2RKIB

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with a triazole derived nnrti
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
424
structure length
402
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Triazole derivatives as non-nucleoside inhibitors of HIV-1 reverse transcriptase-structure-activity relationships and crystallographic analysis.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 reverse transcriptase (RT) p66
total genus 111
structure length 402
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2rkiB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rkiB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rkiB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rkiB04
3DRRA 1RYRA 1S0NA 5KFEA 2ASJA 3V81B 1HNIB 3BSAA 3I0RB 4NLXA 2OH2A 4F4YA 2B5JA 3KLGB 5F8HA 4IH6A 3Q8RB 3LAKA 3M9NB 3KLEA 5C5JA 3OLAA 3PR4A 4ED6A 2ALZA 2R8JA 2CJQA 1HQUA 2DPIA 3RB3A 2WOMA 3RBDA 1S1UB 1JIHA 1MU2B 3V6HA 2E9ZA 4ECVA 2IBKA 3C6TB 2AWZA 5J1EA 1S1VA 1J5OB 4PUOB 4IRDA 1IKXA 5C25A 3KLFB 2JC1A 4MKAA 3KK2B 3DLEA 1S1XA 3OL8A 1HMVA 4IR1A 1RT6A 2RF2A 4ZPBA 4J9SA 4O44B 1QE1A 2YNHA 4PQUA 4J9LA 2YNIB 3T1AA 2YKNB 5KFQA 1RTIA 2ILZA 4ZP9A 3H2LA 4TY9A 3NAIA 2GIRA 4J9KA 3CVKA 5KFHA 4MIBA 4EYHB 1S1WA 2HNZB 2IM0A 4Y34A 5HBMB 4FBTA 3MTKA 3DOKA 1JX4A 4TYBA 1EP4B 3OHAA 3ITHA 1S6QA 3G6YA 3I0SB 2FVQA 2R2UA 1TP7A 2R8IA 1LWEB 4RW6B 2D3UA 3DRPA 5EWGA 3MECB 2UVVA 4IDKA 1RT4B 2OPSA 4DEZA 3PR5B 1NHVA 2XI2A 3V6JA 2ZD1A 4ICLB 2AGPA 1ZETA 1W25A 1RA7A 2D7SA 1QAJA 2ILYA 4DG1A 3GIJA 3ICLA 1LW2B 4I2QB 4RW9A 4NLRA 4I2PA 4YR3A 2XGQA 4MFBA 5C42B 3DMJA 3KK1A 2YKMA 5F8LA 3H5YA 4ID5B 5KFBA 1TKTA 4NYZA 1VRTB 3FQLA 2FLLA 3JYTB 4NRUA 1HNVB 5KT6A 3V6KA 1LWFA 2F8EX 2GC8A 5KFZA 4QWEA 2HWIA 4ZHRB 5I42B 2AX1A 3EPGA 3LALA 4NLPA 3MFIA 4ED7A 1S49A 3TAMA 1IKWA 3V6DB 1T94A 4EBEA 1TQLA 3GIMA 3CJ3A 3MEEB 3QGHA 2IA6A 1RT5A 3RB4A 4JV2A 2XGPA 3V4IA 3LP2B 4JUZA 1DTQB 3I5CA 4J9NA 2I5JB 2AX0A 4XO0A 5F8GA 4IH5A 2OPQB 2AGQA 3H5SA 5D3GB 3H4BA 3CJ5A 1WNEA 4RW7A 1S1TA 4IG3B 1IM4A 3IRXB 3KHRA 4Y3CA 2R2TA 3MR6A 2RKIB 4DL5A 5KFLA 3LP0A 4IFYA 4MK9A 4K4YA 3I5AA 3VQSA 4ECWA 2AQ4A 1XR7A 1XR5A 2I1RA 5KFRA 3MR5A 1FK9B 1JLCA 1FKOB 5KG5A 4WFZA 2HMIA 5J2NB 2B43A 4NLQA 1RT3A 1R0AB 4MK7A 3H40A 4TQSA 1S9EB 3MEDA 4K50A 4G1QA 1T03B 3DRSB 3D5MA 1RTJB 2B6AB 4RU9A 1LW0A 5J2QB 4O3NA 4NLDA 4ZP6A 1RT1A 4WYWA 1RTHB 3GQCA 3IG1A 1IKVA 1LW0B 1RTJA 2B6AA 3DRSA 4G1QB 1T03A 3C6UA 5KG7A 1N5YA 2RDIA 1RA6A 3Q8SB 1R0AA 4ZPAA 3GV7B 1CSJA 2IM2A 2HMIB 4KB7A 1FKOA 4RW8B 4O3RA 4EYIB 2FVPA 2D3ZA 3FQKA 4NRTA 3UR0A 5DG9A 1TVRA 4TY8B 5KT2A 4IRKA 4EO8A 5DG7A 4IFYB 3LP0B 5KG6A 4RNFA 2C2RA 5J2MA 4NCGB 3PHEA 4IG3A 3KLHA 5D3GA 4YQWA 2OPQA 5EWEA 2W7OA 2I5JA 1K1QA 4H54A 2FLNA 4FS2A 4ED3A 3Q8PB 4ECSA 5DQHA 4KHMA 4WFXA 5DLGA 3KLVA 1IKWB 3TAMB 3V6DA 1ZTTA 3HVWA 3QYYA 2VA2A 1TKXB 1BQMB 1S6PB 5KT3A 5EUHA 1K1SA 4QW9A 3KHGA 2W8KA 4WYLA 4U7CA 1HNVA 4KKOA 3JYTA 1JKHA 4DL4A 1JXLA 4URQU 4RZRA 2AU0A 3FFIA 3ISNC 2WK4A 3BR9A 1RTDA 5KG2A 4MKBA 3ISND 4ID5A 3CJ0A 4IRCA 3CJ2A 4ZMMA 3DMJB 4MFBB 4DL7A 1S0MA 5KT5A 1RAJA 4H4OB 1LW2A 5EDWA 2W9AA 3KHLA 5C24B 4F4ZA 2BANA 4ECTA 4Y2AA 4NLTA 5KFJA 1BQNB 3UQSA 3LAMA 4NLUA 4XPEA 1RT4A 2OPSB 3G6XA 4DL6A 2AGOA 1IKYB 5DLFA 3H98A 5JUMA 3PW4A 3KMQA 1S6QB 4QPXA 3NMAA 3T5HA 1JLEA 2V9WA 3DOKB 1GX6A 5HBMA 4Q0BB 4Q8FA 4ZPCA 2HAIA 4QW8A 1RYSA 2BE2B 5KFSA 3QZ7A 3NGDA 4HKQA 1U09A 2C28A 3PW5A 2YNIA 3DYAA 4LQ9A 1QE1B 2YNHB 3N6LA 4O44A 4JV1A 2RF2B 4KHRA 3KK2A 4GC6A 3OL9A 5DGAA 1JLAB 1IKXB 5C25B 3KLFA 4PUOA 5JXSA 5J1EB 3H4DA 5L1LA 1Z4UA 3N6MA 3C6TA 3H5UA 3GILA 4HYKA 4Y2CA 3NBPB 1MU2A 1JLBA 1S1UA 1JLFA 2FVRA 3BSNA 3M9MB 2C22A 5I3UB 1HYSB 4ZPDA 2FJWA 5KFPA 4RNNA 2OPRA 2ASDA 3KLGA 2B5JB 1REVA 2J6SA 1T3NA 3I0RA 4RNHA 4EEYA 4NZ0A 1RT2A 2YNGA 3M8PA 2UVRA 1TV6B 2IMWP 3CJ4A 5KFUA 1JLQB 4J9QA 1HQEB 1TV6A 5J2PB 4O3QA 3M8PB 2C2EA 1RT2B 2YNGB 3LANA 2BQUA 4IG0A 4J9RA 1REVB 2WONB 2XI3A 3GV8B 4LQ3A 2FVCA 5KFTA 2OPRB 3Q8QB 3MFHA 1C0UB 4WXOA 2JEGA 2IM1A 5I3UA 1HYSA 3E01B 3SFUA 1JLFB 2HNDB 1JLBB 2WB4A 4URSA 3NBPA 2O5DA 4ED8A 2R8KA 3KK3A 3GIKA 4M95A 2XCPA 2OPPB 4QWDA 2BRLA 1JLAA 5KFDA 5DG8A 4RW4A 4WE1A 2WRMA 3DYAB 1C2PA 5KG1A 3HVTB 3BJYA 2BRKA 3QZ8A 4NLGA 3RB6A 2BE2A 3CDWA 5K14A 3JSMB 5L1IA 2FLPA 4FS1A 3T5KA 4Q0BA 2UVWA 3UPFA 1JLEB 4TLRA 4O3PA 3GYNA 1S4FA 4ZP8A 1NHUA 3DI6B 3KJVA 1VRUA 5KFVA 5F8IA 3T5LA 4WZMA 2VG6B 2R2RA 1IKYA 1KLMB 2JEIA 2R8GA 2VA3A 3M8QA 4ZVFA 3HVAA 4NLSA 4KO0B 1BQNA 4KFBA 5HLFA 2BANB 5C24A 2YNFB 4H4OA 4LSLA 3CWJA 4TYAA 4QWBA 1RT7A 4Q45A 2HNYB 5HP1B 4K4TA 4KE5A 2RDJA 3CIZA 4H4MA 1RTDB 3FFIB 2IAJA 2VG5B 1JKHB 4IFVB 4R5PB 4KKOB 4QWCA 3IS9A 1TL3B 4TXSA 4R0EA 3T5JA 1TKZB 5HROB 3KNAA 3DLGA 4ZVHA 4KSEB 1TL1A 1BQMA 1S6PA 5CYMA 1TKXA 3NKYA 4IOBA 3PW0A 1SV5B 1S0OA 4IR9A 4J9OA 4RNMA 3KOAA 4ZP7A 1EETA 3RB0A 5CYQB 5KFMA 2WCXA 3N6NA 1LWCA 2W7PA 4KV8A 4J9MA 4ED0A 4R8UB 1OS5A 4O4GA 1I6JA 2IJFA 1DLOA 3PW7A 3NL0A 2J6UA 2W8LA 3E51A 3DLKA 3KLHB 4NCGA 2IM3A 5J2MB 3G6VA 3SI8A 3H59A 3QLHB 2XWYA 1C0TB 2VG7A 5KFXA 5FDLA 5DQIA 4RNOA 1D0EA 2FJXA 5F8JA 1C1BB 1TVRB 4I7FA 4TY8A 3UDLA 3MR2A 1QAIA 2C2DA 3BGRA 4RW8A 4LSNB 1SH2A 2IJNA 3BQ1A 3QIPB 1N5YB 3C6UB 3NAHA 3PVXA 2XC9A 4IQXA 1RDRA 2IC3B 1IKVB 3MEGB 2W9CB 1N6QA 3IG1B 5T14A 3LP1A 1RTHA 4KAIA 1RT1B 3BQ2A 1SUQA 2WHOA 4X2BA 4K4WA 5KFIA 5F9NA 4QWAA 1FKPB 3RAXA 5J2QA 3FSIA 4B3OA 4IKAA 1S9EA 3MEDB 2J6TA 3KLIA 1RT3B 4PWDA 3IGNA 5J2NA 5L1KA 1S9GA 1JLCB 2W9BB 1FK9A 4MH8A 1JLGA 1GX5A 1NNDA 2XCAA 1D1UA 1S97A 4ZVGA 2ASLA 2RKIA 5DGBA 2ZE2B 3IRXA 1S1TB 4RW7B 4G3IA 4K4ZA 2ZE2A 5KG0A 3OL6A 4ECXA 3QGGA 5KFOA 1N48A 1DTQA 4J9PA 3LP2A 4YMEA 3V4IB 3OHBA 4MK8A 5KT7A 2UVUA 1RT5B 3MEEA 1JLGB 3MR3A 3EPIA 2W9BA 2BQ3A 4O4RA 1S9GB 3GIIA 1S9FA 3EZUA 5KG3A 4MIAA 3KLIB 1ZTWA 4PWDB 4ZHRA 5I42A 4FBUA 4DL3A 4B3OB 3CDUA 1LWFB 2R2SA 4F4WA 1FKPA 4ECRA 5KFAA 4K4XA 3TQ1A 1VRTA 1SUQB 5EWFA 3TVKA 3PW2A 1TKTB 3G86A 3LP1B 5KT4A 4U6PA 1N6QB 2EC0A 4K4VA 2YKMB 2IC3A 3MEGA 5C42A 3KK1B 3BSCA 2W9CA 4I2PB 5F8MA 2JEJA 4ED2A 5L9XA 4I2QA 4RW9B 4DG1B 3QIPA 2HWHA 4GC7A 2GIQA 1N4LA 4NLYA 4ECYA 4LSNA 3PJWA 2ZD1B 3BGRB 4ICLA 2UUTA 3CDEA 4RUCA 3OLBA 5DQGA 3D28A 3BSOA 4I7FB 4IDKB 4ECZA 1C1BA 1N56A 3MECA 3DRPB 4TQRA 1LWEA 4RW6A 5FDLB 2VG7B 1C0TA 3I0SA 4WFYA 3ITHB 3QLHA 4EBCA 1KHVA 1EP4A 3BREA 4TN2A 3DLKB 3BQ0A 1HARA 1DLOB 1S1WB 2HNZA 4O4GB 3QIDA 4R8UA 4KV8B 1LWCB 1RTIB 2YKNA 5KFNA 3DDKA 5CYQA 4PQUB 1EETB 1SV5A 1RT6B 1HMVB 5CYMB 1S1XB 3DLEB 1TL1B 3DLGB 2E9TA 2WTFA 1TKZA 1S1VB 5HROA 1J5OA 1TL3A 3IS9B 4OL8A 4Q44A 4Q43A 4YR0A 4IFVA 4R5PA 2VG5A 4JV0A 2IAJB 4NLVA 4H4MB 4IH7A 2WOMB 5HP1A 2JLEA 2HNYA 2FVSA 1SH3A 3M9OB 1HQUB 1RT7B 5KFCA 2BQRA 2YNFA 4LSLB 3GV5B 3KLEB 5HLFB 4KFBB 4KO0A 5KFGA 3T19A 3PJXA 5L1JA 3M8QB 4XPCA 1HNIA 2R8HA 4KBIA 3V81A 1KLMA 3SFGA 3OSNA 2VG6A 4EBDA 3DRRB 1VRUB 3DI6A 3KJVB 3IGVA 5KFFA 4ED1A 2ATLA 3OL7A 1T05A 3QGIA 3HKWA 2E9RX 3QO9B 2JEFA 4ECUA 1QUVA 3DM2A 5F9LA 4EO6A 4URGA 4DL2A 5K14B 3JSMA 5KFWA 5KFKA 4O3OA 3IN5A 1XR6A 3HVTA 4YR2A 1HPZA 3DOLA 2V0NA 1UWBB 4RUAA 2D41A 4WXWA 4NLWA 4RW4B 4WE1B 1DTTB 2QE5A 4Q8EA 3MF5A 4K4SA 4ZVEA 2OPPA 3KHHA 4WZQA 1C1CA 1MMLA 1C1CB 3KK3B 2UUWA 2FJVA 2V4QA 1S10A 4O3SA 2HNDA 1DTTA 3KMSA 3HHKA 2V4RA 3E01A 1SH0A 3I5BA 4F4XA 3PZPA 3RBEA 3OSPA 2JC0A 4F50A 2BR0A 1UWBA 1C0UA 1HPZB 3DOLB 4YP3A 4ECQA 2QV6A 4K4UA 1YVFA 2WONA 3CO9A 4IG0B 1S48A 5KG4A 3DM2B 3RAQA 2DPJA 2ZKUA 5KFYA 3FRZA 3QO9A 1HQEA 5J2PA 2CKWA 1JLQA 1T05B 5F8NA 3H5XA 4NLOA 4M94A 3FDSA 1KHWA
chains in the Genus database with same CATH superfamily
3DRRA 1SCJB 3L7PA 1S0NA 3TW0A 4B3TF 3CF5Q 3RUBL 3RYLA 3U02A 1KQKA 4OHVA 4B02A 2MKSA 1KOHA 3EMTA 1APSA 4RU2A 3Q8RB 1HQ2A 2A10A 1LFWA 2ALZA 2KZZA 2HQIA 3TVYA 1T3OA 3FCHA 3WQPA 3RB3A 4EFAC 1YHQS 3M6WA 1BHNA 5E41A 2R7WA 3CO0P 5DJBA 2DH8A 4IO1A 4IUFA 3FUYA 1P1LA 3BKFA 1VC5A 3HD2A 1ZM9A 5J1EA 3JXOA 4PUOB 4O0NA 4UT4A 1N0UA 2J7KA 2JC1A 1Q0NA 1VCTA 1WF1A 1S1XA 4LT6A 4MKAA 2CQBA 4KPCA 2LMIA 1U2RA 1KDNA 4ES1A 2YNIB 3T1AA 3CJRA 3DXSX 1WDTA 4ILRA 4ZP9A 2HHTA 3H2LA 1TL7B 1U1RA 1QUPA 4J9KA 3CVKA 1URNA 1HFEL 2VD3A 4B9NA 4ERDA 4HTJA 2NXJA 1S1WA 2QLJB 2IM0A 3D0GE 3DOKA 4TYBA 1EP4B 3UVJB 2AJ1A 1WKLA 3DHWC 2CJYB 4DR7J 3L7OA 2ASYA 3G6YA 1F1BB 1TP7A 3NS6A 3H20A 4RW6B 2AJ2A 4OI6A 5HO4A 1VJQA 2R8IA 1Q7YT 3M8RA 2LDYA 2OPSA 3I4PA 3DRXA 3V6JA 3OTCA 3PDNA 1RHJB 2JL9A 2M9KA 1U02A 1SXLA 1WACA 2YWGA 5CABA 2HRYA 3GIJA 3ICLA 4ELVA 2HLUA 4RPFA 2YQ3A 3GR1A 1YRTA 5F8LA 1CC7A 2GMLA 4KH1B 2HQCA 4ID5B 3SCKE 4NYZA 1UVKA 5KFBA 3FQLA 2G2OA 2NYHA 5GAGU 1N8RT 3JYTB 4WP8A 1HNVB 2QYCA 2FTRA 1LWFA 1WI6A 2MZ1A 3W7BA 2MEWA 4A47A 1TK8A 2HK2A 1AW0A 3LALA 1LV5A 4WTYA 4ED7A 4EBEA 3TAMA 3V6DB 2V5HG 2HHHJ 1MG7A 2WW4A 3GIMA 2WVBA 3CJ3A 2Y3YA 2VFUA 3QGHA 4LR7A 4USMA 3O6QA 3E3XA 1UMJA 2WW8A 1X60A 3C19A 2BX6A 2D69A 3KDNA 3O44A 4ZPVR 3TX0A 4A8OA 4DSKA 2HK3A 2KJVA 2GGPA 2I5JB 2AX0A 4XO0A 1SJRA 4IH5A 2OPQB 2AT1B 5D4NA 5E7OB 2DR8A 3WC2A 4WU2A 5IV4A 2VIHA 1IM4A 3OR2A 4YN3B 2X51A 4Y3CA 5LJ3Y 2R2TA 4DL5A 3PFOA 4A8SA 1PJ6A 5KFLA 1IR1A 2AIRB 4HT5A 5FD1A 4F7VA 1RSCA 1WORA 3HT3A 1D9DA 1XQIA 3I5AA 2XZDB 5ADZA 4WKRA 2DHSA 1RLDA 3MR5A 5A8KB 5HVHA 3W62A 2LXFA 3N0VA 4WFZA 2HMIA 2DNNA 4TU9A 1PILA 2JH3A 3VGSA 2B43A 4AYBD 4OV1A 4M5DA 2R7XA 4LF4J 3MEDA 1M90T 1UW4A 1QJHA 1RBLA 1LW0A 1HBNB 4ZJOA 1H73A 1FTRA 1S6UA 2CNNB 2U2FA 4UQGA 2EKYA 3W3SA 5AXKA 1LW0B 3MZIA 2PT0A 3GSIA 2B6AA 2OFHX 3DRSA 1N36F 5KG7A 2FGCA 3S01A 3PG9A 1VISA 2NXUA 1P1TA 3N28A 4Y2MA 4ZPAA 3Q8SB 1CSJA 1SBRA 3ADAC 2JWNA 2HMIB 3MM5A 4AQYF 3NNHA 2C2NA 2XMMA 5A8KA 2HG4A 2FVPA 2D3ZA 3AJ2A 1CLFA 3AJDA 2EFGA 2I9SA 1RWKB 1Y7PA 2L08A 3WX4A 2XMVA 3LWMA 5DG7A 4A8XA 2DNQA 5KG6A 2C2RA 2KTQA 4NCGB 2VBWA 2PN6A 2K1RB 4IG3A 4ED5A 1I5OB 2KH9A 5EWEA 2AEJA 3Q8UA 2I5JA 3P4UB 3SCIE 2F8HA 1B0TA 2M8HA 1ZM4A 4HDHA 3MUTP 2AZ3A 4PR6A 1CBKA 4ANDA 2RRBA 3GWCA 1XNQF 1VMBA 5CAAA 3KJQB 5DLGA 2GVZB 2OMLA 3TAMB 3V6DA 2XMTA 4DDFA 4U96A 3IWLA 1BQMB 3JB9k 4JI6J 1K1SA 1RBOB 2WSCC 4TLQA 5A2QY 4ZLNA 2YX4A 3IBWA 4CNZA 3PACA 1HNVA 1UA0A 4KKOA 1ZYQA 1G6BA 4QR1A 1RKIA 3BR9A 4NPOA 3VV2B 2AYGA 1Q81T 2R7SA 4NOHA 3RBZA 2FJDB 2M7SA 1KNZA 1GXTA 1YGYA 2W9AA 3KHLA 2H65B 5C24B 3VGUA 4ECTA 4Y2AA 4NLTA 1FRHA 5HMWA 2RAQA 5KFJA 3AQPA 4OLOA 1FFWB 4ZCKA 3TVZA 3EVWA 2OPSB 1X5OA 4RL1A 4DL6A 5I4MA 1IKYB 1S5ZA 2LQ5A 1K8AT 1NXIA 3AFGA 4P72A 5E2QA 1H38A 2VONA 3KMQA 1JWWA 4K5RA 1KN6A 4OI3A 1I51B 1Z1ZA 3PX0A 2XWXA 3LGMA 1JLEA 1FWPA 3UCZP 3DOKB 3ENQA 2EW9A 1HW8A 2FGOA 3AB2B 3JQKA 3UO0A 2Z57B 1RACB 3FVYA 2BE2B 4M5MA 5KFSA 5HVGA 3QZ7A 4GO5X 3WZ0A 4HKQA 1U8SA 3SEOA 3QT8A 4HL9A 1FXDA 2C2KB 4LQ9A 4WIQA 5D4OA 3IA0A 4NXMF 4JV1A 3BH7B 3OXFA 1T9VA 3PIOQ 4FKYA 1IBLJ 2WAQD 3ELHA 3CW2C 5DETA 4RUBA 4B3MF 3OL9A 1JLAB 1IKXB 1VQ5S 4PUOA 2CPDA 5J1EB 3NGKA 3H4DA 1IBKJ 2OTJS 4WPAA 5M2PA 4HEA9 4DR5J 2RQKA 5K8NA 4LF9J 2G0CA 1DQ9A 1ZPWX 2GQCA 2OD4A 3DDNA 2FVRA 1NHKL 1HD0A 1K47A 2VBXA 4BLGA 1FJEB 1H2TZ 1MMDA 2QIFA 3BGUA 4QIFA 1RWUA 1EJ7L 2UU9J 1WD6A 2UXCF 4NXMJ 2I6WA 2IY5B 4C0OC 2OAUA 4XIUA 3TAQA 5CZVA 3F56A 3RBXA 1T3NA 4KGKA 1V3ZA 4LREA 4CLFA 2ATCB 3B78A 2NS1B 4NZ0A 2V9KA 3W2VB 4EEYA 3HHLA 2UVRA 2C3MA 3CIMA 3KKFA 4PG7A 5FLXU 4X65F 4OZLA 1KVJA 1FFSB 1H72C 1HQEB 5J2PB 2DCLA 3HHLB 4Y6IA 3IM9A 3W2VA 2C2EA 2YNGB 2Y0SD 2K3KA 2H5JB 3IBFB 4OX9F 3O3LA 3TQEA 1SI9A 2XI3A 2QFJA 4A8QA 1BXNA 3G87A 2KYZA 4FXVA 4KPYA 3BKTA 2OPRB 3MFHA 4NYPA 1ZA2B 3TNVA 1M5HA 1ZBTA 4DV5F 2QSWA 2ZH4A 2RQMA 4QYRA 2WB4A 2IYGA 5JJBA 2VBZA 1LK7A 5BYRA 2GVDB 2XM3A 4FF4A 3MUVP 2O5DA 2DIVA 2NZCA 1WC3A 4R25A 3KK3A 5THWA 3GIKA 4Z37A 4UW2A 2OPPB 3VAJA 1JLAA 3QFHA 4CP5A 1WEXA 1RWOB 2UUCJ 3HPOA 1VBYA 1B0VA 4AUKA 4JI2J 2HHVA 1FE4A 3M8ZA 1V6HA 4BWMA 4Y2KA 5KG1A 1FJGF 3ZTRA 3OTBA 5A76A 2RRNA 3RB6A 2BE2A 5K14A 3JSMB 3QJPA 5L1IA 3CGIA 4GKJJ 1FI4A 2ABYA 2RB7A 1NCLA 4DX8H 5L46A 3CCQS 3CUNA 2UVWA 5ETMA 1JLEB 4ELTA 2V8PA 3G82B 3GYNA 1WI8A 2OEKA 3KTQA 1ZZFA 4HI1A 5B7WA 2UXBF 1EB0A 1VRUA 2B9XA 2CDQA 3P5BP 2P9GA 1X9SA 1BC6A 3CJTA 2DGUA 5A0YA 2YXLA 4ITSA 3THTA 4DR5F 1S57A 3DLBA 1U24A 3HVAA 4NLSA 2N7YA 4C11A 3R6LB 4ZITA 3T1HF 2UUAJ 4DR3F 5A6PA 5HLFA 4LRBA 2DNHA 5C24A 2VASA 3PFEA 4FYYB 4H4OA 4Q45A 4A8FA 4G6VB 5D4PA 2CQCA 3I9ZA 1LQ9A 2VL1A 3BR8A 3BBFA 4OYMA 1SVDA 5IS2A 4NA2A 4CYUA 1FRLA 4JI8J 1JKHB 4R5PB 4KH0B 4KKOB 4YB7A 4WFBQ 2HS3A 4F04B 4X4SA 1SC6A 5HROB 2E7VA 3T9NA 3TA2A 1BQMA 1RADB 4DF4A 3NKYA 1T8EA 2PEBA 3D6TB 1SV5B 3QRQA 2HZAA 2UUBF 2LXIA 5HATA 2VKZG 5GADI 4F2RA 4DV3J 2HPUA 4DPUA 2M4MA 3DKDA 2GX8A 3R5BA 2IHR1 4DPXA 4J9MA 4ED0A 4EZ9A 2IJFA 3HCXA 1SKRA 3PW7A 2XULA 3VZIA 2W8LA 2K1RA 3QSIA 4MAKA 1HWKA 5ETVA 2EPIA 2XWYA 3FZBA 1C0TB 1N88A 2DNRA 1B0PA 2FJXA 1YG0A 3Q8VA 2VHGA 1TVRB 3UDLA 4GO7X 1WKKA 1QAIA 2C2DA 4OIXA 4F3MA 5T7LB 3UNGC 3BQ1A 1U2CA 1M5VC 3QIPB 2MY8A 3TYTA 3HHLD 4PWWA 2DT9A 1X4BA 2MKCA 5BR8F 1CJVA 2H1YA 5K8OA 3THVA 1YWXA 2MQLA 2XC9A 3PVXA 1AFJA 5AE1A 2W9CB 6FD1A 3IG1B 2J0QD 3LP1A 2P5VA 5L39A 3K5LA 3CJ8A 4DCOB 4X2BA 4KIAA 4EI2A 5F9NA 1HBNA 1FKPB 1U6FA 4EMDA 3I32A 3ONQA 3A8EA 3SBMA 3FSIA 2DNGA 2BM0A 2N4CA 2ZJQQ 3MEDB 3CC2S 3KLIA 1J27A 4OYXA 4CRJA 2YPYA 2MQOA 2QLWA 2YWWA 2VOOA 1S9GA 3ULHA 4ZVOB 4NA1A 1GX5A 4UOHA 2HSEB 4OJGA 1NNDA 2RJZA 4OJ3A 2ZHOA 2NQPA 1D1UA 2KO1A 3W63A 2KFYA 4F0MA 4CLUA 3I55S 3DCAA 2ASLA 3MM9B 1ZS6A 2RH3A 5IFMA 2ZE2B 5D8HB 1M5KC 1Q7LB 4RWXA 2RE1A 3RG6A 3OTEA 4P73A 3OL6A 3T6BA 1N48A 2H3EB 1DTQA 1VBZA 3CD6S 3OHBA 4CLLA 2UVUA 1IBCB 5K9FA 2W2QP 3UE2A 2ZZMA 1KFDA 1LNQA 3PRVA 3NOGA 2J0WA 1PCAA 4PEOA 4USHA 4WK1A 4USUA 2W9BA 4C8KA 2ZJRQ 1NDKA 1NSAA 2ZOMA 5CCMA 2BKPA 4ZHRA 5I42A 4WFAQ 4FBUA 2H4YB 2DB1A 4AL5A 1H98A 4A8WA 1DRZA 5U47A 4WKYA 1CULB 1SQEA 1IWGA 2I0XA 3CD7A 4OX7A 4A46A 2BBEA 5CCLA 4K4XA 1GMWD 3OTOJ 2AF6A 3PW2A 1NUEA 4NXNJ 1YJNS 3MEGA 3BSCA 3OXGA 4I2PB 4OZNA 4ED2A 4I2QA 4RW9B 3A3PB 4DCJB 4DN9A 3JAMY 3HO1A 4B3SJ 3W5XA 4KT0C 2MQMA 3KG1A 4NLYA 4GC7A 4QQBA 1FERA 3BN4A 3PJWA 3BGRB 1SIZA 1WC1A 3CDEA 3OLBA 3KNGA 2DRAA 2FZCB 3D28A 1N56A 4C9DA 3MECA 2AYEA 3DRPB 3B4DA 4RW6A 2Z4PA 3GZ7A 2WB1D 2VG7B 3JTOA 1YITS 2XMKA 4XTTA 4I0WA 1FDAA 3UVJA 1EP4A 3JSBA 2QL7B 1YDLA 4TN2A 4CLYA 2OD6A 3BQ0A 3S6EA 2C2ZB 5ETLA 4I69A 2OIHA 2HNZA 3PYDA 3QIDA 3WX8A 2LECA 2V63A 3C15A 3HSDA 4R8UA 2NCKL 2GNKA 4DUTA 1LWCB 2LQ9A 4LFBJ 2YKNA 3D1OA 5KFNA 1FF2A 4LF8J 2YX7A 4LIWA 5A2QU 5DDOC 4JYAF 2FHJD 2DEIA 1CJUA 1ICEB 3MI7X 2MMYA 5CYMB 1S1XB 4V19J 1TL1B 3EICA 1PG5B 1C4CA 1TKZA 1HBOA 1R0BG 3I9V9 4ER8A 3KG4A 4Q44A 4Q43A 4DUYF 3PY8A 1WSRA 2GO9A 5CD4H 2VG5A 1UJ6A 1WOOA 2ZDPA 2NREA 4X66J 4ANCA 5B0DA 3PO4A 1FWLA 3NS7B 2Q6BA 3OFFA 4IH7A 5DRKA 3CTRA 5HP1A 1YJRA 2FVSA 2ZITA 4QJVA 4RJVA 3BN7A 5M2RA 2P6TA 3UFCX 3HJVA 5DDPC 5KFCA 1ZAXA 3CJKA 2RQ4A 2BUNA 3HFVA 3NCRA 2XTJP 3KLEB 4WJBA 3GV5B 1DQAA 3D3CJ 4KFBB 1PYOB 3K58A 1W2IA 3MM7B 2YKOA 2Y0BB 4WCEQ 3DN9A 3DGPA 3O8WA 3OSNA 4EBDA 2VG6A 3W61A 3DRRB 1J5EJ 2UXDF 3VVTA 4P74A 3DI6A 5KFFA 1D9FA 1T7PA 3QT5A 2MXYA 2E9RX 1U1KA 2CQIA 2HKEA 4M5IA 4OI1A 1B3TA 2FY8A 2PDAA 1RI7A 3IFEA 1RQ0A 4F0HA 3UD4P 1RZMA 1RB0A 3N01A 4X4OA 1KEKA 5KFWA 2DNKA 3SQGA 5E0OA 2HQ3A 2XLKA 1XR6A 1OPZA 2FZGB 5E3RA 4GKKJ 2HHSA 3MMAA 3HVTA 1S76D 1IVZA 1RHUB 2F5GA 2N82B 1UWBB 3MCMA 4PG6A 1RP5A 3HHNB 3KJNB 1P6TA 2Y9HA 1XEZA 2FHMA 2YKQA 2F1FA 3GB0A 3K7RA 4CT8A 4LF6F 1KWMA 3MF5A 1Y3KA 4DJBA 4F2SA 1GTHA 2EKNA 3GIRA 3GONA 4ANEA 4WZQA 1MMLA 1WG5A 3QWUA 4OI2A 2KVQE 3POTA 3TOQA 5HMXA 4DFKA 4F4AA 5IOLA 4YB6A 3CCUS 4IOAQ 1H7WA 2JFKA 3M6XA 3I5BA 5LL6d 1WKJA 2CA9A 4PRFA 1WELA 2JC0A 2HFSA 4KC5A 4HHUA 3TJAA 3ZZPA 2AP6A 3HMJG 3T1YF 2MPUA 3OFEA 4U67Q 2HVHA 1F9FA 2VU5A 2MHNA 3D66A 4USTA 1YVFA 1URRA 4N7TA 5LXRA 3OJSA 1NLKL 4B3TJ 1CPZA 1PC5A 3R5DA 4LRCA 4A8KA 1S48A 3DM2B 3UD5A 1N5VA 3T41A 2KG1A 4HHJA 1PIEA 3GJSB 2KG0A 3SV4A 3BBCA 1LWXA 3H5XA 3FRYA 2CQPA 2RUGA 2HHWA 1KHWA 1CQNA 1Q82T 2R3VA 4NZ6A 2DXEA 5K8PA 1GFWB 4LRFA 3M6UA 1ACMB 2ASJA 3K17A 1HNIB 4DUZF 3I0RB 2W25A 2ZZTA 2OH2A 2B5JA 5F8HA 3H0PA 1YK9A 3CCWA 4ZLJA 1PJ5A 3LAKA 1NKEA 2HVZA 1HNWF 2R8JA 1IM6A 4GMKA 4M5NA 4JI1J 2DPIA 2UU9F 2FJEB 3BO3A 3EVOA 3PIPQ 1VRQC 1NH7A 2ADBA 3HDSA 4DV2J 4WIIA 1MU2B 5HQ8A 2A6MA 3TP2A 4ECVA 4V19X 2DGSA 3C6TB 2BJ1A 4N8NA 3GSDA 4Z7YA 2J0SD 3UDEA 1S1VA 1FT8A 1S59A 2KHCA 3KLFB 2H5IB 3KUHA 3HHLC 3TR5A 3DLEA 1NMEB 1HMVA 1D09B 1TU0B 1RT6A 2RF2A 1RE1B 3M30B 4LFCF 3OUYA 4U7UD 1SL1A 1FRMA 4AT1B 2DNMA 5KFQA 1VQKS 5K5MA 3TEHB 3MHYA 1JJHA 4FKXA 3W9HA 3CCSS 4DQRA 1VQMS 4YY3J 1JXVA 2FY1A 4U9RA 3CCVS 5A8RB 3NGUA 2CFXA 1XMQJ 4YFUA 3L95X 4F8RA 2Y1RI 1PBAA 2XB2D 3TUPA 2QG9B 2WVCA 2XSJB 5T41A 3TWZA 4P10A 4ICLB 3W64A 2AGPA 4N76A 2G0IA 1RA7A 3D67A 5LSRA 4DG1A 1X5TA 2FB0A 1R0CB 1SJ1A 1A0OB 2FC9A 1V3RA 3EZ5A 1NK8A 3ZTPA 2XGQA 5C42B 3DMJA 3KK1A 2YKMA 2DH7A 3AB4B 4K8RA 4DXLA 2DVIA 3DLLQ 4CI0B 1TKTA 1HL6A 4ED4A 3CEDA 1VRTB 4YUDA 3THPA 1RISA 4C3LA 2FLLA 3N4WA 4DV3F 2UZAA 3MMBA 5HMZA 5KT6A 3T6JA 3V6KA 2F8EX 2LU2A 3R2CJ 2LDIA 2WBRA 2XS2A 1K0TA 1FX4A 1HBUA 3EPGA 1HHQA 1UJ4A 1RHQB 4GRSA 3QT7A 5G4DA 3BO2A 2MZJA 2DGTA 1I1GA 2QLFB 3MEEB 2Y8WA 3L7UA 3T1HJ 1RT5A 3RB4A 3EXYA 1VHFA 3R7BB 1E6YA 3LP2B 2MKYA 3OQ2A 4J9NA 1RAOA 2VB6A 3B4MA 4QR2A 1FJCA 2AGQA 4WBFA 2UXBJ 5D3GB 3F41A 4CTAB 3H4BA 1S1TA 2I2YA 4C97A 1XIQA 2HFVA 2FUG9 5CZXA 4X64F 1YJTA 5MAOA 3PV8A 2F40A 4ECWA 2DK2A 2XY7A 1XR7A 1Y9OA 5KFRA 3PYFA 4I64A 1FK9B 1JLCA 3MM8A 5KG5A 3MCNA 5EX0A 2AGOA 3QJJA 3RRHA 3R3TA 2ZBPA 1RT3A 1R0AB 2PD1A 4MK7A 2N3OA 3DU6A 2CPJA 4TQSA 1T9WA 3H40A 2R7OA 2F9JA 2QEXS 2ZZNA 3U27A 4K50A 1N32J 1JK9B 3A8JA 4OYBA 1GQEA 4JYAJ 1FNOA 1WC5A 2HBYB 2IDEA 3QRPA 2KN4A 1H2VZ 4DL0C 5LMUF 4IYQA 1RTHB 2NSCA 2CIMA 4A8MP 3DLJA 1RTJA 1DBDA 2YWHA 4CLTA 4DUZJ 1OYDA 4DQIA 2EFNA 5IWAJ 2XMAA 3JTPA 2RDIA 3ENVA 1R0AA 1VHIA 4Q7AA 1R8AA 2E1RA 1AT1B 4NA3A 3K59A 3JSYA 2AZ1A 3QRRA 2DIUA 5FJ4A 1FKOA 1PYSB 5D0HA 4EYIB 3QMQA 4UZCA 3UR0A 3NLCA 5DG9A 2ZH1A 2DNZA 5DZ7A 1NM2A 2ZNZA 4IRKA 4USWA 3SSSA 4M5GA 4EO8A 1SJQA 4IFYB 1FTCA 1YJUA 3C14A 2WSFC 4P75A 1MN7A 5DS7A 5J2MA 4RNFA 2EFVA 3KLHA 2C3PA 5D3GA 1M1GA 2H51B 4CTAA 2ZH9A 4KJIA 3IRWP 4ED3A 2EXUA 4ID8A 1AUDA 3GMGA 2CG4A 2CPFA 3PXGa 4ECSA 3UN3A 4WFXA 3K57A 3IO1A 3TZZA 3QYYA 5A8WA 1PGZA 2CADA 5B0FA 5EUHA 4QW9A 1DQ8A 2QTWA 3IR5B 1H3DA 3KHGA 2W8KA 4WYLA 1HA1A 3VZHA 1JXLA 1YLXA 3D6FB 3M1VA 4DL4A 4URQU 2HEKA 4I68A 3LW5C 4MKBA 5IQQA 3ISND 2Q66A 3GFHA 3X1LB 4ZMMA 3RR8A 1QDUB 3HZGA 4MFBB 3CMAS 2HYIB 3LQVA 4FVCA 1S0MA 1HLWA 1RAJA 4PPDA 4PXBA 4DUYJ 1NAQA 1Q1KA 3M05A 1NDLA 4F4ZA 2BANA 3AH6A 4LF7J 2QMXA 5LMNJ 4I56A 4K0KF 4P7VA 3UN2A 4YDXA 2WSEC 5DM6Q 4XPEA 1UVNA 3G6XA 3NNAA 2F4VJ 1GMUA 2E1PA 4M5HA 2F4VF 5M2UA 5A8RA 2EK1A 1S6QB 4QPXA 2B56A 3L9ZA 4Y00A 2QA4G 4LF8F 4EK2A 5HBMA 4Q8FA 1YZ6A 3HLUA 4ZPCA 4QW8A 2NUHA 3ILOA 4LFAJ 1HWLA 1SJFA 1Q53A 2V2ZA 2ZOGA 4FYVB 2B4OA 3CCMS 1IXKA 2B9WA 3T9ZA 2BJEA 1NJIT 4USIA 1H7XA 1U09A 3LO3A 4WP9A 1SC1B 1HWIA 2XEXA 5BXIA 3GJQB 3MAQA 1R43A 3N5BA 1FKAF 1CVJA 3K5MA 1WHXA 1M1KT 4O44A 5C2GA 1HIYA 3PM9A 1G2EA 2RF2B 3M8YA 4KHRA 5D0RA 4BWJA 4JI4F 3G8TA 4L3KA 3K89A 3Q2TC 5DGAA 5C25B 5JXSA 2AJ0A 2E5JA 3JQJA 1R8HA 1EX8A 1NB2A 4HVZA 3C6TA 3EM1A 2BE7D 3H5UA 4C0BA 4KTQA 1A9NB 3O5TB 3NBPB 4Y2CA 1QD1A 1U1MA 2EFQA 1FWKA 2PMWA 1RJJA 5BYQA 2DNPA 3VGTA 5KOXA 2Z2YB 2C22A 1S99A 1Z2LA 2BJDA 2EWHA 3D1HA 4OZJA 2FJWA 4XDCA 1BY9A 1CG2A 1NK4A 4KGXB 1X0PA 1O6XA 3AY0A 1VQ7S 1RWPB 2QZ8A 2NXEA 4W4MA 1AXQA 3I0RA 3QNWB 1WF2A 1N32F 1A6LA 1VYAA 5H9EK 1RT2A 1AYEA 3M8PA 5CH7B 1TV6B 4LR8A 3K0JA 5D77A 2IMWP 2XG8A 1LFPA 1JLQB 3MEKA 1NDPA 3NRBA 4FP9A 4HTIA 4J9QA 4FN5A 1TR0A 4DV5J 2KXFA 3MCSA 3VTIA 4QU7A 3HP6A 2K7JA 1HD1A 2CWKA 3PO5A 5ETTA 2HGNA 4DZDA 1WG4A 3GV8B 4XDDA 2FVCA 3KXDA 1VGYA 4LQ3A 2RNEA 1TK5A 4JI3F 2AV5A 3SQOP 4WXOA 3M8SA 1QTNB 1NEEA 3MTJA 1JLFB 1JLBB 3MOJB 2QGFB 4HH0A 3WBZA 2QMUB 1T02A 4J37A 2QMWA 1J5EF 4R0JA 5K8MA 4ED8A 4CIOA 2G2YA 3IM8A 1GXLA 3G8SA 2GAGC 1NJZA 5F3TA 1SIWB 3TUJC 2CZVC 5HVFA 3W8PA 2G9OA 2DHXA 2MKHA 4M5JA 1TUWA 4D3GA 2A2DA 5CYJA 3Q0AA 4NX9A 1C2PA 3OT9A 3HVTB 2W7AA 3QQCD 3PX6A 4X62F 2G4BA 3QZ8A 4JI1F 2G1HA 4DV7F 2V6AA 3CDWA 2JJ4D 2ZBRA 1XMOF 2MQQA 3CT9A 1VC0A 1UEVA 2DR7A 5GAEI 5HSPA 4UOCA 3OJUA 3AOBA 5K20B 1S4FA 1NJWA 4LRDA 2K7KA 1WEYA 2B3TB 4MMOA 3DI6B 5KFVA 3T5LA 4AL7A 1UFWA 5CA5A 2CJKA 3U1NA 2VG6B 2JX2A 1K9MT 2MZSA 4BBYA 2R8GA 2HBZB 3Q23A 1IJEB 3MPUB 3MM7A 1SJ3P 4KO0B 3RU0A 4KFBA 1OSDA 2NSBA 3D3BJ 4F0KA 2DJWA 3K8VA 4QWBA 3CWJA 1RT7A 1U45A 1L5UA 2FHOB 3BPSP 2HNYB 1RCOB 5HP1B 1YRUA 1W26A 4LBIA 3UW1A 4K4TA 4DFMA 3TA1A 3CIZA 1RTDB 1CJKA 2VH7A 1AUSL 2BW7A 3WIUA 2VG5B 1XK8A 4IFVB 3AJ1A 3DOMB 3Q22A 2CQ0A 4TXSA 3T5JA 2ROGA 4AE5A 3PW0A 4KSEB 2V8HA 4IOBA 5CYMA 1TKXA 1S0OA 4N56A 5A8WB 1CJUB 3ZZRA 5HL7Q 3G4SS 4J9OA 2RILA 1EETA 3PNIA 5D15A 3RB0A 4MIWA 5ETOA 1M0SA 5KFMA 2LA4A 3VALA 1LWCA 3NS5A 5F3ZA 5IZHA 2CDRB 2W7PA 1U1QA 1FRKA 4CO3A 4RUHA 3OV7A 1QVFR 5HQLA 2LEAA 3C15B 1RWXB 3ZZTA 3NL0A 4ILMA 3CXCR 2J6UA 1TUVA 2CPEA 1NZAA 4UOGA 5J2MB 3MURP 1JXEA 5G0RB 3V5RA 4RNOA 1D0EA 4C98A 1SC3B 1VQYA 4YB5A 5F8JA 4TY8A 4ZVSB 3PX4A 2ZNYA 3BGRA 4RW8A 3ET6A 1SH2A 2CPIA 4EWTA 2IJNA 2Z2ZA 3GFZA 2DXDA 3C6UB 1D8ZA 4ZDNA 3B82A 4IQXA 1RUSA 3AXKA 2KHDA 3MEGB 1UPMB 1HR0F 1N6QA 5T14A 1LKZA 2R7UA 4CO4A 4YOEA 1R6VA 1SUQA 1FNMA 1RWWB 3RAXA 4QWAA 3EE3A 3ILLA 4C48A 2OLWA 2Y1JA 4L74A 4Z2XA 1U6ZA 2VFRA 1S72S 2X1FA 2E44A 5HJXA 5KAKA 2J6TA 2KKHA 4B9MA 3MXHP 2GZOA 3P96A 3CULA 4ZPWR 5IXUA 2KRRA 2W9BB 4MH8A 4YHHJ 1JLGA 1OPIA 2ZBQA 3FEZA 3D2WA 3I87A 1X8DA 2OJ3A 1DZ5A 3IAM9 3N79A 3H2UB 4LJMA 4ZVGA 2R9LA 5ETPA 5DGBA 3I56S 4FF2A 4AFFA 4FXWA 1S1TB 4RW7B 5FLXY 2ZE2A 4S0MA 5KFOA 4QYZJ 2IYIA 5ETSA 3LP2A 4J5OA 2J9CA 3HF5A 2E5IA 4Q2LA 2Z2LA 4YMEA 4V1Ak 4DPYA 2HFNA 1RT5B 3LA0A 4LIRA 5KT7A 1UZDA 2ZC3A 3IAS9 1S9GB 1KP6A 5CD4A 3VAMA 4DHVA 1ZTWA 4PWDB 2W2PP 2UUBJ 4FF3A 1ITPA 1GAOA 1KS2A 4B3OB 2GAHC 3C46A 1NK0A 1ZOTA 3MMBB 4F4WA 1UFLA 1FKPA 4ECRA 2DXFA 1N5QA 3TJ9A 1VRTA 3TQ1A 2EC0A 1TKTB 5KT4A 4U6PA 4K4VA 4C4WA 3NP5A 2IC3A 5C42A 3KK1B 3WC0A 2VC1A 2HIQA 2MYFA 2V94A 3FCVA 5F8MA 1U0HA 1AZSA 1NJXA 1BWVA 3ETMA 4OYOA 3QIPA 1EHWA 3ZZ0A 2HWHA 1BQXA 2FYXA 2KYXA 3AXMA 1RYRA 4YB1P 4ICLA 3D0HE 3BSOA 4C8LA 1F3FA 4I7FB 2IPOB 2IRYA 1C1BA 1SKWA 1KKHA 1FHTA 3DGVA 3DFEA 4DR2J 4I67A 1C0TA 3I0SA 2MKKA 4EBCA 1VLOA 2KDOA 2VDIA 4QIEA 3G9CA 1KHVA 5HK4A 2P9CA 2RVJA 4F4KA 2BJ9A 2LVWA 3OFGA 1HARA 4DR4F 3AOAA 3ZZYA 1RAIB 1UPPA 3QGPA 1GXUA 2M3DA 3P3DA 1XNRJ 4A8YA 1OYEA 2XS5A 1JQGA 1YJ7A 4PQUB 1C4AA 1QLNA 3CJQA 1HBMB 5C7PA 3M4XA 1UA1A 1DAXA 1NPRA 2O1PA 1SV5A 2QLBB 1SPBP 2QYGA 1HMVB 3AODA 3M30A 4XAKA 4ZOSA 2VDHA 3C2PA 2W01A 2E9TA 4UY8T 5HROA 1J5OA 3OFHA 7AT1B 2QN6B 1TL3A 2W2NP 4RBTA 3TJ8A 2CRLA 4YR0A 2ZH2A 4R5PA 2E29A 3EGWB 1KQSR 2IAJB 1RBAA 2JOQA 2C2OB 3W5ZA 4CYUB 4NLVA 1NO8A 3CCTA 4PXEA 2SXLA 3CB4A 1MMNA 2CQ1A 3QATA 2XQCA 1FJGJ 1N0VC 4FZVA 3P6YC 3TANA 2BQRA 4F25A 1H2UX 1EIYB 2CJXB 4DX6A 3PHTA 2BKNA 2NXCA 5AXMA 1IBMF 1RAGB 4C11B 2PFFB 2LLZA 2CQHA 2M0GB 3PJXA 3FK4A 4OZ1A 4ZJLA 5IT9Y 1HNIA 2R8HA 1U1LA 2GMHA 4DSLA 2YBVA 5A0YB 3HVRA 1TFYA 3G6ES 1VRUB 3SV3A 4N41A 4ED1A 3A4TA 2XMWA 4C8NA 2IFXA 2ATLA 1T05A 4JI5J 3QGIA 1BUXA 2HURA 2HZCA 3A3NB 1QUVA 3GTYX 1MWYA 4NYOA 5ETQA 4OYAA 5E3CA 4DPOA 5E3AA 5J1PA 2FD2A 2P8IA 4O3OA 3R97A 3FKBA 4C2MA 2YVSA 5KFKA 3OTOF 4DFPA 2QA2A 4ZVRB 2CWXA 4LFCJ 2V0NA 3ZNJ1 1Q8IA 1OQ6A 2D41A 3RW7A 5JMNA 2MGZB 3SZ2A 4ZN1A 4RW4B 4USKA 3M2VB 1DTTB 4W92B 3RZAA 3S1TA 2W2MP 2E7WA 1TZ0A 1C1CA 2V4QA 1YBAA 3CMES 1V9OA 4JI0F 3H2VE 2HRUA 4P6QA 1WUUA 2H9ZA 1HI1A 4E98A 1S10A 4O3SA 1G1XA 2DGXA 1GEHA 3SXLA 3HHKA 2AJQA 1SH0A 2BR0A 1OQ3A 3PZPA 1W2BR 1CJTA 2B4VA 2CNKB 3D4JA 2EG1A 3MPYA 1UWBA 4ETXA 4ZKAA 3DOLB 1GTEA 3HHDA 4YP3A 2DRBA 3FBEA 3MMAB 2QV6A 3BYRA 3ZTQA 3EGZA 1KTQA 3NOCA 3CO9A 4IG0B 3HSJA 4F3OA 3RAQA 1WDDA 4HACB 2LKZA 2DR6A 3FRZA 1R8BA 8RUCA 4CLZA 5D0EA 3UCGA 2YWEA 3IN5A 2WBMA 2QC3A 3FDSA 2NPIA 4PG4A 1UVMA 1F60B 4FYXB 4KGZB 1I94F 5KFEA 2XHWA 3DGPB 1Q95G 3LOUA 3UI3A 1IBMJ 1D9AA 4NLXA 4DQPA 3NCQA 4RX6A 3BYPA 1AA1B 2X7IA 3IMQJ 4IH6A 4QIWD 2FZKB 4MKVA 3KLEA 1F9HA 4M5KA 3PR4A 3OLAA 2R7RA 2CJQA 2WOMA 1LEOA 2FDNA 1N5SA 1IR2A 2COLA 2H5EA 3RBDA 1UL3A 4JI2F 1SKUB 2R7VA 2IBKA 3PYGA 2Q79A 4WTOB 5D78A 2Q1LA 4IRDA 3QAEA 1IKXA 3EXCX 2RS2A 2L41A 2XY6A 2ERRA 4IR1A 1I3OB 4F02A 4J9SA 4DR1F 2DNYA 2KL8A 4DOZA 1YIJS 1F5CA 2YNHA 1KR4A 2MKJA 2XSFA 4J9LA 4LF6J 4TU7A 2EC2A 5LOQA 1UVLA 2YKNB 5BYSA 4Y28C 4M8LA 4CLPA 3GYXB 1N5TA 4FPIA 1F5BA 3VVUA 3R5AA 4GVLA 5KFHA 1YBUA 3EDRB 2G0JA 2J9DE 4LRAA 3W8GA 2HNZB 4EYHB 1T9TA 4Y34A 1U47A 4LF7F 2UXCJ 1XTZA 3MTKA 2YTCA 1R89A 4PQAA 5ETNA 2XYGB 1O8BA 1OY8A 1Y5NB 2FIUA 3TA0A 3ITHA 2VPXB 5AT1B 4UY85 2FVQA 2R2UA 2B4UA 2DHHA 3K2YA 1S77D 4RO0A 2D3UA 3DRPA 2PFDA 3MECB 2QX0A 1NK7A 1P9YA 5A6WA 6FDRA 5H9FJ 4DEZA 2ZVIA 3FC9A 2ZD1A 4PAAA 4LFAF 1U4BA 1W25A 3PEJA 4P7TA 1M5OC 2OKQA 1QAJA 2ILYA 2MZQA 2WZ1A 2E5HA 1QSSA 1HKAA 1LW2B 4I2QB 4RW9A 2CYYA 4NLRA 3W65A 4DQQA 4I2PA 4YR3A 1ZZNA 2C3UA 2J7WA 4EU0A 4N77A 2M2BA 4JI7F 4OZ2A 1KQFB 3BPDA 3PKMA 1UZHA 1PKUA 1Y10A 2H54B 1CULA 1IWAA 2HHPA 2LQJA 4UOFA 4X84A 4DPWA 4X66F 1U2FA 2GC8A 2WVFA 4QOTA 1UCNA 2VPWB 4QWEA 3KJFB 3F73A 4ZHRB 5I42B 1P27B 3C16A 3SCJE 1NK9A 4LBPA 1Y11A 4NLPA 2N3LA 3MFIA 4LF5F 1DARA 1S49A 2ZM6J 1T94A 1RHKB 2Q43A 3J7A1 1L3TA 1MSWD 4I1TA 1KLNA 2LXUA 4L75A 3A13A 2XGPA 2VQEJ 3CCRS 1DTQB 1RWMB 2MLXA 3BB5A 3I5CA 2FJBB 2HQGA 5F8GA 2Z30B 3DC2A 3HFZB 2V8VA 3CJ5A 3R6GB 4IG3B 1FESA 2MZRA 4Y0FA 1MN9A 3MM9A 3MR6A 2FPHX 3LP0A 1H0HB 1PAUB 2QL5B 3VQSA 2VJVA 1Y5IB 3CCLS 4DX5A 1XR5A 2X1BA 2ZFHA 3B8HA 4Z7CA 1HI0P 5HJYA 4DV6J 3MM5B 2DGQA 4K5SA 1Q79A 1OY9A 1HHTP 3ENWA 4OYZA 2EBEA 2AMCB 3DRSB 3D5MA 2B6AB 1KONA 4C3KA 2V67A 3KUEA 2OSRA 1RT1A 1F6TA 4P71A 3IG1A 4N5SA 9RUBA 1IKVA 2U1AA 3KWMA 4W90B 2VFVA 4RKUC 1M5PC 2KFZA 3OPKA 3HJFA 1VQ4S 3R1LA 1N5YA 3R5GA 5DO2A 4ZS6A 4X4UA 2IM2A 3FSYA 5T7LA 4DLEA 2IIHA 1ULRA 2A0FB 2HHXA 3FQKA 2B51A 1TVRA 1FRXA 3SYZA 3P49B 3LGHA 2W4PA 2BKOA 2LEBA 1XNQJ 3LP0B 3GFYA 1T11A 3A3OB 2HHUA 4C8MA 2D1CA 2I8EA 3OR2B 5LSOA 3J7Z5 4I6WA 1VQPS 1JJ4A 2OPQA 1K1QA 2HS0A 4PYAA 2GGPB 2D3O1 4OI4A 2HAFA 3NGTA 3U1LA 1YTYA 4CH7A 1YI2S 3H7HB 1FEEA 3HVWA 2VA2A 3QFWA 4A4JA 3V2UC 4OX6A 3N9UC 1EARA 3MAAA 2BM1A 5FIIA 3JYTA 1JKHA 2HS4A 3LF0A 3OVSA 2HLTA 2NXNA 4ALZA 4NASA 3FFIA 3ISNC 4WFNQ 4RZRA 5KG2A 4ID5A 3CJ0A 1XWLA 4IRCA 4ZCIA 2B4PA 1U25A 4CO2A 2EI5A 3BGOP 3PTWA 5KT5A 4H4OB 1LW2A 1A7GE 4YEAA 3DDIA 1MWZA 1ZM2A 4OX9J 1FO1A 1BQNB 3UQSA 3LAMA 3IP0A 4M63A 4NLUA 1KFSA 4NCBA 2VJUA 4UQTA 2CXEA 3C66A 3CNQP 1XMQF 3U7JA 5DLFA 2RIJA 2E1AA 4P2XA 3H98A 1F3VA 3PW4A 2PEHA 1FX2A 3QWPA 3G82A 2BV3A 3DHXA 3H42A 3T5HA 3NMAA 1PYTA 2BEFA 1N33J 2QRRA 1GX6A 4Q0BB 2LCWA 3JTNA 1RYSA 3BGLA 2QA4S 1GMWA 5B0GA 3NGDA 2X1GA 2ROEA 3RGIA 4BS2A 2YWFA 3SSQA 5RUBA 3IC1A 3HX9A 3S8SA 2YNIA 3DYAA 4QBUA 3D7SB 2YNHB 4K2XA 1KQGB 3GJRB 3LWLA 3TZXA 4F3QA 3ZTOA 1YSJA 2DISA 1FXRA 5L1LA 3CD0A 1Z4UA 3QPIA 4ETZA 2CUYA 2YWKA 3CPWR 3KDOA 3GFXA 5H9FK 3G96A 2GVDA 2XZTB 4IO9Q 1QSYA 3BSNA 2V2KA 1UP1A 5LM7E 3VAIA 3BM7A 1PSDA 5I3UB 3O1LA 1Q16B 4ZPDA 3WDOA 4DR4J 4ES3A 4MT1A 4I4BA 4RNNA 4OX8A 2OPRA 1WOPA 3HKZD 2AEFA 2O66A 4C8OA 2ASDA 4LFBF 1REVA 5AXLA 4MYUA 4DR3J 4RNHA 4Y65A 5J1NA 2KU7A 2YNGA 1O0PA 1WHVA 1B4SA 2HVEA 1FEHA 2LFVA 3IR7B 4LR9A 3R8YA 3NXZA 4B3RJ 1Q4RA 2GMJA 3IWNC 1GK8A 4G1PA 1MW7A 5KFUA 3W2WB 2ZH8A 4NCAA 2D9PA 4X4VA 1VIXA 3I96A 4O3QA 3SCLE 2OO4A 1KTVA 1WC0A 3AD9C 4HACA 2NZ4A 4IG0A 2ROPA 4KQZA 4J9RA 5IC6B 2E66A 1REVB 2XYHB 3M6VA 1U0SA 1YJ9S 2FQQB 4CT9A 4YS2A 5KFTA 1IR0A 2PI5A 5I3UA 4OYIA 3FMWA 5D4LA 4F36A 3E01B 2K06A 4JOUA 3PKYA 2KM8B 1VJWA 1Q78A 4HDGA 1U26A 2QT7A 2W1BA 4RBUA 2CPHA 2W2OP 4URSA 1U7LA 2L9DA 4C0HA 3HM9A 4NXNF 1WHWA 2R8KA 1UJ5A 4M95A 2DHAA 2CVEA 2XCPA 3A8IA 1N34J 4QWDA 1TMJA 2BRLA 5KFDA 3LGNA 5DG8A 3C3LA 1IQZA 3J7ZT 3M2VA 1VIOA 4RW4A 2K8GA 5IWAF 2VV5A 4USVA 2MGZA 2WRMA 1E6VB 3DYAB 1HI8A 3CDAA 1V3SA 4QZVB 4RLEA 3RAMA 1NK5A 3BJYA 2Q6CA 2KM8C 4QCLA 4NLGA 4L73A 1HNXJ 2G13A 2GCFA 2IVMA 1I94J 1OMSA 4NL5A 4FS1A 4O23A 3NNCA 4Q0BA 3GE9A 1WTBA 3WHIA 4O3PA 4B9UA 1FDDA 2PMZD 4JI4J 1BLUA 4ZP8A 1JJ2R 3MDFA 1ZH5A 4WZMA 1BWEA 2R2RA 3MMJA 1IKYA 1KLMB 4JI0J 1NKCA 2JEIA 4IOCQ 2VA3A 3M8QA 2DR9A 3S7RA 1BQNA 2W4DA 1PBUA 3AQOA 2L48A 4OLPA 2KT3A 3M2RA 5DDRC 2ZH3A 3J80U 2UV8A 3GCXP 5GVQA 3VF0B 1WHYA 3VWSA 4EUVA 4W98A 3FFIB 1UEKA 1Y00A 2IAJA 1XN9A 2FHKA 1TL4A 3B54A 3HD1A 4QWCA 1TL3B 3VCDA 3MAAB 4WU3A 4TU8A 3KNAA 3OVAA 3DLGA 3VGVA 3W1YC 3QT6A 3KOAA 2GVZA 2HWTA 1HBMA 2PO4A 4ZP7A 4ILLA 2G1DA 1WC4A 2CZ9A 5L8RC 1Q5VA 2WCXA 2JEGA 2PA8D 3J81U 1F5AA 4P9SA 1VBXA 4KV8A 1X9MA 2UV8G 2QJ3A 2GJIA 2DGOA 2VFTA 2F4FA 1DLOA 4BDPA 3BEGB 1X4FA 3D0IE 3E51A 4M5LA 1KD1T 4NCGA 2IM3A 3MD1A 1ZAWA 3MMCA 5ETKA 1NU4A 5HMYA 3G6VA 1BD6A 2F65A 1NSPA 5KFXA 4O0IA 1JJCB 3TARA 2XBPA 3TRGA 1C1BB 3Q2SC 4I7FA 1TAUA 1N34F 1XMBA 2W4CA 4P2MA 1U6BA 1VQNS 3LH2S 4LSNB 2HBQB 2EK6A 4PG5A 1N5YB 1YQHA 3A8KA 3EWGA 2IDLA 2GIFA 3OR1B 4C8ZA 1XJWB 2IC3B 1IKVB 1V5IB 3AAWB 4UZBA 1HR0J 4KAIA 1RT1B 2WHOA 2GS8A 1M1HA 4K4WA 5KFIA 5CQGA 1O51A 2N4DA 4MYTA 1UWAA 2CQGA 4DV2F 2BVZA 2DHGA 2XO6A 1JNRB 4B3OA 3KG0A 1N36J 4CCHA 4LF9F 4HI2A 5AE2A 2KI2A 4PWDA 1BGXT 2GHPA 3FGVA 3IGNA 4FNIA 4M5DB 3SMZA 4ZJQA 2AKWB 5L1KA 1FNXH 1QTMA 3QJLA 3K5OA 2A18A 2RU9A 1TK0A 2QFIA 4AXJA 3P8BB 4DV1J 2XCAA 3G71S 1EAYC 2DYAA 5IT9U 2KJWA 4JV5F 4G3IA 1VQ8S 1U1PA 3AOCA 4ZVTB 5GAHI 2B9YA 1CEZA 2POKA 1IN0A 3QGGA 3BZQA 4AD6A 1RU2A 1KC8T 1RTZA 2JSXA 3ZXWA 4MK8A 2B9EA 3RW6A 2BZ2A 1JLGB 1NZ8A 3MR3A 3VAKA 1R3NA 2ZDOA 3R27A 3GIIA 4AL6A 1S9FA 5KG3A 4MIAA 3ZO7A 2BDPA 2OI2A 3C16B 3CD5A 1YJVA 2JVOA 4ES2A 1HWJA 2FLOA 2OEMA 4DL3A 1LWFB 2UUCF 4E0DA 2R2SA 2ZC4A 3FEXB 3Q8YA 1P9QC 4BC9A 2QO3A 1VC6A 5B09A 1SUQB 2O3DA 3D6MB 1F2HA 3TVKA 4ELUA 4PABA 4L76A 1N6QB 5LT5A 3MUMP 2DY9A 2MSTA 3SIPB 4DZ6A 1Z2ZA 3TUZC 1X5PA 2HFZA 4QIVA 2F63A 2JEJA 2CJAA 5AJ3J 3OVBA 1D3WA 4MJKA 5BR8J 1N4LA 1XBWA 3OBIA 4H4KC 3ET6B 2ZD1B 8AT1B 3W9IA 2M52A 2UUTA 4RUCA 2LQ8A 2ZH6A 2X3DA 3CCJS 4ECZA 3VAGA 2PSZA 4TQRA 4JI6F 5FDLB 1P8GA 2EFPA 1KSPA 1S7HA 5G0RA 3ITHB 3QLHA 2BMBA 2BW2A 2HGLA 3PCOB 2K3IA 3G2XA 3MOZA 4OZ3A 3UDCA 4X4RA 3OW2R 4LF1A 4B3SF 2Y8YA 4OHYA 3DLKB 4OV6A 3KFWX 5JVGQ 2M88A 1S1WB 4O4GB 3Q83A 3M32B 1KVKA 4ATNA 2JNJA 1TL7A 5F0WA 2X1AA 2XS7A 3FCWA 3NMRA 5CYQA 2CNLB 2DCUB 1EETB 4OZ5A 4OQJA 1ZPVA 1RAHB 2QSFA 3OTDA 4DLGA 2Z0GA 3D1QA 1NSKL 3A12A 4X4PA 1VS3A 3R5CA 3RJMB 1VLYA 1Y0HA 3IS9B 3IBCB 2A3JA 4IFVA 1CQMA 2BYCA 1MROA 3DOMA 2WVDA 2CQDA 4WWSA 4H4MB 2V4JB 1DURA 1UAWA 4DR6F 2WOMB 2JLEA 2HNYA 2DGWA 2ZHAA 2D9OA 3D54A 3M9OB 1R27B 1RT7B 4G65A 4JB8B 4OHZA 2YNFA 4LSLB 2CPXA 2RMLA 3PJ9A 1RGVA 2HBRB 2KXHA 3ILJA 4KO0A 2B7CB 5L1JA 2KT2A 3L09A 1U49A 4XPCA 4FDFA 1AROP 4KBIA 2C42A 3SFGA 1FVQA 5GAGI 2QL9B 2QA1A 3NWGA 4B3MJ 1EZZB 3KJVB 5IM0B 3GG1A 4RBVA 3QO9B 2JEFA 2V8DA 4ECUA 5IQ6A 4GKJF 1RLCL 1FDBA 2NYIA 3QSYB 4DS5A 4EO6A 4URGA 2MKIA 4DL2A 3IXQA 2VQFJ 1GMVA 1QAYA 2XO7A 1VFJA 3HI9A 3DOLA 4DR1J 3AD7C 1CJTB 1HHSA 4WXWA 2XNQA 1YKWA 3EZOA 4WE1B 3IR6B 3NWRA 4NLWA 1G7CB 4DMZA 5C2CA 5LSLA 3T1YJ 1QVGR 3G8QA 4Q8EA 1R31A 2YH0A 1EKSA 2FHJA 4K4SA 3KHHA 4YHHF 1C1CB 2UUWA 2CAJA 2FJVA 2JZ5A 4OFZA 2MB0B 1T0TV 2HNDA 1DTTA 1UVIA 3RBEA 1Q8BA 3M2UB 3J7YI 3OSPA 2M8DB 2DBBA 2OEJA 1C0UA 1HPZB 2B7BB 1F9EB 2RS8A 2PMHA 3AA8A 2V69A 5DDQC 4OMFG 4ECQA 2WONA 3DNCA 4QR0A 2VPZB 2J76E 5B0AA 1Q86T 2VODA 1U1NA 5KG4A 4D3HA 2DPJA 2E7XA 2ZKUA 2PE8A 3BF4A 5KFYA 2XMUA 2XY5A 2H4WB 2CKWA 2J9DA 1JLQA 1T05B 2MZTA 2HZVA 3FNNA 2UXDJ 5F8NA 4L3NA 4N47A 1N52B 4BC7A 3OHAA 5IC4B 2BQUA 2MY7A 2R42A 4DV4F 3V81B 4F26A 3BSAA 1HNZF 2KVIA 1VQ6S 4F4YA 3KLGB 1UEUA 3BGFA 3O2IA 1RHRB 3M9NB 4ED6A 2A1BA 2ALYB 5C5JA 3EGVA 4AQYJ 1TELA 1HQUA 2OTLS 1UVJA 3I6PA 1S1UB 1JIHA 3V6HA 5B0EA 2YQ1A 2E9ZA 3MWBA 4OYPA 2AWZA 1J5OB 3HZEA 2DRDA 1S4EA 5C25A 2ZBIA 3KK2B 3OL8A 5GMKa 1XC9A 4ZPBA 2B0GA 5HN0A 4JI5F 4LF4F 4O44B 4CO1A 2BOAA 1QE1A 4PQUA 2YX1A 2C3YA 4LVNP 3ZFVA 3VAHA 2UUAF 1QY7A 1RTIA 2ILZA 4OJ1A 2BJ3A 2GIRA 3NAIA 4TY9A 5JVHQ 4MIBA 1RK8A 1WJ9A 3K8WA 4K59A 3E2EA 5L38A 1TAQA 5HBMB 4FBTA 1JX4A 4KHPJ 2DTJA 3Q24A 2PI4A 1S6QA 3US5A 3I0SB 3CE8A 1DJ0A 3FSXA 3Q89A 2ZJPQ 1LWEB 1O5JA 3IWXA 3HFKA 2MQNA 5EWGA 2UVVA 3VAFA 4IDKA 5E33A 3R1HA 2CQ2A 1RT4B 3UCUP 1LXJA 1SC4B 1NHVA 2XI2A 3MM6B 3PR5B 1X0FA 1ZETA 2D7SA 2HVIA 3W9JA 4E2FB 2VFSA 2J8AA 1AZSB 1N54B 1U0HB 3EUNA 1PO6A 5F41A 2YQ0A 4MFBA 3H5YA 5LMUJ 2Y1LB 2ZWOA 2MDAA 4H4KA 1LOUA 1U8WA 4X4TA 1FE0A 1JB0C 2MTLA 4NEYA 4NRUA 4ZLPA 1ROFA 2GHWA 1FRJA 5KFZA 2HWIA 2AX1A 1OY6A 2OMOA 2J0XA 5GADU 1U48A 1KRPA 2EFOA 1FJ7A 2XHCA 4QYZK 1IKWA 5MLCV 1TQLA 4DR2F 2BJ7A 2IA6A 1S7IA 2J5AA 2C3OA 1KVIA 3H90A 1TFWA 1G3OA 2AYMA 3V4IA 1RAFB 4JUZA 4OZ0A 4RU9A 2FJAB 3UR3C 1R6YA 1W7WA 1B99A 4X62J 4GVBB 3H5SA 2AYBA 4CQ1A 1WNEA 3SDEB 4RW7A 4ZLLA 5B0CA 1SJ4P 3IRXB 3KHRA 2MQPA 2RKIB 1K73T 1R8CA 4IFYA 3C14B 1RWNB 2ACYA 2ACMA 2EBGA 4L6V3 4MK9A 4DSIA 4YDDB 4K4YA 2A6OA 1KBRA 2AQ4A 2I1RA 1X31C 1WOSA 4U7UK 4F67A 1D8YA 4B9VA 2XNRA 2IMOA 3BH6B 4E8UA 1S12A 1FKOB 4DV0J 4WF9Q 1MNEA 1SQGA 4DU7A 4NI2A 3L4BC 4UF4A 5J2NB 4TKTA 1HWUA 4NLQA 4P2FA 5E3PA 2MLYA 4CM0A 4UUXA 1S9EB 3ENAA 1X9WA 1SL2A 2AHOB 3N5FA 4G1QA 1T03B 2CQ3A 1RAEB 2HQFA 1RTJB 2ZOFA 3R9LA 2IRUA 2VF3A 5J2QB 1REGX 4O3NA 4NLDA 3W5YA 4ZP6A 4PG8A 3P5TL 4WYWA 4PCQA 3GQCA 3V4MA 4MKYA 2AW0A 1S79A 2EG2A 1HNZJ 4G1QB 1T03A 3C6UA 4KYZA 5ETRA 5D6GA 1FXLA 1IBLF 1RA6A 1Q5YA 3VQTA 4KGMA 3GV7B 4KB7A 4NI2B 2XMJA 3FBCA 3MM8B 4RW8B 3SSRA 4O3RA 1JMTA 4NRTA 3BBBA 3LUYA 4TY8B 3R7SB 1R8PA 3JQMA 1PC4A 2JDJA 2V8GA 5KT2A 5HANA 2NLWA 2OELA 1FA0A 3CCES 3TAPA 1N33F 2KXNB 1BMQB 3PHEA 4DWIA 3X3UA 3GPAA 1NBEB 4JP8A 3SDEA 4YQWA 2B8PA 4H54A 4CLKA 2APOA 4FS2A 1SL0A 2FLNA 2ZWPA 5I3PA 1E6YB 3Q8PB 1XMOJ 2BE9B 1T9YA 2CVIA 2E5GA 2O67A 1EQMA 1ZM3A 4FYWB 2GHVC 5DQHA 2HVDA 4KHMA 2JLGA 2VQEF 3KLVA 1SB6A 1NKBA 1IKWB 1ZTTA 2HIYA 1TKXB 1ZA1B 1S6PB 1X4DA 5KT3A 2PC6A 1HBUB 1TMMA 3FBFA 2ZM6F 3ZZZA 1S0VA 5GAEU 4CM2A 3R2DJ 4AXIA 3HXMA 2HHQA 2JLFA 2OUGA 4U7CA 1UETA 2L9WA 4XK8C 3MPVA 2AU0A 2E1MC 2WK4A 4PPZA 4DBQA 1RTDA 1CJKB 1NPKA 5IV3A 2ZHBA 4MTPA 1J2VA 3CJ2A 3DMJB 4LVOP 4DN0A 4DL7A 3FJ2A 4ZN3A 2DR5A 1FD8A 5EDWA 1Y3JA 2RT3A 3I31A 3HHEA 2N7CA 4HT7A 2A2CA 2V2VA 5CXTA 2DY1A 3I82A 4J91A 4ZVUB 1PAEX 3HK2A 3D9BA 1TTHB 3EGNA 1RT4A 3KYLA 1H6KX 1X4CA 1X5SA 1VDHA 2Z58B 2IA0A 2BACA 2ZUAA 3P45B 2KRBA 4CDIA 4DV0F 2K2PA 5JUMA 4U95A 4ZCLA 4ZPTR 3J7YU 1DHMA 2MSSA 3BO4A 2V9WA 4FXDA 2YKPA 2RDDA 4B17A 2DD8S 2HAIA 1HNWJ 3QBCA 4JBCA 2YY3A 2AJ4A 2J8SA 1ZAVA 3GLJA 2C28A 3PW5A 2JFDA 1QE1B 4A48A 3N6LA 3OUYB 1L3UA 3LPYA 2XZWA 3KK2A 1WTFA 4ZIVA 4GC6A 3KLFA 2DKOB 2JVRA 1VK3A 2EEYA 3N6MA 4Q5VA 1B7YB 3GILA 2GO8A 4HYKA 3NCPA 3U1MA 1MU2A 1JLBA 1S1UA 1JLFA 1CS4A 1T9XA 4RWWA 3M9MB 3CC4S 1HYSB 2LA6A 3NY0A 5BJRA 5KFPA 2RQCA 4NEZA 1RABB 4X4NA 4DV6F 1LK5A 3KLGA 2B5JB 3QAUA 2ZUGA 1XNRF 1TKDA 2J6SA 1R7IA 1KOOA 3BDEA 1NJYA 1YZ7A 2F7VA 5SUHA 5H9EJ 1K44A 3EDQB 4OJHA 3D6HB 5EHHA 3FEYB 4X65J 3RTVA 3CSKA 1NB7A 3CJ4A 5L9NA 2ZVSA 4J7CA 3PYEA 1TV6A 3CDBA 1WC6A 4I6AA 3M8PB 2IBOA 2IJRA 1RT2B 4PKDB 3LANA 2W24A 1DFDA 1L3KA 4K0KJ 1NSQA 4B9TA 2DGVA 3MAHA 5KOWA 2ZKTA 2WONB 2C2MB 2M5YA 1RCXB 3Q8QB 3J7AN 3GYGA 3Q86A 1FFGB 1C0UB 8ATCB 3K5PA 3W66A 2E5LJ 2IM1A 7FDRA 1HYSA 3VR1A 2E5LF 2DEJA 1IJFB 3SFUA 4DFJA 1CS4B 3NEKA 2KFNA 2HNDB 4M1KA 2GJFA 3NBPA 3KUGA 4DR6J 1FVSA 2P2CB 2V2QA 2JHEA 3RRGA 1WWHA 4B08A 2R4FA 4NE9C 3CC7S 1AFIA 3AHPA 4DI6A 4DV4J 1OIAA 1YX2A 4JI7J 4C8YA 2VC0A 1B64A 1VQOS 1B70B 4WE1A 3ILIA 4FVMA 2XLJA 3R5JB 3ZTSA 2IVFB 4NMXA 4C3MA 3ZC4A 2BRKA 2HFOA 3MGJA 4CLWA 2Q3PA 3CCZA 3SQGB 2GV1A 4EZ6A 2FLPA 2WVEA 3T5KA 2GFFA 4FPRA 4TNOA 3UPFA 2CQ4A 1VBKA 1OO0B 1RAAB 4TLRA 4KRWA 1DY3A 4DQSA 4OYWA 4J90A 5IM0A 2VBYA 4HLBA 1NHUA 3KJVA 5F8IA 3TZYA 1VOMA 2E1CA 2H48B 3ETOA 2HW3A 1JNZB 4ZVFA 5E3QA 3AT1B 2MLZA 5LJ5Y 4QU6A 2MQ8A 2BANB 1OJ4A 2R7QA 2OSQA 5F0UA 4BHQA 3F44A 2YNFB 4LSLA 4LUBA 4TYAA 3CJKB 4BCAA 4DS4A 2VOPA 4LSZB 2PGCA 1RKJA 4YY3F 4KE5A 2RDJA 1L3SA 4H4MA 2V4JA 4CNYA 5I3QA 1K0VA 5GMEA 2LYVA 2RRAA 1MROB 2D74B 1X7VA 3M1VB 2DNLA 3ZZUA 5GAHU 2D3OR 3IS9A 1OSCA 4R0EA 1TKZB 1HBOB 3OXLA 4ZVHA 1IUJA 1TL1A 1S6PA 3UN5A 1QAXA 2GJ2A 2VUGA 3F0NA 4P52A 4CO5A 4IR9A 4EGLA 2YKAA 1FDNA 3HT0A 5IT4A 4RNMA 4DSJA 5CYQB 2LQBA 4KHPF 2OGUA 5EGYA 1MWQA 4OHWA 3N6NA 4UTGA 2HFUA 4IQMA 1Y5LB 3M32A 1B7FA 4R8UB 1OS5A 4O4GA 1I6JA 3GR0A 3HSGA 2V68A 3L3CA 4DV7J 5DM7Q 3TZWA 4JV5J 2AJFE 3DLKA 3KLHB 4PZVA 2FC8A 4X4QA 3J81Y 2W7OA 4DSFA 4CWBA 3DRYA 3WIVA 3SI8A 3H59A 3QLHB 2VG7A 5FDLA 1QM9A 2RUSA 5DQIA 3PRDA 2BABA 3MR2A 1WG1A 2HGMA 3BV8A 5HAOA 4C7QA 1IBKF 4X64J 1H74A 2PA3A 2ZBCA 4DPTA 2V34A 2Y1IA 3TI0A 1X4EA 2RHSB 1NH8A 4ZA1A 1RHMB 5D0GA 3NAHA 3VHQA 3BKUA 1RDRA 1GT8A 4ZIWA 3ISZA 2Z2MA 3RRKA 3UNYA 1RTHA 3BQ2A 1HNXF 1NDCA 2AEMA 1Y4ZB 1X4AA 4DV1F 5J2QA 3FBBA 3J81j 4CH1A 4PWUA 3T3FA 1CC8A 4IKAA 1S9EA 2MJNA 5IT0A 1RT3B 5J2NA 3MPDA 1JLCB 4U8YA 2RSQA 1FK9A 1HW9A 1M5SA 2GW8A 4K2JA 3CJSA 1NRKA 3I4HX 5HQMA 1S97A 3MCOA 1Q8KA 3H8YA 2GA7A 2EVZA 3GCWP 3PEHA 2RKIA 3FMBA 4HHHA 4LF2A 2O01C 3IRXA 2CNOB 2HRTA 4K4ZA 4GVBA 4HR2A 2IVYA 5KG0A 4CO0A 1YBTA 4J9UE 4ECXA 2V50A 2Z8QA 3ZNUA 4G1IA 4J9PA 1Q8LA 4J9VA 3V4IB 2BJ8A 5CHCB 2KT5A 3DXBA 3MEEA 3A1YG 2VICA 3EPIA 1TUGB 5EN1A 1AB8A 3GJTB 3D68A 3GU0A 3JS9A 4O4RA 4DSEA 2BQ3A 3NG8A 1VR6A 3J80Y 3EZUA 2AD9A 2MJUA 4NMLA 3KLIB 3RR7A 1OWXA 2I38A 3E8OA 1VI7A 3TEGA 3CDUA 3C8YA 2C1EB 3NGSA 5KFAA 5EWFA 4GKKF 3G86A 3LP1B 2HQDA 2YKMB 2W9CA 4PYDA 3EJMA 5AE3A 1CJVB 2G2ZA 5L9XA 2XLIA 3OR1A 4LBHA 4KGVB 4DG1B 4C6AA 1SKSA 1T95A 2GIQA 2ZEJA 4ECYA 4LSNA 4B3RF 2KZMA 3MM6A 1FRIA 4WP3A 2XSJA 1S6OA 5DQGA 1WSVA 4IDKB 1YRXA 1RXOB 2DITA 4NWBA 1UW9A 1LWEA 1NPPA 4CLSA 2XYPB 4Q2MA 4WFYA 5LMNF 3MMCB 5DZ6A 4DU8A 2J7UA 2BOPA 2GQ2A 3CMQA 4PXCA 3BREA 1XERA 2DH9A 2JRSA 1WF0A 1GNKA 3HSZA 3EYZA 5E5NA 1DLOB 4JI3J 2LP4A 3R7NB 2F3JA 2P6SA 1GH8A 4QIGA 4KV8B 3UDVA 4DCPB 3W60A 1RTIB 1RWVB 4WK3A 2ADCA 3DDKA 3GP9A 2ZH7A 2RU3A 1VQSA 4FF1A 3PRBA 1RT6B 3M8WA 3DLEB 4KY3A 2NR0A 3DLGB 2WTFA 1VQ9S 1FD2A 1S1VB 1X4GA 1G4CA 4OL8A 2CG8A 2YPZA 2F8MA 3BS9A 2CJ9A 2QLXA 3JSRA 4P2SA 5B08A 5H1SV 4JV0A 2ZH5A 2X3GA 2LU1A 4UUWA 5AXNA 3DU5A 1X4HA 3UD3P 2DO0A 2OHDA 2J9EA 4ENOA 2VPYB 3ZZOA 1SH3A 1UTAA 4B9SA 3TX8A 1ELOA 4DF8A 1IQTA 1HQUB 3M2RB 2KB2A 4OHXA 4PXDA 1EKRA 5HLFB 4B9LA 3NGRA 3EVMA 5KTQA 1UKUA 2OFGX 5KFGA 3T19A 3EX7B 1F2GA 3M8QB 1F0XA 2NPFA 3BDPA 3MR7A 3V81A 2CPZA 9ATCB 1KLMA 2VKRA 4LMZA 4CZCA 3AD8C 2PIIA 1WEZA 5LXYA 4Y2IA 4DX7A 3IGVA 1T9UA 4ZK7M 3AA9A 2HHHF 3OL7A 3DLHA 4LF5J 5HI7A 5SZTA 3HKWA 4OI0A 2MHEA 5AJ3F 1VK8A 5F9LA 3DM2A 4ZVQB 3MD3A 5K14B 3JSMA 2VQFF 4TVAB 4U8VA 4HH1A 2L3MA 4YR2A 3TO8A 1HPZA 1RU1A 1SQFA 4K7QA 1E6VA 4RUAA 1U1OA 1BE4A 3LTOA 4JV2A 4L72B 5EX3A 4N8OA 2RHQB 3M2UA 1L3VA 1QSLA 3B6BA 2QE5A 2F9DA 3HULA 5ITHA 4CH0S 3POTB 6AT1B 4I6YA 4ZVEA 2Z56B 2OPPA 1YJWS 1NK6A 2R7TA 2BA9A 4USJC 3KK3B 2L9NA 3M7VA 2IRXA 2VZ9A 3LPEA 4FYDA 3TUIC 7FD1A 1VQLS 2CJBA 2CZ4A 3JAMU 2B8QA 4JI8F 3KMSA 2V4RA 3E01A 1V5VA 4F4XA 1EQ0A 2BXJA 5GMDA 3H25A 4F50A 4DR7F 3UWTA 2NUUG 1LXNA 2DO4A 5B0BA 4RR5A 4ZVPB 2OP5A 1PJ7A 3MPWA 4K4UA 3GG0A 4QPTA 1MLAA 2M70A 1UFKA 2CPYA 2RD5C 4FNHA 3OD2A 4ZCMA 1TL5A 2LEPA 3QO9A 1HQEA 5J2PA 3FZ2A 4NZ7A 4KR0B 3K5NA 3W2WA 2YH1A 2UP1A 4NLOA 4M94A 1FCAA 2DNOA 2GQQA 2P9EA
chains in the Genus database with same CATH topology
3DRRA 3L7PA 1S0NA 3TW0A 4B3TF 3CF5Q 3RYLA 3U02A 1KQKA 4OHVA 4B02A 2MKSA 1KOHA 1APSA 4RU2A 3Q8RB 2A10A 1LFWA 2ALZA 2KZZA 2HQIA 3TVYA 1T3OA 3FCHA 1YHQS 3RB3A 4EFAC 3M6WA 5E41A 2R7WA 5DJBA 2DH8A 4IO1A 4IUFA 1P1LA 1ZM9A 5J1EA 4PUOB 1N0UA 2J7KA 2JC1A 4MKAA 1WF1A 1S1XA 4LT6A 2CQBA 2LMIA 1U2RA 4ES1A 2YNIB 3T1AA 3DXSX 4ILRA 4ZP9A 2HHTA 3H2LA 1U1RA 1QUPA 4J9KA 3CVKA 1URNA 1HFEL 2VD3A 4B9NA 4ERDA 4HTJA 1S1WA 2IM0A 3D0GE 3DOKA 4TYBA 1EP4B 2AJ1A 3DHWC 3L7OA 2ASYA 3G6YA 1TP7A 3NS6A 3H20A 4RW6B 4OI6A 5HO4A 2R8IA 1Q7YT 3M8RA 2LDYA 2OPSA 3I4PA 3DRXA 3V6JA 3OTCA 3PDNA 2JL9A 2M9KA 1SXLA 1WACA 2YWGA 3GIJA 2HRYA 4ELVA 3ICLA 2HLUA 2YQ3A 3GR1A 1YRTA 5F8LA 1CC7A 2GMLA 4ID5B 3SCKE 4NYZA 1UVKA 5KFBA 3FQLA 5GAGU 1N8RT 3JYTB 1HNVB 2QYCA 2FTRA 1LWFA 1WI6A 2MZ1A 3W7BA 4A47A 1AW0A 3LALA 1LV5A 4WTYA 4ED7A 4EBEA 3TAMA 3V6DB 2V5HG 3GIMA 3CJ3A 3QGHA 2VFUA 3O6QA 3E3XA 1UMJA 2WW8A 3O44A 4JV2A 2R7SA 4ZPVR 4A8OA 4DSKA 2KJVA 2GGPA 2I5JB 2AX0A 4XO0A 1SJRA 4IH5A 2OPQB 5D4NA 3WC2A 5E7OB 2DR8A 4WU2A 1IM4A 3OR2A 2X51A 4Y3CA 5LJ3Y 2R2TA 4DL5A 3PFOA 4A8SA 1TK8A 5KFLA 4HT5A 5FD1A 3HT3A 1D9DA 3I5AA 5ADZA 4WKRA 2DHSA 3MR5A 5A8KB 2LXFA 3N0VA 4WFZA 2HMIA 2DNNA 4TU9A 1PILA 2JH3A 4AYBD 2B43A 2R7XA 4OV1A 4M5DA 3MEDA 1M90T 1UW4A 1QJHA 1LW0A 1HBNB 1FTRA 1S6UA 2U2FA 4UQGA 2EKYA 3W3SA 5AXKA 1LW0B 3MZIA 2PT0A 2B6AA 2OFHX 3DRSA 1N36F 5KG7A 2FGCA 3S01A 4Y2MA 2NXUA 1P1TA 3N28A 4ZPAA 3Q8SB 1RKJA 1CSJA 1SBRA 3MM5A 2JWNA 2HMIB 3NNHA 4AQYF 2XMMA 5A8KA 2HG4A 2FVPA 2D3ZA 3AJ2A 1CLFA 2EFGA 2I9SA 1Y7PA 2L08A 3WX4A 2XMVA 3LWMA 5DG7A 4A8XA 2DNQA 5KG6A 2C2RA 2KTQA 4NCGB 2VBWA 2PN6A 2K1RB 4IG3A 4ED5A 2KH9A 5EWEA 2W7OA 2I5JA 3MUTP 3SCIE 2F8HA 1B0TA 2M8HA 1ZM4A 4HDHA 4PR6A 2RRBA 3GWCA 1XNQF 1VMBA 5DLGA 2OMLA 4DDFA 3TAMB 3V6DA 2XMTA 3IWLA 1BQMB 3JB9k 1K1SA 2WSCC 4TLQA 5A2QY 2YX4A 3IBWA 4CNZA 3PACA 1HNVA 1UA0A 4KKOA 1ZYQA