWEA 1KWMA 1Y00A 1Q7LB 5J2NA 1SVDA 1ZM2A 2VDHA 1IKXB 5DO2A 4J9MA 1SL2A 3NMAA 2B4OA 4Q8FA 2N7YA 4OYIA 4DV0F 1IBMF 2OUGA 6FD1A 3HT0A 4C8MA 2ZBQA 4USIA 5GAHU 1KP6A 3W66A 1C1CB 3KHGA 4A8QA 1JXVA 1F3FA 4K5SA 4OQJA 3SIPB 3L7PA 3P49B 4ANCA 2G1HA 5LSRA 2FJWA 1Q8IA 4KIAA 2ZE2A 1QSSA 3DRRA 3HF5A 2KT5A 2LQBA 4QJVA 4WPAA 3O8WA 3W64A 1NZAA 3QLHB 5B0AA 5LJ5Y 4RL1A 5LJ3Y 5GAEU 2ZVSA 3BSCA 2D7SA 2ZHOA 2DY1A 1C1BB 2DNRA 1AFIA 2W2PP 1RADB 3QGGA 3FSYA 2NCKL 1RISA 3OR1A 4RNFA 2N3OA 2OTJS 3KK2A 1RU1A 1WC3A 2RD5C 5DDPC 4X4SA 2HQCA 4OI0A 4W90B 1SC3B 1S9EA 1J5EJ 1S99A 3CJQA 3S01A 4JV2A 2ZKUA 2HWIA 1X7VA 1HKAA 2FPHX 4PG7A 1M5SA 1PYOB 4H4OB 3LAKA 2YNIB 4ELTA 2XY6A 5IC4B 1WTBA 4JI4J 1CC8A 4WU3A 1SL0A 2O5DA 1NPRA 4DFKA 2OD4A 3BDPA 1OQ3A 2KB2A 3I4PA 1SI9A 4U95A 1QTMA 2CQ1A 4ZA1A 2ASLA 4LIRA 1D3WA 3LTOA 1QVFR 2HBZB 4B3SF 3V6JA 1YJ7A 3KLEB 1W25A 3UFCX 3H8YA 2VIHA 3NKYA 1NEEA 3O44A 3V6DA 2B7BB 3HP6A 2AGOA 3P4UB 3T6JA 4JI6J 1FKOA 2AX1A 2CZ9A 2HLTA 3EXYA 5H9EK 2KZZA 5BXIA 3MFHA 1FD8A 1KKHA 1HNWF 1YHQS 3C6TA 3CPWR 2IRXA 4GVLA 4NZ6A 3M7VA 2MQLA 1MWYA 3W2VB 1L3TA 3VAMA 3HSDA 1UWBB 2WVDA 1JLQA 2LU1A 4JP8A 1NM2A 1XNQJ 2E7VA 2G13A 2OFGX 2KRBA 3UI3A 2UUTA 4PYDA 4TU7A 1J2VA 4RUAA 1KHWA 3G9CA 3PHTA 5C2GA 2F1FA 3VCDA 1B70B 1T9YA 3RBZA 2J9CA 3EVWA 3LW5C 2ZZMA 2HSEB 3NAHA 4LBIA 5E7OB 5L8RC 3TEGA 3BN4A 4U7UD 3IWXA 4G1PA 2KRRA 3BGOP 5HK4A 2DNMA 3T9ZA 4DPOA 3BO2A 4DR1J 2KFZA 3K89A 4ZP7A 1T9WA 2GAHC 2LLZA 3SI8A 1VQKS 2L41A 3DXBA 2I5JA 2W1BA 2QFJA 1FO1A 2ASYA 3HJFA 2MJNA 1HQEB 2CJXB 5IT0A 4IOBA 1VGYA 4WU2A 2CRLA 3C14A 1T02A 3Q89A 2PN6A 1RBLA 4OI3A 4CO0A 1HQ2A 1N5QA 1FT8A 4LFBF 3AY0A 2VUGA 4OZ1A 1JX4A 3RTVA 3R1HA 1SH2A 5FDLA 4CZCA 5E41A 2OSRA 3R6GB 5HLFB 1IKWA 2HIQA 2NXCA 2H4WB 3WDOA 3I9ZA 4N76A 1YITS 1IM6A 3GZ7A 2BJ3A 4OYXA 1UPPA 3TEHB 5KT2A 2W4CA 2GJIA 4K4WA 1T7PA 4P6QA 3CCRS 4B3SJ 3T6BA 3AT1B 1LXNA 1WG4A 3IRXA 4OZNA 1HNWJ 4OHYA 3KJVB 4ZVQB 1EETB 3K58A 3K5LA 2MQOA 2Y9HA 4WP3A 1QLNA 1CQMA 1UA1A 3OXFA 3R7BB 4DHVA 1D9FA 1T0TV 2XEXA 3EMTA 1I1GA 4DQPA 3G6VA 1RT3B 3MCNA 4HT5A 1OMSA 4DV6J 5HBMB 1I94J 1Q78A 1WG5A 2XYPB 2J7UA 4X4QA 4DR6F 1S1XB 4J9VA 2OO4A 1GMWD 3MMAB 5L1KA 3UVJB 5IOLA 2PMHA 5DS7A 4XAKA 5IM0A 3JSYA 2OAUA 4M5NA 3MM7A 4XPCA 1S0MA 3SEOA 4ID5B 1Q5YA 3C6TB 4MH8A 3MR7A 3W63A 5AXLA 3NCPA 2CYYA 3FEYB 3PTWA 2HVDA 3CTRA 4IG0B 1R8HA 4USMA 4JI8F 3MUVP 3T19A 2QL7B 2BEFA 4AUKA 1WHVA 2HAIA 2XMMA 1VQYA 2EEYA 4KYZA 1H38A 1ITPA 1SBRA 3SSSA 2HS0A 2C1EB 2KDOA 3EJMA 5ETQA 5A8KB 2YXLA 3OHBA 1RTDB 4B3OB 1GFWB 2J8SA 4H4KC 5T7LA 4DOZA 1UVLA 5KG3A 1UZHA 4AL6A 2H51B 4UOCA 3M2VB 4TVAB 1GQEA 1P1LA 1RTHA 3ULHA 2ZH5A 1EP4B 1L3UA 3HO1A 3GIRA 3DGPA 2J7KA 4DUZJ 1WDTA 3HHLD 2N7CA 3JTNA 4FF3A 3BO4A 3BS9A 3M8PB 4ED1A 2ZBPA 2JJ4D 1LV5A 3QQCD 3FUYA 2NYIA 3CC7S 1A6LA 3JQJA 3JAMU 3K0JA 5HO4A 5LMNF 1HPZA 4B3RJ 3JSRA 4KV8A 2KJWA 2HGLA 4CLWA 2HRYA 2AYMA 3QT8A 2G9OA 3CEDA 1HR0F 4MYUA 3BSOA 3B8HA 3CVKA 1RT1B 4LRFA 1JQGA 2BJ7A 3FMBA 2VG7B 1WDDA 1J5OA 3JSBA 3MI7X 3OTCA 3QIDA 4RU9A 2DNYA 4NL5A 1UEVA 1TL4A 2ZHAA 1DFDA 4N77A 5F3ZA 1PJ7A 3M2UB 2A18A 3KNAA 1TMJA 3OPKA 1C1BA 3RW6A 1RT2B 2BMBA 2QLJB 4KKOA 1BQMB 3OJSA 4V19J 1HA1A 5H1SV 4KAIA 3J80U 1K0TA 5THWA 5GADU 4JV5J 3R5JB 1ZAXA 4JI1F 1T94A 2V63A 1OS5A 2LXUA 1JK9B 2VPYB 4GVBA 4NCGB 2C2OB 5CH7B 2ZNZA 2ROEA 1LOUA 2FHJA 2DPIA 2Q3PA 1DLOA 1FJGJ 2XYGB 2F63A 2W25A 2JFKA 2D9OA 1FWPA 3LP0B 2IAJA 1HWLA 1TL3B 2ZKTA 3BR8A 1VMBA 3TA0A 1YX2A 3N0VA 4LRBA 1CSJA 1Q7YT 5KT6A 4F8RA 2F9DA 1HHSA 4IH5A 2PMZD 1XJWB 4ECYA 2E5LJ 4ES2A 2DGTA 5GVQA 1SH0A 3HHLA 4C8NA 5DM7Q 4J91A 1KVKA 1IKWB 3GJTB 3JS9A 4NLRA 2V2ZA 3VQTA 3WIUA 1J5EF
chains in the Genus database with same CATH topology
2AJ0A 5K8OA 4DSLA 3NNAA 2YX4A 4DUZF 4PWDA 4IFYA 4Q0BA 2N3LA 4ALZA 2GQQA 5F0UA 2FLOA 2XY7A 3ICLA 4ECVA 2U2FA 3PJWA 2RQMA 2ZHBA 2ZC4A 2LXFA 3KJVA 4ZP6A 4QWBA 4UUWA 2XMJA 3OV7A 4PG6A 5B09A 3AB2B 1FNOA 3V4IA 3NRBA 2O3DA 5T7LB 4NLPA 2UXBF 4I1TA 4CH1A 1URRA 4OIXA 3CCSS 5EWEA 3TUIC 2VC0A 4LVNP 2F7VA 4KB7A 4NLXA 3OR2B 1JLGB 1GX6A 2MQPA 2QT7A 2XSJB 2VONA 1ZAWA 2CQCA 4RW7B 1Q82T 4OJ1A 3RR7A 4DS4A 1NU4A 2BQRA 1JLGA 1OIAA 2HWHA 3DLEB 2B6AB 4ICLA 2J8AA 5DQGA 5J1EA 2Q6BA 2UXCF 1LWFA 1IBKF 4A8FA 1JXLA 4UY8T 3V6HA 4QR0A 4CI0B 3O1LA 2WTFA 4MFBA 1TV6B 4TKTA 4ZHRB 3OSNA 1N5VA 4KFBA 4YDXA 4Y3CA 5IT9Y 2UXDF 1SL1A 2RH3A 1VC0A 2RRBA 5CYQB 2JEGA 2PEHA 4ED3A 2L9WA 1N48A 2HWTA 3ENVA 4QIFA 2P6TA 2W4PA 1TVRB 4USJC 4DQQA 3QGIA 4F4ZA 4K5RA 1C0TA 2E66A 2J9DA 3QZ8A 3KK2B 2VOOA 1QUVA 2IA0A 4OZLA 2SXLA 5C5JA 1XR6A 3E51A 4WKYA 1YTYA 2BRLA 2IMOA 3MMCA 3GMGA 4N8OA 1UP1A 4FN5A 5KFNA 1C2PA 4P7TA 4YOEA 1H7XA 4K4XA 2P9EA 1KFSA 1V3SA 1UJ5A 3SQGA 4Q2MA 3KLGB 4UUXA 4QIWD 4MK9A 2PDAA 4X64F 2JZ5A 2XZWA 2ZD1B 4OHZA 4JI0F 3MTJA 2ZITA 3NS5A 2L3MA 4DL0C 3MR3A 3MF5A 1U4BA 3WBZA 2ZJRQ 3J7Z5 3RBDA 1VBZA 4F4XA 2NR0A 5CZXA 3G71S 3FFIB 4F4WA 3FEZA 5GAGI 3DU5A 4IO9Q 1S9EB 2B7CB 3JTPA 4RW7A 1RYSA 3S6EA 3HHKA 4HT7A 1UVJA 3J7A1 5IT4A 4ELUA 5F41A 3WX4A 2DR8A 1TAUA 1JLQB 1IN0A 5M2UA 1DQ8A 4GMKA 3VAFA 2LA6A 4J9LA 1TK5A 4KPYA 2WOMA 4I2PA 4DR2F 3DMJB 3HKZD 3SV3A 4I67A 4WFZA 1JLBA 2KU7A 3CULA 2FVPA 1U26A 2E5GA 3OTBA 5C42B 3E01B 5F3TA 5I3UA 1FRJA 4RW8A 3DMJA 2OLWA 4A8OA 1JLBB 2LCWA 5K8PA 3RZAA 4MIWA 3CCES 1DJ0A 2UUCF 4IDKA 3DHXA 3I5BA 2MDAA 2RT3A 1O8BA 1PSDA 3IA0A 5KG0A 4AFFA 2X1BA 4C0HA 5CQGA 1JKHA 1LW2A 3L09A 5F0WA 5EWGA 1SUQB 2DHGA 3OVSA 5ITHA 3TX8A 4PQAA 1Z4UA 4QW8A 2GMJA 2DH9A 3N9UC 1S6QA 3LO3A 3DCAA 4OI1A 3PHEA 1AROP 4TU9A 4N5SA 2J9EA 2X1AA 2B4VA 3IS9A 4KGKA 1YIJS 5DQHA 1VHFA 1SJ4P 2H9ZA 3OLAA 2NUUG 2KT2A 4C97A 4ZCKA 3TI0A 2MQQA 3VQSA 3MDFA 3AB4B 3DFEA 2XC9A 2R8JA 2R7QA 2XCAA 4RW6A 1SKSA 1K73T 1JLFB 2A2DA 3CJ3A 3S7RA 4WFNQ 2MKSA 2JLGA 2NS1B 2OMLA 3ONQA 4M1KA 3TUZC 1J5EF 5DJBA 2GGPB 1YWXA 3BGFA 2O67A 5A8RB 4HI2A 2DBBA 1H2UX 3SMZA 4ZDNA 2W24A 4MIAA 5FIIA 4ED2A 1S9GA 3S1TA 2PT0A 2CZ4A 3MPWA 4LQ9A 4R25A 3TR5A 2RS2A 3G6YA 3N79A 1XNRF 2C2DA 3M9NB 3UR3C 1JLCB 2IVYA 2KHCA 5GAHI 3I4HX 3CDEA 2J0QD 4M8LA 2R2SA 2OPRB 1IKVA 3ZZ0A 2Y1JA 2Z2LA 1RT5A 1XWLA 4IUFA 3BR9A 2RJZA 1TFYA 3F44A 1YQHA 1MWZA 1LKZA 3K5OA 1VRTA 4KHMA 3SCIE 1VK3A 3HVTB 5I4MA 3I96A 3MMJA 1GXUA 3PKYA 1FJEB 4A8KA 2MZ1A 1B64A 3Q22A 3IC1A 4WF9Q 1XMOF 1L3VA 4I7FB 5CYMA 3PKMA 4TY8B 3NGKA 3GR0A 1S1TB 1S6OA 1JJHA 1NKBA 1C1CA 1HHTP 1K9MT 4ID5A 1RQ0A 4XK8C 2MMYA 1BC6A 3H2LA 2OJ3A 4KR0B 4X4OA 2Z4PA 3T1HF 4OZ5A 3UD3P 7FDRA 5MAOA 3CDWA 3CJ2A 3UE2A 2YWGA 1S48A 2VBWA 3DHWC 4C7QA 5DG7A 1X0FA 3N4WA 5K14A 4HTIA 2XS5A 2IM3A 2BYCA 5A0YB 4ED8A 2JWNA 4FVMA 4WKRA 1FRXA 4R5PB 4MKYA 3LF0A 2E1AA 3NWGA 3PW0A 1G2EA 1JWWA 3QLHA 2J0WA 2A2CA 2EFOA 3DXSX 1HD1A 4E0DA 4JI2F 2M7SA 1YJRA 2CPIA 4KBIA 1VQOS 1SIZA 5IQQA 4U6PA 1X4DA 1F9FA 5H9EJ 2VG6A 3IG1A 1KONA 1FF2A 4URQU 1SUQA 2JOQA 3B4DA 4JOUA 4O3PA 3HHLB 2VPZB 1HQEA 2OP5A 2OSQA 4Y2IA 3PR4A 3ZZZA 1HI8A 3JTOA 3MM7B 2J6TA 3RU0A 2L9DA 1RTIA 3M05A 1CVJA 5F8MA 5BYQA 3R5BA 1WTFA 1VRTB 4I69A 3HK2A 3DI6B 2BXJA 4IG3A 2M8DB 1FESA 4DV3F 2IJNA 4NCGA 2L08A 2NSCA 3HFKA 3HLUA 5F9LA 4DL7A 3T5JA 1VQNS 3AQOA 2XGQA 2UVWA 2KFNA 1Y5IB 2DT9A 2M3DA 2CPXA 4I2PB 1Y5NB 4IG0A 3SCKE 2R7UA 4O44B 2CIMA 2IJFA 1W2IA 1U45A 3SDEB 4CIOA 1BQNB 4QYRA 2M70A 3DLEA 4K50A 1MU2B 1Z2ZA 3D0IE 2NPIA 1REVB 1S9GB 1UWBA 3MM9B 3M6XA 2P9CA 1WEZA 3M4XA 1N32F 1O5JA 4AXIA 4ECSA 4C8OA 1V3ZA 2HGMA 4KE5A 1DQAA 4KV8B 1VQPS 2D1CA 2M0GB 3OTEA 2QA4G 1LW2B 1WHWA 2LEPA 3N28A 1JIHA 1QAJA 2PIIA 2XG8A 2LKZA 2CQ4A 1YBAA 3HDSA 5CCMA 4F3QA 3EYZA 4MMOA 2V5HG 3J7YI 2V4JB 2OPQB 2K1RB 1FE0A 1H2TZ 2OPPA 4H4MA 3PVXA 3MOJB 3KK3B 5AE3A 1SQEA 2RSQA 4OHXA 4WE1A 4J37A 4Y6IA 2C22A 1NJXA 1JJ4A 2IBOA 5A8KA 3KLVA 1IKYB 1TKZA 4RWWA 2LMIA 5F8JA 1N54B 1S72S 3WZ0A 4ZP9A 2E9RX 4WYLA 1VJWA 1XR7A 2GX8A 1B0TA 2V4RA 2AW0A 1RT7A 2RU3A 4I2QB 1WNEA 1FJ7A 4IFVB 2XI3A 5LSOA 3GFZA 3LQVA 2YH1A 2YQ3A 3QWUA 1YRXA 2AGPA 4Y2KA 4KT0C 2CPFA 1SJQA 3IR7B 4PG4A 5F8HA 4RNOA 4OX8A 4ED6A 1QE1A 2FUG9 2DB1A 4DQIA 1DTTA 1KS2A 2Y1RI 2UV8A 1IKYA 3LOUA 4B08A 1VC6A 3MMBB 1U2RA 1DQ9A 4AQYF 3BZQA 4HTJA 3CJKA 4DLGA 4YUDA 2CJQA 5I3QA 3C46A 3EPGA 3OL9A 3GIJA 2VKZG 3SCLE 3OL7A 4LF4F 3CGIA 1RT2A 2B4PA 5D4LA 2MXYA 2EVZA 4NLOA 2ADBA 2HNDB 5KG7A 2JFDA 2DO4A 4RNNA 2HFZA 4X4PA 1UVIA 3MMBA 2RNEA 2KG0A 3S8SA 3H5YA 4DL3A 5HROA 2E29A 4YR2A 3OR2A 1FEHA 4KHPF 3R1LA 1KR4A 2KYZA 3KHRA 1R0AB 3G8TA 1UAWA 2IYGA 4OV1A 4X2BA 2RE1A 4U9RA 2YVSA 3BB5A 1E6YB 3OJUA 1DBDA 4EBCA 3HI9A 3MOZA 4QR1A 2V0NA 2DGVA 1NJYA 1HNZF 4O3OA 5KG2A 1VS3A 2KHDA 3UCZP 2JH3A 1U1PA 5J1EB 2YWEA 4PG8A 1RT5B 2XHWA 3IGNA 5L9XA 3GYXB 1TV6A 4F3OA 2VOPA 1T3NA 1VFJA 1HL6A 1REVA 2C3UA 1MMNA 2DD8S 4NYZA 2FJBB 1FCAA 2BBEA 3SFGA 3T5KA 2J7WA 4DBQA 1NK8A 3PX0A 1KHVA 3SSRA 4WIIA 3U1LA 4AXJA 4OZJA 1UJ4A 1YJNS 4B9LA 5CYMB 3MEGA 3FNNA 3M8QB 4H4KA 3TP2A 3UDLA 4EEYA 1MMLA 2V9WA 1XERA 2DNHA 4DV5F 3F56A 3OR1B 1SXLA 4NRUA 1B0VA 4C2MA 2IM1A 3M1VB 3UCUP 5E33A 1KQSR 1NHUA 4NZ7A 3GG1A 1YI2S 1WI6A 2CQ2A 2R7WA 2FTRA 4ECTA 2IMWP 2EFQA 5E3AA 3TVYA 5KFDA 1XK8A 2BUNA 4HYKA 1R8BA 3F41A 4OX9F 3FCHA 4P7VA 1IBLF 3PFOA 1JLCA 2VBYA 3PV8A 4DV4F 4ZVFA 2IBKA 2AJ1A 2CG4A 2XULA 5AXNA 3N01A 2BZ2A 2XLJA 3QJPA 4FYDA 4NPOA 5DLGA 1U49A 3R5DA 4YR3A 4ZVHA 3H20A 4FS1A 4TQSA 3BDEA 2HW3A 2VPWB 1BY9A 4EYHB 2MKJA 2G1DA 1RDRA 2JC0A 4EO8A 2HZCA 4USHA 1U47A 3Q0AA 1VQ4S 2IM0A 3TVZA 2WBRA 4F2RA 1FK9B 5KFBA 3GV7B 4QIEA 1GNKA 5A2QY 4MTPA 3DRPA 2BOPA 2EK1A 5K8MA 3GQCA 3RRHA 2AYGA 1S1VB 5B0CA 3CUNA 3DLGA 3E3XA 3RW7A 4CTAA 1KLNA 4DUYF 3Q2SC 2FLLA 3K8VA 2NZ4A 3DNCA 2GCFA 4PQUB 4CO5A 4DSEA 1H0HB 2MZSA 1X4CA 2VC1A 4YQWA 2DHSA 3M8SA 4WXWA 4TY9A 1YSJA 3N6LA 1KC8T 4DSIA 4NRTA 2W9AA 1N34F 1U6BA 3FQKA 1E6VB 2LQ9A 3OL8A 2GJ2A 2KVIA 5E3CA 1WF2A 1KLMB 3RB0A 3B4MA 3DU6A 4OHWA 4O0IA 1HQUB 4DL5A 1N5YB 1TKTA 2MKCA 4B9UA 4N8NA 1MU2A 3X1LB 1TKZB 2HNZB 2PC6A 4Q2LA 2I1RA 3POTB 2CVIA 1OWXA 1S0NA 3FRZA 2BW2A 2BDPA 2WAQD 2KTQA 2BQUA 2UVUA 2BM0A 2K7JA 4LQ3A 2ZH9A 3M2UA 2WOMB 3MHYA 1S1WB 5CA5A 4FBUA 4ZMMA 2CJAA 4XPEA 3H4DA 3I6PA 4A8WA 2BM1A 4LSNB 3GFHA 1S77D 3BN7A 3R5CA 4HH1A 4ZPTR 4DV1F 4HKQA 1HNVA 2B0GA 2D3ZA 3CD0A 3MMCB 1D0EA 4ID8A 1MROA 1F0XA 2V2KA 3P5TL 5KG1A 2K2PA 3BSAA 3D28A 4YB6A 4IDKB 2EG2A 4BBYA 4JV0A 4JUZA 3TAQA 2DR7A 5KAKA 3M2RB 4QWDA 3P6YC 2HLUA 2C3OA 4CNZA 1NJIT 4I6WA 2BVZA 5IWAF 3HVWA 2E9ZA 3I0RA 3D2WA 3Q2TC 1BQXA 1QSYA 1HD0A 2HHPA 1UL3A 3D1HA 1M90T 4R8UA 5M2PA 2FJXA 2MZQA 2OH2A 4CH7A 2NQPA 1RGVA 5KFPA 3QJJA 1VK8A 3FRYA 2VH7A 2VA2A 3ENQA 2HHXA 4ECWA 4R8UB 3PFEA 3M6WA 2DO0A 4YP3A 4BC7A 3HPOA 4DS5A 1U1QA 4JV1A 1OO0B 1HFEL 1PC4A 3KMQA 4PRFA 1S97A 3IRWP 2DGSA 3JYTB 1SH3A 3CDUA 2OKQA 4X4NA 1M0SA 2BABA 5JVGQ 1UVKA 2DIUA 2DNPA 2JL9A 4FF1A 3W2VA 1WACA 2I9SA 2WONA 1HMVB 5G0RA 2CQDA 4RW4B 3GSDA 1HARA 5M2RA 2MGZB 2HNYB 5IFMA 4C9DA 3C6UA 2YKNA 1HW8A 4DSKA 3J81Y 2QSWA 1LW0A 2M5YA 3SCJE 1FNXH 2HHQA 3W2WB 2QLXA 1HNIB 2JDJA 2UZAA 3O6QA 2DNNA 4FXDA 5F8NA 1BD6A 1Y4ZB 2EFVA 2NPFA 5CXTA 3F73A 3DRSB 1DTQA 1UMJA 2XNQA 2OPSB 4C0BA 3MM6A 1S1WA 4ECXA 2V4JA 4NLUA 2OPRA 5E2QA 1TR0A 4QW9A 2V9KA 2YWFA 3OBIA 3DRSA 5C25A 5LSLA 1NRKA 1FKPB 2VD3A 4DG1B 1HNIA 5EX3A 5JJBA 1D1UA 1UKUA 3NMRA 3QYYA 1UVMA 2MB0B 2ZDOA 3D0HE 1S6PB 4IR1A 5HN0A 2CVEA 3PACA 3OSPA 1KN6A 2FHOB 2KO1A 1M5VC 2V8GA 1RA6A 3BQ1A 4J9OA 2IM2A 4RW9B 2JSXA 4RW6B 3MEEA 4DV2F 1NK4A 4IQXA 3LP0A 2JEIA 1Q4RA 2C2RA 3FSIA 5BR8F 1U8SA 3MM5B 3OQ2A 3CCMS 4L3NA 5KFIA 5KFFA 2JEFA 5AXMA 5I42B 1NK7A 1G7CB 4XO0A 1FRMA 1X4GA 3GFXA 5HMWA 1GTHA 2J0XA 3MR6A 4J9SA 1H2VZ 3M8QA 3KLGA 2MJUA 1VC5A 3C3LA 1EETA 3DLHA 2CZVC 3CWJA 2Q43A 2ZD1A 3M9MB 4GC7A 1GX5A 2I2YA 4ICLB 1QAYA 1RWUA 1X8DA 2OMOA 4ZCIA 4X4RA 3KHHA 1SJFA 4RW4A 4ZOSA 3P96A 4EO6A 4H4OA 5B7WA 2V94A 3T9NA 3FJ2A 5J2NB 4B02A 5LT5A 1XTZA 2FJAB 2YY3A 2FJVA 1IM4A 3N6NA 4RBVA 2VG6B 5HL7Q 2FJDB 2VG5B 2FHMA 2FJEB 2B51A 2EFNA 2EW9A 3PIOQ 2K3KA 2IFXA 2PO4A 1NJZA 4IRKA 1KQGB 2ZE2B 2E5HA 1WHXA 5D78A 1E6YA 3AJ1A 5HP1B 2E5LF 2GIRA 1TUVA 4TLRA 5C42A 1MMDA 4B3OA 5E3RA 4HH0A 2HNZA 4Y00A 2YNHA 5DLFA 2D3UA 1B0PA 3TNVA 4K4YA 2KKHA 1D8ZA 4LUBA 3FDSA 4DWIA 3CC4S 2MZTA 2LECA 4MK8A 6FDRA 1NH7A 3TA1A 1O51A 1R3NA 3K8WA 4OI6A 1KQKA 5K8NA 4DFPA 1BQNA 2QZ8A 4IFVA 2KXFA 2RVJA 4CTAB 2IVFB 5F9NA 1M5HA 5AE2A 2MPUA 4HEA9 4YFUA 4NLVA 2GIQA 1DTQB 2ZH3A 1S76D 2EKYA 1FVSA 3SSQA 1A9NB 5KG4A 2WW8A 4C8KA 2ZC3A 3ENWA 3M6UA 2R8GA 1BQMA 3BGRA 4X84A 1T3OA 4U67Q 2AX0A 1QE1B 1HQUA 2KN4A 4Y34A 3QIPB 2X1GA 3TRGA 4UQTA 5CHCB 4JBCA 1ZYQA 1UFLA 2IRUA 4NLDA 2IHR1 4QOTA 3D1OA 1R27B 3ISZA 3PR5B 4HL9A 2B43A 2C3MA