3K7RA

Crystal structure of [tm][cuatx1]3
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
70
structure length
70
Chain Sequence
EIKHYQFNVVMTCSGCSGAVNKVLTKLEPDVSKIDISLEKQLVDVYTTLPYDFILEKIKKTGKEVRSGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tetrathiomolybdate inhibits copper trafficking proteins through metal cluster formation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
molecule keywords Metal homeostasis factor ATX1
total genus 19
structure length 70
sequence length 70
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2009-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3k7rA00
1R6YA 4U9RA 2FB0A 1VQYA 2OFGX 2VH7A 2W4DA 3BB5A 4NPOA 1AFIA 5B0AA 2LDIA 1SB6A 1SQEA 2OKQA 2XMJA 3HFKA 3HHLA 1P8GA 4HH0A 3HHLD 3FGVA 5A6PA 1S6OA 1QUPA 2ROPA 3HDSA 3HHLC 4OJ1A 5KAKA 2IYIA 3LGNA 1YJUA 1CC7A 1Y0HA 1FD8A 2PGCA 2AJ0A 1TL5A 2GCFA 3FMBA 2OMOA 3WDOA 1Q8LA 2Q3PA 4Y2MA 3F44A 1OSDA 2FTRA 3BN7A 1YJTA 1V3ZA 2GV1A 2AJ1A 1MWYA 2HQIA 2K1RA 2QLWA 2CRLA 2XMTA 3HF5A 3MCSA 3QMQA 3T9NA 4A47A 4EFAC 3MZIA 1Y3KA 1KVIA 4A48A 2JDJA 2ROGA 2BJDA 2OFHX 1W2IA 2AW0A 2K2PA 2KKHA 1OQ6A 1WD6A 2BYCA 4OIXA 4OJHA 4ZA1A 3DCAA 1U7LA 1N5TA 1Q53A 5F0WA 3E8OA 3BF4A 2GA7A 3BDEA 3CJKA 2XMKA 2HFNA 2ROEA 4HI2A 2N7YA 2OD6A 2XMWA 4Q2LA 2ZDOA 3CJKB 1TZ0A 5F0UA 2K7KA 4HI1A 3TNVA 5B0CA 3BR8A 2K7JA 2G9OA 1TL4A 2LQ9A 1AW0A 5B0BA 3HX9A 3FRYA 1OPZA 4FNHA 2HLTA 1KQKA 3TRGA 1CPZA 3DXSX 3IWLA 4OJ3A 2RMLA 2HIQA 1P6TA 2RILA 4HH1A 3TOQA 1Q4RA 4Y2IA 4DPOA 2FHMA 2KYZA 2BJEA 2EW9A 2L3MA 2W4CA 2QYCA 2OAUA 1FVQA 4NL5A 1ULRA 1URRA 2ACYA 1JK9B 2HFOA 2OP5A 3HHLB 3KNGA 3UDCA 5B09A 5K9FA 5B08A 3QGPA 1FEEA 2KT2A 1FE0A 1N5QA 2QLXA 2GO8A 1GXTA 3K7RA 2BBEA 1MWZA 1CC8A 2N4CA 3IWXA 2RSQA 2FIUA 4YDXA 4YEAA 5A6WA 4QOTA 2XMVA 1N5SA 1S6UA 2LQBA 1IUJA 1X8DA 1Y9OA 5T7LA 5B0DA 1Y3JA 1N5VA 2RU9A 1YJVA 1K0VA 1YRXA 1YJRA 1Q8BA 2KT3A 3LGMA 2BUNA 3KKFA 1TUVA 2XMUA 1RJJA 1X0PA 2K1RB 4HL9A 4A4JA 3LO3A 3BM7A 4OJGA 2GFFA 2ASYA 1XBWA 4FNIA 5B0FA 1OQ3A 5T7LB 2PD1A 2IYGA 2ZDPA 2QIFA 4ZOSA 1SI9A 1JWWA 4DL0C 1KVJA 3VTIA 2XMMA 3KG0A 3KG1A 3GZ7A 4DN9A 1X7VA 2LXFA 1VQSA 2GGPB 2GGPA 2N4DA 1AFJA 1GXUA 5IXUA 1FVSA 2IFXA 5B0EA 2VV5A 4Y2KA 4F67A 1APSA 3BGUA 1FE4A 1LQ9A 2OD4A 1FESA 1TR0A 3I9ZA 4A46A 2W4PA 2HLUA 4Q2MA 1YG0A 2AP6A 5B0GA
chains in the Genus database with same CATH superfamily
3W64A 2D69A 3LA0A 1MROA 1ZM9A 2RF2B 3I5BA 4CNYA 2HVZA 4MIAA 1VRUB 1P27B 4BCAA 4RNFA 3HSZA 3R1HA 1SB6A 1SQEA 4I6YA 1GT8A 3IG1B 5CCLA 2XS2A 1FKPA 4FP9A 2Q6BA 4QR1A 3UPFA 3V81A 3HMJG 5BR8F 1BLUA 1NLKL 4C0OC 1LKZA 1XIQA 4PXCA 3O8WA 1DZ5A 2IPOB 3VHQA 3JB9k 1ZM4A 1CJVA 1VR6A 2LU1A 3FDSA 2FLPA 1OY6A 1KHWA 1RBOB 3NCQA 3PRBA 4RW9A 2NPFA 1UETA 1BC6A 3PR5B 1NK0A 3M8PA 4FYDA 1WF0A 3GE9A 3NOCA 4I1TA 3MM6A 2OPQA 5DG9A 2FVCA 3C15A 4B3SJ 4IQXA 1GXLA 1RI7A 3M8PB 4IQMA 4ZPDA 3HVAA 3ULHA 5L1JA 1U47A 4K2XA 1QAJA 4DX5A 3QMQA 4EFAC 5K20B 3AD7C 2W2OP 1Y00A 1RWNB 1MU2A 1YDLA 2DR9A 4DV4J 3RB0A 1EHWA 2NQPA 4DR6F 2ZD1B 3DGPB 5EX3A 2Q1LA 1OPIA 1PAUB 2ZVIA 3M2UA 5BXIA 3JYTA 3RB3A 3BF4A 3IS9A 1U2FA 1HBUB 4CO0A 1N0VC 2XMKA 3R7SB 5LSOA 3FBBA 5SUHA 1YGYA 2PN6A 3GSDA 4ATNA 4B9TA 1F1BB 5D0EA 1I3OB 1H3DA 2WVDA 1BWVA 1TVRB 4IFVB 5E3RA 3GFYA 3W2VB 2CPYA 3BGRA 2XGPA 2X1AA 3QAEA 2ZNYA 5B0CA 1YBUA 4RJVA 1D8YA 2PA3A 4EGLA 3SYZA 4IOCQ 1NK4A 1WACA 2HAIA 4IH6A 5DM6Q 3DC2A 5DGAA 4O3SA 2H4YB 4ZP6A 1RKJA 5F8HA 4OZ0A 1GAOA 1UEUA 3HT3A 1C0TB 1RHUB 3NGSA 2QSFA 1H38A 1Q4RA 2FHMA 3AD8C 3HVWA 4N77A 2GIQA 2EXUA 3ZZTA 1IR2A 3D6HB 4W4MA 3TO8A 4OX9J 3UFCX 4DUYF 3MCMA 1KS2A 2LA6A 3FCHA 3VAKA 2DHXA 1ZYQA 5K9FA 2JEGA 4EZ6A 4B3OA 4ZS6A 4Q7AA 1AZSA 2LCWA 3C3LA 2NSBA 4ZVFA 2NR0A 2CNNB 4FF3A 1SPBP 2B9EA 4YDXA 4Q8FA 1Q78A 3DXBA 4H4MA 1JKHB 1RA7A 1RU1A 3K8VA 3ICLA 4RW7A 3ZNJ1 1WJ9A 3GG1A 4U7UD 1Y3JA 1HD0A 2RU9A 1JJ2R 4B9SA 2V9KA 2XS5A 1LEOA 2LYVA 2W8KA 3CMES 2QMWA 4CLPA 2MLZA 2POKA 4DR1J 2L9DA 5U47A 2WB4A 4A4JA 4JI2J 1YLXA 2GFFA 4I0WA 5DQIA 1N4LA 4ID5A 1KOHA 5IOLA 3HI9A 4KT0C 1NKBA 2XB2D 3MMCA 3QRPA 2PD1A 5DM7Q 2ZDPA 2XYHB 5FIIA 1H0HB 1SI9A 2KXHA 1UWBB 3EGNA 3KLVA 1VISA 4L76A 3VTIA 4LMZA 4LJMA 4DN9A 1XR6A 3H2UB 4RZRA 4LR7A 2UUWA 4KKOB 4USVA 5GVQA 1TV6B 3NRBA 2ZBPA 4FKXA 4FVCA 5KFXA 5HMZA 1IBMF 2Q43A 4LRFA 2EFGA 1RWXB 4GC7A 1SL1A 3H5XA 2MKYA 4DN0A 1T02A 2MYFA 2OSRA 3S01A 5I42A 3VQSA 2DXEA 5ETMA 3OUYA 4ETXA 2DNYA 3IFEA 4W98A 4MH8A 3BKTA 3Q8RB 2N82B 2ZJQQ 2V6AA 2BJ9A 3QFHA 3BSCA 2BANB 1RDRA 3RBXA 1HBOB 4ZN3A 1AFIA 4ZPTR 1SL2A 2F7VA 3SV3A 4JI4F 4IOAQ 8RUCA 3H5SA 2FHKA 3NBPA 4MFBB 1R89A 4Z37A 1H73A 2J9DA 5A6PA 4WCEQ 3SFUA 1FT8A 1IBLF 3ILJA 3GV7B 3D9BA 4KH0B 2H54B 3LGNA 2AZ3A 3FQLA 2HVEA 1FD8A 4X84A 4IG0A 2PMWA 3TEGA 2BM0A 1BXNA 4K4VA 2ZE2B 5M2PA 5IZHA 2E9TA 1L3UA 2PMZD 1TL7B 2WOMA 4QYRA 2IC3A 1VI7A 2MY8A 3PW0A 4ILLA 1R8CA 2DITA 1JQGA 5AXKA 1ZH5A 4CLSA 4WFNQ 4DJBA 2BACA 4KO0B 5KFDA 2MB0B 3MCSA 3NEKA 3M2VB 1Q82T 1GQEA 2HGMA 1VQ4S 2YH1A 1WSRA 1VRTB 3M8QB 4USMA 2ZH1A 4RW6B 4W90B 4V19X 4CO1A 2K2PA 2DEIA 2KXNB 4QWEA 3MWBA 4WP9A 3R3TA 2KHCA 1A6LA 5ETOA 2XC9A 4DQPA 2VQFF 1SIWB 5KG0A 2IM2A 4KY3A 1HBMB 1RE1B 4G1QA 1FKOB 2IHR1 3FZBA 1RTJB 2F3JA 2MZQA 3ENVA 3TNVA 5K8NA 3OL7A 3KJVB 4DQSA 2FDNA 2PFFB 2KN4A 2FJBB 4X4VA 3MCOA 2IC3B 4LRDA 4F02A 2BOAA 1AW0A 1KBRA 2BX6A 2DGSA 5ETVA 5GAHU 4ED6A 2B6AA 1NDPA 1YBAA 4K5RA 2I9SA 3QYYA 2OH2A 2DHSA 2OPRB 2NXUA 2R7OA 2M5YA 1C0TA 4NA3A 6FDRA 5M2UA 4L3NA 3K5LA 3CCRS 3TOQA 2PSZA 2V68A 4DPOA 4CNZA 2MGZB 3TP2A 3GTYX 2HNDA 1H6KX 2ZBQA 3M05A 3OTEA 3R6LB 3ZZ0A 3CNQP 1VYAA 4QBUA 4EYHB 4Q0BB 4KHPJ 4K50A 5F9LA 3Q83A 2XNQA 1GEHA 1HWKA 1WWHA 1WG1A 2RUGA 3ZTSA 2XMAA 2YWFA 3CJ3A 3MPYA 3TX8A 3OW2R 3SFGA 2XS7A 5I3UB 5ETPA 3A1YG 3K7RA 3T41A 3BSAA 5AXNA 1WNEA 1CC8A 3TZZA 3AQPA 4XK8C 4LF8F 5A6WA 4USTA 3D4JA 5D8HB 1FRJA 2QX0A 3PX4A 2HK3A 1DAXA 2VASA 2GMHA 5J2NA 1S9EB 2ZC4A 3T5KA 4P6QA 2F63A 4R8UA 4L75A 1YJVA 1HNXJ 2F8EX 3WBZA 1YRXA 1HBOA 1YJRA 2XM3A 1U2CA 3KLHB 3NAIA 3BREA 1U48A 2XHWA 3UN3A 2RNEA 5LOQA 2ERRA 1U24A 5C24B 1NK5A 3MXHP 4NRUA 4AQYF 4LF6J 1URNA 4HL9A 4ICLA 2FZKB 3D0IE 1UA1A 4ZJOA 3EPIA 1XNRF 3IM8A 3LP1B 3L7PA 4XO0A 1RUSA 2MLYA 3OBIA 1QVFR 4QYZJ 4DLEA 1YKWA 4ZIVA 2RT3A 2AJQA 4DQQA 5F8JA 1Y10A 3KG0A 1X4DA 2LXFA 3B82A 3NMRA 3ZTPA 1DBDA 1VQSA 4KKOA 5KOWA 4B3RF 5J1EA 3MTJA 4TNOA 5JUMA 5JMNA 4ECXA 2W7OA 5DZ6A 4LSNB 2LXUA 3PW7A 1P1LA 3MF5A 4MMOA 3RYLA 3UD5A 1LQ9A 2FHJA 3D5MA 4QWBA 2ZH2A 3MOZA 5J2QA 4A46A 1EARA 1HFEL 4M8LA 4LFBF 3LAMA 4DV3F 2XNRA 1NDKA 1REGX 1S99A 3MEEB 2O67A 2OFGX 2F1FA 4R5PB 4Q43A 4YB1P 4DUYJ 4J91A 4WFYA 3T1AA 5GAEI 4GKKF 3X3UA 1I94J 2HHUA 3FQKA 4A8MP 4GVBA 4Q44A 3M2UB 4I2QA 2ROPA 3D3CJ 2HQGA 4LQ3A 1RT2A 1E6VA 3PR4A 5A2QY 4A8YA 2XO6A 3FCWA 1X60A 2DT9A 4OQJA 4U6PA 2MKIA 2ZZMA 2R8KA 3BQ1A 4IR1A 1V6HA 1N48A 3N28A 2IVFB 3DN9A 4A8OA 1TUGB 3G87A 3UD4P 1Q81T 1UVLA 3U7JA 4KGVB 5KFOA 1XJWB 2HAFA 4UOCA 2HWIA 2CPFA 2KFZA 1GX6A 3CWJA 4NMLA 3MM9A 1KOOA 3L9ZA 7FDRA 2YY3A 5A8KA 4AQYJ 5DLGA 4G6VB 3QWUA 2YH0A 3VAJA 2YX1A 2PEBA 3DRSB 3HFVA 1IKVA 2HFVA 4DV1J 2EC0A 2R4FA 1KVIA 4KFBA 5RUBA 4WIQA 4DL5A 2UXBJ 3O5TB 4RU9A 1ZPWX 3E01A 1EJ7L 3V81B 2JH3A 2XZTB 2V69A 1HW9A 4RBVA 1SQFA 1SVDA 1RWPB 1UMJA 4N7TA 4PRFA 4OYIA 1N8RT 3MPDA 1RTDA 3CMQA 3MM8A 2ZHAA 5KFVA 4C8NA 2M8HA 2XYGB 3DLEA 4ERDA 4WYWA 2UVWA 3JAMU 5L1IA 1IXKA 1VHFA 4GO7X 2Y1RI 4NLVA 2Q79A 3DHXA 4P2MA 1FRXA 4RX6A 2VIHA 1S0MA 2DGWA 1D9DA 1RT4B 2COLA 2B8QA 3G6ES 3G71S 3G82A 1RBAA 2AEFA 5EUHA 1VJQA 2EVZA 3RG6A 2C22A 3DM2B 2MSSA 1O51A 1HNWF 1IKYA 2E1MC 2VBYA 4B3MF 2CZVC 2G1HA 3CC4S 2EEYA 2OEKA 3ONQA 5IC4B 2HIQA 2RILA 5C2GA 2BKOA 4MKYA 1FWKA 1VRQC 1WC0A 4DV5F 2EFNA 1IKWA 2H9ZA 3OR2A 3IG1A 4BHQA 2ACYA 1TMMA 3MMCB 4K8RA 1U1QA 2AU0A 3QWPA 3OR1A 1Q7YT 1D3WA 2FY8A 2J0XA 2R2SA 4F26A 4IRDA 3QRRA 4ZLNA 1T7PA 3M6XA 2CZ9A 4C11A 4B9UA 4ES2A 4OHZA 1FTCA 2DNHA 3R5AA 4ILRA 4DUZF 4Y2CA 1PYOB 2PFDA 2RD5C 2VFTA 3BZQA 1REVB 1JLAB 3TAPA 3FEYB 3NNAA 1QVGR 2VQEF 1U6BA 2EG1A 3F73A 3DOMA 2D9PA 4ELVA 5J1PA 5EWGA 2VFUA 2BJ1A 1SQGA 1AUSL 2P8IA 4I7FA 2QC3A 4MKVA 5KT2A 1EKRA 4DV6J 3QJJA 2BUNA 3MPVA 3ZZRA 1TUVA 3DLJA 5BYSA 1FWLA 3LP2B 4OLOA 4TQSA 3M8RA 3GCXP 2I8EA 1F2GA 1EKSA 3LO3A 4OI2A 1ZA2B 3P4UB 3DDIA 5B0FA 4UY8T 2DD8S 5D77A 4YR3A 2ZOFA 1SJ3P 1WEZA 2DO4A 1T95A 5HP1B 3WIVA 5A2QU 1X4FA 1X7VA 3CO0P 2APOA 4DSEA 4FF1A 1N52B 2B0GA 4ZVOB 1T05A 3W66A 5FJ4A 1Q86T 5K5MA 3UR3C 2FC9A 4LBPA 2CPHA 4DR1F 2KVIA 2CJ9A 1HWIA 2C3MA 4CT9A 4F67A 5GAGU 4KPYA 4NXNF 1SV5A 4DMZA 3Q23A 2DRBA 4RO0A 4UZCA 2V4JA 3BS9A 4XDDA 1N36J 1KD1T 3IBFB 5KFFA 2B56A 2XTJP 2VQEJ 3M2RB 4H54A 1H7WA 3ZZPA 1XR5A 3HFZB 2CQPA 5DJBA 3PIOQ 2DR5A 2HHQA 1S0VA 1C1BB 1R8BA 3FRZA 1VQYA 2D9OA 6AT1B 1T9TA 1J5EJ 1EETA 3D6FB 3DYAA 3FZ2A 3M6VA 3HM9A 3GR0A 1FJGJ 5GADI 4NE9C 2ZH5A 3UDLA 3I4HX 1NPRA 2ABYA 1HQUB 2I5JB 3L3CA 4Z7CA 4KGXB 1KEKA 2PIIA 1MU2B 1UJ6A 3SEOA 1F5AA 4WPAA 4XAKA 4C8MA 1FTRA 4MK7A 1FWPA 1LFPA 3ENWA 4HACA 5KFCA 3JTOA 2O66A 4X65F 1H72C 3ZZZA 2EG2A 5HN0A 1RAGB 3EXCX 1QLNA 2C42A 1SKRA 1JXEA 2BKPA 2UV8G 4ZP7A 4NLGA 3F44A 3FMBA 3EVWA 3R7BB 2HWHA 1D1UA 4TU7A 2RUSA 3OT9A 4LFCJ 4NXNJ 3TARA 1TKDA 1Y3KA 1P1TA 5A0YB 3PFEA 4A48A 3TVKA 3PV8A 3T3FA 2BYCA 2WAQD 3H8YA 5B09A 3T5JA 2C2MB 1E6YB 1NBEB 1U7LA 1JLGB 3HSJA 3DI6A 2VG6B 3BDEA 3PDNA 2EWHA 3QAUA 4NYOA 2MTLA 2ROEA 3BBBA 4JB8B 1W26A 1RTHA 4USIA 3FBFA 3I5CA 2N7YA 2IDEA 3MECB 3E51A 1HQEA 4FPIA 1DURA 1GMWA 6FD1A 1KQSR 2B8PA 3OR1B 4MKAA 3KLGA 3Q8PB 4O0NA 1Q0NA 3OXLA 2QMUB 4PWUA 4ELTA 2Y9HA 2C28A 2IBOA 4LREA 1IKWB 3OR2B 4NCBA 2FC8A 1WDTA 3CVKA 3D7SB 3QIPA 4FVMA 4NLTA 3UDVA 3WC0A 5DQHA 3RAXA 4DUTA 4HKQA 3KK1A 1OO0B 1RCXB 1V3SA 3DXSX 3LPEA 3SMZA 5ADZA 4B9VA 1WC3A 2QL5B 2Y1LB 1GFWB 2V9WA 4Y2IA 5CXTA 4KAIA 1HPZA 4I2QB 4LFCF 3BSOA 4CLUA 1NCLA 2QYCA 1T03A 2JWNA 2YBVA 5A8WA 3I6PA 4LF7F 3HHEA 3M30A 3TEHB 2RQKA 4R5PA 3UN2A 3C6TB 1X4CA 3D1HA 1GTEA 4LIWA 3TQEA 2QA4S 1LWCB 1VQ8S 5DQGA 2BR0A 4PUOB 4J5OA 4TXSA 2AJ4A 1RLDA 1JLFA 5AXLA 4PR6A 4C3KA 2KTQA 1LWFB 5KT3A 2CWKA 2N4CA 1RABB 1S59A 3IO1A 4USUA 5ETRA 4CH0S 3TR5A 1F60B 3AFGA 3NCRA 1YSJA 3RZAA 5CAAA 1SKUB 2CPXA 3MR6A 1B7FA 1B64A 2B9YA 3VV2B 3J81U 3GPAA 2IM3A 3PYFA 4I6AA 3H7HB 3R97A 1KLMA 2W9CB 3ZZYA 5KFLA 1WG5A 4X4RA 2BEFA 5HQMA 4DL6A 2C3PA 4DFPA 5E33A 5LMNF 1TTHB 1T3NA 3JQJA 3CJQA 3DLKA 1VC5A 3DLBA 3C6UB 2R8GA 2VONA 3OTOF 4ED5A 4L3KA 5AJ3F 1OQ3A 2VBXA 2AMCB 5HBMB 2KVQE 1R0CB 3BBFA 4J9OA 1FCAA 4J90A 2AEMA 4E2FB 3OJUA 2C2KB 1JJ4A 4HHHA 3KLIB 5F8MA 1L3TA 1DRZA 1VQ7S 2VA2A 4QJVA 4R8UB 1BGXT 3D1QA 2VV5A 1RT1B 1U0HA 2HS3A 5F9NA 4LF2A 3RB4A 1WC6A 1S57A 1MWQA 3BGUA 3Q86A 3CSKA 4BLGA 4DHVA 1APSA 1YRTA 3QGGA 4LR9A 1RK8A 4GMKA 3MEKA 4TVAB 3V2UC 5A76A 1RT6A 1ZZFA 5IV3A 1RGVA 4AL5A 1O6XA 2DHGA 5IQ6A 1JMTA 2QEXS 1IKXA 2HS0A 4USWA 2FY1A 5KTQA 1M0SA 1EP4A 3GONA 2H5EA 1RTIB 2VG7B 4FYVB 4ED8A 4OZ5A 4NA1A 3SV4A 2UXDJ 2WHOA 5KFJA 2J8SA 3R7NB 4KYZA 5E3AA 3B6BA 3JTNA 4QPTA 2VFSA 3HP6A 3TUPA 2G1DA 2CPEA 3KDNA 3NXZA 1WTFA 4O3NA 3NMAA 1WC1A 1IJEB 5LMUF 2JLFA 2YNHA 2OMOA 1I1GA 2B6AB 4J9RA 4JI7F 3GB0A 2HRTA 2BJ7A 4DS4A 3NGUA 4OZ3A 1MN9A 3HLUA 4GVLA 1NB7A 3T5HA 1RT4A 4C0BA 1RBLA 4LFBJ 1WKLA 1VIXA 3KUGA 2FTRA 1FRHA 1YJTA 2K1RA 4Y2MA 1K47A 2IVYA 3C14B 5IC6B 1LV5A 2IBKA 1UWAA 3C2PA 3OV7A 3KLHA 3CDAA 5GAEU 4IFYB 1DLOA 3MMBA 5C7PA 1NRKA 3MEGA 3D6TB 2WK4A 4X4TA 2Y3YA 3MHYA 3EGZA 1RT2B 2L9NA 2QRRA 3WX8A 3NNHA 2ZWOA 2G4BA 4OX6A 1NO8A 4LF9F 1C0UB 1N54B 3VGUA 2RE1A 4O4RA 1LWFA 1PC4A 4CWBA 7FD1A 1NH8A 2YNGA 3N79A 5H9FJ 4OI3A 1HQ2A 2DGOA 4JV5F 3AJ2A 3GIRA 2OELA 1TZ0A 2YPZA 5C5JA 5F3ZA 1WORA 2YNGB 1JLCA 1UZHA 2E7VA 3FBEA 4E98A 3DMJA 3RW7A 2OTJS 2VKZG 4TU9A 3S6EA 4ZP8A 2ZEJA 1PC5A 3UQSA 3KUHA 1NK8A 2I6WA 2A10A 1UPPA 4WTYA 2YKNB 3IWLA 2W8LA 4H4OB 1VIOA 1M5SA 3KHRA 4OYAA 4J9KA 5L39A 1IBKF 2FJVA 4W92B 2L3MA 2HURA 3WHIA 3HVRA 4DF4A 3WX4A 4CRJA 1B4SA 4NL5A 2J0SD 1HNXF 1HMVA 1T3OA 4FF4A 1FJ7A 3CCVS 2R7XA 1BQMA 3ENQA 1S10A 5DG8A 2CQCA 4F0KA 2FVQA 4Q8EA 1F5CA 1HBMA 2AWZA 2MKHA 2NXCA 5IWAF 1AUDA 2HMIB 1S6QB 2LKZA 3GV5B 4OL8A 1YQHA 4AXIA 2ILZA 3QGHA 5H9EJ 2VG6A 3VAMA 3K0JA 2CZ4A 3MFHA 1L3KA 4YHHJ 1PJ5A 1FDNA 3ITHB 3KLFA 1VDHA 5A0YA 3TVYA 3N5FA 4U95A 3KFWX 3KKFA 3GIJA 4I64A 1YK9A 1L3VA 1WELA 1VBKA 1GTHA 4ED1A 2D3OR 1S9GB 4NCGA 1EB0A 1RT6B 2YWHA 2HQDA 3OFEA 2ASLA 2DR8A 4FNIA 3CCJS 1RSCA 4MYTA 2DTJA 4ITSA 4WFZA 2DO0A 4WU3A 4NCGB 3AH6A 4ICLB 5KG7A 4J9PA 4F4AA 4MK8A 4JI1F 4K4ZA 1M1GA 4CCHA 4JP8A 1HWJA 4FBTA 1C1CB 3KG1A 3MPWA 5DLFA 1H98A 2WCXA 2WSEC 1QTNB 3SSQA 1R0AB 1AFJA 3D0GE 2VG5A 3PO5A 2P9GA 2KHDA 2M52A 1DFDA 3J80Y 5J1NA 3MAQA 1FESA 5D0GA 2P5VA 2WONB 3DRYA 2YX4A 1ZAXA 5CYQA 4DFKA 3CEDA 3I56S 3Q0AA 4QCLA 2VA3A 4ANCA 4O44B 3OVSA 1JXVA 4DCPB 2ZH6A 4JI8J 2UXCF 4J9VA 3RJMB 2D3O1 4KHPF 3BGLA 4P7TA 4DV2F 3I5AA 3PFOA 4NLQA 2AQ4A 2W25A 1XN9A 4KTQA 4RR5A 4CI0B 2DGUA 1N6QB 2I1RA 3HHLC 4OI0A 1T05B 3FEZA 2VODA 1NPKA 2J7UA 2MHNA 2IYIA 3H2LA 1EX8A 4NLXA 4UOFA 4ZVGA 4HHUA 4F7VA 3JXOA 2UXBF 2VDHA 4Z7YA 4PKDB 3RW6A 3R2DJ 4J9MA 2CVIA 5DZ7A 5E3CA 1G7CB 4NLWA 3C6TA 3TW0A 3FMWA 3G96A 3PRVA 1HHQA 3WZ0A 4B3MJ 4RW4A 5A8WB 2DH8A 3IGNA 5DDQC 1T11A 2KT5A 2AJ1A 3W2VA 4U7CA 1T8EA 1HYSB 3IAM9 2ZE2A 1Q7LB 4YDDB 1KQGB 2RS2A 2JL9A 1W25A 3C16B 1H74A 4WFBQ 5HATA 2HNYA 2HHHF 2J6TA 5AJ3J 4JI1J 1RT5B 3NGDA 1RACB 4OJHA 4YN3B 2G13A 3RAQA 4K4WA 1SJRA 1HR0J 1Q53A 3E8OA 4RNOA 3DRRB 3OLAA 4O3PA 3H4BA 2HVDA 2YTCA 1HNZF 4FBUA 2PC6A 1ZOTA 4KQZA 2F4VF 2WVCA 2UUCF 3PZPA 4X64F 2L48A 5IT4A 1FX4A 1ZAVA 2V34A 3CJKB 1PBUA 2VICA 4OYMA 3CCWA 3BPDA 4B3OB 4DR2F 4DCJB 1TL4A 3OFGA 4IG3B 4Q45A 5KG6A 2K06A 1CJKA 4CLZA 3JSMA 1CEZA 1DJ0A 3PTWA 2HSEB 1KQKA 1UPMB 1HKAA 1GK8A 2FQQB 1QUVA 4DQRA 4BC7A 3TZWA 4ECWA 2AKWB 5DO2A 4ENOA 4JI3F 2KYZA 4X4OA 3R5CA 2W01A 3QIPB 3F41A 4J9LA 2FVRA 3OXGA 5M2RA 2XY5A 1ULRA 4C8YA 1JK9B 2JZ5A 1RAFB 1ZPVA 4F4WA 1EP4B 1FEEA 4UF4A 3FJ2A 2DNMA 1K9MT 2ZFHA 3UWTA 1NSPA 1U8SA 2H1YA 4RW9B 2R7SA 3DLEB 1CJVB 1IWGA 2BBEA 2DRDA 3N5BA 3N9UC 4DEZA 4U96A 3RRHA 2RSQA 3CJRA 1FRIA 4ELUA 2VZ9A 1J27A 3AQOA 3VZIA 4KHRA 3W9JA 4FF2A 1T9WA 1RT1A 3MAAA 2AZ1A 2XLIA 2J0QD 3H2VE 1NM2A 4KFBB 4LSZB 2VUGA 2NZCA 2JEFA 1YJ9S 5EN1A 3LGMA 4F4XA 3IMQJ 1IKXB 3PM9A 2CQHA 1X0PA 2M0GB 2FUG9 5FDLB 4F3QA 4URGA 4ECUA 3MMJA 5E3PA 5ITHA 4JI0F 1RHRB 2ZNZA 1RA6A 3CJSA 4N47A 3K57A 2AV5A 1TL1B 4DL7A 4HACB 2VJUA 2BA9A 2HVIA 5KFWA 4OHVA 4YMEA 1RWWB 2MKSA 5DDRC 4XPCA 1N0UA 3RGIA 3UDEA 4C8OA 5HP1A 3HKWA 4O3RA 5D3GB 2PO4A 4RKUC 3EDRB 5MLCV 3TAQA 3I96A 2AD9A 2P6TA 2DK2A 3D0HE 1TR0A 2V8PA 1S0NA 1O8BA 3EUNA 4I2PA 3AY0A 5ETSA 4B3TF 1G2EA 4NWBA 1HD1A 3C6UA 4AXJA 4C3MA 4OV6A 3T6BA 1LWCA 4AYBD 5HMWA 2VKRA 1LK5A 3OL6A 2MJUA 1HHSA 2D74B 4FYWB 3CIZA 4I2PB 1YVFA 4OYOA 4IRKA 1X0FA 2HFSA 4K4UA 2XSFA 4O0IA 4CO5A 3GYXB 5IFMA 4NXMJ 2CG8A 3VVTA 2YXLA 5KAKA 1RYRA 3DOLA 1YJUA 1HIYA 1JLFB 3G2XA 2PGCA 4ER8A 4J9NA 2J8AA 1ZM3A 3LUYA 5IWAJ 3SBMA 1AXQA 2DBBA 2W7AA 4UT4A 2D3ZA 3KLEA 3T9NA 1FXRA 4WJBA 2HPUA 1FX2A 1MWYA 2E9RX 1HPZB 3MD1A 3RU0A 3RUBL 3UVJB 3NWGA 3K5NA 1HNVA 3HJFA 1S79A 3OVBA 2LA4A 3VGTA 2KFNA 3MM8B 2OPPB 2VBZA 2DNNA 3TJ9A 3FVYA 2BJDA 1KFSA 1FERA 1TL3A 2OFHX 2F9JA 1PSDA 1FA0A 2G2OA 2FZGB 3NLCA 1N5TA 2CNOB 1SBRA 4AT1B 3F56A 1QSSA 4WXOA 2B3TB 2DY1A 2C2ZB 3N6MA 4BWJA 5KFRA 4DXLA 3UCUP 3BYPA 4BC9A 3S8SA 4Z2XA 1U1OA 2HW3A 1MROB 3BPSP 3HHDA 3M9NB 2R2UA 5F0UA 4WXWA 4LF4F 2IA6A 2MEWA 4ZPWR 3B4MA 3FK4A 4ANEA 4NLUA 2W2QP 2LQ9A 2E7XA 2NYHA 2V2KA 3W62A 5L9NA 3FKBA 5IS2A 3P8BB 3QO9B 3IBCB 1FKAF 4F4KA 3HHNB 1QDUB 2M7SA 2X1BA 2QLFB 1IN0A 2ADCA 3G9CA 4DU7A 4RPFA 4JV0A 1FRKA 2DR6A 4OJ3A 1JJCB 1NH7A 3QGIA 1QAXA 3R27A 4P75A 2QL7B 2I5JA 4ES3A 3OVAA 4EBEA 2FHJD 2Z58B 1WC5A 1TL1A 2HWTA 1U8WA 1B0VA 2XGQA 4RU2A 2X1FA 2ILYA 3TJ8A 2HFOA 2OP5A 2QG9B 3ISND 5EDWA 2OJ3A 4NYZA 3D54A 3QGPA 2C1EB 4F04B 1DQAA 3G86A 1TK5A 3QPIA 2BZ2A 1RXOB 1VJWA 1PYSB 1TP7A 1D0EA 3P3DA 1OJ4A 1GMVA 1ITPA 2JNJA 4OHXA 2RB7A 1Z2ZA 5H1SV 1ZTTA 1C4AA 2J9DE 5ETNA 2KG0A 3PYDA 4TY8B 1W7WA 3AA8A 3DOMB 4OHWA 3MAAB 4J9QA 1KRPA 4AE5A 1Q5YA 1V3RA 1CJUA 2QZ8A 2Y1IA 2XULA 4FYXB 4C0HA 1I94F 2KT3A 1KSPA 1UFWA 1X4AA 3U1LA 3KHHA 4U67Q 1VQPS 4WP8A 3NS6A 4O44A 1HA1A 2BE2B 5KG3A 1R27B 4AL6A 2V0NA 3DDKA 3TUIC 3BM7A 2Z2ZA 4DX6A 2W7PA 3SQOP 4NRTA 3QJPA 1AROP 3IXQA 3CJ8A 3N01A 4FXVA 4NLRA 4C98A 4DR3F 3QSYB 2QIFA 3A8EA 1BY9A 3FC9A 2W24A 2XMMA 3LP2A 2WBRA 2AGPA 2MZSA 2YNFB 3LANA 1FFWB 2VOPA 1QM9A 2E5HA 3O1LA 4PYAA 2FLLA 3OFHA 3RBDA 4X64J 4CT8A 2AEJA 1WUUA 4GVBB 4LRBA 4MTPA 4CO4A 1YITS 4IKAA 2PEHA 1ZBTA 3TWZA 3I55S 4F3MA 2Z30B 4UOHA 1XK8A 1KR4A 2HLUA 3SCIE 3KTQA 1MW7A 1FRMA 1FF2A 3D3BJ 3MCNA 4TYBA 5D4NA 1JNZB 4YQWA 2ZHBA 3F0NA 2HIYA 4DLGA 4LF7J 2KDOA 3KK3B 1TELA 2GIFA 3BB5A 1HWUA 2DIVA 1P9YA 4KV8B 1UP1A 5B0AA 4U7UK 3VCDA 4A8WA 4EZ9A 4DPWA 3L4BC 2CJAA 4OX8A 1AYEA 2GHPA 2IVMA 2ZZTA 4LIRA 1VLYA 2DY9A 3P45B 2LECA 2DNKA 2KYXA 3HKZD 2JSXA 3Q8UA 4CH7A 4DX7A 4ECYA 3GLJA 2DRAA 1FXLA 3SCJE 4FKYA 5D6GA 4F50A 3BEGB 4PXEA 2B5JB 5A8KB 1UW9A 2VL1A 2X3GA 4JYAJ 1Q8LA 1SJFA 5ETKA 5HL7Q 3BO2A 3K58A 4FXDA 3W7BA 2AGQA 4F25A 2VPWB 3O3LA 3HSGA 3TX0A 3AJ1A 4PXDA 3VAIA 5BYRA 2JFDA 4Y6IA 1YI2S 2OEJA 5IM0B 5HLFB 1OQ6A 5F0WA 4ZA1A 4DSJA 4CYUB 1RWMB 1WEYA 5AE3A 4PPDA 4M5MA 4UY85 2J0WA 2HZCA 3C8YA 3CTRA 1S6QA 3DOKB 4DOZA 4DV7F 1VQMS 1Y7PA 1W2BR 4J9UE 4G1PA 5HAOA 3KHLA 2ZDOA 3C14A 3C66A 3H4DA 5H9EK 3IM9A 1BWEA 2YWWA 1SC4B 1HMVB 3M7VA 4OYBA 4EWTA 1WF2A 1TMJA 4LF8J 2J9EA 3A8JA 2HNDB 3OQ2A 3SXLA 1X4BA 2VD3A 5F41A 2FPHX 1YZ7A 3MURP 1Q16B 2VJVA 3THTA 3TRGA 5D3GA 2XHCA 1VQLS 2ZKTA 1IR0A 4OZNA 3J7Z5 4UZBA 1D8ZA 3GP9A 4QQBA 2ZJPQ 1ZETA 3EZOA 3CE8A 1FI4A 5HO4A 3KMSA 5AE2A 4ECZA 4B02A 4HTJA 3KNAA 2CDQA 2P6SA 1URRA 2WVBA 4JI4J 1J5OA 3AXMA 3HD1A 1CG2A 3PIPQ 2FLNA 2GHWA 2I0XA 4ZPVR 2B4OA 4P74A 2GQ2A 2QLXA 2GO9A 3HD2A 3ISZA 2R7QA 2GO8A 3UCGA 1S77D 1KN6A 1GXTA 1HNWJ 3OHAA 1YWXA 4DV5J 2GVDA 2WRMA 3JSRA 3MM7A 3MR7A 4HT5A 4UOGA 1Y5LB 5KFAA 1DY3A 3NS7B 3SCKE 3ZC4A 2FZCB 5F8IA 3MUTP 3CDUA 2L41A 2YNIA 3TZXA 2Y8YA 3ET6B 1M5HA 2YKAA 4RW6A 2KI2A 2V2ZA 4O3QA 5JXSA 1ZM2A 3CCMS 1S7IA 2BJ8A 2LU2A 2Q6CA 3RAMA 4X4UA 4R0JA 3T1YF 3T5LA 2JVRA 4ECVA 1TU0B 3T6JA 5GADU 4DR5J 4DPUA 1SC1B 4I67A 2QSWA 5BYQA 5KFZA 4DL3A 3GQCA 3MGJA 1LW0B 4OJGA 4Y65A 4ZK7M 4M1KA 3VVUA 1K0TA 2WZ1A 3G8SA 3RBEA 1X5SA 1S9GA 3D2WA 2W2PP 1SKWA 5KFGA 4PZVA 4YP3A 3GZ7A 2VBWA 1NPPA 1U6ZA 4DF8A 4DR7J 3W2WB 2RDIA 1UEKA 4LT6A 1R31A 2W1BA 4FS1A 1Q1KA 2EFPA 5HBMA 1C2PA 3J81Y 1G6BA 5FLXY 3LWLA 3W65A 1FFSB 2GIRA 4RNMA 2E7WA 3ZXWA 1H7XA 1VRUA 4ETZA 1S12A 2ZM6J 2RF2A 4F4ZA 1X5PA 4RUBA 1B3TA 3CC7S 4ED7A 5I3UA 3G6YA 1F9FA 2IAJA 3H5UA 2DNQA 1K1SA 2ZBIA 3NGRA 3W63A 3LALA 3V6KA 1NKEA 2ACMA 2W4DA 5DG7A 4PG5A 2GQQA 3PW2A 2BE7D 3DOKA 4V1Ak 3I32A 3ITHA 4HT7A 3KLFB 3R1LA 1NJXA 3V6DB 4PAAA 1JLQA 4P2SA 3PYEA 5K8MA 1X9MA 2LQJA 2YKMA 3CPWR 2R7VA 2EC2A 2VC0A 3CB4A 4WK1A 4RLEA 2KFYA 3BJYA 2W2NP 1UKUA 2KO1A 2MKJA 2OPRA 3HJVA 4X62F 3L7OA 3TANA 3N6LA 3IRXA 1FDBA 1PAEX 3EVOA 4PG7A 5HMYA 4X4PA 2AYBA 3QNWB 2DYAA 3A12A 1WEXA 1CQMA 5KT5A 4ZVEA 2UXCJ 2AIRB 3VWSA 4NLYA 2RDDA 4Q0BA 1OSDA 4XIUA 1G3OA 2HQIA 2BE2A 1MN7A 1TFWA 1LNQA 3HF5A 4HEA9 4B9LA 2H51B 1HI8A 2ZBCA 3DNCA 2VFRA 3PO4A 4LF9J 2A6MA 2RJZA 2ATCB 3QFWA 3Q8SB 1W2IA 2WBMA 2GJ2A 4USKA 4KGKA 4CYUA 4DV3J 1XNRJ 2LEBA 2GA7A 1S4FA 3EDQB 2QE5A 1K1QA 4ZVTB 4X4QA 1VBZA 1FJGF 2R9LA 1MMNA 2VDIA 1DLOB 3MMBB 3UD3P 1NU4A 4BDPA 2JEIA 3MD3A 1XERA 2BW7A 1I51B 2HBRB 4HLBA 4IUFA 2ZH4A 4OX7A 1SJ1A 1C0UA 1Z1ZA 1NJWA 4B08A 5CYMB 2BE9B 4AL7A 4FXWA 2VU5A 1OPZA 1B70B 3ETMA 3GJSB 4WBFA 4Y2AA 2CQBA 3S1TA 2XCPA 5F8LA 3D28A 4LR8A 1NSQA 5LJ3Y 1P6TA 1SJ4P 4DX8H 1RAOA 3KLIA 3UNYA 2XY7A 4GKKJ 2V8DA 1JB0C 2V4RA 1K44A 1KTVA 3KJQB 1X4EA 2G0CA 2YWKA 3KK2B 2CJBA 3KNGA 3PJWA 2FJWA 2H5JB 1F5BA 1VOMA 3JS9A 3BQ0A 3GJTB 5K8OA 1Q8KA 4OI6A 5KFQA 5KFUA 2HHXA 3GJQB 2AX0A 3SIPB 1MWZA 1T9VA 3IWXA 2GW8A 3CCTA 3BSNA 1MLAA 5CH7B 2FLOA 3TAMB 2DGVA 2LQBA 3BN4A 1XTZA 4P73A 5ETLA 2W9CA 1S72S 2FVSA 3PCOB 5B0DA 4JYAF 3W3SA 2HNZB 2HHHJ 2MQNA 3NAHA 3PX0A 1LK7A 2B51A 2B43A 1RWKB 2C3OA 5THWA 4P9SA 2MZRA 1UWBA 1FRLA 1YTYA 4RUCA 4LRAA 1RT7A 1XMOJ 4NX9A 3B4DA 2HK2A 4ZPCA 1Q5VA 1R6VA 5F8NA 2EK6A 3M8YA 4HDHA 2PE8A 3J7YU 3SCLE 4N5SA 2V8HA 1OY9A 1X4HA 2HGNA 3A13A 4H4KA 3PEHA 2HGLA 1KC8T 1VS3A 3QSIA 3V5RA 1FVSA 4MK9A 1KONA 1ELOA 2XZWA 1RAJA 1V5VA 2DJWA 4Y2KA 5KG1A 2V2VA 2E5LF 2WW4A 1UZDA 4DV2J 1KVKA 3HT0A 4Q2MA 1DTTA 3EM1A 3I0RB 2R7WA 2Z0GA 4C11B 1FNOA 1HQEB 2DR7A 4U9RA 1SKSA 1DTTB 2CJKA 4YR0A 5HJXA 2GS8A 3I87A 1OYDA 1X5TA 2CQIA 2FJDB 3GCWP 3P5TL 5DRKA 5LL6d 5J2PB 3CUNA 3RR7A 2IY5B 4ZN1A 3PX6A 4X62J 1V5IB 3BKUA 3VALA 1S6OA 1QUPA 3TJAA 3BO3A 1L5UA 4TY8A 3VAFA 4JI2F 4OJ1A 4LUBA 4NZ7A 4QIGA 2ZC3A 4G3IA 1H2VZ 4NZ6A 4ZVUB 3PW4A 1RQ0A 1IKYB 4IOBA 4XTTA 4IDKA 1RAHB 1SIZA 5CZVA 1N32J 2YX7A 1U09A 1FEHA 2DB1A 2KRBA 2RQMA 5KOXA 1X5OA 5L38A 3MPUB 4ANDA 1OSCA 3BR9A 4LF5F 2NXJA 1IBMJ 3Q24A 2BDPA 4IRCA 3MDFA 5E7OB 4PG6A 1NDLA 2CRLA 2XMTA 3Q2SC 4YUDA 4DG1A 2DVIA 2CYYA 2OLWA 3RTVA 2Y8WA 1R8HA 2LEAA 4I7FB 4CLLA 4JI0J 2M2BA 2WSFC 2IJRA 3M1VB 4IO1A 4WFXA 4XPEA 1HI0P 4RW8A 1VQNS 4OIXA 4PG8A 2IRUA 3DCAA 2NPIA 4YB5A 2V5HG 4ZVSB 1IWAA 1TL3B 4HI2A 3ZO7A 4JI5F 3M1VA 1RTIA 2VG7A 1QSYA 3SZ2A 1EQMA 4DL2A 3IBWA 4RNHA 1I6JA 2VB6A 3OL9A 1UFLA 4L74A 4AFFA 2QJ3A 2V50A 1SH2A 4OZLA 1SH0A 1N32F 3TQ1A 3SQGA 2LFVA 1ZZNA 2V94A 1U1PA 1FNXH 4LF1A 1HNVB 2QLJB 3EGWB 3OHBA 3N0VA 4ZKAA 2QFJA 1YJWS 1WOSA 2EW9A 5C25B 3UCZP 2OAUA 1DARA 1P9QC 3C15B 2VPYB 3HO1A 3HHLB 3DFEA 4NOHA 5D0HA 1FFGB 1Q8IA 2DNZA 4IO9Q 5D78A 5JVGQ 2BQUA 1VQ5S 5KT7A 3NGTA 2KH9A 2XY6A 2NXEA 5EHHA 3H0PA 2CAJA 1NK7A 1Y11A 2HYIB 1ICEB 3FSYA 2JX2A 2P2CB 3ILLA 3OXFA 2M3DA 4YEAA 2D41A 4TLQA 2ZJRQ 2CJXB 4DS5A 4HHJA 1PG5B 1TQLA 1GX5A 1HARA 4FDFA 5KG4A 4B3SF 2R7UA 3FEXB 1VK3A 4ECTA 2KB2A 3HSDA 3A3NB 3P96A 4QIEA 2RS8A 4ZJLA 3K5OA 2XLKA 4ILMA 4HYKA 5HK4A 2EI5A 2KU7A 2ZOMA 3VZHA 2DHAA 4FS2A 2DNGA 5SZTA 2GX8A 3G6VA 1VBYA 4C6AA 2DGXA 4M5HA 3I0RA 4OYXA 3CCZA 1XBWA 4X66J 2BOPA 3M30B 3J7ZT 1VMBA 4WIIA 1IM6A 1JWWA 1IJFB 2QA2A 4IDKB 2GZOA 4C8LA 4DSKA 2VG5B 1XEZA 5GMDA 4P2FA 4F2RA 2FJAB 1GXUA 2NREA 2XG8A 4ED4A 3ETOA 1NHUA 2IRYA 4L72B 2ZWPA 5CA5A 2YWGA 4DR5F 1WHXA 1VQ9S 2F4VJ 5J2MA 2XZDB 2RHSB 1JNRB 3HVTB 2GJIA 3PY8A 2KXFA 4EYIB 4PQAA 3I9ZA 1WTBA 4NEYA 3OSNA 3O2IA 3DRXA 3MEEA 5EX0A 2AYEA 1MMDA 3BQ2A 5FDLA 3H40A 1ZTWA 2MQ8A 1RWVB 3CD6S 3H98A 4WE1B 2AP6A 2U2FA 3ADAC 4QIFA 4URSA 5KFYA 1XC9A 4NXMF 2FB0A 1NUEA 2W9AA 3R5DA 1S76D 2MZTA 3KUEA 2JC1A 1S1UA 1Y5IB 4O23A 2M70A 4ZVQB 4DV7J 4ED2A 1UFKA 4ZVHA 4TQRA 4CLWA 2MMYA 4M5DA 2CUYA 2LDYA 3CD7A 5KG2A 4EO8A 4DQIA 4EMDA 3W2WA 4NEZA 1ACMB 1TKXB 5E0OA 1JLBB 1K73T 2HNYB 1FK9A 3AAWB 5A8RA 4JI6F 1N33J 2WW8A 3O6QA 2V63A 2RDJA 3UVJA 1DHMA 1S1TB 3FUYA 3QT7A 2JJ4D 2LLZA 5CD4A 2C2DA 1UVJA 2BRKA 2HQ3A 3JSMB 4N41A 3GFZA 2Q3PA 2V8VA 1LW0A 4KGMA 5BR8J 1B99A 1T0TV 2NUHA 3WQPA 5L1KA 4EBDA 3BN7A 1CS4B 1NHVA 2IM1A 4KIAA 5LMNJ 5AXMA 2UV8A 3IRXB 3CO9A 2HHTA 2EK1A 1VBXA 4WK3A 2HKEA 3MMAB 1RADB 3TZYA 3U1MA 5EWFA 2BQRA 3DRRA 2FJEB 1LFWA 1S9EA 2EBGA 3W61A 3GIKA 5D0RA 3Q8QB 3R5GA 2D3UA 4M94A 2E66A 3Q2TC 2AF6A 3K8WA 2ZOGA 2HHVA 4B17A 2F9DA 3NCPA 5ETTA 1X9WA 3DLHA 4CQ1A 2Z2YB 2JHEA 2IAJB 4I6WA 4P52A 1KP6A 3M2RA 3VR1A 4I4BA 2M8DB 3AB4B 2BV3A 4DCOB 1J5OB 3CDBA 3OSPA 1NK6A 3CDWA 2OHDA 1LW2B 2QT7A 2ATLA 1SL0A 2B7BB 3TUZC 2OEMA 1JLEB 1LWEA 2XWXA 1M1HA 1CULA 4NI2B 2BQ3A 2AT1B 4DZDA 2AGOA 3R2CJ 4DFMA 2VPXB 1VQOS 3IAS9 2RMLA 1DTQA 4OYWA 1CULB 2UUCJ 2VOOA 1BD6A 1NMEB 3D68A 3JTPA 4JOUA 4MAKA 1S5ZA 3BKFA 4DR2J 2GAHC 2NXNA 4R0EA 4M5NA 2E5GA 2ASDA 1FO1A 2DNPA 1KFDA 5KFBA 3BBCA 3US5A 2JRSA 1N34J 4YY3J 1NSKL 5BJRA 2D1CA 3JSYA 5DS7A 2ZZNA 3M6UA 1HNZJ 4OX9F 3VQTA 3M8SA 3CT9A 2ZM6F 1JXLA 2Y0SD 2XO7A 1PCAA 2D7SA 2MQQA 1IUJA 5J2NB 4O4GA 2HRYA 4MFBA 2XWYA 4JV5J 1FHTA 1SXLA 1VRTA 3A3PB 3M8QA 5HANA 4UW2A 1U2RA 5C2CA 4X4SA 3SSSA 2RH3A 4EUVA 2Z57B 2CNKB 4ID8A 3DLGA 3EXYA 9ATCB 4ZIWA 3M9OB 1U1RA 1N56A 3FNNA 1QD1A 2K1RB 1RJJA 2B4VA 3IR5B 4NYPA 2J9CA 3L7UA 5K14A 3R5JB 1IR1A 2XSJA 1RT3A 2KM8C 1H2UX 2F65A 3U27A 2UUAF 1RHQB 2HEKA 2C2RA 3EICA 1S1TA 5F8GA 3K59A 4X65J 2DKOB 3CJTA 1U26A 2ZUAA 3K89A 4YFUA 2JLGA 4KB7A 1S1XB 2R2RA 3U1NA 1VC6A 2ZUGA 3HZEA 4JV2A 3PNIA 3HHKA 2ZITA 1CJKB 2CADA 2RHQB 2VPZB 2YVSA 4KV8A 5CYMA 5LSLA 4ZCLA 1M90T 1QAIA 1T03B 2CKWA 2HFZA 1A0OB 3EZUA 4EI2A 4DR6J 4WE1A 3CJKA 3OTOJ 1FKOA 3KOAA 1BMQB 2V67A 4P72A 1F6TA 4NLOA 1B7YB 1NDCA 1IBCB 3KHGA 1ZAWA 5LT5A 4P7VA 5E2QA 4EU0A 3PJXA 1UL3A 1WKKA 1N5YB 3E01B 2O5DA 1DTQB 5E3QA 3ISNC 1OMSA 4F36A 2BABA 1CC7A 4KGZB 1IKVB 2B4PA 4PABA 3QJLA 3VAHA 4RBUA 3FSIA 4ECQA 3V4IB 3CCLS 2UZAA 4NLDA 1WHVA 1CVJA 4M95A 4LFAJ 1R8PA 1IVZA 1U25A 3AA9A 5HQLA 5HSPA 1UVMA 3CCUS 2PA8D 2AJFE 5I3PA 3BV8A 4MIWA 3FFIA 3ZTOA 1RLCL 4L73A 3PEJA 4A47A 1Z4UA 5K8PA 3M4XA 1OIAA 2OIHA 1GMUA 2UUTA 2K8GA 1RWOB 3T9ZA 2PI4A 4X66F 1F9HA 1TKTB 1UCNA 2H5IB 2VF3A 3AB2B 4EK2A 4DR3J 4B9NA 3HZGA 4IH5A 3TA1A 1LW2A 2C3UA 2HFNA 3ILIA 1SC3B 1PGZA 1PO6A 1HWLA 1IM4A 4TY9A 3HXMA 4PCQA 3QT6A 3KLGB 2QYGA 1RISA 2HQCA 2XMWA 3L09A 3M8WA 1YZ6A 3P6YC 3Q89A 2Z8QA 1RTHB 3DLLQ 3MAHA 1UW4A 2KG1A 4J7CA 2QO3A 1TAUA 5I42B 2KRRA 2R3VA 4A8SA 5HVHA 2UVRA 2BKNA 4F0HA 2HRUA 2P9EA 5IM0A 5HJYA 5HLFA 1WHWA 2R8HA 4PPZA 5KFTA 2EFVA 1S1VA 4A8FA 1R8AA 2B7CB 3KJNB 3JAMY 4ZITA 3H25A 2LXIA 5DDOC 1FKPB 2BJEA 1O5JA 3IRWP 2OSQA 4YY3F 1SCJB 4I68A 1PJ7A 3KYLA 1EQ0A 3GJRB 1WC4A 3EMTA 3GIMA 2LMIA 4CM0A 4IG0B 3MR3A 3DLGB 1RWUA 2KM8B 3MUVP 5DETA 2ZBRA 2JFKA 2UVVA 3IS9B 1CJUB 1KLMB 2JOQA 1IQZA 3DRPA 1HQUA 1SJQA 2MQMA 1X8DA 1NJYA 1QSLA 4NCAA 2DIUA 4O4GB 5T7LA 4RW8B 5HVFA 4E8UA 1N5VA 2CXEA 1S1XA 4P10A 3DU6A 1EETB 2CPDA 5GMEA 1QTMA 2GVDB 2LVWA 3MM7B 1PILA 1RTZA 3W5YA 3FBCA 4R25A 4Y28C 2H65B 4DSFA 1X31C 1BQMB 2RAQA 1TAQA 2XEXA 1NHKL 2XI3A 3KG4A 3NWRA 5ETQA 3VGVA 3OUYB 4DR7F 1CSJA 5L9XA 4CO3A 2E5LJ 2E1CA 4OZ1A 4G65A 2W9BA 5A8RB 4ZPBA 2ZH9A 1TK0A 2LQ5A 1JLBA 3CJ2A 4N8OA 2CQ2A 4LF5J 4DPXA 1CJTA 2IFXA 1QE1A 3RRKA 1UVIA 4M63A 1LWEB 4NI2A 4ED3A 2XBPA 2A1BA 5KFKA 4H4MB 5LXYA 1AB8A 1FE4A 1F2HA 3EWGA 3POTB 3M32B 1H2TZ 5HROA 4ZHRB 1OS5A 1UJ5A 5H9FK 3I82A 4YB6A 5FD1A 3PW5A 4L6V3 3M32A 4X4NA 3EPGA 1FDAA 1NXIA 2G2YA 3POTA 4NPOA 4UQTA 3I9V9 2HBZB 3LQVA 3LP0A 2LDIA 4KH1B 5IQQA 4HH0A 1KHVA 2AJ2A 5KFHA 2VHGA 4QZVB 5CABA 3G8QA 1JX4A 4IR9A 2DH7A 5CQGA 1NK9A 1XR7A 1RAEB 4AUKA 1U1NA 3VF0B 4KE5A 2EPIA 2PI5A 4CLYA 3EYZA 1TL5A 1RP5A 1UA0A 1N34F 4N76A 3SQGB 3BGOP 3ILOA 3NKYA 3WDOA 4K0KJ 1XMBA 3GFHA 4LVOP 4WZQA 3MUMP 4CIOA 3BO4A 2CPIA 2OPQB 4LRCA 5KFPA 3GYGA 1KQFB 1WG4A 3CCQS 2MKCA 1ZS6A 1LOUA 1TL7A 2WOMB 1V3ZA 3AOAA 3N6NA 1PYTA 3QATA 3TA0A 3ZTRA 1KKHA 3W8GA 5C25A 2NUUG 2CNLB 2I38A 2HZVA 2F5GA 2NS1B 4KSEB 3UW1A 4LSLA 2UP1A 2JDJA 2ROGA 4HDGA 3EX7B 4K4YA 3E2EA 3JQKA 1XMQJ 1RB0A 5T7LB 2UUBF 1WD6A 3CJ5A 2LP4A 3PXGa 3OTDA 1REVA 4C7QA 2CQ1A 5L46A 2MLXA 4NA2A 2L08A 4M5KA 4RUAA 1JJHA 2HHWA 3LAKA 2B9XA 2BJ3A 5G4DA 2EKNA 3MMAA 1FD2A 2OTLS 2BANA 2OD6A 2QN6B 3IA0A 3BGRB 3U02A 2ADBA 2JEJA 3MECA 1K8AT 1RU2A 1T9UA 2E29A 4A8XA 2QFIA 4B9MA 5HI7A 4WF9Q 4MYUA 1FNMA 2AX1A 2G9OA 3CC2S 2MZ1A 4QWDA 1SC6A 3K5MA 4F8RA 1M5PC 2HQFA 2QGFB 4Q5VA 4XDCA 3W9HA 2DPJA 4KR0B 1CPZA 1S7HA 2QL9B 2IDLA 4I69A 2QA4G 4HH1A 4TLRA 4C8KA 4LF6F 4DG1B 2DHHA 4FN5A 1U45A 2UXDF 2CQGA 3RR8A 2VC1A 2PMHA 2W4CA 3GIIA 2GC8A 4KPCA 1VK8A 4ZVRB 3T1HF 3P5BP 1XNQJ 3KLEB 2MPUA 1S1UB 5I4MA 3R8YA 3UDCA 1MG7A 1U6FA 5C42A 5CD4H 3R5BA 2CA9A 5B08A 2WVFA 3HPOA 2B4UA 3GR1A 1N5QA 3W60A 1S6PA 1RZMA 1L3SA 4JI7J 3QRQA 2H48B 4PWDB 3TYTA 2XI2A 4OHYA 2E5JA 2IMWP 2W2MP 2OPSA 4QIVA 4WZMA 1UEVA 2ZH8A 3CJ4A 1JKHA 3D67A 1CJTB 1K0VA 4N8NA 2H4WB 2JVOA 1J2VA 2O1PA 3EGVA 4HR2A 2W9BB 2XMUA 2N7CA 2C2EA 1BQXA 1HL6A 1YX2A 2Z56B 4GC6A 2NCKL 3PACA 3THPA 1JIHA 3QLHB 3RB6A 1VFJA 5HROB 2UU9J 5D4OA 3J80U 1QY7A 2AYMA 5J2QB 1RT7B 4TU8A 4ZOSA 3QLHA 4OYZA 3SSRA 3K2YA 4DL0C 3I4PA 3TI0A 1YJ7A 4WYLA 1S49A 7AT1B 2Z2MA 4MJKA 2DGQA 1BHNA 3IWNC 1TUWA 1WI6A 1Y5NB 1JLQB 4GRSA 1X9SA 1UVNA 1I5OB 1OY8A 4LVNP 4BWMA 4PEOA 4P2XA 4Y0FA 2OD4A 1SH3A 3G82B 3L95X 4OI1A 3LP1A 3OJSA 1VC0A 4PQUB 1O0PA 1IBKJ 3JQMA 2X51A 1RKIA 2YQ1A 3Q8VA 1BQNB 2EFQA 4RWXA 5KFIA 4DR4F 2MQOA 1PBAA 1KWMA 4PUOA 1R6YA 2CJQA 2F8MA 3KDOA 1X4GA 2VH7A 2E44A 4EBCA 1RTDB 2XMJA 3HFKA 4C8ZA 4A8KA 1HBUA 5LMUJ 2FGOA 3DI6B 3HHLD 4DPYA 4QW8A 1E6YA 3I0SB 1QJHA 4MKBA 1JLAA 2OI2A 3V6JA 1FJEB 3PJ9A 4JI3J 4OI4A 3GV8B 2KJVA 5I3QA 3C46A 1IQTA 3UN5A 2E1PA 1Y0HA 5KFMA 1VLOA 2C2NA 1CLFA 1RHMB 2GCFA 3TUJC 2MKKA 1RAAB 1HYSA 4RNNA 2FYXA 1AT1B 2ALYB 2HBQB 4UUWA 3SDEB 2ALZA 4IG3A 1WF1A 1RT3B 3CD0A 3ZNUA 1U1MA 1FDDA 4ZP9A 3UNGC 2FJXA 3IR7B 2RRNA 4OZ2A 3H5YA 2FGCA 2DXDA 5GAHI 4PG4A 2K3KA 3MZIA 1J5EF 3M6WA 4JI5J 3LGHA 1S1WA 2NYIA 3D1OA 4CP5A 4DR4J 1VCTA 2VFVA 3KWMA 4YS2A 2A2DA 1NKCA 4NLPA 3DRPB 3HCXA 2MQPA 1Y4ZB 2V8GA 3LOUA 1YRUA 1RT5A 2EFOA 4O3OA 3W1YC 3T1HJ 3E3XA 2GJFA 5LXRA 2L9WA 4WTOB 4ZMMA 5DGBA 3N4WA 3MR2A 2HHSA 4GKJF 3CMAS 3PG9A 3MEDB 4WU2A 1BUXA 3EJMA 4OYPA 2NLWA 2XYPB 3KK2A 1SUQB 1SV5B 2OGUA 1UAWA 3HX9A 1Q95G 4DSIA 4PWWA 2Z4PA 4QW9A 4QR2A 1QE1B 4LF4J 1F3FA 4ALZA 2ASJA 2YQ0A 1A7GE 5E5NA 3C16A 4F4YA 1S0OA 3AD9C 3JSBA 2GHVC 3T1YJ 2XLJA 3V6DA 1FVQA 1LWXA 2I2YA 4JI6J 1N33F 2HFUA 3A4TA 2DPIA 3QT8A 4CH1A 4ECSA 4RBTA 2DNLA 2KT2A 1RTJA 3KJVA 1HNIA 1D09B 5JVHQ 5IT9U 1PJ6A 4YB7A 2ZH3A 5KFEA 2CQ0A 2M4MA 4OLPA 1HW8A 2GAGC 1TKZB 2WONA 4K2JA 5CYQB 2CG4A 1D9AA 2KZMA 2HNZA 4DWIA 5G0RA 2CIMA 4YOEA 1UVKA 5LSRA 2KZZA 3GG0A 2WTFA 3AODA 4URQU 4DDFA 5CCMA 3M9MB 1C1CA 2OMLA 3NOGA 4KRWA 5KT4A 1YBTA 2RVJA 4KO0A 2PT0A 2RKIB 1WDDA 2RIJA 1RCOB 4RW4B 2QV6A 4K7QA 2C2OB 3A3OB 3H42A 1N36F 4B3RJ 1M5OC 3AT1B 1XMQF 2UUBJ 2B5JA 4V19J 3DKDA 5K14B 5L8RC 4LSNA 4D3GA 2RKIA 4ED0A 2Y0BB 3AJDA 3GU0A 4ZJQA 4K0KF 5C24A 4WKRA 5E41A 2OUGA 2QMXA 4AD6A 3NGKA 5J1EB 5L1LA 1B0TA 3ZFVA 1R0AA 1S1VB 1PIEA 1FJCA 3B78A 1BE4A 1NZAA 5IXUA 3QZ8A 1TK8A 3DM2A 3GSIA 2WB1D 3AOBA 4QWAA 1TFYA 3J7AN 2YKQA 2HS4A 4KC5A 3IGVA 2GNKA 5T14A 2MDAA 4F3OA 1WHYA 4ID5B 1WOPA 2W4PA 2CVEA 4DZ6A 4Y00A 3DGVA 5HMXA 1JLCB 1XMOF 2HHPA 2HMIA 1N88A 4WWSA 9RUBA 4IH7A 2DCUB 3MR5A 1NB2A 2IRXA 2Z2LA 4G1QB 3NP5A 3NS5A 4BS2A 1R0BG 3MM5A 3ELHA 1S9FA 4DV6F 3GILA 2IIHA 2CQ4A 3ET6A 2E1AA 2ZKUA 2G0IA 2CPJA 3HDSA 3PHEA 1HI1A 2PDAA 4C3LA 4F2SA 2IJNA 4DBQA 2RRBA 4RWWA 3LWMA 3EZ5A 1WSVA 2AJ0A 2Y1JA 3DRSA 2CQDA 1HBNB 3IC1A 4QPXA 1OWXA 3BDPA 2E1RA 4FYYB 3DMJB 4TN2A 1IBLJ 5AE1A 2BMBA 1AA1B 1T9YA 1CQNA 2ZHOA 2X1GA 2QLWA 1HBNA 2YKOA 3H90A 4JBCA 4U8VA 4OZJA 2YKPA 3UR0A 2YNHB 5GMKa 4ECRA 2MGZA 1XNQF 4K59A 4LQ9A 4OMFG 2JLEA 2IM0A 1HLWA 2J7KA 3OPKA 5LJ5Y 4CTAA 4QYZK 5KG5A 2GQCA 5G0RB 1E6VB 1UTAA 2P9CA 4RW7B 4GKJJ 2RRAA 4DFJA 3UE2A 2UU9F 4C4WA 3V4MA 2BM1A 1NJIT 2J6SA 4QU7A 1R3NA 1TKTA 4DV1F 3QZ7A 1TKZA 4CTAB 3G8TA 8ATCB 2YPYA 4K4XA 1U4BA 4GO5X 4IFYA 4ZVPB 3LH2S 3W5XA 3OLBA 4M5IA 4WKYA 4HTIA 4NZ0A 2J5AA 1UJ4A 4N56A 2NSCA 3EVMA 3FFIB 3QT5A 1Z2LA 3H59A 5IT0A 1LXNA 2AHOB 3AXKA 3CXCR 4M5JA 1A9NB 3OL8A 2E9ZA 1VQKS 3Q8YA 2DGTA 2A3JA 5B0BA 3DHWC 4QU6A 2R2TA 4EEYA 2J7WA 3CIMA 4FNHA 2HLTA 1RAIB 1LXJA 4CO2A 1ROFA 2M88A 3W9IA 3B54A 3BH7B 1S48A 2KJWA 2MQLA 1TV6A 4RUHA 4J9SA 1HHTP 1T94A 2LEPA 3Q22A 4LFAF 1R7IA 2YKMB 3QO9A 5HVGA 1N5YA 1EAYC 2DNOA 3I0SA 4S0MA 3J81j 3THVA 2M9KA 4H4KC 4UUXA 4CDIA 1D9FA 3NBPB 3MM6B 4K4SA 3K5PA 4DPTA 4E0DA 1F0XA 3PKYA 3CF5Q 1RHKB 3QIDA 3V4IA 1TVRA 3DLKB 4PYDA 4CLFA 1BQNA 2O01C 3KMQA 4ES1A 2MSTA 4ZLPA 2VQFJ 2WVEA 2FIUA 1TKXA 3W5ZA 3BH6B 3AOCA 2G2ZA 4FPRA 2MXYA 2QTWA 1N5SA 2XMVA 3JYTB 1U1KA 1M5KC 4HVZA 5F3TA 1ZA1B 2R7TA 2IMOA 1Y9OA 2YNIB 4NASA 4OFZA 3PVXA 4FZVA 2N3LA 1KLNA 1DQ8A 3OTBA 1S1WB 3MM5B 2B9WA 2BW2A 3BYRA 2QA1A 2R7RA 4M5LA 3TA2A 2CFXA 1VGYA 2CDRB 2GMLA 4ZDNA 5D15A 3CD5A 1C4CA 5IT9Y 2R42A 2DEJA 1B0PA 1V9OA 2DXFA 3AHPA 3IR6B 4U8YA 2XQCA 4ZLLA 3G6XA 4DSLA 5AT1B 4CM2A 3SDEA 2XSJB 4USJC 3C19A 4DU8A 3I31A 2IYGA 2V4QA 3J7A1 3V6HA 1S4EA 2IA0A 3PYGA 4Y34A 1U02A 2KL8A 2N4DA 2GGPA 3KJFB 2DCLA 1XQIA 4H4OA 5HQ8A 2YKNA 3H20A 4M5DB 1CBKA 5B0EA 1RYSA 4DI6A 3R9LA 1QAYA 3CCES 2FD2A 3CCSS 1VHIA 5J2PA 1R43A 3DYAB 3FCVA 2J6UA 3CW2C 3IN5A 3KK3A 3LTOA 4DL4A 3MEDA 4WFAQ 2CWXA 3OD2A 1S6PB 2A0FB 5B0GA 3SI8A 4ZPAA 1FXDA 3T19A 1G4CA 3LF0A 2OKQA 3D66A 3HHLA 3PHTA 1P8GA 1MMLA 1U0HB 3VAGA 1YIJS 3FGVA 4JV1A 2V2QA 1MNEA 2EBEA 4K4TA 1GMWD 1OYEA 2CQ3A 4JI8F 2CJYB 3TVZA 2A2CA 3NY0A 2IJFA 2YQ3A 3MEGB 3QQCD 3EE3A 2YWEA 4CLKA 2BXJA 3MFIA 3P49B 1NZ8A 4RL1A 2HG4A 5GAGI 1VQ6S 3M2VA 4C97A 2BVZA 2R8JA 3NNCA 1HR0F 1HNIB 8AT1B 1XWLA 1CS4A 3OTCA 2N3OA 3DDNA 5FLXU 1NAQA 4WP3A 3GWCA 4UTGA 1NEEA 4MT1A 2Q66A 3IP0A 1U0SA 2GV1A 3KXDA 1EZZB 3DU5A 3PKMA 2K3IA 2WSCC 3NG8A 3LW5C 2F4FA 2CPZA 2DISA 4USHA 1MSWD 5B7WA 1FK9B 5D4LA 3RRGA 4KHMA 4JUZA 3KK1B 4LBIA 5KFNA 2AW0A 1Q79A 2KKHA 1JLGA 2MHEA 1JLEA 1WI8A 4P71A 3CGIA 3TAMA 1F3VA 4K5SA 3A8IA 4EO6A 4QIWD 1GH8A 1DQ9A 2A6OA 4ZCIA 3CJ0A 4G1IA 2UUAJ 1NJZA 2BRLA 1YHQS 4IFVA 4Q2LA 3O44A 2EKYA 3G4SS 4NMXA 2K7KA 1KDNA 4HI1A 4J37A 3BR8A 3ZZUA 4YHHF 4DV0J 2AYGA 2K7JA 2LQ8A 5C42B 1U49A 4X2BA 2SXLA 3GMGA 4B3TJ 4QR0A 2FVPA 3HVTA 1M1KT 3FRYA 5CHCB 5EWEA 5CYJA 2ZD1A 3DGPA 4I56A 4MIBA 2FHOB 2ZVSA 5KFSA 3ZZOA 2QLBB 5LM7E 2OO4A 4PXBA 3X1LB 5KT6A 4ZLJA 4LBHA 3M8ZA 1WOOA 3OFFA 2F40A 2X7IA 4BBYA 3J7YI 1NNDA 4ZCKA 2DH9A 2O3DA 2RQCA 4C48A 4CZCA 3MI7X 2F8HA 3RBZA 4F0MA 1FE0A 3GFXA 4Y3CA 1KTQA 3MOJB 3A8KA 4PWDA 2J76E 5MAOA 3BGFA 2HBYB 4YR2A 1M5VC 1EIYB 3S7RA 1GNKA 1U1LA 1KNZA 1YJNS 4TYAA 3UI3A 1F9EB 5CZXA 4KJIA 4QOTA 5T41A 1S6UA 3K17A 3LPYA 2RU3A 1PKUA 3FSXA 2RQ4A 4LSLB 2OPPA 4TKTA 4CLTA 5JJBA 5DDPC 3HK2A 1Q8BA 2MY7A 3WC2A 1NSAA 4A8QA 1S97A 2YNFA 2G0JA 2GVZB 2JC0A 5D4PA 4OV1A 4C2MA 3WIUA 2DNRA 3VGSA 4ZHRA 1AZSB 3CDEA 3MM9B 3CULA 2ASYA 2V4JB 2XCAA 2ZH7A 4PQUA 2NZ4A 3UO0A 3HULA 3PRDA 2R8IA 4DV4F 5J2MB 1KVJA 2HZAA 1N6QA 3ZTQA 4DV0F 2E5IA 4KBIA 4NLSA 1T9XA 3ENAA 3D6MB 3DOLB 2GGPB 2MJNA 3R6GB 4M5GA 1RHJB 3W8PA 4QWCA 2X3DA 2GMJA 1G1XA 2H3EB 2C3YA 5EGYA 4D3HA 5IV4A 2OPSB 4C9DA 3LP0B 1SUQA 4DUZJ 2UVUA 4UQGA 2HVHA 3B8HA 1C1BA 1WKJA 3NL0A 3MTKA 4ZCMA 1YG0A 3GYNA 2U1AA 2A18A 4IYQA 3QBCA 2MZJA 2GVZA
chains in the Genus database with same CATH topology
1MROA 1ZM9A 2RF2B 3I5BA 4CNYA 2HVZA 4MIAA 1VRUB 1P27B 4BCAA 4RNFA 3R1HA 1SB6A 1SQEA 4I6YA 1GT8A 3IG1B 5CCLA 2XS2A 1FKPA 4FP9A 2Q6BA 4QR1A 3UPFA 3V81A 3HMJG 5BR8F 1BLUA 4C0OC 1LKZA 4PXCA 3O8WA 1DZ5A 3JB9k 1ZM4A 3FDSA 2LU1A 2FLPA 4Q8EA 1BC6A 4RW9A 1KHWA 3NCQA 3PRBA 2NPFA 1UETA 3PR5B 1NK0A 3M8PA 4FYDA 1WF0A 3GE9A 4I1TA 4IQXA 3MM6A 2OPQA 5DG9A 2FVCA 1RI7A 1GXLA 3M8PB 4IQMA 4ZPDA 3HVAA 3ULHA 5L1JA 1U47A 4K2XA 1QAJA 3QMQA 4EFAC 1Y00A 1MU2A 2DR9A 2NQPA 3RB0A 4DR6F 2ZD1B 5EX3A 2Q1LA 1OPIA 3M2UA 3JYTA 3RB3A 3BF4A 3IS9A 1U2FA 1HBUB 4CO0A 1N0VC 2XMKA 5LSOA 5SUHA 1YGYA 2PN6A 3GSDA 4ATNA 4B9TA 1H3DA 1TVRB 4IFVB 5E3RA 3GFYA 3W2VB 2CPYA 3BGRA 2XGPA 2X1AA 3QAEA 2ZNYA 5B0CA 1D8YA 2PA3A 4EGLA 3SYZA 4IOCQ 1NK4A 1WACA 2HAIA 4IH6A 5DM6Q 3DC2A 5DGAA 4O3SA 4ZP6A 1RKJA 5F8HA 4OZ0A 1GAOA 1UEUA 3HT3A 1C0TB 2QSFA 1H38A 1Q4RA 2FHMA 3HVWA 4N77A 2GIQA 3ZZTA 3TO8A 3UFCX 4DUYF 1KS2A 2LA6A 3FCHA 3VAKA 2DHXA 1ZYQA 5K9FA 2JEGA 4EZ6A 4B3OA 4ZS6A 4Q7AA 2LCWA 3C3LA 2NSBA 4ZVFA 2NR0A 4FF3A 4YDXA 4Q8FA 1Q78A 3DXBA 4H4MA 1JKHB 1RA7A 3K8VA 4RW7A 3ICLA 3GG1A 1Y3JA 1HD0A 2RU9A 1JJ2R 4B9SA 2V9KA 2XS5A 2LYVA 2W8KA 3CMES 2QMWA 2POKA 2L9DA 5U47A 2WB4A 4A4JA 2GFFA 4I0WA 5DQIA 1N4LA 4ID5A 1KOHA 1NKBA 3HI9A 4KT0C 2XB2D 3MMCA 2PD1A 5DM7Q 2ZDPA 5FIIA 4OL8A 1H0HB 1SI9A 2KXHA 1UWBB 3EGNA 3KLVA 3VTIA 4LMZA 4LJMA 4DN9A 1XR6A 3H2UB 4RZRA 2UUWA 4KKOB 5GVQA 1TV6B 3NRBA 1IBMF 5KFXA 4FVCA 5HMZA 2Q43A 2EFGA 4GC7A 3H5XA 1SL1A 4DN0A 1T02A 2MYFA 2OSRA 3S01A 5I42A 3VQSA 3OUYA 4ETXA 2DNYA 3IFEA 4MH8A 3Q8RB 2N82B 2ZJQQ 3BSCA 2BANB 1RDRA 1AFIA 1HBOB 4ZPTR 1SL2A 2F7VA 3SV3A 4JI4F 4IOAQ 3H5SA 2FHKA 3NBPA 4MFBB 1R89A 4Z37A 2J9DA 5A6PA 4WCEQ 3SFUA 1FT8A 1IBLF 3LGNA 3FQLA 1FD8A 4X84A 4IG0A 2BM0A 4K4VA 2ZE2B 5M2PA 5IZHA 2E9TA 1L3UA 2PMZD 2WOMA 4QYRA 2IC3A 1VI7A 2MY8A 3PW0A 4ILLA 1R8CA 2DITA 5AXKA 1ZH5A 4WFNQ 4DJBA 2BACA 4KO0B 5KFDA 2MB0B 3MCSA 3M2VB 1Q82T 1GQEA 2HGMA 1VQ4S 2YH1A 1VRTB 3M8QB 2ZH1A 4RW6B 4W90B 4V19X 4CO1A 2K2PA 2KXNB 4QWEA 3MWBA 3R3TA 2KHCA 1A6LA 2XC9A 4DQPA 2VQFF 1SIWB 5KG0A 2IM2A 1HBMB 4G1QA 1FKOB 2IHR1 3FZBA 1RTJB 2F3JA 2MZQA 3ENVA 3TNVA 5K8NA 3OL7A 3KJVB 4DQSA 2FDNA 2PFFB 2KN4A 2FJBB 4X4VA 2IC3B 4F02A 1AW0A 2DGSA 5GAHU 4ED6A 2B6AA 1YBAA 4K5RA 2I9SA 3QYYA 2OH2A 2DHSA 2OPRB 2NXUA 2R7OA 2M5YA 1C0TA 4NA3A 6FDRA 5M2UA 4L3NA 3K5LA 3CCRS 3TOQA 2PSZA 4DPOA 2MGZB 4CNZA 3TP2A 2HNDA 1H6KX 3OTEA 3M05A 3ZZ0A 4QBUA 4EYHB 4Q0BB 4K50A 5F9LA 2XNQA 1HWKA 1WWHA 1WG1A 2RUGA 3OW2R 2YWFA 3CJ3A 3MPYA 3TX8A 3SFGA 2XS7A 5I3UB 3A1YG 3K7RA 5AXNA 3BSAA 1WNEA 1CC8A 3AQPA 4XK8C 4LF8F 5A6WA 5D8HB 1FRJA 3PX4A 1DAXA 2VASA 2GMHA 5J2NA 1S9EB 2ZC4A 3T5KA 4P6QA 4R8UA 1YJVA 2F8EX 3WBZA 1YRXA 1HBOA 1YJRA 3KLHB 1U48A 1LV5A 3NAIA 3BREA 3MXHP 2XHWA 2RNEA 2ERRA 1U24A 5C24B 1NK5A 4NRUA 4AQYF 1URNA 4HL9A 4ICLA 3D0IE 1UA1A 3EPIA 1XNRF 3LP1B 3L7PA 4XO0A 3OBIA 1QVFR 4QYZJ 4DLEA 2RT3A 2AJQA 4DQQA 5F8JA 3KG0A 1X4DA 2LXFA 3B82A 3NMRA 1DBDA 1VQSA 4KKOA 5KOWA 4B3RF 5J1EA 3MTJA 4TNOA 5JUMA 4ECXA 2W7OA 4LSNB 2LXUA 3PW7A 1P1LA 3MF5A 4MMOA 3RYLA 1LQ9A 3D5MA 2FHJA 4QWBA 2ZH2A 3MOZA 5J2QA 4A46A 1HFEL 4M8LA 4LFBF 3LAMA 4DV3F 2XNRA 1S99A 3MEEB 2O67A 2OFGX 2F1FA 4R5PB 4Q43A 4YB1P 4WFYA 3T1AA 5GAEI 4GKKF 3X3UA 3FQKA 4A8MP 4Q44A 3M2UB 4I2QA 2ROPA 4LQ3A 1RT2A 1E6VA 3PR4A 5A2QY 4A8YA 2DT9A 2MKIA 4OQJA 4U6PA 2ZZMA 2R8KA 3BQ1A 4IR1A 1V6HA 1N48A 3N28A 2IVFB 3DN9A 4A8OA 3UD4P 1Q81T 1UVLA 3U7JA 5KFOA 2KFZA 4UOCA 2HWIA 2CPFA 1GX6A 3CWJA 4NMLA 3MM9A 1KOOA 7FDRA 2YY3A 5A8KA 5DLGA 4G6VB 3QWUA 2YH0A 3VAJA 2YX1A 3DRSB 1IKVA 2EC0A 1KVIA 2R4FA 4KFBA 4DL5A 3O5TB 4RU9A 1ZPWX 3E01A 3V81B 2JH3A 4RBVA 1HW9A 1UMJA 4PRFA 1N8RT 1RTDA 3MM8A 2ZHAA 5KFVA 4C8NA 2M8HA 3DLEA 4ERDA 4WYWA 5L1IA 1IXKA 1VHFA 4GO7X 2Y1RI 4NLVA 2Q79A 3DHXA 4RX6A 1FRXA 1S0MA 2DGWA 1D9DA 1RT4B 2COLA 3G6ES 3G71S 5EUHA 2EVZA 2C22A 3DM2B 2MSSA 1O51A 1HNWF 1IKYA 2E1MC 2VBYA 4B3MF 2CZVC 3CC4S 3ONQA 2HIQA 2RILA 4MKYA 4DV5F 2EFNA 1IKWA 2H9ZA 3OR2A 3IG1A 4BHQA 2ACYA 1U1QA 3MMCB 2AU0A 3QWPA 3OR1A 1Q7YT 1D3WA 2J0XA 2R2SA 4IRDA 4F26A 1T7PA 3M6XA 4C11A 4B9UA 4ES2A 4OHZA 1FTCA 2DNHA 3R5AA 4ILRA 4DUZF 4Y2CA 2RD5C 2VFTA 3BZQA 1REVB 1JLAB 3TAPA 3FEYB 3NNAA 1QVGR 2VQEF 1U6BA 2EG1A 3F73A 3DOMA 2D9PA 4ELVA 5J1PA 5EWGA 2VFUA 4I7FA 5KT2A 3QJJA 2BUNA 3MPVA 3ZZRA 1TUVA 3DLJA 5BYSA 3LP2B 4OLOA 4TQSA 3M8RA 1U4BA 2I8EA 1F2GA 3LO3A 4OI2A 5B0FA 4UY8T 2DD8S 5D77A 4YR3A 2ZOFA 1SJ3P 1WEZA 2DO4A 1T95A 5HP1B 1X4FA 1X7VA 2APOA 4DSEA 4FF1A 1N52B 2B0GA 1T05A 5FJ4A 1Q86T 5K5MA 3UR3C 2FC9A 2CPHA 4DR1F 2KVIA 2CJ9A 1HWIA 2C3MA 4CT9A 4F67A 5GAGU 4KPYA 4NXNF 1SV5A 4DMZA 3Q23A 2DRBA 4XDDA 2V4JA 3BS9A 1KD1T 5KFFA 2B56A 3M2RB 4H54A 1H7WA 3ZZPA 1XR5A 5DJBA 2CQPA 3PIOQ 2DR5A 2HHQA 1S0VA 1C1BB 1R8BA 3FRZA 1VQYA 2D9OA 1EETA 3DYAA 3FZ2A 3M6VA 3HM9A 3GR0A 5GADI 2ZH5A 3UDLA 3I4HX 2ABYA 1HQUB 2I5JB 3L3CA 1KEKA 2PIIA 1MU2B 1UJ6A 3SEOA 1F5AA 4XAKA 4C8MA 1FTRA 4MK7A 1LFPA 3ENWA 5KFCA 4X65F 3JTOA 2O66A 3ZZZA 2EG2A 5HN0A 3EXCX 1QLNA 2C42A 1SKRA 1JXEA 2UV8G 4ZP7A 4NLGA 3F44A 3FMBA 2HWHA 1D1UA 4TU7A 3TARA 1TKDA 1Y3KA 1P1TA 5A0YB 3PFEA 4A48A 3TVKA 3PV8A 3T3FA 2BYCA 2WAQD 3H8YA 5B09A 3T5JA 3PDNA 1E6YB 1U7LA 1JLGB 4RNNA 3DI6A 2VG6B 3BDEA 3QAUA 2EWHA 4NYOA 2ROEA 4USIA 1RTHA 3I5CA 2N7YA 3MECB 3E51A 1HQEA 6FD1A 1DURA 1KQSR 3OR1B 4MKAA 3KLGA 3Q8PB 3OXLA 4PWUA 4ELTA 2C28A 2IBOA 1IKWB 3OR2B 4NCBA 2FC8A 3CVKA 3QIPA 4FVMA 3WC0A 5DQHA 4NLTA 3RAXA 4HKQA 3KK1A 1OO0B 4B9VA 1V3SA 3DXSX 4LF6F 3SMZA 5ADZA 2V9WA 4Y2IA 5CXTA 4KAIA 1HPZA 4I2QB 4LFCF 3BSOA 1T03A 2QYCA 2JWNA 5A8WA 3I6PA 4LF7F 3HHEA 3M30A 2RQKA 4R5PA 3C6TB 1X4CA 3D1HA 1GTEA 4LIWA 2QA4S 4PUOB 1LWCB 1VQ8S 5DQGA 2BR0A 4J5OA 4TXSA 2AJ4A 4PR6A 1JLFA 5AXLA 4C3KA 2KTQA 1LWFB 5KT3A 2N4CA 3IO1A 4CH0S 2UVWA 2VOPA 3TR5A 1F60B 3NCRA 3RZAA 1YSJA 3MR6A 2CPXA 1B7FA 1B64A 2B9YA 2IM3A 4I6AA 1KLMA 2W9CB 3ZZYA 5KFLA 1WG5A 4X4RA 4DL6A 2C3PA 4DFPA 5E33A 5LMNF 1T3NA 3DLBA 3DLKA 1VC5A 3C6UB 2R8GA 2VONA 3OTOF 4ED5A 5AJ3F 1OQ3A 2VBXA 5HBMB 4J9OA 1FCAA 3OJUA 1JJ4A 3KLIB 5F8MA 1L3TA 1DRZA 1VQ7S 2VA2A 4QJVA 4R8UB 1BGXT 3D1QA 2VV5A 1RT1B 5F9NA 2HS3A 3RB4A 1APSA 3BGUA 3CSKA 4DHVA 1YRTA 3QGGA 3V2UC 1RK8A 4GMKA 3MEKA 4N56A 1RT6A 1ZZFA 4AL5A 1RGVA 2DHGA 5IQ6A 1JMTA 2QEXS 1IKXA 2HS0A 2FY1A 5KTQA 1M0SA 1EP4A 2H5EA 1RTIB 2VG7B 4ED8A 4OZ5A 4NA1A 3SV4A 2WHOA 5KFJA 5E3AA 3JTNA 4QPTA 2VFSA 3HP6A 2G1DA 2CPEA 1WTFA 4O3NA 3NMAA 1IJEB 5LMUF 2JLFA 2YNHA 2OMOA 1I1GA 2B6AB 4J9RA 4JI7F 3GB0A 4DS4A 3HLUA 1NB7A 3T5HA 1RT4A 4C0BA 1VIXA 2FTRA 1FRHA 1YJTA 2K1RA 4Y2MA 2IVYA 2IBKA 3C2PA 3OV7A 3KLHA 3CDAA 5GAEU 4IFYB 1DLOA 3MMBA 1NRKA 3MEGA 4X4TA 2WK4A 3MHYA 3EGZA 1RT2B 2L9NA 2QRRA 3NNHA 2G4BA 4OX6A 1NO8A 4LF9F 1C0UB 1N54B 2RE1A 4O4RA 1LWFA 1PC4A 7FD1A 1NH8A 2YNGA 3N79A 5H9FJ 4OI3A 2DGOA 4JV5F 3AJ2A 1TZ0A 5C5JA 5F3ZA 2YNGB 1JLCA 4E98A 3DMJA 3RW7A 2OTJS 2VKZG 4TU9A 3S6EA 4ZP8A 1PC5A 3UQSA 1NK8A 2A10A 4WTYA 2YKNB 3IWLA 2W8LA 4H4OB 1VIOA 1M5SA 3KHRA 4J9KA 1IBKF 5L39A 2FJVA 4W92B 2L3MA 4DF4A 3HVRA 3WX4A 4NL5A 2J0SD 1HNXF 1HMVA 1T3OA 4FF4A 1FJ7A 3CCVS 2R7XA 1BQMA 3ENQA 1S10A 5DG8A 2CQCA 2FVQA