3K7RA

Crystal structure of [tm][cuatx1]3
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
70
structure length
70
Chain Sequence
EIKHYQFNVVMTCSGCSGAVNKVLTKLEPDVSKIDISLEKQLVDVYTTLPYDFILEKIKKTGKEVRSGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tetrathiomolybdate inhibits copper trafficking proteins through metal cluster formation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
molecule keywords Metal homeostasis factor ATX1
total genus 19
structure length 70
sequence length 70
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2009-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3k7rA00
1YRXA 3CJKA 5A6PA 3HX9A 5A6WA 1URRA 1FE0A 1OQ3A 1ULRA 3FRYA 4YDXA 3K7RA 2Q3PA 1P6TA 2N4CA 2PGCA 1U7LA 3DXSX 5K9FA 4F67A 2JDJA 2BBEA 4HI1A 3TNVA 1AFJA 4ZOSA 1X7VA 3BDEA 2ROEA 1N5SA 2EW9A 2IYGA 2QLXA 5KAKA 1MWYA 2OD4A 4DN9A 2ZDPA 3QMQA 3KG1A 3MCSA 2LDIA 2GCFA 4Y2KA 1TR0A 2BUNA 2VH7A 3VTIA 1FESA 1W2IA 4FNHA 2IFXA 2L3MA 3HHLA 3BGUA 2GFFA 2XMWA 4Y2IA 3TRGA 1AW0A 2HLTA 3QGPA 3F44A 4EFAC 1RJJA 2VV5A 2XMVA 1OQ6A 2QIFA 2LQ9A 1SQEA 3DCAA 3GZ7A 1X8DA 2QLWA 2FIUA 2IYIA 1QUPA 1FD8A 4DPOA 2OKQA 1WD6A 1Q8BA 5T7LA 1OSDA 1Q4RA 3IWXA 2KKHA 2OMOA 4OJ3A 1R6YA 4OJGA 3CJKB 5T7LB 2HLUA 3BR8A 2ACYA 2BJDA 1KQKA 1YJRA 2ASYA 1V3ZA 4A4JA 2GA7A 1SB6A 4HH1A 1LQ9A 3HF5A 1S6OA 5B0GA 2HQIA 1S6UA 2OD6A 3LGNA 4Q2MA 1Q8LA 1TUVA 4NPOA 4OJ1A 5F0UA 5B09A 2K2PA 3BB5A 2W4DA 3MZIA 4Q2LA 1IUJA 2LXFA 1SI9A 4A46A 1GXUA 1N5QA 1X0PA 2FHMA 2K7JA 1VQSA 2OAUA 2XMKA 4QOTA 2RU9A 1YJVA 2XMUA 3E8OA 2QYCA 2KT2A 1GXTA 1CC8A 1TL5A 5B0FA 5B0BA 5B0DA 2LQBA 1TZ0A 1FEEA 2OFGX 4A47A 1VQYA 1JK9B 2ZDOA 4HI2A 1AFIA 2GV1A 3HFKA 5B08A 2GO8A 2OFHX 2K1RB 1FVSA 1YG0A 4ZA1A 2W4PA 2K7KA 2KT3A 3I9ZA 2FB0A 2K1RA 2AJ0A 2G9OA 2HIQA 2PD1A 1Y9OA 4OJHA 2W4CA 1FE4A 4NL5A 2BYCA 5B0AA 4HL9A 3FMBA 1Y3JA 2XMTA 3BM7A 3HHLB 1OPZA 4A48A 5IXUA 1K0VA 2RILA 1CPZA 1N5VA 1P8GA 2HFOA 5B0CA 2OP5A 1XBWA 4YEAA 2XMMA 2CRLA 2GGPA 2ROGA 2XMJA 2HFNA 3HHLD 3BN7A 3IWLA 2N7YA 3UDCA 1APSA 4DL0C 2AJ1A 4U9RA 5B0EA 1CC7A 4OIXA 1Y0HA 2KYZA 3KKFA 2AP6A 1Q53A 1KVIA 3BF4A 3LGMA 1TL4A 1MWZA 1N5TA 2RMLA 3TOQA 1YJUA 1YJTA 2RSQA 3LO3A 3HDSA 4HH0A 2AW0A 5F0WA 3WDOA 1KVJA 3T9NA 1FVQA 2BJEA 2GGPB 2FTRA 3KNGA 1Y3KA 2ROPA 3HHLC 3FGVA 3KG0A 2N4DA 1JWWA 4FNIA 4Y2MA
chains in the Genus database with same CATH superfamily
3MEDA 1ZS6A 2XYHB 3ZNJ1 1UAWA 1TK0A 3TZWA 4B02A 1H0HB 4R0EA 4LRDA 1W2BR 3M2VB 4NCGA 1S48A 1NB7A 3CCQS 2IRUA 5GMKa 1RHQB 2AMCB 3LAKA 3A8JA 2ZWPA 2QA1A 4TN2A 4X65J 4OX9J 4KIAA 1VCTA 2RHSB 4USJC 4WJBA 3SDEA 4ZLPA 2I5JA 5HJYA 1MWYA 1KP6A 3DRSB 2KO1A 4OI0A 4HKQA 2MY7A 3MCSA 2Y1LB 3BBCA 1BE4A 4RNFA 5LOQA 4TLQA 2WHOA 3TZYA 3VR1A 2AJ2A 1T95A 5C7PA 2E5LF 1CQNA 2UUCF 2UUWA 4Y2IA 3V6HA 1ELOA 4MFBB 4CCHA 1R0BG 4NA1A 3TVZA 4ITSA 1RJJA 4JI0F 4FXVA 1QSLA 1RAFB 1HA1A 3T19A 2I2YA 3NNCA 3FFIB 3MR3A 5GMEA 3HFZB 3F0NA 4DN0A 3EGZA 4X64F 1JNZB 2DHHA 4GKJJ 3GIMA 4GKKF 2DK2A 3ILIA 2J5AA 4L3KA 4ED0A 2FIUA 2ADCA 1DTTB 1S1XB 2UXDJ 2MGZA 3R5BA 3MECA 5KFQA 2XC9A 3UO0A 2YNGA 2DHGA 4K4ZA 1LWCA 1F1BB 4FXWA 1KRPA 4A4JA 1BGXT 3HXMA 2YQ0A 1HHTP 1Q5VA 1SB6A 3KNAA 3U27A 2ZHAA 2F1FA 5ETMA 2E1MC 1FKPB 1TK5A 1QVGR 3MEEB 4DSJA 2W8LA 3JAMY 1WNEA 2GJFA 1D0EA 2HVDA 2JH3A 3MZIA 1WUUA 2LYVA 3OFEA 3ELHA 2W8KA 5FDLA 2CXEA 1CEZA 2FHMA 2R7UA 3PV8A 1TV6A 3CJ8A 4IUFA 1YK9A 5DJBA 3AB4B 3KMQA 2B7CB 1JLQA 2PE8A 3M30B 3CW2C 2YVSA 5K8NA 4IR1A 1NEEA 2EBEA 5KFIA 1IWAA 4I68A 4MKBA 3CUNA 4QYZK 2HMIB 1RWXB 1S6PA 3ISNC 3OLAA 2H5EA 3H25A 1REVB 1RT6A 3QAEA 1X0FA 2FVRA 4L75A 4C4WA 5AT1B 4RX6A 5F8IA 1GNKA 2WK4A 4DDFA 4ZLLA 1UJ6A 2H4WB 4ZMMA 1VQOS 1N4LA 1CJTB 1XQIA 1FERA 1SJRA 1HWIA 1UFLA 5D4PA 3T1HF 1IM4A 2UUBF 2HIQA 2YPZA 3FBBA 2OPQB 2EEYA 1RWMB 4B3SF 1C4CA 5KFJA 5B0AA 1S97A 1CBKA 1UEVA 3M05A 3AOCA 4DOZA 3LTOA 3CC7S 5D3GA 3Q2SC 1HNVB 4DFMA 4WP8A 4CH0S 1Q8KA 2GGPA 2MKSA 3BGFA 2E9ZA 2EFNA 2G0IA 5GAEU 2HHVA 4RW8A 4AE5A 2DR6A 2XZDB 3AA9A 3QZ8A 2HPUA 4U9RA 3HSJA 1DY3A 1NHVA 2DY1A 3R6GB 2MB0B 1FJCA 3BKTA 2H48B 1VQ9S 1JLAA 1N54B 4CLKA 2VC0A 3I5CA 2VPWB 1IR1A 1MN7A 1YJUA 2DNMA 3EZUA 3M2VA 4LBIA 2F3JA 3V4IB 1ZZNA 1ZBTA 2D41A 1YQHA 2E7WA 1N0VC 3GJTB 3WZ0A 3IG1B 4BCAA 3GPAA 2CNKB 4CDIA 2NUUG 3ITHB 3UN5A 4X66F 2R9LA 2RS2A 2RRAA 3PYEA 3K89A 4A8FA 2X3GA 3QLHB 2VD3A 1EETB 4ZPCA 2FGCA 5EGYA 4FNIA 1O8BA 1RHUB 2EI5A 4RW7B 2J9EA 1VJWA 2IM0A 3CNQP 5BR8F 2VJUA 3I0SB 3C6UA 3KHHA 3ZTQA 2HYIB 4E8UA 1KS2A 3Q0AA 2KM8B 4M8LA 1YI2S 3DYAB 1AFJA 2KG1A 1S6PB 3LANA 1MROB 5LMNJ 2D9PA 3CE8A 3EDQB 2YKAA 4OX8A 4PXBA 6FD1A 2XS2A 4DPYA 2GCFA 4TXSA 2KXNB 2VH7A 2JHEA 1Z1ZA 2M8DB 1W2IA 3MWBA 3FK4A 4FNHA 1ACMB 2RDDA 3AY0A 3GE9A 2HHHJ 3UCZP 4R25A 4IOBA 3UN3A 3QJLA 1CSJA 3I55S 1MLAA 1TVRB 4XTTA 4JI6J 3R97A 1S4EA 3GSDA 4NXMJ 3RBXA 3TP2A 2E9RX 5KG7A 3C2PA 2LLZA 3DCAA 4ZN3A 2B7BB 1KTQA 1WHWA 2NXCA 5HQMA 3I32A 1S1TB 4F2SA 1SV5B 1WF1A 2KU7A 4OFZA 4WK3A 2NXJA 5T7LA 4F25A 1FWLA 5K8PA 3MCMA 3NCQA 3UDEA 4X4QA 3H40A 5L1JA 1X4CA 3BR8A 4ZVQB 4H4OA 2BJDA 3M32B 4GVBA 2EFGA 3TUIC 4YR0A 2DRAA 1IQTA 3AAWB 2QMWA 3OTEA 4J9UE 5KFSA 3QZ7A 3OTOF 3GTYX 1TKDA 2Z2MA 1SUQB 5CYQA 4NPOA 3NBPA 4RJVA 5HN0A 2LEAA 2W9CA 2YX1A 2RRBA 4OZ5A 4ECXA 1TL3A 2K7JA 4DX5A 3ADAC 4LF8F 4EBDA 4PR6A 2QT7A 3PO4A 5SUHA 4FPIA 3DLGB 3HVWA 3EICA 1U1NA 4KHPJ 1YJVA 3SFGA 1U4BA 2XNRA 3QT6A 4ILLA 1V5IB 5B0DA 1ZH5A 2LXUA 5D6GA 1BQMA 4DR6J 4KJIA 5SZTA 2GVDB 3HKWA 2GJIA 2DNHA 4WTYA 3VF0B 3GYXB 1HQ2A 2JL9A 1U1RA 4HI2A 1HNVA 2BOAA 2B8QA 3BREA 1FTRA 3DYAA 4KGVB 2YNIA 3W62A 3FEZA 5HMXA 2GO8A 3QO9A 5HK4A 4ICLA 3TVKA 1D3WA 1OY9A 3W8PA 3TZXA 5C5JA 2QEXS 2R8KA 4IFYB 3IP0A 4YFUA 1U49A 4ELVA 1H7XA 1WSRA 1LFPA 2XZWA 1IBKJ 3U1NA 2AJFE 2NLWA 4F3MA 2I8EA 3T1AA 3G82B 3AJDA 4ZPDA 4J9MA 4DSFA 3MI7X 3BM7A 1YVFA 4QWDA 3M8QA 1OPZA 3ET6A 1X9SA 2VC1A 1IVZA 2LDYA 1F5AA 4KV8A 3DLKB 3MR7A 3S01A 2IBOA 3SSQA 4ZP6A 2XMJA 3IWLA 3RB3A 3P96A 1NSPA 5E33A 4Y65A 1PAEX 1ITPA 4RZRA 1DRZA 1NU4A 4L73A 3TAMA 2XWXA 4ZJOA 1ZOTA 3CD5A 3E51A 5EX3A 4ECQA 2VONA 3ETMA 5BYRA 1QTMA 1FNOA 3MMBB 3R2CJ 3O5TB 4LSNA 4UW2A 3MDFA 1XNRF 2PT0A 3AA8A 1KQFB 3ITHA 3KWMA 4PG6A 4O3NA 4U7UD 3OTOJ 3ZTPA 3FMWA 3P3DA 4IQXA 3OBIA 3BGRA 1WI6A 5EWFA 4A8MP 4YHHJ 3N6MA 5CYQB 1ZA2B 3OW2R 1SL2A 2XSJA 3T1HJ 3AFGA 4YMEA 3W5ZA 3Q24A 4DL3A 4RW4A 4LT6A 1YRXA 2DNGA 1S1VA 5ETQA 3Q8QB 3DLLQ 2UXDF 1QDUB 2BKNA 5GAHI 4KPYA 1SKUB 2AJ4A 1OQ3A 2IIHA 4HACB 3CC2S 2N4CA 5CZVA 5K9FA 3EVOA 3TNVA 2HAIA 1PILA 3W64A 3RAXA 4M1KA 2EW9A 2VA3A 2WAQD 2E1RA 5JMNA 2ZOMA 1RAOA 3NS5A 2O5DA 2K3KA 3GLJA 4FZVA 4V1Ak 1HYSA 2BZ2A 1IKWA 3KG1A 4R5PB 3VALA 2EBGA 3OTDA 2EKNA 1KEKA 1UJ5A 1U45A 3CD0A 1PYOB 3SV3A 4USMA 3HI9A 3D6MB 3TAQA 2AX0A 3HSZA 4EFAC 3N9UC 5L46A 1OQ6A 3HZGA 1EP4B 2L9WA 3OHBA 1XMQJ 1AUDA 4B3MF 4LF2A 2AJQA 3H5YA 2PIIA 3Q8RB 4CH1A 4RWXA 1RWNB 2CQPA 2E7VA 2HGMA 2BKOA 1DFDA 4DPOA 2BRLA 2OKQA 5DZ7A 5FLXU 1RTDB 1Q8BA 5EDWA 2ZC3A 4H4OB 1HNWJ 2HHQA 2RT3A 1RISA 4ZLJA 5L9NA 2IDEA 4OI2A 2RQCA 3NOCA 4K59A 5F8NA 3MM5A 1OJ4A 3JSBA 1GX6A 1J27A 1JLEA 1SUQA 2WB1D 4KGXB 1REGX 4MKAA 4RBUA 4R8UB 3GV7B 2DR7A 1URNA 2AD9A 4DU8A 3AXKA 4ZVEA 2Z58B 4YN3B 1GEHA 3CCJS 2PI5A 2APOA 2H5JB 1RDRA 5FIIA 1S1UA 4P74A 1V3RA 2HIYA 2F8EX 3CO9A 3DDIA 4GMKA 5GAEI 4CRJA 2NSCA 1PJ5A 3R6LB 4DPXA 4PG8A 4M95A 1IQZA 4NLPA 2YKNA 1C0UA 1RT3A 2AEJA 3HVAA 5B0FA 4X65F 4JV5F 5G4DA 1KR4A 4K5SA 1TZ0A 2Y1RI 4LBHA 3C46A 1RT7A 3L7UA 5L8RC 5I3QA 2HS0A 1PC4A 4K4WA 1FDNA 2RS8A 4ANCA 4EI2A 2OH2A 3I9V9 1HMVA 3ZTSA 5D0GA 2EVZA 1ZYQA 1BMQB 2CQ1A 4BHQA 1A0OB 2CYYA 2E5GA 3KLFB 4ECZA 1PBAA 4ER8A 1MSWD 1EZZB 4ZP7A 3CCVS 3EXYA 2J6TA 1PAUB 1HLWA 3K5MA 4LUBA 3KLGB 4DQSA 1SH2A 4PQUA 3ET6B 3MMBA 4CT8A 3E2EA 2XULA 5KFXA 4C2MA 5EWEA 2FZKB 3SIPB 2DGUA 1GT8A 2FPHX 4B9LA 3GIRA 1SJ4P 1NO8A 2UVVA 1P8GA 4NLVA 1D9AA 2DHAA 2WTFA 2HQDA 3C19A 3E01A 4G6VB 4WU2A 2JLFA 2MKIA 3KK2B 2ROGA 4PABA 2VQEJ 4DUZF 3SEOA 3MM8B 5DO2A 4JI0J 4JI7J 2WVCA 3KUGA 5HROA 5IOLA 2R8GA 4B9MA 1GMWA 3J7AN 1W7WA 3T1YF 4IRKA 1SVDA 1DZ5A 2DH8A 3DOKA 2KFYA 4J91A 5D4LA 2ZJQQ 1J5EJ 1NDKA 2GX8A 3PIOQ 1S76D 2RVJA 3PM9A 3QFHA 1JNRB 2KH9A 2ABYA 2JEFA 4LF4F 1FRIA 4ZKAA 2ZH7A 5HLFA 4NMLA 2JLGA 4K4YA 3LO3A 3HDSA 4LSLB 4BDPA 4O3PA 3MHYA 1DURA 1VFJA 4C3LA 1R43A 1JMTA 3RR8A 2VL1A 4A8WA 2ROPA 2DIUA 2LKZA 1FRJA 1KOHA 2B51A 2C2MB 2MKCA 3FGVA 1S1VB 3LW5C 3GB0A 2O66A 4DMZA 3Q8PB 1N36F 5J2NA 4DCOB 1EKRA 4EBCA 1NDLA 1BQXA 1HPZB 3JTOA 3QBCA 4ED5A 3DLEB 3KYLA 2C2ZB 4QR1A 2JRSA 1RT5B 2E1CA 2HNYA 3EYZA 5IC4B 1HL6A 1WJ9A 3HKZD 2AIRB 1JLGA 1I5OB 2W2QP 5BJRA 1R0CB 1XR6A 1X7VA 3SYZA 1TKTB 4UUXA 2DT9A 2DNNA 1REVA 1RT6B 1IR0A 4FYVB 3JAMU 1JJ4A 1B70B 3Q8YA 3KOAA 1JXVA 1S9EB 3MMCB 2WW4A 3VHQA 3W9JA 1NPRA 1A7GE 3OFFA 1ZAXA 2LVWA 3H5SA 2FQQB 1B0PA 4F4AA 4C97A 2V8PA 3PW5A 1CJKB 2ATCB 2L3MA 1R8BA 1TKXB 2KL8A 1KHVA 2HFVA 3HT3A 1U6ZA 4JUZA 5A2QY 3K5NA 2ZHBA 2Y9HA 2QO3A 4DL5A 3FSIA 1DLOB 3OXFA 1XC9A 3QJJA 1I3OB 2Z30B 3G6XA 1Q8IA 2HRTA 3W8GA 2FC8A 5E3AA 3TVYA 2JVRA 2LEBA 4JV2A 4HLBA 4XIUA 5J2MB 1RYSA 3D54A 4RW9A 1T9WA 2ZZTA 4ZPBA 4J9SA 3FZ2A 4W92B 5D77A 2VFSA 5KG1A 3RR7A 2OMOA 1KHWA 4LF1A 4ZPAA 4C0HA 1T03A 4NCBA 1HI8A 4I7FB 4B3OA 3AJ2A 2DR9A 4PYDA 2XLJA 4DSIA 5KOXA 2E9TA 2BM0A 4FYXB 2GA7A 3J7A1 1GTHA 1LQ9A 3B82A 5EUHA 1EX8A 3H90A 3LWLA 3QIPB 4HEA9 3MPDA 3V4IA 2FVQA 3GIKA 1QLNA 4EMDA 1PKUA 4ZITA 2CA9A 2JVOA 5GMDA 3R5DA 5I3PA 1PG5B 4A46A 3KK1A 3QSYB 3DKDA 4CQ1A 5FLXY 3OUYA 2V4JB 2OAUA 5H9EK 1HQUB 2CPIA 1FF2A 2H65B 2XSFA 1EJ7L 4DFKA 1FJGF 1RLDA 3IBCB 1B7FA 2CAJA 2G2YA 2G0CA 3H2VE 3MMAA 3PO5A 1KLMA 1VRQC 2NR0A 1LWEB 2ZM6J 4X4NA 3MUTP 4I6YA 2RKIA 1VQ6S 3GFHA 2EK1A 2BDPA 4DV0F 1Q79A 2LMIA 4Z37A 2DRBA 1UWAA 4ZVGA 4X4OA 4J9QA 1UJ4A 3FBEA 3GCWP 3PHTA 4LRAA 5KFUA 1D9DA 4NLTA 5HROB 5AXNA 3TUZC 2BW7A 1N32F 2HS3A 2HGNA 1OSCA 2P9EA 2RB7A 5HJXA 1NKCA 3TYTA 4XAKA 3DOKB 1IM6A 2IVFB 2W4CA 2BYCA 3NEKA 4LMZA 3SCKE 2HHSA 2UXCF 1HWUA 4IRCA 2DHXA 2RQ4A 4YY3J 3MURP 4LF6F 3ILLA 5B0CA 4ILRA 3J81Y 4C11A 2GHVC 3MUMP 2XMMA 1UVNA 3SMZA 4CLZA 1U1KA 1UPPA 2GHWA 3P5BP 3UI3A 3DRRA 3AD8C 2CQ3A 4F4XA 1RHKB 1WG4A 4PCQA 1FJGJ 3BN4A 4O3QA 4DFPA 2VQFJ 1N6QA 4RW9B 2AP6A 1HWLA 3AHPA 3BF4A 3M1VA 4LR9A 3SCLE 4DL7A 2QJ3A 4FF3A 1MWZA 4YB5A 3GJRB 4CLSA 1UVLA 1N5TA 3IA0A 4B3RJ 1B64A 1S57A 3C8YA 4OYZA 1AZSB 2F5GA 2CDQA 3MM6A 1Y5NB 1EB0A 3PJWA 1NM2A 4M5DB 2MLYA 3BJYA 2QL9B 1S79A 2Q6BA 3K17A 3O1LA 2DY9A 3VAGA 5IT9Y 4Q44A 3BDPA 1WG1A 3PXGa 1RP5A 1R0AA 2CPYA 3BKUA 3GP9A 2YWGA 4ID5A 2KZZA 2R7VA 3LOUA 3FCVA 3CJKA 3T9ZA 3LP2A 3SQOP 4IFYA 5A6PA 4O3RA 5A6WA 3ZZUA 2Z57B 1UWBB 2J7UA 4NLOA 4YDXA 4MIBA 1ZAVA 3K7RA 2Q3PA 2MLXA 4DV3F 5J1EB 1FHTA 3K2YA 2FJBB 2EWHA 1NUEA 4U7UK 1DLOA 2GC8A 2LEPA 4CM2A 1J5EF 4USIA 4DUYJ 1B3TA 2AZ1A 2QA4S 2O67A 2VBZA 1H73A 4F2RA 2EK6A 1CJKA 2F9JA 4OI3A 5LSOA 2LA4A 3LALA 4DLEA 3AQOA 4JYAJ 1N8RT 1O0PA 2IC3A 4ZK7M 2Q43A 4TLRA 3FNNA 2CQGA 4DL2A 1Q82T 4YB6A 4ZCLA 4ANEA 2R7WA 2V9WA 1GMVA 3M32A 4GVBB 3MTJA 4IG3A 5KFEA 2VG7B 1Y00A 4NXMF 1WOPA 3G8QA 4LRCA 2LQ9A 5KG3A 2ALZA 4DR4F 4NRUA 2HBRB 1U8SA 4C11B 2WW8A 4ZCMA 8ATCB 3J80U 5CYMB 5J2QA 1YGYA 1FFSB 3R3TA 4CT9A 2DVIA 3IWXA 3KHLA 4RW6B 4J9RA 4FKYA 4IKAA 5DDQC 4EU0A 1NK9A 4LFCJ 4NLXA 5HMWA 2MZ1A 4JI3J 2QSWA 3JQJA 1X4AA 3M2RA 1RHMB 3M6WA 3MMAB 4IFVB 1HWKA 1RWWB 3A8KA 1Y5LB 3EDRB 4YR2A 3J7YI 5KFWA 4JBCA 5DQGA 1Y10A 2BKPA 3IR5B 1RZMA 2ZUAA 3L95X 1FWKA 2ZBQA 4ZPVR 4Q2LA 4KR0B 4ZVUB 1RUSA 2J0WA 2BOPA 3NS6A 3PRVA 1N34J 2MLZA 2HBYB 1SKSA 1GQEA 2QMUB 2VKZG 1PSDA 2FC9A 4O4GB 1LWEA 5KT6A 2ZNZA 3T1YJ 1QM9A 2VPZB 3OQ2A 2PC6A 3NP5A 4RW4B 5DQIA 1JX4A 4PG4A 2UVWA 4CLLA 5L9XA 4M94A 1TKZA 3N0VA 3DLBA 2ACMA 4JI2F 3PX0A 3G2XA 2HG4A 3CD7A 4KB7A 3M2UA 3M6XA 3M8ZA 4LQ9A 1OY6A 4LR8A 3FSXA 1YZ6A 3DN9A 3NG8A 4PXCA 4DS4A 4ZJLA 3K8VA 4P52A 2D7SA 2C42A 1G3OA 2A6OA 2CJYB 2A0FB 2DH9A 2NPIA 2OFHX 5CH7B 2AYBA 1KN6A 5LXYA 1R31A 3CCZA 4MTPA 3HPOA 1OS5A 3MUVP 2HNZA 2E44A 4ZVSB 3RG6A 1KFSA 1RWVB 2BJ7A 2C3OA 4QW9A 3BS9A 3BYRA 3JTNA 4OJHA 2OTLS 2L48A 3T6BA 4Z7YA 4CNZA 3KK3B 4NX9A 4M5LA 1Q78A 3VZIA 4GRSA 5D0RA 2RILA 2RQMA 3NGSA 1UFWA 3BR9A 4R8UA 3IN5A 2JFKA 1XBWA 2CZ4A 4ECWA 1T7PA 3QNWB 5ETTA 2X3DA 3HHLD 2DBBA 2GO9A 1C1BB 9ATCB 3PW7A 3UR3C 1T8EA 2IA6A 4J9PA 2L08A 7FDRA 1S10A 3N28A 4XDDA 1S12A 3MR6A 2V63A 1GX5A 4GVLA 4Y6IA 2AZ3A 3V6DB 4DR4J 3MCOA 3EE3A 3KXDA 3M9OB 3MM6B 4M5DA 1NSAA 4RWWA 4PWDB 3TA2A 3V81B 2JEIA 1KONA 2H4YB 1RT3B 2DO0A 2HZAA 1JKHB 3WIVA 2GIQA 1TAUA 1YX2A 3BH7B 2R2RA 4KFBA 5L1IA 2JWNA 1LK7A 2EFOA 1F9HA 1CULB 1U0SA 2HK3A 2V67A 5GADU 1VC5A 1SBRA 4YUDA 2ZKUA 3LP2B 1FD2A 3HMJG 3QRPA 1QAJA 5KFDA 2FJAB 1SQGA 2P5VA 1M5OC 4HTJA 2XNQA 3UCUP 3OTBA 2D74B 3JB9k 1YKWA 1F2HA 3DM2A 3NS7B 4K5RA 1SPBP 3DXSX 2BJ3A 2XHCA 2BBEA 5F41A 4J37A 4A8QA 4DV5F 1H6KX 4CZCA 2FHJA 3R7SB 4KRWA 1M5KC 1IBMJ 4OZLA 3Q8VA 3EXCX 1PO6A 3HHDA 4ES3A 4FP9A 4NLQA 2MZTA 4NYOA 3MEGB 4O44B 5L1KA 4Q8FA 1S9GA 2DD8S 2EG2A 3DOLA 1NSQA 1QSSA 2OTJS 1S1WB 2CJBA 2YTCA 1UW9A 1WF0A 3HHLA 2M4MA 4PPZA 3EZ5A 2V2KA 3PYDA 5F8MA 3DNCA 4OX9F 4DLGA 1X9MA 2J8SA 2DPJA 1GMUA 2DCLA 1FEHA 4QWCA 2VU5A 4MK9A 4PG7A 4CWBA 1WKKA 2FLLA 1R7IA 2YWWA 4MIWA 4KQZA 1KC8T 5F8HA 3B54A 1FRXA 1IBCB 2QL7B 3K58A 4ED6A 5H9FK 2KN4A 4PWWA 1WC4A 3EGVA 2B4UA 4OYOA 5IWAF 1QE1B 4I6AA 1FX4A 4IO1A 4DUYF 1N48A 3VGTA 5KG2A 4PRFA 4MMOA 1RT5A 1BHNA 3DLKA 4ZVTB 2BW2A 3FFIA 3DLJA 2JSXA 3LGNA 4OYMA 5F0UA 4K4XA 3PCOB 4B9VA 2HEKA 3GFYA 2Y8WA 2OMLA 1SI9A 3EPGA 2HVZA 4FVMA 3KLFA 3MECB 3TARA 1EIYB 4NI2A 2FD2A 2C2EA 4WTOB 2VFTA 3B4MA 4HDHA 4URSA 4N76A 2OSQA 5B0BA 5LSRA 1RTZA 1S5ZA 2LQBA 3IGVA 5IT4A 4GC6A 2BE7D 1FJEB 4WIIA 3W2VB 2DRDA 3EVMA 3RB6A 3N5FA 1R8HA 3BH6B 4LSZB 4QW8A 4I0WA 3JSMB 2V4QA 2XSJB 3HVRA 1RAEB 3LP0B 2ZKTA 1JLFB 2IRYA 5D0EA 4X4SA 4NXNF 1VLYA 2HAFA 2C2NA 2CQCA 2W4PA 3MM8A 4P71A 4J7CA 2M2BA 1BWVA 2DGWA 1MMDA 1C1CA 5A8RA 1B7YB 1Y9OA 2IAJA 2PEHA 4O4RA 3S1TA 2HZCA 5KFVA 5D4NA 3CO0P 3FMBA 3PJXA 2UVUA 1S6QA 3MM7B 2L9DA 2DEIA 3AODA 3KLIA 4CIOA 2ZE2B 2OP5A 3MTKA 2PN6A 5LSLA 3OJSA 2Q66A 3MFIA 4MKYA 3W60A 3DHXA 3MPUB 2MDAA 2HFNA 1HR0F 4IR9A 5CXTA 2N7YA 2A1BA 4H4MA 3RW6A 2CQIA 1T9UA 4QIGA 3THVA 2JZ5A 4HR2A 2AJ1A 5B0EA 3JS9A 1M1GA 3EJMA 3HVTB 2GQQA 2CVIA 1VRUB 3HO1A 3KLEA 3MF5A 4WF9Q 3D3BJ 2KG0A 3B6BA 2QLJB 2ZEJA 4YR3A 3TOQA 1EP4A 1V3SA 3IMQJ 3TW0A 4HH0A 4CO5A 1IR2A 4RU9A 4PWDA 1B0TA 3NRBA 3KJVB 1YBUA 2J7KA 1S0OA 5JXSA 3C16B 2IVMA 4DG1A 2W7AA 1B4SA 1TTHB 2YNIB 3D66A 3ILOA 4NASA 4P2XA 3AD9C 4OHYA 1BXNA 1UMJA 2MQMA 2XTJP 1PC5A 5ETLA 3G71S 1O6XA 1ZETA 2OPRA 2WVBA 3FBCA 2F8HA 3DM2B 2C3PA 2LCWA 5I4MA 5DLFA 3HCXA 1BWEA 2Q79A 1ULRA 1TKXA 1RAGB 2XCPA 3G9CA 2G13A 4FBTA 2W9BB 5HAOA 3MM9B 3W65A 5KOWA 4FYYB 3JSRA 1NK4A 5KT3A 4F4WA 1HR0J 3RBDA 5DM6Q 3BDEA 5H1SV 2XHWA 4PAAA 3M8SA 2AHOB 5D8HB 2DGTA 3F73A 3T6JA 1QY7A 1V9OA 1WF2A 2OD4A 3CD6S 1EARA 1YBTA 3VGSA 2W7OA 1U47A 5KT5A 2B4OA 1IWGA 1SKWA 2G2ZA 1HNIA 1JLQB 3HD2A 3M30A 1FA0A 3IRXA 1FESA 3DXBA 2B0GA 1XMOJ 3QPIA 1QTNB 1WHVA 2BE9B 3BGUA 3B78A 4OV6A 3BSAA 3TRGA 1FXRA 2M5YA 3HFVA 4O3OA 2H51B 4NYPA 1JJCB 3F44A 1C1CB 1E6YB 1WOOA 3C15B 5F9NA 1UVIA 2XO7A 5KFAA 2HK2A 5GAGI 1RHRB 2I6WA 4LF5J 2F4VJ 2GAHC 4GC7A 2FHJD 4N8OA 3IM9A 4J5OA 4NLSA 2CPFA 3MR5A 2UUAF 1VI7A 1FD8A 2DB1A 1U1OA 3KK1B 1SQFA 3H20A 2J0SD 4H4MB 4D3GA 1L3KA 5BXIA 4TKTA 2BMBA 2OGUA 1N33F 3MCNA 3QSIA 4E98A 3KMSA 1VQ4S 1Q81T 2XS7A 1GK8A 1B99A 4DF8A 5KFZA 3TUPA 3KLEB 1AB8A 2C22A 1I94J 1MNEA 3CCES 3PG9A 1HBUB 4HTIA 1R89A 2KRBA 5T41A 1SJ3P 2YKMB 1I51B 2CG8A 1KWMA 2VPXB 3WBZA 4DI6A 5JUMA 3HSGA 3CCUS 4UQTA 4W98A 1UP1A 5EWGA 2OELA 3BQ1A 2IMOA 2QYCA 3VGUA 1TL1A 1AYEA 2BQ3A 5I42A 2YX7A 1KVJA 1HNZF 3MD1A 4K4SA 2BV3A 1HNZJ 3I82A 4KKOA 2DGQA 1G2EA 1RK8A 2BM1A 3DMJB 4DR5F 4FDFA 4OMFG 4OX7A 4FBUA 4QIEA 2MKYA 5GVQA 1RBAA 1RU2A 3JYTB 3UVJB 3HFKA 2Y1JA 5B08A 2PMWA 2JC0A 4OZJA 3W2WB 1FVSA 3D3CJ 2V50A 3JQKA 2XBPA 1JLBB 3UPFA 1VDHA 4ZCIA 4X4PA 3K5LA 3KG4A 3U1MA 1TMMA 1RWKB 4G1PA 3V2UC 2ZH4A 4RUHA 2OPPB 1TP7A 4X66J 2YWEA 4QPTA 1LFWA 2IDLA 1KQSR 1FE4A 4A8OA 1C4AA 4QPXA 3BBFA 1EHWA 2D1CA 3G6VA 4DUZJ 3K59A 3BSOA 2XLKA 1TQLA 4URQU 3PX4A 3IBFB 3I5AA 1F6TA 4OZNA 3TA1A 2QN6B 4DV5J 3OR2A 3NGTA 4DWIA 4B9SA 2B6AB 3IAS9 1GH8A 3E3XA 1CC7A 4OX6A 2ZM6F 4YQWA 4KY3A 3SSRA 2CZ9A 2HHUA 2IY5B 2XCAA 1HI0P 1R3NA 3ZFVA 3PW2A 2HFZA 1H7WA 5L1LA 2MQLA 4MYTA 1FVQA 4WFBQ 4M5KA 5LJ3Y 1XMOF 3KFWX 4IH6A 5CA5A 3CDEA 3HHLC 1VBYA 3NOGA 2KJVA 2XEXA 4DL4A 4FF1A 3IGNA 4X64J 1RKJA 3EM1A 2PI4A 2D3O1 1HBOA 2WRMA 1SC4B 4WYWA 2X1AA 2A6MA 2DISA 2XYGB 4DXLA 2OPSA 2FJVA 4MKVA 1Q5YA 4DV6J 4KGZB 3NGUA 1SJFA 1LWXA 3OSPA 4HI1A 4UZBA 3OSNA 2ZFHA 1E6YA 2B5JB 1UVMA 2AEMA 3PW0A 2OUGA 3EVWA 2IYGA 2QLXA 1Y4ZB 1YRTA 2YPYA 3MD3A 5IM0A 4TU8A 3R1LA 3MOZA 1IBMF 4Y2CA 4LIWA 3IRXB 1IN0A 3RZAA 1W26A 3FCWA 4LIRA 2XO6A 2J8AA 1G4CA 3MPWA 1RTHA 4PQAA 2B43A 2UUCJ 4E0DA 2HURA 1U2RA 1U2FA 2Q1LA 3BQ2A 3D0HE 1CVJA 1KFDA 3VVUA 5BR8J 3NGDA 3TAPA 3IR6B 1U1PA 2UXCJ 1NHKL 1UZDA 4B3MJ 2V6AA 2QZ8A 2IJRA 2C2KB 3KUHA 2NS1B 3H4BA 1JXEA 1LW2B 1SQEA 4AD6A 2VJVA 4ZVPB 2C3MA 4ECSA 4B9UA 2QLWA 5LMUJ 4DV2J 2GMJA 5IS2A 2YKMA 2AWZA 4P75A 5F3TA 3DI6A 4NLDA 5F8LA 4DR3J 4ED1A 2KKHA 4IDKB 2W24A 2ZH3A 2B9YA 2QX0A 4QIFA 1NLKL 3TI0A 3R5CA 2MGZB 2E66A 4NLUA 1WKLA 4U8YA 2FJXA 1TL1B 1AROP 2I38A 4IYQA 4C8OA 4USWA 4LFAJ 1Q8LA 3H0PA 3F56A 4Y28C 4RNNA 1IBKF 2BQUA 3M4XA 1F5BA 5AE1A 2YKNB 9RUBA 2XLIA 1HHSA 1VQSA 2HBZB 4ZHRA 3K8WA 4F3QA 4WKYA 4UQGA 3PR5B 1SH3A 5JJBA 4A8YA 4Q8EA 4RUAA 3X1LB 4C3MA 1NDCA 1LW0A 2OJ3A 4B17A 4DF4A 1FKAF 1JLEB 1AZSA 3ZTOA 5KT4A 1FX2A 2HQCA 4ED3A 4DR6F 3KDNA 2C2OB 2I5JB 1JK9B 2DH7A 2JFDA 3RGIA 3IWNC 1I94F 2W9AA 4WWSA 3THPA 3S6EA 1CJTA 3HLUA 3PFEA 5C42A 2ZH2A 2G4BA 3HK2A 2AGPA 2KT3A 2HSEB 2LU1A 3PKYA 3OXLA 2V4RA 2YKPA 3I4HX 3BGOP 4P72A 2KRRA 4E2FB 2ZJRQ 1U48A 2IA0A 2YWFA 1U2CA 2R2SA 2GVZA 2MJUA 5DG7A 5MLCV 4ID8A 5E7OB 2ILYA 3TZZA 5GAHU 3PZPA 2FHKA 3HHLB 4ZN1A 1BUXA 1PYSB 2IPOB 4LQ3A 3GYGA 2WSEC 1SC6A 3ZZYA 5F3ZA 4F50A 4DR2J 2F4VF 3CTRA 3IS9B 5CAAA 2QLBB 2V34A 1HNWF 1NK7A 3BN7A 4JI1J 3UW1A 1HYSB 4W90B 3W5XA 2UUAJ 1LWFA 1FWPA 1LNQA 2VG5A 4DBQA 3Q2TC 3UFCX 4AXIA 2SXLA 1Y0HA 2R42A 2V4JA 4FS2A 5CHCB 2YNFA 1KVIA 4OI1A 1FK9A 4KC5A 3UN2A 1RXOB 2PSZA 1JLCB 2RMLA 2RSQA 3CJTA 2QRRA 1JLAB 4WBFA 4EO6A 2CFXA 4X62F 2Z2LA 1KOOA 3A4TA 4WYLA 3T9NA 1JXLA 3NNHA 2CPEA 1RAAB 2BJEA 2M0GB 2LA6A 2NCKL 3W7BA 2BJ9A 5M2UA 5ITHA 4Q45A 4C7QA 1TV6B 4ENOA 4RW8B 3C3LA 4WPAA 2DXDA 4CTAB 1RLCL 1X4EA 1Y5IB 3SXLA 2MJNA 1S72S 1N36J 2RD5C 2NUHA 3M8PA 1ZZFA 3RJMB 3QGIA 4LVOP 1EETA 1RE1B 3C66A 4ED4A 1XMBA 2O1PA 2B3TB 1U8WA 1VS3A 3EX7B 1WHXA 2CJKA 5AE3A 1P6TA 2PGCA 2WCXA 3D0IE 3WX8A 5DDRC 2Z0GA 3OR1B 2ZZMA 2ZVIA 1FRLA 2CWXA 4OYAA 2EFQA 5GAGU 4F4ZA 3UD3P 1WC6A 2OEMA 1NBEB 3SBMA 4K4UA 3I4PA 2B4VA 3U1LA 5KG5A 2IVYA 4DN9A 4DV4J 2ZDPA 2DPIA 4WZMA 2R2UA 4RW7A 4FPRA 4Y3CA 5DDPC 1RA6A 3US5A 1S4FA 4L6V3 2JJ4D 4C6AA 2BE2A 3DRPA 4O23A 2MPUA 2KVQE 3QAUA 2PMZD 4F36A 4XO0A 3NL0A 3CF5Q 1VRUA 3TJ8A 3WC2A 4CLWA 3VAMA 4DCJB 2HLTA 5H9FJ 1RADB 1DQ9A 2W9BA 2PA3A 4JV0A 1X5PA 2CADA 3BGLA 2VFUA 2ZBRA 1U6FA 1L3UA 4WFZA 1S9EA 2P9CA 3MMCA 2J6UA 4KBIA 1WEXA 3UWTA 1CJUB 2A3JA 5E3PA 3CJ3A 2MTLA 1OSDA 2W1BA 1T3OA 1R6YA 2OPRB 1K1QA 1DQ8A 4KT0C 4U95A 4LR7A 5LMNF 2FDNA 1JQGA 1J5OA 2YNFB 2ASYA 3B4DA 3R7NB 2C1EB 4H54A 3EWGA 1ROFA 3PRBA 5B0GA 5B7WA 2OEKA 5DLGA 2NXUA 2AKWB 4ZS6A 3QQCD 1TUVA 1VK8A 3MAAB 1SC1B 2WVEA 2I0XA 1C1BA 1RKIA 4Y2AA 4GO5X 5J2NB 4YHHF 4EYIB 3CDBA 5J2MA 2HHPA 4KH1B 2I9SA 2RRNA 2DNQA 2J9DA 4LF9J 3HULA 2X7IA 2A2DA 2H54B 3CJ2A 4M5JA 4DQPA 4PUOB 2R2TA 1NPPA 2OIHA 5EX0A 1ZM9A 3O2IA 4C3KA 4IRDA 1JKHA 2WSCC 2KHDA 5DGBA 1TU0B 1QAIA 1NXIA 2V8HA 4H4KC 1Z2ZA 2MQPA 2ZDOA 1K0TA 4BWMA 3GV5B 2P6TA 1CULA 4KAIA 4QIWD 2VHGA 4DR7F 2GV1A 4P9SA 3GILA 3ZZTA 2B9XA 3V6JA 3SDEB 3I9ZA 2R7RA 4X4RA 2U2FA 3BZQA 1C0TA 4K0KJ 2GIRA 4I56A 4Z2XA 4ED8A 4ALZA 1NJWA 1O51A 1KLMB 2VG6B 1HW9A 4G1QA 2VICA 3VAKA 4A8KA 2QFIA 3H8YA 4HL9A 3S7RA 2CJAA 1TK8A 2DR8A 1S49A 2GVDA 1SL0A 4A48A 4EEYA 1GAOA 2KYXA 4N5SA 2GVZB 1U1LA 3TANA 4DS5A 4UY85 2CUYA 3P8BB 1HNXF 2QA4G 1OYDA 3GCXP 1ZM3A 1LXJA 2RQKA 1SJQA 5BYSA 5DDOC 2HWHA 3WQPA 1NKEA 1CS4B 1OMSA 1KQGB 2WSFC 2UXBF 3K5PA 4M5GA 4KGKA 4LRFA 4WP9A 3UCGA 2VA2A 2V8GA 3PR4A 2HZVA 3LGMA 2QMXA 2VOOA 5EN1A 3FDSA 3C14A 4CNYA 1AUSL 4NZ6A 2HBQB 3UD5A 4O0IA 2FZCB 1IBLF 1S99A 1JLCA 5HQLA 3RRHA 1YIJS 3GU0A 4EYHB 3M8PB 4KGMA 1Q0NA 1WEYA 4X2BA 3G6YA 1RT4A 4QR0A 4UOCA 4DQQA 1WG5A 3FQLA 2LP4A 2V94A 1KSPA 3CCLS 4F02A 1J2VA 3U7JA 2ZC4A 1W25A 3CJ4A 1XN9A 2BANB 2DGOA 2W01A 3J7YU 3BSNA 4QU7A 2ZH8A 2F9DA 4Q5VA 2YH1A 2ZBCA 2MZSA 2KDOA 1GXLA 3SCIE 2JDJA 3LPYA 3CCWA 3R8YA 4B3TJ 2DNLA 3POTB 3CMES 3EZOA 4I2PB 2A2CA 1R27B 3MFHA 4JI7F 2CVEA 3NKYA 5CD4A 1F9EB 3CDWA 4OHWA 2HQGA 2JLEA 2AT1B 1MU2B 1YTYA 2X51A 2OLWA 3B8HA 3LGHA 4FN5A 3LH2S 2YNHB 7FD1A 3JYTA 2FVPA 4ZIWA 4DFJA 4B9NA 2IFXA 2BR0A 2HVHA 2GAGC 3BQ0A 1AW0A 4Q43A 2R3VA 3D9BA 1WKJA 2CJXB 2A18A 2LXIA 3T41A 2VV5A 2XMVA 3QGGA 3PJ9A 4N77A 4CH7A 4MFBA 2HWTA 1BY9A 5ETVA 5M2PA 3OLBA 3CJRA 1FXDA 3OVAA 4MK8A 5AXMA 4ZIVA 1JLFA 4KFBB 1E6VB 1YLXA 2VQFF 1QAYA 1ZPVA 3FBFA 5KFMA 3J7ZT 4J9NA 4D3HA 3FC9A 5D3GB 4FYDA 2W25A 1V6HA 1WD6A 3H98A 1VIXA 4KYZA 1N5YB 2MKJA 3VZHA 3MXHP 3J81U 3M6VA 3TJ9A 1RB0A 4V19J 4JI3F 3ISZA 2ALYB 2Z8QA 5IQQA 4LF4J 4NXNJ 5HQ8A 2R8IA 4FF2A 2QTWA 2R7QA 1LWCB 2VPYB 3WC0A 1S6UA 4Q2MA 3RB0A 4OJ1A 1S1UB 2XY7A 4P73A 4ZPWR 2UUBJ 3BB5A 3CC4S 3TQEA 5CYMA 1NJIT 3CCRS 2DGXA 1RT2B 1Y11A 1IKXB 4YB1P 2H9ZA 1S9GB 1XR5A 5C2GA 3WIUA 2XMUA 5KG4A 3UD4P 4NLWA 1RWUA 4OZ3A 2U1AA 4PEOA 1RT1A 3TA0A 1DTQB 2CZVC 2H3EB 4CO0A 1Y7PA 3BPSP 5CD4H 1SH0A 1U02A 4AL7A 4WFNQ 4N56A 4F0HA 2FLNA 5HVHA 3R9LA 4R5PA 3PIPQ 2B5JA 2LQ5A 4ZVRB 1GMWD 1ZAWA 1YSJA 4NEYA 4PXDA 2K7KA 1OY8A 2GQCA 3I6PA 1VC6A 3PEJA 2HRYA 2YWKA 5DQHA 2G9OA 5J2PB 3NMRA 2DNOA 4KH0B 2KM8C 2B9WA 2VDHA 1C0UB 1SL1A 3T5KA 1B0VA 5DG8A 4X62J 4LREA 2DO4A 2DNRA 2XMTA 1XIQA 2BVZA 3GFZA 4P7VA 2R7SA 1YJ7A 2NYHA 2HW3A 1HMVB 1SIZA 3FVYA 4NZ0A 3TX8A 4RNOA 2FVSA 2RDIA 3CIZA 4NWBA 2IHR1 1NJXA 1APSA 3QLHA 3TUJC 8RUCA 1PIEA 2OO4A 1UTAA 2RE1A 4ATNA 2VF3A 1JJHA 3KKFA 1Q53A 2IM3A 3D1OA 2HHXA 1CS4A 1TL4A 2W7PA 3KK3A 1U1MA 2CKWA 4GO7X 5JVHQ 2HVEA 2M70A 3QIDA 1LV5A 4RPFA 5A2QU 5KFOA 1H3DA 3UNGC 1NH8A 1D8YA 4P2MA 1M5PC 1F9FA 5C2CA 2FTRA 3LAMA 3L9ZA 2XY5A 1WC0A 2UUTA 1Q86T 5IM0B 3NAIA 2ZZNA 1CJVA 1M1HA 4K0KF 5DS7A 1ZM2A 1IXKA 2CPJA 1KLNA 3LPEA 1WC3A 3VVTA 4JI6F 1T02A 3HX9A 3O3LA 4I6WA 2L41A 4UF4A 4OYPA 3ZO7A 5H9EJ 4HHJA 1TFWA 4I67A 3KDOA 3V6KA 1NK0A 1RWPB 1S0VA 4PWUA 4PZVA 1VQ8S 1NH7A 1FCAA 1N5SA 2Z2ZA 1HBUA 4DZDA 3LA0A 5KAKA 3ISND 5HATA 2ZHOA 1YJWS 5AXKA 1MN9A 1VR6A 3GG0A 4WIQA 4TY9A 1AXQA 3K0JA 3ENQA 2QL5B 1TR0A 1ZM4A 4WFYA 1FDAA 2Y0SD 1P27B 2YY3A 2MZQA 1D1UA 2GFFA 3W61A 3RB4A 3R2DJ 2PA8D 5L38A 3QT5A 3H2UB 1WOSA 1T05B 3DMJA 3K57A 1UA0A 4F0KA 5KFPA 3OD2A 4ECVA 1ZTTA 4JI1F 1F3FA 3HP6A 1N0UA 4ELUA 2MEWA 4OYWA 2JNJA 2WVDA 1VQ7S 2J76E 4RUBA 1ZPWX 4KHMA 2P6SA 3IR7B 1QUPA 4NE9C 4B08A 2W9CB 2K06A 4FF4A 1Q4RA 2X1BA 1XJWB 4UOHA 5HLFB 1WHYA 2V2QA 4ED7A 5T7LB 2CQ2A 2HLUA 2DIVA 2VZ9A 2MZRA 2VFVA 1IKYB 5ETKA 5C25B 5AJ3J 3HHNB 1FJ7A 1HWJA 1RACB 2JOQA 2ZOFA 3N01A 4HH1A 3QYYA 4Z7CA 2NQPA 1KVKA 1HHQA 1X9WA 5B09A 4JI5J 4L76A 4QWEA 2UV8G 4AXJA 2I1RA 5D0HA 4LFCF 1OYEA 1RI7A 1RAHB 4IH5A 4TNOA 4BC7A 1N32J 2RH3A 1IUJA 5A76A 1H74A 1X0PA 3BO2A 3ZC4A 4ICLB 3OL9A 4CTAA 1VQKS 2R7TA 2DXFA 1WWHA 2RF2B 3D2WA 1DTQA 1RT2A 2CG4A 1S7HA 1KDNA 4DV0J 3L4BC 4QQBA 5HL7Q 1HQUA 1N34F 1CC8A 1GXTA 2PEBA 3DLGA 4C8MA 3L7OA 1YWXA 4ZVOB 3L09A 1HFEL 2CPXA 3DOMB 3R1HA 4B3TF 4USHA 3C15A 1VC0A 3AJ1A 3R5JB 2MXYA 2CQ0A 1AFIA 4LFAF 2DYAA 2YKOA 4YP3A 3G87A 3OVBA 2C2DA 1HQEA 1U0HA 4N47A 4F4YA 3PNIA 4DX8H 2P2CB 2QG9B 3DDKA 3G86A 4MT1A 5A8KA 1IJFB 2ZH5A 1H38A 1SCJB 2OI2A 3RAQA 2WONB 3G82A 2R7OA 5D15A 3CCSS 3OJUA 4G1IA 2GMLA 3NXZA 3V4MA 4NL5A 5KFKA 4CO4A 3M9MB 4KV8B 2J9CA 4IG0B 1OIAA 3Q8SB 1IBLJ 2VASA 3GIIA 4JI4F 4V19X 2YH0A 4HHHA 4Y0FA 2Q6CA 4B9TA 3NNAA 4RNHA 4CM0A 2RIJA 3ENVA 2MQNA 3PY8A 3A13A 2F63A 1FKOB 3NGRA 3HHKA 3TAMB 4URGA 5KTQA 3FCHA 2FUG9 1FRMA 1P1LA 3P5TL 4FYWB 2CNOB 3P4UB 1PCAA 5IQ6A 2E7XA 3OFGA 3I0RB 2G1DA 4DSLA 2NPFA 4Y34A 4NOHA 4C98A 4IQMA 3I56S 4QU6A 5LM7E 2NYIA 1TL7B 3QWPA 4HACA 3QWUA 4PKDB 1RABB 2C3YA 2NXNA 3WDOA 4K2JA 1UW4A 1IKYA 4ZDNA 1XNQF 2W2PP 2DJWA 3BEGB 4X4UA 1T9YA 1VMBA 2LQJA 4DPUA 3KG0A 4I64A 3HJFA 2N4DA 4RKUC 3MPVA 1X4DA 3HVTA 1NDPA 1RSCA 1N6QB 2FY8A 4WCEQ 3FRZA 1CJVB 4U67Q 2X1FA 2HFSA 4TYAA 3Q83A 5IC6B 5ADZA 1NK5A 5LMUF 4DV2F 1V5VA 2VODA 3RTVA 1RCXB 4G65A 4A8XA 2G2OA 1RBOB 1K73T 5FD1A 3G8TA 4QR2A 4ZPTR 1JB0C 4JV1A 1L3SA 2DNZA 2ZD1A 1NMEB 3BPDA 2YQ3A 4B3RF 3OPKA 4UTGA 4KHPF 4RBVA 5FJ4A 2B6AA 1X4GA 2NXEA 4NLYA 2ZH1A 5A8KB 3EUNA 1S6QB 1UZHA 3NWGA 2XMWA 4QJVA 4ZP9A 2XQCA 3C14B 3OL8A 1H72C 1VHIA 2COLA 2E29A 4K50A 5C25A 4MIAA 4OL8A 3T5LA 1I1GA 3QRRA 1FKPA 2VG7A 3A8EA 3MOJB 2F40A 4N8NA 2D3ZA 4JI2J 2HNDB 2EFPA 3IBWA 2ZBIA 3I31A 5HVFA 2RUGA 3FJ2A 4F3OA 4GKJF 3TQ1A 5A8RB 1LK5A 1RTDA 3RBEA 4WFXA 2K8GA 2R4FA 4P7TA 2M8HA 1WC5A 2C3UA 1QVFR 1H2TZ 2D3UA 2MKKA 3C16A 4DG1B 3DOMA 1R0AB 1HD1A 1PJ7A 4ZJQA 3QRQA 2K2PA 3TWZA 3ZZZA 1G1XA 3IG1A 2RF2A 5CCMA 2EPIA 2O3DA 1HI1A 3F41A 4ECRA 2XMKA 3TEHB 1NPKA 3HJVA 1RBLA 2B4PA 2YNHA 2RU9A 4QBUA 3MMJA 5CYJA 3OV7A 1TKZB 4BS2A 1RTIB 3FZBA 3M2RB 1NB2A 4NA2A 2ZITA 1FTCA 4MH8A 3MPYA 1XWLA 3Q22A 5K14A 1KTVA 3ZZ0A 3C6UB 3VAIA 2CNLB 2OFGX 1NZ8A 1VHFA 1FRKA 2DGVA 4KSEB 2IJNA 2DITA 1PYTA 2P9GA 1JLGB 2YQ1A 1HARA 1E6VA 1G7CB 1WTFA 2WONA 3D6HB 3NAHA 4QIVA 1PJ6A 2M3DA 1T0TV 4USVA 1HIYA 3UDLA 1TELA 2FB0A 2ZD1B 3NCPA 5DG9A 2HVIA 1HQEB 1U0HB 2BRKA 2CQHA 2RNEA 2YWHA 3VV2B 5DGAA 1KD1T 1N33J 3CEDA 1NRKA 3TX0A 2RU3A 4QYRA 4USTA 2HNZB 2FVCA 1H2UX 3NLCA 3OTCA 3ZXWA 3PW4A 5LL6d 5IXUA 3OR1A 2IM2A 2BACA 2CQDA 3HD1A 4K4TA 1FKOA 2QYGA 4IG0A 5KFNA 3HM9A 1RGVA 3DU6A 1X60A 3IO1A 4YEAA 1U09A 2CRLA 1CLFA 3IM8A 3ULHA 2EG1A 2FZGB 1T9VA 1D09B 2QGFB 3FKBA 4Q7AA 2KXFA 3A3OB 4BWJA 1M5VC 1YITS 1XR7A 1UCNA 3DC2A 1TL3B 1NJZA 3H7HB 3SCJE 3DRYA 3SSSA 3T5HA 2HNDA 5IT0A 1F60B 3H59A 3EPIA 2W2OP 4XDCA 3DLEA 1DAXA 2ASDA 3X3UA 1QUVA 2XZTB 3KUEA 1TUGB 4EWTA 1HBMA 5GADI 2VBWA 2FYXA 1M5HA 2BX6A 2MQ8A 5F0WA 2AGQA 4JI4J 3FUYA 1S77D 1K44A 2V8DA 4DX7A 3TEGA 3SFUA 1FRHA 3KHGA 4DCPB 1SKRA 2CQBA 5C24B 5CCLA 4UOGA 1L3VA 3FSYA 1CJUA 1R8CA 5IV4A 2E5JA 3IXQA 2XY6A 3P45B 2D3OR 3A3PB 2C2RA 3DRXA 2E1AA 2AQ4A 5L39A 2HNYB 1T9XA 4TY8A 1IJEB 1VLOA 3PTWA 1URRA 3BV8A 3VQSA 4F4KA 3CSKA 4HHUA 1HPZA 2J7WA 2XI2A 1RTIA 3N6LA 4F67A 3UVJA 2FJDB 3W9HA 1WORA 4NRTA 4X84A 4XPEA 3LWMA 3Q23A 1BQMB 4LF6J 1FNXH 1SC3B 4O3SA 2NZ4A 2CWKA 3I87A 4DSEA 2A10A 1U6BA 4P2FA 3QATA 1NCLA 2N82B 4DR5J 1XNRJ 1HBOB 2Z56B 3D5MA 4Y2KA 3CJQA 1QJHA 3ZZOA 4J9OA 1T3NA 3MEGA 4O44A 3BO3A 2G1HA 2QE5A 3GIJA 1FK9B 3C6TB 3QGPA 4DX6A 3H4DA 4FS1A 2E1PA 4JI5F 3TO8A 5KT2A 4JB8B 1UETA 3D28A 3QIPA 2XWYA 4NEZA 5E3RA 4U6PA 3GZ7A 3M7VA 3DDNA 1AT1B 4NZ7A 2EC2A 2PDAA 4DR3F 1C0TB 1PBUA 3O8WA 4H4KA 4OQJA 2V69A 2OPPA 3KLHA 2VBXA 2RDJA 4P2SA 2J6SA 1IKXA 2OPQA 3VWSA 4WE1A 4OJ3A 4OJGA 3D7SB 4W4MA 2M7SA 3SV4A 2XYPB 3GWCA 3R7BB 2VKRA 3O6QA 1MWQA 4WZQA 3DHWC 4RLEA 1KKHA 4I7FA 4BLGA 4TQSA 1RAJA 3HF5A 2VIHA 4AQYF 1LKZA 5E3CA 3DGPA 2HQIA 5HANA 1HD0A 2GJ2A 3CVKA 4LF7J 2HGLA 1R8PA 1ZTWA 3GG1A 3RU0A 3N79A 3UR0A 1LOUA 3GJQB 2QA2A 3PFOA 3Q8UA 1VQPS 1N5QA 1YBAA 3SQGA 2XGPA 2FJEB 2JEJA 3PEHA 4FVCA 2MHEA 2ASLA 3OUYB 2AV5A 4OHXA 5J1PA 1OO0B 1YJ9S 4WK1A 1K8AT 6FDRA 5IWAJ 4C8ZA 3OL7A 3CCMS 2HWIA 3D68A 2ERRA 3H2LA 3W3SA 3S8SA 4CO2A 4ECTA 2KZMA 3LP0A 3UDVA 4EZ9A 1VRTB 5M2RA 3OVSA 4P10A 4I4BA 3T3FA 3PVXA 1LXNA 3W66A 3T5JA 3EMTA 1SXLA 3D4JA 3IFEA 4I1TA 5E5NA 4CO1A 5MAOA 1S7IA 5KFYA 5KG0A 2MZJA 2B8PA 4MJKA 1IKVB 1GFWB 2K1RA 2OPSB 5ETPA 4F04B 4C9DA 3M8RA 1IKWB 3CJ0A 3M1VB 3G4SS 3AH6A 3KLIB 2YNGB 5HSPA 1XNQJ 2EC0A 2XB2D 2UXBJ 1Y3JA 3A3NB 1K0VA 2IJFA 1LW2A 5ETOA 5KFHA 4PXEA 5HI7A 4IO9Q 3PACA 4LF5F 1FDBA 3DRRB 3UNYA 1Q7LB 2DEJA 3EGWB 5KT7A 3MM7A 4M5MA 4OZ1A 1XMQF 1T9TA 1U26A 3UDCA 1OWXA 1YDLA 3CJSA 5C24A 4DEZA 3CXCR 4FKXA 1RCOB 3ONQA 3RRGA 5KFTA 5E0OA 1VQ5S 1HBMB 1F2GA 2CJQA 2XMAA 1WDTA 5J1NA 5LT5A 4C8LA 2QSFA 4WE1B 1YJTA 2J0XA 1U25A 3P6YC 2CJ9A 5EHHA 5IFMA 2H5IB 3KLVA 4NCAA 4IFVA 1F5CA 1VISA 2DNPA 4C8NA 3AOAA 3LP1B 5DETA 1UA1A 1L5UA 4N41A 2R7XA 2V68A 4ID5B 4A8SA 4ZHRB 4LVNP 4NI2B 3W5YA 2VFRA 3QT8A 4QYZJ 4ILMA 3ENWA 4IDKA 1K9MT 4MK7A 4WXOA 1KBRA 1UWBA 3GSIA 4Y2MA 4EK2A 2WOMA 2ZNYA 2D9OA 5J1EA 5KFFA 1UVJA 2CPDA 3FRYA 1NHUA 2FLOA 4O4GA 2DKOB 4M5NA 1TFYA 1A9NB 1VJQA 4M63A 1U7LA 3K5OA 2ZBPA 4DUTA 4X4VA 4OI4A 5AE2A 1WC1A 3RYLA 2V2VA 3DFEA 3JTPA 1WI8A 1NNDA 2BEFA 2ROEA 5A0YA 4QWBA 1UEKA 3DLHA 3QGHA 2LU2A 2KXHA 2Y0BB 3BBBA 1FDDA 1EKSA 4U7CA 3I96A 3NMAA 4LJMA 4C8YA 2F8MA 2LDIA 2GW8A 4KPCA 1A6LA 1LW0B 2KJWA 3HHEA 2AU0A 3FEXB 4NCGB 2IMWP 4ELTA 2HKEA 5HP1A 3I0RA 5KFGA 3LUYA 2B9EA 4ZCKA 4AYBD 4DHVA 1TL7A 1VBZA 4LF8J 4IH7A 2AYGA 5D4OA 4PG5A 2NSBA 3SI8A 2CDRB 5E2QA 3DGPB 3BYPA 3W63A 4TQRA 2FY1A 4NLGA 3QO9B 2F4FA 5C42B 5AXLA 3KTQA 3HSDA 3ETOA 3J81j 3E01B 2XM3A 4JV5J 4J90A 3ICLA 5J2PA 5HVGA 1HKAA 4M5HA 3TJAA 5I3UB 5RUBA 5J2QB 3KLHB 2DNYA 4ECUA 2DHSA 2ATLA 1YJRA 3CT9A 1WSVA 1GTEA 2AYMA 2IM1A 3A8IA 3ENAA 3NY0A 4OZ2A 2J9DE 4I2PA 2W4DA 1TKTA 5D78A 2ZUGA 4K7QA 4EBEA 4EGLA 2VG5B 2W2NP 3AD7C 4P6QA 4TU7A 4ETXA 2V0NA 2RHQB 3Q86A 4LSNB 1D9FA 1FI4A 5F8GA 3E8OA 1NK6A 4DQIA 2GMHA 2HQ3A 4K8RA 3SQGB 2EXUA 1G6BA 1VQLS 1TL5A 4UZCA 3RRKA 1X5OA 2KI2A 4OYXA 4NMXA 1VQYA 2R8HA 2AYEA 3BGRB 1TVRA 2BA9A 1N52B 2YX4A 3LF0A 2DNKA 1MMLA 4Y00A 1IKVA 2K1RB 5DM7Q 2QLFB 1I6JA 1D8ZA 1Q7YT 3W1YC 3R5GA 3BKFA 3MEDB 5HMYA 2DR5A 1VQMS 3OL6A 4K4VA 1JLBA 4HYKA 2W2MP 3V5RA 3CJ5A 3AQPA 4C0OC 4PPDA 4R0JA 4B3SJ 3OXGA 4ES2A 4KKOB 1S1WA 2K3IA 2WVFA 2ADBA 3AOBA 4U96A 1FFWB 4ZVFA 4DR2F 4LSLA 3OR2B 2KHCA 3M8WA 4IOCQ 3NBPB 3DRSA 2VB6A 2NZCA 2DGSA 2XG8A 4AL5A 3KJNB 2F65A 2QFJA 1EQMA 2BE2B 3DRPB 3LQVA 4GKKJ 4FXDA 3IAM9 2VG6A 4G1QB 4OHZA 1M0SA 1WEZA 2XI3A 5I3UA 5AJ3F 2ZH9A 1OPIA 2WBMA 3CMAS 3QJPA 3H5UA 2WZ1A 4WXWA 1WTBA 2M88A 2AW0A 2AEFA 1WACA 2MMYA 3GR1A 3MAHA 4KO0A 4C0BA 2ILZA 4EO8A 3KNGA 4KTQA 2PFDA 3KJQB 1BC6A 2FLPA 5KFCA 3TR5A 2XGQA 3VAFA 4ZP8A 2C28A 1RWOB 8AT1B 2FJWA 1JWWA 1MW7A 3PYFA 4YY3F 1FFGB 5A8WB 3IRWP 1VYAA 4U8VA 5I42B 2AGOA 4CLTA 2GZOA 3I5BA 4QCLA 1NAQA 3PHEA 6AT1B 3L7PA 2VDIA 1U1QA 2PMHA 3GJSB 2E5HA 2Y3YA 4ZOSA 3UQSA 2ZH6A 3GQCA 5F8JA 2RKIB 2RUSA 2LQ8A 2Z4PA 4MAKA 4RBTA 4CO3A 4LBPA 4OLPA 3QMQA 5KFLA 1U24A 1NSKL 4OHVA 4XPCA 3CPWR 4DV4F 2R8JA 2DTJA 3CDAA 1X4FA 2BUNA 4PUOA 3N6NA 3RW7A 4DV7J 1X5SA 1O5JA 1UVKA 3ZNUA 3MAQA 1PGZA 2NREA 4I2QA 3DOLB 4IOAQ 3N4WA 2E5LJ 1RT7B 2QIFA 5HP1B 1X31C 1HBNA 4JP8A 4NA3A 4Q0BB 1F3VA 1WDDA 5DZ6A 1MROA 2CPHA 2MYFA 3ILJA 3PKMA 3DI6B 4DV3J 2IYIA 3A12A 5K20B 1K47A 5LJ5Y 1QE1A 2KTQA 2V8VA 3H42A 1UEUA 4DR7J 3A1YG 3CJKB 4OZ0A 3G8SA 2AX1A 3M8YA 2ACYA 3RAMA 3ZTRA 3H5XA 3MEKA 3D1HA 4CLPA 3GR0A 2BQRA 3RUBL 1RAIB 1HW8A 2QC3A 4PYAA 1S6OA 2QV6A 4X4TA 4KE5A 3W2VA 4ECYA 1DJ0A 4YS2A 2N7CA 1S1TA 2ZOGA 4AUKA 4KO0B 2UVRA 3JSMA 4TYBA 4CI0B 2FGOA 4LF9F 1N5YA 4AL6A 4JI8F 2GHPA 2KVIA 3I0SA 4QOTA 1VK3A 4DV1J 2O01C 4RNMA 5U47A 4C48A 3CDUA 2KT2A 1YJNS 1DARA 2HRUA 1P9YA 1AA1B 1UL3A 3C6TA 3CWJA 1RYRA 2HHWA 3FEYB 4A47A 4MYUA 2MHNA 4IG3B 1H2VZ 1RU1A 1SIWB 3GONA 2Z2YB 4USKA 3GV8B 3VAJA 4OV1A 4DQRA 1VQNS 1RT4B 3M6UA 1P1TA 2UP1A 3GYNA 3JSYA 4WU3A 2OHDA 2DXEA 4YB7A 3D6TB 7AT1B 5IV3A 2HHHF 2OEJA 5K8MA 1NKBA 2Y8YA 1X5TA 2B56A 3D1QA 2AJ0A 1WELA 2UU9F 2MKHA 3HT0A 4AFFA 2V2ZA 4F26A 2PD1A 3U02A 5HO4A 5G0RB 1DHMA 3IC1A 4WKRA 5BYQA 2IC3B 2VBYA 4ED2A 3AXMA 3POTA 2N3LA 2IAJB 3D0GE 4EUVA 1DQAA 3Q89A 4DU7A 1N5VA 2MY8A 1MMNA 1SV5A 4OYIA 3KJVA 1FT8A 1MU2A 1UPMB 4Q0BA 2ZE2A 4UT4A 2AF6A 4LFBF 3RBZA 2L9NA 4S0MA 3VQTA 4DL0C 5KFRA 2XS5A 3EGNA 1BLUA 4OIXA 2KYZA 2ZWOA 3PX6A 1HNXJ 2E5IA 4AQYJ 3CB4A 2HFUA 4O0NA 3PDNA 1RTJA 1TAQA 1YRUA 4DPWA 5K8OA 4UOFA 4WFAQ 3OT9A 3VAHA 3WHIA 3D6FB 2KFZA 1M90T 3CGIA 3NWRA 3KJFB 4TVAB 4JOUA 4USUA 4CYUB 3IS9A 3MM9A 1BQNB 3AB2B 5HBMA 4RUCA 3D67A 1EQ0A 4UY8T 2H1YA 2JX2A 3JQMA 4DV7F 1LWFB 1ICEB 2V5HG 3SZ2A 3GFXA 3J80Y 1NJYA 3VGVA 2KB2A 1T03B 4B3OB 4HT5A 3BSCA 2HS4A 5E3QA 1MG7A 2EKYA 4ES1A 1FE0A 2GQ2A 5A8WA 4OI6A 4CLYA 1R8AA 2LECA 2PO4A 3P49B 1XK8A 4J9VA 3QFWA 2F7VA 1Q95G 2UZAA 1FXLA 5F9LA 5ETRA 4DR1F 1SJ1A 1XERA 2D69A 3OHAA 2V9KA 3R5AA 1XEZA 3FQKA 2Y1IA 4L74A 3M2UB 2DCUB 1HNIB 3PYGA 1UKUA 4ZVHA 4ZLNA 4WP3A 4ANDA 4F8RA 1VRTA 1CG2A 5CZXA 1VGYA 4LRBA 5ETNA 4ETZA 3ZZRA 1X4BA 5K5MA 3VTIA 1F0XA 1VOMA 1YHQS 3V6DA 2X1GA 5IZHA 1M1KT 4JYAF 3R27A 3BO4A 2KFNA 4YOEA 3M8QB 2G0JA 1ZA1B 4XK8C 1RT1B 2OSRA 1HBNB 5KFBA 1JJ2R 5K14B 1N88A 1QSYA 4DL6A 1NZAA 2M9KA 4DV1F 4I2QB 2LFVA 3NGKA 2BJ1A 2ZJPQ 3G6ES 1BD6A 1K1SA 4G3IA 1X8DA 2ZVSA 2MQQA 1S59A 4LFBJ 2EFVA 3THTA 4ERDA 2RJZA 4OYBA 4QZVB 2YXLA 4HVZA 4CLUA 1DTTA 1RQ0A 1S1XA 2CIMA 2WOMB 4NYZA 3CCTA 5JVGQ 5IT9U 1KQKA 1T05A 4CLFA 1V3ZA 5ETSA 2KT5A 4F7VA 1S9FA 5THWA 4YDDB 3QT7A 3V81A 2OD6A 3G96A 2CPZA 1XTZA 1RA7A 5FDLB 1JIHA 3L3CA 2GS8A 1R6VA 2ASJA 4LF7F 4CYUA 4HT7A 2VOPA 2GIFA 3LP1A 3J7Z5 2PFFB 3W9IA 2LXFA 4DJBA 1N56A 1GXUA 3ZZPA 1S0NA 2WBRA 2JEGA 3PRDA 1CQMA 4RO0A 4QWAA 1L3TA 5T14A 1LEOA 3DU5A 1VBKA 1C2PA 1KNZA 1Z4UA 2IBKA 4K2XA 3O44A 4DPTA 2HMIA 4N7TA 2MSTA 1J5OB 4CP5A 1X4HA 2CNNB 4JI8J 3CMQA 2YKQA 3HZEA 3NCRA 4RL1A 1FEEA 2BXJA 2JC1A 2M52A 3MEEA 2VQEF 2J0QD 4DV6F 1Z2LA 1H98A 5CQGA 3MGJA 1TMJA 1TUWA 1YG0A 4ZA1A 4DR1J 1UFKA 2BABA 1QD1A 5G0RA 4L72B 4TY8B 3W2WA 4KHRA 4L3NA 2HQFA 5DRKA 3M9NB 3GMGA 3VCDA 3CULA 5LXRA 2VUGA 2UU9J 2BJ8A 5KG6A 4J9KA 1EAYC 3KHRA 2YBVA 1CPZA 2RAQA 3DGVA 2HFOA 1BQNA 5HBMB 1FNMA 1T94A 4F0MA 5E41A 3WX4A 1Q16B 2MQOA 5CABA 1YZ7A 2UV8A 3JXOA 4BC9A 2P8IA 1VBXA 1RTJB 2IRXA 4AT1B 1QAXA 3MM5B 4DSKA 3KLGA 4PQUB 1T11A 1Q1KA 1P9QC 2FHOB 3UE2A 1VIOA 1S0MA 3MAAA 4J9LA 1NK8A 4RR5A 3MR2A 4HDGA 4DZ6A 2HHTA 1M5SA 1RHJB 2MSSA 3CIMA 2CQ4A 4M5IA 2GGPB 4BBYA 4TU9A 3KK2A 4NLRA 1Y3KA 2N3OA 5A0YB 4RU2A 2POKA 4C8KA 4OLOA 4I69A 2BANA 2WB4A 5HMZA 2GNKA 3N5BA 4UUWA 3OFHA 4EZ6A 4RW6A 3AT1B 1DBDA 1FO1A 1RTHB
chains in the Genus database with same CATH topology
3MEDA 1UAWA 1TK0A 4B02A 1H0HB 4R0EA 1W2BR 3M2VB 4NCGA 1S48A 1NB7A 3CCQS 2IRUA 5GMKa 3LAKA 2QA1A 4TN2A 4KIAA 4USJC 4WJBA 3SDEA 4ZLPA 2I5JA 1MWYA 3DRSB 2KO1A 4OI0A 4HKQA 2MY7A 3MCSA 4RNFA 3T5HA 2E5LF 4TLQA 2WHOA 3VR1A 1T95A 1CQNA 2UUCF 2UUWA 4Y2IA 4CCHA 1ELOA 4MFBB 4NA1A 3TVZA 4ITSA 1RJJA 4JI0F 4FXVA 1QSLA 1HA1A 3T19A 2I2YA 3NNCA 3FFIB 3MR3A 3EGZA 4DN0A 4GKKF 4X64F 1JNZB 3GIMA 2DK2A 2ADCA 2J5AA 4ED0A 2FIUA 1DTTB 1S1XB 2MGZA 3R5BA 3MECA 5KFQA 2XC9A 2YNGA 2DHGA 4K4ZA 1LWCA 4FXWA 1KRPA 4A4JA 1BGXT 3HXMA 1HHTP 3KNAA 1SB6A 3U27A 2ZHAA 2F1FA 2E1MC 1FKPB 1TK5A 1QVGR 3MEEB 4DSJA 2W8LA 3JAMY 1WNEA 1D0EA 2JH3A 3MZIA 2LYVA 3OFEA 2W8KA 1CEZA 5FDLA 2FHMA 2R7UA 3PV8A 1TV6A 4IUFA 5DJBA 3AB4B 3KMQA 2B7CB 1JLQA 2PE8A 3M30B 4IR1A 2YVSA 5K8NA 1NEEA 2EBEA 5KFIA 4MKBA 4I68A 3CUNA 2HMIB 3ISNC 1S6PA 3OLAA 2H5EA 3H25A 1REVB 1RT6A 3QAEA 1X0FA 2FVRA 4C4WA 4RX6A 5F8IA 1GNKA 2WK4A 4DDFA 1UJ6A 1VQOS 4ZMMA 1N4LA 1FERA 1SJRA 1HWIA 1UFLA 5D4PA 3T1HF 1IM4A 2UUBF 2HIQA 2OPQB 4B3SF 1C4CA 5KFJA 5B0AA 1S97A 1UEVA 3M05A 4DOZA 3CC7S 5D3GA 3Q2SC 1HNVB 4DFMA 4CH0S 2GGPA 2MKSA 3BGFA 2E9ZA 2EFNA 5GAEU 2HHVA 4RW8A 4AE5A 3AA9A 3QZ8A 2HPUA 4U9RA 2MB0B 1FJCA 1NHVA 1VQ9S 1JLAA 1N54B 2VC0A 3I5CA 2VPWB 3EZUA 1YJUA 2DNMA 3M2VA 3V4IB 2F3JA 1ZZNA 1ZBTA 2D41A 1YQHA 2E7WA 1N0VC 3WZ0A 1KVJA 3IG1B 4BCAA 2NUUG 3ITHB 2RRAA 4X66F 2R9LA 2RS2A 4A8FA 2X3GA 3QLHB 2VD3A 1EETB 4ZPCA 2FGCA 5EGYA 4FNIA 1O8BA 4RW7B 2EI5A 2J9EA 1VJWA 2IM0A 5BR8F 3I0SB 3C6UA 3KHHA 2HYIB 4E8UA 1KS2A 3Q0AA 2KM8B 4M8LA 1YI2S 3DYAB 1AFJA 2KG1A 1S6PB 3LANA 1MROB 2D9PA 3CE8A 2YKAA 4OX8A 4PXBA 6FD1A 2XS2A 2GCFA 4TXSA 2KXNB 2VH7A 2JHEA 1Z1ZA 2M8DB 1W2IA 3MWBA 4FNHA 3AY0A 3GE9A 3UCZP 4R25A 4IOBA 3QJLA 1CSJA 3I55S 1TVRB 3GSDA 3TP2A 2E9RX 5KG7A 3C2PA 2LLZA 3DCAA 2B7BB 1KTQA 1WHWA 4F2SA 3I32A 1S1TB 1SV5B 1WF1A 2KU7A 4OFZA 4WK3A 5T7LA 4F25A 5K8PA 3NCQA 3H40A 4X4QA 5L1JA 1X4CA 3BR8A 4H4OA 2BJDA 3M32B 2EFGA 3TUIC 4YR0A 2DRAA 1IQTA 3AAWB 2QMWA 3OTEA 5KFSA 3QZ7A 3OTOF 1TKDA 2Z2MA 1SUQB 5CYQA 4NPOA 3NBPA 5HN0A 2LEAA 2W9CA 2YX1A 2RRBA 4OZ5A 4ECXA 1TL3A 2K7JA 4LF8F 4EBDA 4PR6A 2QT7A 3PO4A 5SUHA 3DLGB 3HVWA 1U1NA 1YJVA 3SFGA 1U4BA 2XNRA 4ILLA 5B0DA 1ZH5A 2LXUA 5D6GA 1BQMA 4KJIA 5SZTA 3HKWA 2GJIA 2DNHA 4WTYA 3VF0B 3GYXB 2JL9A 1U1RA 1K8AT 4HI2A 1HNVA 2OIHA 3BREA 4DQIA 1FTRA 3DYAA 4FBUA 2YNIA 5HMXA 3FEZA 1S0VA 2GO8A 3QO9A 4ICLA 3TVKA 1D3WA 5C5JA 4ELVA 2QEXS 2R8KA 4IFYB 4YFUA 1U49A 1H7XA 1LFPA 2XZWA 3U1NA 2AJFE 2NLWA 4F3MA 2I8EA 3T1AA 4ZPDA 4J9MA 4DSFA 3MI7X 3BM7A 1YVFA 4QWDA 3M8QA 1OPZA 1X9SA 2VC1A 2LDYA 1F5AA 4KV8A 3DLKB 3S01A 2IBOA 3SSQA 4ZP6A 2XMJA 3IWLA 3RB3A 3P96A 5E33A 4Y65A 4RZRA 1DRZA 1NU4A 3TAMA 4KHPF 2XWXA 1ZOTA 3CD5A 3E51A 5EX3A 4ECQA 2VONA 5BYRA 1QTMA 1FNOA 3MMBB 3O5TB 4LSNA 4UW2A 3MDFA 1XNRF 2PT0A 3AA8A 1KQFB 3ITHA 3KWMA 4PG6A 4O3NA 3FMWA 3P3DA 4IQXA 3OBIA 3BGRA 1WI6A 5EWFA 4A8MP 1SL2A 3N6MA 5CYQB 3OW2R 2XSJA 4YMEA 3Q24A 4DL3A 4RW4A 4LT6A 1YRXA 2DNGA 1S1VA 3Q8QB 3DLLQ 2UXDF 5GAHI 4KPYA 2AJ4A 1OQ3A 3CC2S 2N4CA 5CZVA 5K9FA 3TNVA 2HAIA 1PILA 3RAXA 4M1KA 2EW9A 2VA3A 2WAQD 2E1RA 2ZOMA 3NS5A 2O5DA 2K3KA 4FZVA 1HYSA 2BZ2A 1IKWA 3KG1A 4R5PB 3VALA 2EBGA 3OTDA 1KEKA 1UJ5A 1U45A 3CD0A 3SV3A 3HI9A 3TAQA 2AX0A 4EFAC 3OHBA 3N9UC 1OQ6A 3HZGA 1EP4B 2L9WA 4B3MF 2AJQA 1AUDA 3H5YA 2PIIA 3Q8RB 4CH1A 4RWXA 2CQPA 2HGMA 1DFDA 4DPOA 2BRLA 2OKQA 1RTDB 1Q8BA 5EDWA 2ZC3A 4H4OB 2HHQA 2RT3A 1RISA 5L9NA 4OI2A 2RQCA 4K59A 5F8NA 3MM5A 3JSBA 1GX6A 1JLEA 1SUQA 2WB1D 4MKAA 4RBUA 3GV7B 2DR7A 4R8UB 1URNA 2AD9A 4ZVEA 3CCJS 2PI5A 2APOA 1RDRA 5FIIA 1S1UA 1V3RA 3CO9A 2F8EX 4GMKA 5GAEI 2NSCA 4M95A 4PG8A 1IQZA 4NLPA 2YKNA 1C0UA 1RT3A 3HVAA 4X65F 5B0FA 4JV5F 5G4DA 1KR4A 4K5SA 1TZ0A 2Y1RI 3C46A 1RT7A 5L8RC 5I3QA 2HS0A 1PC4A 4K4WA 1FDNA 2RS8A 2OH2A 3I9V9 1HMVA 2EVZA 1ZYQA 2CQ1A 4BHQA 4ECZA 2E5GA 2CYYA 3KLFB 1MSWD 4ZP7A 3CCVS 3EXYA 2J6TA 3K5MA 4LUBA 3KLGB 4DQSA 1SH2A 4PQUA 3E2EA 3MMBA 4CT8A 2XULA 5KFXA 4C2MA 5EWEA 2DGUA 1GT8A 2FPHX 4B9LA 1SJ4P 1NO8A 2UVVA 1P8GA 4NLVA 1D9AA 2DHAA 2WTFA 3KK2B 3E01A 4G6VB 4WU2A 4DUZF 2JLFA 2MKIA 2ROGA 3SEOA 3MM8B 5DO2A 2R8GA 5HROA 4B9MA 3T1YF 4IRKA 1DZ5A 2DH8A 3DOKA 2KFYA 5D4LA 2ZJQQ 1S76D 2GX8A 3PIOQ 2RVJA 3PM9A 2KH9A 1JNRB 2JEFA 2ABYA 4LF4F 1FRIA 4ZKAA 2ZH7A 5HLFA 4NMLA 2JLGA 4K4YA 3LO3A 3HDSA 4LSLB 4BDPA 4O3PA 3MHYA 1DURA 1VFJA 4C3LA 1R43A 1JMTA 3RR8A 2VL1A 4A8WA 2ROPA 2DIUA 2LKZA 1FRJA 1KOHA 2B51A 2MKCA 3FGVA 1S1VB 3LW5C 3GB0A 2O66A 4DMZA 3Q8PB 1N36F 5J2NA 4EBCA 1BQXA 1HPZB 3JTOA 4ED5A 3DLEB 3KYLA 4QR1A 2JRSA 1RT5B 2E1CA 2HNYA 3EYZA 1HL6A 3HKZD 1JLGA 5BJRA 1XR6A 1X7VA 3SYZA 1TKTB 4UUXA 2DT9A 2DNNA 1REVA 1RT6B 1IR0A 1JJ4A 3KOAA 1S9EB 3MMCB 1A7GE 3OFFA 1ZAXA 2LVWA 3H5SA 3PW5A 1B0PA 4C97A 2L3MA 1R8BA 1TKXB 1KHVA 3HT3A 3K5NA 1U6ZA 4JUZA 5A2QY 2ZHBA 2QO3A 4DL5A 3FSIA 1DLOB 3OXFA 1XC9A 3QJJA 3G6XA 1Q8IA 2FC8A 5E3AA 3TVYA 2JVRA 2LEBA 4JV2A 4HLBA 4XIUA 5J2MB 1RYSA 3D54A 4RW9A 4ZPBA 4J9SA 3FZ2A 4W92B 5D77A 2VFSA 5KG1A 3RR7A 2OMOA 1KHWA 4ZPAA 4C0HA 1T03A 4NCBA 1HI8A 4I7FB 4B3OA 3AJ2A 2DR9A 2XLJA 4DSIA 5KOXA 2E9TA 2BM0A 3J7A1 2GA7A 1GTHA 1LQ9A 3B82A 5EUHA 3LWLA 3QIPB 4HEA9 3V4IA 2FVQA 3GIKA 1QLNA 2JVOA 5I3PA 3R5DA 3KK1A 4A46A 4CQ1A 5FLXY 3OUYA 2V4JB 2OAUA 1HQUB 2CPIA 1FF2A 2XSFA 4DFKA 1FJGF 1B7FA 3MMAA 2G0CA 3H2VE 3PO5A 1KLMA 2NR0A 1LWEB 4X4NA 3MUTP 4I6YA 2RKIA 1VQ6S 3GFHA 2EK1A 2BDPA 4DV0F 1Q79A 2LMIA 4Z37A 2DRBA 4ZVGA 4X4OA 4J9QA 1UJ4A 5KFUA 1D9DA 4NLTA 5HROB 5AXNA 3TUZC 1N32F 2HS3A 2HGNA 1OSCA 2P9EA 2RB7A 1NKCA 3TYTA 4XAKA 3DOKB 2IVFB 2W4CA 2BYCA 4LMZA 3SCKE 2HHSA 2UXCF 1HWUA 4IRCA 2DHXA 2RQ4A 3MURP 5B0CA 4ILRA 3J81Y 4C11A 2GHVC 3MUMP 2XMMA 1UVNA 3SMZA 1U1KA 2GHWA 3UI3A 3DRRA 2CQ3A 4F4XA 1WG4A 4PCQA 3BN4A 4O3QA 4DFPA 1N6QA 4RW9B 2AP6A 1HWLA 3AHPA 3BF4A 3M1VA 3SCLE 4DL7A 4FF3A 1MWZA 4YB5A 1UVLA 1N5TA 3IA0A 1B64A 3C8YA 2W9BB 2CDQA 3MM6A 3PJWA 1Y5NB 4M5DB 2KZMA 3BJYA 1S79A 2Q6BA 3O1LA 3VAGA 5IT9Y 4Q44A 3BDPA 1WG1A 3PXGa 1RP5A 1R0AA 2CPYA 2YWGA 4ID5A 2KZZA 2R7VA 3LOUA 3CJKA 3T9ZA 3LP2A 5A6PA 4IFYA 4O3RA 5A6WA 3ZZUA 1UWBB 2J7UA 4NLOA 4YDXA 4MIBA 1ZAVA 3K7RA 2Q3PA 4DV3F 1FHTA 5J1EB 3K2YA 2FJBB 2EWHA 4U7UK 1DLOA 2GC8A 2LEPA 1J5EF 4USIA 2QA4S 2O67A 2VBZA 4F2RA 2EK6A 2F9JA 4OI3A 2LA4A 3LALA 4DLEA 3AQOA 1N8RT 1O0PA 2IC3A 4ZK7M 2Q43A 4TLRA 3FNNA 2CQGA 4DL2A 1Q82T 4YB6A 4ZCLA 2R7WA 2V9WA 3M32A 3MTJA 4IG3A 5KFEA 2VG7B 1Y00A 4NXMF 3G8QA 2LQ9A 5KG3A 2ALZA 4DR4F 4NRUA 1U8SA 4C11B 2WW8A 4ZCMA 5J2QA 5CYMB 1YGYA 3R3TA 4CT9A 2DVIA 3IWXA 3KHLA 4RW6B 4J9RA 4IKAA 5DDQC 4EU0A 1NK9A 4NLXA 5HMWA 2MZ1A 2QSWA 1X4AA 3M2RA 3M6WA 3MMAB 4IFVB 1HWKA 4YR2A 1Y5LB 3J7YI 5KFWA 4JBCA 5DQGA 3IR5B 3L95X 4ZPVR 4Q2LA 4KR0B 2J0WA 2BOPA 3NS6A 1SKSA 1GQEA 2VKZG 1PSDA 2FC9A 4O4GB 1LWEA 5KT6A 2ZNZA 1QM9A 2VPZB 3OQ2A 2PC6A 3NP5A 4RW4B 5DQIA 1JX4A 4PG4A 2UVWA 5L9XA 4M94A 1TKZA 3N0VA 3DLBA 4JI2F 3PX0A 2HG4A 3CD7A 4KB7A 3M2UA 3M6XA 4LQ9A 4PXCA 3FSXA 4DS4A 3DN9A 3NG8A 3K8VA 2D7SA 2C42A 1G3OA 2DH9A 2OFHX 5CH7B 2NPIA 2AYBA 1KN6A 5LXYA 1R31A 3CCZA 4MTPA 3HPOA 1OS5A 3MUVP 2HNZA 2E44A 1KFSA 2C3OA 4QW9A 3BS9A 2OTLS 3JTNA