3K7RA

Crystal structure of [tm][cuatx1]3
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
70
structure length
70
Chain Sequence
EIKHYQFNVVMTCSGCSGAVNKVLTKLEPDVSKIDISLEKQLVDVYTTLPYDFILEKIKKTGKEVRSGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metal homeostasis factor ATX1
publication title Tetrathiomolybdate inhibits copper trafficking proteins through metal cluster formation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 19
structure length 70
sequence length 70
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2009-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3k7rA00
2QLWA 2RSQA 2BJDA 1P8GA 3KNGA 1KVJA 3IWLA 3F44A 4EFAC 1OQ6A 2EW9A 3HDSA 3E8OA 2GCFA 3I9ZA 1JWWA 4Q2LA 1P6TA 2VV5A 1U7LA 1KQKA 2FB0A 2K1RA 2ASYA 2KYZA 4OIXA 3VTIA 2XMMA 3BM7A 2OD4A 5B09A 2W4DA 1AFIA 1TZ0A 2RILA 4A47A 2Q3PA 1OQ3A 2HFOA 4OJ1A 1QUPA 4A4JA 2XMJA 1Y3JA 2OKQA 5B0CA 1Y3KA 4A46A 2XMVA 4NPOA 1Y9OA 3TRGA 1K0VA 3HHLA 1TL4A 5B0AA 1Q53A 1RJJA 1Q4RA 3QMQA 4ZOSA 1GXUA 3HX9A 1FVSA 4HH1A 1V3ZA 1VQYA 1URRA 3WDOA 2GV1A 1CC7A 3HFKA 2OAUA 2GO8A 5B0EA 5T7LB 3T9NA 5B0BA 1X7VA 2BUNA 1Y0HA 3HHLC 4DL0C 2RMLA 1FEEA 1TR0A 2OD6A 4HI1A 5K9FA 3CJKA 1S6OA 2HFNA 3KG0A 3BR8A 2HIQA 3BN7A 3QGPA 3FGVA 5KAKA 1YJUA 1N5QA 2LXFA 4OJ3A 3MZIA 1WD6A 1APSA 4Y2MA 2ROGA 1FE0A 2CRLA 2BYCA 2AJ1A 2ROPA 3LGNA 4Q2MA 4YDXA 2OFHX 1W2IA 2QLXA 3MCSA 4F67A 2K7KA 2IFXA 1SQEA 1CC8A 1MWZA 1YJRA 4NL5A 4U9RA 1N5VA 1MWYA 1TUVA 2KT3A 2PD1A 1YJTA 2IYIA 4HI2A 1VQSA 2XMUA 3TOQA 2N4DA 2OP5A 2AJ0A 2KKHA 5B0DA 2HLUA 2AP6A 4OJHA 4Y2IA 4DPOA 1FESA 2W4CA 3FMBA 1X0PA 1X8DA 2LQBA 2XMKA 1OPZA 3BGUA 2KT2A 4FNHA 5A6PA 2GGPB 3K7RA 1Q8LA 2AW0A 2FTRA 3BF4A 5B0FA 4Y2KA 1FE4A 2GA7A 2ZDPA 2HLTA 2K2PA 5A6WA 1AW0A 3KG1A 2N4CA 2XMWA 4OJGA 1FVQA 2K1RB 2VH7A 5T7LA 1KVIA 3BB5A 2G9OA 2QYCA 1OSDA 2LDIA 5B08A 2ROEA 2GFFA 2XMTA 4HH0A 2ACYA 2OFGX 3FRYA 2BJEA 4ZA1A 4HL9A 3TNVA 3UDCA 3IWXA 1N5TA 1SI9A 2GGPA 2W4PA 1JK9B 1AFJA 1R6YA 2QIFA 3KKFA 1ULRA 3GZ7A 4A48A 2LQ9A 1Q8BA 2L3MA 4QOTA 1S6UA 2OMOA 2IYGA 1YJVA 1IUJA 1YG0A 3HHLB 1CPZA 2BBEA 1SB6A 2RU9A 2K7JA 3BDEA 2N7YA 3LO3A 2PGCA 5F0UA 2FIUA 2ZDOA 3HHLD 3LGMA 5IXUA 1YRXA 1N5SA 2JDJA 2HQIA 4DN9A 5B0GA 2FHMA 1FD8A 1GXTA 4YEAA 1LQ9A 3CJKB 3DCAA 3HF5A 4FNIA 1XBWA 5F0WA 1TL5A 3DXSX
chains in the Genus database with same CATH superfamily
3N0VA 1AA1B 3ZZUA 3U7JA 5DLGA 1JX4A 4GKKJ 1HBNB 1EP4A 3LWLA 1TMJA 4ANEA 4OJ1A 5J1EA 1X5OA 1RA7A 2UUTA 2Y9HA 2PC6A 5HVFA 3T19A 3HLUA 2V9WA 3UD5A 4I4BA 3CXCR 5BXIA 3C19A 1IBKJ 4MKAA 4QIVA 4DDFA 1IJFB 4YDXA 5KG2A 3THTA 1HI1A 3N6MA 3PEHA 3EMTA 3GB0A 1UEUA 3WZ0A 4FYDA 2LU2A 3AA8A 2XY7A 3ELHA 2HLTA 2CQGA 1Q79A 1OSDA 4P9SA 4FZVA 2N7CA 3DLBA 3MD1A 4C0BA 4Y00A 3LQVA 1HWJA 4EGLA 4ZVHA 2QT7A 1N36J 4TY8B 4NA2A 5K8PA 2FIUA 7FD1A 1Y7PA 4NE9C 3LH2S 1J5OA 4ZP6A 3Q23A 3TQ1A 3FBBA 4USJC 2WSFC 2B8PA 3VVTA 5IWAF 3OTDA 3KLHB 3D5MA 2JFKA 3RBXA 3S7RA 4IQMA 5K8MA 3MCOA 2GHWA 5LMNJ 2ZJRQ 4DCPB 1RHJB 3JTNA 2GV1A 1FI4A 1KP6A 1FEEA 3BS9A 3K2YA 2EFNA 1WG5A 2CQ0A 5KAKA 5KFVA 3B82A 1RI7A 5F9NA 4EU0A 2R7SA 4K4UA 3ZNUA 2KT3A 3PTWA 1H38A 2IRUA 3KJFB 4WYLA 2APOA 2U1AA 1NSQA 1FE4A 2H5IB 3FBCA 4ZVPB 4C3KA 2PFFB 2MJNA 2A6OA 4DR3F 4ECSA 1T05A 3W2VB 2MKCA 2CQBA 4B08A 2YKAA 1S6UA 1RWPB 4Q8FA 1PBAA 1NHKL 2K3KA 1X4HA 1DTQB 4GVBB 2IDLA 1L3TA 3K58A 3G4SS 4FYWB 1CULA 1WKKA 1M5PC 3AT1B 4K0KF 1IR2A 4ILMA 5KTQA 3E51A 3Q2TC 1H72C 3G2XA 4V1Ak 2R9LA 1Q1KA 2DJWA 1S1XB 5H1SV 4UOFA 2D9PA 3ITHB 5ETVA 1F5CA 4XTTA 3OHBA 3D7SB 5DDQC 4QWCA 1RXOB 2C22A 1BWVA 1SL2A 5H9EK 4JI3F 4DR7J 4ZVOB 2R2SA 5LT5A 4H4MB 1H73A 4NASA 2CWKA 1REVB 1NXIA 3NCRA 4KGZB 5T7LA 4NLTA 2R7WA 2OSRA 5H9FK 4PWDA 2D74B 3CJRA 4P6QA 3KJVA 1PCAA 2MQOA 1S7IA 5A76A 1WSRA 3EVMA 3PW7A 4TVAB 2RT3A 5HBMA 4PQUB 1SH3A 3R3TA 3TARA 1B0TA 3HT0A 1X31C 2B4UA 3E01B 2RILA 4AL7A 5FLXU 3D2WA 2BA9A 3RAMA 1P27B 2DYAA 4R5PB 4CLPA 1R27B 2Y1LB 1QDUB 4BLGA 3OFEA 1S4FA 1N5QA 1VK3A 1PJ7A 4OFZA 1IM6A 1RTIA 4B3RF 4DFMA 2J9EA 3SQOP 4ZHRB 2MGZB 1AZSB 2MYFA 1VQSA 4Y0FA 2MZSA 4YFUA 2CJAA 1LKZA 2CJBA 1RAAB 4X65F 3QGHA 1X60A 3OTBA 2EFPA 1SC3B 1T7PA 1S6PA 2HQDA 2WRMA 5L9NA 1TK5A 3DI6B 2FVSA 4OZNA 4RLEA 4C48A 2IBOA 1R6YA 2OEMA 4NRTA 4IOCQ 5C25A 4B9LA 1HPZA 2N7YA 3DLGB 3TVKA 4BHQA 4GKJJ 1GQEA 2HHUA 3BZQA 3E8OA 2DNMA 2VD3A 1N33J 4FXVA 1HR0F 2RF2B 1G1XA 3PV8A 1SUQB 4MK7A 1TKTA 1B4SA 4ECRA 2W01A 3MEDB 1LOUA 4J9MA 1HNWJ 1D3WA 1P1TA 2XBPA 5LM7E 2VQFF 1NDKA 1JXEA 4PG8A 3DN9A 1QLNA 4F4XA 3GV5B 1NSAA 3OXLA 2R4FA 3KG0A 3CJ5A 1Z2LA 4M5JA 4QJVA 3FVYA 4Q2MA 4DX7A 5DETA 2HVIA 5LMUF 1RAIB 3TVYA 1ZM4A 3NAHA 4IH7A 1RT2B 3QJJA 4IFVA 2QFJA 2DNPA 4RNOA 4EBDA 2XI2A 4USIA 2MQLA 2LDYA 3KFWX 3EZ5A 3KK3B 2HNDA 4DFJA 1MU2A 2ASLA 2ROEA 4DR5J 2HURA 3AOBA 5E3QA 3B54A 3M6XA 4B3TJ 3BBCA 1RHKB 2MZJA 2F4VJ 4WE1B 1DLOB 1HI8A 1P9QC 3R5JB 2F9JA 4CT9A 3OL6A 1UA0A 1I1GA 1RA6A 3MFHA 2N82B 3HP6A 1YJ7A 3H4BA 1XNRF 2CADA 4DWIA 2BEFA 2NQPA 3SYZA 5KFJA 3M8WA 4OX7A 1D9AA 4LF2A 2RH3A 5B0BA 4UQGA 1JLFA 2I6WA 1XMOJ 3AH6A 1M5HA 4O23A 3WBZA 5CD4H 3ILOA 3FC9A 2RS2A 3DRSA 2QLFB 3ENQA 4FXDA 3PKYA 3M9OB 2CJ9A 2ZH9A 1EETB 5C2CA 2R2TA 2LFVA 3DOKB 1MSWD 1SBRA 3CE8A 2LXIA 2Y3YA 1X4GA 3CD7A 4X66J 4Q0BA 2ZDOA 3B4DA 6FD1A 2BX6A 5GMKa 2M52A 2H4YB 2OHDA 2V2QA 3M6WA 4FNIA 3NWGA 2ZZNA 2BJ1A 2MKJA 4EFAC 3QGIA 1M90T 1UVJA 1RZMA 3A3OB 2JEGA 4IFYA 3A12A 1VDHA 2D3ZA 1PYOB 2HHSA 4QBUA 5FDLB 4ZVSB 4C6AA 4IG0A 2BM0A 3SDEA 2HGNA 3R7NB 2HK3A 4KKOB 2OSQA 3M05A 3R9LA 2V9KA 1R89A 1TELA 3K5MA 3CDWA 4PEOA 2CJQA 4DV5J 2OTLS 4Q43A 1FK9A 3G8QA 4P75A 5IM0B 5A8KB 3WHIA 3UDCA 4IOAQ 3BPDA 4DX6A 1TMMA 2EWHA 2V8HA 3HHKA 3NRBA 3D4JA 2O5DA 3A13A 3GQCA 2C3MA 2WBMA 3QO9B 1ITPA 5E33A 3VQSA 1JLEB 2MB0B 2YKPA 5CA5A 3K5NA 2WONA 4L6V3 2NPFA 4ES1A 3GFZA 1WKJA 1P6TA 2LKZA 2J0SD 4WYWA 4USKA 3GR0A 4MKBA 1N0UA 5L38A 4BWJA 4I6AA 5C42A 3UDLA 1VQ9S 1VBZA 1X5TA 1DHMA 4WZQA 3CEDA 3W61A 4HYKA 2XCPA 1VQKS 5BYSA 1AROP 2ZOMA 4N5SA 2RRNA 4JI7J 5LL6d 2YWKA 3NKYA 1S9EA 2OPQB 3PRDA 2H54B 5I3PA 2R7VA 4FVCA 4LQ9A 2G0CA 3F73A 4G65A 2CPDA 3DRPA 4ELVA 1IBKF 3HKWA 3MMCB 3P96A 4P10A 3KNAA 2GVZB 4O0NA 4UUWA 1LWEA 5RUBA 3TNVA 3GYGA 2W8LA 1N5TA 5L1JA 3C14A 3IR6B 1G4CA 4BWMA 3LGMA 4OI4A 2D1CA 4DV4J 2JL9A 1KSPA 3HULA 4CM2A 1TV6A 2CJYB 2DGQA 1XK8A 3B4MA 3GPAA 3RJMB 2DNKA 2JRSA 4UY85 4CTAA 4WTOB 2JC1A 4EZ9A 4PKDB 3RUBL 2AEJA 4FF4A 3VHQA 1RAFB 3LPYA 3PDNA 3BYPA 2BXJA 4RW9B 1KHWA 4ZS6A 2CQHA 5LMNF 2MXYA 4NXMF 5EGYA 5HO4A 3IS9A 1CC8A 2PD1A 5KFKA 3GV8B 1KLMA 4JV2A 1O8BA 3MM5A 2DNGA 1EKSA 1U0HA 1AW0A 3R6GB 5E41A 3OSPA 3LUYA 4FBTA 2UZAA 3H0PA 1Q95G 3D66A 4NA3A 3TUPA 3PX4A 4RBVA 1LK7A 1P1LA 2QMUB 3GP9A 2QSFA 2ILZA 5ETSA 2XLKA 2HHXA 1S1VB 2RSQA 4KAIA 3DLEA 4ZPDA 5KG3A 3I9ZA 6FDRA 4H4KC 4FYVB 3QAEA 2KVIA 2HNZA 2FB0A 1NO8A 3K59A 1Y5NB 5J2MB 5D0HA 2AEMA 3Q22A 3OL7A 1NEEA 3KLVA 3CO9A 3MR7A 1KFSA 3HX9A 3MM8B 3LP2A 2RDIA 3IG1A 2A2CA 2Q6CA 1S48A 2Y0SD 4A8SA 4OHVA 4DZ6A 4CLTA 1RLCL 4YHHJ 1RUSA 3EVOA 1KRPA 2XG8A 4OYZA 4A8FA 3RBEA 3DU6A 1HBNA 3N01A 3NBPB 1PC4A 2VOPA 2HHTA 2JFDA 1EB0A 1UETA 1NZ8A 1WI6A 1X9WA 1FERA 3CWJA 3QT8A 2V4RA 2VDHA 4HDHA 1GK8A 1VQLS 4J9LA 3HXMA 1VFJA 2LQJA 4K50A 5HK4A 1IKXB 8ATCB 3G71S 1Q8BA 2C1EB 2BJ3A 3UWTA 4QIFA 2AKWB 2MY8A 2B4OA 5MLCV 3G8SA 2HEKA 1X4FA 3T5LA 4GC7A 3AOCA 2HAFA 3TZXA 4O4RA 2SXLA 4DFKA 2E7WA 1SQGA 1T9WA 1YVFA 1UAWA 1LXNA 2IPOB 2HQCA 4PG5A 5HMWA 3V5RA 3MR5A 4K59A 1JLQB 2MKHA 4EO8A 2WZ1A 4TY8A 2ZUGA 4OZJA 2WVCA 3VR1A 4DR4J 2GQQA 4ILLA 4KR0B 1SVDA 2LXFA 1Q78A 1VQPS 4URGA 1VJQA 3KLHA 4LVOP 1NSPA 1PGZA 1NU4A 2VG5B 4ETZA 2Q79A 2J7UA 4C8LA 3SI8A 5KOWA 1RCXB 4DQIA 3IAS9 2HHVA 2D3OR 2GA7A 2UXBJ 1KLNA 1TL7B 4KSEB 3N28A 3VGUA 5KFGA 1JK9B 3DMJB 4RBTA 1ZZNA 4DG1B 3CDAA 1IUJA 2W25A 2RRBA 5HJXA 3CCVS 5KFBA 1NLKL 3CCZA 1RLDA 3X1LB 1HNVB 3R6LB 4DL4A 3NCQA 5GADI 3DNCA 2CFXA 3JSRA 4OZ1A 3LWMA 2E1CA 4GMKA 3PRVA 2H1YA 2HHQA 4U7UD 3T1AA 1VQ8S 3F0NA 4LUBA 3W2VA 1LXJA 5HVGA 1RT3B 3SCLE 5HMXA 2ATLA 1DTQA 3FZ2A 1U6BA 4GVBA 4DSJA 3DC2A 2E7VA 2RDDA 4LSLB 4BC9A 3TA1A 2K7KA 1HARA 1HNWF 3FSYA 4W4MA 2J5AA 2RKIB 1Z4UA 3FEZA 1KWMA 5KFZA 2CQ3A 4WK1A 4N41A 4K2XA 4CLKA 1FTCA 1NMEB 2NLWA 5DZ7A 1S1XA 2B5JB 2K1RB 3ITHA 4C4WA 1T11A 1K44A 3D3CJ 4O4GB 1L3VA 1QTMA 5D77A 4PXBA 2JHEA 2QRRA 4HHUA 3OVBA 1WC5A 3ZZOA 4LF6F 4H4MA 1GX6A 1VQ5S 4DR5F 5KFLA 5IOLA 1REVA 4B3TF 5KOXA 4RWWA 5F8NA 2F4VF 4JI5J 4LIRA 2J7KA 3VAGA 4ED4A 2V94A 4B9UA 2PSZA 2H5EA 2FZKB 3P3DA 2OPRB 3P5BP 2HGLA 3GIIA 4NOHA 3L7UA 4I67A 4ZVUB 2UV8G 2KXNB 4QU7A 1TR0A 2XM3A 3H59A 2HHWA 3W9HA 4V19X 2L41A 4XDDA 1RWXB 3E01A 4Q5VA 1QSYA 1MWZA 4PUOB 5T41A 2AJ0A 2KKHA 1VHFA 3M8YA 5GMEA 2D41A 4KPYA 2H9ZA 3DOLB 1EHWA 3R97A 1VQNS 3KUGA 4R5PA 4O3PA 2Z2MA 4L75A 1XMOF 4AE5A 3AXKA 4NLOA 2L08A 2ZHOA 3C3LA 4I0WA 3ZNJ1 4ZHRA 2DNZA 3NGUA 1AZSA 3T9ZA 1RHMB 1B7FA 1DURA 1X9SA 1KONA 1U6ZA 4M5NA 2DHHA 3FQLA 2QL5B 1HMVB 4WK3A 3EZUA 3DI6A 4WIIA 4X66F 2KJWA 1F2GA 1UW9A 3AXMA 4I7FB 2OJ3A 2M88A 4ZPTR 3THPA 1X5PA 2VQEJ 1FCAA 3MAAB 1JJCB 1NBEB 4JI6J 3DLGA 4BCAA 1R8PA 2Y1JA 2FVPA 2DRAA 4O44B 5HQ8A 1FE0A 2OFHX 1U47A 2V63A 1IBLJ 4NL5A 2PE8A 2RF2A 1IKWB 4NYZA 2GX8A 4IRDA 1SUQA 3QFWA 4ENOA 5MAOA 1MN7A 3HSDA 2VG7B 3MEDA 3S8SA 2VPYB 3QZ8A 2AQ4A 1Q7LB 1JLAB 5B08A 3UD3P 4AFFA 3CVKA 4OL8A 1VCTA 2A0FB 4U8VA 4LRCA 3TQEA 4UOCA 3BYRA 4NXNJ 5CZVA 2CVEA 1SB6A 2HRUA 4DV5F 2ACMA 1FDDA 5B7WA 1RT2A 3UVJB 2QX0A 1IR1A 3ISZA 4J9RA 2IBKA 3I5BA 3KK3A 3CJSA 3M32B 5LOQA 1K9MT 5SUHA 2ADBA 2PEBA 1XJWB 2AJFE 4RUBA 3EICA 3CJ4A 4KYZA 1YRUA 4WE1A 1DLOA 4ECVA 5F9LA 3VAHA 1V6HA 2IM1A 2RQCA 1EQ0A 5L1LA 3FGVA 2AYGA 4WFYA 3MR2A 2NXUA 8AT1B 2YQ3A 4WFNQ 1VMBA 2HS0A 4QR2A 1VJWA 3HKZD 3QWPA 2DNLA 2ZBQA 1JMTA 2DRDA 1JXLA 5ETOA 2QSWA 5GAEU 4JI7F 1UJ5A 2QO3A 2YWWA 4N56A 3N79A 1R43A 5IQQA 1SI9A 2DTJA 3C15B 3H8YA 3V81B 1VRTB 3BO4A 3V6JA 2RHSB 4ATNA 1LWCB 4TQSA 1GEHA 2V8PA 3EJMA 1R3NA 3D1OA 1T9XA 3M30B 2LEPA 1NHVA 2BQRA 1EETA 2CPEA 3I82A 3DM2B 3K5OA 4DV4F 2IJFA 3DOKA 3SV3A 2XY6A 2K3IA 2VPWB 4P2XA 4DR1F 2BVZA 2DITA 5BJRA 1FWPA 2MEWA 4F26A 3FCHA 3BGOP 2CIMA 4ZITA 3JTPA 4F67A 2MQMA 1YK9A 1FD2A 2KJVA 1GFWB 4MKVA 2P9GA 1TL1B 1JLCB 2RAQA 1KHVA 2AF6A 2HHPA 3O1LA 1S99A 2CWXA 4OQJA 1HL6A 5FDLA 1VC0A 4JI1J 4IYQA 4JYAJ 2YX1A 1NDCA 1KKHA 2FHOB 4MMOA 2VB6A 4LSNB 3GYXB 5AXKA 1I6JA 4KKOA 2ASJA 4X4NA 1Y11A 1CJUB 4F25A 1H74A 4FXWA 2UXDJ 1RWVB 2AZ3A 4RW6B 4B17A 3NGKA 1S0NA 5IM0A 3G6YA 5A8KA 1YWXA 2PA3A 3MXHP 4AT1B 3CSKA 2F1FA 2XMVA 4WBFA 4DFPA 3EE3A 2KHCA 2C2RA 1Q86T 3BQ2A 3QO9A 4NLVA 2X1BA 4USMA 1JLEA 3WDOA 3K8VA 1H7WA 1SJ3P 2O66A 5K9FA 1S97A 4JBCA 2QEXS 2PO4A 4ZPAA 3NNCA 1SV5B 1ZH5A 1E6VB 4Y34A 2XYPB 3G87A 2CDQA 2R8KA 1RAEB 2M0GB 3U02A 4XO0A 3M9NB 3MR3A 2I1RA 3I4PA 3GLJA 4YHHF 4CH7A 2HRYA 1HWUA 5D3GB 5DGBA 3ZFVA 1VK8A 4DV7J 4R25A 5KFOA 3JS9A 2AV5A 4MYUA 3OR1B 2HFSA 2QL9B 1HWIA 1YJVA 3Q8RB 2F65A 4A8XA 2OPQA 5BYRA 1KQSR 3OVAA 1GXTA 3C6UB 3J81j 2JEIA 1U02A 2ALYB 5D15A 4ERDA 5KFAA 1WC0A 1FX4A 2YQ0A 2GCFA 2X3DA 4DUZF 3MMCA 1IN0A 2GVZA 2KO1A 2W1BA 3RGIA 3KDOA 3NG8A 2CPJA 4DSKA 3GWCA 3PY8A 1XNQJ 3IC1A 4DPUA 1RTJB 3CUNA 3M9MB 4XPCA 1TL4A 2RE1A 1FTRA 1AYEA 1EZZB 3NOGA 3ZZTA 4IQXA 3GU0A 2EBGA 2XMAA 2HFNA 4AQYJ 3MM9B 2Y1RI 4ECTA 2WK4A 5AE1A 1WACA 3SV4A 2DHSA 2GJIA 1X0PA 4DR4F 3NMAA 5A6PA 5JXSA 3BF4A 1F1BB 1T02A 3R5AA 5DQIA 3W60A 5D4PA 4RW9A 3M6VA 3EM1A 3RYLA 4ZLPA 1R8HA 5KFEA 2FLPA 1XC9A 3V6DB 3JSMB 2MZQA 2EI5A 3J80U 4P72A 5LJ3Y 1ZM9A 1XMQJ 4H4KA 3KNGA 3IWLA 3A8JA 3ICLA 2ZC4A 2FJVA 5KT2A 4YB1P 1H2UX 2QA1A 3BGFA 2GAHC 4RW8B 2HK2A 2VJVA 5IT9Y 4OX9J 3IBCB 4DL0C 2MPUA 3BSNA 1S1VA 1IBMJ 4TU9A 4Y2CA 5HROB 1OMSA 2C3UA 2V4JB 2DR5A 2JLFA 2DH8A 2ROPA 4EK2A 4EMDA 4DL7A 5IC6B 3SIPB 2FZCB 3A8EA 3W8GA 3PCOB 5J2MA 1C1CB 1Q16B 1D1UA 2XTJP 2YWHA 4F3OA 4YB7A 3PW5A 5B0FA 1RBLA 3MM8A 3KG1A 3CCRS 1RBOB 5KG1A 1JKHB 4XPEA 2DD8S 4WTYA 3FBFA 2EK6A 2Z2LA 4CP5A 1NNDA 2ABYA 1E6YB 3NBPA 1S12A 4NLDA 3DGPB 4DX5A 3MI7X 4K4SA 1YJNS 1TL3B 2J0WA 3K8WA 1QAJA 4X4UA 4B3SJ 4B02A 4V19J 1IKXA 4CYUB 1B99A 5D78A 2W7AA 1UFKA 3M2RB 3UCZP 2YPZA 2B6AB 2ZM6J 3QPIA 3KK2B 4JI5F 3M8QB 4ZP9A 1WEXA 3RB0A 1UA1A 3TA2A 1TUVA 3TRGA 4WZMA 2W7OA 5M2UA 4UOHA 2KN4A 2HKEA 1Q8LA 8RUCA 1JLQA 1Q0NA 2B7CB 3RAXA 2J0QD 4U95A 4QCLA 2H3EB 2DGOA 5L9XA 2W4PA 3N6LA 1Y5IB 2J7WA 2C3PA 3IR5B 2R2UA 4P2SA 1HD0A 2VG5A 2CG4A 2YKMA 1RT4B 4OLOA 1JJ2R 4JOUA 4USVA 5CHCB 3W1YC 1WOSA 3D9BA 4NMLA 1HNXJ 5EUHA 3R1LA 3H4DA 1PIEA 1MW7A 2I2YA 1TL7A 1FXDA 4C8MA 3DMJA 1RWMB 3LP1B 3MEGB 4ZCMA 4OZLA 4DG1A 3ZTPA 2BE9B 2FC8A 2UXCJ 1EAYC 3MPDA 1RT5B 1TKDA 1AT1B 4TLQA 1HNVA 4KQZA 5HVHA 1WHXA 2IM2A 3MF5A 3MZIA 4YDDB 4ZPWR 1M1HA 1NJIT 4ED3A 1W2IA 4X64J 2VQEF 4N8OA 4F36A 2VG6B 4DV3J 5LSOA 3FBEA 2PT0A 2IRXA 3GFYA 5L39A 1RT3A 1RU2A 5KT4A 4IR1A 2VFRA 4RNMA 1PKUA 1IBLF 5CQGA 2AWZA 2VZ9A 4LSLA 3N9UC 4Q45A 3TAPA 5EX3A 3UCGA 5IXUA 2BACA 2J6TA 2RKIA 2IAJB 2XLJA 5EDWA 4LBHA 4I68A 2ZFHA 2NREA 3HHEA 4B3OB 1ZTTA 2CPFA 4C11B 1KQKA 4QWEA 2B5JA 4NXNF 4K4WA 2K1RA 2XB2D 4KGXB 2I9SA 4O4GA 4TU7A 3TW0A 2R7QA 3NGSA 3PX6A 5JJBA 4K4VA 3W5YA 5IT4A 3QT7A 1I5OB 3QFHA 2DY9A 4DSFA 2BV3A 2DO0A 5DDPC 1MROB 3BH6B 2HVHA 2QN6B 3MM6B 4DBQA 2QMXA 4NX9A 4CM0A 2OPRA 1T9YA 3PYFA 1M1GA 1VI7A 2FVCA 1T3NA 5ADZA 1G6BA 3PIPQ 4USHA 4NA1A 2ZC3A 4NCGA 2DNQA 5F3ZA 2Y8YA 5GAGU 3J7AN 2ZVIA 4PUOA 1KFDA 4ED2A 5F0WA 1QAXA 1HNIB 4X4RA 3DOLA 5FD1A 3VAFA 5HQLA 5AT1B 3H90A 3AODA 4PG7A 3VAMA 4ANCA 4B9NA 1RAJA 1U1QA 2MKYA 3D28A 4CNZA 4OYXA 2KXHA 2ZWOA 1G7CB 4LFCJ 3I32A 4LRFA 2W2MP 2FYXA 1N88A 1WKLA 1BGXT 2L9DA 4K7QA 3ENAA 4P2MA 1VISA 5EX0A 3HVRA 2UUAJ 1HMVA 5KG0A 1PYSB 1URNA 2HGMA 3NGRA 3BBFA 3W65A 1WG4A 2BE7D 4PPZA 1YJTA 4I7FA 1XTZA 3AB4B 3VGTA 5E3CA 3MAAA 3KLEB 2MQ8A 2G0IA 4B3MJ 1L3KA 2CAJA 2GJFA 4WXWA 2LDIA 2YNGB 3GSDA 2GFFA 2EVZA 2PMHA 4O44A 2NZCA 2FHJA 4X62J 1CG2A 2QA2A 4G1IA 4I64A 1Y5LB 4A8WA 1U26A 3GONA 4F4ZA 2GZOA 2KB2A 1IKWA 2MZ1A 3HMJG 3CTRA 3MMBB 5BYQA 1NKCA 2VG7A 4JYAF 3HDSA 4X4QA 5CAAA 4QPXA 1JLAA 2N3LA 2GC8A 4LF4J 2RB7A 1NUEA 1Y9OA 2UXDF 3L4BC 4K5RA 3HVAA 4ZIWA 3UVJA 1N32J 1S9GB 4P2FA 4OLPA 4ES3A 3OTOJ 3AD9C 4WFAQ 3M32A 2HS3A 2YKQA 5AXLA 1Z2ZA 3OTCA 5KFNA 2KZZA 3FMBA 2UVVA 1MG7A 3K89A 1YQHA 1CEZA 2VA2A 1ZYQA 3SCIE 2GHPA 3I4HX 5CYMA 4KH0B 2C2KB 3HHDA 3HFZB 2E5IA 3TJAA 3CNQP 4I6WA 3HHLB 3J81Y 3BDEA 2AJQA 5AE2A 3CC7S 2ZJQQ 3IRWP 2CQDA 2AGPA 1C4AA 4DR2J 4DV7F 2D9OA 1S77D 1X4BA 1QVGR 4KY3A 4I2PB 2YWFA 3V81A 3RG6A 2ERRA 5IT9U 1VRTA 2Z2YB 4IOBA 3T1YF 4DQSA 1LWCA 3HZEA 3HJVA 3CGIA 3GCXP 3D6MB 3H2UB 3HHLC 4L3KA 1N54B 3M30A 4LF7J 3T1HJ 3GILA 2Z58B 3P49B 4PWUA 1QD1A 4QQBA 3MFIA 3D0IE 1KD1T 3FSXA 2N4DA 2QJ3A 3DM2A 4C8OA 2KT2A 4YOEA 3DLJA 2NYHA 3ETOA 2ZDPA 1OIAA 1FXRA 2YNHB 4AQYF 2N4CA 3MR6A 1RYRA 3HT3A 1KVIA 3KLIB 2IA0A 3I56S 1NM2A 1IQTA 4RNNA 4QOTA 3QGGA 2VF3A 2ZWPA 1T95A 2JOQA 1JXVA 4FKYA 4I2QB 1T03B 1TL1A 1JLCA 1BQNB 3LW5C 2WVBA 2BQ3A 2MSSA 4CCHA 1A9NB 1N4LA 1WG1A 1QUPA 1HQEB 4OI0A 2DBBA 2FHKA 5F8GA 5L1KA 1FJGJ 1I94J 3SMZA 4OI2A 4LSNA 4ZKAA 4W90B 4JP8A 2ZH4A 1NK4A 4X4PA 3QGPA 1CJUA 2CQCA 3IWNC 4WKRA 2BKPA 1PJ6A 2DGUA 4RW6A 3OFGA 2UP1A 2VKZG 3JTOA 3MWBA 4QW8A 4OX9F 2J9DE 3QJPA 3WQPA 1Q8KA 3A8KA 3W64A 1NPKA 2BW7A 2XMKA 1IBMF 3ET6B 3R5GA 1RT1B 2MLXA 5IFMA 2ZITA 4MK9A 3IWXA 5AXNA 4LJMA 5CYJA 1B64A 4TQRA 2DCUB 1SV5A 3DRXA 4JI0F 1E6VA 2FQQB 4A8KA 3SSRA 2KT5A 2VC0A 1X5SA 1PAEX 5DO2A 2PDAA 2IY5B 5D3GA 1VGYA 4DS4A 1NPRA 2F63A 1D0EA 4MIBA 4UZCA 2BW2A 1WC6A 5HL7Q 2VFTA 4JI2J 4QYRA 1D9FA 3NWRA 3OR1A 4ITSA 4NPOA 1WSVA 2JLGA 1UWBB 2EFQA 5A2QY 2AGOA 4U96A 2QA4G 4YB6A 2MLZA 3C6UA 3H5UA 3GJRB 2OGUA 4B3SF 2DH7A 1NH8A 1WOPA 1Y00A 4DPYA 4DV0J 4BDPA 4OJHA 3H42A 1VRQC 3R5DA 3CJ0A 1M5SA 5DM6Q 3W8PA 1RTJA 2X3GA 1X4DA 3RR7A 2FGCA 4UOGA 5E3PA 2HIYA 2BE2B 1X4AA 2XS7A 1CBKA 1IJEB 1DAXA 5HLFB 2OFGX 3GJTB 3AQPA 5CCLA 2JNJA 3ZXWA 1RTHB 3MM9A 5AXMA 1QUVA 3QRQA 1DARA 4UW2A 1U8SA 3M2VB 4USUA 4PCQA 2YKNB 4C7QA 3A8IA 4CNYA 3H40A 2WVDA 4CO5A 2VOOA 3QZ7A 1RKJA 2V2KA 4NZ7A 2D69A 3W7BA 1TKZB 1TK8A 1FFSB 4L76A 3QIDA 2W8KA 4IR9A 3ZTQA 2VKRA 5IV3A 2DEIA 3V6DA 3JSMA 1H2VZ 3BN7A 1WC3A 3ZTOA 4O3RA 1SC6A 1VC5A 2QFIA 2B9YA 2VBWA 2O1PA 5K8NA 2UXCF 1S1TB 1SL0A 3H5YA 1WC1A 4YMEA 2AT1B 3BGUA 4LFBF 4RW8A 2GGPB 3PNIA 2IHR1 1UEVA 3ENWA 4OJGA 4RKUC 4X64F 1RYSA 5HROA 4HL9A 4DV3F 2V4JA 3OW2R 3TAQA 2OI2A 1VBKA 2CJXB 1CPZA 2DKOB 3HHLD 3NAIA 2Z2ZA 2YX4A 2DIUA 3R5CA 1C1CA 1TUGB 4KHRA 2FDNA 2CQIA 2VFVA 3V6HA 4LF8J 2XI3A 2X1AA 2ADCA 3D0HE 1JKHA 1MLAA 3PACA 2GQ2A 4C3MA 5J2PB 4ER8A 1Q53A 2QGFB 2EBEA 1E6YA 4RNHA 2XWYA 4DPTA 2KG1A 2HQGA 1RK8A 3DGPA 2WSCC 3AY0A 4OJ3A 1FJEB 1F3FA 5AJ3F 1TL3A 4X4TA 1MNEA 1FNMA 3IRXB 1YJRA 2A10A 3DDKA 3R2DJ 1KOHA 1RHQB 3TEGA 4F4WA 3TX0A 5F8LA 3CDEA 4CYUA 4KFBB 3SSQA 2JX2A 3M2RA 2H65B 4C8YA 2B6AA 1NKEA 2BJ9A 1FFGB 3BKTA 3KK2A 3M8QA 4LR8A 4E8UA 2G4BA 1GMUA 3EGWB 1ZA2B 3AD7C 1SJ4P 2QLBB 4F3MA 3S1TA 2XNQA 3GG1A 1SKRA 1YDLA 2ZJPQ 3WIVA 2LEAA 1HW9A 2NXEA 5CABA 1NPPA 3HJFA 2Z56B 2LA4A 2VU5A 2UV8A 2LCWA 2IC3B 2MHNA 2XO7A 1FXLA 5D0GA 3MPWA 1EKRA 1U24A 1CJVB 3RR8A 2DNRA 3I9V9 3W9JA 3T6BA 2ZHBA 2Q1LA 3TO8A 3VAIA 2VHGA 3DLKB 4N47A 1RT4A 4CLWA 2JSXA 2CQPA 4CO2A 1N0VC 2YH1A 2B9WA 2HBRB 4GRSA 2A2DA 1C4CA 2KFNA 3LGNA 3HD1A 1FRXA 4CH1A 2AP6A 5JVGQ 2N3OA 1BC6A 4LFCF 2EFVA 3LP1A 1DBDA 1O5JA 1U2FA 1WI8A 3WX8A 2HNYB 1RT5A 1C0UB 5G4DA 2DNHA 2P5VA 3X3UA 3KWMA 2OELA 4O3SA 4IO9Q 3GFXA 1YLXA 2MMYA 3NL0A 4ZCLA 2VG6A 1WHVA 4WJBA 5KG4A 2OMOA 3TZZA 3KK1B 1TUWA 1PAUB 5DQGA 2HFVA 5A8WB 4OIXA 4JI4J 3HK2A 1C1BB 5CYQB 4HACB 4MKYA 2VODA 2VBYA 1S1UB 4ZPCA 4HH1A 1NHUA 2BUNA 2PN6A 2ZBPA 1RWWB 2IAJA 3KLGB 4NLRA 3Q86A 1M1KT 4B3OA 4HT5A 3MCSA 5D4NA 4C11A 4CDIA 4F0MA 1JLBB 2JLEA 1OYEA 3ZZ0A 3CCTA 1N32F 4K4ZA 5D4LA 3OTOF 4MAKA 3FRZA 3ENVA 3W66A 3G6VA 2VIHA 4PAAA 2M8DB 3VWSA 1SKUB 3QJLA 5HP1B 3R7BB 3UR0A 1H3DA 5EWGA 1MROA 1U25A 1CJKB 3MM6A 3EPGA 3OBIA 4I56A 3QRPA 1J5EJ 3M2UB 5IWAJ 1S5ZA 3QT5A 3W5ZA 1L3SA 3I55S 2VV5A 3PM9A 4UQTA 3VTIA 3ADAC 5HMYA 2R8GA 1ICEB 4FPIA 1F5AA 1S0VA 4E0DA 1FJ7A 3FUYA 3CCLS 2POKA 4DR2F 2KTQA 4R8UB 4F7VA 2DCLA 4HTIA 2UUCJ 1HHSA 5K8OA 2D7SA 4NLSA 4S0MA 2OPPB 3H2LA 3GIJA 4ZN3A 3PJWA 1HNIA 4DS5A 1R0CB 2DXFA 3HCXA 1SH2A 2E29A 4IH6A 2JWNA 4HHJA 1IKVB 3KHLA 1TQLA 3FZBA 2GJ2A 2F9DA 3LF0A 5GAEI 3EYZA 4LF7F 2M3DA 4WU2A 3T1HF 1DZ5A 4G1QB 1WOOA 3CDUA 1YITS 1N48A 2J6SA 4HDGA 3PW4A 3D6FB 3FRYA 2M70A 1NK0A 4ECYA 4F0KA 4DR3J 1NK8A 1QJHA 3RW6A 2V67A 2YKOA 1JLGB 1O51A 5JUMA 2LP4A 2ZE2B 3RRGA 2R8IA 4IRKA 1U1OA 4GC6A 1BY9A 2O67A 4JV5F 2BOPA 5HSPA 2R7XA 1DFDA 4CLLA 3KLEA 1UTAA 5ETLA 4DL3A 2VL1A 4J9UE 2XY5A 1GAOA 2YNGA 4A4JA 1KN6A 1NRKA 5HN0A 4K8RA 3GIRA 4DCJB 5A2QU 2M5YA 4OHZA 4P73A 3OXFA 3Q24A 3UE2A 1OSCA 4ECQA 3GIMA 2ZEJA 1NJXA 2MZTA 3MMBA 3TI0A 2RU3A 3Q89A 1C0TB 4RR5A 1FJGF 2XGPA 2CPZA 2L9NA 2KI2A 1I94F 2J6UA 4JI3J 4QR1A 4B9MA 3RW7A 5KG6A 3L7OA 2K2PA 1U0SA 1F0XA 2E1MC 4PZVA 2WOMB 4G6VB 3P4UB 2NYIA 1S9GA 3QNWB 3L95X 4RW4B 2V5HG 3MMJA 1R8BA 4TYAA 3TEHB 4KJIA 3LP0B 5B0GA 5I42B 1FKOB 4YP3A 2YWGA 2F8HA 4OHWA 3TVZA 4U7UK 1VS3A 3LTOA 3BQ1A 5EWEA 1IQZA 5KFRA 4QWAA 4Q8EA 5ETTA 3K57A 1K0VA 3DYAB 3HHLA 5BR8F 1RJJA 3OSNA 3MEEB 3IP0A 3BREA 4NYPA 2X7IA 1J2VA 1IWGA 3IGNA 4GO7X 2P9EA 4JI2F 5KT6A 4B3RJ 1ZBTA 2GHVC 3C46A 2MQPA 5DDOC 3CCWA 4I2PA 2ZH6A 2W4CA 3THVA 4B9VA 5E3AA 3CMQA 2BQUA 5G0RB 1H6KX 2HAIA 1XIQA 3I0RB 2GO9A 4LBIA 4DV0F 2CVIA 4EUVA 4CWBA 2E66A 4LFAJ 2QA4S 1HA1A 3UCUP 3GV7B 4NEZA 2CNNB 2RQMA 4J9KA 4J90A 4RPFA 2YH0A 2QLWA 1P8GA 2UVWA 2FLLA 2BKNA 3B78A 2F8MA 1UCNA 2YNHA 4GKKF 1VIXA 2BRLA 3KLIA 1UZDA 3BR9A 1HR0J 1A7GE 1UP1A 3TUIC 4L72B 4C8ZA 1VBYA 4PYAA 5SZTA 3FFIB 1URRA 1V3RA 2AX0A 1MWQA 3JQJA 5C24B 3QWUA 3PX0A 2EK1A 2W2OP 4I2QA 1T03A 3QRRA 2E1PA 4IDKB 1BQNA 1REGX 2MQNA 4ZK7M 3VZIA 4I69A 3GJQB 3NNAA 4NYOA 4HI2A 2JZ5A 5F3TA 1LW2B 1UWAA 1HQEA 4ANDA 1FKPA 2AYBA 1IR0A 3D68A 5ETNA 3LALA 3BGRB 3OXGA 1S1WB 2ATCB 3MM7B 3KUHA 2W9CB 3BBBA 4LRAA 4AXJA 4WP9A 1HI0P 4CH0S 1N36F 1ULRA 2BBEA 1BLUA 3WIUA 4P71A 1KBRA 3DCAA 1UKUA 2XC9A 3ET6A 2B0GA 4Q2LA 2PMZD 1RT1A 4L3NA 3CIZA 3LGHA 1UVNA 4EEYA 3KUEA 2Q3PA 2IJRA 1Y3JA 2C3YA 2CPHA 4UT4A 1S59A 2VONA 5KFUA 3CMES 1X7VA 4C98A 1AUSL 1T9TA 1SJRA 4LF8F 3IBFB 3Q8QB 1T9UA 3IM9A 3M4XA 3J7ZT 2W2NP 3JSYA 2IMOA 4MTPA 4AUKA 3BSOA 2HBYB 4EBEA 5KFTA 2VUGA 1UWBA 2VH7A 1V9OA 3RB3A 2HQFA 4DI6A 1WEZA 3V6KA 1YBAA 4KRWA 3IAM9 3IM8A 4N7TA 4RJVA 4X4OA 1YSJA 2J8AA 3SEOA 1LQ9A 3GSIA 3H20A 2QE5A 1KQGB 5KFMA 5KFCA 3OUYB 1EIYB 2BE2A 3JQKA 2AD9A 4OV1A 1T9VA 2W4DA 4EWTA 1D8YA 3AJ2A 4OX6A 2FJEB 1NK5A 1NH7A 2P9CA 2ZKUA 1RTHA 2W9BB 4YQWA 3G9CA 3QSIA 1YBTA 2DEJA 1QVFR 3M2VA 2O3DA 4RUHA 2YKNA 4HLBA 4RW7B 1X4CA 3AQOA 1OWXA 1S9FA 1F3VA 1U09A 2FD2A 2QLXA 3CMAS 4RUCA 1N5VA 4Y6IA 1RKIA 4DR7F 1TKZA 2IVMA 2QC3A 1L3UA 3EVWA 4BBYA 4PR6A 3BGLA 1U49A 3NGTA 5F8HA 4NCBA 3I96A 2DK2A 2RHQB 1HD1A 2DO4A 2W2PP 4N77A 1WWHA 4F3QA 4DCOB 1KTQA 3CC2S 2K7JA 2ZNYA 2EXUA 2FHMA 1S1TA 2XZDB 2KG0A 1YHQS 1K47A 2P2CB 3MECB 1Q5VA 1Q82T 3SBMA 5A0YB 3MPVA 2HZVA 5HMZA 4E98A 4IUFA 1RHUB 1JJHA 3OL9A 2BJ8A 2JEFA 5DS7A 1R0BG 4L74A 3WC2A 3C6TB 5KFQA 2NZ4A 3CD5A 2RS8A 5F41A 4JI4F 4IKAA 1FEHA 4K5SA 1YJWS 1NJYA 1SQEA 4U9RA 1XEZA 1YIJS 1TAQA 1KC8T 1QE1B 2PA8D 4A8OA 5J2PA 3K7RA 4YR3A 1F60B 2KH9A 3RTVA 1YKWA 4F04B 2LYVA 2YY3A 2QIFA 3KKFA 2M2BA 3UD4P 1IKYB 2IA6A 3IRXA 1HBUB 4QWBA 2HQIA 4GKJF 1JNZB 2J9CA 2AMCB 3HI9A 4KFBA 4ALZA 3TJ8A 2EC0A 4NI2B 1GT8A 1N33F 2V8DA 4H54A 2CNOB 4IH5A 2HFOA 1RAGB 4H4OB 4U67Q 2PIIA 1IXKA 5D0EA 1OPIA 3TUZC 1J5EF 4ZOSA 2YNIB 2DR6A 2ZH2A 5I3UB 4TXSA 2NXJA 1K1QA 1IWAA 3J7A1 3K0JA 2F8EX 4ZPVR 2ROGA 1UVMA 3Q83A 3S01A 3OV7A 4NXMJ 2C2DA 4PPDA 3O6QA 1S6QB 2I5JB 3PXGa 3PHEA 2UUCF 2IC3A 4LSZB 4CIOA 4DF4A 1FWKA 1CJVA 4OZ2A 4Y28C 5GAHU 1FFWB 5ETPA 2HVEA 5L46A 3DLKA 5A8RB 2HPUA 2B7BB 2HVDA 1UFWA 3D3BJ 3BSAA 5DG7A 5GAGI 4KC5A 1KTVA 3H98A 4QIGA 2OEKA 4UZBA 2E9TA 5E2QA 1FRIA 3BH7B 1OQ6A 4A8YA 1R0AB 2HNYA 2NR0A 4OZ3A 5KFPA 1BWEA 2CPYA 1RWUA 3M1VB 1C0UA 5CXTA 4PQUA 4ECUA 1OQ3A 4ED5A 1LFWA 3PVXA 2HVZA 3QMQA 1UPMB 2ZBCA 3CW2C 1XR5A 2DR8A 2E5GA 2XYHB 3OQ2A 1CS4B 3KK1A 1BQXA 2BJ7A 3HSGA 4RO0A 1RTDB 5DDRC 5A8WA 2COLA 3LPEA 2XGQA 1VR6A 2DGXA 2J9DA 2IYIA 1P9YA 3C8YA 3B8HA 1C1BA 5CYQA 1S76D 3UI3A 4HACA 2MGZA 2OPSB 1S1UA 3FDSA 3SCJE 1UMJA 3BB5A 2ZNZA 2CPXA 3KLGA 3RRKA 4DX8H 4M8LA 3PR5B 2G2OA 3TR5A 1PILA 5HATA 4LRBA 2OIHA 1DQAA 2DPIA 2ZH8A 2GMHA 5DZ6A 4J9VA 1JLBA 3BV8A 3TAMB 1SIZA 3FQKA 1B3TA 2HWIA 1EJ7L 3F44A 2Z4PA 1RWKB 2V69A 2YQ1A 3MUMP 4MFBB 5B09A 3KJQB 3TANA 1Y3KA 5HAOA 4X84A 5T14A 1WDTA 3OT9A 5LJ5Y 3OHAA 3SFUA 1D09B 5HP1A 4QWDA 4DSLA 4ZP8A 2OEJA 3J7YU 4YB5A 2E1AA 4NMXA 3NNHA 1CQNA 2XEXA 1CJKA 3BR8A 4FVMA 4PXDA 4ID5B 3DXBA 1U2RA 2KDOA 3M2UA 2Q43A 4DEZA 3RU0A 4LF5J 2QL7B 2ILYA 3DHXA 2GVDB 2WB4A 4DL2A 7AT1B 3P5TL 3UNGC 2QV6A 2K06A 2XSJB 2HBZB 4FNHA 4JB8B 1O6XA 3FSIA 4R8UA 4ZLNA 3CCES 1SCJB 1C2PA 2L48A 1AB8A 2VFSA 5H9EJ 2Z8QA 2OPPA 4J7CA 3ILIA 1U6FA 1ZPVA 1K8AT 3AAWB 1N5SA 4WCEQ 3CCMS 2DY1A 1IKVA 2FPHX 2AHOB 2ZH1A 1FNOA 1XBWA 1M5OC 4P52A 5H9FJ 1R31A 5DRKA 1YJ9S 4G1QA 2HSEB 2E9ZA 4G1PA 4KHMA 3TWZA 4LFAF 2PFDA 1S0MA 2NXCA 4USTA 2Y8WA 3UQSA 2FGOA 2OMLA 4FDFA 5HJYA 1JLGA 3TUJC 3RB4A 2DHXA 4J5OA 2ZE2A 1UVKA 1RAHB 4DSEA 1YJUA 4GO5X 1QSLA 2XS2A 3MDFA 1ZPWX 1NAQA 1W2BR 1H7XA 2LECA 2NPIA 2DR9A 4OHYA 6AT1B 2EKYA 4N8NA 2CG8A 4KV8B 1Y4ZB 4ICLB 3UN2A 3T6JA 4DV2J 1GTHA 4EZ6A 2DGWA 3H5XA 3RB6A 4RUAA 1SL1A 3C66A 3JSBA 1C0TA 1OY6A 5F0UA 1B7YB 2R7UA 2H4WB 4RNFA 1KVKA 1GMWD 2BMBA 4LF6J 1FDBA 1CJTB 2GS8A 3Q8PB 2VJUA 2R7OA 1FRKA 1VLYA 4FPRA 5EN1A 2WOMA 2DXEA 4RW4A 3DRRB 1LK5A 4NLWA 3Q8VA 3D0GE 2E5JA 3PYDA 4NLGA 2BANB 3LP0A 5I42A 2I0XA 2RMLA 4C0HA 4LBPA 4KBIA 1FKOA 2MTLA 1RADB 3P8BB 5K20B 2IVFB 1FNXH 3NOCA 3MUVP 2GQCA 3CULA 3AA9A 2PI5A 2YPYA 3DYAA 4CO0A 3MEEA 1YTYA 4PXCA 2DRBA 5ITHA 3L7PA 2PEHA 5ETQA 1HBMB 4C0OC 3V4MA 4O0IA 1Q7YT 4EO6A 3OTEA 2LXUA 2FJAB 3D6HB 1KNZA 2D3UA 1GX5A 3D1QA 2KYXA 2J76E 1RWOB 5G0RA 3U27A 3G82B 3JYTB 4M1KA 4OZ5A 2I8EA 1NCLA 2FUG9 4DLEA 3I0RA 2AJ4A 1A0OB 1F9EB 4LR7A 3KLFB 2HRTA 4A46A 2RUGA 2ZH5A 5GMDA 4E2FB 5GVQA 4M95A 2DNOA 3ZZYA 4OZ0A 3DDNA 4QIWD 2DGSA 2HBQB 2HIQA 1PJ5A 3EDQB 3ILLA 3WC0A 1FWLA 4X2BA 1M5KC 1FX2A 4HTJA 1RU1A 2ZZTA 7FDRA 1HLWA 1N56A 3M8SA 1SXLA 1FESA 4URQU 2Y1IA 4R0EA 1SJQA 2MZRA 3FFIA 3MGJA 5C24A 1WELA 2XMTA 2CNKB 3HPOA 4IDKA 3MCNA 1TTHB 2DNYA 3Q2SC 4XAKA 4XDCA 1EARA 4UY8T 3AB2B 1ACMB 3FKBA 4C8NA 3ZTSA 1LW2A 4IRCA 4F8RA 2VBXA 4TLRA 5M2RA 3KHRA 1JNRB 3MOJB 3BGRA 1WORA 1S1WA 3HVTB 3MM7A 3R5BA 1RBAA 2W9CA 1O0PA 5E7OB 1VC6A 2O01C 4XIUA 2CQ2A 5I3QA 4DU7A 3H2VE 1LW0B 3Q8YA 3PO4A 3GR1A 3HFKA 4TYBA 2GO8A 3R2CJ 4J9OA 5D6GA 4X4VA 2F7VA 2IIHA 3JQMA 2EFGA 1F5BA 3VZHA 4HEA9 3D67A 4LT6A 3K5LA 4HVZA 2IFXA 3PJXA 5KT5A 1RISA 4QW9A 2HLUA 3M8PB 5U47A 4FN5A 1BD6A 3QAUA 2MKIA 3KMQA 2Z57B 1OY8A 2AX1A 1RWNB 2UXBF 2GIRA 1W25A 4F4YA 3BQ0A 3GCWP 1NB7A 1ZM3A 3QLHB 2DISA 2RQ4A 2XSFA 4K4XA 2RU9A 1WHWA 1DQ9A 5KFDA 4LMZA 3CJKB 4CO4A 3OLBA 1ZETA 2QG9B 1XWLA 3OLAA 5K14B 1VRUB 3CF5Q 1TVRB 1N8RT 5KG5A 2YX7A 1UJ4A 2XMMA 3BPSP 5ETMA 2HMIB 1DTTB 3WX4A 2B56A 3I0SB 4DR1J 4RWXA 4J37A 3FEYB 5F8IA 4LQ3A 2BZ2A 2YNFB 2DH9A 3NXZA 3MD3A 3KMSA 4F02A 1WD6A 3K17A 1RE1B 2R2RA 1OY9A 2ZH3A 3OUYA 1V5VA 2BM1A 2RQKA 4ZIVA 1RAOA 4UUXA 1SC1B 4G3IA 2W9BA 3LAKA 3M8ZA 4DN0A 4RW7A 2FLOA 3A3NB 1YGYA 3DRYA 3US5A 2BABA 1JQGA 4WP8A 4TKTA 2OUGA 3CPWR 3N4WA 4DV6J 1LWFB 3FNNA 2RJZA 4OYWA 3BKFA 1OO0B 4LVNP 1YI2S 2XS5A 4KT0C 1CSJA 2CUYA 3AD8C 4KHPJ 3U1LA 2HFZA 3W5XA 1VLOA 1A6LA 2QTWA 1S79A 3EDRB 5B0AA 2NSCA 4URSA 3R8YA 4NRUA 1KEKA 3SFGA 1BHNA 4PYDA 3MECA 1RT6B 4F4AA 5A0YA 3CC4S 5E0OA 2CJKA 4M5DB 5IV4A 5K5MA 2Y0BB 4DF8A 1BMQB 1U1KA 4J91A 5KFFA 4RBUA 5J1PA 2AW0A 3FMWA 1FDAA 3CCQS 4FF3A 4CO1A 3MTJA 2G9OA 1WDDA 3C6TA 4QIEA 2WW4A 3UDVA 4UF4A 1FDNA 3KDNA 4CLUA 4K4TA 3BO2A 3EGNA 3C2PA 5DJBA 3A4TA 3MPUB 2ZUAA 3QBCA 3PYGA 3TZYA 3KTQA 1QE1A 4F4KA 3QYYA 3QIPB 4Z7CA 4DUZJ 1GXLA 4FKXA 2MQQA 4M5GA 2XHCA 4NLQA 2Q6BA 5LSLA 1B0VA 3AJ1A 1D8ZA 1NK9A 4P7TA 1Q8IA 1IKYA 4JI6F 1Q81T 1HBUA 4OYBA 5ETKA 2E5LJ 1UPPA 1GMWA 2FVRA 2ZOFA 1L5UA 3B6BA 1RGVA 4BS2A 1S10A 1LEOA 4NI2A 4DHVA 5KFWA 4C8KA 4ZVQB 1WF2A 2VPZB 4ED0A 3CIMA 5DGAA 2C2ZB 4H4OA 3P45B 1N6QB 3BDPA 2EFOA 3W62A 3G6XA 2UVUA 4Y2KA 4WU3A 2YNIA 4MH8A 4LF5F 4NZ6A 5I3UA 2BRKA 1UJ6A 2YKMB 2KFYA 3T3FA 2V8GA 1HHTP 2RUSA 4J9PA 3G6ES 4TN2A 3ZZZA 1S6QA 2I5JA 4KE5A 1HFEL 1N34J 1ZTWA 1PG5B 3UNYA 4FP9A 3DGVA 4M5MA 1HQUB 5A8RA 3CDBA 1DJ0A 2ZZMA 4QU6A 2A6MA 2UUWA 4XK8C 3NGDA 2C2OB 3IFEA 3CD0A 4I1TA 4Q44A 1CC7A 4C9DA 3TYTA 2NUHA 4OYOA 2GMLA 4QYZK 3TJ9A 3NEKA 1R0AA 2WVEA 1V3SA 2QMWA 3C16B 3M1VA 3F41A 2OLWA 2GW8A 1T0TV 1NDPA 2AIRB 3VGVA 3NP5A 1G3OA 1RT7B 2KRBA 1FT8A 2EKNA 3UN3A 4YS2A 2WTFA 5CH7B 2IJNA 3BEGB 4RU9A 2V2VA 1K73T 1CS4A 2IVYA 2X1FA 3UFCX 1RTDA 3ONQA 4F2SA 4DV2F 4WF9Q 2ZD1B 4J9NA 4OMFG 2V6AA 2OPSA 4W98A 2W9AA 2CZVC 1JWWA 3MMAB 1VBXA 3OR2B 1UVLA 3KHHA 3CCUS 1WUUA 4Y3CA 2C28A 2NSBA 3DHWC 3SQGB 4AD6A 4NLYA 3ZC4A 3T5KA 3J80Y 2EPIA 2E9RX 2QLJB 2QZ8A 4TNOA 2EC2A 3Q0AA 2JJ4D 3TAMA 1TKXB 2C2NA 4Z2XA 1LFPA 3O3LA 3Q8SB 1SQFA 5LXYA 1KS2A 2L9WA 1IVZA 3HVWA 1NJWA 1FRHA 1MWYA 4MFBA 3FJ2A 4N76A 2XMUA 3CO0P 3G8TA 5HQMA 3IR7B 3PR4A 2CZ4A 3NCPA 2BR0A 4NCGB 1SKWA 2XMWA 2R7TA 2JC0A 4DUTA 1ROFA 1R8AA 1FRJA 4JI1F 2NUUG 2PMWA 4ID5A 2A3JA 3MTKA 1UFLA 2GVDA 2Q66A 4ID8A 1U1PA 4ECZA 1U48A 2VDIA 2LQ8A 2XSJA 3E3XA 5D0RA 4MJKA 3ZZPA 4YR0A 2LU1A 2AJ2A 3R1HA 3T5JA 3ETMA 4JUZA 2OKQA 4YUDA 3I31A 1D9DA 1U4BA 4OYAA 3P6YC 4HI1A 3DU5A 3UDEA 4Y65A 2IMWP 3OD2A 1U1MA 4J9SA 2C3OA 3O8WA 1PYTA 1VQ6S 5B0DA 4Y2IA 3DOMB 3TX8A 1HKAA 1TFWA 4WFBQ 2AZ1A 3DKDA 1XQIA 3TZWA 5F8JA 1RABB 3POTB 1AFJA 2A18A 2F40A 3NMRA 1WTFA 4AXIA 2V50A 4ZP7A 4EI2A 4U7CA 3DLHA 2VPXB 3MOZA 3C15A 3PEJA 2CPIA 4JI8J 4WWSA 2IRYA 3HF5A 4IG3B 5L1IA 1RCOB 4KV8A 4ICLA 2ZBIA 5FJ4A 1U7LA 2M4MA 5F8MA 3NS6A 3VALA 1FA0A 1XNQF 3E2EA 2K8GA 3MHYA 3I5AA 2D3O1 1WJ9A 2B9XA 1VHIA 3IA0A 3VCDA 1CJTA 1U1RA 2AJ1A 4M5KA 1CLFA 2WHOA 1VIOA 3PO5A 3U1MA 4CO3A 1YZ7A 5J2NB 5CYMB 4OX8A 3DRRA 1YZ6A 4O3QA 2BANA 3HSJA 1PC5A 1U2CA 1BQMB 4F2RA 5IC4B 3FCWA 4TY9A 1OJ4A 2M8HA 3V4IB 3AJDA 3O5TB 1VQ4S 1YRXA 3T5HA 4ZVEA 3SZ2A 4DV1J 4RX6A 1XMQF 3HSZA 1FRLA 2E7XA 3M7VA 2BJDA 1T3OA 4U6PA 5DG8A 1MMNA 2CZ9A 2EG1A 2ASYA 3I5CA 2PI4A 4A47A 1NSKL 4ED6A 1HBMA 3MAHA 1UEKA 3FEXB 2B43A 1NJZA 4WP3A 4ECXA 4FF1A 1U8WA 2P8IA 1V3ZA 1RDRA 1VQMS 1K0TA 2DR7A 4LR9A 4K2JA 3CT9A 3PYEA 2CRLA 4DLGA 4GVLA 3G82A 3ZZRA 1X9MA 3JYTA 2GNKA 2CYYA 5KFIA 3PJ9A 2UVRA 2ZVSA 4FYYB 4FF2A 3KLFA 2H5JB 2P6SA 4KTQA 2VICA 1ZZFA 4ZJLA 5A6WA 1HYSB 5KFSA 2MJUA 2DHAA 2AEFA 4CI0B 1YRTA 1N5YB 5D4OA 4LREA 3CCSS 4HR2A 3TA0A 1UW4A 5J1NA 1RB0A 4DU8A 1H98A 4Q7AA 4M5LA 1NK7A 5C5JA 3N5FA 1Q5YA 4ZLLA 2AYEA 2UUBJ 1W26A 5L8RC 1HBOB 3N6NA 5IQ6A 1HQ2A 5B0CA 1LV5A 2NS1B 4U8YA 1XERA 2V34A 1TFYA 4DV6F 2HZAA 3PFOA 2XO6A 4R0JA 4OHXA 2ZM6F 2R42A 4MYTA 4F50A 4DUYJ 4KHPF 1APSA 3DLLQ 2G0JA 2G13A 2BYCA 2MHEA 3HVTA 4PWWA 4DPXA 3EX7B 2ZH7A 2OP5A 3VF0B 3OJUA 1PBUA 3L3CA 1OPZA 1Z1ZA 4DOZA 3GTYX 1LW0A 4C97A 1CQMA 1OS5A 1F9FA 3BSCA 3GZ7A 4ZDNA 4A48A 1HWLA 4W92B 3GYNA 4ZPBA 5J2QB 4QPTA 3W2WB 3CJ8A 2RD5C 1JB0C 3M8PA 1HNXF 2C42A 1M0SA 4KGKA 3RBZA 3OL8A 3H7HB 3O2IA 2RRAA 3CCJS 3KG4A 3HO1A 3QLHA 3LOUA 2G2ZA 3T1YJ 2ALZA 3LANA 5B0EA 4KO0B 1HIYA 4FS2A 3CJKA 1NKBA 1ZS6A 1H2TZ 5K14A 4F0HA 1VRUA 2C2MB 2YXLA 2OH2A 1TVRA 2RDJA 2E5LF 5KT7A 2HMIA 4NEYA 1DTTA 4CT8A 3I0SA 4QZVB 4ED1A 2VBZA 4ED8A 2FHJD 2YVSA 2R7RA 1S7HA 3FCVA 1EP4B 5ETRA 3KOAA 2YNFA 5J1EB 1WNEA 1KQFB 1YG0A 2EG2A 2GIQA 1KDNA 5I4MA 2FC9A 3VAKA 2DPJA 3JB9k 4LF9J 1QSSA 2HHHJ 3W63A 2H51B 2VASA 2P6TA 3D54A 4NLXA 4CLZA 3IGVA 4RU2A 4CLYA 1SPBP 2XMJA 2ZOGA 1N34F 1S57A 2MKKA 4ETXA 4WXOA 3HZGA 2ZKTA 2EEYA 1V5IB 5DG9A 2RIJA 1NK6A 1PSDA 1J27A 2DGVA 3T41A 1TAUA 5DM7Q 1LWFA 3LAMA 2HWTA 1WHYA 1G2EA 1GTEA 2KFZA 3PW0A 2E5HA 4DL5A 4FS1A 2MY7A 5THWA 3VVUA 4USWA 3GJSB 2KHDA 3PHTA 1J5OB 1QAYA 2W2QP 4DZDA 3GFHA 5GAHI 1R6VA 3PIOQ 3U1NA 3LA0A 3OJSA 2MLYA 3BO3A 3JAMY 2MSTA 4DR6J 3ULHA 4ZA1A 2HW3A 3NLCA 2B8QA 1VQOS 1S72S 1KR4A 2LQ9A 1RT6A 1HNZJ 4JI0J 4M5DA 4WKYA 2WB1D 3DFEA 2V4QA 4MIAA 4C2MA 1T8EA 3W9IA 4YY3J 2Z0GA 2UU9J 2EW9A 4WFXA 1ZM2A 2WW8A 4YN3B 3GIKA 4QR0A 5JVHQ 1Y10A 3OFHA 3HHNB 1SH0A 1FVSA 2JVOA 2HZCA 1LNQA 3MEGA 1OYDA 1S6OA 3GG0A 1T05B 2UUAF 4NLPA 3SSSA 4Y2MA 4RZRA 3QIPA 3IXQA 2DNNA 3J81U 2CDRB 2XNRA 1RSCA 1CULB 2IDEA 3TP2A 4D3HA 2LA6A 2BDPA 4ES2A 1SC4B 4B3MF 3PG9A 3D6TB 4OV6A 2R8HA 4X62F 3L9ZA 2DHGA 3CJ3A 2FJXA 2IYGA 3HFVA 2LEBA 2QYGA 1DQ8A 4KGVB 1TK0A 1GNKA 1W7WA 5LSRA 3JXOA 3MPYA 1N6QA 1NB2A 3EXYA 4DQQA 3QSYB 4FBUA 4JV1A 3ISNC 4NWBA 1QTNB 2GMJA 4LF4F 4OI6A 4LRDA 4FYXB 4NLUA 3J7YI 1SJ1A 1X4EA 1U45A 4Z7YA 1VYAA 5T7LB 1FF2A 2OD6A 2CXEA 4PWDB 3MURP 3I6PA 3KJVB 1DY3A 3KYLA 2KM8B 4AL5A 3QQCD 1HQUA 2WCXA 3MEKA 1RQ0A 5HBMB 3MCMA 1JJ4A 4M5IA 4LFBJ 1S4EA 2YTCA 2LLZA 5E3RA 2KXFA 2QYCA 4PABA 2KVQE 2LQ5A 4LF1A 1FKAF 4ZJOA 4A8QA 3C16A 2XULA 4L73A 3ZO7A 3UR3C 2VC1A 2OTJS 4DSIA 2KM8C 3RRHA 1RTIB 1KVJA 1F2HA 3AOAA 5GADU 1RT7A 3CJTA 4IO1A 5IZHA 1NDLA 4DQPA 2ZBRA 3V2UC 1UZHA 9RUBA 2V68A 4M5HA 1FO1A 2Z30B 4JI8F 3VV2B 2CA9A 1BXNA 2HWHA 1S6PB 2XZWA 5KFHA 2OAUA 4K4YA 1TU0B 2ZD1A 2VFUA 3EZOA 4OI1A 2XLIA 5C25B 5AJ3J 5FIIA 3MMAA 4KIAA 4PXEA 4CRJA 3RBDA 1HPZB 4A8MP 2RVJA 3OR2A 5HANA 4P74A 2E1RA 2HG4A 3FK4A 4CLFA 5CZXA 3G86A 1U1LA 3SQGA 1H0HB 1WEYA 4PRFA 1TKTB 1XR6A 1TKXA 2CQ4A 2GIFA 4K0KJ 3EWGA 2AU0A 1YBUA 2ASDA 3Q8UA 4DN9A 3IBWA 4LIWA 1CVJA 2X1GA 4C3LA 4HKQA 4PG4A 4ZJQA 2IM0A 4ZCKA 4DPWA 4M63A 3IN5A 1LWXA 2IM3A 2WVFA 5JMNA 3CJQA 4IFVB 4ZVFA 1EX8A 4DV1F 2M7SA 2HNDB 1ELOA 1KOOA 1MU2B 2XQCA 4OYMA 2J8SA 3UPFA 2AYMA 4DJBA 4Y2AA 2WBRA 3A3PB 4M94A 3GMGA 2DIVA 3W3SA 4EYIB 4NCAA 2LMIA 3ZTRA 5CD4A 4B9TA 2H48B 2FLNA 2M9KA 2B3TB 3MAQA 4DMZA 2C2EA 2FZGB 5CCMA 4PQAA 4ZCIA 3AHPA 4J9QA 3EUNA 2G1DA 3KHGA 4DXLA 2HYIB 4QYZJ 5KFXA 1U1NA 2G2YA 3DOMA 4X4SA 5EWFA 4PG6A 1TL5A 1R7IA 1JLFB 1FJCA 3KXDA 1RHRB 3UO0A 2NXNA 4CLSA 4O3NA 4OI3A 3I87A 2KYZA 3BM7A 2X51A 2DGTA 3POTA 4ELUA 3DRSB 4I6YA 2DB1A 4KGMA 1XN9A 3QT6A 3KJNB 1VQYA 2UUBF 5DLFA 2B4PA 2F3JA 5EHHA 4X65J 1EQMA 2OO4A 1HHQA 3PFEA 1RTZA 4IG3A 3M8RA 5D8HB 2BOAA 3CB4A 1MMLA 3NY0A 3H5SA 3K5PA 4Q0BB 1K1SA 4KH1B 2XHWA 1IBCB 3TOQA 2DXDA 4ED7A 3PRBA 4Z37A 2R3VA 2JEJA 1AXQA 4DUYF 3ISND 4TU8A 1VOMA 4EYHB 2XYGB 3HD2A 1FVQA 5AE3A 1YX2A 4IFYB 2ACYA 2WSEC 1DRZA 1ZAVA 4KB7A 1X0FA 2L3MA 1MMDA 5C2GA 2KRRA 2FVQA 4AL6A 2YBVA 3IMQJ 4O3OA 4UTGA 2WAQD 1NZAA 1RP5A 1UL3A 3O44A 2CQ1A 5J2NA 4IG0B 3BKUA 2VQFJ 5E5NA 1M5VC 3SDEB 1ZAWA 2B9EA 2FJWA 1TZ0A 1WF1A 1N52B 3PZPA 5KG7A 5FLXY 3IO1A 1HW8A 1BQMA 5LMUJ 5KFYA 5HI7A 3V4IA 1WTBA 4CQ1A 1FK9B 1BUXA 2F4FA 1GMVA 2GAGC 3N5BA 1Y0HA 2MDAA 3EGZA 5M2PA 2KU7A 3F56A 1WC4A 4YR2A 3G96A 3D1HA 2A1BA 2YWEA 1ZAXA 2FY1A 1RACB 2WONB 2RNEA 5DQHA 2FTRA 1SIWB 2MKSA 3R27A 2XWXA 4WIQA 3JAMU 3R7SB 2FJBB 4ECWA 2JH3A 1BE4A 1F9HA 1QY7A 2NCKL 3EXCX 4HH0A 2BJEA 3SXLA 3VQTA 5C42B 4ZVRB 2CKWA 2HS4A 2E44A 1XNRJ 2PGCA 4WPAA 4ZN1A 1ZA1B 1B0PA 2U2FA 1XMBA 4YEAA 1QM9A 3CD6S 1AUDA 1FRMA 4AYBD 4JV5J 5C7PA 3EGVA 5IT0A 3L09A 4B9SA 3M6UA 1MN9A 1S49A 1HYSA 2HQ3A 3NS7B 4WFZA 3VGSA 1S9EB 2DVIA 3A1YG 4P7VA 4DL6A 1N5YA 4KPCA 3OVSA 2V0NA 3AFGA 3OFFA 3DRPB 4LF9F 2HHHF 1I51B 1Q4RA 3DDIA 3RZAA 3T9NA 3CJ2A 4DQRA 4OYPA 1LWEB 2B4VA 5LXRA 3SCKE 2R8JA 1JIHA 3C14B 2I38A 1FKPB 3QATA 4BC7A 3MUTP 4JV0A 2FY8A 3ILJA 1HBOA 3HM9A 2J0XA 4DPOA 1SKSA 1X8DA 1TV6B 1IM4A 2KZMA 4ZLJA 1UVIA 4CTAB 1PO6A 1T94A 4EBCA 5HLFA 4HHHA 2W7PA 3UN5A 3BN4A 1R8CA 2W24A 4ZVGA 5KT3A 3UW1A 4ELTA 3DXSX 4ZMMA 4DR6F 4ILRA 5IS2A 3GE9A 3IS9B 4ZVTB 1HNZF 2OD4A 1AFIA 1KLMB 3MM5B 2F5GA 4MK8A 2HFUA 3BJYA 1TP7A 3VAJA 5BR8J 1U0HB 4YY3F 1GXUA 5J2QA 2UU9F 2V2ZA 3W2WA 3OPKA 1S0OA 3EPIA 3PKMA 1I3OB 2G1HA 1FHTA 3H25A 1QAIA 4HT7A 2FJDB 2BKOA 4MIWA 1HWKA 4RL1A 1XR7A 3NS5A 2XCAA 2CNLB 2JVRA 1WF0A 2LQBA 3PW2A 2XZTB 3DLEB 1F6TA 1B70B 1VQ7S 4NZ0A 1SJFA 2DT9A 2HNZB 1GH8A 4CZCA 2KL8A 4KO0A 3RAQA 2V8VA 3J7Z5 2GGPA 9ATCB 4MT1A 4OYIA 3LO3A 3LP2B 2ZHAA 2JDJA 3IG1B 3S6EA 1FD8A 2B51A 1ZOTA 4D3GA 2LVWA 2AGQA 2VA3A
chains in the Genus database with same CATH topology
4JV5F 2BOPA 3N0VA 4F25A 2R7XA 1DFDA 1ZTWA 4FXWA 3ZZUA 3KLEA 3U7JA 5DLGA 4RW6B 4FP9A 4DL3A 1JX4A 2VL1A 1HBNB 4B17A 3NGKA 2XY5A 5IM0A 1EP4A 1GAOA 1HQUB 5A8RA 3LWLA 1S0NA 2YNGA 3CDBA 3G6YA 1DJ0A 5A8KA 2ZZMA 1YWXA 4OJ1A 4A4JA 4QU6A 2PA3A 1KN6A 2UUWA 5J1EA 3MXHP 1NRKA 1X5OA 5HN0A 4XK8C 3CSKA 2F1FA 2XMVA 3IFEA 3NGDA 3CD0A 4DFPA 2KHCA 1RA7A 2UUTA 2M5YA 4OHZA 2C2RA 2PC6A 1Q86T 3BQ2A 3QO9A 4I1TA 4NLVA 2X1BA 1JLEA 4Q44A 3WDOA 3OXFA 1CC7A 3K8VA 3Q24A 3UE2A 1OSCA 3T19A 4ECQA 4C9DA 3HLUA 1H7WA 3TYTA 3GIMA 2NUHA 2GMLA 1SJ3P 2O66A 5K9FA 1NJXA 1S97A 2V9WA 2MZTA 4JBCA 2QEXS 3MMBA 4I4BA 3CXCR 3TI0A 4MKAA 2PO4A 4QIVA 2RU3A 4ZPAA 4DDFA 1IJFB 1C0TB 1R0AA 3NNCA 4YDXA 1SV5B 1V3SA 5KG2A 2QMWA 1FJGF 3THTA 2XGPA 1ZH5A 2CPZA 1E6VB 2L9NA 2KI2A 1HI1A 3M1VA 3N6MA 3F41A 3PEHA 4Y34A 1I94F 2CDQA 2OLWA 2J6UA 3GB0A 1UEUA 3WZ0A 2R8KA 4FYDA 2GW8A 2M0GB 3U02A 4XO0A 3M9NB 4QR1A 4B9MA 3MR3A 2LU2A 3AA8A 3RW7A 5KG6A 2XY7A 2I1RA 3L7OA 3NP5A 3I4PA 1G3OA 4YHHF 2HLTA 2K2PA 1RT7B 2HRYA 4CH7A 2CQGA 1HWUA 1F0XA 2KRBA 1FT8A 5D3GB 1Q79A 2E1MC 3ZFVA 1OSDA 5CH7B 5DGBA 2WTFA 1VK8A 2IJNA 4FZVA 2N7CA 2WOMB 3DLBA 4G6VB 4R25A 5KFOA 3MD1A 4C0BA 2NYIA 4Y00A 2AV5A 3BEGB 3LQVA 1S9GA 3L95X 4MYUA 4RU9A 4RW4B 1HWJA 3OR1B 4ZVHA 4EGLA 2V5HG 1K73T 2IVYA 3MMJA 2QT7A 1R8BA 2X1FA 1HWIA 1YJVA 3Q8RB 3UFCX 1RTDA 3ONQA 4TY8B 4NA2A 4TYAA 2FIUA 5K8PA 7FD1A 4F2SA 4A8XA 1Y7PA 4KJIA 3LH2S 3LP0B 5B0GA 2OPQA 5BYRA 4DV2F 5I42B 1KQSR 3OVAA 1GXTA 2ZD1B 3C6UB 1J5OA 4ZP6A 3Q23A 3TQ1A 4J9NA 2JEIA 4USJC 2WSFC 4OMFG 4ERDA 1FKOB 4YP3A 5KFAA 2OPSA 5IWAF 2W9AA 2YWGA 3OTDA 2F8HA 3D5MA 3KLHB 2GCFA 2JFKA 2CZVC 4OHWA 3TVZA 4DUZF 4U7UK 3MMAB 3MMCA 1JWWA 3S7RA 1VBXA 4IQMA 1IN0A 2KO1A 3OR2B 1VS3A 5K8MA 3BQ1A 1UVLA 3KHHA 3CCUS 3NG8A 2CPJA 5EWEA 2GHWA 1IQZA 5KFRA 3GWCA 4DSKA 4Y3CA 4QWAA 3PY8A 4Q8EA 1L3VA 2C28A 3IC1A 2ZJRQ 3K57A 2NSBA 3DHWC 1RTJB 3SQGB 4NLYA 3CUNA 3ZC4A 3M9MB 1K0VA 3T5KA 3DYAB 4XPCA 3HHLA 1TL4A 5BR8F 2RE1A 1FTRA 1RJJA 2EPIA 3J80Y 3MEEB 3OSNA 2E9RX 3JTNA 2QZ8A 2GV1A 3ZZTA 4IQXA 4TNOA 3BREA 4NYPA 3Q0AA 1FEEA 3BS9A 2EBGA 2JJ4D 2HFNA 3K2YA 2EFNA 1J2VA 3TAMA 1WG5A 1TKXB 2CQ0A 3IGNA 5KAKA 5KFVA 4Z2XA 4GO7X 2P9EA 1LFPA 4JI2F 5KT6A 3B82A 3MM9B 3O3LA 3Q8SB 1RI7A 1ZBTA 2Y1RI 5LXYA 1KS2A 5F9NA 4ECTA 4EU0A 2L9WA 2WK4A 2R7SA 3HVWA 1NJWA 4K4UA 5AE1A 1FRHA 1MWYA 2KT3A 2GHVC 4MFBA 1H38A 1WACA 3FJ2A 2XMUA 3C46A 2MQPA 5DDOC 4N76A 3CCWA 4I2PA 2IRUA 3SV4A 2DHSA 2ZH6A 2GJIA 2W4CA 3G8TA 1X0PA 4DR4F 3THVA 4B9VA 3NMAA 5E3AA 4WYLA 2BQUA 2APOA 3IR7B 3PR4A 5A6PA 5JXSA 2U1AA 5G0RB 2CZ4A 1H6KX 3NCPA 3BF4A 2HAIA 1FE4A 2BR0A 4NCGB 1SKWA 1T02A 2XMWA 3R5AA 2JC0A 5DQIA 2R7TA 4C3KA 1ROFA 3I0RB 5D4PA 2GO9A 1R8AA 2PFFB 1FRJA 2MJNA 2NUUG 4DV0F 4DR3F 4JI1F 2CVIA 4RW9A 4ECSA 4ID5A 1T05A 3M6VA 3RYLA 3W2VB 4EUVA 2E66A 2MKCA 2CQBA 4B08A 2YKAA 1S6UA 4ZLPA 1R8HA 2QA4S 4Q8FA 1HA1A 3UCUP 5KFEA 2A3JA 3MTKA 2FLPA 1UFLA 3GV7B 1XC9A 2K3KA 1X4HA 2MZQA 3JSMB 3V6DB 2EI5A 1DTQB 2RQMA 4J9KA 2Q66A 5LJ3Y 4ID8A 1ZM9A 1L3TA 1U1PA 3K58A 4ECZA 1U48A 3G4SS 2YH0A 2QLWA 4H4KA 2XSJA 3E3XA 1P8GA 3KNGA 2UVWA 3IWLA 1M5PC 2FLLA 4MJKA 3B78A 4K0KF 2F8MA 3ICLA 2ZC4A 3ZZPA 2YNHA 4GKKF 2FJVA 4YR0A 1VIXA 2BRLA 2LU1A 5KT2A 3R1HA 3T5JA 3KLIA 3BR9A 4ILMA 4YB1P 1H2UX 2QA1A 1A7GE 4JUZA 1UP1A 2OKQA 5KTQA 3E51A 3BGFA 3Q2TC 4YUDA 3I31A 3TUIC 4RW8B 4L72B 1D9DA 2R9LA 4C8ZA 1Q1KA 5IT9Y 1VBYA 1U4BA 2DJWA 1S1XB 5H1SV 5SZTA 3FFIB 1URRA 1V3RA 2AX0A 2D9PA 5C24B 3PX0A 3ITHB 3QWUA 4DL0C 2EK1A 2MPUA 3P6YC 3BSNA 4I2QA 1S1VA 4HI1A 4TU9A 4Y2CA 1T03A 4IDKB 5HROB 1F5CA 3DU5A 2C3UA 1BQNA 2V4JB 4Y65A 2DR5A 2IMWP 2MQNA 2JLFA 2DH8A 1U1MA 3OHBA 4ZK7M 3VZIA 2ROPA 4I69A 5DDQC 4QWCA 3NNAA 4J9SA 2C3OA 4NYOA 2C22A 1SL2A 4DL7A 3O8WA 4HI2A 2JZ5A 5F3TA 4JI3F 1LW2B 3A8EA 1VQ6S 5B0DA 2R2SA 1HQEA 4Y2IA 5LT5A 5J2MA 3TX8A 1C1CB 1FKPA 4H4MB 1Q16B 2AYBA 1D1UA 1TFWA 1IR0A 2YWHA 4F3OA 4YB7A 3PW5A 1REVB 4WFBQ 3LALA 3BGRB 3NCRA 5B0FA 3OXGA 3MM8A 1S1WB 3KG1A 3CCRS 3MM7B 5T7LA 2W9CB 4NLTA 5KG1A 4AXJA 2R7WA 2OSRA 5F8JA 3POTB 1JKHB 4PWDA 4XPEA 1HI0P 1AFJA 2D74B 2A18A 2DD8S 4CH0S 4P6QA 3KJVA 2F40A 3NMRA 1N36F 1ULRA 1WTFA 4AXIA 4WTYA 4ZP7A 2MQOA 4U7CA 2EK6A 2Z2LA 2BBEA 3DLHA 1BLUA 2VPXB 3PW7A 3MOZA 1NNDA 2ABYA 1E6YB 3NBPA 3PEJA 2CPIA 2RT3A 3DCAA 2IRYA 3HF5A 5HBMA 4NLDA 4IG3B 3MI7X 4PQUB 4K4SA 1SH3A 5L1IA 1UKUA 3R3TA 3TARA 1YJNS 1B0TA 2XC9A 2B0GA 4KV8A 2B4UA 1TL3B 4ICLA 2ZBIA 2J0WA 4Q2LA 3E01B 2PMZD 1RT1A 1U7LA 3K8WA 5FJ4A 4L3NA 3CIZA 1QAJA 4X4UA 2M4MA 5F8MA 3NS6A 4EEYA 1UVNA 4ED0A 2RILA 4B02A 2Q3PA 4V19J 4AL7A 3VALA 3D2WA 1Y3JA 1FA0A 2C3YA 1XNQF 3E2EA 2CPHA 2BA9A 1IKXA 3RAMA 2K8GA 5D78A 1P27B 2W7AA 3MHYA 3I5AA 3M2RB 4R5PB 3UCZP 2VONA 5KFUA 3CMES 2B6AB 2B9XA 1R27B 1X7VA 3QPIA 4C98A 3KK2B 3OFEA 4JI5F 1SJRA 3IA0A 4LF8F 3M8QB 3VCDA 1S4FA 1N5QA 1VK3A 4OFZA 3Q8QB 4ZP9A 1RTIA 1WEXA 4B3RF 1U1RA 2AJ1A 4DFMA 2J9EA 3M4XA 3J7ZT 3RB0A 1CLFA 1UA1A 4ZHRB 3TA2A 2MGZB 2WHOA 2MYFA 1TUVA 3JSYA 3TRGA 1VIOA 3PO5A 3U1MA 1VQSA 4Y0FA 4WZMA 4CO3A 2IMOA 2MZSA 2W7OA 4YFUA 2CJAA 4MTPA 4AUKA 5J2NB 5M2UA 1LKZA 2CJBA 4X65F 3QGHA 5CYMB 4OX8A 3DRRA 2KN4A 3OTBA 3BSOA 2EFPA 4EBEA 1Q8LA 1JLQA 5KFTA 1T7PA 1S6PA 1UWBA 2VUGA 2B7CB 2WRMA 5L9NA 3RAXA 1TK5A 2J0QD 3DI6B 2VH7A 4O3QA 2FVSA 2BANA 4QCLA 1V9OA 3RB3A 4OZNA 2DGOA 4RLEA 1WEZA 5L9XA 2IBOA 2W4PA 3N6LA 1R6YA 1Y5IB 1PC5A 2J7WA 3V6KA 1YBAA 2C3PA 4NRTA 4IOCQ 5C25A 4KRWA 3IAM9 1BQMB 3IR5B 2R2UA 4F2RA 4B9LA 4TY9A 1HPZA 2N7YA 2M8HA 3V4IB 3O5TB 1VQ4S 4P2SA 1YRXA 1HD0A 2VG5A 4X4OA 3T5HA 4ZVEA 1YSJA 3DLGB 2CG4A 2J8AA 1RT4B 2YKMA 4OLOA 3SEOA 3TVKA 1JJ2R 1LQ9A 4JOUA 4BHQA 5CHCB 3SZ2A 4RX6A 1XMQF 1FRLA 1GQEA 2E7XA 3H20A 2BJDA 2QE5A 1KQGB 1T3OA 4NMLA 4U6PA 2HHUA 5EUHA 3R1LA 3H4DA 5KFMA 3BZQA 5KFCA 3E8OA 2DNMA 5DG8A 3OUYB 1MMNA 1MW7A 2VD3A 2BE2A 2I2YA 2EG1A 4FXVA 2ASYA 2AD9A 3I5CA 1FXDA 4OV1A 1HR0F 2RF2B 2W4DA 4C8MA 2PI4A 4A47A 4ED6A 1HBMA 1G1XA 3MAHA 3PV8A 1SUQB 4MK7A 4EWTA 1D8YA 1TKTA 3AJ2A 4OX6A 2FJEB 1NK5A 1NH7A 2P9CA 2ZKUA 3DMJA 3FEXB 4ECRA 3LP1B 2B43A 3MEGB 4ZCMA 1NJZA 4OZLA 4DG1A 3MEDB 1LOUA 4J9MA 1D3WA 1P1TA 1RTHA 2FC8A 2XBPA 4ECXA 4FF1A 2W9BB 4YQWA 1RT5B 2VQFF 1V3ZA 1TKDA 3G9CA 1JXEA 1RDRA 4PG8A 3DN9A 4TLQA 1QVFR 1QLNA 1HNVA 3M2VA 4KQZA 4F4XA 2O3DA 4RUHA 3GV5B 1VQMS 1K0TA 3OXLA 2R4FA 2DR7A 2YKNA 4HLBA 4RW7B 3KG0A 3CJ5A 3CT9A 1X4CA 1Z2LA 1OWXA 3AQOA 1S9FA 1WHXA 2IM2A 3MF5A 3MZIA 4YDDB 4QJVA 3FVYA 2CRLA 4ZPWR 4DLGA 3ZZRA 1U09A 4Q2MA 1X9MA 1NJIT 2FD2A 4ED3A 1W2IA 2QLXA 3JYTA 2VQEF 2GNKA 4N8OA 2CYYA 5KFIA 2UVRA 5DETA 3CMAS 4RUCA 2VG6B 1N5VA 2HVIA 5LMUF 4Y6IA 1RKIA 5LSOA 2ZVSA 4DR7F 1TKZA 2IVMA 1L3UA 4FF2A 3TVYA 1ZM4A 3NAHA 4IH7A 3KLFA 1RT2B 3QJJA 4IFVA 4BBYA 2QFJA 2DNPA 2P6SA 4RNOA 4PR6A 4KTQA 3BGLA 1U49A 2PT0A 4EBDA 2IRXA 3GFYA 2XI2A 5L39A 4USIA 2MQLA 5F8HA 2LDYA 1ZZFA 1RT3A 3KFWX 4NCBA 3I96A 3EZ5A 2DK2A 3KK3B 2HNDA 5A6WA 4DFJA 5KT4A 1HYSB 5KFSA 1HD1A 4IR1A 2DO4A 2VFRA 4RNMA 2MJUA 1MU2A 2DHAA 2ASLA 4N77A 1WWHA 1IBLF 2ROEA 5CQGA 4CI0B 2AWZA 1YRTA 4F3QA 1N5YB 5D4OA 5E3QA 1KTQA 3M6XA 2VZ9A 3CCSS 3TA0A 1UW4A 5J1NA 2MZJA 3CC2S 4LSLA 3N9UC 4Q45A 4WE1B 3TAPA <