3K7RA

Crystal structure of [tm][cuatx1]3
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
70
structure length
70
Chain Sequence
EIKHYQFNVVMTCSGCSGAVNKVLTKLEPDVSKIDISLEKQLVDVYTTLPYDFILEKIKKTGKEVRSGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Metal homeostasis factor ATX1
publication title Tetrathiomolybdate inhibits copper trafficking proteins through metal cluster formation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 19
structure length 70
sequence length 70
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2009-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3k7rA00
2LQBA 2AW0A 2VV5A 2ROPA 1FVSA 5B0EA 2N7YA 3IWXA 2OFGX 2ZDOA 2FB0A 1YJUA 1Y3KA 2IFXA 3F44A 4Q2LA 1APSA 1TL4A 2LXFA 1FE4A 2XMWA 1SQEA 4OIXA 5K9FA 1X0PA 1N5QA 2QLXA 1S6OA 2XMJA 3DCAA 4A46A 4DPOA 2ROEA 2OAUA 5IXUA 4HI1A 4U9RA 1OPZA 4YEAA 3HHLB 2CRLA 1IUJA 3FMBA 3E8OA 1MWZA 1Y0HA 2ACYA 1N5SA 1OQ3A 3BM7A 4NL5A 2EW9A 2GV1A 3HX9A 1CPZA 4YDXA 2HQIA 2W4DA 1LQ9A 2BBEA 1VQYA 4ZA1A 5B0FA 4HH0A 1JWWA 2GA7A 2KT2A 2ZDPA 2GGPA 3HFKA 1YJTA 2L3MA 2XMMA 3BF4A 3LO3A 5F0WA 5T7LB 1CC7A 2XMTA 2K1RA 2GO8A 3QGPA 3TOQA 2IYIA 3FGVA 3HF5A 2OD6A 3UDCA 3HDSA 2AJ1A 2HLUA 4A47A 3TRGA 1FD8A 4F67A 3K7RA 4Y2MA 1R6YA 4EFAC 5B0GA 2K2PA 3I9ZA 4ZOSA 3BDEA 1JK9B 1W2IA 2JDJA 2N4CA 3KKFA 3VTIA 2RMLA 3BR8A 1Y3JA 2BYCA 1N5TA 2OMOA 1FVQA 2G9OA 1VQSA 5T7LA 3BN7A 4DL0C 2RSQA 4OJ3A 4FNIA 1P6TA 1P8GA 1KVJA 2XMVA 3WDOA 3IWLA 1GXUA 1TR0A 2AP6A 2HLTA 4FNHA 2VH7A 1YG0A 4HL9A 4NPOA 4DN9A 1Y9OA 3GZ7A 3HHLA 2W4CA 1OQ6A 1QUPA 1YJVA 1SB6A 2W4PA 1FEEA 5B0BA 3DXSX 1ULRA 5F0UA 2HIQA 2BJEA 1AFJA 1KQKA 1X8DA 1YRXA 2HFOA 1Q8LA 2OFHX 1GXTA 2PD1A 1TZ0A 2N4DA 4QOTA 1AW0A 1RJJA 2KT3A 3KG1A 1U7LA 2RILA 2PGCA 5B08A 1YJRA 1X7VA 3BB5A 3CJKB 3HHLC 5B09A 2KYZA 1TL5A 2QIFA 2RU9A 5A6WA 3T9NA 1Q53A 2BUNA 2OP5A 2K7JA 3FRYA 3HHLD 1S6UA 4OJGA 4A48A 1AFIA 1Q8BA 2FTRA 5KAKA 3BGUA 1URRA 1OSDA 2HFNA 4A4JA 1MWYA 2BJDA 2GGPB 2XMUA 3LGMA 4HI2A 2GFFA 4HH1A 3KG0A 1FESA 3TNVA 1K0VA 2OD4A 1CC8A 1Q4RA 2FIUA 2KKHA 2K1RB 2ASYA 1WD6A 1FE0A 3KNGA 4OJ1A 3LGNA 2ROGA 2GCFA 3QMQA 3CJKA 5A6PA 1TUVA 3MZIA 2QLWA 2FHMA 2Q3PA 2AJ0A 1KVIA 2LDIA 3MCSA 1N5VA 2LQ9A 2QYCA 2XMKA 4Y2KA 5B0CA 1SI9A 1V3ZA 1XBWA 4OJHA 2K7KA 5B0AA 5B0DA 4Y2IA 2OKQA 2IYGA 4Q2MA
chains in the Genus database with same CATH superfamily
4ICLA 3OL7A 1I94F 4DF8A 4B3OB 3PFEA 3MTKA 2P6SA 3R5BA 4OHYA 4ID5B 3AXMA 2GMLA 5GADU 4WK3A 3D6TB 3HX9A 3G2XA 2Y1IA 1LNQA 2YXLA 3GV8B 4DG1A 3I4PA 1KLMA 2UXBJ 2EVZA 2OEMA 1BQXA 4EFAC 2A6OA 1R0AA 5B7WA 1X4HA 2R7TA 2HMIA 2HBZB 2XMVA 2J9DE 2PMZD 1ZZNA 3GV5B 1IWGA 3VCDA 1J27A 1WEXA 3GSIA 1OY9A 4PWUA 5AXNA 1AW0A 4ZVEA 4LQ3A 1F0XA 2PN6A 2GGPB 2DISA 2R4FA 5KTQA 1AA1B 3CO9A 4FPRA 2X3GA 2RF2A 1T02A 4TVAB 2X1FA 4LFCJ 4KHRA 1Q8IA 3I5AA 3MFHA 1NK5A 3GIKA 3D0GE 4UF4A 2UVUA 4DV4J 1VRTB 1YTYA 3J7YI 4K4SA 4RNHA 4B3RJ 1SL1A 4LF5F 4ECTA 1JLGA 1WHWA 1T9WA 3BF4A 4M94A 3L95X 2KZMA 1RWUA 3HMJG 4C98A 1NDPA 5HK4A 5KFRA 3TZZA 3KK1B 1FK9B 1YKWA 1RTHB 4RZRA 1ZZFA 1RTJB 1U47A 5EX3A 2KFNA 3OW2R 4MIBA 1NRKA 3RBXA 4JYAF 5U47A 5AJ3F 4ECSA 2FZKB 2H48B 3M8PA 3R97A 2F4VJ 4N8NA 1BXNA 4ILLA 4MIWA 2ZNZA 2E5GA 1J5EF 1RWKB 2W1BA 4ECXA 4O0NA 1RHMB 1YDLA 1RDRA 3CCWA 1TL1A 3DLKB 1U0SA 3FFIB 2MKYA 2FJXA 3K57A 2HVEA 4YDDB 3BV8A 4ZPVR 4ELTA 3FCVA 3UN3A 5CD4A 1SJQA 2NYHA 2VDIA 3CVKA 3CJ4A 4RW4B 1S0VA 2XCPA 1WSRA 2M9KA 4LBHA 3DLGA 4LF9F 2BM1A 4OI2A 5L1JA 5BYSA 1N33F 2I8EA 1TKDA 5F8MA 2NCKL 6FD1A 2MZSA 3GJQB 2DNZA 2CQPA 4WFNQ 3RRGA 2XHCA 1GH8A 2O3DA 2BJEA 4LF6F 4HDHA 2BW2A 2SXLA 4TY9A 3M2VB 4AL6A 2E9RX 2RUSA 1IKXB 1RAJA 4E98A 2ZFHA 2Z57B 1VQ5S 1MSWD 4CO1A 1FTCA 1CJUA 1GX6A 3DI6B 5GAGU 1F3FA 2WVCA 2IBKA 3RZAA 1Q79A 1KVIA 4B3SF 4DV0F 4HYKA 2CZ9A 2G4BA 1R8PA 3HPOA 4MTPA 1OPIA 3CGIA 3HZEA 3J7ZT 2O01C 2ZDOA 1U24A 2CJBA 4PQUA 4AT1B 1WI8A 2H5EA 2DO0A 1MROA 1HNZJ 1QVFR 5KFGA 2UUBF 1U0HB 2C2KB 5IT9U 4P73A 2AYGA 3UDCA 4PXBA 1UEUA 5DM7Q 4USJC 2NSCA 3IP0A 4ZHRA 4A8YA 3JSYA 1WC1A 4FNIA 2MZQA 3Q8YA 1NDKA 2VBWA 2MY7A 3BSAA 1M1KT 2AEFA 3GFXA 3IWLA 1WEYA 3NOCA 2NPFA 1S4EA 4NPOA 2FVCA 2W9CA 2LLZA 4IUFA 3GJSB 2DIVA 4ZN1A 4NEYA 3JYTB 5A6WA 1HL6A 1MWYA 4DV6J 4ZJLA 1CC8A 3W2WA 4NZ7A 2DITA 4OJ1A 1GMWD 3MUTP 2YWFA 1F6TA 5KFXA 1TK8A 1WKLA 3L4BC 2LDIA 4H4KC 2LQ9A 1NM2A 2DHXA 4EZ6A 1YZ7A 3NMAA 3CJQA 4CM2A 2FHOB 3M1VB 1TL4A 1HQ2A 1NAQA 4ZVTB 2VQFJ 2L9DA 4DBQA 4Q0BA 2LQ8A 1HQEB 4MK9A 3JB9k 2QC3A 4DR6J 2DHHA 4ZS6A 1UEVA 4PWWA 4QPTA 4MFBA 2V50A 3CMES 1FWLA 3UPFA 4CO4A 1HYSA 1WF2A 1X5TA 3TW0A 3AOCA 1RHQB 1S7HA 1Z1ZA 2JVOA 2ZOGA 1RYSA 4GKJF 1CS4B 5IC6B 1IBKJ 2YWWA 3D1OA 4YN3B 1PJ7A 1Q95G 3TAMB 3R5AA 1RWOB 2OELA 4NLVA 5AE1A 1KTVA 3TVZA 1T9YA 1RAOA 3QJLA 1TL7B 1SL2A 3M8SA 2ZHAA 4W90B 3DGPB 1NDLA 3KHGA 4X62F 4KKOB 1CVJA 1TK5A 3F0NA 3K5NA 3D1QA 2W2QP 4EU0A 1S6OA 4D3GA 4KY3A 2RRBA 2DCLA 3P5TL 1OQ3A 1BWEA 1NKCA 3C19A 3AJDA 1JLFB 3I5CA 4ES1A 5H9FJ 4PQAA 1EETB 4BLGA 4CM0A 3OUYB 4FKYA 5IS2A 2OEJA 3M6VA 5IM0A 5GAEI 2OLWA 3ITHA 3AD8C 4U8YA 3KJNB 4ZN3A 4J9NA 1NJIT 1QTNB 1BLUA 4XIUA 3N4WA 2H3EB 4V1Ak 1NPKA 3V6DB 1YK9A 1GMWA 4ZPCA 1UVKA 1TELA 2NXNA 4DX7A 4ATNA 5EGYA 2CJYB 3CCLS 2FJVA 3CB4A 2RT3A 1WD6A 2PEHA 3VAFA 4C8OA 4IFVA 4N7TA 5HQ8A 2HK3A 3MECB 4R5PA 3MM8A 2IYGA 1RGVA 5GAHI 2YKMB 2DGTA 2NXEA 4LQ9A 1WJ9A 2ACMA 2XNRA 1Y5IB 5JVHQ 2OAUA 4KFBA 3DFEA 1MU2A 2ZKUA 3KUEA 5K8OA 2PA3A 3MMCB 2UV8G 2RVJA 3H8YA 2DNOA 2ZDPA 2J6SA 4G1PA 3IXQA 5L46A 2E1PA 1EHWA 4IR9A 1LWCA 2B4VA 2P9CA 3SYZA 3WHIA 3K5LA 5J2QB 2AJ1A 4HEA9 1SKSA 4X4VA 2IA6A 1LEOA 4J7CA 1RB0A 1PC4A 5A2QU 3V6JA 2HLTA 1HNWF 3K0JA 3GZ7A 4TYAA 2HVZA 4PEOA 2BJ9A 7FD1A 1HQUA 2Y8WA 2R8IA 3NLCA 2CPYA 2BUNA 2OP5A 1L3TA 1URRA 3JQJA 3ZZTA 1VHFA 2XWXA 2IPOB 2UVWA 3MM5A 3K89A 2F40A 1VQLS 2VBYA 4FN5A 4CDIA 3FMWA 2C28A 1F5BA 1JLQA 1S79A 4JV1A 1CQMA 2YQ0A 1FVSA 2F9JA 3NWRA 2FJWA 4Q2LA 3G9CA 5IWAF 1YZ6A 2HW3A 3D2WA 2D9OA 3OTDA 4OYBA 2GVZB 2OPRB 4DV3J 1F5AA 3OLAA 2F4VF 1P9YA 1WACA 3MD1A 3CEDA 1H98A 4ANEA 2DO4A 4ILMA 5CA5A 4P72A 1R7IA 4JUZA 2MY8A 3D0IE 1HPZA 3W65A 2DR5A 4R25A 1O5JA 4L75A 4GO5X 3TO8A 2B43A 2ZJRQ 1VQSA 4I1TA 4IYQA 3QQCD 3SCKE 1GK8A 3C6UA 3HVTB 4C11A 2W4CA 1P1LA 4FYXB 3KFWX 4YB1P 4C2MA 5JXSA 2R2UA 4NLSA 2IVMA 4UUWA 2BDPA 2JFDA 4LSZB 4LRBA 2N3OA 2ZD1B 2AMCB 2V2QA 1ZAVA 3PYFA 2X1AA 1QLNA 3TI0A 2VG6A 4LMZA 3CCJS 1ZETA 2N7YA 2QO3A 3BGLA 3LTOA 4C0HA 1ZM3A 2KI2A 4OZ3A 1S6PB 2MLZA 2HVIA 1VIXA 2W24A 2JEGA 3SV4A 1SKWA 3CDEA 2C3PA 5EUHA 5M2PA 1WF1A 1EKSA 3CSKA 1RWMB 1WC3A 2BKNA 1R6YA 3CDUA 1Y00A 3C6TA 2HFVA 5LSOA 1B3TA 1HBMA 1RU2A 2YKNB 1HNVB 2J9EA 3ENWA 1AZSB 3CTRA 2HFSA 1G7CB 2EK1A 2PEBA 4CLYA 2NZCA 4DFMA 4OI4A 5HQMA 1VRUA 3SI8A 4MAKA 4USWA 1XR6A 4A48A 1IR2A 3CCUS 4U95A 1S49A 4PYDA 3RUBL 1WOSA 1OJ4A 3C14A 3CIZA 2B9XA 1OYEA 4KJIA 1UWBA 2DYAA 2W8KA 4R8UA 1UAWA 4Y3CA 2DNHA 1IKWB 5KFCA 4JOUA 2CQIA 4O44B 2VOPA 1V3SA 2DH8A 4HT7A 4F4ZA 3HLUA 2COLA 2XMJA 3KLEA 3T3FA 1RTIB 1JLCB 2XSJA 1UA0A 2QA4S 3VGVA 3CJ3A 5SZTA 2V0NA 2BKPA 2RDDA 1DTTB 4ZITA 1C2PA 4LFAJ 2JVRA 1BQNB 3I9ZA 1XQIA 4PPZA 4QIVA 3WIUA 1SL0A 4WWSA 5FDLA 4DCJB 3E51A 5KFZA 1EP4B 1J5OB 1D09B 1KQGB 1KFDA 4LRFA 2HNZA 3OJSA 4P7VA 4XAKA 3VF0B 1IN0A 2DRDA 4DR4J 2M8DB 1Y5LB 2MQLA 4FYYB 1NPPA 4GMKA 2FVRA 1K0VA 2GQ2A 3CNQP 2K1RB 2VA3A 3B54A 4OYWA 5HVHA 4N56A 4ZLLA 3LP0B 3R5CA 1VS3A 1ZBTA 3T1YJ 5CYMA 3Q8VA 2F63A 4LRAA 4U9RA 1WTFA 4NLOA 4LF2A 3V2UC 1QE1B 2JH3A 5HP1A 5H9FK 3CMAS 4ED6A 1S6QA 2F7VA 2HEKA 2KO1A 2JC1A 3WZ0A 1G4CA 3W5ZA 3AT1B 3M8ZA 3NS6A 2J6TA 4PUOB 1F9EB 2UUCF 2BXJA 1RABB 3L9ZA 4QPXA 4UOCA 2XY5A 4IDKA 3AHPA 2RRAA 4L3KA 3NG8A 5AT1B 2HFOA 1HW9A 5KFTA 1I1GA 2ZH2A 3PY8A 1N32F 3AOBA 4NEZA 3PRVA 2J76E 2V34A 2VONA 3R3TA 4LIRA 3IR5B 1MN7A 3JS9A 5L9NA 2ZC3A 4V19X 2ASYA 3R5DA 3M9OB 1JQGA 5JJBA 2CJQA 4P2SA 5HATA 4ETXA 4WZMA 1RKJA 1URNA 1X4GA 5ETPA 5KT4A 4ZVQB 1LWXA 1S1UB 2GGPA 4ZPAA 4DV7F 1R0CB 1NKEA 1RT2B 3I56S 3KTQA 3BDPA 3S1TA 3GMGA 5ETOA 2DXEA 2HWHA 3LUYA 1FVQA 2H65B 3HVAA 5ADZA 3KUGA 4OX6A 1VRTA 2FGCA 4F2RA 4RNFA 4TYBA 3L7PA 5T41A 3THVA 1NHVA 4CI0B 2PGCA 4YR2A 2CQDA 1F5CA 3D4JA 1NZAA 1FERA 1GTEA 1M90T 2QGFB 3TANA 4PPDA 2BACA 3KK1A 2QX0A 3DYAB 1RTHA 2QYCA 1X4BA 1Q5VA 2MEWA 3NWGA 4WIQA 4JV5F 3H42A 1KS2A 3JTOA 4JP8A 2ILYA 4ZCIA 2WVDA 2IJRA 1SV5A 1PJ6A 2R42A 2V94A 2W4DA 3V4IA 1EZZB 3PYGA 2MZRA 2BA9A 5KG6A 4YR3A 1YX2A 2JHEA 3NY0A 4K50A 4K4YA 1HW8A 5A8RB 3FFIA 3KKFA 2BYCA 4UUXA 4NA1A 2DY1A 1RWWB 3DRXA 1C1CA 2FYXA 4OLOA 2B4PA 2E1CA 1FT8A 4WFYA 1FFSB 4J9VA 2P2CB 2PD1A 5DG8A 4X4QA 1Q86T 4DHVA 3ISNC 1VBYA 2N3LA 1BC6A 4YQWA 4OYIA 2DK2A 3EGNA 2OMLA 2XG8A 3KNGA 1K44A 3GP9A 4HHJA 3H5YA 2J7KA 2O1PA 3FSIA 5KFIA 4F36A 3N6MA 4ECWA 2DGSA 4OV1A 3NGTA 3M30B 3DDIA 2ZOMA 3KK3A 2OTLS 2PO4A 4P71A 2ACYA 5SUHA 3ZNJ1 1IKXA 4DEZA 2NXUA 4J9RA 3FUYA 1DTQB 1LXNA 2CQBA 4PKDB 1HMVA 3A8EA 5F9LA 4Y65A 1FA0A 5HI7A 5T7LA 4EBCA 5K14A 2DCUB 5CHCB 3HT0A 2CNOB 4DL4A 2E5LJ 2JEJA 5C25B 3QO9A 4BBYA 4CTAB 5EX0A 1ROFA 3KK2B 3BKTA 2V69A 2C2MB 3QZ8A 4JI3F 1U0HA 3CDWA 5B09A 1OIAA 1WG5A 5CABA 1NLKL 1OS5A 2QMUB 1VQ9S 3MCMA 3Q8RB 3C46A 4NLQA 3G6VA 2PFDA 1SC3B 4KH1B 2PDAA 3S01A 2J7WA 2BANA 5A0YB 2HS3A 4HR2A 3EGWB 2CQGA 3IBWA 1OO0B 4OI1A 3G6XA 3OVSA 5D15A 2BRLA 1VBXA 4WFAQ 2W25A 3CCRS 4LSNB 3DOLB 4PABA 4CLLA 4CLZA 4WPAA 1S77D 1DBDA 4DV2J 1IR1A 4ZA1A 5HBMB 2W7AA 3M6XA 4H4MA 2V8PA 4J5OA 1HI1A 4BC9A 2MQMA 3T1AA 3P5BP 3H0PA 2P9EA 1GFWB 2AV5A 4HTIA 1SQGA 3JSBA 1H7WA 4CO3A 5IT9Y 2CQ4A 3CPWR 1DZ5A 3D3BJ 2HSEB 3H4BA 1S57A 1HQEA 2O5DA 2G13A 4GVBB 2YNGB 3ZFVA 3N79A 4I6WA 4X4OA 3S8SA 2B51A 4LBIA 2DGUA 2C3MA 5KAKA 2UZAA 5EWEA 3G8SA 3VQSA 2MYFA 3G82B 5DQHA 3OL6A 4OZ2A 1TUVA 3P45B 1HARA 4J9LA 2XO6A 3QIPA 2AJ4A 3V4MA 2CG8A 1S97A 4TY8B 1TP7A 4LFBJ 2V6AA 3DMJA 4RW8B 4X4PA 2ROEA 3PW2A 2H54B 3GWCA 3ZTOA 1JLAA 2W2PP 1YBUA 1IVZA 5LT5A 2A0FB 2DR8A 3O1LA 3ZZPA 2PSZA 1TL7A 3DLEB 5D0RA 4XDDA 3LALA 1RT4A 2AEMA 3TUPA 1HNIB 3RRKA 2X1BA 4NRUA 4KKOA 1K1SA 3T1YF 2ZBPA 1B70B 4QBUA 4ANCA 5A8WB 3KDNA 1N0VC 2KG0A 4Y0FA 2V4JA 5KT2A 3QWPA 3U7JA 1IBCB 3W66A 2RU9A 1LWEB 3OXFA 4MKBA 3GYGA 2R7OA 2ASJA 2HZAA 4CQ1A 1U1OA 2L48A 3RBEA 4AL5A 3D1HA 4DI6A 3MEDB 1WHYA 3MEKA 4C9DA 1JXEA 4TU9A 4IH5A 4KGMA 3FBCA 3OBIA 3RB6A 1EAYC 2WVFA 5KFEA 3TEGA 2RQKA 3NCPA 4PCQA 2XGPA 5BXIA 1NJZA 3CD5A 1FKOA 1HI0P 4ED1A 1UVJA 3V6DA 1VQ8S 2IY5B 4KHPJ 1C0UA 1R8HA 4LBPA 1HLWA 5J2PB 1DLOB 4P52A 1U8WA 3G86A 2HHTA 3HDSA 2HLUA 3DRSA 3T5LA 3M8QB 1H2TZ 1WI6A 3FSYA 5KFBA 2CZ4A 1HNXJ 4M95A 1UJ5A 4RX6A 4ED8A 2ERRA 2PC6A 3A12A 1MN9A 5DZ7A 5DDQC 3MMCA 4M5NA 2IJFA 2DEJA 3R5JB 3A13A 2G1DA 4ZP7A 3X3UA 4ECRA 2KU7A 4X65F 3M8RA 5E33A 1HWLA 3TVKA 1NBEB 1HBUA 4WU2A 1RAAB 1OSCA 2CPFA 4TNOA 2CKWA 3KMSA 5AE2A 1LWFA 1OPZA 5LXYA 2GIFA 4M5DB 4LSLA 3UCZP 3SCIE 5KG4A 1VQYA 1PJ5A 2B9WA 5IT4A 2VG5A 3K8WA 3Q8PB 4DWIA 3N9UC 1RT7B 2V4RA 2QL9B 4I7FB 4U8VA 4B3TF 2CNKB 3EWGA 5ETKA 3W8PA 3GV7B 5FD1A 4I2QB 1BWVA 2VA2A 3BH6B 4RNOA 1X8DA 4N5SA 2ZH1A 1P9QC 4OZJA 2HHPA 3PX6A 3PVXA 2BM0A 4ZMMA 2K3KA 5F8NA 3CJKB 1T9XA 5A2QY 3US5A 1GMUA 2HQCA 2I5JB 1ZM2A 2ABYA 3PNIA 4MMOA 2HGMA 1SCJB 1AXQA 4QZVB 1MMDA 4B3MJ 3HVTA 2ATCB 2R7SA 1BQMA 3N01A 3P8BB 1XWLA 2K3IA 2D3UA 3UW1A 1YJ9S 4DL7A 2C22A 1YBTA 3KLVA 1CPZA 3F41A 3FEZA 3SSQA 2WONA 4LUBA 5G0RA 3HVWA 2DXDA 4FS2A 4DZ6A 3MWBA 3GPAA 2IHR1 1JK9B 3DC2A 4B9MA 3HKWA 4N8OA 1M5KC 2P9GA 1Q81T 3PW0A 2WB1D 5F3ZA 5ETQA 3BJYA 3KLIB 3LP2A 4X4SA 1FRJA 2YNIA 1S6PA 1KQKA 5J1NA 1I5OB 4P2FA 3NP5A 5IT0A 2R8JA 8RUCA 2PMHA 1E6YA 3CDAA 1QAXA 8AT1B 3OQ2A 1RCXB 1XNQF 2AWZA 1NH7A 3HFZB 3J7Z5 3TZWA 5D4OA 2YKNA 3IG1B 1AZSA 2GX8A 1O6XA 4WFXA 1ZH5A 3PW5A 1U25A 1B99A 3KXDA 4ZP9A 4OX8A 1EX8A 2LEAA 1N34J 2DNKA 2GA7A 2VPYB 4GC6A 2JEFA 1YJ7A 4DR5J 4JV2A 2HBQB 3EJMA 5ETRA 4PRFA 5E3PA 1IKWA 3BR8A 3OVAA 1RHJB 2OMOA 5HMZA 3KJVA 1ZPWX 2PE8A 1Q1KA 2EG1A 2RQ4A 2AYEA 3AA9A 2KYXA 1RTIA 2B0GA 3PFOA 2XBPA 1JLCA 4WTYA 4ERDA 4I2PB 4IFYA 2RQMA 2B4OA 2JX2A 4Q45A 2NUHA 1BE4A 3Q86A 2CAJA 3U27A 3DRPA 1U26A 3PYEA 5IC4B 2ZEJA 1KTQA 1L3VA 1EP4A 2DR6A 2BQ3A 1FXRA 3ILJA 1N5YA 4ED7A 3SQGA 1VRQC 1RISA 2YWEA 2X51A 4K4WA 2KG1A 3GFZA 4O3OA 4G3IA 3JQMA 2CWKA 4DUYJ 2XS5A 1GEHA 3AA8A 1FCAA 2K1RA 4MYTA 2GMHA 1WUUA 5HLFA 1JB0C 2EKNA 3QT8A 1CBKA 4FXDA 3E01A 4KAIA 3IGVA 4DSFA 5D0GA 2DXFA 3K7RA 4Y2MA 2MMYA 3IGNA 3LP0A 1LFWA 3U02A 1P1TA 3RAMA 3PEJA 4AQYF 3M2UA 1KHVA 1WSVA 1FEEA 4I4BA 3IR6B 5GADI 2E1AA 3QBCA 1TL5A 1HR0F 2AZ1A 4ZVUB 2EFQA 1XK8A 4ECUA 2G2YA 3OXGA 3GIIA 4PUOA 3D28A 4OYPA 4C6AA 1SIWB 4IOCQ 2HFZA 3HSDA 4K59A 2MQNA 4DV5F 1E6VB 2U1AA 2VD3A 3F56A 4U6PA 1JLEB 1EIYB 1MWZA 3BBFA 4A8XA 1WELA 1OY6A 4OMFG 5LMNF 1RT5A 3UWTA 1GT8A 5KFSA 5HSPA 4ECYA 2WBRA 1VFJA 3QGPA 2WRMA 4DS5A 1FJ7A 5DRKA 3HFVA 1PAUB 2CQCA 2M0GB 2I6WA 1RT6B 3DLBA 3ZZ0A 1Y3JA 4FXVA 5KT7A 2B3TB 3UCUP 1TKXA 1FWKA 2Y3YA 1ULRA 2JRSA 3TR5A 5D4LA 4QQBA 1S1UA 2ZWOA 2JLGA 4B9VA 1N88A 2Y1JA 6AT1B 1UJ6A 1FESA 3MAQA 1RA7A 1GNKA 1MWQA 3PKMA 2XSFA 2ZITA 1HNXF 3MZIA 1X5SA 4NCBA 3UVJB 4BWMA 3MM7A 3DM2B 4PXCA 2AX1A 2W7OA 1IM6A 5L8RC 1T3NA 5I3UA 1LW2B 3DCAA 2K06A 3CCMS 2RJZA 1T11A 1WC6A 3M32B 4ED4A 2HHQA 2XM3A 1YJTA 4O4GB 1VC0A 3N6NA 3PHEA 1A9NB 4ED3A 3V81B 3FQKA 2UUTA 5D0HA 3DRRB 5DG7A 3DYAA 2D3ZA 3A3OB 4J9MA 5D6GA 2HQFA 4LF5J 4NASA 5AXKA 3R6LB 3BO3A 5HANA 1SB6A 4KV8B 5J1EB 1S1WB 4ZCMA 1Y5NB 1XN9A 1KQFB 1M5OC 4RNNA 5RUBA 4ZP8A 1D0EA 5A8RA 2KKHA 1NKBA 1EB0A 3RBDA 5CYQA 3LGNA 2QN6B 4BCAA 5KG2A 3H7HB 3V6HA 1XTZA 4JYAJ 2W2OP 5AJ3J 1C4AA 3QGHA 1X9WA 4C4WA 1XBWA 3QRQA 2B6AB 3GYNA 4ZVFA 2W01A 4OX9F 4R0JA 1PAEX 3QRRA 1J5EJ 2J0XA 5F8LA 5DDPC 1NUEA 3EXYA 4JI0F 1S9EA 2KM8C 1T8EA 2CDQA 2JOQA 2BQUA 2CA9A 1ZYQA 3M9MB 2BRKA 4YHHJ 3O5TB 3PCOB 1S59A 2W8LA 1NNDA 1AB8A 2NLWA 5KG3A 2OD6A 3B4MA 2IM2A 3TA1A 3KG4A 4O3NA 2QA1A 5GAGI 1SJFA 3ZTPA 4WTOB 2F5GA 4MK7A 3VZHA 4M5IA 3AB4B 1VBKA 3M30A 2AU0A 3PIPQ 2PI4A 3MPWA 3H2VE 3KWMA 3VAHA 3OL9A 2R2RA 4DL3A 3W9IA 4RBTA 2CQHA 3EVOA 4NYPA 4QWDA 4LF8J 1SC6A 2XB2D 3KMQA 3VAJA 4ID8A 4MYUA 1FXLA 2ZH4A 1U1KA 3BPDA 2E66A 2MB0B 3TUJC 4USKA 4Y2AA 2V5HG 4LF6J 1RADB 2BOAA 1DAXA 1NSQA 3ZXWA 5C25A 3TZXA 4TLRA 2ROPA 3EICA 2E7XA 2XMWA 5ETMA 1T94A 5E3RA 1R8BA 2DGXA 2CIMA 4U96A 3H5SA 4JBCA 2RKIA 4K5RA 2IA0A 2EFOA 1B0VA 4B3SJ 4DV0J 2U2FA 5J2NB 2L3MA 4I56A 1YLXA 3M9NB 4RW9B 1WC4A 5A0YA 3I32A 3EVMA 1DQ9A 3V6KA 1XIQA 4JI6F 2VPXB 5K8NA 4DCPB 5C24B 1C0TB 1V6HA 5KFDA 4IG3B 2UUBJ 3DOLA 4UOGA 2MGZA 4JI2F 1TV6A 1YWXA 2WCXA 1WKKA 3ZZYA 1JNZB 5HBMA 5AE3A 1U1QA 3HXMA 2Z2MA 3FRYA 1X9MA 3J80U 4DR5F 5F41A 1NK6A 4PR6A 3MCOA 2LU2A 5C42B 4PG4A 2QLBB 1U2RA 2I2YA 4NXNJ 4DFKA 3NNCA 2LVWA 1B4SA 5DZ6A 3VGUA 5B0DA 1V3ZA 3THPA 3TJAA 1SBRA 3OT9A 4IH7A 2VOOA 2H51B 4DQIA 1LW0A 4I68A 3UN5A 3H2UB 2B4UA 2YNGA 1WHVA 3AY0A 5BYQA 3SQOP 4YDXA 3BPSP 3MMBA 3ONQA 3UR0A 4DPWA 1BMQB 2PMWA 5MAOA 4LREA 4NMXA 1S1VB 2MSTA 3U1MA 3OR2B 4GO7X 1REVB 1RAFB 5EWFA 2X3DA 2ALYB 4CLTA 2HQDA 2ZWPA 4TY8A 1R43A 2XNQA 3BSCA 2CPDA 2DY9A 1TVRA 4DR2J 4O0IA 5KFFA 2RDJA 1ZTWA 4EGLA 3T6JA 2M88A 2ZZNA 1X7VA 1AROP 3BGRA 3MMAA 1S5ZA 2DGVA 3DLEA 4ZJOA 4Y00A 3MEGA 1JLBB 3QSIA 5HQLA 3PZPA 2LXIA 1S72S 2APOA 2MQ8A 3EGVA 4Y2KA 4GKJJ 1T03B 4ED0A 3CCES 1FE4A 4UQTA 2XLIA 3D5MA 4J9QA 4TU8A 1K9MT 4MKAA 2O67A 1LWEA 3IA0A 4ECQA 4TKTA 2XC9A 3I0RB 4K0KF 1BUXA 5I4MA 2DB1A 1ELOA 4X62J 3R8YA 4WYLA 4K2JA 3AH6A 2MKSA 3MEDA 4C7QA 1XMQF 1HA1A 4LJMA 5KT5A 2JWNA 4QCLA 1CJKB 4KH0B 4M5HA 3FCHA 3ZZRA 2CJAA 3I55S 4M8LA 4R0EA 3KLHA 4PWDA 1NB7A 5DQGA 2G0CA 4IR1A 2KRRA 2YH0A 2C3YA 4H54A 3LF0A 5DJBA 1H7XA 2FHJD 1DLOA 3NBPB 2OGUA 4RW7B 4RNMA 4YP3A 3G71S 2ZHBA 3TA2A 3ENQA 3LAMA 2X1GA 4ICLB 3M8QA 2R9LA 2ROGA 3LA0A 2HHHF 2Z8QA 2HNYA 2OPPA 3VGSA 3OJUA 4CH0S 2ZOFA 1J2VA 2HHSA 5ETNA 5B0EA 2BABA 1N36F 4KT0C 4OIXA 2WSFC 4XPEA 4RUAA 1KLMB 3RJMB 3DLJA 4HDGA 1KHWA 1S9FA 2W9BA 5A76A 4A8QA 1PG5B 1Y0HA 1PILA 1LFPA 3NEKA 3BREA 1T3OA 1X4EA 4JI4F 4JB8B 3MFIA 2DNNA 1SKRA 1R0AB 3RRHA 2B56A 2HMIB 4CNYA 1RHKB 2EPIA 3GIJA 4ZPDA 1SVDA 1CQNA 3W3SA 1IR0A 4JI5F 3A3PB 3PIOQ 2VB6A 4C8ZA 1S1XB 4M5DA 1TFYA 2XS7A 2BZ2A 3DOKA 3GB0A 2OTJS 4UT4A 1TZ0A 3WC2A 2W2NP 4K5SA 4XTTA 3UR3C 4JI7F 3Q83A 4USHA 4HI2A 1RAHB 1HNWJ 4U7UK 3EVWA 3IAM9 1P27B 4QWEA 3ILLA 4M5LA 1F2HA 1T9VA 4NI2A 2XZDB 2ZNYA 3EX7B 2QE5A 4I2QA 4DJBA 2HHUA 1APSA 1JLGB 2FZGB 5K5MA 1SQEA 3RBZA 5KT6A 3W8GA 2JL9A 3LH2S 4DR1F 4N47A 2IAJA 2YQ3A 3KJQB 1NXIA 2E7VA 1REGX 2AYMA 1VISA 1PGZA 4TXSA 2VF3A 1WTBA 2EEYA 3LQVA 2EFVA 4LR8A 1FJEB 2XMMA 3AFGA 3MM9A 5H1SV 3VR1A 3W2VA 2E29A 3W9HA 5IWAJ 1SJ1A 5E7OB 1VQOS 1HBNB 2B5JA 2CYYA 2RS8A 3UI3A 2FHJA 5HROA 4Z7CA 2OH2A 2XI3A 3DXSX 3EE3A 3TAPA 1XNRF 3MR5A 2HYIB 1CULA 2QL7B 2HRTA 3HD1A 4URSA 5ETTA 4YHHF 3FDSA 1U6BA 4RW6A 3BGUA 1TL1B 3QT5A 4I6YA 4ZVGA 1PBAA 1T95A 1RA6A 4P2XA 2DNGA 1U4BA 4B9NA 2IRXA 4F3OA 2JFKA 1NMEB 4NRTA 1FRHA 2QLFB 4ZPWR 2Z58B 3NS5A 5HL7Q 4DPOA 4FDFA 2MHNA 4LF8F 2CRLA 1XMOF 1G3OA 4DPUA 3BQ0A 4RUBA 1YITS 1FNXH 3NCQA 1UPPA 2LCWA 5BJRA 2BW7A 2W2MP 2C2RA 2XLJA 4FYWB 4MIAA 1N4LA 3IG1A 1KFSA 3HHEA 3TAQA 2MPUA 1NHUA 2RAQA 4PYAA 3E3XA 3ENAA 2ATLA 4HACA 1N56A 3JSMA 3RB0A 1LK7A 2FC8A 1CJUB 2IRUA 2QMWA 3T19A 1KP6A 1RACB 3CE8A 3I82A 4X84A 1TKZB 4KO0A 2RRNA 3ET6B 3B4DA 2HFNA 4IQMA 4WK1A 1RTDA 2FIUA 4PQUB 2VFRA 3NGDA 2QLWA 2BMBA 5DS7A 2XEXA 3H5XA 1MROB 1L3UA 4KRWA 1S4FA 2WVEA 3OR1A 4B17A 4H4OA 2CADA 5K9FA 1RI7A 4OI6A 4FF3A 5I42A 1NSKL 3Q2SC 1T05B 2UXDF 1UVIA 4ZHRB 2XY6A 2C3OA 1DURA 4NLUA 3G6ES 5KFLA 4NXNF 4DR3F 3D9BA 3RAQA 2MTLA 4OHVA 1FRXA 3QLHA 1U8SA 1VC6A 3LP1A 5LJ3Y 3OL8A 4YB6A 2GHVC 3EGZA 2VH7A 4IG0A 3BQ2A 3HHDA 3K58A 4K4VA 5DO2A 2DNRA 2C1EB 3SIPB 4PAAA 3IO1A 3W2WB 2F8HA 4J37A 1QY7A 4UQGA 1UW4A 4TU7A 3O2IA 1UPMB 2KYZA 1K0TA 2DNMA 4C3LA 2P8IA 1XR7A 3PV8A 1WHXA 2NPIA 4M5KA 2IVYA 1TUGB 3MEEA 2GCFA 1DQAA 5E0OA 4KGVB 4FBTA 2AJ0A 2LQJA 2ZH3A 2V9WA 2YBVA 4Q0BB 4Y2IA 2POKA 4DR2F 2YNFA 2EC2A 7FDRA 1YI2S 2IC3B 2EFGA 4KGKA 2PIIA 3OTCA 3SV3A 4DSJA 2QG9B 3QRPA 1IKVB 3CO0P 4IRDA 1HYSB 3ZC4A 5ETSA 4X4RA 1K47A 4F67A 1S0MA 4OL8A 1JJHA 4DSKA 1U1RA 4IKAA 3CC7S 3AOAA 3ZO7A 1IWAA 2YX7A 4EO6A 3HJVA 3POTA 4AUKA 3NRBA 2OIHA 2HNDB 2HIQA 1H0HB 1YRXA 1S0OA 1Q16B 3H98A 5B08A 3OTOF 3AXKA 4C8LA 2LMIA 4DFPA 4GKKF 4WIIA 5L39A 1PCAA 3KLGA 1DFDA 2CWXA 2UUCJ 2HBYB 3NGRA 1S1TA 1N32J 2R8KA 2OKQA 3D67A 5THWA 2M5YA 2Y0BB 2MKCA 4NCGA 3BH7B 3QPIA 4MKVA 3GIMA 1ZOTA 3J81U 2MKIA 3AQPA 2XYPB 4HH0A 2KT2A 3I0SA 5F3TA 3A8JA 3MURP 1VLOA 4I0WA 2J7UA 3BR9A 3ITHB 4E0DA 3Q24A 2HGNA 3D6FB 4ELVA 1GQEA 2HG4A 2CQ3A 4DV7J 1YG0A 1FKPA 1VC5A 4X66F 2J0QD 3M32A 3JQKA 2ZM6F 2QYGA 3RB4A 3KLFB 2RILA 3R27A 4O4GA 4DSLA 4IFVB 2MJUA 5DDRC 2GIRA 5KFOA 4KTQA 2D3O1 4R5PB 3CC4S 5KFWA 3KG0A 1UFKA 2V63A 3DDNA 2J9CA 5KFMA 2RUGA 4FP9A 1NK0A 3SEOA 4KFBB 2V2ZA 1MU2B 1S99A 2WHOA 4L76A 1WG1A 1DJ0A 4LR9A 3CJ0A 4KV8A 4EK2A 2GHPA 2XTJP 3EPIA 3MDFA 2Z30B 1RP5A 2B8PA 1UJ4A 4ELUA 4NLRA 2EBGA 2C2DA 1X4DA 2JJ4D 1Q82T 1WF0A 4JV5J 1SC1B 3G96A 2V8VA 4IH6A 5KFHA 5FLXU 2FLNA 1QAJA 1TAUA 3BN7A 2Z0GA 5JUMA 1X60A 1HQUB 1VDHA 1R8CA 2J6UA 4F26A 1HI8A 4EBEA 4PG6A 4L73A 3I96A 3MM5B 5M2RA 4NYOA 3DN9A 4A8MP 1JLQB 2HZVA 2XMUA 1YIJS 4KE5A 1X4CA 2MLXA 3ZNUA 1TK0A 3QMQA 1TMJA 3K5OA 2H9ZA 2XQCA 4OHZA 2HWTA 2KTQA 3ISND 4JI1F 4J9KA 3BKUA 5DDOC 4TN2A 3CJRA 2Y9HA 2VC1A 3BSNA 3HHLB 2KJWA 1SQFA 2DRBA 1TQLA 1R6VA 3B82A 3W5YA 3U1LA 1NJYA 5F8HA 4DS4A 2M4MA 2R3VA 4P6QA 3GQCA 3C6UB 2AJ2A 4C3KA 1VMBA 4QYRA 4C11B 3PW7A 4A8FA 1FDBA 3GSDA 1JJ2R 3TX0A 2HIYA 1S76D 1LK5A 2VG7A 1VQKS 2IM0A 5KFJA 2FVQA 3QWUA 3CCZA 1UKUA 2UUAF 1MW7A 2EK6A 1U2FA 4UOFA 3QSYB 1FKAF 3GG0A 2HHWA 3ZZZA 3CXCR 3WC0A 4CO0A 5D3GA 1IQTA 4OYOA 2VG6B 4NCAA 2H4WB 3FSXA 4LF4F 2F8EX 9RUBA 5C7PA 5CD4H 5A8KA 1FI4A 2J8SA 3SCLE 2DIUA 2FHMA 4FYDA 2I9SA 5C24A 4WU3A 3ETOA 4JI3J 2NXJA 4Z7YA 3T1HF 3CCSS 2LA6A 4ZIVA 3MUMP 1HBOB 3JSRA 1S9GA 4JI8F 1WORA 1QSYA 2A6MA 3FJ2A 3IRXB 4QIGA 3C6TB 1HBMB 4DV1F 3T9ZA 5DGAA 2IYIA 1MLAA 3HF5A 1D9AA 4L72B 2V67A 2AJFE 2UVRA 1W2IA 5L38A 1TMMA 2WOMA 3M05A 1JXLA 2BJ3A 1RT3B 3HKZD 5F8GA 1P8GA 1GAOA 1H73A 1WC0A 2R7WA 4OQJA 2JLEA 2BEFA 3KOAA 1N6QA 2VL1A 3JTPA 1RWXB 1QSLA 3C14B 4RR5A 3H20A 4L6V3 3D54A 2QIFA 1UWBB 4X64F 2Y1RI 4R8UB 3Q8QB 3MAAB 1M5VC 2FJDB 3PO5A 3OR2A 3ADAC 3EDRB 4Y2CA 2KM8B 5KFQA 2IDEA 2QEXS 2FVSA 1M1GA 3R1HA 2ADBA 4FF4A 2J8AA 3W60A 3TVYA 1ZA2B 4KBIA 1N5VA 2BOPA 3J80Y 3QFHA 4LF7F 5IFMA 3L7UA 2A18A 4ZLNA 5J2MA 4NL5A 4LVOP 4USIA 2JSXA 1CC7A 3HK2A 3W62A 2R7UA 2FDNA 3CWJA 1O8BA 1ZS6A 2HNZB 4CYUB 2RMLA 1T03A 2LQ5A 3UE2A 3SSRA 4NLYA 4F0HA 3IM8A 2VKZG 4Q44A 4OZNA 2DRAA 2KFYA 4C8MA 3RTVA 3C15A 2QJ3A 4LRDA 4ZVSB 2HRUA 4QOTA 3LAKA 4G1QA 4NE9C 3GCWP 1H74A 3MPYA 4Y34A 3T9NA 4M1KA 1FEHA 3S7RA 4IO9Q 5CYMB 2JLFA 1CJKA 1V5VA 1MMNA 2CDRB 2ZZTA 2XHWA 1FXDA 5HP1B 3TZYA 2UXCF 2DPJA 1S6QB 2AEJA 2HBRB 5CZXA 4K4UA 2CQ1A 1A0OB 3E8OA 3J7A1 2VBXA 2B7CB 3BBBA 4B3OA 1X4FA 4B9UA 2MHEA 3VALA 3MCNA 4ZLJA 2CPJA 3MD3A 4DX6A 4ID5A 5KFKA 1AUDA 3OTBA 2GQCA 3FEYB 1AT1B 1PKUA 1RBLA 1FD8A 4HHHA 4YUDA 4IDKB 1L5UA 2FZCB 4M63A 4F4YA 5D0EA 1RK8A 5CCLA 1QD1A 3Q22A 3P6YC 5HN0A 4DU7A 1W26A 1Q53A 3CCTA 3N5FA 5IV4A 2V2KA 1O0PA 1EARA 3R2DJ 2QRRA 1H6KX 3TYTA 4F8RA 1RE1B 1S1XA 2HZCA 1Y11A 2LFVA 1VJQA 1NO8A 3VHQA 1YJNS 4X65J 2CPEA 3FMBA 2F4FA 3PTWA 2NS1B 2VQEJ 5KOXA 4ZCKA 2BJ7A 2DHSA 1R89A 4WFBQ 1HWIA 2WTFA 3FGVA 2YX4A 1BHNA 3O3LA 4QWBA 1HHQA 1KD1T 1KNZA 3HZGA 2P5VA 2XZWA 5L1LA 1RXOB 3MMJA 4CLKA 2CJXB 1FRLA 1R31A 4P10A 1FK9A 1KOOA 2BJ8A 2EBEA 2N4DA 1UA1A 4C0BA 4B3TJ 1RTJA 4B9LA 4U7CA 2VZ9A 1RAIB 4NA2A 2C2NA 4CNZA 4DL2A 2IRYA 1HBNA 2AZ3A 1NJWA 3H4DA 1FF2A 2LDYA 1HWUA 1HD1A 4UY8T 1SJ3P 3CW2C 3EUNA 5HAOA 4ED2A 1SV5B 2L41A 3V4IB 1TKTB 3KNAA 2LECA 3CULA 2R2TA 3PJXA 3FQLA 3DLKA 4WBFA 3OXLA 3KYLA 4NLDA 1OY8A 3DKDA 4CLUA 3GG1A 2GVDB 2A2CA 1C1CB 3TA0A 4RW4A 3VGTA 3DLLQ 3PM9A 1SKUB 1U02A 1FJGF 2FLLA 2FLOA 4I64A 3TQEA 2CG4A 1P6TA 1CEZA 3BN4A 1UFLA 5EWGA 4DUZF 3IBCB 1I3OB 1S7IA 2R8HA 4F4XA 2I0XA 4RU9A 1KVKA 3GE9A 1ZA1B 2GJIA 1CG2A 4URGA 3M2VA 4DX8H 3KK3B 3HHKA 2E44A 2MSSA 4MT1A 1RLDA 2L9WA 4RPFA 4CP5A 2RD5C 3DI6A 1RWPB 1KKHA 2UU9F 1XNQJ 1TKZA 1HMVB 1WG4A 5B0FA 3ET6A 5LMUJ 1FDNA 5T7LB 1VCTA 1FNOA 1NPRA 5K14B 1F2GA 1C1BB 4HLBA 4A47A 3QO9B 1CJVB 5B0GA 1FRKA 3HJFA 5K20B 5LXRA 1SIZA 5F9NA 4LR7A 4ER8A 3HVRA 4AXIA 2IM1A 3CD7A 1IXKA 2KHCA 1IBMF 5F0UA 4ZJQA 4B02A 1T05A 4HKQA 3GCXP 2MKHA 2BANB 1KDNA 4Q7AA 4RUCA 2RQCA 1B7FA 3TQ1A 3H59A 3QAUA 3IRWP 1XC9A 1YSJA 3JYTA 2V4QA 4OI0A 3QGIA 4YY3J 2AYBA 1W7WA 3SBMA 4ETZA 2FVPA 2XWYA 1HWKA 4NLTA 3LANA 4H4MB 3R9LA 3CJ2A 4FXWA 4QIFA 3QJPA 3BM7A 2RHQB 3H90A 3M1VA 4F4WA 3NS7B 3QIDA 2E5HA 4IQXA 1FO1A 3EZOA 3PX0A 2XZTB 1PYTA 2FY1A 1NH8A 8ATCB 2IC3A 3Q23A 2M70A 3FBFA 3PX4A 3VWSA 3IFEA 3UN2A 1YHQS 2YKPA 2FLPA 3BB5A 4CZCA 4FYVB 3T6BA 1S6UA 1IKVA 3QIPB 4A4JA 2YKAA 4AQYJ 3Q0AA 1H72C 2BJ1A 2GJ2A 1CS4A 3I4HX 1RWVB 3DMJB 4DLEA 4K8RA 2GMJA 2F9DA 3TAMA 1JLAB 2RDIA 1HR0J 1NB2A 2HNDA 2GNKA 5L1IA 1V3RA 4CLPA 4MJKA 3KHLA 2R7RA 1W2BR 4CCHA 2BE2B 3DGPA 1UVMA 4UZBA 1RT4B 2ZH6A 4MKYA 3PR5B 1AUSL 1T9TA 2XS2A 2R8GA 2GW8A 4DV5J 3BZQA 2J0WA 2AGPA 2ZBIA 3A8KA 2KRBA 3CF5Q 1JLFA 3DNCA 1EETA 3ICLA 5MLCV 2ZVIA 2YQ1A 2DGWA 2V4JB 3OUYA 3QNWB 5EHHA 5LMNJ 3R7SB 2R7QA 3PKYA 3EMTA 3TJ8A 2CUYA 2CPHA 3MR6A 3GFYA 1AFJA 1PYOB 5KFPA 2OPQB 3BBCA 3CJ5A 2MZ1A 3FZ2A 2PFFB 2ZH9A 5BYRA 4ILRA 3HHLD 4M5GA 1VQPS 2GC8A 2BV3A 3MOZA 3QT7A 4N77A 3Q8SB 2KXFA 2DTJA 2ALZA 1FKOB 4Z2XA 3RR8A 2KFZA 1U6ZA 1OMSA 3C3LA 5FIIA 2DD8S 5E3CA 2UXBF 3H5UA 1C0UB 3FKBA 4NLWA 2KXHA 1IQZA 1PSDA 3IBFB 3HM9A 4A46A 5DLFA 2BE7D 2QV6A 3KLFA 3W5XA 4CLWA 3MECA 2FUG9 3FC9A 2YKMA 3UNGC 3DRSB 1L3SA 4CRJA 4PXEA 4F0MA 2BR0A 5F0WA 2RIJA 4CH7A 5G4DA 3J81Y 3Q2TC 2AX0A 1Q7LB 2RH3A 1WNEA 2CXEA 2K2PA 2L9NA 2Q6CA 4CWBA 2AD9A 3H25A 5C2GA 3TUZC 5ITHA 1KSPA 3SFUA 1QVGR 1JX4A 1ITPA 5J2QA 2ZH8A 2FC9A 2IBOA 3HSGA 1CJTB 5KT3A 1U49A 2VQEF 3OHBA 1FX2A 4LFCF 2KT3A 1U6FA 5D8HB 1HBUB 4OJGA 4AE5A 3LOUA 2RU3A 2QFIA 2JC0A 2OSRA 2QTWA 1U1MA 4DV4F 5LOQA 1HHSA 1LWFB 1FX4A 2PI5A 4B3RF 3ILIA 2ZE2B 4LSLB 4F4KA 2LXUA 4O4RA 2IMOA 2G2OA 5AXMA 2AJQA 2EG2A 2CPZA 1CSJA 5L1KA 1K1QA 4WXWA 3P4UB 3ULHA 2R7VA 4EI2A 2GZOA 2VG5B 5GMDA 2OPSB 1PO6A 4RUHA 3RG6A 2HQIA 2NSBA 2DGQA 3UDLA 4BC7A 4OX9J 4ZCLA 2GVZA 2OPRA 3MR3A 3AODA 3PEHA 3L7OA 4ZKAA 4JI0J 2OI2A 4EO8A 4FKXA 2XYGB 3I5BA 4Y28C 4OZ0A 5KG0A 3EXCX 4X4UA 2GQQA 2L08A 3HHLA 3OPKA 1FD2A 3NOGA 1X5OA 3V5RA 2P6TA 3J7YU 5FLXY 1UFWA 2HKEA 3THTA 1FFWB 2CNLB 2ZC4A 3W63A 3UO0A 1HIYA 1AFIA 2NUUG 3SXLA 2BJDA 1BQMB 5GVQA 3MPUB 1WOOA 3LWMA 2ZBQA 5IV3A 1GX5A 3OSNA 4LVNP 4Q2MA 4ECZA 2GAHC 2WONB 2ZD1A 1KRPA 5G0RB 2OO4A 4RL1A 4EEYA 2D1CA 4CLSA 4BS2A 2ZJPQ 3ILOA 1N48A 1KLNA 3HO1A 1T0TV 4EMDA 2EC0A 4DL6A 1NJXA 3DGVA 5E3QA 3GIRA 4Z37A 4QR0A 3HD2A 3LP2B 1UZDA 1KWMA 2YNIB 2FJEB 3B78A 4P9SA 3ISZA 4DF4A 3OFFA 4F50A 1HBOA 2WW4A 3UQSA 2G1HA 1QUPA 2GJFA 2W4PA 5B0BA 1UVNA 1E6YB 1CLFA 3OV7A 2BX6A 3BSOA 5LMUF 1HNVA 3C16B 3IRXA 3R5GA 4W98A 1TL3B 5H9EJ 2N7CA 1FDAA 5DGBA 4JI6J 4Q8EA 4TQSA 1V5IB 1M5PC 1XMBA 1UETA 2OD4A 2KVIA 1RU1A 4J9PA 2Z4PA 4JI2J 4RWWA 1RT3A 1HNZF 4USVA 1G1XA 1S12A 1A6LA 4DL5A 4QR1A 1VQ7S 1ZPVA 2QFJA 3VZIA 1SUQB 3K2YA 2LXFA 5IQQA 2DHAA 4OYMA 5LL6d 5HJXA 3NL0A 5KFNA 3M8YA 5KG1A 4WE1B 3FBBA 3MAAA 4O44A 2VBZA 4P75A 3KJVB 1G2EA 2A10A 4FPIA 3MGJA 4C8NA 3U1NA 4YY3F 3TRGA 1FWPA 2XMAA 4USUA 3N28A 1VQ4S 2RSQA 4OJ3A 3N6LA 1YRTA 4IFYB 4PXDA 3UD3P 1DTTA 3D66A 1WEZA 4RU2A 2DH7A 2MKJA 4DV6F 3D7SB 4NZ0A 1BQNA 2MQQA 1UEKA 3LW5C 3RGIA 2NR0A 3EDQB 2VPZB 3DRPB 5CAAA 3UCGA 1J5OA 3PDNA 1RT1B 4ES3A 2M2BA 1N52B 4QWCA 1N8RT 1UL3A 1N5YB 4IOBA 3LGMA 3SQGB 2VQFF 3DDKA 4CYUA 2XO7A 2DT9A 4DR6F 4RBVA 3KHHA 2XMKA 3ENVA 4V19J 3DLHA 1HFEL 2C2ZB 4J9OA 2F3JA 2M8HA 5IZHA 1SH2A 3BEGB 4KC5A 1NK4A 5HLFB 3E01B 4QU6A 1X5PA 5J1PA 2ZHOA 1K73T 2NQPA 1H2VZ 1WKJA 1RKIA 1NK9A 1D8ZA 1QE1A 4O3PA 2MZTA 3M2UB 2N82B 3M8WA 1IBKF 2WSCC 1IKYB 1JKHB 3TJ9A 4DL0C 4ZVPB 1H2UX 3HI9A 4K0KJ 1U2CA 1RYRA 4NZ6A 2D7SA 4K2XA 2GHWA 5F8IA 3P3DA 2WSEC 3C2PA 2FJBB 1XMQJ 1D8YA 1JIHA 3MR2A 1NU4A 3K17A 4G6VB 1B0TA 2ASLA 2VUGA 5L9XA 1ICEB 4LF1A 1JJCB 3OSPA 5HO4A 2Z56B 2YY3A 5LM7E 4A8SA 2RE1A 2NREA 3CDBA 4M5JA 3BO2A 2QA2A 1RT5B 5BR8J 4RBUA 1FJCA 2KJVA 2DEIA 1LOUA 3RB3A 3CCQS 1HHTP 1M1HA 2HHHJ 3O44A 4F7VA 4XK8C 1X9SA 1TU0B 4DCOB 1N36J 1K8AT 3GLJA 4W4MA 1TKXB 5T14A 5ETVA 2HS4A 4OYZA 4C0OC 1DQ8A 1RT2A 3RW7A 3GJRB 2KN4A 2GO9A 4JI4J 1HKAA 3EYZA 2QA4G 3GONA 2ZBRA 2XY7A 2B8QA 2YNHB 1GXLA 1FHTA 2YKQA 4NOHA 4KYZA 3A1YG 2KVQE 2VFSA 5DQIA 1Q8BA 1QAIA 4JI5J 1NK8A 3MM7B 3TNVA 4LIWA 3CJSA 5KFUA 3M6UA 1IM4A 2RHSB 1ZAXA 5E41A 5I3UB 3MTJA 1GTHA 2B9YA 4KGXB 2ZZMA 1MNEA 2HAIA 3FK4A 5GAEU 2YWKA 3F44A 4JI7J 2QLXA 4Q5VA 3JAMU 3EM1A 1IJEB 4L74A 2D74B 2BBEA 2BKOA 4M5MA 2RS2A 3SDEB 3A8IA 2IM3A 4USTA 1I6JA 2MDAA 2AGOA 4E8UA 2HWIA 4DR1J 1XR5A 1TKTA 2XI2A 4P74A 4EYHB 2QLJB 3W1YC 5GAHU 3QATA 1VR6A 4G1IA 4ZPTR 2KT5A 1U1PA 1AYEA 3NMRA 5CXTA 3RR7A 2M3DA 5CYQB 3HCXA 2NZ4A 2DGOA 3A3NB 2GS8A 3AJ1A 2GVDA 2XYHB 3FEXB 4I67A 1FDDA 3OTEA 4B9SA 2E9TA 4DV3F 3I87A 2Q3PA 3AJ2A 1XNRJ 1MG7A 1S9EB 3WQPA 4RO0A 5C5JA 4Q43A 2VV5A 2AT1B 1TUWA 1VK8A 3G8TA 1N5QA 3D6MB 5CQGA 2EKYA 2KDOA 1NHKL 1RAGB 1RBOB 1PBUA 2Q43A 1EKRA 2HK2A 3CD0A 4NYZA 1RHRB 4RWXA 4BWJA 2GO8A 3E2EA 1Q78A 1LV5A 3TOQA 4ZVHA 4IRKA 3OLBA 4X4NA 3M2RB 2W9AA 4ZK7M 4P7TA 1DARA 7AT1B 1XMOJ 2ZVSA 4C8KA 2C3UA 1DTQA 2CVIA 4ZP6A 1NEEA 3MPDA 3W7BA 1IBLJ 2UP1A 1GMVA 4KPYA 3GYXB 2ZUAA 1VHIA 3BO4A 2OFHX 2ZH7A 4F02A 5H9EK 1PYSB 2VHGA 3IS9B 1RJJA 1FRMA 3W9JA 5LSRA 4CTAA 2WBMA 4YB7A 1C1BA 3PRBA 4TQRA 2MJNA 4KHMA 1U1NA 1CJVA 3KK2A 2LYVA 4DUTA 2YVSA 3W64A 5KFAA 1TTHB 2VDHA 2RKIB 5LSLA 4EYIB 3Q8UA 4J90A 4WP9A 2IFXA 4CT8A 4RLEA 2E5IA 4G65A 1OYDA 3R1LA 3AD7C 2IMWP 9ATCB 1LQ9A 4K4XA 1ZTTA 3DHWC 4C3MA 1ACMB 4LSNA 1S10A 4ES2A 1W25A 2GIQA 5I3PA 2Q6BA 2RB7A 1F60B 2MGZB 1TV6B 3MM6B 1JMTA 3PXGa 1VI7A 2FJAB 2UXDJ 1GXUA 1R8AA 3PG9A 4AXJA 4CO2A 1Z2LA 1Q8LA 4NXMJ 4DR3J 2HHVA 4DXLA 5HMXA 3GR1A 2Z2LA 4IOAQ 3QJJA 2VICA 3N0VA 3PJ9A 4WYWA 3QGGA 1EQ0A 2DHGA 1X4AA 4GVBA 2BE9B 4DX5A 3NXZA 4PZVA 3EZUA 2MXYA 3UD4P 1S0NA 3NCRA 1LW0B 2V8GA 1VLYA 5B0CA 2FGOA 3G87A 2D69A 3MMBB 1QTMA 3G82A 5CZVA 4LFAF 3UDEA 4DU8A 4ZPBA 3CMQA 3W61A 1NZ8A 2MZJA 2ZH5A 5IQ6A 1U45A 4RW8A 1Z2ZA 2QSFA 3KJFB 1EJ7L 4NMLA 1TVRB 3LPEA 4GVLA 3DHXA 2CVEA 4DR4F 1KEKA 4XPCA 1U48A 4NWBA 2D9PA 1TR0A 2AP6A 1ZM9A 5FJ4A 3BGRB 3MMAB 1HNIA 4FS1A 2BE2A 4YOEA 4QYZJ 3MEGB 2KZZA 3IWNC 5AXLA 3OFHA 3DOMB 3CT9A 4TLQA 1UWAA 1U7LA 3K5MA 4N41A 4QW8A 4DSEA 4OZLA 5A8WA 1WDDA 4WP3A 4WFZA 5DLGA 4HH1A 3ELHA 4YB5A 1VQMS 4RJVA 1JJ4A 3CD6S 3WBZA 2IJNA 2AIRB 2K7KA 2UVVA 1PIEA 3OTOJ 3JTNA 4GKKJ 2HHXA 2AGQA 2OPQA 3PYDA 4ECVA 2EI5A 2HGLA 3ETMA 4CH1A 1IUJA 1N5SA 1F9FA 3H40A 1R3NA 3HSJA 3WIVA 2DNQA 4A8WA 2AKWB 2JZ5A 3KLHB 1VIOA 4UW2A 4PWDB 4U7UD 5J2PA 2JDJA 4NA3A 2YTCA 1UMJA 4DR7J 5BR8F 1KVJA 3MHYA 5I3QA 3D0HE 3GU0A 2KL8A 1L3KA 2AF6A 2G2ZA 4K4TA 2K7JA 2HNYB 2OPPB 2IIHA 2K8GA 3ZTQA 4YMEA 6FDRA 4DG1B 3FRZA 4H4KA 4OI3A 5DG9A 2VODA 3K5PA 3IC1A 4O3RA 3T5JA 4X66J 4OYAA 2YWGA 2D3OR 2Y1LB 3C8YA 1RWNB 2ZM6J 2W9BB 3RW6A 1QSSA 3NGUA 4CT9A 3CC2S 4HT5A 3GFHA 2LQBA 4F25A 3FCWA 4U67Q 3IWXA 3WX8A 2FHKA 4DFJA 1Y3KA 1CJTA 3KUHA 1VJWA 2WAQD 4AL7A 3EPGA 2VFTA 3MXHP 4ZIWA 1UW9A 3G4SS 4F4AA 3MI7X 4WCEQ 2V8DA 5GMKa 4OYXA 2QMXA 1DRZA 4BDPA 4DQPA 2JEIA 4W92B 2CJ9A 2ZE2A 3QYYA 2Q1LA 1N5TA 3DOKB 2QT7A 3HHNB 2RF2B 5EN1A 2V9KA 5KG7A 4O3SA 3VAKA 2M7SA 1NDCA 1RT7A 2CFXA 3MPVA 1YJVA 2OPSA 4I7FA 1D1UA 1F1BB 3RAXA 4MH8A 1VBZA 2CZVC 1KC8T 3G8QA 4S0MA 2VFUA 5CH7B 4UOHA 3AD9C 4NI2B 4CO5A 4EZ9A 1KONA 2EXUA 4UY85 1S48A 2LEPA 4FVCA 3CJKA 2F1FA 1B7YB 2XLKA 4L3NA 2I5JA 2IAJB 3IAS9 3SFGA 3ZZUA 2AW0A 4WXOA 3TUIC 1KQSR 3UDVA 3M6WA 3MM9B 3W2VB 3BKFA 4J91A 5HVFA 2GAGC 2B5JB 3M8PB 3IN5A 4QR2A 3OD2A 4JI1J 2UV8A 4KIAA 3OVBA 1NSAA 2LA4A 5HROB 2LP4A 3NAIA 3L3CA 4MK8A 4EBDA 3DXBA 3BS9A 4WKRA 1LXJA 4QU7A 3UNYA 4QIEA 2HVDA 4E2FB 3T5HA 1CULB 2V68A 2XCAA 2EWHA 3F73A 3BYRA 1RTZA 2VFVA 4RW6B 2Y0SD 2X7IA 2VC0A 2HURA 4HHUA 3R7BB 3KLIA 3FVYA 4ZLPA 2VU5A 2UUWA 4HTJA 2DNPA 3DLGB 1Q4RA 4D3HA 2Z2YB 5D77A 2D41A 1QDUB 2UUAJ 3FZBA 3ZTRA 1O51A 3CJTA 2WB4A 2MKKA 3MCSA 2DNYA 1SI9A 3NGKA 1IBLF 2G0IA 2HVHA 2OFGX 2FB0A 4KSEB 4LF4J 1RAEB 5M2UA 3C16A 1BY9A 1TL3A 3FNNA 3IR7B 3G6YA 5KG5A 2OJ3A 1JWWA 2AQ4A 2E5LF 4K7QA 4KGZB 3T1HJ 2C2EA 1UTAA 5CYJA 4DQRA 4KPCA 1MMLA 4ALZA 1T7PA 4HACB 4JI8J 2I1RA 2YPZA 1SUQA 3JSMB 4O23A 3IM9A 4KO0B 1Y9OA 4DV1J 4WE1A 3SSSA 1RTDB 2BQRA 1FTRA 2ZBCA 3MR7A 5EDWA 2WZ1A 5C2CA 3LWLA 1RQ0A 1N0UA 4OV6A 5KFVA 3GTYX 4I2PA 4OZ1A 2ZKTA 1RSCA 4K4ZA 3P96A 2M52A 4NX9A 3OR1B 4H4OB 2H5IB 1BGXT 1EQMA 4OZ5A 4A8OA 4DV2F 1FRIA 1M5HA 1WOPA 4DDFA 5I42B 5DETA 3PW4A 4X64J 3SZ2A 4DSIA 2G0JA 4HI1A 4NXMF 4YEAA 1RT1A 1D3WA 2W9CB 4B9TA 5KFYA 2C2OB 3H2LA 3HFKA 3QLHB 4EUVA 2PT0A 1QM9A 3LP1B 1HD0A 4DZDA 2LEBA 1B64A 4LF7J 4WZQA 4IG0B 4FVMA 3HP6A 1YVFA 2EFPA 5K8MA 2CPXA 2Q79A 1H3DA 3HT3A 4QYZK 4DN9A 1VQNS 1KN6A 2OHDA 3MEEB 5HJYA 1HWJA 3UFCX 4P2MA 4LFBF 3BGOP 4YFUA 2E1MC 4USMA 5D4NA 2YNFB 4MFBB 1IKYA 4AYBD 5A6PA 1JKHA 3SMZA 4ENOA 3D68A 2A1BA 4X4TA 2MQOA 2H5JB 1C4CA 2V8HA 5HVGA 4WF9Q 2A3JA 3O6QA 2DR7A 3I31A 2H1YA 1FFGB 3GILA 4NLPA 3PHTA 2KB2A 2ASDA 2ZUGA 1VGYA 1IJFB 1VQ6S 3PR4A 1E6VA 5GMEA 1TAQA 3O8WA 1JLEA 1U1LA 2QZ8A 4PG5A 4FBUA 2O66A 3POTB 2UXCJ 1DHMA 4OHXA 2OSQA 4DLGA 1QJHA 2G9OA 3B8HA 3ZZOA 3VVUA 3VVTA 4IO1A 4ZVOB 3QT6A 1I94J 4YS2A 1OQ6A 1RT6A 1UZHA 1NK7A 3DRYA 3KLGB 3CUNA 4GRSA 1JNRB 3CJ8A 3P49B 2HRYA 1F3VA 3HHLC 1M0SA 4CIOA 4QJVA 1RUSA 4BHQA 1S1TB 3TP2A 1X0FA 2DNLA 2DPIA 4F04B 1SH3A 2J9DA 4X2BA 1Q5YA 2WK4A 4NCGB 3TWZA 4KHPF 2VJVA 1V9OA 1FNMA 3HULA 4DR7F 2WW8A 4F3QA 4OHWA 3S6EA 5D4PA 1D9FA 4CLFA 1SJRA 1D9DA 2EFNA 3I0SB 5IM0B 2YNHA 4GC7A 2HQGA 3RYLA 2W7PA 2H4YB 3UVJA 3DM2A 3B6BA 3N5BA 3SCJE 2E9ZA 2DH9A 2QL5B 1LW2A 2YX1A 1B0PA 4NLGA 2DVIA 4J9UE 4O3QA 4C97A 4UTGA 5JMNA 1FKPB 4FZVA 1VOMA 3BDEA 3R7NB 2N4CA 3BQ1A 1Q8KA 4XDCA 3PRDA 1NCLA 3V81A 1Q7YT 4QWAA 3DRRA 2CQ0A 3MM8B 5KOWA 3NNHA 4FNHA 3VV2B 1SPBP 2J5AA 4FF2A 3NNAA 1GXTA 1RHUB 3KG1A 3SDEA 3FBEA 1YJRA 1YQHA 3A4TA 1WDTA 4C8YA 2YKOA 4DN0A 5JVGQ 4ZVRB 5J1EA 1S1WA 4OX7A 4QW9A 1SH0A 4KB7A 4KQZA 1LWCB 1ZM4A 2FY8A 3L09A 4IRCA 4DPYA 4AFFA 3QFWA 1YGYA 2IDLA 5CCMA 3T41A 3LGHA 4Y6IA 3I6PA 2B6AA 2E7WA 3R2CJ 2PA8D 1JXVA 2DKOB 3MUVP 2KH9A 3J81j 2HFUA 3JAMY 2MLYA 1PC5A 1SC4B 3VQTA 4HVZA 2HPUA 5F8JA 3PACA 1Q0NA 1RLCL 3WDOA 1ZAWA 3GJTB 4I6AA 1R0BG 1VK3A 5IOLA 4B3MF 2VPWB 1RCOB 1FJGJ 4ANDA 3M7VA 1OWXA 2NYIA 3M2RA 2GFFA 5E3AA 4LF9J 1SXLA 1FE0A 4FF1A 4DUZJ 3TX8A 1HPZB 3ZTSA 1N33J 2CQ2A 4Q8FA 4LRCA 4PG7A 3QAEA 1YJUA 2B7BB 1Y4ZB 2QSWA 4WJBA 2DBBA 4OLPA 4AD6A 3IS9A 3I9V9 1Y7PA 2R7XA 1R27B 2GV1A 1F9HA 2CJKA 4UZCA 4LT6A 3LO3A 2VASA 2ZJQQ 1UCNA 3AAWB 1Y10A 4DQSA 2VG7B 2UU9J 1UP1A 4F3MA 1RZMA 5J2NA 2XGQA 4DQQA 3MAHA 4ED5A 1T9UA 4RW9A 4DMZA 5D3GB 2FD2A 5E5NA 3OFGA 4A8KA 3PO4A 2YH1A 3AB2B 2C42A 1C0TA 4IG3A 5A8KB 5K8PA 2FTRA 4KR0B 3DU5A 3HSZA 5ETLA 5HMYA 1QAYA 1IBMJ 3MM6A 4J9SA 2OEKA 1N34F 3OFEA 4F0KA 1H38A 3NKYA 1S9GB 2CPIA 4OJHA 2R2SA 3PJWA 2FQQB 4F2SA 5C42A 1X0PA 5LJ5Y 2YPYA 5E2QA 2NXCA 1G6BA 4JV0A 3CIMA 4OFZA 2HAFA 4DPXA 2JNJA 2ILZA 1VYAA 1RBAA 1WC5A 1VRUB 2WOMB 2XMTA 4QIWD 2DJWA 2VKRA 3OHAA 2B9EA 1XJWB 2KHDA 4DPTA 3WX4A 1YRUA 3C66A 2HQ3A 3NAHA 4ZOSA 2V2VA 3GR0A 1N6QB 2A2DA 2E1RA 2I38A 1S1VA 4HL9A 2F8MA 3LPYA 1REVA 4PG8A 2FPHX 2XULA 2YWHA 2CNNB 2Q66A 2J0SD 3KLEB 3J7AN 1I51B 1N54B 2Z2ZA 2XSJB 3R6GB 3VAIA 3VAMA 1YBAA 3K8VA 2AHOB 3K59A 1KR4A 2LU1A 2KXNB 3BYPA 4NLXA 3TEHB 3DU6A 2OUGA 4DUYF 4C48A 2E5JA 5J2MB 1JLBA 4DOZA 4URQU 2RNEA 5FDLB 4YR0A 1BD6A 2IVFB 4B08A 3DOMA 3MF5A 5IXUA 3Q89A 4I69A 1U09A 2VJUA 1UVLA 2EW9A 3D3CJ 3T5KA 3X1LB 1TFWA 4RKUC 2ADCA 1XERA 3VAGA 3KHRA 3JXOA 2F65A 4XO0A 3C15B 3MOJB 3I0RA 3CCVS 3VTIA 1A7GE 2WVBA 2BVZA 1LKZA 3QZ7A 5HMWA 4ZDNA 2MQPA 4G1QB 5DM6Q 4ITSA 4EWTA 3M4XA 3NGSA 1NSPA 1X31C 2DR9A 3IMQJ 1KOHA 1Z4UA 4WKYA 2LKZA 3AQOA 1SJ4P 1OSDA 3RU0A 1QUVA 3KDOA 3EZ5A 2VIHA 1DY3A 3UD5A 3TARA 3NBPA 4RW7A 1XEZA 1YJWS 5D78A 2HS0A 1KBRA 1WWHA 1M5SA 3BGFA 4WP8A 2Y8YA 4N76A 3D6HB 5B0AA
chains in the Genus database with same CATH topology
2M5YA 4ICLA 3OL7A 1I94F 5KFEA 2MKCA 4DF8A 4B3OB 2RQKA 2QA2A 3PFEA 4NCGA 3NCPA 1RT5B 3QPIA 4PCQA 2XGPA 1NJZA 3GIMA 4RBUA 3CD5A 1FJCA 1FKOA 2KJVA 3MTKA 2P6SA 3R5BA 1ZOTA 4OHYA 4ID5B 1HI0P 4ED1A 2GMLA 2MKIA 1LOUA 5GADU 1UVJA 4WK3A 3V6DA 3RB3A 1VQ8S 3CCQS 3AQPA 3HX9A 1HHTP 1C0UA 1R8HA 2Y1IA 3GV8B 5J2PB 3O44A 4DG1A 4HH0A 1DLOB 2KT2A 4XK8C 3I4PA 3I0SA 1KLMA 5F3TA 3G86A 2EVZA 1X9SA 2HHTA 3MURP 1K8AT 4I0WA 1TKXB 3HDSA 2HLUA 5T14A 2J7UA 3DRSA 2HS4A 3BR9A 3ITHB 3Q24A 1BQXA 3T5LA 3M8QB 4E0DA 2HGNA 4EFAC 1H2TZ 4ELVA 1WI6A 4C0OC 1GQEA 1DQ8A 1RT2A 3RW7A 3FSYA 5KFBA 2CZ4A 4M95A 1UJ5A 1R0AA 5B7WA 1X4HA 2R7TA 2HMIA 2HG4A 4RX6A 4ED8A 2KN4A 2XMVA 2CQ3A 2GO9A 2J9DE 2PMZD 1ZZNA 2ERRA 3GV5B 2PC6A 1YG0A 1FKPA 3VCDA 3EYZA 2QA4G 1VC5A 4X66F 1WEXA 5DDQC 2J0QD 3MMCA 3M32A 4PWUA 2XY7A 2ZM6F 2YNHB 2IJFA 1GXLA 5AXNA 1FHTA 2YKQA 4NOHA 1AW0A 2PFFB 3RB4A 3KLFB 2RILA 3R27A 4O4GA 3A1YG 4DSLA 2G1DA 4ZP7A 4IFVB 4ZVEA 2MJUA 3X3UA 2VFSA 5DDRC 4ECRA 4LQ3A 2GIRA 5DQIA 5KFOA 1Q8BA 1F0XA 2PN6A 4KTQA 1QAIA 2KU7A 4R5PB 1NK8A 2GGPB 4X65F 3M8RA 3CC4S 2DISA 2R4FA 3MM7B 3KG0A 5KFWA 5E33A 3TNVA 5KTQA 4LIWA 1HWLA 3DDNA 5KFUA 3TVKA 2J9CA 3M6UA 1IM4A 3CO9A 4FPRA 1ZAXA 5E41A 5I3UB 1HBUA 5KFMA 3MTJA 1GTHA 2B9YA 2X3GA 4WU2A 2RUGA 2RF2A 1OSCA 4FP9A 2ZZMA 1NK0A 1MNEA 2CPFA 3SEOA 1T02A 4KFBB 1MU2B 1S99A 2X1FA 2HAIA 4TNOA 2WHOA 4KHRA 1WG1A 1Q8IA 1DJ0A 2CKWA 3KMSA 5GAEU 3I5AA 3CJ0A 3MFHA 2YWKA 3F44A 1NK5A 5AE2A 4KV8A 3GIKA 3D0GE 2GHPA 2QLXA 1LWFA 4Q5VA 2UVUA 3EPIA 1OPZA 3MDFA 1VRTB 1YTYA 5LXYA 3J7YI 1RP5A 4M5DB 1IJEB 4LSLA 3UCZP 1UJ4A 4K4SA 4ELUA 3SCIE 5KG4A 4RNHA 4NLRA 2D74B 2BBEA 2EBGA 1VQYA 2C2DA 1SL1A 4LF5F 4ECTA 1JLGA 1WHWA 1X4DA 2JJ4D 1Q82T 2RS2A 3SDEB 3BF4A 2B9WA 4M94A 5IT4A 2IM3A 2VG5A 3K8WA 3Q8PB 1I6JA 1WF0A 3L95X 2MDAA 4DWIA 2AGOA 3N9UC 2KZMA 1RT7B 1RWUA 3HMJG 4C98A 4E8UA 3G96A 2V8VA 2V4RA 2HWIA 5KFRA 4I7FB 4IH6A 5KFHA 4B3TF 2FLNA 1XR5A 1QAJA 1TAUA 3BN7A 3KK1B 1FK9B 1TKTA 2XI2A 2Z0GA 4EYHB 5JUMA 5GAHU 1HQUB 1RTHB 5FD1A 3GV7B 4RZRA 1ZZFA 4G1IA 4ZPTR 2KT5A 1R8CA 1RTJB 1U1PA 4I2QB 1U47A 5EX3A 3NMRA 3OW2R 2J6UA 2KFNA 2VA2A 4F26A 4RNOA 1HI8A 4EBEA 4PG6A 4MIBA 3I96A 1X8DA 4N5SA 2ZH1A 3MM5B 1P9QC 1NRKA 4JYAF 4OZJA 5M2RA 4NYOA 5U47A 5CXTA 3RR7A 2HHPA 3DN9A 5AJ3F 4A8MP 2M3DA 3PX6A 4ECSA 3PVXA 2BM0A 4ZMMA 2K3KA 5F8NA 3M8PA 5CYQB 2NZ4A 3CJKB 2DGOA 1JLQB 5A2QY 3AJ1A 3US5A 4N8NA 4ILLA 4MIWA 2I5JB 2ZNZA 2E5GA 1J5EF 2XMUA 3FEXB 4KE5A 1X4CA 1YIJS 4I67A 1ZM2A 2ABYA 1TK0A 1FDDA 3OTEA 4ECXA 3PNIA 3QMQA 4B9SA 1RDRA 2HGMA 3K5OA 4MMOA 4DV3F 2E9TA 2H9ZA 3I87A 1AXQA 4QZVB 2Q3PA 1MMDA 3AJ2A 4OHZA 3CCWA 1TL1A 3DLKB 3HVTA 1S9EB 3FFIB 2R7SA 1BQMA 2HWTA 5C5JA 3N01A 4Q43A 2KTQA 2VV5A 3ISND 1XWLA 2K3IA 4JI1F 2D3UA 4J9KA 2FJXA 3UW1A 1YJ9S 5DDOC 4TN2A 1VK8A 3G8TA 3K57A 1N5QA 4DL7A 5CQGA 2C22A 2VC1A 4YDDB 2EKYA 3BSNA 4ZPVR 4ELTA 2KDOA 3HHLB 3KLVA 2KJWA 1SJQA 3CVKA 2Q43A 3CJ4A 4RW4B 1CPZA 2DRBA 1S0VA 3F41A 3FEZA 1TQLA 3SSQA 2XCPA 3B82A 2WONA 4LUBA 3CD0A 5G0RA 3U1LA 1NJYA 2M9KA 3HVWA 5F8HA 4DS4A 4NYZA 3DLGA 4RWXA 4LF9F 2BM1A 4BWJA 2M4MA 2GO8A 3E2EA 4P6QA 3GQCA 4OI2A 1Q78A 4FS2A 3C6UB 1LV5A 3TOQA 4C3KA 1VMBA 4ZVHA 4QYRA 4IRKA 3OLBA 4X4NA 3MWBA 3M2RB 2W9AA 2IHR1 4ZK7M 4C11B 5L1JA 3PW7A 4P7TA 5BYSA 1N33F 1DARA 1JK9B 1FDBA 2I8EA 3DC2A 4B9MA 3GSDA 4A8FA 3HKWA 4N8OA 2ZVSA 4C8KA 1JJ2R 2C3UA 1M5KC 1TKDA 2P9GA 1Q81T 5F8MA 1DTQA 2CVIA 3PW0A 4ZP6A 1S76D 2WB1D 5F3ZA 6FD1A 1LK5A 2MZSA 1NEEA 3BJYA 2VG7A 1VQKS 2IM0A 3W7BA 2UP1A 3KLIB 3LP2A 2DNZA 2CQPA 5KFJA 2FVQA 3QWUA 3CCZA 4WFNQ 4X4SA 3RRGA 1UKUA 4KPYA 1GH8A 1FRJA 2O3DA 1MW7A 2BJEA 1S6PA 2EK6A 2YNIA 3GYXB 1U2FA 2UUAF 1KQKA 3BO4A 4LF6F 5J1NA 4HDHA 2OFHX 2BW2A 2ZH7A 4F02A 1FKAF 2SXLA 3GG0A 3IS9B 4TY9A 1RJJA 1FRMA 3ZZZA 2HHWA 3CXCR 3NP5A 3WC0A 3M2VB 4CO0A 5LSRA 4AL6A 5D3GA 2E9RX 5IT0A 2R8JA 4CTAA 1IKXB 2WBMA 4YB7A 1C1BA 1RAJA 3PRBA 4E98A 2ZFHA 1IQTA 2PMHA 1E6YA 4TQRA 1VQ5S 2MJNA 4KHMA 1U1NA 2VG6B 4NCAA 3FSXA 4LF4F 3KK2A 1MSWD 2LYVA 3CDAA 2F8EX 1QAXA 4CO1A 1FTCA 2YVSA 1GX6A 3OQ2A 3DI6B 5CD4H 5GAGU 5A8KA 1XNQF 2AWZA 3SCLE 2DIUA 2FHMA 2IBKA 1NH7A 3RZAA 4FYDA 1Q79A 3J7Z5 5KFAA 1KVIA 4B3SF 5D4OA 2YKNA 4DV0F 4HYKA 2I9SA 5C24A 2RKIB 1R8PA 3IG1B 4WU3A 3HPOA 2G4BA 5LSLA 3ETOA 4EYIB 4MTPA 1OPIA 3T1HF 3CGIA 3HZEA 3CCSS 3J7ZT 2O01C 2GX8A 2LA6A 2ZDOA 1U24A 2CJBA 2IFXA 4PQUA 1WI8A 4CT8A 4RLEA 4WFXA 2E5IA 2H5EA 3MUMP 3PW5A 1ZH5A 1HBOB 1U25A 3JSRA 1S9GA 3R1LA 4JI8F 2DO0A 1MROA 4ZP9A 4OX8A 1QSYA 2LEAA 2IMWP 1ZTTA 1LQ9A 4K4XA 1QVFR 2DNKA 3FJ2A 2GA7A 3DHWC 4C3MA 5KFGA 2UUBF 3IRXB 4LSNA 4QIGA 3C6TB 2VPYB 1S10A 4GC6A 4ES2A 2JEFA 1HBMB 1W25A 4DV1F 3T9ZA 5DGAA 2GIQA 2IYIA 3HF5A 1D9AA 2AYGA 3UDCA 4L72B 4JV2A 5I3PA 2Q6BA 2RB7A 4PRFA 1F60B 2AJFE 1UEUA 4PXBA 5E3PA 2MGZB 5DM7Q 2UVRA 1W2IA 4USJC 1TV6B 2NSCA 5L38A 1IKWA 3BR8A 4ZHRA 3OVAA 2OMOA 5HMZA 4A8YA 3KJVA 2WOMA 3JSYA 3M05A 1JXLA 1RT3B 3MM6B 4FNIA 2MZQA 1ZPWX 2PE8A 1JMTA 3HKZD 1Q1KA 5F8GA 2VBWA 1P8GA 2MY7A 3BSAA 2EG1A 3PXGa 2RQ4A 1GAOA 2AYEA 1M1KT 1VI7A 2FJAB 2R7WA 3GFXA 3IWLA 4OQJA 1GXUA 3AA9A 1R8AA 2KYXA 1WEYA 2NPFA 2JLEA 4NPOA 4AXJA 1RTIA 4CO2A 2B0GA 3PFOA 2XBPA 3KOAA 1JLCA 2FVCA 4WTYA 1N6QA 4ERDA 4I2PB 1Z2LA 2W9CA 2LLZA 2VL1A 4IUFA 1Q8LA 3JTPA 2DIVA 4IFYA 2HHVA 1QSLA 2RQMA 2B4OA 2JX2A 4Q45A 3JYTB 3H20A 5HMXA 4L6V3 3D54A 3GR1A 2QIFA 2Z2LA 1UWBB 2NUHA 5A6WA 2Y1RI 4X64F 4R8UB 4IOAQ 3Q8QB 3QJJA 1HL6A 1M5VC 2FJDB 3N0VA 3PO5A 4WYWA 1MWYA 3QGGA 3OR2A 2DHGA 1X4AA 4Y2CA 3U27A 1CC8A 3DRPA 3W2WA 2KM8B 1U26A 5KFQA 4NZ7A 2DITA 2QEXS 4OJ1A 2FVSA 3EZUA 2MXYA 3MUTP 3UD4P 2YWFA 1KTQA 3NCRA 1S0NA 3R1HA 1L3VA 1LW0B 2V8GA 2ADBA 4FF4A 5KFXA 2J8AA 1TK8A 1EP4A 2LDIA 4H4KC 3TVYA 4KBIA 1FXRA 1N5VA 1VLYA 2LQ9A 5B0CA 2BQ3A 1N5YA 2BOPA 4ED7A 2DHXA 3SQGA 3J80Y 2FGOA 4EZ6A 3NMAA 3MMBB 2FHOB 1QTMA 3M1VB 1TL4A 1NAQA 5CZVA 4LFAF 4LF7F 5IFMA 1RISA 2YWEA 2L9DA 4ZPBA 2X51A 4DBQA 4K4WA 4Q0BA 2KG1A 3GFZA 2A18A 5J2MA 1HQEB 4MK9A 4O3OA 4NL5A 3JB9k 4G3IA 4LVOP 4USIA 2MZJA 2ZH5A 2JSXA 4ZS6A 5IQ6A 2XS5A 1UEVA 3AA8A 1U45A 1FCAA 4RW8A 1CC7A 2K1RA 4MYTA 1Z2ZA 4QPTA 2QSFA 2GMHA 4MFBA 5HLFA 3HK2A 1JB0C 4FXDA 3E01A 3CMES 4KAIA 4NMLA 2R7UA 2FDNA 3IGVA 4DSFA 3CWJA 3K7RA 4Y2MA 1TVRB 1O8BA 3DHXA 2HNZB 1T03A 2MMYA 2RMLA 3IGNA 3LP0A 2LQ5A 3UE2A 2CVEA 4DR4F 1LFWA 1KEKA 3U02A 3SSRA 4NLYA 1P1TA 3UPFA 4CO4A 4XPCA 2VKZG 1U48A 4Q44A 3RAMA 1HYSA 3PEJA 4NWBA 4OZNA 2D9PA 4AQYF 1TR0A 1WF2A 1X5TA 2AP6A 3M2UA 1KHVA 3TW0A 2KFYA 2DRAA 1ZM9A 4C8MA 3BGRB 5FJ4A 3MMAB 3RTVA 1HNIA 4FS1A 1FEEA 2BE2A 4YOEA 1S7HA 1Z1ZA 4QYZJ 3MEGB 2JVOA 2KZZA 4I4BA 3IWNC 3IR6B 5GADI 5AXLA 2HRUA 2E1AA 3OFHA 2ZOGA 4QOTA 3CT9A 4TLQA 3LAKA 4G1QA 1RYSA 1U7LA 3K5MA 4N41A 4GKJF 4QW8A 4DSEA 1TL5A 3MPYA 4Y34A 3D1OA 3T9NA 1HR0F 4M1KA 4OZLA 5A8WA 2EFQA 3TAMB 4WFZA 5DLGA 3R5AA 4HH1A 1FEHA 1XK8A 4NLVA 4YB5A 5AE1A 3S7RA 1VQMS 4ECUA 1KTVA 3TVZA 3QJLA 4IO9Q 5CYMB 1JJ4A 2JLFA 3WBZA 3CD6S 3OXGA 1SL2A 2IJNA 3M8SA 3GIIA 4PUOA 3D28A 1MMNA 1SIWB 2K7KA 2ZHAA 4IOCQ 2UVVA 4W90B 2HFZA 2XHWA 2MQNA 4K59A 3KHGA 4X62F 1FXDA 4KKOB 4DV5F 1E6VB 2U1AA 5HP1B 1CVJA 3JTNA 2HHXA 2AGQA 1TK5A 2OPQA