3K7RA

Crystal structure of [tm][cuatx1]3
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
70
structure length
70
Chain Sequence
b'EIKHYQFNVVMTCSGCSGAVNKVLTKLEPDVSKIDISLEKQLVDVYTTLPYDFILEKIKKTGKEVRSGKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metal homeostasis factor ATX1
publication title Tetrathiomolybdate inhibits copper trafficking proteins through metal cluster formation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 19
structure length 70
sequence length 70
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2009-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3k7rA00
2OKQA 4HH1A 2HFOA 2LDIA 2ROPA 2EW9A 5B0AA 2GO8A 4YDXA 4OJ3A 2GFFA 2K7KA 1X0PA 2XMKA 5IXUA 2GGPA 2OD4A 2FB0A 4Q2MA 1N5VA 2HQIA 2ZDOA 1JWWA 4HH0A 2BBEA 1VQYA 5A6WA 4DPOA 1RJJA 1S6OA 2XMMA 3HX9A 3CJKB 1AFJA 3HHLD 1SB6A 1V3ZA 1FESA 3FRYA 3HHLC 4Q2LA 5F0WA 4OIXA 4EFAC 2FIUA 2RILA 1Q53A 1Q4RA 3HF5A 5A6PA 3DXSX 1Y3JA 5B0BA 3BDEA 2PGCA 1N5QA 1N5TA 1R6YA 2BJDA 2BJEA 3KG0A 4A46A 1OQ6A 4ZA1A 2OAUA 2K1RB 1YJRA 1XBWA 2K2PA 2W4PA 2FHMA 2N7YA 2LQBA 3IWLA 2XMTA 3VTIA 1FE4A 2ACYA 2HFNA 2KT2A 4HL9A 4Y2IA 4A47A 2AJ0A 1SI9A 2BYCA 5B0EA 3F44A 1P6TA 3IWXA 3CJKA 3DCAA 2RMLA 2N4CA 1W2IA 3WDOA 5B0FA 2CRLA 3E8OA 1K0VA 1U7LA 2XMVA 1Y3KA 3KNGA 1YG0A 2RU9A 2L3MA 1GXTA 4Y2MA 4U9RA 1KVIA 1FD8A 2W4DA 1X7VA 1S6UA 2QYCA 4HI2A 2N4DA 1KQKA 1X8DA 2K1RA 2W4CA 3LGNA 4HI1A 4NL5A 1IUJA 2HLTA 2KT3A 4YEAA 4ZOSA 1AW0A 4OJHA 1YJTA 3BR8A 1Y9OA 4A48A 1Q8BA 1SQEA 2KKHA 2OMOA 2Q3PA 2PD1A 2QIFA 2QLXA 3HHLA 4DL0C 3BM7A 2IYGA 2IFXA 3HDSA 2JDJA 2RSQA 4DN9A 5B08A 1VQSA 1AFIA 1CPZA 3FGVA 2ROGA 3UDCA 1Y0HA 3HHLB 2XMJA 1LQ9A 2ROEA 3K7RA 1YJUA 1WD6A 1TR0A 2AW0A 4FNHA 5T7LB 3I9ZA 1JK9B 4Y2KA 1TZ0A 2XMUA 2GA7A 3BF4A 2HLUA 2AJ1A 3MZIA 5B09A 1FVSA 1YRXA 1URRA 3LO3A 4OJ1A 1OQ3A 3QGPA 1CC8A 3LGMA 3TOQA 5B0DA 2OD6A 3KKFA 1N5SA 1ULRA 1FEEA 2ASYA 2QLWA 3BN7A 2OFGX 1TL5A 1YJVA 1MWYA 1P8GA 2BUNA 2VH7A 2XMWA 2ZDPA 5KAKA 2K7JA 1TL4A 2FTRA 1FVQA 2G9OA 3GZ7A 1MWZA 5K9FA 2LXFA 3TNVA 3T9NA 5T7LA 4NPOA 2LQ9A 1OSDA 1KVJA 3BB5A 2GGPB 2AP6A 2IYIA 2KYZA 1OPZA 2OP5A 4QOTA 3FMBA 4OJGA 5F0UA 4F67A 3HFKA 2VV5A 1TUVA 5B0GA 3MCSA 1APSA 1GXUA 2HIQA 2GV1A 4FNIA 5B0CA 3QMQA 2GCFA 1CC7A 3KG1A 2OFHX 3TRGA 1FE0A 1QUPA 4A4JA 3BGUA 1Q8LA
chains in the Genus database with same CATH superfamily
4R5PB 1HI8A 2A0FB 4CYUB 4IRKA 2FB0A 3J7AN 4FF1A 2BJ3A 4WXWA 4ECYA 3CJKB 3PO5A 4ERDA 3P45B 2IVMA 3QGGA 3Q8SB 4RBUA 3JTNA 3AY0A 1F5BA 3ILLA 5FIIA 1GMWD 4DUZJ 1UPMB 3ZZPA 3M8RA 1PILA 5JUMA 3S01A 3KJVB 4BDPA 2MQ8A 3V6HA 1BQMB 2BA9A 2DR9A 4KPCA 3CVKA 4I4BA 2E5JA 3OVSA 2ZH7A 1CJUB 3DDIA 4PXDA 3MOZA 3MGJA 3NCPA 2DYAA 2JLFA 4WCEQ 4DSEA 1DTQB 1FRJA 3GCXP 3QT8A 1KP6A 4U96A 1IR1A 2ZC4A 1NO8A 1DAXA 3R6GB 2DNKA 2OPPA 3P6YC 3R7SB 4J9UE 2Y8WA 4AQYJ 2ZBRA 5D3GB 2VFRA 2NCKL 4I2PA 4N47A 3TYTA 2HQFA 5IXUA 2XO6A 2VFUA 2M88A 1GTHA 1HHTP 1JLFA 1F3FA 2MXYA 1KSPA 2DY1A 3KG0A 3GLJA 4KO0B 2OAUA 2K1RB 3O3LA 4ZPVR 3GJSB 2C2ZB 3PW5A 4QR1A 2CRLA 4O3QA 3MF5A 2ZUAA 1S99A 3EDRB 1FWKA 1HWUA 1ITPA 1S6UA 3K58A 2V9WA 2L41A 1V9OA 3MUTP 1Y9OA 2NPFA 4A8WA 3R1HA 4RKUC 2KJVA 4ED0A 2XY6A 5B7WA 3KWMA 3NS6A 2D9OA 4RJVA 3P8BB 5DGAA 4OI4A 2NR0A 1WG5A 2YKOA 4O4GA 1NEEA 3TZZA 3BB5A 1U1RA 4DV5J 1VBZA 3DGVA 4DEZA 1MMNA 5K14A 1WC4A 1RAOA 2W25A 5IV4A 2XMAA 2DO4A 3CSKA 2R42A 2J0XA 1BQNB 3E01B 2R8KA 4CLWA 3POTA 3SCJE 1HKAA 2DD8S 3UN2A 2DBBA 5HROA 4ZK7M 3D0GE 5B0BA 2QFJA 3PIOQ 2HVIA 3SQOP 1RSCA 3P5BP 3QIDA 5LSOA 4OV1A 3UVJA 2MSSA 5C25A 1KHWA 2J6UA 4A8MP 1N4LA 3NMAA 2KB2A 1UEKA 2B5JB 4L75A 1F6TA 2K3IA 2DNNA 2VBZA 4DSJA 4N8OA 4LRDA 2KT3A 3PW7A 3ENVA 4USKA 5IOLA 3K8WA 1SH0A 4C8NA 4B9SA 4YHHF 1MROB 3NOCA 4O3PA 3T1HJ 4X4QA 4KR0B 2XMUA 2ZNZA 3NNAA 4B9TA 4IOBA 1Q5VA 3M8ZA 1GX6A 1YJVA 4KY3A 4Y2CA 4ZIVA 1JLGA 1CBKA 3HJFA 3DHWC 1S0NA 4ANCA 2CJAA 1S5ZA 5DQHA 3RAXA 3KDNA 4OYWA 2DEJA 3FCVA 1S72S 1WOPA 4C3KA 1QVGR 1UKUA 5BYRA 1WF1A 2LQJA 4F3OA 2DJWA 3WBZA 5IWAJ 3PW0A 1SKWA 3GR0A 2RKIA 5CYQB 2CJQA 2LFVA 3L4BC 2I1RA 2UXDJ 5A0YB 4RPFA 4IG3A 2YX7A 3RAMA 3KMQA 4ATNA 4RWWA 4OYIA 2DHXA 2M7SA 4MFBA 2XB2D 3LOUA 2ASLA 4DR4F 3BM7A 1OWXA 3NEKA 4JI5J 4CM0A 2MJNA 1R0BG 3EVOA 3MWBA 4WIQA 3HHLB 4W90B 3EZUA 3R97A 1ZM9A 3K5MA 1YRXA 2XCPA 4M5IA 1KEKA 2HKEA 1U2RA 2QL7B 3K17A 2BE7D 2VBWA 2WB4A 5KFOA 1S12A 1KQGB 2D3ZA 4GO5X 1HQEA 2AU0A 2Z2LA 3GJQB 4LSNB 4CZCA 3AOBA 2ROPA 4DQPA 2EW9A 4P72A 3EMTA 4USJC 2ZH1A 2XMMA 3BV8A 2ALZA 4WWSA 4DV4F 3SFUA 5D4LA 4RNMA 1LK7A 2YXLA 2CFXA 4JV5F 4YY3F 4LF5J 1GK8A 1T3OA 4DR6F 1FNOA 1IKXA 5CQGA 4ELUA 3FZBA 1FRMA 4JI7J 2N4DA 2W01A 5L9NA 3GWCA 3KLVA 1Q82T 4R0JA 3N5FA 2RNEA 2W8KA 5DQIA 4NLDA 3TZWA 2HHWA 4WTOB 2JFDA 4ECWA 3VGVA 4CQ1A 1ICEB 4NLWA 2WW8A 3B78A 7FDRA 1LOUA 2J76E 4X65J 3HVRA 3BSAA 3A13A 4XDDA 3BSNA 2N7CA 2Y3YA 2OPSA 3KLEB 1S10A 3OR1A 4Z2XA 4C3MA 5A6WA 2PSZA 3MAAA 1SUQB 3HHLD 4RU9A 3G4SS 2OTLS 2PE8A 1U8WA 3VZHA 1X4AA 1RA6A 4KE5A 2WVBA 3G6XA 1U02A 1R6YA 2AGPA 1DZ5A 2HHPA 2XNQA 1RHJB 2HFNA 2BQRA 1S6QA 4G1QB 1VIOA 2YQ3A 3HSZA 1TL1B 5AXKA 4ZCIA 4O3RA 2B7CB 2KFYA 2V2ZA 4DQQA 4F7VA 3RB3A 4OHYA 4AL7A 4X4OA 1H98A 1NZ8A 1RBAA 3AOCA 4MMOA 3CMQA 5E7OB 4TQRA 4UOHA 4IFVB 3I0SA 1F60B 4DCOB 1LWEB 2IPOB 3DMJB 3IFEA 4USUA 3HT3A 2ZE2A 1IM6A 2ADCA 1N36F 2YKMA 3EICA 4Q2LA 1VHFA 1O5JA 5LL6d 3SCKE 2G0JA 4DL5A 3H5YA 2FJAB 4LF7J 2CA9A 2FD2A 3WC2A 3HKWA 1LWCA 3ZFVA 5ETKA 2RMLA 4FKYA 1IQTA 1UVLA 1KLMA 1U7LA 4L6V3 1QLNA 3H4BA 1K1SA 4BBYA 4O44B 4EEYA 3MM8A 3BSCA 3TJ9A 4YB1P 2YX1A 1SQEA 3AT1B 1B0VA 1KTQA 3D6TB 1RU1A 3HFZB 2I2YA 3SQGA 3W66A 4H4OB 2FVPA 2M70A 2HW3A 3MPVA 1GMWA 3OFFA 2BQ3A 2LECA 1R6VA 1MSWD 2K3KA 3CCSS 1CS4B 2WAQD 2DH8A 3NGDA 1DFDA 5HMYA 2LCWA 5KFWA 2X7IA 3HHDA 2IA6A 4CH1A 1M1HA 4ZVQB 4G3IA 2R8IA 3CC4S 3D68A 2W2OP 3ZZYA 3OBIA 4PYDA 4NMLA 4L74A 3K59A 2FIUA 3SV4A 4J9MA 5KOXA 3GTYX 2OEKA 4HL9A 1RHUB 2ASDA 2E1PA 4F8RA 1X4DA 1UEUA 4YDDB 3K5OA 2D1CA 4P7VA 2L3MA 4NASA 5KFRA 3ICLA 1U49A 1H0HB 5DDRC 2O01C 2RQMA 4ZHRA 1G2EA 1LKZA 3HCXA 1GMUA 2GHPA 5B08A 3FGVA 8AT1B 5KFQA 3QRRA 2AW0A 2FHJD 3K5LA 2GW8A 2E5LF 4FBUA 4KH0B 2M8DB 5HL7Q 3JAMU 2BVZA 2XSFA 4IO1A 1FWLA 2IC3B 3CMES 4IG0B 1RCXB 2LP4A 4URSA 3W64A 2KXHA 4M5NA 2VDIA 2AP6A 5K8OA 3OTEA 3LALA 5MLCV 3I4HX 5CZXA 4R5PA 3ZZTA 4CYUA 2W2MP 4LF8F 2IJRA 3ZNJ1 2X1AA 2DHGA 4F4WA 2BABA 3TUJC 1NHKL 2HQIA 1HHSA 2HG4A 4K50A 2WBMA 2J0SD 3T1YJ 1G7CB 3RBXA 4PYAA 1FWPA 3SIPB 5F0WA 4OIXA 4DU8A 3D3CJ 3DYAB 3QWPA 2HRTA 3R5GA 3DLBA 2FY8A 2ILYA 2QSFA 2LLZA 4DL2A 3KJVA 4ZVSB 3DOLA 2BYCA 3M2VA 1BQMA 1DHMA 3D67A 3TI0A 1K0VA 2HNYB 4JYAJ 2PMZD 3JQJA 3JSMB 5KG2A 1YTYA 5M2UA 4FDFA 3MEEB 1EP4A 1WTBA 3FUYA 4ED1A 1R27B 4RNNA 1FT8A 2QMUB 3EGNA 4QIGA 3W62A 1DTQA 4KBIA 3AA9A 4LUBA 1HIYA 4JI6F 1OQ3A 4ZITA 1QVFR 4PXEA 3THPA 1GT8A 2IA0A 3BJYA 4FVMA 1FJ7A 1S0VA 2QA4G 1VK8A 5D3GA 3QGHA 1LWFB 1T9XA 2AYGA 2GJFA 2PDAA 4ZVGA 4AYBD 3MEDA 2CZ4A 2HQCA 1ZTWA 4WKRA 3CDUA 3W8GA 1VRTA 4Q2MA 3CJ2A 3HX9A 4LR8A 4ICLB 4J37A 3CEDA 1I94F 3Q8QB 5HLFA 1Q4RA 3D1OA 1RHQB 4FYWB 4IKAA 4B3RF 1FE4A 3LP1B 5B0EA 1SL1A 1NSPA 3DOKB 4QW9A 1HYSA 1X8DA 2CQPA 3DC2A 3MMAB 3PVXA 5I3QA 3HVAA 4EUVA 4IDKB 5CZVA 3P49B 2GA7A 4NCGA 4RW9B 1AA1B 1URRA 4O3SA 2R7TA 2M2BA 1RHRB 3TOQA 2VD3A 3CGIA 2HURA 2IDEA 2EWHA 4DOZA 3M6WA 1V5IB 2XZWA 2Y1IA 1TL7A 2JEFA 1TKTB 2YNIB 2V67A 3BGFA 5KFSA 1H73A 2Z2MA 1XQIA 2OPQB 2FZKB 1NXIA 2BE9B 1LXJA 4WU2A 4KSEB 4LT6A 1ROFA 2UVRA 2YKNB 3HSDA 2B8QA 3KK2B 4MJKA 2CNOB 2IMOA 3L3CA 2XCAA 3ZTRA 4ZS6A 1S4FA 3D6MB 2H65B 1XIQA 3UN3A 4ZCLA 3FSIA 2FHMA 4ED7A 1BD6A 3MEGB 4NXNJ 3W5ZA 5E3CA 5HBMA 4B02A 1RBLA 3I4PA 3DXBA 4DV0F 2GMJA 4EBEA 3QFWA 1U6ZA 5DDOC 1S9GA 1EIYB 2WONB 2MKYA 2LYVA 4LVOP 3WZ0A 2MZRA 1G1XA 3OLBA 2HHHF 2O66A 4K4SA 2DR7A 3TAQA 3LANA 3TZXA 3ENQA 1EJ7L 1FDDA 2GV1A 1VBKA 3OL9A 3KG1A 2E7WA 4WP8A 4WTYA 3CCRS 3IBCB 3WQPA 4DPYA 1DJ0A 4DV2F 3LUYA 5AXMA 2XMKA 3NAIA 2CDQA 4I64A 4HDGA 3FQLA 4OZJA 2Q1LA 3N6NA 4JI0J 4NZ6A 3CJRA 4J9PA 3L7PA 2J7UA 3LP0B 4KKOB 4XK8C 2XULA 4DLGA 1PBUA 5B0FA 1I94J 3AXMA 4CNYA 2GHWA 2HAFA 1XNRJ 4BWMA 1KQKA 4K0KJ 1NK7A 3RBEA 3G87A 2A2CA 4D3GA 2RJZA 2HBQB 3HHLA 3DI6B 2NXEA 1TKZB 4X4RA 1PJ7A 1IKWA 1X9MA 1GXLA 5E2QA 1HQ2A 3EUNA 2V50A 1RWVB 4YMEA 2BKPA 3MTJA 5J1EB 4U7CA 2WSFC 1L3UA 2KJWA 4ZN3A 2X1BA 4WYWA 2P5VA 1NPRA 2VG7A 2J8AA 4KAIA 1YQHA 2C22A 4DFJA 3NBPB 4NA2A 2JVRA 3T19A 1IXKA 3J7ZT 1U0HB 1B0TA 3SDEA 4J5OA 3RR7A 4HTIA 4TLRA 4I68A 1ZPWX 1N6QB 5G0RA 1RAJA 5F8MA 2AKWB 1D9AA 2CAJA 2BJDA 3SMZA 1NMEB 4BCAA 2AX0A 3W2VB 2KO1A 4DR1F 3EGWB 3V5RA 3ILJA 3HMJG 5F8IA 4PZVA 3TAPA 3JTPA 2VJUA 2OJ3A 1FFWB 3DRRB 2CPYA 2J0WA 3MI7X 3I5CA 4PWUA 1TR0A 2RF2B 4Y2KA 2DHAA 2HLUA 1R31A 5L8RC 1TFWA 1UEVA 5A8RA 4OMFG 2Z58B 2VH7A 1H74A 3M1VB 5GADI 1IKVB 4ZIWA 3ENAA 2ZBIA 4BLGA 4ZPDA 1RTDA 1RWXB 3DLKA 5FDLA 3KUGA 2CJBA 1VC5A 3QLHA 3OR2B 3TWZA 1SUQA 1RTJA 1JWWA 1D8YA 3VAMA 3RUBL 1WEYA 3T6BA 3EX7B 2CQCA 4NYPA 4NLGA 4CO3A 3MM6A 3IG1B 2UP1A 4LF6F 4OYOA 2DRBA 2VQFF 4A46A 2GMLA 3PHTA 3QYYA 1XBWA 4ZP7A 2IY5B 2KT2A 4B3MF 1HNVB 2DH9A 1JNZB 3K2YA 4M1KA 4ALZA 2OI2A 3HJVA 3GPAA 1WTFA 4WFBQ 3JSBA 1IUJA 1C0TB 2VPWB 4OJHA 4Q5VA 1DLOA 2CQ2A 1FDAA 4ZVHA 1IKYB 1EHWA 1KQSR 2OLWA 1S1XB 4WU3A 3IAM9 3LO3A 1T03A 1QAIA 3BYPA 2LXUA 1RXOB 1NJXA 3L9ZA 3LTOA 1LWEA 3TQEA 2CVIA 5JVHQ 1SIZA 4N7TA 4M5DA 4ZP6A 2C2DA 3DM2A 1LXNA 4GKJF 5J1PA 1OJ4A 1IBKJ 2FDNA 2CQBA 2W2QP 2V94A 2FHJA 1C4AA 2ZH6A 4XPEA 3VCDA 4QW8A 2RQKA 1HBMA 3EXYA 1HPZB 4I69A 1VHIA 1PGZA 3BZQA 2OGUA 2FVSA 4A47A 2HZCA 3CE8A 1JKHA 1YRTA 5D6GA 3GMGA 2L9NA 2DIUA 2B4VA 4M5JA 1JLAB 4PG7A 2HHUA 1FX4A 1RI7A 4B9LA 5KTQA 1L3KA 4J9QA 1RBOB 2ZZTA 4U95A 1HWIA 1YGYA 3J7YU 1Y0HA 2YNHB 1QDUB 5T41A 1UMJA 4F2RA 5HK4A 2ZDPA 3R27A 2YWKA 5DG9A 5L1JA 3IBFB 3PCOB 4CLZA 2VHGA 2UU9F 2J0QD 2LQ9A 3MDFA 3DHXA 3UDLA 4EZ9A 4WKYA 2KRRA 2PA8D 5EWFA 2RU3A 1UJ4A 3MAHA 1KFSA 4LFCF 2QT7A 3DGPB 3A4TA 2V8HA 1H2UX 4Y65A 3IWNC 2GFFA 4NI2B 1QAXA 1FDNA 4EWTA 3J81U 5F8HA 1N48A 4N5SA 2EG2A 4FF3A 3VWSA 3UD4P 1NBEB 4PCQA 1VQ8S 1M1KT 3EVWA 5KFDA 2V0NA 4OYZA 5E33A 3KLHB 3UCUP 1NHUA 2I0XA 1AUSL 1E6VB 2D3O1 4LF9J 2RUSA 2IYGA 3H59A 2ROGA 3UDCA 5C2CA 1XR6A 1O6XA 1O8BA 1TZ0A 2VG6A 2LDYA 2EPIA 1VRQC 1WEZA 2FC8A 3PDNA 5A8KA 1UJ5A 5T7LA 3C14B 3H5XA 2HS0A 2MQQA 3WC0A 3L09A 2E7XA 3SI8A 3DRSA 2Z57B 2GHVC 5E3RA 1DY3A 2WSEC 3M30B 3N28A 1C1BB 1JLCA 2DTJA 3ADAC 4USMA 3DYAA 1Y5LB 2CQ1A 2XWYA 4P10A 4J9VA 3T6JA 1NSAA 2HAIA 4TY9A 2HNYA 4ECRA 4PG6A 4MYTA 5J2QB 2UXCJ 1FKAF 2QEXS 2BOPA 2YNFA 1X4FA 8ATCB 2E5IA 4KPYA 4CLYA 2RDJA 3AD7C 1J2VA 3NGKA 2DNYA 3AODA 1ZAWA 1WELA 3NAHA 2HNDA 4PQAA 2OELA 2BW7A 3KLFA 1VQSA 3IGNA 2YBVA 1MMDA 2HRUA 4CO2A 4AFFA 5CYMB 3IP0A 3FSXA 2ZWPA 4OYXA 1U1OA 2L9WA 5B09A 1BY9A 4Y2AA 1S6PB 3BDPA 4JI3J 1MWYA 4OLOA 3K89A 4OX9J 1C1CA 4GMKA 2NXCA 1U1QA 4DX5A 4OJGA 3V6DA 1FXLA 2Q6CA 2MY7A 1RADB 2R2TA 3J80Y 4ZCMA 1RTZA 2AYMA 5FLXY 3M8PB 3R5DA 1X9WA 4HKQA 5LXRA 3O1LA 5U47A 2FJEB 2MQMA 2ZM6J 2RH3A 1VLOA 5M2RA 2JC1A 5C42B 4USWA 2CNNB 1R8PA 1NLKL 5I42B 1XMOJ 3MCNA 4Y2MA 1NPPA 2C1EB 3P3DA 4H4KA 2N3OA 5AE2A 2QLXA 6FD1A 3HFVA 1WKLA 2R7XA 3QT6A 3M9MB 5DG7A 3CD0A 1SC1B 1WACA 2XI2A 3BGRB 1VJQA 2MHNA 2KXNB 2UUAF 2VOPA 1DARA 3U1LA 4I6WA 3CDBA 1RTHB 2GAHC 1TKTA 1BMQB 1RT2B 4NOHA 3BS9A 1HNIB 4UY8T 4F25A 4ZPBA 3GCWP 2BRKA 4KTQA 2RS2A 2BEFA 1J5EF 2YWHA 1SL0A 4ZVPB 4WK1A 4F02A 3DRYA 4DL3A 5HMWA 1UAWA 1M5HA 1FRKA 4HTJA 1EETA 4ID8A 2WVEA 4QYRA 4C0HA 3D28A 5HN0A 5M2PA 5ETLA 2ZEJA 1UTAA 2MTLA 5HQ8A 1X5TA 4X62J 4UW2A 3DDNA 2NXUA 5KFPA 4F0KA 1FK9A 2P9EA 3FEZA 2H51B 3KFWX 3C46A 4C6AA 3I9V9 3N4WA 1FXDA 1IVZA 2F9JA 1TL3B 3G86A 4ECVA 1B70B 5K9FA 5IC4B 4IYQA 2DNPA 1WKJA 4K5SA 4ETZA 1SCJB 1NM2A 4KHRA 4NLVA 4HEA9 2JZ5A 3GFZA 1RWPB 2E7VA 3OTOJ 3PRBA 3Q0AA 3RYLA 3B8HA 4J9SA 2X51A 2DNOA 4DPOA 3M8QA 2DY9A 4NZ0A 2HHQA 3PYDA 3E3XA 2MJUA 2DNZA 4G65A 3H90A 5CCMA 2HFSA 2EK1A 1UVIA 3I55S 4CDIA 1R8CA 2F5GA 3KUEA 3CCZA 1Q0NA 3ILOA 1RISA 3NGTA 4TYAA 4E0DA 3DI6A 4TXSA 4IOCQ 2E9TA 3LW5C 4ECXA 5IC6B 2KM8C 2XHWA 3OUYA 3OFGA 2OPPB 4GC6A 1CULA 2HZAA 4DG1A 4EBDA 2ZH8A 2QFIA 1W26A 3M2RA 4I2PB 3U1MA 1Y5IB 3LP2A 1QAYA 2W24A 2KVIA 3FMBA 3CDWA 4ZLLA 3WHIA 1JLFB 2HVZA 2UV8G 2VQEJ 1N34J 4DL4A 5CAAA 3ZTOA 1N6QA 5D8HB 2GGPA 3OXFA 2B9WA 1NB2A 4OX8A 3UCGA 3AD8C 2OEMA 1AXQA 5DZ6A 4B3OB 4Y6IA 3PEJA 2JRSA 5DLFA 4B3TF 1VFJA 5HVFA 3CJ0A 3CO0P 2O3DA 5KFXA 2YKQA 2VBYA 3A1YG 1SKRA 4HI1A 4U7UD 3PJXA 3C3LA 3C8YA 2DH7A 4JI8F 1S9EB 4LFBF 2OMOA 4O4GB 4X4UA 2RF2A 2CADA 4YUDA 4DR3J 4RUHA 1TAUA 3CJQA 5IT9Y 2XI3A 3SXLA 5K14B 3C15A 1FJGF 1K1QA 5CD4A 3PEHA 3IN5A 2VASA 1M0SA 2VC0A 2WB1D 2FJDB 1KC8T 4WFXA 1WNEA 4OV6A 2B9EA 2XG8A 3KMSA 2F4VJ 3T5LA 3D3BJ 4I56A 5EGYA 3POTB 2DGXA 1SJFA 3UFCX 5HROB 4X64J 4DF4A 5L1IA 5HQLA 1XNQJ 1U45A 1I5OB 4UY85 4TU9A 4L3NA 2E1MC 4ECSA 1DQ8A 3IS9A 1N32J 5C25B 3FRYA 5F8JA 3A8EA 1RWMB 4OHWA 4C0BA 3D6HB 4OZ5A 2P2CB 4TNOA 3I5AA 3PR5B 1AT1B 2W9CA 3Q86A 4USVA 4JUZA 1YJTA 5ETMA 1IKYA 3D4JA 4PG5A 3G9CA 1S1VA 2UXBF 1FEHA 1Y4ZB 1XTZA 3VF0B 3HPOA 2GJIA 2P6SA 3HK2A 5D77A 1OMSA 3KNAA 4LF1A 2YWEA 1IBMJ 1T02A 5D4OA 4NCAA 2AT1B 5DG8A 2FJVA 4EYHB 4X4VA 2NXNA 1APSA 2RKIB 2B51A 2GS8A 2OFHX 1N56A 3TRGA 1QSLA 4DR5F 3NGSA 1I6JA 3F41A 1QE1A 4GKKJ 1X0PA 3JXOA 1K9MT 3SYZA 1H3DA 1N52B 4QWBA 1KOOA 1VIXA 1TQLA 3TAMB 3OJUA 2ERRA 5EN1A 2F4FA 4MFBB 2PA3A 1RA7A 1YX2A 4F04B 1HBOB 2HPUA 1ZZNA 3VAFA 4DV3F 1F2HA 3KHRA 2AMCB 2W7AA 1BWVA 2DPJA 4WPAA 5D0EA 3PKMA 4KV8B 1F0XA 2HBYB 3ILIA 2UVWA 5AJ3J 4ZPTR 3GJTB 3VV2B 4DV6F 2QL5B 3P4UB 3ISZA 5ETOA 4B08A 1HQEB 2KM8B 2B43A 1RWNB 3W7BA 4F0HA 4FXVA 2GVZB 2W2NP 1RT6A 2IMWP 3DGPA 5B0CA 2FYXA 4UF4A 4N8NA 2OO4A 4DX6A 3EZOA 2BBEA 1CQMA 2RQ4A 2DO0A 2FLLA 5ETRA 3D1HA 3GE9A 3KJQB 4JV0A 1EAYC 2V2VA 3SFGA 4CTAB 2AGQA 1UP1A 4P2SA 3KLHA 2N4CA 4PUOA 4RUAA 1HL6A 3H5UA 1NKEA 4YR2A 4DXLA 5LMNF 3UO0A 2RRAA 3UD5A 1VK3A 3MXHP 3W9IA 4HT7A 3OL6A 1JJ4A 1S57A 3KJFB 4IH6A 4LVNP 2K8GA 2PEBA 2QLWA 3BN7A 4LREA 4NXMF 2J6TA 3KLIA 1HNWJ 5CH7B 3RAQA 1YDLA 2OPSB 1ZH5A 2XZDB 3NG8A 4BHQA 3OR1B 5AT1B 3J81j 2Y1LB 4MK9A 3GILA 4PWWA 1T8EA 3D2WA 1IBLF 2UUBJ 3HHNB 3PHEA 1S6QB 2XM3A 3D0HE 1T94A 4LMZA 4HHUA 1I3OB 3DXSX 2CIMA 3BDEA 1K8AT 2LMIA 1VCTA 3RTVA 3MURP 4USHA 1G3OA 3H2VE 2NUUG 3ZZUA 3Q2TC 1KVIA 4U9RA 1UZDA 1Z2ZA 2QYCA 4DUYF 2CPZA 1S7IA 2IRYA 1VR6A 3H25A 2QX0A 3BR8A 4DWIA 1JXVA 5D0RA 1Q8BA 2YKPA 4TY8B 4DHVA 3OW2R 2IJNA 4KFBA 3OD2A 2GIRA 3I0SB 2EK6A 3Q83A 3VGUA 5ETSA 4J9LA 2CQHA 1WF2A 4WZMA 3FQKA 3N9UC 2UUCJ 1VDHA 4K4TA 4IFYA 1WUUA 1KRPA 5IQQA 4C48A 3D6FB 2F8EX 4LBPA 1FERA 2EFQA 4CRJA 4NLQA 4DFKA 3T5JA 2WK4A 2E44A 5KG7A 4KYZA 1NU4A 5F9LA 2QMWA 1VJWA 1U1MA 1LWCB 3O5TB 2U2FA 2P9CA 2V8DA 4P71A 5KFJA 3C6UA 2ZJRQ 2BE2B 4E8UA 1XMQF 3MM8B 2W9BA 2XMTA 4GO7X 5I42A 2MYFA 1NK9A 2ZHBA 5DETA 3RBDA 2V4JA 2CWKA 3SQGB 4JB8B 3Q8VA 5CYJA 2YWWA 4HT5A 4PG4A 2Z0GA 3M6XA 1TUGB 2CPHA 3BO4A 2JDJA 5KG6A 3BGRA 2W7PA 3K7RA 1HWJA 5LM7E 1NK8A 3IAS9 3TA1A 3UR3C 3ZNUA 2MB0B 1SJ3P 3Q22A 2CJ9A 1HNIA 3BBFA 4M8LA 4P7TA 2PEHA 3I82A 4FS1A 3GV8B 3BKUA 4WF9Q 2HWHA 2WVCA 1GXUA 1XC9A 3OTBA 2RHSB 1U6FA 3DDKA 2YH0A 5F3TA 4A4JA 2JOQA 5DDPC 2W1BA 1X4GA 4YDXA 3VAIA 5HATA 5A2QU 5CD4H 1Q7LB 1U6BA 1NAQA 5KFMA 4RLEA 2VPYB 2EXUA 4YR3A 1V3ZA 1FESA 4R0EA 5I4MA 3UE2A 3CD7A 1HBUB 2MQPA 1L5UA 4ZVRB 1IWAA 2DGSA 3I56S 2CJKA 4OZLA 4ZHRB 1P1TA 1X31C 3CJSA 3T5HA 2C2KB 3OHAA 3E8OA 2BV3A 1Q78A 1Y3KA 4NRUA 2WRMA 4UOFA 1X4EA 3V81A 1M5OC 1VQ4S 4GVBA 2KHCA 4UOCA 1JLEB 4DR2F 2EEYA 2WCXA 3THTA 1OS5A 4LF2A 2IDLA 2HMIA 4O0IA 4QIEA 3JSYA 1K44A 3D54A 1HQUA 4J90A 1HW8A 1XJWB 3N6MA 4FYVB 3M32A 4J91A 4LRBA 1YRUA 4ZJQA 2R7QA 3GFXA 3R5CA 2DR5A 3MD3A 2XHCA 1OY8A 1K0TA 5ITHA 3V4IB 3PTWA 4JI1J 2HFZA 2ATLA 4B9MA 3DOLB 2QC3A 3BPDA 3MR6A 3M2VB 3MR2A 2XGPA 3HHLC 4NWBA 4DV1F 3M4XA 2FVCA 3FC9A 3IRWP 1YJRA 1EP4B 4N76A 4F4ZA 4OYMA 1B4SA 4J9KA 4C8KA 2LKZA 2KKHA 1RT7A 2OMLA 4DDFA 3N79A 4QIWD 4NYZA 4Y34A 5I3UB 2A1BA 5DRKA 2BR0A 1RT1A 1Q8IA 4MIBA 3KHGA 2R7SA 1HNZJ 2HS4A 4DSIA 1VYAA 3MEDB 4KGVB 1WSRA 3PFOA 4NLTA 1VRTB 4V1Ak 2PMHA 3W60A 2VV5A 3PV8A 2CWXA 1N0VC 4EO6A 3BYRA 5E5NA 2XBPA 1TU0B 5HLFB 4W98A 3LH2S 4E98A 5ETTA 1Q1KA 3UNGC 2D3OR 3DKDA 1SL2A 4JI4J 4JI2F 1WJ9A 1VRUB 4Q44A 3PX0A 1T9TA 1Q5YA 3BEGB 4B3OA 1UWBA 3HKZD 3UD3P 2FJWA 1HBNA 4I1TA 1HYSB 3MPWA 1URNA 3M6UA 5A76A 2DITA 3ET6B 4A8KA 3MMCA 4ANEA 2QRRA 2V8VA 3J80U 2XO7A 4ED2A 3FCWA 5FLXU 1PCAA 4FKXA 5ETQA 1S9EA 4NCGB 2JL9A 3EDQB 2ZBPA 2ZJPQ 2MLZA 3PY8A 3C66A 2Q3PA 5KFGA 4F0MA 3GIIA 5IV3A 1TL7B 1RB0A 2EBEA 1S1TA 4Y3CA 1NH8A 1RTIA 2NQPA 3CCJS 3IA0A 1LV5A 4AL5A 2BACA 3PXGa 4DN0A 3ULHA 3BGOP 1NKCA 1CJKA 1Q79A 1SH3A 5JJBA 1UFWA 2V68A 1FRHA 1SC4B 4C9DA 2KT5A 2IBKA 3R9LA 2KZMA 4WFNQ 4TLQA 4HH0A 2UVVA 1RJJA 1HR0F 2Y9HA 2DNRA 1UA0A 1DURA 4KHPF 3TANA 5HBMB 1E6YB 2I6WA 3RG6A 3B54A 1MMLA 2VKZG 3RU0A 2ACMA 1G6BA 4NLXA 1UETA 4FPRA 1S9GB 2AWZA 4JBCA 2GVDA 3OHBA 1WI6A 1IWGA 4C97A 4HVZA 5EX0A 2EFPA 2CPEA 5HJXA 1W25A 5J2NB 1Q16B 1UJ6A 3KUHA 2RDDA 5IT0A 2MQOA 4DPTA 4AE5A 3H2UB 2YWGA 1JMTA 2BJ1A 1H38A 2ZVIA 3S6EA 3BQ2A 2NPIA 3SZ2A 4LFAF 2GQCA 4ZLPA 2QLJB 3MR3A 5D0GA 1WDDA 3GB0A 4IQXA 4OJ3A 3TQ1A 4H4MA 3BH6B 2ZKUA 3GSIA 3TAMA 4CT8A 1VQ7S 1KBRA 2A2DA 4PWDA 2DT9A 2UUTA 4O0NA 2RILA 3F0NA 3R3TA 3QQCD 2NUHA 3CCES 1HBOA 1QJHA 4LSZB 4MKAA 2BANA 4LSLB 2MKCA 4WE1A 3SEOA 3IWXA 1IKWB 4KV8A 3MMBA 2F63A 5F9NA 5BR8F 2NSCA 1T05A 2C28A 5J2PA 1GAOA 1X5SA 1HWLA 1R89A 2E5GA 1N5YA 2MLYA 2DGOA 1KVKA 4YOEA 4C11A 2VG7B 5F8LA 2DNHA 2MY8A 1SBRA 4P74A 3NGRA 1N8RT 4MIAA 2XZTB 2GVZA 5BYSA 5CHCB 4X4PA 3H20A 3SDEB 1OY9A 4DQIA 1PC5A 3AB4B 3OTCA 5G0RB 1DQ9A 5L9XA 4ER8A 4BC9A 1Q7YT 3R8YA 4NEZA 2L9DA 2MDAA 4DV7F 3JB9k 4NLOA 3SSSA 3RW7A 3M9OB 2POKA 3KJNB 1TMMA 1ZM2A 4X66F 2VONA 4CTAA 2Y0SD 5AXLA 3H4DA 4IUFA 4ETXA 2NZCA 4MKBA 4PR6A 3KXDA 3IM8A 4KHPJ 4KH1B 3M8YA 3OSNA 3K5NA 1X7VA 3HM9A 1AROP 5H9FK 3DN9A 1F9EB 5A8RB 4YHHJ 4RUCA 1UL3A 1JXLA 3HDSA 4QR0A 1IN0A 5HVGA 1WOOA 2YH1A 4NLUA 1R0AA 1ZM3A 1N5SA 1J5OA 1RTDB 2DRDA 3DLKB 2G1HA 5FDLB 1VQPS 2NYHA 3QLHB 3J7YI 5BJRA 3NCQA 2O67A 3TNVA 2WBRA 2DR8A 2EFGA 3LA0A 4KQZA 2DGVA 1RTJB 2BW2A 1EARA 1SJQA 1FF2A 1I1GA 3FBBA 1RHMB 2COLA 1NDPA 3MM6B 2LDIA 4YFUA 1RAAB 1WC1A 2N82B 4OHVA 3R5AA 4EMDA 1SQGA 3H0PA 1VQ6S 1PAUB 2GX8A 5KFIA 2JWNA 2MMYA 4DR7F 2BOAA 5DDQC 2Y1JA 1KFDA 2AIRB 1TKXB 1YIJS 3HXMA 1DLOB 3B82A 4F4YA 2FLNA 2RUGA 4OX6A 2DKOB 2FZGB 4TY8A 4DR4J 3BO3A 2YKAA 1T03B 3VR1A 4U6PA 1VS3A 4KB7A 3Q89A 1RT4A 1VI7A 1SQFA 3Q8UA 2X1FA 2ALYB 1JK9B 1D1UA 1TKDA 4M5DB 4WFZA 3DM2B 1NB7A 1PJ5A 2ZFHA 2IM2A 3RRHA 3M8WA 5GADU 1YJ7A 4PABA 2ZVSA 1HBMB 4KRWA 2HEKA 4CM2A 3TEGA 5LMUF 2JFKA 4MIWA 4M94A 8RUCA 4JV2A 4LR7A 1XMBA 1REVB 1GX5A 3W2WA 4C4WA 2HK3A 3QT7A 1KQFB 4DV4J 4FF2A 3OFHA 4H4KC 3DLEA 4JV5J 4YY3J 3JSRA 1JKHB 2BE2A 4DI6A 3IRXA 4XTTA 4DR6J 4IR1A 2I38A 5KT5A 3A3PB 2C3UA 2QL9B 5KFNA 2JC0A 3WDOA 1KS2A 1VQNS 4WJBA 3E2EA 1CEZA 1ZA1B 1BHNA 1RE1B 2QSWA 2OPRA 2HBZB 2CNKB 5GVQA 4QPXA 2JHEA 4CLPA 3NGUA 2JH3A 2GIFA 2E66A 5GMKa 3DRPA 1NPKA 3PZPA 5IQ6A 1WC6A 4F2SA 4P73A 3NS7B 1FKOA 5LSRA 1A6LA 5D0HA 4ECZA 1F2GA 4XAKA 2ZH5A 1HMVA 4PPDA 2M3DA 5ETNA 2VICA 5EDWA 1N33F 4I2QA 2AEMA 1EX8A 2K7KA 4OZ0A 2FPHX 3HSJA 2GMHA 2ATCB 4Q7AA 1PIEA 3OXLA 1UVMA 1HBUA 1RWUA 3CD6S 4ILRA 3KYLA 1WG4A 3DRXA 3QATA 3S8SA 2XWXA 2E5HA 2FGCA 1RWOB 3GIKA 3PO4A 1FRLA 3HD2A 2BJ7A 3PYFA 2J9EA 4W92B 3MUMP 1JLEA 1FRXA 2RAQA 2VG6B 2F8MA 1BC6A 4A48A 4FS2A 2IAJA 5A8KB 3BQ0A 2A6MA 3CCUS 5T7LB 2NSBA 5HQMA 5G4DA 4ZVEA 2MKHA 3DRSB 5FJ4A 2QA2A 2CG8A 2P8IA 4ECQA 2RHQB 4JOUA 1WEXA 4NZ7A 4TN2A 4ILLA 3IR5B 4PXCA 1Y5NB 4R8UA 1JLCB 4LF4F 1Z1ZA 3V4IA 1WORA 4ID5A 2ZHOA 4OQJA 3G2XA 3L7OA 3NL0A 2BX6A 4KT0C 3TA2A 3OXGA 2XYPB 1S76D 3AJ1A 1N36J 4K8RA 1QUVA 3CIZA 2XSJA 1S49A 1UFLA 1T9WA 2AYEA 3FDSA 1FTCA 3NXZA 2YNFB 2BJEA 1RACB 1U1NA 4L73A 4YB6A 4GRSA 3F44A 2V8PA 2HNDB 4QIVA 3KLFB 4M5MA 4DUZF 5LJ5Y 3OVAA 5DM6Q 4RW6B 5HP1B 1P1LA 3BGLA 2W4CA 3QIPA 2U1AA 3CCQS 5KFEA 3KK1A 1LW2A 2HQDA 5I3UA 3GU0A 5KG4A 1C1CB 2FHOB 4X2BA 1X4BA 2LU1A 5GAEU 2MZ1A 2ABYA 3SSQA 4K7QA 1CC8A 3V6DB 1R7IA 3GV5B 2DXDA 3GFHA 2MKKA 2V8GA 1S1WA 2IM1A 4DF8A 2LVWA 4FYYB 3G8TA 2Z8QA 4C0OC 1NDCA 4AQYF 2HK2A 1NJYA 2PO4A 5IM0A 2B6AA 5L1KA 1VRUA 3TVZA 3CULA 2GQ2A 4ZN1A 3HI9A 4ZJOA 4NRTA 4RNHA 4S0MA 2H48B 3ET6A 3LGHA 2R9LA 3FBCA 2QYGA 3GG0A 2PFDA 3GQCA 5C24A 4J9RA 5F41A 2R7RA 3GIMA 4YB7A 4OI1A 4DS4A 4USTA 3EGVA 3R2CJ 4WBFA 2ZHAA 4ZVUB 2PMWA 4O3NA 1AW0A 5A8WB 4FXDA 1ZYQA 3AHPA 4URGA 4TU8A 2R2UA 2E5LJ 3FSYA 4CO4A 2HHTA 1LW0B 2WW4A 3JS9A 3EE3A 2RDIA 3H2LA 1DRZA 2D7SA 3TX8A 1NK5A 4IR9A 3I6PA 1JLBB 4QWAA 3MHYA 2XLIA 2EKYA 2ZITA 4LF8J 4DV5F 3DNCA 1RAHB 3R7BB 4P9SA 3KK3A 4E2FB 4JV1A 3JTOA 7FD1A 1KHVA 5E41A 3AXKA 5FD1A 2R8JA 1EETB 2HGLA 4NEYA 1FFGB 3F56A 1E6YA 3WIVA 4DFPA 1VC0A 4DSFA 3B4MA 5A6PA 4IRCA 1HW9A 4F50A 3IWLA 3OJSA 2WZ1A 3U1NA 5IFMA 3I87A 2V4RA 5K8PA 1FK9B 2BRLA 1EZZB 3AJ2A 1YJ9S 1GXTA 1FD8A 1UFKA 3G8QA 1NK0A 1N88A 1VQKS 2ZUGA 1IJFB 5J2NA 2PD1A 4MKYA 3LPEA 3G82A 3FZ2A 4PPZA 3T3FA 4JI6J 3QRPA 1R8HA 2FUG9 2BM0A 3VAKA 4DSKA 1YLXA 3MD1A 3T1HF 2RS8A 2KVQE 2XNRA 2LQ5A 1NH7A 3HZGA 1GNKA 4B9UA 4LJMA 4F67A 3CMAS 4CLLA 2A6OA 1S4EA 4MT1A 3M8QB 2VBXA 1FE0A 1Q95G 2RD5C 3CC2S 2DCUB 2H3EB 1T9UA 4IQMA 2VFTA 1S1UA 1NSKL 2AZ1A 4I6AA 3W1YC 1RWKB 3L95X 3G6VA 5IWAF 2HNZA 2F1FA 4B3RJ 2J9CA 1OO0B 3KLGA 3CWJA 1F1BB 4LSLA 1ZTTA 2WOMB 2UXDF 4RNOA 1RT3A 4KGZB 3TJAA 4K4UA 2XMVA 3OUYB 4V19X 3TVYA 3CJ3A 2W4DA 3H42A 1CULB 4DG1B 1NNDA 1FCAA 2CQ3A 2DK2A 3M2RB 1TMJA 4D3HA 3LP2B 4JI5F 4RW8B 1X9SA 1XERA 3IXQA 1ULRA 3MM5B 2H5EA 2BUNA 3H5SA 2RQCA 2GGPB 4AD6A 1LNQA 5KFCA 3OTDA 1QUPA 4DX8H 3DLLQ 1VQYA 5SZTA 3BN4A 2CDRB 4QJVA 2K2PA 3FFIB 1MU2A 4LF5F 3FVYA 1V5VA 1ACMB 1DTTB 3C16B 5KFAA 4DV0J 1AYEA 4JI7F 1PSDA 2QG9B 1NDLA 1MG7A 3C15B 2HFVA 1RWWB 3W9HA 3N5BA 2RB7A 2C2EA 2W8LA 3GG1A 3V4MA 4ENOA 2HHHJ 3KKFA 5K20B 2E29A 1BXNA 3CB4A 2FTRA 2OSQA 1WI8A 3PJWA 4P2MA 3RW6A 3NOGA 2R7VA 2PIIA 1ZPVA 2HVDA 2CUYA 1RT5A 3IS9B 3K0JA 4DV2J 2KG1A 4HACA 4X65F 3CTRA 1GTEA 1U0SA 1L3TA 1VGYA 3NMRA 2ZD1A 1M90T 1CJVA 1B3TA 2XEXA 2W9CB 5KT7A 4KIAA 3UCZP 4EFAC 1TKXA 5KFKA 4RZRA 4ZLJA 3IBWA 5L1LA 3NWRA 2HQGA 1Y10A 2ACYA 4KGKA 4DQSA 3I32A 2AJ0A 1GH8A 2R2RA 1TFYA 4EI2A 4DL7A 1S1VB 2ZOMA 2G2YA 3I31A 3FRZA 3W5YA 3LGNA 1TVRA 3DLGA 1WDTA 1P9QC 1C4CA 3VGTA 1WSVA 2HWIA 4UUWA 4B17A 1YBTA 4NMXA 3ZTQA 4NCBA 2BM1A 5DZ7A 4XPCA 4WYLA 4K4YA 4EU0A 5GAHU 1FVQA 1YZ7A 1QE1B 3PW2A 2JJ4D 1V3RA 3FBFA 4U8VA 5K8NA 2MKJA 5D4NA 1T11A 1REVA 4OI0A 3J81Y 4ZCKA 3GYNA 3MECA 2OTJS 2DR6A 2RIJA 1S6OA 1TV6A 3LAMA 1NRKA 1WWHA 2OIHA 4RL1A 1JLQB 4DR1J 1LK5A 1O0PA 3CDAA 2LQBA 1NZAA 1NK4A 2MSTA 2SXLA 1NSQA 1KWMA 1NJIT 3MM9A 4LF7F 2F65A 3KNGA 2G4BA 2CPJA 3Q8YA 4OI6A 2EC2A 1GQEA 4YN3B 3I0RA 3PACA 5MAOA 5C5JA 3FEYB 1QM9A 4DN9A 2DVIA 5BYQA 1H7WA 1SC3B 3W65A 4ZVFA 1PO6A 1RT6B 3VVUA 5B0DA 2WHOA 4IO9Q 4PEOA 3KG4A 4ANDA 2FLPA 1IBCB 3G96A 1MWZA 4QQBA 3K57A 2EC0A 1A7GE 1U4BA 2VG5A 5B0GA 3R1LA 3QMQA 3G8SA 2YNGA 2LU2A 3J7Z5 2GO8A 3U27A 2R7OA 2C2RA 3K8VA 3EPGA 4LQ3A 2WVDA 2EBGA 4RNFA 4LF6J 2CQ4A 2VQFJ 1W7WA 4PUOB 5AE1A 1LFPA 2DNQA 4B3MJ 4ZA1A 4F4KA 1GEHA 1MLAA 1HWKA 3QT5A 2ZZNA 3Q23A 4OZ2A 1RAFB 2AF6A 3M2UA 2C2OB 1TK5A 2R2SA 2UUWA 4NLYA 5LT5A 3O6QA 3DU6A 3RRKA 2IFXA 3KLIB 4WIIA 5DLGA 1FX2A 3JYTA 5KT2A 3I9ZA 2DRAA 4A8OA 4KC5A 4TU7A 1YKWA 4UOGA 3KHLA 3EVMA 1REGX 2OSRA 1X4HA 3TEHB 3T9NA 2CKWA 2IVYA 4GKJJ 3MEKA 2G1DA 4XDCA 2IRXA 3HFKA 4UZCA 1S97A 1VQLS 2M0GB 2M5YA 3AH6A 2GAGC 1C0UA 2OD4A 3V6JA 1V3SA 3W61A 1PYTA 2G2ZA 2O1PA 3FJ2A 1L3SA 1VQMS 3R2DJ 4NLRA 3TP2A 3ZTSA 2DGUA 2QA4S 3T1YF 5KFYA 3PJ9A 1N5TA 2KU7A 1H2VZ 1RABB 1ZA2B 3LF0A 1EKSA 1Y11A 3MFHA 4WP3A 3EPIA 1BGXT 4KFBB 4RW6A 5HP1A 1WG1A 2PC6A 1YG0A 1SV5A 1BWEA 3I5BA 2A10A 2NXJA 4Q45A 1HFEL 2ZBQA 4PG8A 4JYAF 3LAKA 2B7BB 2RRNA 2J9DE 2B0GA 1GFWB 5H9EJ 5DJBA 2RSQA 3CDEA 2FC9A 3EYZA 4J9NA 1IR0A 1SKUB 2H1YA 4RO0A 4N77A 4IFYB 4X4TA 4IH5A 5ETPA 2B4PA 4ZDNA 1FEEA 4OLPA 4IOAQ 4ELTA 2UU9J 3SSRA 4EK2A 4LIWA 3TR5A 2VODA 3T5KA 2ZH9A 2ZOFA 1RK8A 4LFCJ 2HIQA 4DMZA 5DM7Q 4F4XA 1AB8A 2A3JA 3ONQA 4C8YA 4I7FA 3C6UB 2W9BB 2FZCB 4Q8FA 2UV8A 4PKDB 2V4JB 3A3NB 1NK6A 2XS5A 2KTQA 3ETOA 5KG0A 1Y3JA 4Z7YA 2JEJA 4P6QA 2E1CA 3BQ1A 3SBMA 4P52A 3DOMA 1NCLA 1BQXA 2YY3A 3T41A 3T9ZA 2OH2A 5A8WA 2I5JA 1XWLA 4O23A 3HHEA 2HLTA 2DPIA 4EGLA 4UT4A 3IC1A 5SUHA 1SJ4P 5CCLA 3HVWA 1LW0A 3BF4A 5HMXA 1WC3A 1U2FA 3HSGA 3AB2B 1HHQA 2HHVA 2DNLA 3PRVA 2M8HA 3VHQA 3QAUA 4QWCA 1JLBA 4GC7A 4P2FA 5L46A 4X84A 2R8GA 1CC7A 4FXWA 1UVNA 2C42A 5J2MA 1S0OA 1N0UA 2IM0A 3EXCX 3HD1A 4I67A 3V81B 3AQOA 4GVBB 2CPDA 2N7YA 1Y7PA 5AE3A 3LQVA 3CJKA 3Q24A 3OL8A 2CXEA 1FDBA 5E3PA 2Q43A 4NXNF 2ZH4A 3E51A 4FF4A 1UCNA 4HI2A 3MFIA 2HMIB 1R0CB 1EQ0A 1MN7A 3AOAA 4Q0BB 1HQUB 3M32B 3BO2A 5GAGU 1Y00A 2XYHB 3VQSA 1VC6A 2F7VA 4PXBA 1CJUA 2MZQA 4ZLNA 1YI2S 1TL5A 2ZWOA 1B7FA 2K06A 4HYKA 4QWEA 1S0MA 2NS1B 1OPZA 2CG4A 5BXIA 3ZZRA 1Q81T 4WXOA 4QZVB 4TKTA 1A0OB 4O4RA 3BGUA 2AD9A 2OKQA 4DPXA 3TVKA 3GJRB 2NZ4A 2HS3A 3FMWA 4P75A 2VC1A 3UPFA 4G6VB 4QPTA 4Z37A 4YQWA 1RAIB 4ES3A 4H54A 3PX4A 4JI0F 4K2XA 1R3NA 2M9KA 1VBYA 2WOMA 3M9NB 3KTQA 2KFZA 3VTIA 1TP7A 2AJQA 3BBCA 3D0IE 4K4WA 1P6TA 1RT7B 3PRDA 3QRQA 2J8SA 5H9EK 5D4PA 2AJFE 4KO0A 2K1RA 2VFSA 5EUHA 1XNRF 1RT1B 4K0KF 4ECUA 3T1AA 2PI5A 5KT6A 4RW8A 3RR8A 1HLWA 3RB4A 5CXTA 5KFLA 2GZOA 1N54B 2UUAJ 4B9VA 3TUZC 3MM5A 2IVFB 2J5AA 2OD6A 3FK4A 1TUWA 4CH0S 4CO0A 2ILZA 2ZJQQ 3CIMA 3O8WA 4Y00A 1XR5A 1UWBB 1J5EJ 3BSOA 1TAQA 4HH1A 1HBNB 5I3PA 4WFAQ 2B9YA 2W9AA 2NYIA 3MMCB 1M5KC 4QU7A 1AFJA 2FLOA 5H1SV 1T7PA 1U2CA 3GIRA 4MK8A 2CPXA 2J7WA 1S7HA 4R25A 3FFIA 1PBAA 1GMVA 1BQNA 3MM7B 4U8YA 3E01A 1HI1A 1DTTA 3C16A 2MGZB 5CABA 4F36A 2VZ9A 3VVTA 2DXFA 1SJ1A 1ELOA 4J7CA 3QWUA 3OQ2A 2X1GA 6AT1B 1S1TB 2HFUA 2CQ0A 1RTIB 4ED4A 1CJTB 2DEIA 2CZ9A 1M5PC 2EI5A 1OIAA 4C2MA 2GNKA 3KDOA 1LQ9A 2B5JA 5GMDA 2ASYA 4BC7A 1S79A 1CJKB 4CNZA 3C6TB 3GR1A 1ZZFA 1MROA 5HJYA 1J27A 4RW4B 4AL6A 3AA8A 5F0UA 3RRGA 1TUVA 3MCSA 3HO1A 5K5MA 1VQ5S 4HDHA 1Q8LA 1HARA 3VAHA 3NP5A 3UQSA 3KOAA 4DJBA 4M5GA 1D3WA 4MK7A 3AFGA 3NLCA 3S1TA 1SB6A 4OHXA 3TUIC 2GVDB 1OQ6A 2CQDA 1JB0C 1IQZA 2VDHA 5CYQA 3NWGA 3N6LA 2EVZA 3EJMA 2I8EA 4Q43A 5A0YA 3VAJA 2KL8A 3U02A 1ZM4A 1F3VA 1RUSA 1F5AA 2FJXA 2H4YB 2DB1A 3B6BA 4FNHA 2BKOA 3PFEA 4GVLA 2OEJA 1JIHA 2R7WA 3ZZ0A 3H98A 2AQ4A 1JX4A 2K7JA 2ASJA 4H4MB 4G1PA 3HZEA 2XS7A 5J1NA 4Q8EA 4M63A 1LWXA 4PWDB 3NCRA 1AZSB 5IS2A 3X1LB 3RJMB 1KDNA 2C2NA 4ES2A 1IBKF 3QZ7A 2BANB 4WE1B 3OT9A 5GMEA 1ZETA 2QMXA 2F3JA 2VL1A 4WK3A 4LSNA 4B3TJ 1JLQA 4FYDA 2VFVA 2Q79A 3MMBB 3TA0A 1YWXA 2QGFB 2JEIA 2HVHA 3NS5A 2UZAA 1T05B 5J2PB 2LA6A 3MMJA 3PKYA 1N5YB 3MCMA 3ZO7A 2VKRA 4C11B 4JI8J 3ZTPA 4LFBJ 3RB6A 2AX1A 2W7OA 1TTHB 4ZJLA 1OYEA 1TELA 1KN6A 5RUBA 4CO5A 4F3MA 4ED8A 4QBUA 2KRBA 1MW7A 3GSDA 1FJGJ 2V69A 4DCJB 4L3KA 4CO1A 4F4AA 1U48A 3AJDA 1HNXF 2ZH3A 3PYEA 3MPUB 1KNZA 3ENWA 3OFEA 2H5JB 2VIHA 4ZOSA 1QSYA 4C8LA 3S7RA 2DGTA 2HFOA 4FPIA 3BREA 1X0FA 1ZBTA 1RDRA 2EKNA 4EO8A 1NHVA 1JNRB 2YPZA 3ZZOA 4M5KA 4G1IA 4O3OA 3QO9B 2R4FA 3NNCA 1W2BR 2VOOA 1S59A 5D15A 1N5QA 3VGSA 2VA3A 5HI7A 3KLEA 2NREA 1YBAA 2CVEA 1RYSA 2VJVA 4M5LA 3N0VA 4HHHA 2XY5A 5KFVA 2HQ3A 4NYOA 4ZVOB 1YZ6A 1JJ2R 1SXLA 4RBVA 1R0AB 2UXBJ 1J5OB 2G0IA 1C2PA 3CJ8A 4G1QA 4URQU 4TQSA 1RP5A 3WX4A 2HYIB 4LF9F 1FKPB 5F3ZA 5DQGA 4F26A 1TL1A 1B7YB 3CXCR 4F3QA 2DGWA 4OFZA 9ATCB 3QGIA 3MOJB 1KTVA 3ELHA 3MPYA 2IIHA 2VF3A 1KKHA 2GO9A 5F8GA 4B9NA 2Z30B 2LXFA 4NPOA 2HGNA 3NKYA 1O51A 4QOTA 3ETMA 2EFNA 1PC4A 2D9PA 3R5BA 4DR5J 3VZIA 3CJ4A 4FNIA 4N56A 1TK8A 2M52A 3Q8PB 1X5PA 1D8ZA 3M05A 2Z2YB 4Y0FA 4IFVA 1YSJA 1U09A 2MLXA 2ZDOA 3CC7S 4I6YA 4ED6A 3RB0A 3OLAA 3AAWB 2V2QA 2HGMA 3DMJA 2QLFB 3UDVA 3CCTA 3FBEA 1VLYA 3W3SA 2XYGB 4DV3J 4V19J 1ZAXA 4YP3A 2VPZB 5IZHA 2D74B 3CUNA 2PFFB 4DPUA 3FNNA 1S77D 1RT4B 2V5HG 3UI3A 1XEZA 2UXCF 2GJ2A 2Z4PA 4OYBA 2L48A 2B8PA 3C2PA 1A9NB 1AFIA 1UW9A 3FCHA 3VALA 3B4DA 4DV6J 2WSCC 1T9VA 4O44A 4DZDA 1M5VC 2ZH2A 3HHKA 4C98A 3QFHA 4OZ1A 5KAKA 4FVCA 3HT0A 2XS2A 4JI3F 4OX9F 3G71S 4H4OA 5JVGQ 3W2WB 2C3MA 2DHSA 4K4VA 3DLEB 4TVAB 5A2QY 1HD0A 4QYZJ 2PN6A 2RRBA 1HNXJ 2R8HA 3IRXB 2W2PP 1CS4A 1N5VA 3HULA 2IBOA 3GONA 5KOWA 3L7UA 2FHKA 2MHEA 3D9BA 4IH7A 2E9RX 4AXJA 1D0EA 2ZM6F 3QNWB 3A8IA 1DBDA 4LR9A 3VAGA 2BZ2A 1SI9A 2CJYB 4L76A 1W2IA 2OPRB 5JMNA 4WFYA 5LMNJ 4HR2A 1XMOF 3C19A 3FKBA 2J9DA 2YQ0A 1SJRA 3EM1A 3DRPB 2JLEA 3BKFA 3PX6A 4CI0B 2YPYA 3US5A 4DUTA 9RUBA 1FKOB 2AHOB 3MZIA 4NA3A 3NNHA 2XQCA 3SCLE 4DS5A 4NXMJ 1HMVB 1QD1A 1RKIA 5L38A 1PJ6A 3GZ7A 4UTGA 1WOSA 5GAEI 4I2QB 4USIA 1B64A 1RAEB 2DXEA 3PNIA 2D3UA 4RBTA 4PQUB 1KOHA 2IC3A 4KGMA 1IBLJ 4M95A 2ZC3A 3IR7B 3CF5Q 4IG0A 1V6HA 1M5SA 2FVQA 3PR4A 1CLFA 1S48A 2Q6BA 1VQOS 3QZ8A 2OHDA 2UVUA 1L3VA 3JQMA 3AQPA 4ITSA 1RLDA 2IAJB 3DCAA 4FBTA 2AJ4A 1ZOTA 3UW1A 1U1PA 4DUYJ 3WX8A 2BDPA 3J7A1 2MKIA 4NL5A 4RR5A 3W63A 2FGOA 4ZPWR 4Q0BA 4X62F 2FY1A 5DS7A 2GIQA 4ED5A 3JSMA 4R8UB 3MEEA 2V4QA 4ID5B 2WTFA 2OFGX 1P8GA 3VQTA 4IRDA 4EZ6A 2B3TB 3BH7B 2E9ZA 1OSDA 4XO0A 5EHHA 3GP9A 5EX3A 2OUGA 4Y28C 3TUPA 2XSJB 4A8QA 4MKVA 3CCLS 2HRYA 1NUEA 4FN5A 2ZOGA 2P9GA 3ZZZA 7AT1B 4LRFA 2O5DA 3GFYA 4BWJA 3CJ5A 1QAJA 1LWFA 3R5JB 3OTOF 1QSSA 4LRAA 2B9XA 3A3OB 4OI2A 4JP8A 3JQKA 1EKRA 1XMQJ 3CPWR 3QIPB 2JVOA 2V34A 1MNEA 3KK1B 1LW2B 3OSPA 2Q66A 3W9JA 1NJZA 4OL8A 4ICLA 2JLGA 4A8SA 1UVKA 2RVJA 1PKUA 2PI4A 1I51B 4CLFA 2XLKA 2VPXB 3G6YA 2MZTA 3LP1A 1H72C 2ZBCA 4MAKA 1EQMA 1YBUA 4ZVTB 3DOKA 1S1WB 5HMZA 1D9DA 4CLTA 4OJ1A 1CSJA 1RLCL 3LGMA 2X3DA 1YK9A 3MMAA 2WVFA 5THWA 2QN6B 3EWGA 1SPBP 3IGVA 5IM0B 1BE4A 2B6AB 4IDKA 4QYZK 3OL7A 4RW9A 3ITHB 4UQTA 4LBHA 4CIOA 1WHYA 4CLUA 3GYGA 4K2JA 1KONA 1CVJA 2ZZMA 2V6AA 4LIRA 1FXRA 3GIJA 2LEBA 2F9DA 3GV7B 2YNIA 3FEXB 3LWMA 2VQEF 1N34F 5C24B 2F40A 4BS2A 1SC6A 1RHKB 4ELVA 3HVTB 2J7KA 4DSLA 2OPQA 3MM7A 1FJEB 1CG2A 4CLKA 2MGZA 1Q8KA 5ADZA 4EBCA 2CZVC 4NLPA 2YKNA 5H9FJ 3KK2A 2QV6A 2KHDA 5IT4A 4RUBA 4P2XA 4NA1A 3HLUA 3QBCA 4FP9A 4UUXA 1YJNS 1CJTA 4DR2J 2BKNA 2KDOA 3MEGA 2BMBA 1Q86T 2B4OA 2ZKTA 3A8JA 4DR3F 4RW7B 1FVSA 3DFEA 4WZQA 4XIUA 3C6TA 4ZP9A 4OX7A 1TL4A 3KK3B 4RW4A 2WONA 5K8MA 4X4NA 3PG9A 1QTMA 2F4VF 3ZXWA 2ZNYA 3CCMS 3THVA 1WHWA 2AV5A 3TW0A 4X64F 3EGZA 4QIFA 1TK0A 1XNQF 4N41A 4DV1J 1F5CA 3QJLA 1FHTA 3QPIA 1UA1A 1JJCB 1OSCA 1N32F 1YVFA 3A12A 3MAQA 4QR2A 1U1LA 4MTPA 2CQGA 1PYSB 5E3AA 2MZSA 4DBQA 3ISNC 1YHQS 4WP9A 3G82B 1IR2A 1Z2LA 2KH9A 2R7UA 1ZS6A 3QAEA 4YEAA 4KJIA 3K5PA 3LP0A 4KKOA 2B4UA 4OYPA 5C2GA 4ZKAA 2ROEA 4OI3A 4QWDA 2D69A 1U24A 1VQ9S 1QY7A 2LEAA 3DU5A 5HAOA 2KG0A 3R6LB 4B3SF 1TKZA 3V2UC 3OVBA 4LRCA 2AJ2A 1IBMF 5E3QA 1KVJA 1AZSA 2HZVA 1U1KA 1NJWA 1S1UB 2LEPA 1LEOA 5J1EA 2DISA 1R8BA 2HNZB 3KLGB 4JI2J 1RCOB 3Q8RB 4C8ZA 3NBPA 4GKKF 2YTCA 1RT3B 2A18A 3IMQJ 4YB5A 2AGOA 2I9SA 1VISA 3CW2C 5KG3A 1PG5B 5KT3A 1U0HA 4RX6A 1RU2A 4MH8A 4Z7CA 4HLBA 3WIUA 3UDEA 3HP6A 5L39A 5EWGA 4A8XA 1RQ0A 3SCIE 2HVEA 3W2VA 5HO4A 4OYAA 4FZVA 3M7VA 3DLJA 2VUGA 2CJXB 5AJ3F 1M1GA 2YVSA 3CD5A 3UWTA 3DRRA 2JEGA 5KG5A 3Q2SC 1RZMA 1T3NA 2QE5A 2G0CA 1K47A 2BJ8A 3EZ5A 4CCHA 5KFUA 5GAHI 3M1VA 1IKVA 3DLHA 3PIPQ 1X60A 2VB6A 3D1QA 1MU2B 1HR0J 1BUXA 1OYDA 3QO9A 2J6SA 3QJPA 2YX4A 5KFZA 2KFNA 1IM4A 2BQUA 1QTNB 2CPFA 2HHSA 2PGCA 2YQ1A 3OR2A 3O2IA 2DIVA 2W4PA 1ZAVA 4A8YA 1T95A 3TX0A 4KGXB 1WKKA 1U47A 1G4CA 2RE1A 1RGVA 3ZC4A 3IG1A 2B56A 1PYOB 3UVJB 3O44A 1D9FA 5LOQA 4DL0C 1HNVA 1FKPA 3TZYA 3H8YA 1CPZA 4K5RA 6FDRA 1KD1T 3BKTA 2BJ9A 2NLWA 3X3UA 2DCLA 5EWEA 2P6TA 1C0TA 3A8KA 2IM3A 4DFMA 2DNMA 1RT5B 5IT9U 4HACB 1KR4A 3TARA 2KXFA 2G9OA 3UNYA 1S1XA 1JLGB 4LFAJ 1HNWF 2ZD1B 1CJVB 1PAEX 1IJEB 2ADBA 1FRIA 4W4MA 4B3SJ 1XN9A 2QJ3A 2MPUA 4CWBA 2F8HA 1WHVA 1BLUA 4KHMA 5JXSA 2KN4A 4DLEA 2LA4A 2DGQA 3AD9C 2C3YA 2UUBF 3GYXB 4ZP8A 3HF5A 3CCVS 2IHR1 2Z56B 3IO1A 4U7UK 1VMBA 1TVRB 3DLGB 1H7XA 3TO8A 4MYUA 1HPZA 2GQQA 1VOMA 4ZPCA 1UW4A 4IG3B 3CJTA 1FI4A 2RT3A 5BR8J 3MR5A 3CCWA 2CNLB 2G2OA 3D7SB 4DX7A 1U8SA 5DGBA 2AEFA 2E1RA 1T0TV 5AXNA 1D09B 1JLAA 4C8OA 4LBIA 2BXJA 4EYIB 1WC5A 2XGQA 1U25A 2XLJA 3KHHA 3RBZA 2YNHA 2LXIA 1WHXA 5HANA 2Y8YA 3MECB 2UUCF 1DQAA 2PT0A 1TV6B 2YWFA 2GCFA 4DPWA 5DO2A 5KFTA 1FJCA 4DV7J 2V63A 4ES1A 1JXEA 1FFSB 1B99A 4AXIA 4J9OA 3MM9B 4X66J 2H4WB 4AUKA 2QO3A 2X3GA 2FQQB 3M8SA 1CQNA 4TYBA 3I0RB 2Y1RI 4NI2A 4UQGA 5KT4A 4C7QA 3V6KA 3JAMY 1XR7A 1IKXB 1FTRA 1MN9A 4AT1B 2V2KA 2H54B 2QTWA 1WF0A 1LFWA 1AUDA 4X4SA 3MPDA 1H6KX 3SV3A 2XMJA 1R43A 1P9YA 2D41A 2AJ1A 2VG5B 2AZ3A 2M4MA 1E6VA 4NE9C 1UVJA 2YNGB 2QLBB 2XMWA 2GC8A 1RYRA 1JJHA 3P5TL 5C7PA 3PM9A 4I0WA 1FNMA 2MEWA 1YITS 4PQUA 2L08A 2MQLA 1R8AA 1B0PA 4NX9A 2V9KA 2R3VA 2HSEB 2APOA 3ISND 5B0AA 4DZ6A 4K4XA 4YS2A 3C14A 1UPPA 2QZ8A 2KI2A 3BR9A 4DR7J 3TJ8A 3MAAB 3F73A 1F9FA 3M2UB 4CH7A 2Z2ZA 3UN5A 5LXYA 4DCPB 3M30A 4A8FA 2FJBB 1FD2A 4QCLA 2E1AA 1C1BA 2KYXA 1VBXA 4OHZA 3UR0A 3JYTB 4RWXA 4QU6A 1UZHA 1WC0A 5T14A 1U26A 1F9HA 2XY7A 3BBBA 3H7HB 2G13A 2XC9A 3OV7A 3LPYA 5J2QA 1YJUA 1WD6A 1EB0A 4DU7A 3CNQP 4ECTA 5LSLA 2Y0BB 4ZPAA 5KFFA 3D5MA 2FVRA 3W8PA 3N01A 3QJJA 3QSYB 4OZ3A 5CYMA 1C0UB 4L72B 4M5HA 1K73T 1OPIA 2KYZA 2OP5A 3BPSP 5LMUJ 1FO1A 2KZZA 1S6PA 3IM9A 3QSIA 2DHHA 5HSPA 2IJFA 2EFVA 3W5XA 3M6VA 4JI1F 2JNJA 2AYBA 2ZE2B 4K59A 1Q53A 1P27B 1SV5B 5KFBA 1S9FA 2YKMB 2CQIA 4DQRA 3M8PA 4C3LA 4DL6A 2CYYA 2HWTA 3IR6B 1SH2A 3PW4A 1SIWB 2C3PA 4CT9A 4ILMA 5D78A 1KLMB 1SKSA 5C42A 4C8MA 2LQ8A 2N3LA 5KFHA 3OPKA 4OZNA 1OY6A 2QIFA 2MKSA 1HA1A 3MR7A 2H9ZA 5CA5A 2HBRB 3RGIA 4PRFA 3RZAA 2MQNA 5ETVA 2QA1A 4FYXB 1NKBA 3ITHA 4I7FB 2JSXA 3D66A 1HNZF 2HIYA 1Z4UA 5GAGI 3P96A 1UWAA 2IYIA 2IRUA 4UZBA 1HD1A 4PAAA 3MUVP 3U7JA 1N33J 2EFOA 1RTHA 4CP5A 3NRBA 3H40A 1RT2A 5HVHA 1T9YA 3CT9A 3HVTA 1RKJA 4JI4F 3DOMB 2C3OA 5F8NA 2HHXA 1RAGB 1X5OA 2VU5A 4ED3A 2I5JB 1MWQA 3R7NB 1KLNA 5E0OA 4Y2IA 3G6ES 3LWLA 3MTKA 1YJWS 2CPIA 5KG1A 2RU9A 1SVDA 4YR0A 2C2MB 1FA0A 4ZMMA 2H5IB 1JQGA 2DNGA 1HI0P 4RW7A 1FNXH 3PYGA 3QGPA 4K4ZA 4RU2A 2VA2A 2XTJP 1XK8A 4U67Q 4NLSA 3CO9A 4CLSA 2MZJA 2EG1A 4LF4J 1H2TZ 2JX2A 5J2MB 1NDKA 3MCOA 3NY0A 4LQ9A 1X4CA 2AEJA 3I96A 4HHJA 5LJ3Y 1TL3A
chains in the Genus database with same CATH topology
2GHVC 2COLA 4R5PB 5E3RA 1HARA 1HI8A 2LDIA 3MM6B 3VAHA 4YFUA 3NP5A 3UQSA 2WSEC 3KOAA 4DJBA 3M30B 3N28A 4IRKA 2FB0A 2N82B 1D3WA 3R5AA 4OHVA 4FF1A 1C1BB 1JLCA 2DTJA 4MK7A 4WXWA 4ECYA 3NLCA 3CJKB 1VQ6S 3S1TA 2GX8A 5KFIA 1SB6A 3PO5A 3DYAA 2JWNA 4ERDA 2MMYA 4DR7F 2IVMA 1Y5LB 2CQ1A 3QGGA 3Q8SB 4OHXA 5DDQC 2Y1JA 2XWYA 1KFDA 4RBUA 3TUIC 3JTNA 3AY0A 1F5BA 1OQ6A 5FIIA 1TKXB 3T6JA 1YIJS 2CQDA 2HAIA 1JB0C 4TY9A 3HXMA 2HNYA 3ZZPA 1IQZA 1PILA 5JUMA 3M8RA 4ECRA 3S01A 4PG6A 3KJVB 1DLOB 4MYTA 5CYQA 3NWGA 4BDPA 3B82A 3N6LA 3V6HA 5J2QB 1FKAF 4F4YA 1BQMB 2QEXS 2EVZA 2YNFA 2BOPA 1X4FA 2E5IA 2RUGA 2BA9A 2DR9A 2FLNA 2I8EA 4KPYA 3CVKA 2RDJA 4Q43A 4I4BA 4OX6A 2E5JA 3OVSA 1J2VA 4TY8A 3NGKA 2ZH7A 3BO3A 5A0YA 3VAJA 2YKAA 4PXDA 1T03B 2DNYA 1ZAWA 3U02A 1WELA 3VR1A 3MOZA 1ZM4A 3MGJA 3NCPA 3NAHA 2HNDA 4PQAA 3KLFA 4U6PA 1VQSA 1VS3A 3IGNA 1MMDA 2HRUA 4KB7A 4CO2A 4AFFA 1F5AA 2JLFA 2FJXA 5CYMB 1RT4A 2DB1A 3PFEA 1VI7A 4FNHA 2X1FA 3FSXA 3OUYA 1JK9B 1U1OA 2L9WA 1D1UA 5B09A 4WCEQ 1JIHA 4DSEA 2R7WA 1BY9A 1DTQB 4Y2AA 1TKDA 4M5DB 4WFZA 1FRJA 3DM2B 1NB7A 3ZZ0A 1S6PB 3H98A 3BDPA 2AQ4A 1MWYA 4OLOA 2ZFHA 1JX4A 2K7JA 2ZC4A 1NO8A 1C1CA 2IM2A 1DAXA 2ASJA 3RRHA 4GMKA 2DNKA 5GADU 2OPPA 4H4MB 3P6YC 4G1PA 3HZEA 2XS7A 1U1QA 5J1NA 4Q8EA 2ZVSA 4OJGA 1HBMB 5D3GB 4M63A 4PWDB 3NCRA 4KRWA 2VFRA 3V6DA 5IS2A 1FXLA 5LMUF 2Q6CA 3X1LB 2MY7A 2JFKA 4MIWA 2R2TA 3J80Y 4I2PA 4N47A 4M94A 4ZCMA 2AYMA 3TYTA 4ES2A 4JV2A 1IBKF 3QZ7A 1XMBA 5FLXY 1REVB 1GX5A 3W2WA 5IXUA 3M8PB 3R5DA 4C4WA 1X9WA 4HKQA 2VFUA 2M88A 1GTHA 1KQFB 2BANB 5LXRA 1HHTP 4FF2A 3O1LA 3OFHA 4WE1B 5U47A 1ZETA 2QMXA 2F3JA 4H4KC 2VL1A 3DLEA 2FJEB 1JLFA 2MQMA 3JSRA 4WK3A 2MXYA 4LSNA 1JKHB 2RH3A 1JLQA 2BE2A 4FYDA 3IRXA 2VFVA 2Q79A 3MMBB 5M2RA 3KG0A 1KSPA 4KO0B 4IR1A 2I38A 3TA0A 2OAUA 2K1RB 1YWXA 2JC1A 5C42B 2JEIA 2HVHA 3O3LA 5KT5A 3NS5A 4ZPVR 2UZAA 2C3UA 1T05B 1R8PA 5KFNA 5J2PB 2LA6A 2JC0A 3PW5A 3MMJA 4QR1A 3PKYA 3WDOA 2CRLA 4O3QA 3MF5A 5I42B 1N5YB 1S99A 1KS2A 1VQNS 4WJBA 3E2EA 1CEZA 4Y2MA 1HWUA 2VKRA 1S6UA 4C11B 3K58A 3P3DA 2V9WA 4H4KA 3RB6A 2N3OA 2L41A 1V9OA 2AX1A 3MUTP 5AE2A 2W7OA 1Y9OA 2QLXA 6FD1A 2NPFA 4A8WA 2QSWA 3R1HA 2OPRA 4RKUC 1KN6A 2KJVA 4ED0A 4CO5A 4F3MA 4ED8A 2XY6A 5B7WA 3VALA 2R7XA 3KWMA 3M9MB 3NS6A 5DG7A 2D9OA 3CD0A 1WACA 4QBUA 2KRBA 4OI4A 5DGAA 1MW7A 2XI2A 2NR0A 3BGRB 3GSDA 5GVQA 4QPXA 2JHEA 2MHNA 2JH3A 2KXNB 2UUAF 2E66A 1DARA 2VOPA 1WG5A 5GMKa 3U1LA 2YKOA 4O4GA 3DRPA 4I6WA 4CO1A 1U48A 3CDBA 1RTHB 3PZPA 5IQ6A 4F2SA 1TKTA 1HNXF 2ZH3A 1NEEA 1RT2B 4NOHA 1KNZA 3BS9A 1HNIB 1FKOA 3BB5A 4UY8T 1U1RA 5LSRA 1A6LA 1VBZA 4ECZA 3ENWA 4F25A 3OFEA 4ZPBA 4DEZA 1MMNA 2BRKA 5K14A 1F2GA 4XAKA 2ZH5A 1HMVA 2W25A 4PPDA 2M3DA 4ZOSA 1QSYA 4C8LA 3S7RA 2DGTA 2HFOA 5EDWA 4KTQA 2RS2A 1N33F 1J5EF 2DO4A 3BREA 3CSKA 1X0FA 1ZBTA 4I2QA 1RDRA 2J0XA 2YWHA 2K7KA 4OZ0A 4EO8A 2FPHX 1SL0A 1BQNB 3E01B 4WK1A 1NHVA 1JNRB 2R8KA 2GMHA 3POTA 3SCJE 4F02A 2DD8S 3DRYA 2DBBA 3ZZOA 4Q7AA 4G1IA 5HROA 3OXLA 4O3OA 1UVMA 3QO9B 1HBUA 4ZK7M 4DL3A 1RWUA 2R4FA 3CD6S 4ILRA 3D0GE 3NNCA 3KYLA 1W2BR 5HMWA 2VOOA 5B0BA 2QFJA 1WG4A 3PIOQ 1N5QA 3DRXA 2VA3A 2HVIA 5HI7A 3KLEA 1UAWA 3S8SA 2XWXA 1M5HA 2E5HA 1FRKA 1YBAA 2CVEA 4HTJA 2NREA 1RYSA 1EETA 3QIDA 2FGCA 5LSOA 3GIKA 3N0VA 4ID8A 1FRLA 3PO4A 4QYRA 2J9EA 4OV1A 2XY5A 4C0HA 5KFVA 4W92B 2MSSA 5C25A 1KHWA 2HQ3A 3D28A 2J6UA 5HN0A 4A8MP 5M2PA 1N4LA 3NMAA 4NYOA 2KB2A 3MUMP 2B5JB 1JLEA 1FRXA 2DNNA 2K3IA 2VBZA 4DSJA 5HQ8A 1X5TA 4N8OA 4UW2A 1JJ2R 2VG6B 1SXLA 2F8MA 4RBVA 2KT3A 3PW7A 1R0AB 3ENVA 1BC6A 1J5OB 3DDNA 4A48A 4FS2A 1C2PA 2IAJA 3K8WA 1SH0A 2NXUA 4C8NA 5KFPA 4G1QA 4URQU 4B9SA 4TQSA 1FK9A 2P9EA 4YHHF 1MROB 1RP5A 3WX4A 2HYIB 5A8KB 4LF9F 1FKPB 3FEZA 5F3ZA 5DQGA 3BQ0A 4F26A 3KFWX 3CCUS 5T7LB 4O3PA 3C46A 4X4QA 1TL1A 4KR0B 2XMUA 2NSBA 3I9V9 3N4WA 2ZNZA 3CXCR 5G4DA 3NNAA 4F3QA 4B9TA 2DGWA 4IOBA 4OFZA 4ZVEA 1FXDA 3QGIA 1KTVA 2MKHA 3MOJB 3MPYA 1GX6A 1YJVA 3DRSB 5FJ4A 2F9JA 1TL3B 3G86A 2QA2A 4Y2CA 2GO9A 5F8GA 4ECQA 4ECVA 4JOUA 1JLGA 1WEXA 4NZ7A 4TN2A 3HJFA 4B9NA 3DHWC 5K9FA 3IR5B 1S0NA 2LXFA 4ILLA 4NPOA 2HGNA 3NKYA 1O51A 4IYQA 2DNPA 1Y5NB 4PXCA 4R8UA 4QOTA 2EFNA 2CJAA 1PC4A 5DQHA 1JLCB 2D9PA 3R5BA 3RAXA 4LF4F 1Z1ZA 3V4IA 3VZIA 4ID5A 3CJ4A 4FNIA 4K5SA 4N56A 1TK8A 4ETZA 2ZHOA 4KHRA 2M52A 4NLVA 4HEA9 4OQJA 3Q8PB 3L7OA 2JZ5A 3NL0A 1X5PA 1D8ZA 3GFZA 3M05A 1S72S 4Y0FA 4KT0C 4IFVA 4C3KA 3TA2A 1YSJA 3OXGA 1QVGR 1U09A 3PRBA 3Q0AA 1UKUA 5BYRA 1WF1A 3RYLA 2LQJA 3AJ1A 4F3OA 1S76D 2ZDOA 3B8HA 2DJWA 3WBZA 4J9SA 3CC7S 2X51A 2DNOA 4DPOA 4I6YA 1QUVA 3PW0A 3CIZA 3M8QA 1SKWA 2XSJA 3GR0A 4X2BA 2RKIA 1S49A 1UFLA 5CYQB 4ED6A 4NZ0A 2HHQA 2CJQA 3RB0A 3E3XA 2AYEA 2MJUA 3FDSA 3OLAA 3AAWB 1FTCA 2DNZA 2YNFB 2HGMA 3DMJA 2BJEA 2I1RA 5CCMA 2EK1A 1UVIA 3CCTA 3I55S 1VLYA 5A0YB 3W3SA 1U1NA 4IG3A 4YB6A 1R8CA 4V19J 3F44A 2YX7A 1ZAXA 4YP3A 2HNDB 3RAMA 2VPZB 5IZHA 4QIVA 3KLFB 2D74B 3CUNA 3KMQA 4ATNA 3CCZA 4DUZF 4RWWA 2PFFB 5LJ5Y 3FNNA 3OVAA 1S77D 1RISA 5DM6Q 1RT4B 2DHXA 2M7SA 4MFBA 4TYAA 2XB2D 4RW6B 2V5HG 5HP1B 1P1LA 3UI3A 4E0DA 3BGLA 2W4CA 3LOUA 1XEZA 3QIPA 2UXCF 2U1AA 3DI6A 4TXSA 2ASLA 4IOCQ 3CCQS 2GJ2A 2Z4PA 5KFEA 2E9TA 3KK1A 1LW2A 2L48A 3LW5C 3C2PA 4DR4F 3BM7A 1OWXA 1A9NB 1AFIA 5I3UA 4ECXA 5KG4A 1C1CB 2FHOB 2MJNA 2XHWA 3FCHA 3B4DA 3MWBA 2KM8C 3HHLB 1X4BA 2LU1A 3OFGA 5GAEU 2ABYA 2WSCC 2MZ1A 4W90B 3EZUA 2OPPB 1ZM9A 4O44A 3K5MA 4GC6A 1YRXA 3SSQA 4DG1A 1CC8A 4EBDA 1M5VC 2ZH8A 2XCPA 3V6DB 1R7IA 3GV5B 3HHKA 2ZH2A 4C98A 4OZ1A 5KAKA 1KEKA 3M2RA 1U2RA 4FVCA 4I2PB 3GFHA 2XS2A 4JI3F 3U1MA 2MKKA 2V8GA 1Y5IB 4OX9F 3LP2A 3G71S 4H4OA 1S1WA 2IM1A 3W2WB 1QAYA 5JVGQ 2VBWA 2C3MA 2WB4A 5KFOA 4DF8A 2W24A 2DHSA 2KVIA 3FMBA 3CDWA 2LVWA 3G8TA 1KQGB 2D3ZA 2Z8QA 1HQEA 4GO5X 3DLEB 4C0OC 2Z2LA 2AU0A 5A2QY 4K4VA 1JLFB 2HVZA 2UV8G 1HD0A 4QYZJ 4AQYF 1NJYA 2PN6A 4LSNB 2RRBA 2PO4A 4CZCA 2ROPA 4DQPA 2EW9A 2R8HA 3IRXB 4DL4A 5IM0A 2B6AA 5L1KA 1VRUA 3TVZA 3CULA 2GQ2A 1N6QA 5D8HB 2GGPA 3HI9A 1N5VA 4NRTA 4RNHA 3OXFA 4USJC 2ZH1A 2IBOA 2XMMA 2B9WA 5KOWA 4OX8A 3UCGA 2ALZA 4DV4F 3SFUA 5D4LA 2FHKA 1AXQA 1LK7A 4RNMA 4B3OB 2MHEA 4Y6IA 2CFXA 4JV5F 3PEJA 4IH7A 2JRSA 4YY3F 2E9RX 2R9LA 4AXJA 1D0EA 2ZM6F 5DLFA 1T3OA 4B3TF 1DBDA 1VFJA 3GG0A 3GQCA 3VAGA 2BZ2A 5C24A 1FNOA 3CJ0A 4DR6F 4J9RA 1IKXA 1SI9A 5CQGA 5F41A 2R7RA 4ELUA 2O3DA 3GIMA 4YB7A 3FZBA 1FRMA 1W2IA 2OPRB 4OI1A 4DS4A 5KFXA 2YKQA 4WFYA 2VBYA 3A1YG 1SKRA 2ZHAA 1XMOF 2N4DA 4HI1A 4O3NA 5L9NA 3GWCA 1AW0A 3PJXA 3C3LA 3C8YA 2DH7A 4JI8F 1S9EB 5A8WB 4FXDA 2J9DA 1SJRA 2OMOA 3KLVA 1ZYQA 1Q82T 4LFBF 3AHPA 4O4GB 4URGA 4R0JA 3DRPB 3N5FA 2RNEA 2W8KA 4X4UA 2RF2A 4YUDA 5DQIA 4TU8A 2R2UA 2JLEA 4RUHA 4NLDA 3PX6A 4CI0B 3FSYA 1TAUA 3US5A 2HHWA 4CO4A 2HHTA 2JFDA 1FKOB 1LW0B 3MZIA 4NA3A 2XI3A 5IT9Y 4ECWA 3NNHA 3SCLE 4DS5A 2RDIA 3SXLA 5K14B 1HMVB 1FJGF 3H2LA 1RKIA 5L38A 2D7SA 1DRZA 1K1QA 4CQ1A 4NLWA 3TX8A 3PEHA 3IN5A 2VASA 1M0SA 3GZ7A 2WW8A 2VC0A 5GAEI 2WB1D 1NK5A 4I2QB 4USIA 2FJDB 1B64A 1KC8T 4WFXA 4IR9A 1WNEA 3B78A 2XG8A 3KMSA 3I6PA 3T5LA 7FDRA 1JLBB 1LOUA 2J76E 4I56A 5EGYA 4QWAA 3MHYA 3PNIA 2DGXA 3POTB 2XLIA 2EKYA 1SJFA