2RKIB

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with a triazole derived nnrti
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
424
structure length
402
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV-1 reverse transcriptase (RT) p66
publication title Triazole derivatives as non-nucleoside inhibitors of HIV-1 reverse transcriptase-structure-activity relationships and crystallographic analysis.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 111
structure length 402
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2rkiB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rkiB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rkiB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rkiB04
2ZE2B 1JLGB 3I0RB 4K4YA 4O3SA 4KV8B 1ZTWA 4WYLA 4IDKA 3DRSA 4NLSA 1TL3B 1S49A 3LP1B 3H40A 5C42A 2IM1A 1RT5A 3DOLA 1WNEA 3NKYA 3MFHA 1TKXA 3CJ2A 1MU2A 1QAJA 4MIAA 2XCAA 3OSPA 4MK8A 4U7CA 1QE1B 1RAJA 5HROB 4ZHRB 3KHRA 2W9BB 1S0MA 2ZKUA 4DL2A 3ITHA 4G1QB 4LSNB 4TQSA 4IFYA 3IS9B 4Q44A 4I2QA 4DL7A 4IG3A 5KFEA 4B3OB 3EZUA 5KFWA 5J2MB 3MR6A 1S1WB 2WONB 4ICLA 4KBIA 3LP2B 4ED8A 1JIHA 4NLRA 4K4TA 4F4XA 1JKHB 2B5JA 4ZVHA 3LAMA 4RNNA 3RAXA 4K4SA 1NHVA 4H4MA 1TQLA 2HMIB 4U6PA 3PVXA 2FVRA 3V4IA 5F8NA 2AX1A 1S97A 4O4GB 4O44B 3QLHB 4O3PA 3OL8A 1U09A 4H4OA 2JEGA 1SV5B 5HLFA 3BR9A 3MR5A 3MEDB 3H5YA 5DGBA 1KHVA 2VG5A 2RF2B 4PUOB 1HARA 2YNHA 5L1LA 5J2QA 4URGA 5EWFA 2V0NA 5K14A 1HYSB 1XR7A 2F8EX 2AX0A 1S9GB 2ASLA 2YKNB 4TY8B 2OPRA 1N5YB 5J2PA 1JLQA 3G6YA 4EYHB 5FDLB 2YKMA 5KFHA 4ECUA 1N56A 2J6TA 4Y34A 3PW2A 4ZVGA 3HVTB 3KJVA 4QPXA 3KK3A 3KK1B 2HWIA 4MKBA 4Y2AA 4Q43A 3KMQA 4H54A 2RDJA 1TV6B 4ZPBA 5J1EB 2IM0A 2YNGB 3UR0A 5F8LA 5F8MA 1IKYB 1S0NA 4KE5A 1RTDA 3H5SA 4DL5A 1LWFB 2AGOA 2W7PA 1TKZB 3MEEB 2XI3A 5KFGA 4PQUB 3KHHA 3MTKA 3I5AA 1HQUA 2W9AA 1JLBA 3BQ2A 3RB6A 2AGQA 4IOBA 3GILA 4DG1A 2AQ4A 3Q8QB 4ZVEA 1C0TB 4EO8A 2BQRA 3DLEA 4NLWA 4ED1A 2I5JB 4RNOA 3LALA 2WOMA 1LWCA 3M8QB 3N6LA 1N6QB 4KKOB 3GV5B 5KT2A 3FQKA 3G6XA 3BREA 4KHRA 1RTIB 1LWEB 4ECVA 4I7FB 3CJ4A 1T03B 5DG9A 1OS5A 4J9KA 3CDWA 3M9NB 4WFXA 5HBMB 1BQNB 2OPPB 3BGRB 3IRXB 1ZTTA 3GIIA 3NBPB 4EBCA 3MR2A 4Q0BA 1DTTA 3FRZA 2OPQB 1XR5A 3SFGA 4ECTA 4IR9A 4IRKA 4TQRA 3GYNA 2ZE2A 1JLGA 3I0RA 1HNVA 5HP1B 2AWZA 1S1TB 1EP4B 2VG6B 4KV8A 1TP7A 2FVCA 4ZPCA 2XC9A 1TL3A 4J9LA 4LSLB 2JEJA 2E9TA 3LP1A 1S9EB 4QWDA 1S6PB 4ZP6A 2VG7B 3OL7A 3IN5A 2IAJB 4IFVB 4O4RA 4ZP8A 4RUCA 1QE1A 2IM2A 5HROA 4ZHRA 5DLGA 4GC7A 3KHLA 5JUMA 4YMEA 4G1QA 4LSNA 1DLOB 3IS9A 4ZMMA 2R8JA 2WTFA 3QIPB 5CYQA 1QUVA 5KFAA 2WRMA 2OPSB 3PW7A 3CVKA 1CSJA 3N6MA 2V4QA 4RW9B 4IH7A 3DOKB 4DL4A 3PW0A 1JKHA 1S6QB 4MH8A 1C1CB 5DQHA 3V6DA 2UUWA 1S1UB 2HMIA 2FJVA 2XGQA 5KFTA 2DPIA 4K4WA 2FVQA 2R2UA 5KFQA 3KLIB 4O44A 3QLHA 1HPZA 2XGPA 1RT1B 1ZETA 2BQUA 1SV5A 3M8PB 3MEDA 4RW7B 5C24A 4DL3A 2HWHA 5KFIA 1SH0A 1RT2A 2RF2A 4ID5B 4PUOA 1RT4B 1C2PA 4ED2A 5I42A 4OL8A 2BRLA 5DGAA 4FBUA 1VRUB 3OHBA 2HNDB 3GV8B 4WXOA 4EBDA 2W8LA 5J2NA 1HYSA 1KLMA 4RNFA 1S9GA 2R8KA 2YKNA 4TY8A 3T1AA 2AU0A 1RA7A 3C6TB 4Y3CA 4Y2CA 2V4RA 1N5YA 2BANB 3CIZA 3MF5A 5KG3A 1HNIB 3BSAA 5DQGA 2ZD1A 2HNYB 3CJ0A 1RT6B 3CJ5A 5EWGA 3HVTA 2ASDA 1EETB 5L1JA 3KK1A 5KFPA 1JLAB 4ZPDA 4O3OA 1TV6A 4F4YA 5J1EA 2YNGA 2FJWA 3T5JA 1IKYA 3C6UB 2UUTA 3DMJB 3OLAA 4J9OA 4EBEA 1JXLA 4K4VA 3RB0A 3RB4A 4EEYA 1LWFA 3RB3A 2FVPA 1TKZA 3MEEA 3T5LA 1J5OB 4PQUA 4EO6A 2DPJA 3QZ7A 3KLGB 2IJFA 1R0AB 1W25A 2IJNA 3CDUA 1C0TA 4R5PA 2I5JA 3QO9B 2B6AB 3QZ8A 4NLTA 4IR1A 2R8HA 1SH2A 1TL1A 3M8QA 1GX5A 2HNZB 1RTHB 4KKOA 1DTQB 1N6QA 1IM4A 1SH3A 2JC0A 3BQ1A 4FS2A 4QW8A 4DL6A 3HKWA 4JV2A 1RTIA 3H4DA 1T03A 4QWAA 2JC1A 3LP0A 2BRKA 2YNIB 2RKIB 5HBMA 1BQNA 2OPPA 3BGRA 3SI8A 5KG6A 3IRXA 2GIRA 5KFMA 4TY9A 4URQU 2C22A 4NRTA 3LAKA 4ZPAA 4ED3A 3NMAA 5F9NA 1JX4A 3KOAA 1HQEA 5I3UB 4JV0A 4FS1A 2JEIA 5HP1A 4J9QA 1S1TA 1EP4A 4M94A 2AGPA 3H4BA 1JLEB 4LSLA 3LANA 3KK2B 1S9EA 4XO0A 1S6PA 4XPCA 3V6KA 4KFBB 3Q8RB 4IKAA 2FLLA 3OL6A 4NLUA 4TXSA 2IAJA 1JLCB 4IFVA 2R2SA 4NLPA 2ASJA 4NZ0A 4F4ZA 1LW0A 5KFCA 4ECRA 1FKPB 4O3RA 2IA6A 1DLOA 1TKXB 2JLEA 2R2RA 1IKXB 3PHEA 3QIPA 3H5UA 3DLGA 3VQSA 2BR0A 4MK9A 3BSOA 3DI6B 5KFUA 4RW9A 4IH6A 4KO0A 3GIKA 3DOKA 3DLKB 3ITHB 1RT7B 5KT5A 1JLFB 4F4WA 4NYZA 4J9NA 3I0SB 1S6QA 1C1CA 2GIQA 3OLBA 3MEGB 3KLFB 1RYRA 4WE1A 5DQIA 2BE2B 3IGNA 4TN2A 1HMVB 2O5DA 4KB7A 4RW8A 2D7SA 5KG5A 4IH5A 5DG7A 5KFRA 4TYAA 3M8PA 2C2RA 5KT7A 2W8KA 3V4IB 3IG1B 1NNDA 4ID5A 4Q8FA 4RW6B 2JEFA 1QAIA 5KFDA 2W9CB 4YP3A 1S10A 2UVWA 4Q8EA 3I5CA 4X2BA 3T5KA 3GV7B 1VRTB 1TKTB 2GC8A 3T19A 2VG5B 3C6TA 4WZQA 2ILZA 2BANA 4NLYA 5J2QB 1RT3B 2HNYA 3ISND 4HKQA 2WHOA 3HVWA 4YR3A 1RT6A 3EPGA 4K4XA 2W9BA 1EETA 3E01B 3V6HA 3QGGA 4WYWA 1JLAA 4YQWA 3DYAB 4B3OA 2R8IA 3DMJA 3TQ1A 5J2MA 2C2DA 2UVRA 3M9OB 3KNAA 1S1WA 2WONA 3PJXA 3KJVB 3DRPB 3LP2A 4RZRA 3PW4A 4K50A 1J5OA 5L9XA 5EUHA 1S1XB 1REVB 3Q8PB 1R0AA 1K1QA 3SFUA 3V81B 1IKVB 2CJQA 3QO9A 5KG2A 2B6AA 1RYSA 4LQ3A 4RW4B 3KLHB 1GX6A 1RTJB 4O4GA 1LW2B 5KFXA 4IRDA 1JLBB 1FK9B 1C1BB 4DG1B 3OL9A 5KFOA 2HNZA 1RTHA 1BQMB 1DTQA 4IG0B 4ZP7A 4I2PB 2D41A 2E9ZA 3MR3A 4RUAA 5KFLA 4NLXA 4JV1A 4QWCA 4WXWA 3TAMB 2VA3A 5KFKA 4NCGB 4J9PA 3DRRB 2YNIA 2FLPA 2RKIA 2XWYA 2B43A 4J9MA 1T05B 5FDLA 1N4LA 1N48A 3QGIA 3EPIA 4K4UA 4QW9A 4WZMA 1UWBB 1JLEA 4ECZA 1DTTB 4J9SA 2J6SA 3V6JA 3KLEB 5KG7A 1NHUA 3NGDA 1SUQB 1HNVB 1TVRB 4KFBA 3BJYA 1JLCA 5KT3A 3JYTB 4PWDB 4KAIA 5C25B 3FFIB 5CYMB 3DDKA 5KFBA 3HHKA 1FKOB 3DM2B 4ED0A 1FKPA 5DG8A 4GC6A 1IKXA 1S1VB 4MFBB 3JSMB 3CDEA 1K1SA 3DI6A 3TVKA 3QIDA 4ECQA 5KT4A 5DLFA 3OHAA 3CJ3A 3DLKA 4NLDA 5JXSA 3KMSA 1RT7A 4R8UB 1JLFA 1IKWB 4MIBA 3I0SA 1RA6A 5CYQB 1LWEA 5KFYA 4I7FA 3MECB 3MEGA 3KLFA 1S9FA 4FBTA 3NAIA 1I6JA 2IM3A 2BE2A 5C5JA 2FVSA 3FSIA 3BSCA 1HMVA 4O3QA 3T5HA 5D3GB 3MFIA 2FJXA 3NBPA 4ZVFA 2IC3B 3V6DB 2ILYA 3CO9A 4F50A 2YNFB 2OPQA 3D5MA 2WCXA 3CWJA 2EC0A 4K4ZA 4G3IA 4RU9A 1D1UA 3IG1A 3RBEA 4RW6A 2VG6A 1Z4UA 3ICLA 3ISNC 1HPZB 2W9CA 4YR2A 5C24B 1VRTA 1TKTA 1C0UB 3D28A 3UPFA 1RT2B 2VG7A 4ED7A 5I42B 4M95A 4IDKB 2WK4A 1RT3A 3DRSB 5KT6A 2HAIA 2RDIA 2IBKA 5F8GA 5C42B 3PR4A 1RT5B 3DOLB 1KLMB 5J2NB 4TYBA 4J9RA 5L1IA 3E01A 5KFSA 3RAQA 3DYAA 1MU2B 3PJWA 2ZD1B 4NLVA 2OPSA 3BSNA 4URSA 4DEZA 2VA2A 4RNMA 5EWEA 3FDSA 3UQSA 3KLVA 3DRPA 4IFYB 3I5BA 4I2QB 1S1XA 4IG3B 3N6NA 1REVA 1XR6A 4HYKA 1S1UA 2IMWP 4ICLB 3V81A 1IKVA 3PW5A 5KFJA 2R8GA 4RW4A 3KLHA 2WB4A 1RTJA 2B5JB 1LW2A 3KLIA 3QGHA 1FK9A 1C1BA 1RT1A 4H4MB 4ECYA 1BQMA 4IG0A 4MKAA 4RW7A 4I2PA 4R5PB 2CKWA 5KG1A 4NLOA 1RT4A 2FLNA 1TL1B 3TAMA 3H98A 4NRUA 1VRUA 4H4OB 2HNDA 3DRRA 4NCGA 3UDLA 3NAHA 5HLFB 4IQXA 5KFZA 4KSEB 2XI2A 1RDRA 3KHGA 1T05A 2YNHB 1HNIA 3G6VA 2ALZA 3NL0A 3LP0B 3H2LA 2V9WA 5K14B 3E51A 2W7OA 1KHWA 5KFNA 5KG0A 2OPRB 5F8HA 4ECWA 1UWBA 5J2PB 1JLQB 2J6UA 3C6UA 3HVAA 2YKMB 4Q45A 5KFVA 2UVVA 3KLEA 4R0EA 1HQEB 3BQ0A 4IRCA 3KK3B 1SUQA 1TVRA 5F8JA 4EYIB 2UVUA 3JYTA 4PWDA 1T3NA 5C25A 3FFIA 5CYMA 3KLGA 1RTDB 3M9MB 1FKOA 3DM2A 3FQLA 3H59A 4NLGA 1S1VA 3GIJA 4MFBA 2C28A 3JSMA 5L1KA 3G86A 5EDWA 1HQUB 4TLRA 1LW0B 3GIMA 4RNHA 3DLEB 4R8UA 1IKWA 2QE5A 3DLGB 4KHMA 1MMLA 3MECA 2D3ZA 4NLQA 2D3UA 3QYYA 4MK7A 5KFFA 2WOMB 1LWCB 4KO0B 1YVFA 4LQ9A 4QWBA 5F9LA 3Q8SB 4ED6A 2E9RX 1S48A 5D3GA 2XCPA 2R2TA 2IC3A 1S4FA 2QV6A 5KG4A 3IGVA 4WE1B 1T94A 2YNFA 5T14A 4ECXA 2ATLA 3OSNA 4WFYA 3PZPA 1S0OA 5I3UA 4WFZA 4O3NA 2I1RA 3PR5B 4YR0A 3RBDA 4RW8B 3GQCA 1D0EA 2C2EA 2OH2A 2BQ3A 3H5XA 5F8IA 4XPEA 3KK2A 4Q0BB 4JUZA 4ECSA 4QWEA 1C0UA 4ZP9A
chains in the Genus database with same CATH superfamily
1TKXA 4IG3A 4LF8J 4NLRA 2HLTA 4K4TA 5FIIA 1IM6A 3CJKA 2CADA 3V4IA 2DH9A 3NOCA 3OQ2A 1CJUB 1I1GA 2JX2A 3UDVA 1KHVA 4CT9A 2RF2B 2GVDA 4YB7A 2QYCA 2F8EX 2YKNB 4EYHB 4LF5F 4MKBA 2VFUA 5EX0A 3HJFA 1IKYB 4U7UD 4QYZJ 1RTDA 2EW9A 4UOGA 2AZ1A 2R7UA 1YLXA 3RB6A 1CBKA 3HFKA 2YPZA 2JZ5A 3X1LB 1U24A 1VQ9S 2IBOA 4KKOB 1VJQA 1IXKA 2HGLA 3CJ4A 3QJLA 1UPMB 1WOSA 1HHTP 2OPPB 3PXGa 1S4EA 3DRYA 1CJKB 1S9EB 2WSFC 4ETXA 5BYSA 4KGVB 1QUVA 3PW7A 4RW9B 3HSJA 1VRQC 4P52A 2VV5A 4KQZA 4UZCA 3QGPA 4ZJOA 3UO0A 3KLIB 1WTBA 4ED2A 2VDIA 2CYYA 1VRUB 3M2UA 1S9GA 5F0WA 1N5YA 3IR6B 3CJ0A 2OFGX 1WTFA 3CJ5A 3M32A 5KFPA 2BYCA 3C6UB 5IZHA 3DMJB 4DR1F 3RB0A 2CPYA 2RNEA 3VZHA 3MAAA 1NB7A 5FJ4A 4EO6A 4RLEA 3J7Z5 1W25A 4DLEA 2KXFA 4NLTA 2DXFA 3RAMA 1SH2A 4ANEA 2CPJA 1SH3A 2MSTA 1SQEA 4ELUA 3EGVA 4D3HA 4TY9A 5B08A 1HR0F 4FS1A 4LFCJ 3O44A 2ZZMA 3W2VB 4IKAA 4ITSA 1ZZNA 4NLPA 4J9UE 2ADBA 1A7GE 1NK4A 3EM1A 1K0TA 1FRKA 2LQ9A 2JL9A 3R9LA 3GFZA 2BR0A 1FRHA 2V4JB 5LT5A 3S01A 4X4NA 4P10A 4KB7A 2IRUA 1YJTA 5CQGA 2HQDA 4Q8FA 2AHOB 3JSYA 2JFDA 5BR8F 3HVWA 4DDFA 3TZYA 1S1WA 2CQPA 4RZRA 2SXLA 1J5OA 1VIOA 1WUUA 4XIUA 3R97A 4AQYF 4FYDA 4K2JA 4PG8A 3PX0A 1U1MA 1SQFA 3SQGA 2BZ2A 3CCMS 5A8RB 4DV6F 4J9PA 4USJC 2FLPA 4LR8A 1T0TV 4B08A 3LUYA 5LJ5Y 2HHXA 3KLEB 2V68A 4OX9F 2N4DA 2C2ZB 2DR5A 1CPZA 3CJ3A 1E6YB 2FTRA 3I0SA 4FBTA 4QU7A 1NKBA 1N5TA 2FZCB 2Z57B 3J7ZT 2DY9A 2YNFB 5K20B 4ILRA 2GV1A 4S0MA 5T7LA 2NS1B 1HPZB 1RAAB 1TKTA 2QGFB 2WW8A 1AW0A 2DR6A 1Q81T 1I94F 4ELTA 1H73A 3E01A 1Q5VA 4NLVA 3M2RA 4OZ2A 1NEEA 4RUHA 2IMWP 2FY8A 2KTQA 1FK9A 5THWA 4OV1A 4AL7A 2DB1A 4Y6IA 1MSWD 3BO2A 3PRBA 2XMKA 2ZOMA 2AIRB 1NO8A 5IWAJ 4UT4A 1UZHA 5M2RA 3BQ0A 3NS6A 3JYTA 2U1AA 3KLGA 1DQ8A 1X4EA 4ZPVR 2MQMA 4RNHA 2HVHA 3LQVA 5JVHQ 1CEZA 1MG7A 1VQSA 5D3GA 4K0KF 1S4FA 1WKJA 2QRRA 3OSNA 1JXVA 3KK2A 2XMVA 3FNNA 3T1HJ 2YQ1A 3DOLA 3OFGA 2MKHA 2C3UA 4H4KA 4WBFA 3EZUA 4A8MP 4ED8A 1X4AA 1RUSA 3ADAC 4NXMJ 3RTVA 3MAQA 2R3VA 2AX1A 2ADCA 1S97A 2LEBA 2EVZA 2M5YA 3L7OA 1HR0J 2OMOA 1CULA 2AV5A 1XNQF 1HYSB 1XN9A 2N3OA 1H6KX 1HNZJ 3NS7B 2CFXA 4F3QA 5HVGA 3KK3A 4Q43A 2DD8S 2KFNA 2LEPA 1P1TA 4FVMA 3I5AA 2EFPA 4M5HA 2H54B 1FTRA 1VQNS 1PBAA 1B0TA 5LMUF 4F3OA 2G0JA 5CHCB 1OS5A 4J9KA 1U45A 3PYFA 1FWLA 1U02A 1WC0A 4LIWA 1REGX 2HBQB 2Z8QA 2JEJA 2B9YA 4ZP6A 4OZ0A 3QNWB 4DN9A 1FESA 1R43A 3P6YC 2J9CA 3CIMA 2I8EA 4AQYJ 5CYQA 3VAMA 1TL4A 1XC9A 3OR2B 4DL0C 2Q66A 5D8HB 4XDDA 3QLHA 2J5AA 3GFXA 1TK8A 1BWVA 2RQKA 1RT6B 3D6MB 4MMOA 4CLYA 3OVSA 1SC6A 1OYDA 4UOCA 1LWFA 2HZAA 2RH3A 3L7PA 4EFAC 1P27B 3CUNA 2ZH5A 3PYEA 1VHFA 2OLWA 3HI9A 4PPDA 5A0YB 1DURA 1N54B 3MMAB 2NXJA 4OI3A 3CDBA 1M1HA 5I3UB 2KM8B 4DV3F 1KOHA 4CO5A 4J9QA 3S7RA 2RUGA 2KRRA 4EWTA 4KFBB 3Q8RB 2CNKB 4NLUA 1NDCA 2J0XA 4F4ZA 1BD6A 2IA6A 4OZ3A 1WDTA 2KJWA 2Z2YB 3TEGA 2V6AA 1XJWB 1OY8A 3M1VB 3MEGB 3CCRS 4OYZA 2XYGB 3LW5C 5HSPA 4OHYA 3LTOA 4DJBA 3Q8YA 3MR7A 3T1YJ 1FX4A 1RBAA 4P7VA 3FMBA 3T19A 3LO3A 2GW8A 4FDFA 1NSAA 1OQ6A 2Q79A 5ITHA 5LM7E 3KNAA 1A0OB 4Y2MA 1T9TA 4ZVSB 1YJWS 5HQ8A 1HNXJ 4L73A 3OTBA 1IWGA 5A2QU 2D41A 4OJHA 4K0KJ 4CO4A 4NCGB 2HVIA 3TYTA 2VHGA 2XMJA 1RZMA 3A3PB 4C11B 3EGNA 4LF2A 1U26A 1JLEA 3HZGA 1HNVB 4KPCA 3FBFA 2EXUA 1N88A 2AT1B 4OI2A 2W4DA 2HFZA 2QYGA 4I7FA 1WC4A 3C14B 4UW2A 4XTTA 1OYEA 1G7CB 3MFIA 2MGZA 4USUA 1P9QC 3DHWC 1NZAA 3A12A 3I32A 2PFFB 3ISNC 1XNQJ 4C9DA 2ZDPA 4LBPA 3OPKA 5I42B 3AA9A 2PA8D 2RHQB 1RWNB 2UZAA 2ZHAA 2ERRA 1JJ4A 2KHCA 4Y2IA 1J27A 1WF0A 5E41A 1S1XA 4IG3B 1NAQA 1SJRA 5K8OA 4PPZA 3KNGA 4OV6A 2V8PA 1R0CB 1RTJA 3QGHA 1C1BA 3VV2B 3CJKB 4RW7A 1UZDA 2RS8A 3M6UA 2B51A 2V2QA 3MMCA 1RT4A 3RJMB 4IQXA 3NS5A 1T05A 2GVDB 2BM1A 3LP0B 4DR7F 4PCQA 5SZTA 3MD3A 2LQ8A 4WP8A 4C8ZA 1NJZA 5D0HA 3TQEA 2B7CB 1RTDB 2RRAA 3NXZA 3P96A 3AH6A 4QIWD 3DLGB 4MK7A 1NK0A 1FF2A 4N77A 1UAWA 4OHXA 1ZA2B 1DZ5A 1FA0A 1NJIT 3I82A 2VD3A 2ZJRQ 4NLSA 4B9UA 2YWFA 4OYMA 5DDOC 1QAJA 3A8KA 3WQPA 4U7CA 3KHRA 4KTQA 4M5IA 2DR8A 3QFHA 2B0GA 3LAMA 3T41A 4GKJF 1KN6A 3J7AN 2YH1A 4O4GB 2HRYA 3QWUA 5HLFA 1R8CA 3M2UB 1UJ6A 3R6LB 1S77D 1S9GB 1N5YB 5B0CA 4ECUA 4N7TA 1UFWA 1U48A 3UNYA 2IM0A 1FRMA 3H5SA 5HI7A 3QSIA 3HFZB 3TUPA 2UV8A 1N0VC 2AJFE 2E5IA 1WF2A 2NXEA 3W62A 3N6LA 5KT2A 2HHHF 2V50A 4ECVA 2FZKB 2I2YA 1QD1A 1ULRA 4GO7X 2EK1A 2G1HA 1XR5A 1FJCA 4IRKA 3GYNA 2X1GA 4OZNA 5D0EA 2MYFA 3KTQA 4MYTA 2GMHA 4JI4J 2QLXA 1X5TA 3EZOA 2IM2A 5HANA 2E7WA 2WRMA 4X4PA 2VICA 4MH8A 1WI6A 1P8GA 3NWGA 2QN6B 2DKOB 2O66A 1Q53A 1PJ5A 4DV0J 1SV5A 5G0RA 2HWHA 2DIVA 1SH0A 1N48A 4FBUA 4OL8A 1HI1A 5E3AA 4LFAJ 2HURA 5KG3A 5EWGA 2V5HG 1Y00A 4JV5F 2FHJA 4O3OA 1ZM3A 1J5OB 2PN6A 2YX4A 2CPEA 3M7VA 2GA7A 5A2QY 2QC3A 3N5BA 1NZ8A 3Q24A 2R7OA 1V9OA 2GJ2A 3D0HE 1WEYA 1BQNA 2AYEA 4OJ3A 1PG5B 2D1CA 2KZMA 3THTA 4KGMA 3OL6A 5CH7B 2IIHA 3L09A 4NA2A 2XS2A 2NPIA 2QA4G 2JLEA 2CNLB 4DSEA 5HMZA 4ZLNA 5IXUA 5DETA 4F4WA 3I0SB 1S6QA 5HMXA 1FD2A 1ZAXA 1WF1A 3BKUA 4DR2F 4NEZA 4PRFA 4NASA 2GIFA 1TKTB 4WZQA 1KNZA 4A8KA 2YWHA 3EPGA 2CZ9A 4FVCA 3JQMA 3E01B 3QGGA 1ZS6A 4ZCKA 2C2DA 3M2RB 3PW4A 1GFWB 1KQFB 5AE3A 1FK9B 4DV2F 2BJ8A 2PO4A 5KFOA 2NREA 1ELOA 2YKAA 2BE9B 2HZCA 2Z2LA 1X4FA 2J7WA 1H2VZ 4F0MA 3CJRA 2V9KA 3VAHA 4WZMA 2DNNA 5CZXA 2OFHX 1F9EB 2Q43A 1O8BA 3JYTB 3DDKA 4DQIA 2UUCJ 4DS5A 4F25A 4ES2A 4P74A 1WWHA 4WU2A 1ACMB 3BZQA 3BSCA 2DO0A 4OJGA 5D3GB 3ZTPA 2E5GA 1HQ2A 2ILYA 3D5MA 3CWJA 1B0VA 2XM3A 3FMWA 4Z2XA 1QTNB 1KVJA 1L3UA 3EGZA 2K7KA 2VG7A 2IBKA 1PYSB 1U25A 4LFBF 3DOLB 2HBYB 2QLBB 2RMLA 4URSA 1WOOA 5EWEA 1IBKJ 4YHHF 2HQFA 1WACA 1XBWA 3D3BJ 5I4MA 3K58A 4IG0A 2IY5B 5IC4B 1S6UA 2WVCA 4OYIA 4LF4F 3ZZUA 3TAMA 5F8HA 2MMYA 3SDEA 3R5JB 3V5RA 1BGXT 1CULB 4OHVA 3FBBA 3HF5A 2O01C 1UEUA 5KFVA 1U6ZA 3KK3B 3G87A 1GXTA 1HBMA 2VODA 3JTNA 5JMNA 2VIHA 4MFBA 2J9EA 1FD8A 4TLRA 1IJEB 3MECA 4NLQA 5LMNJ 2VBZA 1U0HA 4DXLA 1S48A 3QJPA 4FF1A 1FDAA 3H5XA 4JUZA 4ECSA 4C7QA 5D4PA 3ZZPA 1ZTWA 4JV5J 4DX5A 3CJ2A 3FBCA 1VIXA 2MTLA 1GXLA 3I6PA 2CJAA 4DL7A 5J2MB 1DJ0A 5C2GA 3MR6A 4ICLA 4X65F 1XMBA 2K3KA 4K4SA 1TQLA 3QLHB 1TFYA 2XYPB 1F0XA 4RBUA 2A0FB 4DPYA 5GAGU 4FXDA 4QYRA 3EJMA 5J2PA 5E3QA 2B4UA 1TK5A 2FLOA 1QLNA 2RDJA 1LWFB 3IC1A 1WSRA 4ERDA 2AQ4A 1RWVB 1EIYB 5AXMA 3G8SA 5H9EK 2IMOA 4DR2J 2PDAA 3OW2R 3M9NB 4NPOA 2YKPA 3I0RA 1M5OC 2FVCA 4HI2A 1DHMA 3I4PA 1VK8A 4RUCA 1S99A 3KHLA 3PNIA 3V2UC 3H2UB 2F9DA 3G2XA 3GE9A 1U1RA 2P5VA 4K4WA 4WK1A 5KFIA 3J81Y 3M30B 4U8VA 4I68A 3J80U 4EBDA 2LFVA 3HVRA 3JAMY 3TRGA 3N28A 3RB4A 3CC2S 3MEEA 3CO0P 4X4TA 5A8WA 2HS3A 2BOAA 2Y9HA 1YGYA 2HQ3A 2DNKA 2KT2A 3VHQA 4QIFA 4QYZK 5HBMA 1VFJA 1HQEA 4ES1A 4LFBJ 5JJBA 1JLEB 2R7TA 3N4WA 3U02A 2R2SA 2CQ2A 4YHHJ 3MAHA 1YSJA 4PQAA 1N8RT 3BSOA 3ITHB 2QT7A 4B17A 1FT8A 3CC4S 2FGCA 4WPAA 3M8PA 5KT7A 4ID5A 2KDOA 1RJJA 5CXTA 5LSLA 1S10A 2HK2A 3TJ8A 4X2BA 3GV7B 1FXRA 1NXIA 1EETA 4MT1A 2NXNA 4WYWA 2UVRA 1M0SA 3KJVB 4JI7F 4PABA 5IT0A 1S1XB 2XZDB 4DI6A 2B9XA 2P6SA 1RTJB 4F04B 1RLCL 1C1BB 1S7HA 2GHPA 3NEKA 3MCSA 4WXWA 3S8SA 4LVOP 2YNIA 2CRLA 1T05B 2QA4S 4B9VA 2J0WA 1QDUB 2F4FA 3GWCA 3B54A 3NGDA 1DRZA 2FD2A 1JLCA 1B4SA 5DG8A 2JH3A 2KM8C 2N7YA 2KYZA 4HH1A 3ET6A 5L38A 4X65J 1UPPA 1EB0A 2PE8A 2H51B 4OI1A 1RA6A 1YI2S 3H8YA 1VLOA 2CWXA 1EX8A 2ZVSA 2HIYA 4LF1A 2EC0A 1VQ6S 2DBBA 3PG9A 1TUVA 4PEOA 1U4BA 1R0BG 3TUJC 3PFOA 1CQMA 3NG8A 1EARA 1RT2B 3IXQA 3ULHA 2H65B 4TYBA 1R8BA 1FFSB 3VAIA 3AB4B 3D66A 2V69A 2ZNYA 2OPSA 4ZOSA 4TKTA 2EC2A 3DRPA 3CDAA 4DSIA 4B3RF 4DV7F 2BMBA 3K17A 2XO7A 2VKRA 2HRUA 3OXLA 2LVWA 4DCOB 2HAFA 3BBCA 3W1YC 2HNDA 2BEFA 5HLFB 1X4CA 1Q16B 1RDRA 3G6VA 2ALZA 4OZJA 3NRBA 4M5DA 3UWTA 1YJ9S 1N33F 1TTHB 3CCES 4DR5J 1SUQA 2BKOA 1TVRA 1R27B 2IFXA 4HL9A 2WVDA 4CI0B 1FKOA 2M0GB 3C2PA 2BVZA 3CCWA 2XLKA 5KFFA 3Q8SB 3Q8VA 1FRJA 4B3SJ 3OV7A 5T14A 3BDPA 4CIOA 2M2BA 3AT1B 1Y5LB 2XLIA 2ZUAA 3N01A 2ZNZA 2I6WA 2B9WA 2DHGA 4MK8A 2GHWA 4B02A 4NXNJ 5K8MA 2AJQA 3MCMA 5KFWA 4WP9A 2CJ9A 1GMWD 1QSSA 3HMJG 4DQSA 2PMWA 4U6PA 2RD5C 2M7SA 1SV5B 5G0RB 5DDQC 1H72C 3HT3A 2GJFA 3J80Y 4YB5A 2YNHA 5L1LA 3VAJA 3KDOA 5K14A 2V67A 3U7JA 1U0SA 4FF3A 2YKMA 1N56A 3FCWA 3MPWA 5LOQA 1ZBTA 3B4MA 3ZTQA 1OJ4A 3K8WA 3G71S 1SIZA 2AGOA 5KFGA 2APOA 2IRXA 4QOTA 2C3MA 2PI4A 2B8PA 1VBYA 3LALA 3OXFA 4ATNA 3GV5B 3A3NB 4KY3A 2AJ1A 4CH7A 4FYVB 1F1BB 1BQNB 3W60A 2F3JA 3GIIA 2MKIA 3UD5A 4IR9A 1B99A 1S6OA 3GMGA 3G8TA 3LP1A 3ENVA 1R31A 3CJSA 2ZC3A 5D4NA 4ID8A 1XMQF 1RAHB 2R8JA 4K2XA 4DCPB 2V4QA 1CSJA 1NDPA 2DEJA 4E2FB 4NMXA 2EFNA 3UCGA 4DV4F 1TZ0A 1S6QB 4LJMA 2UUWA 1S1UB 2DR9A 3MEDA 4DL3A 3PRVA 1NRKA 1YRXA 3GV8B 1T3OA 2C3OA 3J7YI 1N36F 4TY8A 1KOOA 2HG4A 4QR0A 4FXVA 3VALA 1L3SA 4ZPDA 3WBZA 2NLWA 1N5QA 2ZJPQ 3UVJA 2CUYA 3HHLD 2X51A 2GS8A 3T9ZA 2DGXA 1D9AA 3S1TA 3IRXA 2C22A 2N82B 1DY3A 4N47A 4JV0A 4BCAA 5HP1A 2AGPA 3H4BA 3IR7B 3Q2SC 4XO0A 4ZCIA 2XMUA 3K5LA 4LR7A 5AJ3J 3H20A 1GK8A 1MW7A 3U1NA 3QIPA 2A18A 4MK9A 4B9MA 4NYZA 3OLBA 1V3RA 4NZ7A 2D7SA 3RUBL 1ZZFA 2QL5B 2OMLA 5L9NA 4NCBA 2UVWA 2FHMA 3QMQA 1N33J 5D4OA 2WHOA 2HNYA 3ISND 2XSJA 3HHNB 1ZM9A 3V4MA 2MHEA 3IO1A 3R7BB 3LP2A 3WX4A 5FLXU 1X9WA 3KWMA 1RHRB 5ETVA 4A4JA 1XNRF 1MMDA 4IG0B 1DTQA 3R5CA 2MLZA 2DXEA 1JJCB 4WFBQ 2BV3A 1QSLA 4DSLA 3TAMB 1H74A 4D3GA 2VPWB 2HFSA 2MQ8A 4J7CA 2J9DE 1DTTB 5HO4A 3EWGA 2GVZA 3D2WA 1KFDA 1HBMB 3Q22A 1U1NA 1Z2ZA 3J7YU 4AXJA 4MFBB 2PI5A 2DISA 5KT4A 4MIBA 3DN9A 3R6GB 4KPYA 3MECB 1J5EF 5C5JA 3FSIA 1U0HB 4OYWA 2VJVA 4G3IA 4YR2A 2BABA 5C24B 1VRTA 1PJ6A 3AODA 4JI3J 1T9YA 1M5HA 3TR5A 4NCAA 4Q5VA 4ZIVA 2ZM6F 4LF9F 4UQTA 4ICLB 1SC4B 2CPXA 3O1LA 2WBRA 2CZ4A 1H2UX 4N41A 1WC1A 2VPXB 2MKJA 4HTIA 3CCSS 3OVAA 2UUAJ 5J2PB 1AT1B 1YX2A 3GONA 3SXLA 1RCXB 4CP5A 1CC7A 2K06A 3ZZRA 2XLJA 4DOZA 4DFJA 3GFHA 5L1KA 1VQ5S 3P45B 1LW0B 2DGWA 1SKWA 1SBRA 4GKKF 2Y1IA 1RK8A 1V6HA 3MM9A 4LQ9A 1SQGA 2E9RX 2OSRA 1UVMA 4G1PA 3MPYA 2I1RA 4ED4A 3A1YG 1EAYC 2GO9A 2C2EA 1WI8A 2HGMA 3I0RB 2IDEA 1PSDA 1S49A 4PG6A 3RRHA 5AE2A 1U6FA 2XCAA 3D7SB 1Q4RA 4NI2A 4CYUB 1ICEB 1QY7A 1JIHA 2ZUGA 2DH7A 3CD5A 3W9JA 1QVGR 3O3LA 3QWPA 2QMXA 1YZ6A 3BR9A 2DR7A 2HRTA 5EWFA 1XR7A 5A76A 1CC8A 3M05A 1FJ7A 2DT9A 3EVMA 3MURP 2MZTA 2VC1A 1G6BA 3AJDA 3R27A 3MEEB 1JNRB 1JLBA 4KH0B 3Q8QB 1R7IA 4P71A 2WOMA 1LWCA 3IM9A 1KP6A 5DG9A 5HBMB 2UU9J 3W5XA 2LP4A 4C48A 1UW9A 4Q0BA 2OPQB 3SFGA 4KV8A 2WVFA 1WG5A 3MOJB 2M8DB 4A48A 4ZCMA 1IBMJ 4ZP8A 2V94A 2XG8A 1T8EA 4PXCA 1XQIA 3P4UB 2FPHX 4LUBA 1RAFB 4Q2MA 1TK0A 1A6LA 4ZLJA 2BQUA 3CW2C 2UUBF 1AFIA 3M8PB 1IJFB 4ID5B 1D9FA 3HULA 5I3QA 1AXQA 5J2NA 3K89A 1KLMA 2R8KA 2DVIA 1RHMB 4Y28C 4JOUA 2ZH3A 1KR4A 2I38A 1EETB 3D6FB 1HWJA 1DARA 2D9OA 4EBEA 4MJKA 2DRBA 4WU3A 2FVPA 3MM8A 3P5TL 3Q89A 4PQUA 3QZ7A 2IJFA 3H90A 1FX2A 2JC0A 1C4CA 2RIJA 5E3RA 2JC1A 2YNIB 2X1BA 1ZAWA 4UY8T 1WG4A 2LQJA 1NSQA 4KGZB 4LSLA 1GNKA 4TU7A 4XPCA 2YH0A 2OD4A 5RUBA 1JLCB 2R7RA 2QEXS 2F4VJ 3PHTA 1KFSA 3O6QA 1DLOA 2R2RA 2ZM6J 1WC3A 1WSVA 3ET6B 1VC0A 1KWMA 3LF0A 5D77A 4L74A 4MKVA 2Z58B 4C3MA 2W4PA 3DGPA 2JSXA 4RW8A 4DR3J 5B7WA 2Z4PA 1WC6A 4UOHA 2GCFA 2XZWA 2BANA 3OFFA 2OEJA 3AY0A 2OP5A 7AT1B 3V6HA 2F8HA 2VL1A 2WONA 3DLBA 2AYMA 3DRPB 1KQSR 2C42A 4A8XA 4Y2KA 2B6AA 3RG6A 3PX6A 4P2FA 5DZ7A 4RUAA 1UFKA 2ZOGA 3MCNA 3NY0A 4HHHA 3CULA 2D74B 3IWLA 3NGSA 1P9YA 4M5DB 2L9NA 1SUQB 1TVRB 1H0HB 1NJWA 1FKOB 3P49B 5BYQA 2UV8G 3JTPA 3TVKA 2Y3YA 2HHQA 3KLFA 3CE8A 2IM3A 1JB0C 4YUDA 4PZVA 4V1Ak 4JI0F 4X66J 4A8SA 4QIEA 3RBEA 2KG0A 3TEHB 4OQJA 1MROA 1FRXA 2IA0A 5F8GA 3PR4A 2J7KA 3RAQA 4DEZA 3PDNA 3KLVA 3SBMA 4C97A 4JI6F 2IVFB 3JB9k 3PW5A 3HT0A 4L75A 3KLHA 3ILJA 2FUG9 2CQCA 2M4MA 3H98A 2F40A 4I1TA 2J0QD 2YNHB 3AD9C 5K14B 3E51A 2ATCB 4OZLA 3ZXWA 2YKMB 4QR2A 2GGPA 2RHSB 4QIVA 3GP9A 1AZSB 2EG2A 1Y9OA 3ETOA 3FQLA 2ROEA 2PA3A 2BUNA 3JSMA 4LRAA 2JDJA 1RWOB 2Z2ZA 1PO6A 3JSRA 4KO0B 3CCQS 4FYWB 1OQ3A 2C2OB 1T94A 1FJGJ 2ATLA 4WFZA 3GZ7A 3RGIA 2BQ3A 5ETMA 4I4BA 3EICA 1RCOB 2GMLA 3MMJA 4P6QA 3G82A 3LP1B 4DFKA 3NKYA 3W8GA 1Y3KA 2E5HA 4WCEQ 3CXCR 3QT5A 4USVA 3ZFVA 5GAHI 1RAJA 4C0OC 4DR6J 2W9BB 1SL2A 4DV1J 3W5ZA 2ZJQQ 1BY9A 4B3OB 3E3XA 4F4XA 2XHWA 5F8NA 4LF8F 1FVQA 4LMZA 3MEDB 2H5IB 2HVEA 2BJ3A 2ZITA 1LFWA 4USIA 2VQEF 4TY8B 2VUGA 2J8AA 3C8YA 3W61A 5F3ZA 2HBRB 1F3VA 4NYOA 1LXJA 2MQLA 4CQ1A 4PR6A 3D0IE 2LKZA 3KHHA 3MTKA 2CVEA 3BS9A 4IOBA 4DG1A 4EO8A 2QO3A 4ED1A 1ZM4A 1KBRA 3OJSA 3VQTA 2EEYA 4CO0A 8AT1B 4N76A 3IRXB 1PKUA 3OR1A 1YTYA 2CNNB 1U1QA 1AUSL 3WZ0A 5HP1B 3UQSA 3TX8A 1S5ZA 2X3GA 1NH7A 3CNQP 1SL1A 4YEAA 5HROA 4GC7A 3BGFA 3OT9A 3J81j 2WTFA 4QR1A 3QIPB 5KFAA 4YOEA 3CD6S 4OFZA 3HHEA 4B9SA 2BXJA 2Y1JA 2A2CA 5KFTA 2J0SD 4X62J 3L3CA 1RT1B 3VVUA 3F0NA 3MHYA 3ZO7A 1T02A 1RA7A 1WEXA 2IPOB 3BSAA 2HNYB 3N5FA 2XSJB 2ASDA 2KXHA 1HWLA 2VF3A 1OPZA 4K4VA 2P9EA 4EEYA 4ES3A 4I0WA 5ADZA 1VQLS 1B70B 3ILIA 3M8QA 5GAHU 1DTQB 5EN1A 1T9UA 4JI0J 3HSDA 3LPEA 3BGRA 1X0FA 4DSFA 3ETMA 1SXLA 4I69A 1W26A 4K8RA 1Q1KA 1EP4A 3TAPA 4PYAA 4AFFA 1K0VA 1J2VA 4IFVA 1TUWA 3IM8A 4LFCF 3QT8A 3NGUA 1P6TA 5KT5A 1B0PA 3VAGA 4WE1A 3EDQB 2O1PA 5DG7A 4P9SA 2W8KA 1I51B 4UOFA 4X4VA 1NKEA 1VRTB 2AEJA 3C6TA 2ILZA 2MY8A 2Q6BA 3AOAA 1PYTA 1U7LA 2G2YA 2DJWA 4CCHA 1HI8A 4OYOA 3I96A 5EUHA 4KHPJ 2QG9B 4JI5J 4ZLPA 5IT4A 2CJQA 3H42A 4WTOB 1NJXA 1MWQA 1SCJB 2GQ2A 4FXWA 1HBUA 3ZTSA 4ER8A 1ZAVA 4K4UA 2RQCA 4C6AA 4ECZA 1D8ZA 2A6OA 3AJ2A 1IKXA 3CDEA 2EBGA 3BGOP 3OHAA 4IUFA 5JXSA 3H7HB 3OTOJ 1LWEA 4F4KA 1I6JA 1OY9A 2OGUA 5I3PA 3NBPA 4EZ9A 4W4MA 2L9DA 4I64A 2VQEJ 3DLHA 1RT3A 1G4CA 4ZN3A 4B9NA 3GYGA 2ZD1B 4Z37A 2NXUA 4L6V3 3MM7B 1YQHA 4F0HA 2R42A 3AOBA 1IKVA 2DGUA 2HS0A 1M5PC 4OYXA 1TL1B 2V8VA 3HHLA 1YJUA 3KHGA 5IOLA 3GG0A 1HNIA 1PJ7A 3H2LA 1VLYA 3BH7B 4ANDA 3BM7A 2AEFA 2J6UA 3N9UC 3L9ZA 4IRCA 1MNEA 2CPFA 5IWAF 3U1LA 1OPIA 1Y7PA 2H4WB 3GIJA 2HQIA 3RW7A 1BE4A 2QE5A 2E5LF 3R3TA 1V5VA 3R8YA 4HR2A 2WOMB 1LWCB 3CJ8A 4QWBA 2BOPA 1H7XA 3PZPA 5F0UA 3OBIA 2XMWA 4YR0A 1R8HA 4ZA1A 4Q0BB 3I55S 1V3SA 4DX8H 3HHDA 4QWEA 4KV8B 4JP8A 3BF4A 1YRUA 1O5JA 2R7WA 2DH8A 4MIAA 3MPVA 2R4FA 2YWGA 5DJBA 3T1HF 3UN5A 3QQCD 1U6BA 5DZ6A 3TZZA 1QVFR 4X4UA 1APSA 1RWUA 2MZ1A 2FVRA 1YHQS 2DNPA 4QPTA 4H4OA 3B78A 4NXMF 2G13A 3VGUA 4LF7J 1TU0B 3BV8A 4X4RA 5H9FJ 2V8HA 2EK6A 4DPOA 2V2KA 5FDLB 5DM7Q 4ZVGA 2MXYA 3B8HA 2LQ5A 1HNZF 3DLLQ 2V34A 4JI8J 3MM8B 4PQUB 1RWWB 4NLWA 4RNOA 4DLGA 3RW6A 2CG4A 3SV3A 2IHR1 3HDSA 5HN0A 2HFOA 4L76A 4TQRA 3GTYX 1TL3A 4LSLB 3BDEA 3TA2A 4QCLA 4XDCA 2Y0BB 3NGTA 1XWLA 1FE4A 4O0NA 1DLOB 2MLXA 2QX0A 3ZZ0A 1JKHA 1IQZA 4P2SA 3B82A 1FDBA 3DGPB 2FJVA 1N5SA 4B9LA 2GO8A 4LREA 3PTWA 1C2PA 2HFNA 1Q5YA 3SSSA 1QAYA 1HBOA 4EUVA 3T1AA 2AU0A 4NOHA 2BANB 3CIZA 4CNYA 1RADB 2L9WA 3Q86A 5J1EA 3CCJS 3FC9A 3EXYA 3RB3A 3T5LA 2C3PA 2B6AB 3BO4A 5E3CA 2ZH8A 3NGRA 1N6QA 3HD1A 5DM6Q 4YFUA 4BS2A 5KFMA 3FKBA 3FCVA 2DGTA 4YY3J 1E6VA 4DFMA 1NK7A 3BYPA 4HTJA 2MQQA 3RBXA 4JI1J 3PHEA 4M5JA 3H5UA 1ZPVA 2DCLA 4BDPA 4IH6A 5IQ6A 4Y0FA 4J91A 2UXCJ 3AQOA 3KLFB 4J37A 1I5OB 1T7PA 3QT7A 5HK4A 4XAKA 5KFRA 3QAEA 3SMZA 2AJ2A 2DXDA 4Q8EA 1RSCA 3A13A 4FYXB 2VG5B 3T1YF 5J2QB 4HKQA 1MROB 2BJ9A 4WFNQ 4K5SA 4AE5A 2HZVA 4X64J 2BW7A 4A47A 2ZBRA 2DRAA 1F5AA 2E5LJ 3CD0A 4YB6A 3SSQA 4BWJA 2E7XA 3KLHB 4LRFA 1HWKA 2HNZA 3U27A 1HNXF 4DUTA 1LEOA 1FE0A 2IYGA 4P73A 2F7VA 3FBEA 4W90B 3A4TA 3TX0A 2HFVA 5M2UA 5LL6d 5CAAA 4F2RA 2DCUB 1RLDA 2GGPB 1RHQB 4IO1A 3W7BA 3GYXB 5KTQA 2CQ1A 3BH6B 5KT3A 2FZGB 1JJHA 4A8WA 4QBUA 3JSMB 5B09A 2OEKA 2N3LA 4ZDNA 3NAIA 2NSCA 3MM6A 2RU3A 2BE2A 1HMVA 1VISA 4AL5A 3V6DB 1RQ0A 3IG1A 4UZBA 1CJKA 2UXDJ 4PKDB 2HPUA 2EFVA 5D4LA 5ETRA 4CT8A 1NSKL 2XY5A 2DEIA 3I87A 1WEZA 2XMTA 5HJYA 3OFEA 4FPIA 3NNCA 1XR6A 2I9SA 5IV3A 3KLIA 4ECYA 1BQMA 4R5PB 3MPDA 2F65A 3VAKA 4WKYA 4DX6A 1VRUA 2Z30B 2PFDA 3HD2A 3NL0A 4A8QA 2VDHA 3R2DJ 1UWBA 3C6UA 5ETTA 4EYIB 1HHQA 3FFIA 2H1YA 1SJ1A 3GSIA 1PCAA 4C0BA 4C2MA 3R2CJ 1F60B 3FCHA 1KTQA 4OX6A 2C2NA 2ACMA 1SB6A 2HHUA 5DDPC 3T3FA 3UI3A 2BACA 5D78A 1ZPWX 4WYLA 3KUEA 4JYAJ 1OWXA 1WNEA 2NXCA 3KJFB 4IQMA 4ZJLA 2M3DA 2FGOA 5HROB 3MXHP 3TOQA 4TQSA 3CJTA 5KFEA 2JWNA 2HFUA 2K1RA 1IBLJ 1MN9A 1KD1T 2B5JA 1NHVA 1FHTA 1EJ7L 3GR0A 3I56S 5MAOA 4NZ6A 4PWWA 5IS2A 4CLZA 1N5VA 2L08A 4I6WA 4HEA9 1FTCA 3CPWR 2D9PA 5HMWA 2W9AA 2BW2A 1PAUB 2BQRA 4N8OA 5A8RA 2MSSA 1NM2A 3M8QB 3NNHA 2VB6A 3BGRB 2O67A 2BJ7A 3MZIA 2ZE2A 5DO2A 2VG6B 1EP4B 2HIQA 2XC9A 2X7IA 4QWDA 5C2CA 2CPHA 1Z1ZA 2EKNA 4IFVB 1XIQA 5CYJA 4DUZJ 2B9EA 5JUMA 2PMZD 1E6YA 2WVBA 3MM5A 3AXMA 2OUGA 4JI4F 1HD1A 1Q8BA 3PW0A 1ZA1B 1VQOS 4AUKA 2XGPA 1HPZA 3DNCA 5GAEI 1Q95G 5DGAA 2CQIA 4DV0F 3K8VA 3C6TB 3M6VA 3HVTA 2W1BA 1FERA 4LFAF 3E8OA 1S79A 2XB2D 5K8NA 1AROP 2I5JA 5DS7A 4F0KA 4FS2A 4F4AA 1NK6A 2GAHC 1YDLA 4W98A 2PGCA 1KVIA 1QSYA 4L3NA 4KJIA 5KG6A 2E29A 4LF6J 1DFDA 3SEOA 4EGLA 4E0DA 1S1TA 1M90T 1EKSA 2ZBCA 8RUCA 4TXSA 3EE3A 3PFEA 2AP6A 3PY8A 1D8YA 4O3RA 1TKXB 1IKXB 1Y4ZB 2PD1A 3PO5A 3GG1A 2JVOA 4DPXA 4ZVUB 2WSEC 4TN2A 4MYUA 2OAUA 2V63A 4RR5A 3QFWA 2B56A 2DNYA 3V4IB 2R9LA 3I5CA 4B3TJ 3IRWP 6FD1A 3HKZD 1RT3B 4K4XA 1U8SA 1UL3A 4YQWA 2HW3A 5E7OB 1SPBP 4HDHA 1WORA 2XTJP 3NGKA 4ZN1A 1R0AA 1IKVB 2CZVC 3QO9A 3G4SS 3HFVA 3PKMA 3MPUB 5KFXA 2QLJB 1LQ9A 5D6GA 3HHLB 3JQKA 2KT3A 2HK3A 3KDNA 3BN7A 4HH0A 2Q1LA 1XERA 3V6JA 4Y65A 1VC5A 5GAEU 4DF8A 5AT1B 2QL7B 2BJDA 3FGVA 3HPOA 1G2EA 1X5SA 1VQKS 3QIDA 4DFPA 2UUCF 2WZ1A 2KL8A 3PEHA 2J9DA 1PAEX 2M88A 4F50A 2RQ4A 1D1UA 5J1PA 4M5KA 1DAXA 1X7VA 4YB1P 3D28A 1KSPA 2KYXA 4P2MA 4BLGA 3IBFB 2YQ0A 1OIAA 4KYZA 2V8DA 4OYAA 4C8NA 1FFGB 4RNMA 3M32B 4FNHA 3I5BA 1RB0A 3AOCA 4B3MJ 2A2DA 1RBOB 2MQNA 1NPRA 3KG1A 3MAAB 2WB4A 1IBKF 4MKAA 2ROGA 3THVA 2FLNA 2F1FA 1U49A 4H4OB 3US5A 5KFZA 3R1HA 4DV5J 3FSYA 2R7VA 2VQFF 3RR8A 5KG0A 1NK8A 4CWBA 4R0EA 3LGHA 4L3KA 1M5SA 4A8FA 1T3NA 5C25A 5CYMA 4Q7AA 4WK3A 1GT8A 3PKYA 1EHWA 4KGXB 5M2PA 2R7XA 3T9NA 2VZ9A 4UQGA 1FJEB 4LRBA 4EK2A 5I3UA 5LMNF 2ASYA 4C0HA 1UFLA 3ZZOA 1C0UA 2FJBB 4DX7A 1TL3B 2OKQA 5C42A 2IM1A 3GJQB 3L95X 2KB2A 1MU2A 1FVSA 1F5BA 2AF6A 2EKYA 1S0MA 3W66A 3LH2S 2F9JA 1EQMA 4DU7A 1LWXA 1S1WB 2DRDA 4J5OA 3ZZZA 1JKHB 3G96A 3MEKA 1NBEB 2Y0SD 4H4MA 3PVXA 3VF0B 1T95A 3OL8A 3SQGB 4C3KA 1F5CA 2JNJA 4URGA 5ETNA 1HBOB 2ASLA 3EGWB 1FRIA 4JB8B 2J6TA 4P7TA 5J1EB 3UR0A 4KE5A 1IN0A 2JLFA 1Q0NA 3BQ2A 4ZVEA 1IWAA 1X4BA 1N6QB 1Y5NB 5AE1A 2LXIA 1R6VA 2FHJD 2F63A 3CDWA 2P9GA 4BC7A 3W5YA 3MR2A 2ZFHA 1JLGA 1HNVA 1E6VB 5T7LB 4TNOA 4ZPCA 2E9TA 1MMNA 3KXDA 1WHXA 2CJYB 3OL7A 3IN5A 3ZTRA 3SCKE 4O4RA 5DLGA 4ZHRA 2QFJA 4YMEA 4ZMMA 5G4DA 3K57A 3N6MA 2QJ3A 1UVIA 2QSFA 4ZVOB 4QIGA 2XGQA 1HBNA 5LSOA 2CJXB 2FVQA 2R2UA 4O44A 1ZETA 1W7WA 2C3YA 1UEVA 3FUYA 2XWXA 5I42A 1YIJS 2G9OA 1D09B 2L3MA 2DNGA 4C3LA 2V4RA 3CC7S 4AYBD 2FJWA 4J9OA 4F8RA 1TKZA 3KLGB 1FEHA 4F02A 1BQXA 3QZ8A 1SKSA 2ZH7A 3NWRA 1GX5A 2HNZB 2OJ3A 3HKWA 5E3PA 3LP0A 3ENAA 1HKAA 2YPYA 1XMOJ 2DNMA 4NRTA 2MEWA 5F9NA 2F8MA 3KOAA 1VBKA 3GU0A 2ZBPA 4CDIA 9ATCB 3KK2B 1U2CA 1MLAA 2FLLA 3OXGA 2M70A 3DLGA 1UW4A 2V8GA 5KFUA 3GCWP 3GFYA 1W2IA 4P75A 1IQTA 3SIPB 3MM6B 3KJNB 2BE2B 3BBFA 1NPPA 1HMVB 2AMCB 2DO4A 3IG1B 2VQFJ 4KRWA 4YP3A 2UXBJ 2HBZB 5EX3A 5E33A 2RRNA 3TUIC 2W2NP 2B4PA 5A6PA 4X4OA 2R8IA 2CNOB 2Y1RI 3PJXA 2PEHA 4RWWA 1TL5A 1HNWJ 5L9XA 1KQGB 5KG2A 4O4GA 4ZP7A 1BQMB 2WSCC 4NLXA 4QWCA 1VK3A 3UD3P 2XO6A 2KFYA 3FEXB 2QZ8A 1UWBB 2J6SA 1VBZA 2B4VA 1RE1B 3FFIB 2HVDA 1KC8T 1YRTA 2IRYA 5KOWA 3Q2TC 1N0UA 3TP2A 3W9HA 1UA0A 3W63A 5CYQB 5KFYA 1YZ7A 4K7QA 3T5HA 2FJXA 1KDNA 2QLWA 3CO9A 2WCXA 2KU7A 4K4ZA 4RU9A 1UTAA 1IBCB 3AAWB 4ED7A 2H5EA 5EHHA 1SIWB 4UTGA 2HYIB 3M6WA 4ZVQB 2ZZTA 2RDDA 3JXOA 3MTJA 2K1RB 1Q8LA 4RW4A 4CH1A 2B5JB 3IAM9 4WWSA 4FP9A 2E44A 5KG1A 3BBBA 2G0CA 3UDLA 2JOQA 2OSQA 3F56A 3DRRA 2G2ZA 2WVEA 2J7UA 1XTZA 4DZ6A 2YX1A 3CTRA 3D6TB 1X4GA 4ECWA 4N56A 4WTYA 3QRQA 3DM2A 2EBEA 4ALZA 4NLGA 4DR5F 2VBXA 4CLFA 3CMQA 3NCPA 1IKWA 2HVZA 3QYYA 5E2QA 4C8OA 1SJQA 2QIFA 5KG4A 2IC3A 1JXEA 4WFYA 5F3TA 4PG7A 3BO3A 1F3FA 4B3SF 2M8HA 3L7UA 1Q82T 2ZE2B 3UD4P 8ATCB 3R5DA 5ETSA 2G4BA 3EDRB 3MM5B 3M8RA 1Y0HA 4DQRA 1ZYQA 3CGIA 3D68A 4M5GA 1SVDA 3LWMA 3DOMA 4GMKA 4NXNF 4ZVHA 4RNNA 1VC6A 3H2VE 3N79A 3MD1A 2W01A 5DGBA 1Y11A 1HARA 4LF5J 1JLQA 3G6YA 1IR0A 3HVTB 2HWIA 4U67Q 1RAIB 5F8MA 4DWIA 4FN5A 4DL5A 2OI2A 3PRDA 1HQUA 1JMTA 1NK9A 2I5JB 3QBCA 1Q86T 1H98A 3FQKA 4I7FB 2V2VA 3TJ9A 2ZH4A 1YJNS 2VOOA 2R7QA 2MGZB 5K9FA 4AXIA 1S1TB 5ETPA 3M8YA 2YWEA 2LECA 3FRYA 4ZPTR 4V19X 3IS9A 3VCDA 3CVKA 2GHVC 3VR1A 4NMLA 4IH7A 3LPYA 1RXOB 3TVZA 1HW9A 2BKPA 4LBIA 2VBWA 4RW7B 5DDRC 3DRXA 1HW8A 1UP1A 2KI2A 4NWBA 3MMCB 1RT4B 1S59A 4RU2A 2ROPA 3RR7A 3AJ1A 1BHNA 3MF5A 4DR1J 4HACA 3UW1A 1LXNA 3FVYA 1TV6A 2UUTA 1JXLA 3M8ZA 2H9ZA 4FZVA 1R0AB 3CDUA 5H9FK 2DNRA 3QO9B 1UWAA 5IC6B 5D0RA 3AA8A 3GJRB 1WD6A 4DL6A 1RTIA 1T03A 2DNHA 2R7SA 2HKEA 3SI8A 4DMZA 1FWPA 2IJRA 1YKWA 3MGJA 3LAKA 2IYIA 5ETKA 2LU1A 3JS9A 2MKCA 4WIQA 5CABA 3PJ9A 4M94A 2HHPA 2A3JA 2BA9A 3NOGA 1S6PA 1O6XA 2IVMA 2ZHBA 1BLUA 1HLWA 2BBEA 4BWMA 1UKUA 5E5NA 3VQSA 5AJ3F 3GIKA 4CLPA 3ILLA 1VQMS 2XYHB 1C1CA 2U2FA 4MTPA 4OIXA 2CQ0A 1VBXA 1OSDA 5BR8J 3FEYB 1K8AT 4OYBA 4YR3A 2P8IA 4PG4A 5HQLA 1FWKA 3DDNA 5J2MA 1M1KT 1S0VA 2WAQD 4DV6J 1RYSA 3MMBA 4IRDA 1M5KC 1WOPA 2E9ZA 5B0DA 2XSFA 1LFPA 2E1MC 2VONA 4OX9J 2FJEB 4A46A 3AXKA 5C25B 5CYMB 4NA3A 5KFBA 2CQ3A 3DI6A 3F44A 3KMSA 4NLDA 2CG8A 4KT0C 2P6TA 4O3QA 1Z2LA 2XS7A 3RRGA 1I94J 3VTIA 3PIPQ 1C0UB 3UPFA 2Z2MA 2VFVA 4M95A 2HWTA 2VFRA 2WK4A 5C42B 4O0IA 4OJ1A 3DYAA 2MZSA 4M8LA 1MU2B 3PJWA 3BSNA 1SKUB 4DN0A 4JI3F 1UETA 1S7IA 2KJVA 2H3EB 3NMRA 3ZZYA 2MKSA 3V81A 2MJUA 2P2CB 1H38A 4ILLA 4H4MB 2X1FA 1IR2A 2DGOA 3E2EA 1MWZA 3M30A 4TU9A 3D3CJ 1N52B 2EWHA 2YTCA 2VU5A 1IVZA 2E1PA 4WF9Q 1HWUA 3W3SA 3HHLC 3SQOP 1UMJA 4PWDA 2UUAF 1K44A 3PV8A 3M9MB 1X9SA 4DSJA 3G86A 3SYZA 2DNLA 2BJ1A 1NLKL 4KHMA 2D3ZA 2HHWA 4PG5A 1JK9B 3MOZA 1RTZA 5F9LA 3EUNA 1B64A 4ECXA 4O3NA 3RBDA 1VCTA 3GQCA 1D0EA 4EU0A 3DDIA 1OY6A 4JBCA 3HK2A 5HJXA 1F9FA 1JLGB 4O3SA 3K2YA 3C66A 1L5UA 3MWBA 5IV4A 4ZHRB 2Z56B 1ZM2A 3ITHA 4IFYA 1GAOA 2ACYA 2HS4A 1U2RA 1JJ2R 3RAXA 2DGSA 2FB0A 2CQBA 1HBNB 1R8AA 3DXBA 4O44B 2JEGA 1X4HA 2CXEA 1RACB 1YBUA 4RO0A 3LOUA 3Q23A 3TNVA 2BDPA 5HATA 3GSDA 3CF5Q 3PW2A 3D1QA 3KJVA 1DQAA 2OTLS 2DHXA 1TKZB 1F6TA 3NCRA 2AGQA 1RBLA 5LMUJ 3ILOA 2NPFA 4DS4A 3FZBA 1GMUA 4XK8C 2CA9A 4FNIA 1RWMB 2KKHA 2RQMA 3T6JA 2VKZG 2UU9F 4RWXA 2QLFB 2NUHA 1NPKA 2VG7B 4N5SA 1TMMA 3W9IA 2ZC4A 1IBMF 4USMA 2H5JB 3EVWA 2QSWA 5DQHA 3D6HB 3CMES 1RGVA 3THPA 2CJKA 4WFAQ 2D69A 2DIUA 3TARA 4EMDA 1RT2A 4YDDB 4F2SA 4L72B 2ZOFA 4WKRA 1LK5A 3O8WA 3SDEB 2JLGA 4RNFA 3NLCA 2L41A 2VPYB 2YNGA 3T5JA 3OLAA 3CD7A 2IJNA 1C0TA 2ZEJA 2KHDA 3UCZP 3R1LA 3DCAA 2W2MP 5MLCV 1IM4A 2JJ4D 4MKYA 4QW8A 4JV2A 1WG1A 3H4DA 3DGVA 4DV3J 4PXBA 3BB5A 3RYLA 4RBTA 3FK4A 1YJRA 2NR0A 3G8QA 1JX4A 3LANA 3V6KA 4LIRA 4WJBA 2IAJA 2ASJA 3R5GA 3R7NB 1SL0A 2ZWPA 1LKZA 2PMHA 1TR0A 3DOKA 3BR8A 2F4VF 2EFOA 4IYQA 1IR1A 3VZIA 4I6YA 2LXUA 5DQIA 3IGNA 1MN7A 3TA1A 1UCNA 3VAFA 2YY3A 2YQ3A 4DR3F 2WBMA 2YKOA 4PYDA 4ETZA 3UCUP 2XY7A 5CCMA 2BJEA 1VQYA 4BC9A 2EPIA 1KLNA 3KG0A 2ALYB 4LQ3A 4RW4B 3QAUA 5L39A 4RPFA 1S12A 4C8LA 1YBTA 1WKLA 2OD6A 4JV1A 3DRRB 1WHWA 3Q83A 2XWYA 3M8WA 3UN2A 1NHKL 3BPSP 4CTAA 1SJ3P 2KFZA 3HSZA 1B7FA 3DM2B 1B3TA 1FKPA 1UVKA 3B4DA 1X4DA 3JTOA 4HLBA 4DPUA 2WW4A 1JLFA 1IKWB 2GQQA 3D54A 3PACA 3HLUA 5IFMA 2IC3B 2KRBA 2GX8A 4CRJA 4RW6A 4H4KC 2W9CA 2E7VA 4Y00A 3HO1A 3VWSA 3DFEA 4DR4F 4X66F 5KT6A 3TJAA 4J9RA 5KFSA 2MKKA 1O51A 1HFEL 3WC0A 1S76D 3TWZA 5D0GA 1S1UA 2LDIA 3DOMB 1U1OA 2W7AA 4ZIWA 5A8WB 4I2PA 2RB7A 4DF4A 4DR7J 3J81U 3OFHA 3ZC4A 5ETQA 4DBQA 3GPAA 5A8KA 1PILA 2KG1A 3IMQJ 3JAMU 1JLQB 2VBYA 4Q45A 1HQEB 1URNA 1RWXB 1FXDA 2VH7A 1G1XA 4HT7A 4HDGA 1S1VA 5EDWA 1HQUB 2K8GA 1AA1B 1DBDA 5J1NA 2D3UA 4LBHA 2KN4A 1NU4A 1WDDA 5KOXA 2BE7D 2XQCA 2OH2A 2CWKA 1BWEA 4XPEA 3FJ2A 4MAKA 1WHYA 4K5RA 2DNOA 1FJGF 4K4YA 1TELA 2YX7A 3DRSA 5B0FA 1KTVA 3MI7X 3HSGA 1ITPA 5GAGI 4RX6A 3IS9B 4GKJJ 3W65A 5HVHA 2FC8A 1RWKB 4DR6F 5FLXY 1HI0P 4DV1F 4LSZB 1K73T 2YWKA 4ZK7M 4OHWA 4CO3A 3C16A 2HGNA 2QMWA 3MR5A 3H5YA 2RUSA 2LLZA 4U95A 3MDFA 3JQJA 3MUTP 4HACB 4Y34A 3WX8A 4QPXA 4CM2A 3KMQA 1NKCA 1TV6B 5F8LA 1S0NA 1NSPA 5L46A 1YJVA 4K59A 3UN3A 2JFKA 1VR6A 3HX9A 5CCLA 2NSBA 4UUXA 2HHHJ 1FFWB 3R5BA 3HM9A 6FDRA 4OLPA 4I56A 2POKA 4GVLA 4FF4A 2DK2A 1RTIB 3POTA 3LGMA 1T03B 1HL6A 1VYAA 2MZRA 5U47A 4F3MA 1DTTA 3FRZA 4ECTA 2E5JA 1GMVA 4ZVPB 4HT5A 4PWUA 1EZZB 3K5PA 1H3DA 1S6PB 4AT1B 1RI7A 1QE1A 1K47A 3AQPA 2OPSB 1LV5A 2HEKA 3GIRA 1C1CB 1TAQA 1SJ4P 5GMEA 2HMIA 3P5BP 2DPIA 2Z0GA 2ZHOA 3OTCA 5KFQA 4ZLLA 3MCOA 5C24A 2B8QA 2QA1A 4PUOA 1H2TZ 2RU9A 2HNDB 4X62F 3SSRA 5LJ3Y 4DU8A 5DQGA 3BPDA 4C8KA 3EVOA 3PX4A 2XNRA 3KK1A 4F4YA 5L8RC 2DTJA 2H48B 4U9RA 3D1OA 3PYDA 4M63A 1LK7A 3MMBB 1VQ8S 4LVNP 2RVJA 4NYPA 1TL7A 3NCQA 5GVQA 1RYRA 1PGZA 2LQBA 4ZPAA 4HVZA 4DR4J 1VI7A 2YXLA 4GRSA 3O2IA 3PIOQ 3A3OB 4NZ0A 4O23A 3ZZTA 1LW0A 5KFCA 3BKFA 3CB4A 3IFEA 3DI6B 1FXLA 7FDRA 1X8DA 2NCKL 3AD8C 2DITA 2O5DA 1UJ4A 5AXLA 2XNQA 4F7VA 2W4CA 1NNDA 2LYVA 1QAIA 1F9HA 2JHEA 1WJ9A 3AD7C 4NLYA 4DZDA 2DYAA 3DYAB 2PSZA 4CYUA 3TQ1A 1GTEA 5GADI 4DV2J 2WB1D 3SFUA 3HCXA 2Y8WA 3V81B 2B4OA 2ZDOA 4N8NA 3SV4A 4KHPF 1SC1B 4NX9A 1RTHA 4JI5F 5KFLA 4ILMA 5ETOA 4C4WA 4M5NA 4TLQA 2DGQA 3EPIA 3UNGC 4QW9A 2VOPA 3BJYA 4PWDB 4KAIA 4DUYF 3GCXP 1NH8A 3HHKA 5HAOA 5IM0A 2RJZA 4ECQA 3UDEA 2RSQA 1N32F 1CG2A 1RT7A 3Q0AA 5HMYA 3OTEA 4ZVRB 4F67A 2FC9A 2CAJA 3DLJA 4BHQA 2VC0A 3OTOF 1FO1A 2OPQA 3O5TB 4MIWA 1Z4UA 2XY6A 3M4XA 3TVYA 5CD4A 1LOUA 4OX7A 3QSYB 1WELA 3FDSA 1NDKA 4IFYB 1Q7LB 4HYKA 3W2WA 4LF4J 1LW2A 2CQGA 4X4SA 2Q6CA 3UVJB 4ED5A 3M2VA 1R8PA 4LR9A 4NLOA 4KR0B 2J8SA 4HHUA 2QTWA 1T9VA 1KHWA 5KFNA 3HVAA 1M5VC 2UVUA 2J76E 3C3LA 3BGLA 1FI4A 1ROFA 1YWXA 2MY7A 4R8UA 3WIUA 1MMLA 3EX7B 2BM0A 3C19A 5HVFA 3ELHA 5GADU 2FJAB 4E8UA 2XCPA 3CCVS 2R2TA 1V5IB 3C46A 3G6ES 4U8YA 1RHUB 1SC3B 3DU6A 4IDKA 3M6XA 1RT5A 3MFHA 4CLSA 2ZBQA 3OSPA 2OO4A 1RHJB 2ZKUA 4DL2A 4RBVA 3MUVP 1RHKB 1TFWA 4KBIA 4KGKA 3LP2B 1YK9A 3P3DA 3SZ2A 2KXNB 1RKJA 4WIIA 1PC4A 3RBZA 4ZITA 2AX0A 4V19J 4USWA 5KFHA 4LF7F 4H54A 2OIHA 2YNGB 1CS4A 4Q2LA 2GVZB 5LXYA 3DHXA 4TVAB 2KT5A 1URRA 1C0TB 4JI2F 3HXMA 4JI8F 5D15A 3S6EA 3KUGA 3BREA 4KHRA 2CJBA 2RAQA 1GMWA 4QJVA 2AKWB 3M8SA 2ZZNA 4DHVA 4USHA 5C7PA 4B9TA 2M9KA 3KYLA 4J9LA 2AYGA 2FY1A 5B0AA 2LCWA 1CVJA 2IAJB 2XULA 3EXCX 1ZH5A 2HHVA 4CLUA 2GAGC 4G1QA 4LSNA 1AFJA 1FRLA 3DOKB 3GLJA 1XK8A 1EQ0A 2A1BA 2HHTA 1U1PA 2BRLA 3LGNA 4WXOA 3MUMP 4CLKA 2C2MB 3A8IA 1HIYA 4DUYJ 1KVKA 3LWLA 3IP0A 2O3DA 4Z7YA 3B6BA 3CJQA 3IBCB 3CSKA 1RU1A 1N32J 1KS2A 2KVIA 4OHZA 1GXUA 3DU5A 4IR1A 2YKQA 2R8HA 3IBWA 2HQGA 3BQ1A 2VFTA 3QATA 4W92B 2AEMA 3MM9B 2MZQA 3BKTA 4GVBA 4OI6A 3P8BB 2GIRA 4URQU 3WC2A 3NMAA 2HHSA 2HSEB 4CTAB 4DPWA 1AZSA 3TZWA 4LRDA 4YY3F 2W2OP 3GJSB 4X4QA 3IA0A 4ECRA 1FKPB 1WC5A 4A8YA 1RAGB 2E1CA 5F41A 4KO0A 2AJ0A 4NI2B 2LDYA 1JLFB 2I0XA 4JI1F 1XEZA 3KKFA 2LMIA 2UXCF 2E1AA 4TYAA 4NE9C 2NZCA 2A6MA 4RW6B 2W9CB 3DC2A 3A8EA 4JI7J 2W9BA 3D4JA 1JLAA 2QFIA 4B3OA 1CLFA 2FHOB 3TI0A 4R0JA 2QMUB 1K1QA 4X64F 4CNZA 2CQHA 1JLBB 2CDQA 2MKYA 3OL9A 4CLTA 4I2PB 4KC5A 3MR3A 5KFKA 2DY1A 2RKIA 2B43A 1X0PA 5T41A 4J90A 5HL7Q 5A8KB 1FNOA 3QGIA 2EG1A 1W2BR 4ZVTB 3CCUS 4PXEA 5DRKA 2DGVA 1QM9A 4G1IA 2RE1A 2XBPA 3TAQA 2OTJS 4FF2A 1S1VB 3D0GE 1NUEA 5DLFA 1FEEA 1U1LA 3DLKA 3OUYA 2RRBA 2G0IA 4ENOA 2FVSA 1H7WA 5A6WA 2ZH6A 3K59A 4RJVA 2VJUA 1GH8A 1FNMA 1AB8A 2IDLA 1VQ4S 2CPDA 3TO8A 3WIVA 3I4HX 3JSBA 1VQ7S 3DRSB 4NEYA 1BMQB 2UXDF 5J2NB 1KLMB 4B3RJ 4DV7J 1NMEB 2VA2A 1KONA 2DNZA 5CA5A 1REVA 4JI2J 3VGVA 1SI9A 1RT1A 4OYPA 2CKWA 3ZNUA 3C16B 1JWWA 4P72A 2BX6A 1X60A 2V9WA 1PIEA 2W7OA 3TZXA 1VOMA 3K5OA 2QL9B 1Q8KA 1YBAA 3ZNJ1 1K9MT 4USKA 1SKRA 3HZEA 2K2PA 4UUWA 3GIMA 1JQGA 4HI1A 2KH9A 4IOAQ 3POTB 3W64A 4DQQA 3C15A 1G3OA 1S0OA 2JRSA 2NUUG 4RW8B 3OVBA 2MQPA 2EFGA 2LA4A 2G2OA 3KG4A 3H40A 2N4CA 2NQPA 4UF4A 2ZVIA 1NK5A 1VGYA 1QE1B 1CJVA 2PEBA 4JYAF 4FKXA 3ONQA 3QPIA 3VVTA 4Q44A 4I2QA 9RUBA 3NNAA 4YDXA 2WONB 4IOCQ 1VDHA 3VGSA 7FD1A 1Q78A 1RKIA 2HMIB 2PC6A 3D67A 1IBLF 2FJDB 3OD2A 2PIIA 4PUOB 1U1KA 1P1LA 1CJTA 3D1HA 2OPRA 3PCOB 3UFCX 3KK1B 4Y2AA 4ZPBA 4RUBA 2C2KB 1L3KA 1DQ9A 3FZ2A 5GMDA 2KO1A 2B7BB 3DLEA 1GTHA 4PAAA 1BC6A 3AB2B 2GFFA 2FHKA 1TL7B 2DHHA 3TUZC 4DPTA 4WFXA 2H4YB 1ZTTA 1UA1A 4M5MA 4LRCA 1XMQJ 1TP7A 5IQQA 3OJUA 3IAS9 4DV4J 1FKAF 1TAUA 1I3OB 3EMTA 2FDNA 3BN4A 2E66A 3BGUA 4DL4A 4DUZF 3CCZA 2LA6A 2RT3A 3PO4A 1JNZB 1CJUA 1N36J 2W2PP 2Y1LB 2RF2A 1NCLA 4P2XA 2YKNA 2MHNA 2ZD1A 3MM7A 4IO9Q 2M52A 4HHJA 2W24A 1IKYA 4M1KA 3IR5B 3IWXA 2DPJA 3BEGB 4UY85 5ETLA 3WDOA 1TL1A 1RTHB 4KKOA 1ZOTA 3X3UA 1WHVA 4QWAA 3QRPA 2BRKA 2OPPA 1VMBA 1O0PA 2V2ZA 5B0EA 2Q3PA 3EYZA 4LF6F 1C4AA 1S9EA 4ZJQA 3T6BA 1OSCA 1RABB 1AYEA 2MDAA 3AFGA 3G82B 3PM9A 2XS5A 2GMJA 4J9VA 1TMJA 1A9NB 5IM0B 4CH0S 2XMMA 4RW9A 4OMFG 2AZ3A 4DSKA 1RT7B 4J9NA 2GIQA 1RU2A 1M1GA 2BKNA 4Z7CA 5FD1A 4IH5A 3IWNC 4FPRA 2C2RA 3ISZA 2JEFA 2MB0B 4CO2A 1F2GA 4DCJB 3T5KA 4B3TF 2G1DA 3DMJA 1RISA 3M9OB 1T11A 1XNRJ 4RKUC 1UVNA 1PBUA 3W2WB 2RILA 2AW0A 1GX6A 3CEDA 1LW2B 4ANCA 2ZH1A 4DG1B 1Q79A 2AD9A 3M2VB 3LA0A 3R5AA 3WHIA 4J9MA 4M5LA 5FDLA 1N4LA 1U2FA 2MLYA 3OR1B 2CPZA 3W2VA 3SCLE 1QAXA 1VS3A 1U47A 1J5EJ 2XMAA 2V4JA 1Y10A 4R8UB 2JVRA 2LU2A 2YWWA 1S9FA 1PC5A 3BYRA 1R3NA 1HD0A 3D9BA 3H0PA 2RS2A 1T9XA 2E1RA 4QQBA 1SJFA 2FYXA 4RL1A 4IDKB 1OO0B 3PYGA 2OEMA 1RT5B 3UDCA 4LF9J 3RZAA 4ZCLA 1X5OA 3N6NA 4CO1A 1FDNA 1HWIA 4KH1B 2R8GA 3Q8UA 2IVYA 4B3MF 6AT1B 1TUGB 3RU0A 3NAHA 1OMSA 4KSEB 2XI2A 4OZ5A 3HJVA 4U96A 4EZ6A 1V3ZA 3EZ5A 1RWPB 3AHPA 4DV5F 2K3IA 1U8WA 4OX8A 2UVVA 3KLEA 2GJIA 3R7SB 1MWYA 2VPZB 4PXDA 5F8JA 4G6VB 2GZOA 1CS4B 2ZWOA 1IUJA 4GKKJ 3H59A 2C28A 5CZVA 4U7UK 3DKDA 3GB0A 1FDDA 3GR1A 4KIAA 1YVFA 3U1MA 3L4BC 2QV6A 3IGVA 4WE1B 4CLWA 2YNFA 1Y3JA 4I6AA 2HLUA 4ZP9A 1D9DA 2MQOA 1X9MA 4FYYB 1S57A 1Y5IB 1HHSA 1RAEB 4G1QB 4LSNB 2N7CA 4QU6A 2AJ4A 2MJNA 2EI5A 2GNKA 4DQPA 4R25A 5IT9U 5K8PA 4O3PA 2X3DA 1U09A 2MZJA 2VG5A 1EKRA 2A10A 2K7JA 1HBUB 2D3OR 5J2QA 2DHSA 5BJRA 2DNQA 2HQCA 2V0NA 4CLLA 2FIUA 2C1EB 5BXIA 4LT6A 2W7PA 2XI3A 3NP5A 3GILA 4OZ1A 1QUPA 1L3VA 5K5MA 3DXSX 1YJ7A 2OELA 5JVGQ 2AYBA 3G6XA 2CQDA 1LWEB 4AL6A 2CIMA 3I9V9 4GVBB 1UJ5A 3ZTOA 3F73A 2D3O1 1X5PA 3NBPB 4EBCA 5HQMA 2OHDA 3A8JA 2AWZA 3G9CA 1R89A 3CCLS 3W8PA 3KFWX 4CM0A 4A8OA 3I9ZA 4YN3B 4CZCA 3SCIE 5H1SV 2UUBJ 5KAKA 3V6DA 1AUDA 3GJTB 4ZPWR 1VQPS 3TA0A 2KZZA 2NYHA 4C8MA 3OHBA 4ZKAA 3K0JA 2W8LA 1HYSA 1N34F 4NA1A 4Y3CA 4Y2CA 3CCTA 1HNIB 1D3WA 1QJHA 2ZBIA 5L1JA 1JLAB 1LNQA 3QJJA 1PYOB 4R5PA 5B0GA 4EI2A 3KUHA 3N0VA 3QRRA 2FQQB 2CQ4A 1KRPA 3OTDA 1NDLA 2F5GA 2RKIB 3KJQB 1CQNA 4ED3A 2JEIA 3PEJA 4F36A 1XMOF 2COLA 3HP6A 1WKKA 4C8YA 1RP5A 4FKYA 4C98A 1BUXA 1UVJA 3DLKB 3OUYB 5SUHA 3OR2A 2DHAA 4ZS6A 2XEXA 5KG5A 1NB2A 3K5MA 2YVSA 5KFDA 1VJWA 2UP1A 2GC8A 5EGYA 5AXKA 1BXNA 1RT6A 2W25A 2UXBF 5LXRA 1Q7YT 2EFQA 4K50A 1B7YB 3SCJE 2L48A 3RRKA 1REVB 3Q8PB 2X1AA 1FCAA 2W2QP 3UE2A 1R6YA 3ENWA 3QT6A 3VGTA 1HNWF 5GMKa 3ENQA 2YBVA 2ABYA 1KEKA 5A0YA 1FNXH 2LXFA 2VA3A 3MMAA 2VASA 2ZH2A 1NJYA 1S72S 5B0BA 3UR3C 2B3TB 4J9SA 1X31C 5KG7A 4YS2A 1NHUA 4KFBA 3K7RA 4OI0A 5CD4H 4TU8A 2NYIA 4E98A 4ED0A 4GC6A 5AXNA 4USTA 1VHIA 1K1SA 3I31A 3M1VA 3MEGA 3FSXA 3CT9A 1GQEA 3J7A1 3F41A 1Q8IA 4ZVFA 2CVIA 3C15B 1RAOA 2MPUA 2VG6A 3ICLA 1YITS 2PT0A 2NZ4A 1L3TA 3FEZA 2HAIA 2RDIA 2Y8YA 4JI6J 4F26A 1CJVB 3TANA 2LEAA 4I2QB 1KQKA 4I67A 5KFJA 3TW0A 1F2HA 4ELVA 2KVQE 5E0OA 1GEHA 2CDRB 5IT9Y 2XHCA 2QA2A 4GO5X 5L1IA 4NRUA 4NCGA 1UVLA 1TKDA 4NL5A 2GQCA 5BYRA 1CJTB 4AD6A 4C11A 2OPRB 5LSRA 5H9EJ 2CPIA 3H25A 3CMAS 4X84A 4BBYA 1HA1A 4G65A 3DLEB 4OI4A 4QZVB 1UEKA 1YG0A 3K5NA 3C14A 2ZKTA 2ZH9A 4ED6A 2VFSA 2P9CA 3PR5B 4WP3A 4OLOA 1T9WA 5F8IA 1QTMA 1KKHA 1N34J 2XZTB
chains in the Genus database with same CATH topology
1Y5LB 1ZPWX 4K4YA 2XLIA 4WYLA 2YX7A 3DRSA 3N01A 1OWXA 1WNEA 2ZNZA 2B9WA 4IQMA 1TKXA 2DHGA 5B0FA 1KTVA 2M3DA 4MK8A 3MI7X 2FGOA 5HROB 2GHWA 4B02A 3MXHP 3TOQA 5GAGI 4RX6A 4TQSA 3IS9B 5K8MA 2AJQA 4IG3A 5KFEA 5KFWA 2JWNA 2CJ9A 2K1RA 2FC8A 4NLRA 2HLTA 4K4TA 5FLXY 5FIIA 1KD1T 1HI0P 4DV1F 2B5JA 1QSSA 4DR6F 3HMJG 1NHVA 4DQSA 1FHTA 3GR0A 1K73T 3CJKA 2YWKA 4U6PA 2RD5C 4ZK7M 3V4IA 2DH9A 4OHWA 3I56S 2M7SA 5MAOA 4NZ6A 3OQ2A 4CO3A 2HGNA 1SV5B 5IS2A 1I1GA 2QMWA 5G0RB 3MR5A 3H5YA 2JX2A 5DDQC 3HT3A 1KHVA 4CT9A 2RF2B 3J80Y 4YB5A 2YNHA 5L1LA 2LLZA 3VAJA 4YB7A 1N5VA 5K14A 2QYCA 2F8EX 2L08A 3K0JA 2HHWA 2YKNB 3U7JA 4FF3A 3MDFA 4EYHB 2YKMA 1N56A 3MUTP 4Y34A 4LF5F 3MPWA 4QPXA 3KMQA 4MKBA 2VFUA 1NKCA 5EX0A 4I6WA 1TV6B 1ZBTA 1FTCA 4HEA9 5F8LA 2D9PA 3CPWR 1S0NA 1IKYB 3B4MA 3HJFA 4QYZJ 1RTDA 3K8WA 1YJVA 2EW9A 4K59A 3G71S 1SIZA 2AGOA 5HMWA 5KFGA 2JFKA 2APOA 3HX9A 2W9AA 2R7UA 5CCLA 3RB6A 2IRXA 2NSBA 4UUXA 2BW2A 3HFKA 4QOTA 2BQRA 2C3MA 2JZ5A 2PI4A 4N8OA 3X1LB 1U24A 3R5BA 5A8RA 2MSSA 3HM9A 1VBYA 1VQ9S 2IBOA 3LALA 3OXFA 6FDRA 3M8QB 4OLPA 4ATNA 4KKOB 3GV5B 1IXKA 4I56A 2POKA 4FF4A 2DK2A 2HGLA 1RTIB 3CJ4A 3POTA 3LGMA 1T03B 2AJ1A 3NNHA 1HL6A 4CH7A 2VB6A 3QJLA 1HHTP 1BQNB 2OPPB 3BGRB 2MZRA 2F3JA 3GIIA 3PXGa 2O67A 2MKIA 5U47A 4F3MA 1DTTA 3FRZA 4IR9A 4ECTA 2E5JA 3MZIA 4HT5A 1S6OA 3DRYA 2ZE2A 4PWUA 5DO2A 2VG6B 1EP4B 3GMGA 2HIQA 2XC9A 3K5PA 3G8TA 3LP1A 1S9EB 3ENVA 2WSFC 1H3DA 4QWDA 1R31A 1S6PB 2CPHA 1Z1ZA 4ETXA 1RI7A 2ZC3A 5D4NA 5BYSA 4IFVB 5CYJA 4ID8A 1QE1A 1XMQF 5JUMA 2PMZD 1E6YA 3MM5A 2R8JA 4K2XA 1QUVA 3AQPA 2OPSB 3PW7A 2V4QA 1CSJA 1LV5A 4JI4F 4RW9B 1HD1A 1Q8BA 3PW0A 2EFNA 3UCGA 4DV4F 1TZ0A 1S6QB 1C1CB 1TAQA 4LJMA 2UUWA 1SJ4P 1VQOS 1S1UB 2HMIA 2VV5A 4KQZA 2DPIA 2Z0GA 3QGPA 2ZHOA 4AUKA 3OTCA 5KFQA 3KLIB 2XGPA 1HPZA 3DNCA 5GAEI 2DR9A 3MEDA 5C24A 4DL3A 2QA1A 4PUOA 1NRKA 1H2TZ 4ED2A 5DGAA <