3K7RA

Crystal structure of [tm][cuatx1]3
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
70
structure length
70
Chain Sequence
EIKHYQFNVVMTCSGCSGAVNKVLTKLEPDVSKIDISLEKQLVDVYTTLPYDFILEKIKKTGKEVRSGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metal homeostasis factor ATX1
publication title Tetrathiomolybdate inhibits copper trafficking proteins through metal cluster formation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 19
structure length 70
sequence length 70
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2009-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3k7rA00
2QLXA 5KAKA 2XMKA 3CJKA 4A47A 2XMUA 2PGCA 3QGPA 2IYGA 1SQEA 5B0AA 1WD6A 3E8OA 4DN9A 1OPZA 1VQSA 2QIFA 1OQ6A 3TNVA 1AFIA 1N5QA 2LDIA 2AJ0A 2XMTA 2RSQA 2RILA 1Q4RA 2OKQA 1X8DA 1FVQA 2ACYA 3TRGA 2L3MA 3BGUA 2K7JA 1Y3KA 3HFKA 1TR0A 4F67A 2BJDA 4QOTA 1S6OA 5B0FA 4EFAC 4HH1A 2GA7A 3GZ7A 2KKHA 2CRLA 2W4DA 1YRXA 4NPOA 2QLWA 1MWZA 3FGVA 3IWXA 4OJ1A 1APSA 4OJHA 2HFNA 1N5TA 1Q8LA 1MWYA 1W2IA 2Q3PA 3VTIA 5B0DA 3HDSA 1LQ9A 1U7LA 1SB6A 3F44A 4U9RA 2FIUA 1TZ0A 1R6YA 3TOQA 2RMLA 3T9NA 2FHMA 5A6WA 5A6PA 1XBWA 2RU9A 5B0CA 2N4DA 3LGMA 4ZA1A 3LGNA 2KT2A 3BF4A 2OP5A 1AW0A 1KVJA 3K7RA 4DPOA 1YJRA 4HL9A 2AP6A 5B0BA 3DXSX 1TL5A 3BB5A 2W4CA 1FESA 1N5SA 2N4CA 2ROPA 1JK9B 4FNIA 1Y9OA 2G9OA 2JDJA 2FB0A 2BUNA 2LXFA 3DCAA 2KYZA 1URRA 2GGPB 4FNHA 3HHLD 3KKFA 1IUJA 3IWLA 4A4JA 1FEEA 1GXUA 3BN7A 3MCSA 5K9FA 2QYCA 3FMBA 2AW0A 3HHLB 3MZIA 4HI2A 2GV1A 4OIXA 4A46A 1RJJA 2ASYA 1S6UA 1SI9A 3LO3A 4YEAA 3WDOA 2IFXA 2XMMA 2ROGA 2ZDOA 3HF5A 4OJ3A 2LQBA 5F0UA 2EW9A 3I9ZA 4A48A 1KVIA 2BJEA 2OMOA 1Y0HA 3FRYA 1TL4A 2BYCA 1Q8BA 1X0PA 2GO8A 5T7LB 4Y2IA 4OJGA 2ZDPA 2K2PA 4Y2KA 1Y3JA 2KT3A 1QUPA 2HLUA 1FD8A 5B09A 2BBEA 2OFGX 1CC8A 3KNGA 1OQ3A 4NL5A 1CC7A 2N7YA 1YJTA 2GGPA 2AJ1A 5B0EA 2K1RB 2IYIA 1ULRA 3BDEA 2W4PA 1Q53A 2GFFA 1FE0A 3HHLC 2OD6A 3HHLA 2VH7A 2HQIA 5F0WA 3CJKB 1YG0A 5B08A 1P8GA 1TUVA 1V3ZA 1CPZA 2HIQA 1P6TA 4HI1A 2ROEA 2HLTA 4Y2MA 1FE4A 4YDXA 2GCFA 3UDCA 1VQYA 2HFOA 4Q2MA 1AFJA 3HX9A 5B0GA 2XMWA 2OAUA 5T7LA 1FVSA 2PD1A 4HH0A 5IXUA 1JWWA 1K0VA 1GXTA 1YJVA 4Q2LA 2XMVA 2LQ9A 2VV5A 1X7VA 2XMJA 2OD4A 4ZOSA 1KQKA 3KG0A 2OFHX 3BM7A 3BR8A 4DL0C 1YJUA 2K1RA 2K7KA 3KG1A 3QMQA 1OSDA 2FTRA 1N5VA
chains in the Genus database with same CATH superfamily
4G1QB 2DH7A 4LRDA 2E5LJ 1HNZF 2VBYA 4OYPA 3KMSA 1FWPA 4JI1F 4K59A 2FPHX 4H4KC 2LEAA 3NP5A 2HVEA 4OHZA 2FJVA 3TI0A 3DLEA 1SQFA 4F25A 2N4DA 3W65A 3B6BA 2J9EA 3W60A 5MAOA 3D54A 2P9CA 4HYKA 3HT3A 2MY8A 2XYGB 4ZIWA 4WFXA 4DJBA 2RQ4A 4OX9J 3HVTB 1TVRB 3HF5A 1KVIA 2HAFA 1XMQF 4RL1A 2F63A 5L39A 2RDJA 1ZH5A 4Y2KA 2QEXS 5KFYA 2UXDF 4DSJA 1NB2A 2XY7A 4RBTA 2B0GA 2PA3A 3VV2B 2DH9A 1AT1B 4ILLA 2VJUA 2KG0A 3EZOA 4ECQA 1T3OA 4UT4A 2M2BA 3DGVA 2C2NA 1I94J 2J9DE 3BO2A 1NNDA 3UR0A 5HLFB 4A8YA 3MM6A 3MM8B 3DXBA 4RJVA 4A8KA 1N6QA 3ITHB 5KFPA 4ILMA 1SQGA 1Q8KA 3WX8A 3CJ8A 4N8NA 3NBPB 4HTJA 5K8PA 1F0XA 1CVJA 5F8GA 3BO4A 4CM2A 4C0HA 2H5EA 5KG6A 2YKPA 1RT6B 4YHHF 2OTLS 2DKOB 5A6PA 2D9PA 2YNHA 4KC5A 1C2PA 1NBEB 2N7CA 2FB0A 3DCAA 2H54B 4P7VA 4DV5F 1U49A 3HHNB 4YDDB 1LWFB 3PDNA 2V4JA 4YB1P 3QPIA 4BWMA 4BS2A 1DZ5A 1FT8A 4OZ0A 3UQSA 5IZHA 2XS7A 1NUEA 4YQWA 4LSZB 3JQJA 4F4WA 4KFBB 4XTTA 3MR7A 4JI4F 4OI3A 2YKMA 2ROEA 1MLAA 3SIPB 3V6HA 3W8GA 1S59A 2VPYB 2FDNA 3Q0AA 3HCXA 3GB0A 4B3MF 2W8LA 3KK2B 2B3TB 3VAJA 1OSDA 2OMLA 2AEJA 3QZ8A 1O6XA 2BJ1A 3G87A 2WK4A 2UUTA 1KEKA 2MTLA 4DV1F 2EBEA 3NS5A 2CPIA 3KFWX 1YWXA 2MQLA 2KKHA 3TZYA 2ZWPA 2H1YA 3TR5A 4RUAA 3BGFA 4ZVRB 3R5BA 4LF4F 2L08A 1YVFA 3B54A 3BN4A 1F2HA 1UL3A 3R7SB 3V2UC 4J9UE 3PFOA 4JP8A 4K4UA 1CS4B 3U1NA 4JI6F 1FEEA 2KYXA 3PEJA 1DARA 2EW9A 3BH6B 2HRUA 4FYDA 2V2KA 2DYAA 2XSFA 4HHHA 3EICA 5DZ7A 1FRLA 3BKFA 1XK8A 2O3DA 2OD6A 4EI2A 3RAMA 2XZTB 1H0HB 4JUZA 1R3NA 3MMCB 2YX1A 3V6JA 1WF2A 3LW5C 2CQIA 4NCAA 1BMQB 1H6KX 4Q8EA 2RHQB 2ZM6J 3DLKA 5A8KA 3JYTB 4K4XA 2BEFA 3VAHA 3VGVA 3JQKA 3TVYA 3KLFB 2ACYA 3W9IA 1F1BB 1HNVB 5HJYA 3R2DJ 4LR8A 3N4WA 4OI0A 2GHWA 2UUAF 3D66A 3IRXA 3K58A 2YQ0A 1RTHB 4I1TA 1F9FA 4DV4J 4NLTA 2AJ2A 3R5JB 2Y0BB 2XO7A 3GV8B 2LQ8A 4UF4A 4RW7A 1M5OC 1O0PA 1T05B 2KFYA 4NA3A 1SCJB 3MEGB 2NUUG 1RWXB 3Q8VA 3DGPA 1RHMB 3G9CA 4DX8H 1RT4B 2AT1B 4Y2CA 3VAMA 4Z2XA 2E5JA 4N47A 2XYHB 4ENOA 1DTQA 1FK9B 1ZAWA 2BKNA 2VODA 2HS0A 3AFGA 3NGTA 1QY7A 2XCPA 2IA6A 3SZ2A 2R8JA 1LW2A 1XC9A 4O0NA 3RBXA 1X5TA 2ILZA 3HSJA 5I42B 1RBAA 1UJ4A 1HHQA 4ZCKA 1N5VA 1JLQA 2V5HG 4OYMA 3M6XA 2QL9B 3PHTA 4UZBA 3SEOA 1R7IA 2EC2A 2XYPB 5CYMB 2QLWA 2FVSA 3QLHA 5F8IA 1VS3A 1J5EF 3ZXWA 3NOGA 2B8PA 2W4CA 1P9QC 4DV2F 1U6FA 1HNZJ 4KGXB 3RB3A 3QRQA 3BQ2A 2KT5A 2D3ZA 3NGDA 1RQ0A 4FBTA 1B99A 5EGYA 4OIXA 1RUSA 3MM9B 5M2PA 1Q82T 5EDWA 3ENWA 3CMAS 3PW7A 4DR2F 2XO6A 4ZLPA 2IMOA 3BV8A 3KK3A 1ULRA 3JSYA 2J7WA 1P6TA 2B51A 4Y2MA 4IG3B 3TARA 3NAIA 1HYSA 2CG4A 3ENQA 4ANEA 2ACMA 5FD1A 2NSCA 2LU2A 1DLOA 1XMQJ 4C8NA 4WCEQ 3D0GE 4M5DA 4QIFA 2UXDJ 1FNOA 1N5QA 4DOZA 5J1PA 4DV6F 1FDDA 1UJ6A 4WWSA 5DS7A 1X4CA 2GVDB 4N76A 3GZ7A 5BYQA 3IS9A 5F8HA 2HKEA 1M1GA 3DLEB 3QRPA 3R7NB 4DEZA 1T9WA 2OPPA 4O0IA 5DDPC 2VG5A 1H2TZ 1UVIA 1A9NB 2P9EA 5AE1A 1X4AA 1N48A 4FNHA 4RWXA 1H7XA 4JI8F 3O2IA 1K73T 1T9TA 4MKAA 2LQ5A 2A1BA 3H98A 2ZDPA 2HBRB 3H59A 4CO1A 4YHHJ 1NJIT 1WC5A 4TN2A 2F8MA 4OL8A 4JI2F 2RRBA 2LDYA 1NJZA 3VGUA 5F0WA 5D77A 1UPPA 1IKYB 4DI6A 4ZN1A 4DV5J 1N4LA 3OFFA 4CO2A 1SJFA 1KSPA 4DL4A 1U1QA 4RW6A 4IG0B 1TFYA 4ZVSB 2HFVA 1CEZA 3QJJA 1V3RA 5E3AA 3QAEA 2HZAA 1HWUA 3VALA 4C8MA 5EWGA 3OXFA 2RF2A 4JI4J 2J0XA 5B0FA 3R97A 1PC5A 5A8WB 3HM9A 4B3MJ 1U0HA 3MUTP 2G13A 4A8QA 5CQGA 4FKYA 3PKMA 1P1TA 1TTHB 3BSOA 1YJ9S 3OJUA 4DV1J 2MLXA 4C0OC 1UFLA 3JQMA 2GV1A 1TU0B 4QJVA 1S6UA 3GIJA 3GR1A 3HD1A 1TKXA 4DLEA 3IFEA 4M5LA 3I5BA 1S9EA 2LVWA 4LFAF 4LF4J 1AZSA 3JS9A 3KNGA 4FDFA 4DFMA 1D0EA 2WB4A 1ZZFA 1N5YA 3Q22A 4YDXA 4JI6J 3CC4S 1BQXA 1WF0A 2MZJA 3GPAA 4NASA 1N0UA 1IXKA 4XPEA 3KNAA 2VG7B 1TKTB 4L72B 2BKOA 3THTA 1S76D 4MKYA 1TR0A 3BGRB 1NXIA 2ALZA 2HNZB 4DHVA 1IN0A 1ZM3A 5ETMA 1AB8A 3QQCD 2IY5B 3ELHA 5J2MA 4OZ3A 4A8MP 1S6QB 2G2OA 3F56A 3E3XA 4V19X 3T9NA 3PTWA 2DNNA 4D3GA 2KFZA 3UPFA 1HWLA 3IR7B 1IUJA 3I5AA 1BGXT 2W2OP 2VUGA 2LQBA 2UUAJ 3V6KA 2BYCA 4I7FB 2JC0A 4X4UA 5I4MA 4NLQA 4CWBA 4IRDA 4Q43A 4W92B 2KVIA 4NL5A 2R8GA 2JVOA 1UZDA 1UPMB 5B08A 5ETVA 1Q86T 2QA4S 2PC6A 4DSKA 1FKOB 4OZNA 1V5IB 2DJWA 2NUHA 1OY9A 5KFQA 3WX4A 3A8EA 2CXEA 4XDDA 4B3TJ 2QA2A 3MMAA 2W2NP 2AJ0A 1DURA 4JOUA 4PEOA 3KG4A 1RP5A 4WE1A 4KSEB 2DHGA 2B8QA 2J7KA 1APSA 3W5YA 1PJ5A 4X4VA 4E2FB 3KOAA 3GFZA 4KYZA 2O5DA 5HMXA 1X9SA 3IRXB 1SC3B 7AT1B 1CJKA 5KT3A 2GMHA 4XK8C 2DNMA 4KIAA 2NXEA 2PIIA 1GH8A 3D1QA 4IFYB 3KJFB 4C3KA 1EIYB 5IQQA 1UFKA 3NWRA 2WVFA 1FRHA 1LXNA 1AUSL 3ISNC 3DYAB 2NYIA 1VISA 2ATLA 4WP3A 4ZPTR 4KY3A 3D68A 3RUBL 4P2SA 3QYYA 1J5EJ 3PXGa 4YY3J 4ED7A 4DV2J 3DU5A 3W66A 3NLCA 1HWJA 4DQSA 2FJDB 1T7PA 5ETQA 2CPEA 3H8YA 4KHMA 3PVXA 2JFKA 3R5DA 4NPOA 4DQIA 1LWCA 2I0XA 2PGCA 2I38A 3FQLA 4DR2J 1N54B 2V67A 4DN0A 1JLQB 1TQLA 5DO2A 1S1TB 1YBUA 4RU9A 2JEGA 4FF1A 2CG8A 3O3LA 2ASDA 1HBUA 3DNCA 1PIEA 4DPXA 4RR5A 1JJ4A 2NXCA 4R8UA 3C15B 2Q3PA 4DR1F 4F4XA 2EXUA 3EZ5A 1NPRA 3J80U 4ES2A 2C28A 4DPUA 3I6PA 5DG8A 3OVBA 1S1XB 3UCGA 1UVLA 3PRDA 2XLJA 3NS7B 1UZHA 4ICLA 3AJ1A 4DV6J 1S99A 3ZNJ1 2RUSA 2WB1D 1PCAA 2QYCA 2W9CB 2ZITA 3ETMA 4A48A 5CXTA 3LWMA 2RHSB 3NXZA 1KLNA 6AT1B 4DSFA 1HQUB 1LV5A 3HHLA 3DRRA 3AAWB 5ETPA 1S1UA 3IO1A 4Q2MA 5IXUA 1Y10A 4JI8J 3PW0A 1HNXF 4IQXA 4HT7A 4S0MA 4RW9B 2R2TA 2MKSA 5KOWA 2F9DA 2FJXA 1WOPA 4FYYB 1DLOB 1FXRA 4P7TA 1V3SA 4DV3J 2QA1A 1Q95G 3HHDA 4JI2J 3ADAC 5I3UA 2OKQA 5K8OA 3LGHA 3CC2S 1KQGB 2MQNA 5KFKA 2YKNB 1WHVA 4WP9A 1RAOA 4GO7X 4LR7A 1JKHB 1ZETA 4KH0B 1T9UA 5AXKA 4X62F 3UN3A 3JSBA 4M5IA 4GKKJ 5J1EB 1NU4A 2ZH7A 2W24A 1B0TA 3AJDA 2HBQB 2EKNA 2I1RA 3K2YA 5KT6A 3PW2A 3SQGA 2ZH5A 2ASYA 1CJUA 2IFXA 3DRPA 4USVA 2R4FA 2HMIA 3VCDA 1FF2A 3QIPB 3J7AN 1YJ7A 5KFBA 1QVFR 1HW8A 2RKIA 5JUMA 1S57A 1F5CA 4ZHRA 1KP6A 2XHWA 4QCLA 2ATCB 3ONQA 3EGVA 4P73A 4H4MB 2JLGA 2IYGA 4LFAJ 3WHIA 4I6AA 3OTBA 4DV0F 2P9GA 4IUFA 4XPCA 3TX8A 1RT5A 1HBNA 4TQSA 3PRBA 1FX4A 1U6ZA 5KFXA 4UZCA 1NK9A 2Y1IA 2AEFA 4ZVPB 3ZZPA 3TUPA 4PG4A 3RR8A 5ITHA 1VRUA 5SUHA 4O3RA 3VF0B 4RZRA 1FESA 3TAPA 2DR8A 1YDLA 5KOXA 1U0SA 1XNRF 1K44A 2KXHA 4Q45A 1ZAXA 3AXMA 5F0UA 3A1YG 4USHA 2BJEA 2FY1A 2RDDA 3I4HX 4P2MA 4IOBA 1R8BA 3A3NB 5AE3A 3CCRS 2DGWA 4RW4B 3FC9A 3MAAA 5LL6d 3ZFVA 6FDRA 3TEHB 2RQKA 2PMZD 4TU9A 2ZVSA 3SDEA 1SPBP 3FBFA 3PYDA 5T14A 3PEHA 1XN9A 2XWYA 4IDKA 5DGAA 1SJ1A 2Y3YA 3Q89A 3ZTSA 1NK7A 5ETNA 1K9MT 1FDNA 1Y7PA 3T6JA 2DCLA 4F67A 2P5VA 2LFVA 4AD6A 1JLGB 3G8QA 3D6FB 1WG4A 1PAEX 3DOKB 3F44A 1BWEA 3M2RA 3TOQA 2LLZA 5DQIA 1X5OA 3WZ0A 3NG8A 3LP0B 4CO5A 2IAJA 4A8XA 1SKWA 1DTTB 2QJ3A 3HLUA 1R0CB 1SJRA 1NHUA 3H5XA 3ET6B 3OD2A 3FSXA 4LSNB 3AOAA 2I8EA 3W5XA 2KRRA 4DR6F 4ECXA 3N6MA 4ZPBA 5D4OA 3K0JA 1MN7A 1RBLA 5CABA 5D4PA 2GHVC 1TMJA 2ADBA 5LSLA 4I2QB 4DQRA 5IC6B 1CULA 3AY0A 3VZHA 1O8BA 4J9QA 3I5CA 2XY5A 4N8OA 3KG1A 4IQMA 2YNFB 3J7ZT 4A47A 1JJHA 1VQ8S 1D9AA 3DLLQ 3CIZA 2EG2A 2VU5A 4L6V3 1NSQA 4RNNA 4RU2A 4C7QA 1H2UX 3GIRA 3M6UA 4GMKA 4C98A 2LKZA 2KN4A 1TL7B 3R5AA 3GIIA 4ZVOB 3ZZ0A 4ER8A 3TZWA 3OXLA 3E01B 5D3GB 4EMDA 2G4BA 3J7Z5 4DUYF 4FF3A 2F4FA 3I56S 1RKIA 3MUVP 1TL4A 4DR1J 4PRFA 4KV8B 4ZITA 1U6BA 1KQSR 4TXSA 3GFHA 4DL2A 1U1KA 8ATCB 4ANCA 2VQEF 5J2NB 3H2VE 1RCXB 2IDEA 1QUVA 1R8HA 3MR2A 3RU0A 4DX5A 1JMTA 4DL7A 1SL1A 1RT3B 2GJIA 4TU7A 3CO9A 4JI0F 2HNDA 2C2ZB 1T3NA 3G2XA 2XULA 4P2XA 3F41A 2QIFA 2YWWA 3I96A 2DNPA 1FFSB 1EX8A 2IRUA 3SSSA 1X8DA 2EK1A 4RX6A 5CYQA 3KMQA 1Q1KA 2GA7A 1PYTA 3MPUB 4HACB 4JYAF 5DJBA 1HNXJ 2RDIA 1NJWA 3DN9A 2FHMA 5G0RA 2KT2A 2Z2ZA 4LFCF 4HHJA 4FNIA 2HHPA 2MZTA 3MECA 1GXUA 1W26A 2AZ3A 2V2QA 4KH1B 4YP3A 5A8RB 1H7WA 4EZ9A 4ZVHA 3OL7A 3W2WB 4PG6A 1QUPA 2R7SA 3I31A 4X62J 3H40A 4B08A 2CQHA 3EVWA 2DR7A 1Q79A 2L41A 1VR6A 1IKVA 4K4SA 3W63A 3EDRB 1QSSA 5KFVA 4XIUA 3DU6A 4NLRA 2OFHX 4LJMA 2HVZA 2I5JA 3D4JA 3DHWC 3P49B 4WKRA 3AA9A 5B0AA 3J80Y 1SVDA 2M8DB 2HRYA 3OL6A 2D7SA 2R2SA 5DLGA 4ECTA 1FJGF 2C42A 3V6DA 2P6TA 2RILA 3M1VA 2IIHA 1J27A 3R9LA 3QJPA 4PUOB 2W8KA 2J76E 1WWHA 4FYWB 3F0NA 3IM9A 5E7OB 1RAAB 3GWCA 3GCWP 2ZOFA 1H3DA 1Q7LB 4DS5A 4DV0J 1T9XA 1Q81T 2MZRA 3VAIA 3G6ES 1QDUB 3RZAA 2G0CA 4DV7F 3KK1A 2WOMB 2CQDA 2DIVA 2IM2A 3K5LA 4NZ6A 1F6TA 3FNNA 4YR0A 3HSGA 4QU6A 1VLYA 3U27A 4UOCA 3PCOB 4C97A 3V4MA 3HK2A 1AFJA 1XNRJ 4RKUC 3M8RA 2CWXA 3C6UA 1UA0A 2P8IA 1KC8T 3U1MA 3RG6A 3LALA 3AQPA 4RLEA 3CXCR 4NRTA 3SCJE 1S1VB 3ZNUA 4TNOA 3QFHA 3W8PA 3OT9A 3HFKA 3PACA 3DLGA 1I1GA 4A8FA 4K2XA 3I55S 1R6YA 2PDAA 3GFXA 2F8EX 1RT1A 4L74A 1WHWA 4PXEA 3M8YA 3K17A 2KZZA 4MIWA 4IFVB 3LO3A 4LT6A 1OPIA 3HSZA 4KHRA 2QMXA 2FQQB 1JIHA 2R7WA 1IJEB 2P6SA 4RO0A 2JEJA 1FWLA 3BBCA 1GAOA 2A6MA 4BC7A 3UN5A 3M8PA 3EGNA 3RBZA 1R0AA 1RAFB 1UWAA 2XMJA 2J5AA 2MMYA 3TVZA 5C7PA 1CQMA 2VDIA 4PKDB 5IT9U 3GJQB 1Q0NA 4DR6J 2XG8A 3RTVA 3OR2A 4NYOA 2F3JA 1HQEA 1AROP 3HKWA 3KJVB 4HH1A 1DBDA 2E7VA 2MY7A 2YQ3A 5EX0A 2LA6A 5HQMA 2C2MB 2PEHA 3M2RB 1XBWA 2H3EB 5LMNF 5GVQA 2E66A 5RUBA 3OTOF 5CYJA 2XBPA 4FVMA 1NH7A 4WK3A 4P52A 1NHVA 3W9HA 1FXDA 3DC2A 3N28A 3CF5Q 2OO4A 3D0HE 4PABA 1OY8A 1C0UB 2W7PA 1C1BB 1RADB 3GU0A 3WC2A 1S0MA 4J9SA 2DHXA 1DQ8A 2BOPA 1MROB 5JVGQ 2MPUA 2E1AA 5I3QA 1HBMB 4HEA9 1SKRA 2HVHA 4J37A 2VIHA 4NI2A 1NRKA 1E6YA 2AZ1A 2N82B 3GQCA 4F4ZA 2BZ2A 4DUYJ 4F36A 1FRKA 4LQ9A 3Q86A 4TLRA 1HI1A 1KQKA 3EGZA 3I82A 2DGUA 3AOCA 5D0RA 2O66A 1WACA 4DG1B 3BYRA 4G65A 2V2ZA 3TUZC 4CLYA 1T8EA 4NWBA 1WTFA 1MU2B 1X5PA 1QTMA 2VQEJ 2B56A 2LXUA 2HQDA 1VHFA 3HD2A 2VG6A 2HHQA 5H9FK 4ITSA 3CSKA 4C8OA 4ZS6A 2R7QA 2DNGA 5F3ZA 5CCMA 1PG5B 4JI0J 2BXJA 4N5SA 1KVJA 1X5SA 1TL5A 4CZCA 3GYGA 3Q24A 2G9OA 1HHSA 3FBBA 3VR1A 1SV5B 2M5YA 3OVAA 2YX7A 2MKIA 2UV8G 2WONB 4DCOB 4JYAJ 5AXMA 2CAJA 3HVRA 4TVAB 3C6TB 4OI6A 1NMEB 2HWHA 3H4DA 1T0TV 2AJ1A 2BM1A 3DI6A 1FRMA 2COLA 1WJ9A 2N3OA 4LFCJ 1REVB 3Q8QB 4L3NA 2ZE2B 3CGIA 2AMCB 4CT9A 3T1HF 2GQ2A 1LKZA 4TY9A 1K0TA 2DGQA 3BR8A 2VKRA 4HI2A 2C22A 2XI2A 1NM2A 1NSAA 4M1KA 3AODA 4F0KA 2EC0A 2R42A 3A12A 1FJCA 2K06A 3HKZD 3BGUA 3SYZA 1J5OB 2M3DA 3PJXA 5CYQB 3QNWB 1ZM4A 3HFZB 3O1LA 5CA5A 3POTB 1VJQA 2B7CB 2LU1A 4PXCA 5B0DA 3HDSA 2R7XA 3A8KA 3M9OB 2E1MC 4X65F 4DPOA 1IKXA 2OSQA 1Q5YA 3BH7B 5J2QB 1FJGJ 1S0OA 2QE5A 2VASA 1GK8A 1RWUA 3IR6B 1OYEA 2LQJA 2CNLB 2FZCB 2F9JA 1LFWA 4CLUA 3M9MB 1UWBA 4Z7YA 4ZPDA 1KHVA 4JI5F 2K2PA 2QV6A 4GKJF 3I0SA 4EZ6A 3PIPQ 3CJQA 2Q6CA 1B4SA 1SUQB 4IR1A 3R8YA 2G2YA 1WF1A 1YIJS 2Y1JA 2HFUA 3TJ8A 2AYGA 2CADA 1E6VA 3KG0A 1N0VC 3ZTOA 2NR0A 2IVFB 2GQCA 4IH5A 3ILIA 2XMUA 2Q43A 4CM0A 2F5GA 3E8OA 1JNZB 3D6MB 1RAGB 2B4VA 3CCWA 3M1VB 4DFPA 4B17A 3W2VA 5GAGU 3DRSA 3CCQS 1TKZB 5E33A 3CMES 1FRXA 1B70B 1KQFB 3EXCX 3Q8SB 5KG4A 2Y1LB 2D1CA 2YWEA 5HN0A 3DMJA 3CCJS 3MM7A 2B9WA 2H9ZA 3VGTA 3AD7C 3RR7A 2ZKTA 1OWXA 1X4EA 4C2MA 4PQUB 3WC0A 3UWTA 3CCZA 3NCPA 4AXJA 2NPIA 1GNKA 2OFGX 2HEKA 4RNHA 5HMZA 1LOUA 3D6HB 2MKCA 1BQNA 1LW0A 1TUVA 2Y8YA 3OTDA 2C2EA 2GX8A 4YN3B 1EETB 1T03B 1IKWA 5A76A 2A10A 2LQ9A 2LP4A 3CCVS 2DXFA 4U8YA 4TY8B 1H74A 4QWAA 3T5HA 4UTGA 2DHSA 3E2EA 3KLVA 4N41A 2DNYA 1RKJA 1Q4RA 4LF6F 1S7IA 1Q5VA 3N0VA 8RUCA 2UVWA 3DOMA 4ETZA 3AOBA 4ZJQA 2ZZNA 5DM7Q 1VQLS 3OTEA 2NXJA 3CC7S 4C8KA 1I3OB 4LF8F 3FQKA 3PJWA 2FIUA 4EGLA 2AV5A 5C25A 2CVEA 2X1GA 1VC0A 3CJ3A 2BM0A 2DGTA 2XHCA 2CPHA 2IVYA 3QIDA 1QE1A 5HQLA 2AYEA 4O3SA 1N5SA 1Y9OA 4PCQA 3JXOA 5IM0A 4TYAA 2C1EB 2CJAA 3CPWR 2DRAA 3MEDA 4PXBA 2C2RA 4MYUA 4UOGA 1WC4A 5LMNJ 2N7YA 3KLGB 3OTOJ 4LF9F 3X1LB 3BDEA 3TA2A 3CJKB 4NLXA 4U6PA 4ECZA 5FDLB 4J9RA 1I51B 5T7LA 3VAGA 2RT3A 2K7KA 4Y0FA 1NB7A 4DZDA 1RLDA 1S0VA 4X66F 3IWNC 3L7OA 2XMAA 3D28A 2IM1A 1CG2A 2CDRB 3Q2TC 5KFDA 2K7JA 3EVMA 4LQ3A 2HRTA 3A4TA 4KHPF 2HHHF 4OJ1A 4QWEA 2L9DA 1NO8A 3TAMB 4ZPVR 4OYZA 1YX2A 2Z30B 3MEEB 3X3UA 1GX5A 1KD1T 3TA1A 2CPJA 3C14B 2W9BB 4K8RA 2KRBA 3UI3A 4WXWA 4N7TA 4I2PB 1FRJA 3BSNA 4A46A 2H4YB 2OUGA 5D0GA 1DQ9A 1QVGR 3W61A 3EYZA 1BE4A 3HI9A 1IWGA 5B0EA 3TUJC 1K1QA 4NLVA 2OELA 4USWA 1RWNB 4DLGA 4K4ZA 1VQ4S 3W1YC 3UDCA 3OVSA 2QX0A 1E6YB 1XNQJ 2VOOA 1CJVA 2WSFC 1HI0P 3T19A 4FS1A 3TAQA 3UVJA 1D9FA 1GT8A 1JLBA 4AT1B 4KTQA 5HO4A 2HNYA 2BE2A 3MPWA 1T94A 2DXEA 3EGWB 1AFIA 1IR0A 4CH7A 3CW2C 4C11A 1JB0C 1ZTTA 2CJBA 4TLQA 5ETLA 3M8QB 2BJDA 5GAGI 3P8BB 3T1HJ 4BBYA 4OX6A 2FHJA 5DETA 2BQ3A 3OLBA 3ZTPA 2YNIB 2ERRA 3PJ9A 4WTOB 3QSYB 3VZIA 4Y6IA 4C48A 5J2PB 3PYGA 3DKDA 2IM0A 1VRTA 3DDNA 5CD4H 3RBEA 3V4IA 3FFIA 1JLCB 4QYZJ 2ZKUA 1M5KC 4OYIA 3A8IA 2Z2MA 5IT4A 4X65J 3M2UA 1KFSA 2APOA 2XZDB 1X4FA 3M32A 1N56A 2M4MA 4PPZA 1RWPB 2VA2A 1H73A 1Q8IA 3JSRA 1S97A 2PFDA 2MZQA 1JLFB 4JI5J 2ZHOA 1EARA 4GKJJ 4G6VB 4HDHA 1ZAVA 4QIGA 3PX0A 1C4AA 2H51B 6FD1A 5GAEI 1QSYA 5LXYA 5KFFA 2CQ0A 4MFBB 3V81A 3VTIA 1HWKA 3RGIA 1MW7A 5HK4A 4DSEA 2BV3A 2V9WA 1NK0A 2V4QA 3CCMS 3US5A 4P74A 2YWHA 1ZM2A 3C16B 2GGPB 1HHTP 1QD1A 4FN5A 4YUDA 3ENAA 3OJSA 3IXQA 2BJ3A 2AWZA 2BJ7A 4MK9A 2ZDOA 2ZH1A 2CJKA 3TO8A 2B4PA 3BQ1A 3WIUA 3MURP 1IQZA 3OUYB 3RAQA 2QSWA 1T11A 5M2UA 4YFUA 1K1SA 4CYUB 2DNRA 3MMBA 1FHTA 1ZYQA 2XCAA 3ZZRA 2A2CA 1FRIA 2VH7A 2OEJA 2Q6BA 2WVCA 2HHXA 2V94A 1GEHA 2M70A 3M2VA 4I6WA 2FVRA 2XMWA 2DISA 1BHNA 3TX0A 1VQKS 2ZBPA 4KKOB 2E9ZA 2KG1A 5ETTA 1X9WA 3G6YA 3FCVA 4DUTA 4ED8A 2BMBA 1DJ0A 2FVCA 2B6AA 3U02A 2NREA 3UDLA 4ZVEA 2DEJA 1BUXA 1N5TA 4BC9A 3CWJA 5LOQA 3MDFA 5C24A 3CUNA 1C1CA 3NGKA 3UCZP 4M5MA 3TWZA 4LF6J 2ADCA 5FIIA 3CD7A 4CH1A 1A6LA 1HPZB 2RVJA 3RB0A 4FXWA 5ETSA 4LF8J 2OPSB 3KLIB 5A2QY 4W4MA 2JLFA 3FCHA 1AUDA 2V6AA 4Q5VA 4AFFA 3JAMY 1YG0A 1A7GE 3EWGA 3JTPA 1YRUA 3KDOA 2KTQA 3UD3P 4ECSA 3A3OB 3MTKA 1R8PA 2PFFB 2XB2D 3J81j 2BANA 3KHLA 1RTDB 4LF9J 3CJ2A 3SV3A 1CJTB 2B4UA 2FVQA 4V19J 1VIOA 1Y3KA 4KR0B 3RB4A 1MNEA 5F41A 4NE9C 2DR9A 2UV8A 2CNOB 3KHGA 4HR2A 2MGZA 1S12A 1TL3B 4I68A 5HP1A 4B3OB 2MEWA 2CJQA 2IJFA 4X66J 3SV4A 4FVCA 2E1CA 1WSRA 4DPTA 5DG9A 4H4OA 4G3IA 1HBOB 4WYLA 2EFVA 2R2RA 3CJ4A 3UCUP 3LP1B 1HD1A 4LVNP 2V8GA 2GAGC 2EKYA 2FGCA 4KHPJ 3T1YF 2R9LA 2HHHJ 4J9OA 1HMVB 1T95A 1HIYA 4V1Ak 4Y34A 4DSIA 5CHCB 3LAKA 3TA0A 1EAYC 2GVZB 3BGLA 1TFWA 4OV6A 4CTAB 3EXYA 4O44A 1YGYA 3KLHB 4OYWA 2EG1A 4WFNQ 4NRUA 2A2DA 5E3QA 4NLWA 2XI3A 2Z57B 3SCIE 1WC3A 1FO1A 5SZTA 3M6WA 3L7PA 1TV6B 4ID5B 2M8HA 4NLSA 2DR5A 2JZ5A 2UUCF 5D0EA 4BHQA 2J9CA 1V5VA 2W4DA 2V50A 3HJFA 4I56A 1RTJB 4ZPAA 3G8TA 3IAS9 2HSEB 1VMBA 4OMFG 1U1NA 1U2FA 1XQIA 4BLGA 2UUWA 2HURA 2J8AA 1XEZA 4WP8A 1VJWA 5F9LA 2OI2A 4C3LA 1U8WA 2QO3A 3TP2A 3CMQA 4M8LA 3I0RB 5LM7E 5D4LA 1BWVA 4ED3A 5HL7Q 3KXDA 1S6PB 2B5JB 1Z4UA 4PPDA 1LWEB 1RZMA 3CE8A 2JEFA 4MT1A 2CKWA 5IS2A 2HHUA 2KHCA 5HMWA 3M4XA 4ED0A 2XMKA 3M30B 4Q0BA 4Y65A 4IRCA 1KNZA 1VQ6S 3UDEA 2YNGB 3ZZUA 3UFCX 3BKUA 3AD8C 4CLTA 3IG1B 3AXKA 1CQNA 5K14A 3ULHA 1O5JA 3S6EA 1N52B 4ZA1A 2ZEJA 2FGOA 5KFOA 1MMNA 1SKUB 3K89A 1HNIA 5KFJA 2KYZA 1FFWB 3OFGA 4E0DA 3IWLA 4KO0A 5CZVA 3DOLB 1RAEB 1UKUA 4OX8A 1UCNA 2NCKL 2IC3B 2MB0B 4FXDA 2HYIB 2UVUA 2GJFA 3Q8RB 1JLEB 1X60A 3K5NA 4NOHA 4R5PA 3ZZOA 3LP2B 2CIMA 1RCOB 2MXYA 3CCES 4CO4A 1ZTWA 5HROA 4B9UA 5F8MA 4XO0A 1RU1A 3NRBA 5KG3A 2PT0A 1Z2LA 4Q8FA 4NMXA 1VQOS 3CNQP 4NA2A 1WKLA 3KLEA 5BXIA 4LSLA 1QM9A 2MSTA 3MCNA 1BQMA 4LREA 4AYBD 2W7AA 3T6BA 2FVPA 3PNIA 3FGVA 4OJHA 2XY6A 2RB7A 2YKAA 2OP5A 2V69A 5E3CA 2JL9A 1G6BA 2DVIA 5DG7A 3FMBA 1UEVA 1PJ7A 2A3JA 1RJJA 4USJC 2EPIA 4M5HA 1VIXA 1G4CA 3GV7B 5KFZA 4GVBB 4PYDA 3KJQB 4C8LA 3EM1A 4A8SA 1RTIA 4P2FA 2BKPA 2OH2A 3BO3A 3OR1B 1GXTA 2XQCA 3TVKA 2IRXA 2K1RA 2OPRA 2OPQB 2KU7A 4JBCA 3M05A 3D2WA 2BRKA 2LDIA 3ZO7A 2RSQA 3JSMA 2O1PA 2OEKA 4J91A 4QR0A 1DFDA 1WOOA 3SCLE 1S1WB 2HQGA 4WBFA 4B02A 1OMSA 1PYSB 4Y2AA 3OW2R 3IA0A 1IR2A 4MAKA 4PWDA 4ECYA 1IQTA 3TQEA 5B0CA 2ZJQQ 1FTCA 3WIVA 1TL1A 4B3TF 2EWHA 1IVZA 5F3TA 4LRAA 1SH2A 3HZGA 5IC4B 1HKAA 2HBYB 4FYVB 3JB9k 2NZ4A 3O5TB 2QA4G 2HVIA 1C0TB 3MM5B 4NCGA 2KDOA 2BE7D 3DM2B 2XGPA 4IO9Q 4URQU 1DRZA 3LOUA 1R27B 3NAHA 2IVMA 2HFOA 1S9GB 3ETOA 4CO3A 1EHWA 4WFYA 3T1YJ 1RISA 4U67Q 4KBIA 4YR2A 1S10A 2CZVC 2D9OA 4QQBA 2HHVA 5A0YA 3UW1A 1RT7B 2V4RA 4ZJOA 2AJFE 3LPYA 3H25A 5HBMA 2V8VA 3OV7A 4NZ0A 2CA9A 2R7OA 3NS6A 4YY3F 4KAIA 2CQ4A 4USUA 2W7OA 4P71A 3NGRA 1RT2A 2RU9A 3VQSA 2G1HA 3NMRA 3D0IE 3MCMA 3RJMB 3FZ2A 4HHUA 3J81Y 3P4UB 2UUCJ 4KE5A 4F4AA 5H1SV 3F73A 3B4MA 5BR8F 1RYRA 2IBKA 2V8HA 4M95A 2R7UA 4NXMF 1D8ZA 1WORA 3NL0A 5C42B 4O4GA 2IJNA 3CD6S 2BQRA 2BJ8A 1QAXA 5LSOA 2QC3A 2ZH4A 4EEYA 4BWJA 1KBRA 4URGA 4B9MA 1K0VA 4NMLA 4KGVB 3C66A 4WIIA 4DF8A 3MTJA 2GW8A 2HGNA 4IKAA 2UXBF 2DIUA 2XS5A 4TKTA 4FF4A 1FX2A 3C19A 8AT1B 1S77D 2XLIA 2GIFA 4G1QA 4WTYA 3I87A 3CJTA 1XR6A 2YQ1A 2KVQE 4KGMA 1HFEL 3E51A 1K47A 3D3BJ 4DFKA 4J9PA 2QTWA 4J90A 5KFCA 2Y1RI 1UJ5A 5D8HB 4DV3F 3D3CJ 5THWA 4FYXB 5JVHQ 2QLBB 2Z56B 4OI4A 3EPIA 4OZ2A 1FEHA 4R0JA 2XC9A 2YX4A 1RYSA 2NSBA 2KH9A 4RBVA 3MM6B 5HANA 4QYRA 2DHHA 1N6QB 3HVTA 4GKKF 4QW8A 1TVRA 2Z0GA 1KTVA 2FD2A 3K5MA 1IR1A 1IBCB 1FDAA 2Z8QA 1DQAA 2MQQA 2Q66A 4F8RA 2YWGA 1EZZB 2DO0A 3W3SA 2HHWA 5HLFA 2YNHB 5CH7B 3MM8A 4HT5A 3ITHA 5HATA 3OLAA 2V4JB 2N3LA 3MXHP 3U1LA 4AL7A 3NBPA 3VWSA 4QIVA 1YK9A 5L38A 3BB5A 5GMKa 4ZLLA 1NH8A 3K5OA 1FWKA 3FKBA 2E29A 1MSWD 1U2RA 4DR4F 1RT6A 4OYBA 3W7BA 2YKMB 3EPGA 2WBRA 2W9AA 2V2VA 4ED4A 3NMAA 1GQEA 3VGSA 4OYOA 1F9EB 5KFAA 4MK7A 2BX6A 1LNQA 1EJ7L 1R6VA 2QFJA 3GE9A 1Y11A 1LWFA 1LK5A 1F5BA 4R5PB 3DHXA 3H5YA 2YH1A 3NKYA 1VQYA 4L3KA 2OAUA 2B4OA 2YPZA 4HTIA 5KT4A 4IOCQ 1FJ7A 2NZCA 2XNQA 4KFBA 2QMUB 4ZVQB 4WPAA 1U1PA 5KG0A 3MF5A 1A0OB 1Z1ZA 1NPKA 2F40A 4RNOA 2WZ1A 4YS2A 3FBEA 4QOTA 3KK2A 4KJIA 1GMWA 2CNNB 1P27B 1XR5A 1HD0A 5GMDA 4M5GA 5JJBA 4J5OA 5DDRC 3LGNA 2D3O1 3PRVA 5KFLA 3I9V9 1R43A 1FXLA 4FPIA 3BBFA 2BW2A 4Y00A 2W25A 2GMLA 2OMOA 3FRYA 1UVMA 1QTNB 2VZ9A 4OJGA 4C8ZA 4X4SA 1FNMA 4ED2A 4G1PA 2BW7A 1CS4A 2ZH8A 2WW4A 5C5JA 4Q44A 5LJ3Y 1L3UA 3T5KA 3DLKB 5A8KB 2LYVA 4K4YA 5T41A 2ZD1A 2D74B 1KOOA 5EHHA 1EKSA 2I2YA 5AE2A 3BM7A 5KFTA 4WIQA 4F2SA 5HAOA 4GC6A 1WEZA 2ZVIA 2ZUGA 3QZ7A 1RSCA 3GJTB 3DRXA 1WD6A 3MMCA 2CJXB 1TKDA 3Q8UA 3MGJA 1YRTA 1PKUA 4I69A 2DHAA 5KG7A 3IRWP 4H4KA 1M5HA 4RW7B 2RJZA 3BEGB 4NA1A 3JYTA 2X7IA 3NGSA 3DGPB 3KLFA 4LIRA 4ZP7A 4ZIVA 1HNVA 4LBIA 4NEYA 1FD2A 2J0QD 3QGHA 2CQ1A 4JB8B 1KKHA 3WQPA 1DTQB 4UY85 3T5LA 3Q8YA 1AYEA 4ZPWR 2RIJA 1RTHA 1QLNA 4HLBA 2B43A 2XMMA 1LW2B 1MWQA 2BA9A 4R25A 2CPYA 4KB7A 2J6UA 5GAHU 4OYAA 1R0BG 4CDIA 1T05A 2KJWA 3MEGA 4DUZF 3D5MA 2X3DA 4C8YA 1V3ZA 1RT4A 4FP9A 4RBUA 2R3VA 1H38A 4LFBF 3SSQA 3NGUA 1KRPA 2KJVA 1KVKA 1XWLA 5BR8J 1FK9A 5KFRA 2OIHA 3QT6A 4NXMJ 3L4BC 2ASLA 1MMLA 3QLHB 2EK6A 2HS4A 1G1XA 3FUYA 1RDRA 2CJYB 5I42A 4R0EA 2L9WA 1L3TA 1VBYA 2EBGA 3L9ZA 3TJ9A 3UD5A 3M9NB 4JI7F 2C2OB 2GZOA 4FXVA 5EWFA 1RB0A 3CDWA 4Z7CA 2RAQA 1F5AA 1SXLA 3I4PA 5DQHA 3AQOA 1UVNA 2QSFA 4NCBA 2UXBJ 4JV5F 4DQQA 2YWFA 5CYMA 2ROPA 3T5JA 3BGOP 2XTJP 3KK3B 3IBWA 3M7VA 3MCSA 2ZZMA 3WDOA 1PSDA 3BSAA 1YHQS 3H20A 2JH3A 1HYSB 5KFNA 1YJNS 1GMWD 1IBMF 1RWKB 2UXCF 2E1RA 2I9SA 3PZPA 3LAMA 3B4DA 4M5DB 1S4FA 2HWTA 4DX7A 4HI1A 3MM9A 1N34F 3H2LA 4F04B 3MFHA 2YKOA 1NKBA 4X64F 1ICEB 3IS9B 1QJHA 4O23A 4DN9A 1GMUA 4IG3A 2UVRA 2BOAA 2OPPB 1JXEA 1IBLF 5CAAA 2VG5B 1M1KT 1RHKB 2MYFA 3MAHA 1VBKA 1TP7A 3NWGA 3HT0A 2GQQA 4X4OA 5KFUA 2FC9A 2J8SA 4U95A 2GVDA 3HMJG 2ZH6A 3CCUS 4K5RA 4QYZK 3K57A 4GO5X 3MZIA 1LXJA 2DCUB 2DK2A 3CCLS 2PO4A 4CP5A 2VFVA 2E1PA 4RW6B 2ALYB 3L3CA 2D69A 2VQFF 2U2FA 2BVZA 1WI6A 2EFOA 2CZ4A 4DR4J 4L75A 2RF2B 2R7VA 3RB6A 4ZVUB 1RWOB 3QT5A 4F4KA 2JX2A 3T1AA 3L09A 3IR5B 4E8UA 1IKYA 1VQ5S 1U0HB 1RAHB 4KPYA 2XNRA 1NAQA 4QZVB 2JHEA 1K8AT 4IG0A 4X4QA 2W2QP 2YBVA 2AQ4A 4DQPA 3A3PB 1JJ2R 3VVTA 2CDQA 1U02A 4RUCA 3W62A 1TKXB 3RAXA 3MFIA 2GHPA 1S9EB 3RW6A 1AZSB 4UW2A 4RUBA 2BUNA 1Q16B 1HLWA 4L76A 5A8WA 2R8HA 2ZH9A 1N5YB 4ID8A 4F3QA 2HG4A 3RRKA 2AEMA 5KT2A 1T02A 2HLUA 1O51A 2E44A 5GAHI 1RI7A 4OI2A 1WOSA 5KG1A 3HHLC 1M5SA 4ECVA 1TUGB 3HX9A 4NLPA 2VPZB 3GSDA 1S49A 1W25A 5LT5A 5J2MB 3O6QA 5CZXA 3HJVA 4IH7A 4ECWA 1FI4A 1KTQA 2AJQA 2A18A 2AGOA 1MWZA 2VG7A 1Y00A 1TKTA 2CQGA 3CD5A 2AF6A 4YB7A 5AXLA 2CYYA 2KM8C 3BGRA 3GJRB 2GO9A 2HNZA 2H5IB 1YBAA 2IDLA 2LXFA 3H7HB 1H2VZ 3D6TB 1S6QA 3GYNA 1UW9A 2ROGA 2JEIA 4WK1A 3H2UB 3HXMA 1Q8BA 4PAAA 5GADU 1G2EA 3SXLA 4IOAQ 2FJEB 3PFEA 5HI7A 1FERA 2Z2YB 3P6YC 1NKCA 2ZBQA 1Y5NB 2IMWP 1VQ9S 3MMAB 4OZ5A 1WC0A 1OIAA 4I7FA 2ZD1B 3MR3A 2QMWA 1ZPVA 3PO4A 2XWXA 2QLFB 4WE1B 1JJCB 4NLGA 4EFAC 1IM6A 2DEIA 2Q1LA 2HHSA 3K5PA 5DM6Q 3BREA 4ETXA 1FKOA 1CJKB 5EWEA 1WUUA 4DUZJ 4FPRA 3EE3A 4QIWD 4F26A 1PBUA 1VK3A 4LFBJ 2DNLA 3HP6A 2CVIA 1WELA 4OI1A 1WEYA 2DPIA 2VFUA 2OLWA 1X4HA 3DLHA 3EUNA 2QGFB 2JC1A 4G1IA 3BZQA 2E7WA 3OSPA 1N33F 1UMJA 3DDIA 4JI7J 3TZZA 3KWMA 3TANA 3MPYA 2VC0A 4K4TA 4IFYA 3N01A 4OHVA 4JV5J 1LWCB 2DNKA 2HQIA 2KXNB 4FF2A 1VOMA 3DYAA 4LMZA 1JQGA 1NPPA 2VFRA 3K8VA 1HBUB 3HVWA 5KT5A 2G2ZA 4R8UB 1VQNS 4F3MA 1IBMJ 2UXCJ 3S7RA 5E5NA 1V6HA 1NDCA 4PWWA 1GXLA 2IPOB 1SJQA 1N34J 2HW3A 2KZMA 4ICLB 2AJ4A 5E3PA 5F8LA 1RWWB 4PG8A 1SB6A 2X1BA 4X64J 4LF2A 1S1TA 1MN9A 2CQCA 2QT7A 5L1IA 2HVDA 5DQGA 1NK6A 2BJ9A 3NNHA 4OX7A 3LA0A 3EDQB 3C15A 3FEZA 1IBLJ 3D67A 2IJRA 4OYXA 1JXLA 2MDAA 3HHLB 2H48B 1SL0A 3DRRB 2C2DA 1XIQA 2F8HA 1U48A 1S1UB 3D9BA 1ZS6A 5H9FJ 1S1XA 1C4CA 1ZOTA 5HJXA 3M8ZA 4EO6A 5D6GA 2FLLA 1Q53A 2W9CA 4JI1J 3MPVA 2WBMA 3QFWA 3GFYA 1FE4A 5L1JA 5I3UB 3ZZZA 4K4VA 2NXNA 1HQUA 2RQCA 4QWBA 1GTEA 2GJ2A 2CNKB 2B9XA 3J7YU 3TNVA 3MI7X 2VQFJ 3BQ0A 2G0IA 2MJUA 3TRGA 2KM8B 4RW9A 1R89A 2FC8A 2HWIA 2JWNA 2MSSA 5H9EJ 3SQGB 1CJUB 3DRPB 4AL6A 2VICA 3HO1A 3FRZA 2YH0A 2HMIB 5I3PA 1U25A 2YKNA 1GTHA 1RAIB 4ZLNA 2HQFA 1JKHA 5BYSA 2RKIB 4JI3F 2WVBA 1M90T 3BPDA 4QWDA 1DY3A 4ZHRB 5J1EA 2KT3A 5GADI 2ZBRA 3H0PA 2POKA 4CLKA 4DR7F 1KHWA 5B7WA 3T3FA 1U24A 3EZUA 4LUBA 1S72S 4RWWA 1S0NA 1RT5B 3OHBA 1HBNB 5FLXU 3QIPA 3IP0A 4IO1A 3C3LA 4GC7A 3UR3C 2V63A 3G82A 4ZN3A 3OL8A 4ZP8A 1U8SA 2MKJA 4ERDA 2VF3A 5KG2A 3BDPA 1VRUB 3RW7A 1YRXA 5IWAF 4H4MA 2JJ4D 3U7JA 3LPEA 1PGZA 1IM4A 1B7FA 2V0NA 4ZPCA 3MOJB 4GRSA 1GX6A 2AGQA 3B78A 4LBHA 4ELVA 3W9JA 2MKHA 1OS5A 3MAAB 2YVSA 5HMYA 1ROFA 2ZJRQ 4B3RF 3TZXA 2K3KA 3SDEB 1P9YA 2XS2A 1FE0A 4IDKB 4CNZA 3G6VA 2DY1A 5F9NA 3DLBA 1ZBTA 1X7VA 2R8KA 4AUKA 3FEYB 4RW4A 3ZC4A 2CWKA 2PI5A 4EBCA 3EJMA 4IRKA 2V34A 2H4WB 2IAJB 2DNZA 4RPFA 2JOQA 5IQ6A 1W2IA 1LQ9A 1U7LA 4ATNA 3SSRA 4EBDA 2AIRB 2VL1A 3N6LA 1LK7A 3ZTRA 4WZMA 1URNA 4CT8A 2CQ2A 4NYPA 1JLGA 5DDQC 2JDJA 2VFSA 4EBEA 4B9NA 3DOKA 3BKTA 4YOEA 3LP0A 1CULB 2HQCA 1DTTA 2YY3A 1WDDA 2GMJA 1G3OA 1QSLA 4OLPA 2ZHBA 3D1OA 3ET6A 2MQPA 1SKSA 3R5CA 2H65B 1Y5LB 4LSNA 2W2MP 4HH0A 1N33J 2XMVA 1BD6A 4ZOSA 4ES3A 5DZ6A 1RWMB 4I64A 1MMDA 3Q2SC 1SJ4P 2VBXA 2RQMA 3GG0A 2W1BA 2V8PA 3QGPA 4I2QA 1OPZA 3J7YI 2WSCC 2M9KA 4XDCA 2XSJA 2D41A 3BPSP 3PR5B 1NSKL 2FUG9 2MZ1A 1FDBA 3IN5A 4CI0B 2YNFA 5AT1B 1VQMS 1XNQF 3D7SB 1I5OB 3KTQA 3O8WA 4I4BA 2BQUA 2BDPA 4ZCLA 2AYMA 2FZKB 1JXVA 3ZZYA 3BN7A 5KG5A 1TL7A 3TUIC 5K8MA 5IV3A 2R8IA 2IBOA 3E01A 4U7CA 5D3GA 2PSZA 1D09B 4HKQA 1EQMA 1YJTA 5HQ8A 3UNYA 4ZCIA 1UVKA 2ZUAA 2HNDB 4CH0S 1VQPS 4YMEA 2OGUA 3HULA 1H72C 3CJ0A 4DMZA 3KUEA 3VAKA 3GJSB 4F3OA 4KV8A 3OQ2A 3CVKA 2YPYA 4K7QA 2UVVA 1L3KA 1RLCL 4F0HA 4WFAQ 3ISND 5J2NA 4P72A 2KI2A 5G0RB 4WXOA 1U4BA 2UU9F 1U26A 1ZPWX 2ZNYA 2X1AA 1RT3A 4QW9A 2ZC4A 5C2CA 2F7VA 1Q8LA 1XMOF 4EYIB 3GTYX 3MECB 2IRYA 5ETOA 2LMIA 2VDHA 4EK2A 1RA6A 2DNQA 4HACA 4NLDA 3KJNB 1URRA 2JSXA 4CQ1A 4OHWA 4NZ7A 2NYHA 1DAXA 2WSEC 3A8JA 1RXOB 2DBBA 3PV8A 2D3OR 4F02A 4B9VA 5MLCV 1IKVB 2GNKA 3G4SS 4Y2IA 4OZ1A 2RS2A 2G0JA 4DPYA 5JMNA 5A2QU 3PX6A 2I5JB 2QYGA 2IYIA 4PR6A 4P6QA 1EQ0A 2HFZA 4MH8A 5A8RA 3JAMU 3HZEA 5ADZA 2ZHAA 3V6DB 1VI7A 4WU3A 2DGVA 3W2WA 1YQHA 4DX6A 4ZKAA 1B64A 4O3PA 4CLLA 4JI3J 2CQ3A 4RW8A 1UTAA 4I0WA 3I32A 3T9ZA 1SQEA 4DBQA 2PE8A 4JV2A 3CTRA 4Y3CA 4B9TA 4DR7J 5DGBA 4WFZA 3FDSA 2G1DA 3NOCA 4ZP6A 1T9VA 4ZLJA 4DR3F 3NNAA 3O44A 3KK1B 3CCTA 2WRMA 3R1LA 2ZZTA 4PUOA 1KLMA 4YEAA 5IWAJ 4MK8A 2J0SD 3H5UA 2B9YA 2GO8A 4DL6A 4B9LA 3J7A1 1FKAF 3R6LB 3SI8A 2C3MA 2DNHA 1SH0A 3C6UB 3QWUA 3H4BA 1GMVA 2HPUA 3CDBA 3P3DA 2WOMA 1RHQB 2ZBCA 4B3RJ 3DLGB 3BYPA 3N5BA 3C8YA 4ZP9A 3CIMA 1OQ6A 3KHRA 3MR6A 1VLOA 2V68A 3G82B 5EX3A 1RT1B 3OHAA 5LXRA 5KFIA 3CCSS 4TYBA 1RK8A 5E3RA 3AB2B 4HVZA 1PJ6A 3KUHA 1OO0B 1HR0F 2HFSA 1S1VA 3GSIA 4IYQA 1G7CB 2CPFA 1X4BA 4HL9A 1IBKF 4DU8A 5IOLA 5K9FA 2J7UA 4CLWA 4F7VA 1RACB 3HHKA 1YKWA 5FJ4A 2EVZA 3Q83A 1SC1B 5FLXY 3RRHA 3M8PB 4LRFA 1R0AB 3MR5A 5LMUF 3OXGA 4A8OA 4ZK7M 2X1FA 2WVEA 3MOZA 4IFVA 4F50A 4CO0A 3CO0P 2HIQA 4WU2A 5KTQA 4UUWA 3OR2B 2HK3A 2PD1A 1JWWA 1HQEB 1SH3A 2HK2A 5M2RA 5CCLA 4MKBA 1EKRA 3GP9A 3GLJA 3G8SA 1QAJA 2MQOA 2KL8A 1VHIA 1RHJB 1JX4A 3AD9C 3AA8A 4OLOA 1NKEA 1OYDA 1TAUA 2Y8WA 1MWYA 3FCWA 3S01A 2J6SA 2OJ3A 4JV0A 3QGGA 2C3UA 4DDFA 2CPDA 2WHOA 3K7RA 3R2CJ 3KJVA 5KFWA 3GYXB 2DD8S 2FLPA 2Z2LA 4LRCA 3HHLD 3VQTA 2FJAB 1TK5A 4NI2B 2RH3A 4ZJLA 3DDKA 4ZVGA 2JVRA 2AHOB 2K8GA 1C0UA 1C1BA 1RBOB 2LEBA 3K59A 4ELTA 4PXDA 1MROA 1WG5A 4K50A 2EFGA 2VG6B 1T9YA 1HBMA 3L95X 3MD1A 4ED1A 2F4VF 4OHYA 2XSJB 2AYBA 3S8SA 4URSA 3LF0A 3ENVA 3HSDA 1RU2A 1BY9A 4DG1A 1WKKA 3KYLA 1MU2A 1CSJA 4ECUA 3N9UC 1Y4ZB 3K8WA 3IAM9 1N8RT 2Z58B 3PR4A 1XTZA 2H5JB 4K4WA 3FJ2A 2UU9J 1FTRA 3DI6B 2YXLA 2O67A 2CPXA 1WKJA 3JTNA 4QR1A 3VVUA 5EUHA 4MIBA 1OSCA 1XMOJ 4X4TA 1FJEB 4AXIA 4FZVA 4X4PA 2DGSA 4ILRA 2BBEA 2PEBA 4CNYA 1OQ3A 3MWBA 1SV5A 2DTJA 3MHYA 2EI5A 2BR0A 4USMA 5U47A 3CDAA 2WONA 2HLTA 3HHEA 2DITA 3GCXP 3C6TA 3HVAA 4LIWA 3FZBA 4UUXA 2FTRA 4MYTA 1REVA 4Z37A 1XERA 1M5VC 2ZE2A 3QO9A 5KFGA 1KONA 1F9HA 2HAIA 2E5GA 2O01C 1IKXB 2LA4A 3MMJA 2ZC3A 2HFNA 2VBWA 1HNWF 2RNEA 2HGMA 5K8NA 1IJFB 1ZZNA 2ILYA 4YB5A 9ATCB 4O4RA 5A6WA 1TAQA 4EWTA 1UWBB 1J5OA 3IGVA 1EP4A 1TK0A 3C2PA 2X3GA 4PWUA 3POTA 2WAQD 3I0SB 3KKFA 4M5JA 2XEXA 5L1KA 2V9KA 1UEKA 3I9ZA 3ICLA 2OEMA 1ELOA 2VPWB 4DR3J 1E6VB 2GS8A 3PY8A 3NCQA 5J2QA 4U7UK 1CC7A 1AA1B 2J6TA 4F2RA 2VONA 3GG1A 3CD0A 2MJNA 2PA8D 5ETKA 2CQBA 1V9OA 1VBXA 3AJ2A 5E2QA 1R8CA 5B0GA 3CJRA 3FMWA 3GIKA 4YB6A 4TU8A 2VA3A 1DHMA 3W2VB 3CJ5A 3DRSB 4RW8B 1SUQA 5L9XA 3BJYA 2RS8A 3P5TL 4O3QA 3UO0A 2E9RX 2CJ9A 3DMJB 1B0VA 3PYEA 3MM7B 2ZOGA 3ZTQA 1NJXA 4DCPB 2RD5C 2VD3A 1HQ2A 1NDLA 2FHKA 1JLAA 1U2CA 2F1FA 2JLEA 2AP6A 3A13A 2Z4PA 2DRBA 2LECA 1F60B 2BACA 1TKZA 3ISZA 2UUBF 3P96A 4A4JA 2ZFHA 1KLMB 3QJLA 4KGZB 3J81U 4H54A 4ELUA 1BQNB 1LW0B 4IH6A 4I67A 4M94A 3GIMA 4J7CA 1HR0J 2EEYA 1IKWB 1D8YA 2NS1B 1FD8A 1PO6A 1UA1A 1LFPA 4DPWA 1KFDA 1ZM9A 1NZAA 1B0PA 5BYRA 4PQUA 1IBKJ 1FVSA 2IM3A 2PN6A 4ZVFA 3DOMB 4ES1A 4ECRA 3T41A 1SIWB 5LMUJ 2VC1A 5C25B 1EETA 1T03A 4QIEA 2VOPA 2RRNA 1QE1B 3PW5A 3QRRA 4X2BA 1WNEA 5L9NA 4TY8A 2FY8A 4K5SA 5IM0B 2M88A 4USKA 5IT0A 3MEDB 3IM8A 4DF4A 3MEKA 3R3TA 1HARA 1UW4A 4CLSA 1H98A 4U96A 4A8WA 2Y9HA 1U1OA 3GONA 5T7LB 1VQ7S 1KDNA 2DT9A 4EYHB 4BDPA 3R1HA 4MJKA 1UVJA 4DR5F 4LBPA 3TW0A 4NXNF 2ZH2A 3JTOA 4LF1A 3GR0A 3BR9A 1YJUA 3KLGA 1WI8A 2DR6A 2QLXA 4F0MA 3CJKA 3ILLA 2HQ3A 2KFNA 2ASJA 5FDLA 2ABYA 2B9EA 4RNFA 1KWMA 3N6NA 1NZ8A 4B3SF 3PYFA 2DPJA 4QR2A 4C3MA 1RHUB 4KPCA 1D1UA 3IBFB 1NLKL 1YZ6A 2OTJS 4Y28C 2F4VJ 4CLZA 2OSRA 2D3UA 5LSRA 3LH2S 3TAMA 2VFTA 1PYOB 1SL2A 3NY0A 3MEEA 2BRLA 1SC6A 2MQMA 3FBCA 2BE9B 7FD1A 2JNJA 3C14A 1CJVB 2W9BA 2V8DA 4M5KA 4MTPA 1CC8A 5LJ5Y 3OPKA 1YBTA 2EFNA 5C2GA 4I2PA 3UVJB 2E5HA 3MPDA 1JLBB 3N5FA 2HNYB 2BE2B 3QBCA 1P8GA 2UZAA 3G71S 1ITPA 1CLFA 4C11B 4XAKA 3PIOQ 4LF7F 4FKXA 3CT9A 2KHDA 3PG9A 1MG7A 5AJ3F 4WFBQ 1RA7A 2DY9A 2QG9B 2XMTA 3B82A 3MUMP 3HPOA 4DZ6A 3LANA 1VRTB 1FCAA 2RRAA 3OBIA 1KS2A 3G6XA 2C3OA 3V4IB 3FFIB 2JRSA 4UQTA 1VC5A 1XJWB 3CB4A 3DRYA 3M8WA 4MKVA 3M8QA 2DO4A 1KR4A 2X51A 1OY6A 1TELA 4I6YA 2YNIA 3M2UB 2QL7B 2WVDA 3M32B 1P1LA 1XR7A 1HNWJ 5J2PA 1N36F 3G96A 4KGKA 3HFVA 5HVHA 3OFHA 1RHRB 3MD3A 5HVFA 4QWCA 4U7UD 2NLWA 3RRGA 1JLCA 4Q2LA 5DDOC 2VV5A 4CRJA 5DRKA 3QMQA 3V81B 3FSYA 3D1HA 3QO9B 4LR9A 5D15A 3P45B 3S1TA 5H9EK 4UOFA 2XM3A 3THVA 2R7TA 1JLFA 2M7SA 4PYAA 2VKZG 1KOHA 1B7YB 3EVOA 1PILA 3SFGA 1GFWB 2RMLA 1XMBA 2L9NA 4FS2A 5B0BA 1EP4B 3R7BB 2LXIA 1N32F 4LF5F 2ZNZA 4MFBA 4P75A 3MMBB 3V5RA 5L46A 2NPFA 2VHGA 5GMEA 1B3TA 2CPZA 4J9MA 3M2VB 5DLFA 1YZ7A 1X0PA 4ZMMA 2EFQA 3C16A 2GGPA 4CCHA 4K2JA 2C3PA 5HVGA 2CQPA 1SC4B 5KFEA 1CPZA 1D3WA 4E98A 2UUBJ 4KRWA 2J9DA 5D0HA 1SIZA 3SMZA 3OUYA 2HZCA 1WSVA 1PC4A 1QAIA 3R5GA 4CYUA 2B6AB 1S7HA 1FNXH 4J9LA 4DCJB 1VK8A 1VC6A 4AQYF 1AXQA 1PAUB 5C24B 3FK4A 1C1CB 4KKOA 4DV7J 3IWXA 4AE5A 3OSNA 3B8HA 2MLYA 1TZ0A 4WJBA 1IWAA 1S79A 2MZSA 4M5NA 1NEEA 1YJRA 1JLAB 5D78A 1SBRA 4USIA 3ZZTA 2DNOA 4WYWA 3NNCA 1D9DA 3UN2A 2GAHC 4OJ3A 1S9FA 4DXLA 1LWXA 1UFWA 4DU7A 7FDRA 1F2GA 1KN6A 3GMGA 2MQ8A 4B9SA 1RGVA 3C46A 5J1NA 3P5BP 2LCWA 1WG1A 2W01A 1HPZA 2BANB 4JV1A 2DXDA 4NX9A 2HIYA 2OPSA 3KLIA 4NYZA 3TEGA 3DLJA 2I6WA 1NK5A 1M0SA 2VB6A 2QN6B 1U47A 4OZJA 2A6OA 2MGZB 2NQPA 4RNMA 4QPTA 1NCLA 5HP1B 2MLZA 5F8NA 4OQJA 3IC1A 4DR5J 2RU3A 1S6OA 4NXNJ 4H4OB 3IGNA 1S48A 5K5MA 5D4NA 1QAYA 4ALZA 3H90A 3SBMA 4P10A 1X4GA 4CLFA 3PKYA 1RTDA 1UEUA 4NLOA 1CJTA 2K3IA 1S5ZA 4C0BA 3IBCB 1R31A 3H42A 3AT1B 5GAEU 1VDHA 3LWLA 1UAWA 3FSIA 2HGLA 3EMTA 3PX4A 4PG5A 4O44B 2KB2A 3OFEA 3OTCA 4K0KF 1TL3A 4B3OA 4B3SJ 1F3FA 1YI2S 1YJWS 1Y3JA 1FKPA 1HBOA 4BCAA 3LP1A 4QBUA 1YSJA 1J2VA 5EN1A 1WTBA 3QT8A 2VBZA 1HMVA 1L3VA 2E5IA 3SFUA 1X4DA 4FBUA 2OHDA 1Q78A 2KXFA 4KT0C 2GVZA 3W64A 1TUWA 4W90B 1JNRB 3QSIA 4CTAA 1RAJA 3KLHA 3VAFA 5KAKA 3Q23A 2CZ9A 3UD4P 1UP1A 2MHEA 1NHKL 4C4WA 1HWIA 4W98A 2JFDA 5K20B 1TV6A 1VCTA 3CDEA 4LF7J 3UE2A 4ID5A 2AU0A 2RE1A 1W7WA 3QGIA 4DL3A 5AJ3J 4MMOA 2DB1A 4GVLA 1M5PC 1RTJA 2WW8A 1BC6A 2FZGB 4C6AA 1REGX 1SI9A 4NEZA 3NEKA 1Y0HA 2F65A 2E5LF 5IFMA 2E9TA 1NK4A 1Q7YT 1RABB 4J9NA 5JXSA 4Q0BB 1ZA1B 3QATA 1RWVB 3CULA 2A0FB 1RTZA 3KUGA 3ILOA 4N56A 1HW9A 5F8JA 2FJWA 4KQZA 5KFHA 3I0RA 5IT9Y 1X9MA 1N36J 2FJBB 5E41A 2GIRA 3RBDA 2AX0A 5K14B 1WC6A 1VQSA 4HDGA 4OV1A 1S6PA 2QFIA 2IHR1 3R6GB 4PG7A 2ZJPQ 2UP1A 2B5JA 1FVQA 2L3MA 4O3OA 4DFJA 1LWEA 4WF9Q 4LRBA 4OX9F 2NXUA 5KFMA 1WDTA 1HNIB 2CRLA 3VHQA 3AHPA 3M30A 3G86A 1UETA 4KO0B 2M0GB 4YR3A 2C2KB 3LGMA 1W2BR 1NJYA 2AD9A 3BF4A 2YNGA 3DXSX 5IV4A 2MKKA 1NDPA 2DGOA 2YKQA 3PO5A 2C3YA 4CLPA 3IG1A 3R27A 3KDNA 5L1LA 4ANDA 1I94F 2SXLA 4X4RA 4RUHA 3GILA 4TQRA 5HROB 2VJVA 1X0FA 1NDKA 2IA0A 2VPXB 2DH8A 4UOHA 2FYXA 2J0WA 3DOLA 2R7RA 3UNGC 1VGYA 2YTCA 1N32J 2R2UA 1CBKA 3CEDA 1VYAA 4LF5J 3KLEB 4LSLB 2MHNA 4DSLA 1OJ4A 2IC3A 2AX1A 2FLOA 4O3NA 1YLXA 4DL0C 1BQMB 1YTYA 1JLEA 4OZLA 5KFSA 1NSPA 3LP2A 3MAQA 2HS3A 5HSPA 3TYTA 4IR9A 3TJAA 4QPXA 1L5UA 3GV5B 1VBZA 4DL5A 3LQVA 4AQYJ 2GIQA 3M6VA 5ETRA 3LUYA 2N4CA 1WEXA 1X31C 4DWIA 1NK8A 4ZDNA 2DGXA 3DFEA 4P9SA 5AXNA 2AW0A 3AH6A 3H5SA 1R8AA 2LEPA 1RTIB 3THPA 2AGPA 2HZVA 3QT7A 3LTOA 4U8VA 5B09A 3BSCA 1SJ3P 4UY8T 3WBZA 1U1LA 1PBAA 1TMMA 1N88A 2K1RB 2OPRB 1LEOA 4EO8A 1VFJA 2P2CB 2Q79A 3M8SA 4UQGA 4LVOP 4AL5A 1WHYA 4EUVA 2KO1A 4CIOA 2WCXA 3JSMB 2XGQA 4NLUA 3N79A 1ACMB 3NCRA 5L8RC 4GVBA 3BS9A 4ED5A 1I6JA 1Y5IB 2W2PP 1ZA2B 2ZOMA 3PHEA 1S4EA 1HL6A 4PWDB 3OR1A 4ZCMA 1BLUA 1TL1B 9RUBA 2ZH3A 3PM9A 4QU7A 3SQOP 2OPQA 2RUGA 3QWPA 1U09A 3KHHA 4Q7AA 1FFGB 1RE1B 2ZBIA 3Q8PB 2DRDA 2QL5B 1EB0A 1AW0A 3W5ZA 3QAUA 1HI8A 2FHOB 1S1WA 4J9VA 3RYLA 1JK9B 4NCGB 2L48A 3CDUA 2EFPA 3PW4A 4USTA 1U1MA 5BJRA 3TQ1A 4PZVA 2WTFA 1FA0A 1L3SA 3UDVA 2ZM6F 2XZWA 3FEXB 3MCOA 2CUYA 4ZVTB 4D3HA 2GFFA 5A0YB 5KT7A 4F4YA 3CJSA 3BBBA 1VRQC 3L7UA 4NLYA 2PI4A 2GCFA 5HBMB 1U45A 2AKWB 4N77A 1C0TA 4K0KJ 3MM5A 4PQAA 4WKYA 2FHJD 1WC1A 3AB4B 2MKYA 2CFXA 3DM2A 3EX7B 4DV4F 3SCKE 1S9GA 1U1RA 2U1AA 1RT2B 2FLNA 1HA1A 4DS4A 2E7XA 3OL9A 1RT7A 4U9RA 2BABA 4EU0A 4MIAA 3IMQJ 4L73A 1YITS 2B7BB 2YWKA 4X4NA 1TK8A 1F3VA 2Y0SD 4C9DA 2XLKA 4O4GB 4OFZA 2QRRA 4X84A 5CD4A 2HBZB 4OHXA 4ED6A 1BXNA 2PMHA 2ZWOA 1M1HA 2M52A 2GC8A 5G4DA 1FKPB 4WZQA 2PMWA 5E0OA 2W4PA 1Z2ZA 1WHXA 4M63A 2HHTA 3ILJA 3FVYA 1YJVA 2QZ8A 2OD4A 4J9KA 5C42A 2QLJB
chains in the Genus database with same CATH topology
1KC8T 3N5BA 3U1MA 4DF8A 3MTJA 4G1QB 2GW8A 2HGNA 3C8YA 2DH7A 4IKAA 3LALA 3AQPA 4RLEA 2UXBF 2DIUA 3CXCR 4ZP9A 3CIMA 4NRTA 2XS5A 1OQ6A 4TKTA 3SCJE 4FF4A 3KHRA 1HNZF 3MR6A 1S1VB 2VBYA 1S77D 4TNOA 5EX3A 3KMSA 3HFKA 4JI1F 4K59A 1RT1B 3PACA 3OHAA 5LXRA 2FPHX 4H4KC 2LEAA 3NP5A 5KFIA 2XLIA 3DLGA 1I1GA 3CCSS 4OHZA 4TYBA 1RK8A 5E3RA 3AB2B 4G1QA 4WTYA 4HVZA 4K2XA 4A8FA 2FJVA 3TI0A 3DLEA 1OO0B 1HR0F 3I87A 3I55S 1R6YA 1XR6A 4F25A 2PDAA 1S1VA 4KGMA 1HFEL 4IYQA 2N4DA 3E51A 1G7CB 3GFXA 2F8EX 1RT1A 1X4BA 2CPFA 2J9EA 4DFKA 4J9PA 4HL9A 5MAOA 5KFCA 1WHWA 2Y1RI 3D54A 2P9CA 1UJ5A 4HYKA 4PXEA 3HT3A 4DV3F 5D8HB 2MY8A 2KZZA 4WFXA 1IBKF 5THWA 4DJBA 2RQ4A 4MIWA 5JVHQ 5K9FA 2J7UA 3HVTB 4IFVB 3LO3A 3HHKA 1TVRB 4LT6A 1OPIA 5FJ4A 2EVZA 3HF5A 4OI4A 1KVIA 3EPIA 1FEHA 5FLXY 1XMQF 3RRHA 4KHRA 2QMXA 3M8PB 5L39A 4R0JA 2XC9A 2YX4A 2RDJA 1R0AB 3MR5A 1ZH5A 4Y2KA 1RYSA 5LMUF 2NSBA 2QEXS 3OXGA 5KFYA 2KH9A 2UXDF 4A8OA 4RBVA 4ZK7M 3MM6B 2X1FA 1JIHA 4DSJA 4QYRA 2R7WA 1IJEB 3MOZA 3HVTA 1N6QB 2XY7A 2P6SA 4RBTA 2B0GA 4GKKF 4IFVA 2JEJA 4F50A 2PA3A 4QW8A 4CO0A 1TVRA 2HIQA 2Z0GA 4WU2A 5KTQA 1KTVA 2DH9A 4ILLA 2FD2A 1GAOA 3K5MA 2KG0A 4BC7A 4UUWA 4ECQA 1T3OA 3M8PA 3OR2B 1JWWA 2PD1A 2M2BA 3EGNA 1R0AA 2J9DE 3BO2A 1FDAA 1HQEB 1NNDA 2XMJA 3UR0A 2J5AA 2MMYA 2Z8QA 1SH3A 3TVZA 4A8YA 5HLFB 1CQMA 3MM6A 3MM8B 3DXBA 1DQAA 4A8KA 1N6QA 4PKDB 2MQQA 2Q66A 3ITHB 5M2RA 5CCLA 4MKBA 5KFPA 4ILMA 4F8RA 2YWGA 3G8SA 1QAJA 2MQOA 2XG8A 2DO0A 3RTVA 4N8NA 3OR2A 4NYOA 3W3SA 2F3JA 1JX4A 3NBPB 1HQEA 2HHWA 4HTJA 1AROP 3HKWA 3AA8A 4OLOA 5HLFA 2YNHB 5K8PA 1F0XA 1CVJA 3KJVB 1NKEA 4HH1A 5CH7B 1DBDA 3MM8A 5F8GA 3BO4A 4HT5A 1TAUA 3ITHA 4C0HA 2MY7A 2YQ3A 1MWYA 5EX0A 2LA6A 2H5EA 5KG6A 3S01A 2J6SA 2PEHA 3OLAA 2YKPA 2V4JB 2OJ3A 4JV0A 1RT6B 2N3LA 3MXHP 4YHHF 3QGGA 3M2RB 3U1LA 2OTLS 5A6PA 2C3UA 1XBWA 4DDFA 5LMNF 5GVQA 2CPDA 2E66A 3NBPA 3VWSA 4AL7A 4QIVA 3OTOF 2D9PA 2WHOA 5CYJA 2YNHA 3K7RA 4KC5A 1C2PA 2XBPA 4FVMA 1NH7A 4WK3A 5L38A 3KJVA 3BB5A 5GMKa 3GYXB 5KFWA 1NHVA 2N7CA 1NH8A 2DD8S 1FXDA 2FLPA 2Z2LA 2FB0A 3DCAA 3DC2A 3K5OA 3N28A 3CF5Q 2OO4A 3D0HE 4P7VA 2E29A 4DV5F 3HHLD 1U49A 1MSWD 1C0UB 3HHNB 4YDDB 2W7PA 1LWFB 3PDNA 3VQTA 1C1BB 1U2RA 2V4JA 4DR4F 1RT6A 4YB1P 3QPIA 4BWMA 4BS2A 1DZ5A 3WC2A 2FJAB 3W7BA 1TK5A 1S0MA 2YKMB 3EPGA 1FT8A 2WBRA 2RH3A 2W9AA 4OZ0A 4J9SA 3NMAA 1GQEA 3UQSA 2DHXA 1DQ8A 5IZHA 2BOPA 3DDKA 4ZVGA 2XS7A 1MROB 2JVRA 5JVGQ 4YQWA 5KFAA 4MK7A 2MPUA 2E1AA 2K8GA 5I3QA 1C0UA 2QFJA 3GE9A 1LWFA 4F4WA 1HBMB 1LK5A 4HEA9 1SKRA 1C1BA 1F5BA 4J37A 2HVHA 4KFBB 4R5PB 2LEBA 3DHXA 4JI4F 4OI3A 3K59A 3H5YA 2YH1A 2YKMA 1NRKA 2ROEA 1E6YA 3NKYA 4ELTA 1VQYA 2N82B 3GQCA 4F4ZA 2OAUA 2B4OA 4PXDA 2BZ2A 3V6HA 1MROA 2VPYB 1FRKA 2FDNA 4LQ9A 3Q0AA 1WG5A 4TLRA 1HI1A 1KQKA 2EFGA 3GB0A 4HTIA 5KT4A 3EGZA 4K50A 2VG6B 4B3MF 2W8LA 3I82A 3KK2B 2B3TB 3VAJA 1OSDA 2OMLA 4IOCQ 1HBMA 2DGUA 1FJ7A 3L95X 3MD1A 2XNQA 4KFBA 2O66A 4ED1A 1WACA 3QZ8A 4DG1B 1U1PA 5KG0A 2F4VF 3TUZC 4OHYA 3MF5A 1Z1ZA 1T8EA 2WK4A 2F40A 4NWBA 4RNOA 2UUTA 1WTFA 1KEKA 2XSJB 1MU2B 1X5PA 1QTMA 4DV1F 2EBEA 2B56A 2LXUA 3S8SA 2AYBA 1VHFA 4URSA 2VG6A 4QOTA 3LF0A 3NS5A 2CPIA 3ENVA 3KFWX 1YWXA 2MQLA 2KKHA 3KK2A 4KJIA 3TR5A 2HHQA 1BY9A 4DG1A 1P27B 1XR5A 1HD0A 4ITSA 3CSKA 4C8OA 4RUAA 3BGFA 4ZS6A 3KYLA 2R7QA 2DNGA 3R5BA 5F3ZA 5CCMA 4LF4F 2L08A 1MU2A 1CSJA 1YVFA 5JJBA 4J5OA 4ECUA 3N9UC 5DDRC 1Y4ZB 2BXJA 3LGNA 4N5SA 1KVJA 1X5SA 3BN4A 3K8WA 3IAM9 1N8RT 1UL3A 3V2UC 3PFOA 1TL5A 3PR4A 4CZCA 1XTZA 3Q24A 4K4UA 2G9OA 1HHSA 3FJ2A 4K4WA 3U1NA 4JI6F 5KFLA 3I9V9 1FTRA 3DI6B 1R43A 3VR1A 2O67A 1SV5B 1FEEA 2KYXA 2CPXA 2M5YA 3PEJA 3OVAA 1FXLA 2BW2A 3JTNA 2YX7A 4QR1A 4Y00A 2MKIA 1DARA 2W25A 2UV8G 2GMLA 2WONB 5EUHA 5AXMA 2EW9A 2OMOA 1OSCA 3FRYA 4MIBA 1UVMA 4X4TA 3HVRA 4AXIA 1FJEB 4FZVA 4X4PA 2DGSA 2VZ9A 4ILRA 3C6TB 4OJGA 4C8ZA 4X4SA 1FNMA 4OI6A 4ED2A 2HRUA 4FYDA 2V2KA 2HWHA 2XSFA 2BBEA 4G1PA 4CNYA 3H4DA 1OQ3A 2AJ1A 1FRLA 3MWBA 2BM1A 2ZH8A 3DI6A 5C5JA 1XK8A 1FRMA 1SV5A 2DTJA 5LJ3Y 3MHYA 4Q44A 2COLA 2N3OA 2O3DA 2OD6A 1L3UA 3RAMA 2EI5A 2BR0A 1REVB 3T5KA 3DLKB 3Q8QB 4L3NA 5U47A 1H0HB 5A8KB 3CDAA 2ZE2B 4JUZA 1R3NA 2WONA 3MMCB 2LYVA 3CGIA 2HLTA 4K4YA 5T41A 2ZD1A 2D74B 3HHEA 2YX1A 4CT9A 2DITA 3T1HF 3V6JA 2GQ2A 1KOOA 5EHHA 3C6TA 1LKZA 2I2YA 4TY9A 1WF2A 3LW5C 2CQIA 3HVAA 4NCAA 1K0TA 2DGQA 5AE2A 3BM7A 3BR8A 4LIWA 5KFTA 1H6KX 3FZBA 4F2SA 2VKRA 4UUXA 2FTRA 4HI2A 1WEZA 4MYTA 4GC6A 4Q8EA 2C22A 2ZUGA 2XI2A 3QZ7A 4M1KA 1REVA 3DLKA 3DRXA 4Z37A 1XERA 1WD6A 5A8KA 2ZE2A 3QO9A 3JYTB 3MMCA 4K4XA 1M5VC 5KFGA 2EC0A 1KONA 1TKDA 3MGJA 3VAHA 1YRTA 3TVYA 3KLFB 2HAIA 2ACYA 1FJCA 3HKZD 2E5GA 3BGUA 3SYZA 1J5OB 1HNVB 2O01C 4I69A 1IKXB 2DHAA 2M3DA 2LA4A 3PJXA 3MMJA 5CYQB 5KG7A 3IRWP 4H4KA 1M5HA 1ZM4A 4RW7B 3O1LA 3N4WA 5CA5A 2ZC3A 3POTB 2HFNA 2RJZA 2B7CB 2VBWA 3BEGB 2GHWA 2UUAF 2LU1A 4PXCA 4NA1A 3JYTA 4OI0A 2RNEA 5B0DA 3HDSA 3IRXA 2HGMA 5K8NA 1IJFB 1ZZNA 2ILYA 2R7XA 3K58A 4YB5A 1RTHB 4O4RA 5A6WA 4I1TA 3M9OB 1F9FA 3KLFA 1TAQA 2E1MC 4EWTA 4X65F 4NLTA 4LIRA 4ZP7A 1UWBB 1J5OA 3IGVA 1HNVA 4DPOA 1EP4A 1IKXA 1FD2A 2OSQA 2J0QD 3QGHA 2CQ1A 1TK0A 2XO7A 3C2PA 3GV8B 5J2QB 4RW7A 1S0OA 2X3GA 2QE5A 4PWUA 2VASA 3POTA 1M5OC 2WAQD 3I0SB 1O0PA 1DTQB 4UY85 1RWUA 3IR6B 3KKFA 3T5LA 4ZPWR 1T05B 2KFYA 4NA3A 3MEGB 2LQJA 2RIJA 2NUUG 2XEXA 5L1KA 1RTHA 1QLNA 3DGPA 2V9KA 2F9JA 1LFWA 4HLBA 3G9CA 2B43A 2XMMA 1LW2B 3M9MB 4DX8H 3I9ZA 3ICLA 1RT4B 1UWBA 2BA9A 4R25A 4Y2CA 4ZPDA 4Z2XA 3VAMA 2E5JA 2CPYA 4KB7A 1ELOA 1KHVA 4JI5F 2K2PA 2VPWB 1E6VB 2J6UA 3PY8A 4N47A 3NCQA 5J2QA 5GAHU 2QV6A 4U7UK 1CC7A 4GKJF 3I0SA 2VONA 2J6TA 1DTQA 4EZ6A 4F2RA 3GG1A 1FK9B 1ZAWA 3CD0A 3PIPQ 1T05A 2Q6CA 2KJWA 2MJNA 2VODA 3MEGA 2HS0A 1SUQB 4IR1A 2PA8D 2CQBA 1V9OA 1QY7A 2XCPA 1VBXA 2IA6A 3AJ2A 3D5MA 4DUZF 3SZ2A 2R8JA 4C8YA 1V3ZA 1WF1A 1LW2A 1YIJS 2Y1JA 1RT4A 4FP9A 4RBUA 1XC9A 5E2QA 1H38A 1R8CA 1X5TA 2ILZA 5B0GA 3GIKA 3FMWA 2AYGA 4YB6A 1E6VA 5I42B 4LFBF 3SSQA 1KRPA 1HNWF 2KJVA 1UJ4A 4TU8A 1XWLA 3KG0A 2VA3A 1DHMA 3W2VB 3CJ5A 1FK9A 3DRSB 4ZCKA 1N0VC 1N5VA 5KFRA 4RW8B 2IVFB 1SUQA 2OIHA 2NR0A 2GQCA 4IH5A 2XMUA 1JLQA 2Q43A 2ASLA 2V5HG 1MMLA 3E8OA 5L9XA 3BJYA 3QLHB 2RS8A 1JNZB 2EK6A 2HS4A 3M6XA 3P5TL 1G1XA 4O3QA 1RDRA 3SEOA 2B4VA 1R7IA 2E9RX 5I42A 2CJ9A 2L9WA 3CCWA 3M1VB 3DMJB 4R0EA 4DFPA 1VBYA 1B0VA 1L3TA 2EBGA 4B17A 3MM7B 3W2VA 5GAGU 2ZOGA 3DRSA 3M9NB 3CCQS 4JI7F 5CYMB 1NJXA 1TKZB 2QLWA 5E33A 3CMES 1FRXA 2FVSA 4FXVA 1KQFB 3QLHA 5EWFA 3CDWA 3EXCX 2RD5C 1F5AA 1SXLA 2VD3A 3I4PA 1VS3A 3AQOA 5DQHA 5F8IA 3Q8SB 1UVNA 2QSFA 5KG4A 1J5EF 4NCBA 2D1CA 2FHKA 2YWEA 1JLAA 2F1FA 2JLEA 3DMJA 5HN0A 4JV5F 3CCJS 2AP6A 3MM7A 4DQQA 2Z4PA 2DRBA 2YWFA 2W4CA 1P9QC 1F60B 2B9WA 2ROPA 2BACA 5CYMA 4DV2F 1U6FA 2LECA 1TKZA 3T5JA 2H9ZA 3RB3A 3KK3B 3IBWA 3BQ2A 2KT5A 2D3ZA 3ISZA 2UUBF 3P96A 4A4JA 2ZFHA 3MCSA 1KLMB 3NGDA 3RR7A 2ZZMA 3QJLA 1RQ0A 4FBTA 5EGYA 4H54A 2ZKTA 4OIXA 4ELUA 1BQNB 3WDOA 1LW0B 4IH6A 4I67A 1PSDA 3BSAA 4M94A 1OWXA 1YHQS 1X4EA 3H20A 4C2MA 2JH3A 3WC0A 3GIMA 3MM9B 3UWTA 5M2PA 4PQUB 1HYSB 1Q82T 5EDWA 3CCZA 3NCPA 3ENWA 1IKWB 4AXJA 3CMAS 5KFNA 3PW7A 4DR2F <