2RKIB

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with a triazole derived nnrti
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
424
structure length
402
Chain Sequence
b'ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase (RT) p66
publication title Triazole derivatives as non-nucleoside inhibitors of HIV-1 reverse transcriptase-structure-activity relationships and crystallographic analysis.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 111
structure length 402
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2rkiB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rkiB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rkiB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rkiB04
2ZE2B 2V0NA 4NCGB 3ITHB 3KHGA 1JLQA 1XR6A 4ED2A 1REVB 2YKMB 1JLGA 5KFIA 5F8HA 3LP2B 5KG7A 4O4GB 1QAIA 5I3UA 2XI3A 3HVTA 4WYWA 4ECTA 3DLEB 3Q8SB 2ASLA 2HWHA 3IS9A 3QIPB 4MK8A 3BQ2A 3OHAA 1C0UB 4ECRA 3PR5B 2EC0A 2I1RA 4ECUA 3H5UA 4I7FB 2YNIB 4O44B 1HQUB 4O4RA 1BQMB 1EP4B 3DRSA 4K4UA 3DOKB 3DRPA 3KLGB 1JLCA 2IBKA 3KK1B 5KT7A 1N56A 2WOMA 1RYRA 1R0AA 5F9LA 2WONB 4FBTA 1RT7A 2HMIB 5HLFA 5L1IA 3SFUA 2BQ3A 3LALA 3OHBA 3RB0A 4FBUA 3KJVA 3C6UA 4WYLA 4F50A 1RT6A 1YVFA 4RW6B 5KFTA 4KE5A 2FVPA 1BQNA 3KNAA 1FKPA 2OPSA 1LWCA 3DI6B 3E01B 4ZPCA 5KG5A 4RW4B 3BJYA 4O3SA 1S9FA 1KLMB 1RA7A 1VRTA 2HNDB 4LQ9A 5EWFA 3DM2A 3NGDA 3QZ8A 4EYIB 3T5KA 3T5HA 3PJWA 3EPGA 1MMLA 4ZVFA 1JLQB 2UVUA 3H5SA 2HWIA 4EBCA 2JLEA 2IM1A 3I5BA 4QWCA 5F8LA 2XCAA 5I3UB 4IH6A 4KHRA 4KKOA 3HVTB 4IG3B 4PUOA 3QO9B 3M8PB 3KLIA 5HBMA 4ED8A 4NLDA 3I0RB 1T05A 3MECA 1S1VB 3TAMB 1IKVB 4TY8B 2IM2A 1ZETA 4IRDA 1TKTA 3BQ0A 2AGQA 4I2QB 4Q0BA 3CDEA 5DQIA 4RNMA 1HPZA 5KFKA 5J2PB 5HROA 3DRSB 4GC7A 2XGQA 1FK9B 4NYZA 1JLCB 1TL3A 1TKXA 4RW8A 3HKWA 4NLWA 1HYSA 4ED3A 3KK3A 3RB4A 5CYQB 4ZHRA 2W9BA 4Y3CA 5I42A 4YQWA 3MTKA 5DLFA 1JLAB 5KFRA 1RT1A 4IFYA 4LSNA 3KJVB 3C6UB 3CO9A 3HVWA 3GQCA 4ECVA 1RT6B 4XPEA 3PZPA 2FLLA 5C5JA 2IC3A 4XO0A 3DYAA 2BRLA 3KHLA 1FKPB 2YKNA 5DQGA 1LWCB 1K1QA 2WRMA 3SI8A 2C22A 1LW2B 4R8UA 5HP1A 5KFZA 5KFJA 1EETA 3OLAA 3HVAA 5KFUA 2UVWA 1NHVA 2ZE2A 3M9NB 2YNGA 4NLTA 2BR0A 3H40A 4Q8FA 2XWYA 4NLGA 3ITHA 5L1KA 1REVA 2YKMA 5J2QA 3DDKA 3T19A 3KLVA 4NLXA 1DLOA 2HNYB 2AQ4A 2FLPA 2IAJB 1RT5A 3IRXB 3CIZA 4IH5A 4TXSA 3H4BA 2IMWP 2XC9A 1N6QA 3MR2A 5DG8A 1QAJA 2VG5B 2ALZA 3GIIA 3Q8QB 1C0UA 5F8JA 3IGNA 1S4FA 5EDWA 4K50A 4Q44A 2YNIA 4WE1B 4ED6A 4YR2A 2UVVA 4EBDA 5KG1A 1S0MA 2J6UA 4TYBA 1TL3B 4M94A 3IGVA 1IKXB 2VG7B 3BGRA 1DTTB 4K4XA 1C1BB 5C25B 3KK1A 3V4IA 3KLFB 4ZHRB 4NLQA 4Y2AA 5EUHA 2W9BB 5I42B 4MKAA 2ILZA 4QWDA 2WONA 5KFXA 5DLGA 1RT1B 2HMIA 3H4DA 1RT3B 4IFYB 2R2RA 1RTIB 2FJXA 2JEGA 4FS1A 3PW5A 2IC3B 4RW6A 5KT5A 2YKNB 5F8NA 3CJ4A 4KHMA 5L9XA 2C2RA 4RW4A 1C0TA 3UQSA 1EETB 2HNDA 4IDKB 5KT4A 3QLHA 2IM3A 3CDUA 2YNGB 3N6MA 4NLVA 3KLHB 3MFHA 5JXSA 4Q43A 2WK4A 5J2QB 2DPJA 1DLOB 4LSLA 1T3NA 3UDLA 1RT5B 4IG3A 1QE1B 3QO9A 3M8PA 1N6QB 3I0RA 4URQU 4DL5A 3NAIA 3G6YA 4KBIA 4ZVHA 1S1VA 3TAMA 1IKVA 4TY8A 4QPXA 4IFVB 3BREA 3JYTA 5KT3A 1JLEB 4I2QA 4ZVEA 3CJ5A 5J2PA 3FSIA 1FK9A 1RTDB 3NMAA 2FVRA 1RT2B 4F4XA 3BGRB 1S1XB 2ASDA 3T1AA 3V4IB 3RB3A 3GYNA 1SH2A 4KV8A 5CYQA 3UR0A 4WFZA 4RNNA 4DL4A 2C2DA 2AGOA 4H54A 2OPRB 3V6DB 1C2PA 1JXLA 1JLAA 4YMEA 3MR3A 5L1LA 2UVRA 3FQLA 3C6TB 1KHVA 3MEEB 3ISNC 1HARA 2R2TA 4KSEB 5KG0A 3GV8B 3G6XA 4TN2A 4Q8EA 1LW2A 4ZP9A 5DGAA 1C0TB 2XCPA 4J9LA 4X2BA 4RU9A 5KFHA 2E9ZA 4F4WA 3QGGA 1S9GB 3FFIA 3QLHB 2W9CA 3V6KA 4RW7A 2I5JA 4NZ0A 4YR3A 3NBPB 4K4TA 4IR1A 3PW4A 4LSLB 1LW0A 2YNFB 3CWJA 2HNYA 5KFVA 5KFEA 2BANA 4J9OA 2IAJA 3IRXA 1TL1A 4KFBB 4WXOA 2RDJA 2GIRA 4EBEA 4H4OA 4MIAA 5KFMA 3OLBA 2VG5A 4EYHB 4KO0B 2OPQA 3JYTB 2IJFA 3MEGB 2IM0A 1C1CA 2RDIA 4NLPA 4O3QA 3BR9A 5D3GA 3TQ1A 3Q8PB 4J9SA 1TVRB 4WE1A 4DL2A 1S6PA 3DLGB 4IG0A 1TQLA 4NLRA 5DG9A 1OS5A 4JV1A 2QV6A 4RNHA 1RT4B 5EWEA 1IKXA 2VG7A 1DTTA 5KT2A 1C1BA 5C25A 4KV8B 3KLFA 4IRKA 1S1UB 1ZTTA 3MFIA 3M9OB 3LAMA 5DQHA 1LWEA 3EPIA 5F8GA 4U7CA 1RT3A 1RTJB 3N6LA 3MEDA 4ZPBA 1RTIA 3NAHA 4MKBA 4DL6A 1HNVA 5F8IA 3OSNA 4OL8A 2D3ZA 4GC6A 3PHEA 4O3NA 4ID5A 4ZP7A 5FDLA 2FLNA 5KFNA 5C24A 1KHWA 2W8LA 2YNHB 3JSMA 1SH0A 3RBEA 4R0EA 5KT6A 3NL0A 3FFIB 3CDWA 4IDKA 3HHKA 4Q45A 2W9CB 4RW7B 4K4YA 2I5JB 4ZVGA 3DLKA 3KLHA 2AX0A 4K4SA 1SH3A 1RYSA 2CKWA 1LW0B 1N5YA 5KG4A 2ASJA 2BANB 1N4LA 1QE1A 1TL1B 5KFPA 4KAIA 4G3IA 4J9PA 2FJVA 1FKOA 4H4OB 2JEFA 2WB4A 1IKWA 5T14A 4DL3A 2E9RX 2OPQB 1CSJA 4IFVA 3D5MA 4ED1A 1C1CB 1MU2B 3RB6A 5D3GB 1JLEA 2RF2B 2RKIB 4NLOA 4RNFA 2XGPA 1SUQA 3FQKA 1S6PB 1SV5A 2B5JB 4IG0B 4B3OB 2R2SA 3H5XA 4MH8A 1RTDA 3V6HA 1RT2A 1GX5A 4WZMA 1S1XA 2W8KA 3PW2A 4TY9A 1S10A 2E9TA 1NHUA 2AU0A 2R8JA 1LWEB 2OPRA 3SFGA 3V6DA 3OL9A 1JLFB 3MEDB 3CJ0A 3C6TA 1HNVB 1JLBB 3MEEA 4RW9B 2B43A 3UPFA 3M8QB 5DGBA 1D0EA 2R2UA 4ID5B 4DG1B 1HMVB 1HNIA 1TP7A 2IJNA 5FDLB 5KFWA 3GIJA 4J9RA 5C24B 1TV6B 3JSMB 2WHOA 4ECWA 2ILYA 1RTHB 3OL7A 3KHRA 4MFBA 4PQUB 1JX4A 1S9GA 5EWGA 3BSOA 5KFQA 3T5LA 2FVSA 2WCXA 4WFYA 4J9MA 3DLKB 4IH7A 2JC1A 3KK2A 3NBPA 4MK7A 1N5YB 4U6PA 5KFFA 2YNFA 5KG3A 1GX6A 4G1QB 4URSA 4LQ3A 4QWAA 3RAQA 1RAJA 3G6VA 2W7PA 1FKOB 3IG1B 4KFBA 2V4RA 3PJXA 1IKWB 3V81A 4FS2A 1S1TA 2W9AA 3LP0B 5K14A 5J2MA 5CYMB 4NRTA 3VQSA 4KO0A 3KLEA 3MEGA 4M95A 3H2LA 1LWFA 3G86A 5KFYA 1TKZA 4J9KA 1SUQB 1S1WA 1SV5B 2FVCA 1TVRA 5F8MA 3DLGA 4ZP6A 1IM4A 3GILA 2C2EA 1WNEA 1VRUB 5J1EB 1RDRA 1RT4A 4R5PB 1I6JA 2XI2A 2W7OA 5JUMA 4TQSA 2JEIA 3DMJB 1S1UA 4NLYA 2HAIA 3QGIA 3Q8RB 3OL6A 4PWDB 5KFCA 3GIMA 4IRCA 3I5AA 1RTJA 3GV5B 4NRUA 3BSAA 1K1SA 4K4ZA 3M9MB 3ISND 2VA2A 1IKYA 1HNIB 3DRRA 5KFGA 2YNHA 4NLSA 4YP3A 3LP1A 3DOLB 4MFBB 4EO8A 1N48A 3E51A 3EZUA 1J5OB 5KFOA 4JUZA 4ECSA 1S9EB 3KK2B 4Y2CA 1S6QA 4ICLA 4K4VA 4ED7A 3D28A 3QYYA 5KFDA 1DTQB 2OPPB 2HNZA 3KHHA 1T03B 3V81B 3KMSA 2B6AB 2R8IA 1S1TB 4XPCA 5K14B 3QGHA 2VG6B 5J2MB 1NNDA 4JV0A 4QW9A 3GV7B 4K4WA 3KLEB 1UWBA 3PW7A 2BQRA 1LWFB 1MU2A 1TKZB 5J2NA 3RBDA 2RF2A 1S1WB 2RKIA 4H4MB 3H5YA 2J6TA 4IKAA 4B3OA 2B5JA 1S48A 1U09A 5KFLA 4QWEA 4TQRA 3KMQA 2BE2A 4I2PA 2D41A 1JLGB 1T94A 1QUVA 3TVKA 3NKYA 3CJ3A 4IR9A 2V9WA 2AX1A 1JLFA 4ED0A 4RUAA 3IS9B 4RW9A 1JLBA 5KFSA 1HQEA 1W25A 1IKYB 3LAKA 3M8QA 3CJ2A 4DG1A 1HMVA 2V4QA 3DRRB 2OH2A 1JKHA 4WFXA 3MR6A 1TV6A 3CVKA 3ICLA 4QW8A 2VA3A 3LP1B 5KG2A 1RTHA 3LANA 4PQUA 1ZTWA 4O3PA 3DRPB 2DPIA 2WOMB 1JIHA 1R0AB 5C42A 3GIKA 3MF5A 4NLUA 4RZRA 4YR0A 1S6QB 4RNOA 4ICLB 3H59A 1RT7B 4DEZA 3BSNA 5KG6A 2D7SA 5HLFB 4EEYA 4G1QA 1XR7A 3N6NA 2FVQA 2HNZB 5KFAA 4HYKA 3OSPA 5KFBA 2R8KA 3IG1A 4F4ZA 4WZQA 1BQNB 3T5JA 3PVXA 2OPSB 3LP0A 3PR4A 3QZ7A 3RAXA 1UWBB 2F8EX 5CYMA 3I0SA 3V6JA 1Z4UA 2IA6A 5J2NB 2ZD1A 2J6SA 3BSCA 1VRTB 2FJWA 4ECYA 3DM2B 4ECQA 3KOAA 4TYAA 4O3RA 4ECXA 4ZPDA 2ZKUA 2BE2B 2O5DA 4I2PB 4RUCA 1S97A 1VRUA 5J1EA 4NCGA 2R8HA 4R5PA 2WTFA 3DMJA 3LP2A 1S0OA 4KKOB 4URGA 2C28A 4O4GA 4PWDA 4PUOB 2BQUA 1S0NA 3KLIB 5HBMB 3DLEA 4ZMMA 1T05B 3BQ1A 3MECB 1HQEB 3QIPA 4F4YA 2ATLA 3IN5A 2R8GA 4TLRA 3H98A 4ECZA 4MIBA 1JKHB 1TKTB 4KB7A 2D3UA 4Q0BB 3MR5A 4JV2A 3PW0A 1HPZB 4I7FA 4O44A 4IOBA 1HQUA 5HROB 1BQMA 1EP4A 3DOLA 3FRZA 1RA6A 2QE5A 4EO6A 4RW8B 1TKXB 1J5OA 1S49A 3DOKA 3KLGA 1HYSB 4J9NA 3KK3B 5C42B 3FDSA 1S9EA 1D1UA 2JC0A 4HKQA 4DL7A 4LSNB 5L1JA 2GIQA 3I5CA 1DTQA 2OPPA 2AWZA 2GC8A 2AGPA 4Y34A 4IQXA 1T03A 4J9QA 2B6AA 3DYAB 1XR5A 4QWBA 2UUWA 3QIDA 4ZPAA 5DG7A 2CJQA 2VG6A 3I0SB 4MK9A 5F9NA 2JEJA 3OL8A 3E01A 3DI6A 5HP1B 2BRKA 4R8UB 4ZP8A 2ZD1B 4O3OA 1KLMA 2UUTA 4H4MA 4WXWA
chains in the Genus database with same CATH superfamily
2DO4A 2LXIA 1FRLA 3I31A 3LP2B 2FJAB 3VR1A 2CQPA 3QIPB 4HLBA 2DO0A 5GMDA 5IT0A 3OTOJ 1J2VA 1SBRA 4UOHA 4DN9A 5HSPA 2ZBPA 1U0HB 5HAOA 3SFUA 3GR0A 3KJVA 2OSRA 1WC6A 4KGXB 2ZITA 4N77A 4DR7J 3OTEA 2R7VA 2XWXA 4RW4B 4K5RA 3POTB 3T5HA 3PJWA 2GGPB 1X4HA 5F8LA 1RKJA 1U6FA 1DQ8A 2XLIA 3MOZA 1OY8A 4DPXA 3UCZP 1DQAA 5HROA 2KKHA 3SQGB 2MSSA 2K2PA 4A47A 4EK2A 3G9CA 3HX9A 2W9BA 1C4CA 4LSNA 3PZPA 2HRTA 3CCJS 1KRPA 5HANA 2IY5B 3QSIA 5KFJA 2JFDA 2AZ3A 5H9EJ 1ZZNA 5L1KA 5J2QA 2JOQA 1S4FA 3ZC4A 1RUSA 3BN7A 3IGVA 3N28A 3KLFB 4JI1J 2OUGA 4MKAA 2UUBF 2RSQA 5DDRC 2JEGA 3IAM9 1YJRA 1Y11A 3CJRA 4JB8B 2A3JA 3KLHB 4GVBA 1FI4A 1T3NA 3NEKA 1VDHA 3QGPA 3TAMA 1YITS 3HK2A 3JYTA 1R8CA 3CJ5A 1WOSA 5CYJA 3RB3A 1JB0C 3R2DJ 4RBTA 2NZ4A 3SXLA 3LWLA 3ENQA 4OI3A 4DV5J 4WJBA 3K5PA 4CIOA 3D67A 4LF9F 4UY85 2BVZA 5CQGA 4FN5A 5KFVA 1MROB 1Q8KA 4KFBB 1UEVA 1Y3JA 2KI2A 2DD8S 3RRGA 3ZZTA 1U47A 3Q8PB 1R6VA 2V2QA 1TVRB 4WE1A 4G65A 4JV1A 1S1UB 3NOGA 2W24A 2VDIA 1KD1T 1RTJB 2NZCA 4UW2A 1HD0A 5IFMA 2GZOA 3C15A 1WC1A 4Q45A 4RW7B 1S79A 1RAFB 2EG2A 5E41A 4MAKA 1S99A 5JVHQ 1MSWD 5CCLA 3F0NA 1Q8LA 3FCHA 1GT8A 3OR1B 2C3OA 3NS7B 5A0YB 3W8PA 4LF8F 3EM1A 5CH7B 2VBYA 2XYGB 1ZPWX 1GAOA 1SC4B 2QA2A 2ZH7A 1HA1A 2HHVA 4MFBA 3T5LA 4WFYA 1B3TA 4MK7A 4U6PA 1G1XA 5KFFA 5KG3A 4URSA 3NNCA 2NS1B 3JTOA 2K06A 1NK5A 3G86A 4RPFA 1NEEA 4PWDB 1X4DA 2FC8A 5KFCA 1NRKA 2YKPA 1PYSB 4PYAA 1ZM9A 2VF3A 1S6QA 2VJUA 1TKDA 4HH0A 3PEJA 2ZHAA 1S6OA 4DV6F 4I6AA 1FFWB 4IKAA 3MUTP 1YZ7A 3T1YJ 3K5MA 2V9WA 3HHLA 1HQEA 3WZ0A 1B64A 4OYWA 1CS4B 1H7XA 3O2IA 2NQPA 4QIGA 2D7SA 2R7SA 4V1Ak 1TAQA 3T5JA 1Q53A 4YHHF 1VRTB 3H2VE 2O5DA 2R8HA 2CJAA 5D4NA 4JYAJ 4URGA 3QQCD 1KWMA 5DDOC 3DLEA 1U8SA 4F4YA 2N82B 4F26A 4Y2IA 4J9NA 3KLGA 4IOCQ 2XY6A 3RBZA 1KTQA 2EWHA 4LF7F 1R89A 1D1UA 1NMEB 2AGPA 2B6AA 2CJQA 4L75A 4R8UB 1S72S 5L38A 1NK4A 1U24A 5KG7A 1QAIA 2XI3A 3BO4A 2ASLA 1YJNS 1N33J 3FNNA 2KTQA 3MAAA 4NOHA 1JK9B 4I56A 4NXNJ 3H5UA 4K4UA 1DARA 1P6TA 1Y5LB 3A3OB 2WOMA 2IHR1 3AJDA 3D6HB 1OSCA 4OYZA 3C6UA 4AXJA 1BQNA 2HGMA 4F2RA 4GMKA 3E01B 3DI6B 1KLMB 4X62J 3NGDA 4JI6F 2RHQB 2KT3A 5I3UB 5HO4A 4HI1A 1RE1B 2E1MC 2YQ3A 2QZ8A 2QIFA 3VAJA 3NGUA 2VBZA 3KK3A 3ZNUA 4WU2A 4Y3CA 4CM2A 4ZLNA 1NDLA 2F7VA 5DM7Q 3CCSS 3HSJA 1K1QA 2C22A 2HFOA 1SJQA 5KFUA 2CQDA 4G1IA 1X5SA 3RAMA 2FLPA 1JMTA 4DPYA 3CIZA 2UXDJ 2QA1A 1VLYA 3UWTA 1TL7A 2APOA 2ZZMA 4OHVA 4YR2A 4ELVA 5KG1A 4GKJF 2DYAA 3MCNA 3G2XA 3PX4A 1T11A 2E1CA 3GYGA 2UUCJ 2DNQA 1EETB 1GTHA 1WI6A 5KT4A 3QLHA 3P45B 4I4BA 2J0WA 4F02A 4NYOA 5IM0B 1AB8A 2IVFB 3M8PA 2E7XA 3NWGA 1RWMB 1D8ZA 1W2IA 2KN4A 2FVRA 2B56A 1DFDA 1WEYA 4HR2A 1Q0NA 2C2DA 4B3MF 1KHVA 2RIJA 4KSEB 1J5EF 4QIWD 3LO3A 4X4VA 1IR1A 2HBQB 2XCPA 5KFHA 2W9CA 2E5LJ 1TUWA 3R2CJ 4NPOA 4IR1A 2QC3A 2NR0A 1TL1A 3J7A1 1RP5A 4H4OA 4RUHA 1HHQA 1VISA 5CD4A 3D9BA 2IJFA 2RNEA 1N0VC 3BR9A 2GVDB 9ATCB 2XYHB 3SSQA 1YX2A 1RLDA 3CCES 3DDNA 2C3MA 2VG7A 2F5GA 1RWPB 3BGUA 4QR1A 1T9XA 1RT3A 1N52B 3PHTA 1P27B 2D3ZA 2X1AA 2CQ0A 5FDLA 3IFEA 4A8KA 1U1OA 2HIYA 2I5JB 4ZVGA 2ASJA 4XK8C 1X9WA 2BANB 2DIVA 1FFGB 4IFVA 1PGZA 4PXEA 5D3GB 3H5XA 2XY5A 4JI2F 1S77D 2GVZB 3V6DA 3BBCA 1XMOF 2MQQA 2FGOA 1HMVB 1TV6B 2HK2A 2PI4A 2M88A 3DLBA 3KK2A 5K8OA 2XM3A 2DRBA 4LFBJ 3LGHA 1H38A 1C4AA 4PAAA 1S12A 1OYDA 2V6AA 6FDRA 3W60A 4C2MA 1RKIA 1Y5IB 5SZTA 3S01A 3MM7A 3M32B 4A48A 2D74B 3WHIA 2OPPB 3HT3A 3GV7B 4K4WA 2JZ5A 1I51B 3RGIA 1RWKB 1VRQC 3W2WB 2V4JA 3VALA 1TR0A 1HWKA 2YH0A 3OVAA 5AJ3F 4QW8A 3OUYA 4OYPA 2V8PA 2PDAA 4RLEA 2K3KA 1FJ7A 1R0AB 5C42A 4A8SA 3THVA 1DQ9A 4CO4A 2OPSB 1O0PA 2IBOA 1M0SA 2V50A 2V2ZA 2R7UA 1UJ5A 3DM2B 3VGVA 4Z2XA 2M5YA 3AA8A 5HQ8A 1MWQA 1S97A 3ENWA 4NCGA 3DXSX 1S7IA 2C28A 2BOAA 3VAIA 2ATLA 1H98A 2VQEF 2E44A 1L3UA 4DR2J 1VCTA 3N01A 2QFIA 3D7SB 1S76D 1UA0A 4FXDA 5IZHA 3H0PA 1Q1KA 3IR6B 1F5CA 3DC2A 3MXHP 4ZP8A 1Q8IA 3BBFA 2AEMA 1TELA 2V8GA 4BCAA 1REVB 2ZH4A 5B0GA 3O1LA 1OWXA 3LOUA 2XO7A 3E3XA 7FD1A 3OHAA 2FQQB 2I6WA 2YNIB 1HQUB 4PRFA 1X9MA 2M2BA 2DR6A 1CJVA 2HMIB 3LALA 2CNKB 2UU9F 3D2WA 2N4CA 3PX0A 4BS2A 1RA7A 4CQ1A 3EPGA 3H5SA 4F3MA 1UWAA 2F40A 2DHHA 1F9EB 1VQ7S 3KLIA 3MECA 3GU0A 1HBNA 2EFGA 3FK4A 2JWNA 1YI2S 1X4BA 3D0IE 5BJRA 4RW8A 1N5TA 1ZAXA 1QAXA 1LFWA 3R5CA 3LA0A 3QAEA 2JVOA 4UT4A 1MNEA 1FKPB 2YKNA 1XMQF 2RQKA 4DBQA 3BGLA 3HVAA 1WC0A 3MPVA 5BYSA 1UZDA 4NI2A 3JTNA 2ZHOA 2XWYA 3HSZA 4IH5A 1MWYA 4OYBA 2PFFB 1N6QA 4L76A 2VG5B 4B9SA 1S57A 5D0GA 3PKMA 3GG0A 5BR8J 1S0MA 3DGPB 1C1BB 4DDFA 3BM7A 5I42B 2KG1A 1U2CA 2RS2A 4RW6A 1CLFA 4KHMA 1UCNA 3OTOF 4LRBA 4IDKB 4KPCA 3GJTB 1TUGB 5JXSA 1RCXB 3FZ2A 2CQ1A 3PM9A 3G6YA 1IKVA 4Y2KA 1WG5A 3O6QA 2P9GA 4ETXA 4DR7F 2XHWA 1CJTB 2MTLA 3MUVP 3ILLA 3LQVA 2N3OA 4HTIA 3TARA 4KGMA 2FB0A 2Q43A 1Q86T 4Q8EA 1C0TB 1CC8A 1F2GA 2XSFA 3V6KA 3BZQA 5DZ7A 1OYEA 5T41A 1UA1A 4MYTA 5ETKA 4KO0B 3D6FB 2MQOA 4O3QA 2ZEJA 4OI6A 1RT4B 2ZM6J 3M9OB 1AXQA 1Q8BA 3NAHA 3PNIA 2XBPA 4X4SA 4ZP7A 2NXEA 3D0HE 3FFIB 3HHKA 2RDDA 4JI1F 3SSRA 4C8OA 1KLNA 5H9EK 3H90A 3FRYA 4C8MA 2MJUA 4RNFA 1S6PB 1WHYA 1J27A 3KTQA 2KHDA 3SFGA 2A1BA 1FRIA 4HT7A 1D0EA 1PJ5A 3JSMB 3TZYA 3I4HX 1NAQA 2DY1A 2YWHA 3NBPA 4QU6A 4JI4J 2X1GA 3ET6B 2X7IA 1IKWB 2AF6A 2W9AA 3VCDA 3MEGA 3OFHA 4DV5F 1LWFA 3TX0A 1SUQB 3NNHA 3KJNB 1G7CB 4R5PB 3VTIA 5JUMA 4NX9A 1RWVB 3TJ9A 1IVZA 3DRRA 4F7VA 1N48A 2B3TB 2L41A 4Y2CA 1WHWA 1VFJA 4IO9Q 1NH7A 3GYXB 5DS7A 3B8HA 3AFGA 2XHCA 4A8YA 3M8WA 3AAWB 3DFEA 3M2UA 3UN5A 1L3KA 3JB9k 3BGOP 5IQ6A 1NBEB 5B0AA 3D6TB 4XDDA 4ED4A 1SKWA 1G2EA 1V6HA 3F44A 3MF5A 4PYDA 1NK7A 2R8KA 4CH1A 1Z4UA 2J9CA 5J2NB 2FJWA 1NDPA 2CFXA 4EUVA 2YWEA 2G2OA 1R7IA 4ZS6A 3S1TA 2DR7A 2CJ9A 2BDPA 1NUEA 4ECZA 2XMJA 1UVLA 4AL5A 5MAOA 3MR5A 4JV2A 2X1FA 3RU0A 5HROB 2DHSA 3KKFA 1RHKB 1CJKA 4X4RA 2F9JA 4ILLA 1M5SA 4EGLA 4LSNB 1HNWJ 4FYYB 1XR5A 2RU3A 2IRYA 4OZ0A 3TVZA 3IWLA 2DGWA 2QL9B 5F3TA 3G71S 4O4GB 3UE2A 1ZH5A 2AV5A 1HL6A 4FXVA 3BQ2A 1WTFA 1BQMB 3AXMA 3CTRA 1PIEA 4FBUA 4QR2A 2LEBA 1YVFA 3T1YF 3TYTA 1LWCA 4X64F 2KM8B 2CA9A 4PG8A 4LF2A 4GVBB 3PFEA 4KHRA 2N7CA 3H7HB 2XQCA 4OI0A 2C3UA 3TAMB 1B0PA 1ZETA 3CCRS 1Y4ZB 3BQ0A 3W1YC 5DQIA 2X1BA 1VOMA 1JJ4A 1TL3A 3BKUA 4ED3A 2K7JA 3N5BA 3MTKA 4YS2A 2IA0A 2BOPA 1RZMA 2YQ0A 4KH0B 2LCWA 1KBRA 3S7RA 3IO1A 1OPZA 1P1LA 4N56A 4F3OA 5IV3A 2KL8A 3HCXA 3AB2B 3DDKA 4CO1A 3WQPA 2IMWP 5DG8A 2K3IA 4OX8A 2MKJA 3M8YA 3RW6A 4WE1B 1X31C 1CULA 4WBFA 3QNWB 4IFYB 1SL0A 1VQOS 5L8RC 2EKYA 1VIXA 2W4CA 1N33F 1X4AA 3CJ4A 2ZOFA 4NXNF 1S4EA 4N8NA 2MLZA 2YWGA 4DL5A 1E6VB 2CYYA 1N88A 5KT3A 4I2QA 2J0QD 3Q0AA 3J81j 4X62F 3T1AA 2M9KA 3QT5A 3UR0A 2AGOA 3MM6A 3W2VA 5D6GA 3M30A 3W5XA 2VPZB 5GADU 4TN2A 5L46A 1M5HA 3ZZOA 3M2VA 2HURA 2BKPA 4Z37A 3KFWX 4DHVA 3W63A 2B0GA 3OD2A 3FCVA 3TQEA 2AP6A 1NK8A 3NG8A 2J0XA 4ED5A 2VPWB 1HNXJ 1V3SA 2EBGA 3HSGA 1NO8A 1DTTA 4KV8B 3HFZB 1KQFB 4K5SA 3LAMA 3M6UA 2FLOA 3N6LA 1BD6A 3OSNA 1RAEB 4OL8A 4O3NA 3HULA 2UXDF 1JJ2R 2I38A 4KGKA 3QRPA 1N4LA 2FGCA 3NGKA 1U4BA 3D5MA 3D3CJ 2UUCF 4WF9Q 2HAFA 3R8YA 4DMZA 1S1XA 1BLUA 2AU0A 1LWEB 1X8DA 4CH7A 4ZCIA 1R8AA 3T1HJ 3HHLB 3DKDA 2Y8YA 2HFZA 1JWWA 1D9FA 4ECWA 3W62A 2FVSA 3C14A 2YNFA 2FJEB 1GFWB 5J2MA 1JXEA 1M5VC 2YX4A 1R8BA 2C2EA 2E5LF 1RI7A 1F3VA 4N76A 3L7PA 3PRBA 1UAWA 4F0MA 4U7UK 2KXHA 4M1KA 2ZJRQ 5BXIA 3Q89A 1HFEL 4ICLA 5E3CA 2DGOA 3V81B 2B6AB 4I67A 4QW9A 4PG4A 2VC1A 4KIAA 3KLEB 3R9LA 2J8AA 2PGCA 5BYRA 4TQRA 1PG5B 2G0JA 2VQFJ 4DUYJ 4OX6A 2ZH8A 2C42A 3M6WA 1JKHA 3MR6A 3J7ZT 1KSPA 3SCJE 2WOMB 1RADB 1N0UA 5HQMA 2EK6A 3K89A 2MQLA 1BQNB 2MZRA 3JQJA 2IA6A 4BDPA 1T02A 4A8WA 3WC0A 4DV1J 4NWBA 3LP2A 2IDLA 2VDHA 2XS7A 2RRNA 3MEKA 1BWVA 4P6QA 3QIPA 4LFBF 5M2RA 3W9IA 1RA6A 1CG2A 4DPOA 2D69A 3KK3B 2ZC3A 2J9DE 1U1QA 1U0HA 4ZLJA 5DO2A 1Q79A 3OJUA 4QWBA 3QIDA 2PO4A 5F9NA 3TUIC 4WU3A 1NZAA 3POTA 2JSXA 4ZVOB 3KHGA 2GGPA 2BABA 4QYRA 3OTDA 4ECTA 4FPRA 1AYEA 2RRAA 1TMJA 5DJBA 1FJGJ 4Y28C 4I7FB 1X5PA 2ZOGA 3U1LA 5ITHA 2IBKA 5ETRA 3CULA 5AE1A 4LR9A 3RB0A 7AT1B 4OMFG 2QX0A 4TVAB 1KQGB 4LQ9A 3HZEA 3EGNA 2NSBA 3RJMB 1KFSA 2VFSA 3BR8A 3UCUP 4FNIA 3L95X 2R3VA 3M8PB 1RAHB 1B70B 4P7TA 3LGNA 2NPFA 1XEZA 2HG4A 3UO0A 4LVNP 3FBEA 1TKXA 2GMHA 2JFKA 2DGUA 3HVWA 5LMUJ 1WTBA 1DZ5A 4WPAA 4ECVA 1VS3A 2WRMA 5B0CA 2F8MA 2BV3A 5U47A 1NHVA 1VQYA 4DR2F 5DM6Q 2HVEA 1B0TA 1C0UA 4I69A 1RWNB 2UVVA 4M94A 2VG7B 2H48B 3M8ZA 1RT3B 1I1GA 1IWAA 4PABA 3PW5A 3HO1A 2XMMA 5GVQA 1Q82T 4HL9A 4B9NA 2XB2D 3PACA 4FYDA 1F60B 2BYCA 1MROA 2KZZA 3T9ZA 1VC6A 4TY8A 4IFVB 4XAKA 3QWPA 1YRUA 3FUYA 1B7FA 2C2OB 2ZH9A 3V6DB 4X4OA 4YMEA 3RR7A 2O67A 4BC7A 4X2BA 1N8RT 2E9ZA 1YWXA 2MYFA 3PCOB 4RW7A 1EZZB 5GAEU 3JAMU 3R6LB 2J5AA 3IRXA 3MM5B 4MKVA 4EBEA 4LREA 1FNOA 2EEYA 2LU2A 3OLBA 1QDUB 4DZDA 3GWCA 2LQ8A 4IQMA 2DNYA 4C0BA 5KT2A 2J7UA 5M2UA 1ZZFA 1ZTTA 4H4KA 4PWWA 4ZIVA 4U7CA 5A0YA 4GC6A 2H9ZA 1WJ9A 3MM7B 2LVWA 3NL0A 1PILA 5BR8F 2ZOMA 2V67A 4MT1A 1LW0B 1VK8A 5KG4A 3IM9A 3CCQS 1O51A 1WG1A 4O23A 2FJVA 2XTJP 4LRDA 2E9RX 1B4SA 1RTDA 4X84A 3G8TA 1YLXA 4CO3A 2GCFA 3K5OA 1L3VA 2YY3A 2B9YA 3CJ0A 3FEXB 3C6TA 1HNVB 5DGBA 4DFJA 2ILYA 3W3SA 2LQ9A 3VZIA 2D9OA 2ROPA 3DLKB 1FX2A 1N5YB 1IXKA 3DU5A 3G6VA 1ROFA 4FS2A 3WIVA 1K9MT 2NXCA 4DS4A 2WAQD 4YB7A 2DVIA 2ZH2A 3NGSA 3B4MA 3HFKA 1YSJA 5IXUA 4LFCJ 3ZTPA 1YZ6A 2WVFA 3FEZA 2YNHA 2O66A 1CS4A 3N0VA 5HMYA 1PO6A 2MEWA 2CG4A 1N36J 4MKYA 2OIHA 1WEZA 2V5HG 1S1TB 4Y2MA 2VJVA 3AJ2A 1NNDA 1MU2A 3SCLE 1SC1B 2DR8A 2J6TA 2HQCA 4B3OA 2B5JA 1S48A 2BJ9A 3SBMA 3BV8A 3CJ3A 2AX1A 4ZPVR 1ITPA 3LANA 4Q2LA 1X4FA 1XNRJ 1CJVB 2CRLA 4CLLA 2HNZB 5KFAA 2FIUA 3GTYX 5HMZA 4X4UA 4ZVUB 2MB0B 3DMJA 2W25A 3KLIB 4JI4F 3W9JA 3MECB 1HBNB 2PEBA 4U8VA 4AL7A 4MIWA 4CNYA 1FKAF 4RW8B 1OJ4A 1HI1A 3OFEA 3EWGA 1YIJS 2AWZA 4A8FA 3E01A 3DI6A 3WDOA 1KLMA 4NASA 4NI2B 3CC4S 1RAAB 2DNKA 4JV5F 5CHCB 5I3UA 3SV4A 4K8RA 3Q8SB 1KR4A 4DV0J 4PPZA 4Q7AA 2I1RA 2GHPA 4ECUA 1DBDA 5FLXU 3QT6A 5KT7A 4BWMA 2O01C 1FWLA 4RW6B 2FVPA 3K0JA 2QO3A 5B0EA 1TK5A 1L3SA 2GAHC 2R7QA 4F0KA 1MG7A 2JNJA 2YPYA 3EICA 3RR8A 3VV2B 5HBMA 1T05A 3JSYA 1IKVB 2IM2A 3MM8A 3CDEA 3F56A 2CQIA 3OR2A 2VIHA 5CZXA 1N54B 1RT6B 4X65J 2ZVIA 1K44A 1WG4A 3L9ZA 4IYQA 5A76A 1EETA 3FMBA 4KJIA 2BJ7A 1ZM2A 5IM0A 2OTLS 3CE8A 4UQGA 3H4BA 2DITA 1BC6A 4J90A 3MR2A 4I6YA 1HNWF 1CBKA 3PDNA 1SJ1A 4Y2AA 1WORA 1U49A 2IPOB 2ZUAA 3CSKA 4R25A 4F4KA 4HACA 3CJSA 4KTQA 2WK4A 1DLOB 4IG3A 1T8EA 3RRHA 2LEPA 3OTBA 4AQYJ 4CLUA 1UPMB 4PZVA 3P96A 2HQ3A 2RUSA 5D15A 2GVDA 1HBMA 1FK9A 4ES1A 4RNNA 4DL4A 2FZCB 4JI7J 3WC2A 2R42A 1NSKL 3K5LA 1Q7LB 2BM1A 3QGGA 3CT9A 4KGZB 1HQ2A 3TUPA 2I5JA 3NBPB 1DJ0A 3GSIA 2E7WA 4TKTA 4LF6F 2BANA 2A6MA 1IBLJ 2BX6A 2GIRA 2Y1JA 3MEGB 5D3GA 4ES2A 4DXLA 5DDQC 1XJWB 1TL5A 2QV6A 5C25A 3CCUS 3ZTOA 1FDDA 3U27A 3KDNA 4DWIA 1VI7A 5B09A 2XY7A 4K4YA 1F0XA 2KHCA 1BGXT 2VD3A 4OV6A 2GA7A 1JLEA 2QSWA 3FQKA 4IG0B 1D9DA 4DQQA 3MCMA 4WZMA 2RQMA 4NMXA 1NHUA 5A8RA 1OQ3A 3MEDB 4CO2A 2DNHA 4HH1A 4AXIA 2HFNA 3TOQA 4P74A 3M32A 1BXNA 1A7GE 1ZA1B 5L39A 4G6VB 3SDEA 1OSDA 1VJWA 1NK0A 3BO2A 2HHQA 1FKOB 4PQAA 1XNQF 3BF4A 3NNAA 5J1NA 2AHOB 4DCJB 2VV5A 3FBFA 2MKIA 1E6YB 3LTOA 2JEIA 3GJSB 1O5JA 4USVA 4ES3A 3I5AA 4CM0A 4K7QA 5EX3A 1XERA 1A6LA 4HDHA 1CJKB 2XO6A 4JP8A 1VC0A 1H6KX 1LXNA 1UVJA 1R8PA 3PG9A 2E5HA 1NPPA 3FBBA 3R1LA 2M70A 5L9NA 5GAGU 1S1WB 1X4EA 4QIVA 3KMQA 2D41A 4QIEA 3AY0A 5IS2A 3JSRA 1JLFA 3JAMY 2ZWOA 1MLAA 1OMSA 4L73A 1FRHA 2DNOA 4BLGA 2AJQA 1JIHA 1FEEA 2R7RA 4RZRA 1TK0A 4G1QA 2AD9A 4RBVA 3DHXA 4F4ZA 3T1HF 3LP0A 2F8EX 2YKOA 3QT8A 2J6SA 3PEHA 5GMKa 1HI0P 4RUCA 1FDAA 2HLTA 1Y00A 4YFUA 1K0VA 2W2QP 1ICEB 2B7CB 3GE9A 3UD5A 2HLUA 2H51B 3FKBA 4IOBA 2CVIA 1HQUA 4UOCA 2QE5A 1S49A 1TUVA 1F5BA 5K20B 1FHTA 4FYWB 4B9UA 2UV8A 2GQQA 2PI5A 4IQXA 1T03A 4J9QA 3OL8A 3DGVA 3OW2R 1CJUA 1IR2A 1SJFA 3KUGA 8AT1B 5IV4A 4B02A 3KG0A 2XS2A 4X4QA 1APSA 1EP4B 2Z0GA 2P5VA 3QMQA 4DUZF 5F9LA 3UFCX 2VFVA 5L1IA 2BQ3A 3RZAA 3OHBA 3EZOA 1AZSA 4RKUC 4ZCMA 5LXRA 2VQFF 4DUYF 1FKPA 1ZAVA 3S6EA 1MW7A 2Q6CA 1Y7PA 1RBLA 4XTTA 1BWEA 2JLEA 2XSJB 2A2CA 4KKOA 3JXOA 2DNZA 2D3O1 4DR4J 2ZBIA 2HZAA 4I2QB 4CLWA 4J7CA 1NJWA 3P49B 3Q24A 1LFPA 1HWIA 3DGPA 2CWXA 3RB4A 3MM6B 5I42A 4DV1F 3R5DA 3W2VB 3DCAA 5ETNA 5K8NA 3H8YA 4OI1A 3UR3C 2YKMA 2W1BA 4CZCA 4TXSA 2Q6BA 4E0DA 5FD1A 4FVMA 1EARA 3Q8QB 2DY9A 1TFYA 1X4CA 4ED6A 1OY9A 2OSQA 4TYBA 1DTTB 3PIPQ 2DH7A 2WONA 1HD1A 5HN0A 1IBKJ 2DBBA 1ELOA 2D1CA 1C0TA 3E2EA 1FJEB 5ETMA 1FJGF 4R0JA 2IM3A 2YNGB 4KHPJ 2BJ1A 3UVJA 3OXLA 3AD8C 4ZVQB 1UFKA 2YWFA 1S1VA 2HHUA 1FDBA 2H5IB 2NYIA 4OI2A 4ZLLA 2AYMA 3BGRB 1S1XB 4WFZA 4LSZB 1JXLA 1Q5VA 4M5DB 4PR6A 2E29A 1YDLA 4RU9A 3FFIA 5ETOA 1EB0A 1GMVA 3C14B 2YNFB 5FLXY 2EXUA 3CJQA 2HVZA 3ENVA 2RDJA 3EUNA 4QU7A 5LMUF 4DV3J 3J80U 4J9VA 5ETQA 1S6PA 1XK8A 2JVRA 2V2VA 2PFDA 1IKXA 2P9CA 1FNMA 5DQHA 3JTPA 3EDQB 1W2BR 4Y6IA 3CCWA 3T3FA 4WP9A 3JSMA 3RBEA 1LXJA 1X0FA 5IWAJ 3ET6A 4OX7A 1IKWA 2DIUA 3RB6A 4NLOA 4UOFA 3UNGC 1SUQA 2CZ9A 2EG1A 3V6HA 1D3WA 1RT2A 1GX5A 4OX9F 1RSCA 4P71A 5A2QU 1K47A 2RB7A 2A10A 3EMTA 5KFWA 4NZ6A 1U48A 1WI8A 5C24B 2WHOA 3Q2SC 3KHRA 3ZTSA 1JX4A 2HEKA 2Y0SD 1U2RA 3KNGA 2DISA 3KWMA 4C8LA 5IOLA 4WWSA 3B82A 2O1PA 1UP1A 4QIFA 1PC4A 1WNEA 2ADCA 2R7OA 5LJ3Y 3Q83A 3OJSA 4USUA 4ITSA 3TUJC 2MPUA 4YP3A 3VGSA 1VQNS 4DOZA 1QJHA 3D28A 1KVIA 1R8HA 4NEZA 3QGHA 3PW7A 2OFGX 4KT0C 1HWJA 4JOUA 1TKZB 5J2NA 2VHGA 2KVIA 2KFNA 2EFNA 2ROGA 2GW8A 4QBUA 5HVFA 2RQCA 1W25A 1PYTA 4ALZA 2OH2A 1IUJA 5D77A 2CPXA 3HKZD 2FDNA 2DPIA 3KYLA 1FWPA 1P8GA 1SCJB 3P8BB 4CH0S 2X51A 1UZHA 2KJWA 4OYMA 3OSPA 3AOCA 2B9XA 3W7BA 3CCLS 3D1HA 5HVGA 2BE2B 4B3RJ 3EVWA 4ZN3A 2KYXA 4USMA 4O4GA 3B6BA 4ZMMA 2R8GA 4TLRA 1BQMA 3IXQA 2QMXA 2DNRA 1TKXB 2ZH6A 1S9EA 1TFWA 2HS0A 4C11A 4HKQA 3I5CA 2HVHA 4ZPAA 4KGVB 2BRKA 4H4MA 2HKEA 3ZZUA 2U1AA 2EPIA 1ZOTA 1UTAA 4WIQA 2CNNB 1N36F 1EQ0A 1C0UB 4ECRA 2H5EA 2OEMA 4OJHA 1M5KC 3UDCA 5IC6B 1HIYA 4K2XA 1Z1ZA 1Y5NB 4YB5A 2GHVC 3BJYA 1R3NA 3PYGA 3QZ8A 1BY9A 4ZVFA 3BYPA 4I0WA 4L74A 4IH6A 1XNRF 4BBYA 3HFVA 3MTJA 4TY8B 2VONA 4DPTA 5CD4H 4IRDA 1F3FA 4RNMA 2ZJPQ 2WSEC 1GMWD 2CZ4A 1FERA 3B78A 1N32J 3KG4A 2PE8A 1IJEB 4U8YA 4IFYA 4WFNQ 1IN0A 1HNZJ 3KHLA 2UUAJ 2E1RA 4L3NA 1ACMB 2XZWA 3EZ5A 2BR0A 4Q8FA 3J7AN 4NLGA 1QSYA 4RO0A 3ADAC 5LJ5Y 1T9YA 1UJ4A 2OJ3A 3IRXB 2ZNZA 1E6VA 3IBCB 2FD2A 4ZHRB 4Y65A 2HPUA 2FJXA 4C8NA 2IC3B 3QPIA 4DV0F 3UQSA 4DCOB 2ZUGA 3FVYA 2AJ4A 3VHQA 1UVKA 4UY8T 3MMCB 3HSDA 3C19A 1RT5B 2DH9A 2NUHA 1NH8A 3GONA 3TI0A 2P6TA 2HK3A 3W5ZA 2ZH3A 1M5PC 2IVMA 2DNPA 3FSIA 1RTDB 3FBCA 4KV8A 4ZN1A 2FJDB 1M1KT 4CO5A 3C6TB 1HARA 1FO1A 4P10A 2AW0A 3TAPA 2HHHJ 2J8SA 3G6XA 3H42A 2CQ4A 5DGAA 3GMGA 4CI0B 3BGFA 3CWJA 4EI2A 4FF3A 2W7AA 4B17A 1GXUA 2IM0A 2EFPA 3R5BA 3MOJB 9RUBA 3TUZC 3G4SS 1GK8A 2N7YA 1LWEA 2PA8D 1K73T 2KXFA 2MZSA 2YNHB 2OKQA 4R0EA 2MZJA 3CDWA 4ETZA 2DHGA 1PCAA 2OLWA 3SCKE 1RYSA 2CKWA 1WF2A 3HDSA 1OQ6A 2AYGA 4UZCA 1M1HA 2WB4A 1YJ9S 4USKA 1MU2B 1YRXA 2KVQE 4B3OB 2B5JB 3NGTA 2H65B 4MH8A 4ATNA 4OZ2A 3PW2A 4LBIA 1ZBTA 2B43A 1ZPVA 4ID5B 4AQYF 2AYEA 4E98A 1S9GA 1AROP 1G4CA 3QWUA 4FKYA 2RVJA 2OP5A 4LF8J 4JI7F 3V81A 2ZWPA 4NRTA 3KLEA 2OGUA 4FPIA 2HIQA 1REGX 4DJBA 3PX6A 2M52A 3DMJB 2B7BB 3BH6B 2IMOA 3ETOA 3GV5B 1K1SA 1IBLF 1NM2A 4KPYA 5KFGA 4KY3A 5EHHA 3U1MA 1KS2A 1HBUA 1WSVA 1V3ZA 3KMSA 5K14B 2RQ4A 2BQRA 4ZVPB 4QWEA 1RHQB 2MQMA 4I64A 2WVDA 3TVKA 3X3UA 1DRZA 3CNQP 5C7PA 1PYOB 3LUYA 1IKYB 2M7SA 3EGWB 2VA3A 1RTHA 1ZTWA 2IIHA 1FEHA 3J80Y 4DEZA 3NS5A 2RU9A 3KG1A 2ACMA 4M5HA 4B9VA 4HDGA 5LMNJ 1N34J 3RG6A 4JI8F 1CC7A 1YRTA 3BSCA 3KJFB 4CLTA 4ECXA 4M5KA 1PC5A 4GO5X 2UV8G 5HBMB 1T05B 4FKXA 3MM8B 1KOHA 4ANCA 4I7FA 4EO6A 3OR2B 3CPWR 3KXDA 3OXFA 5L1JA 3UN2A 1AUDA 1UFLA 1UPPA 1KVJA 4HHHA 4LIWA 2H3EB 2EK1A 2VG6A 2MHNA 4C97A 5A2QY 3EJMA 2V0NA 1JLGA 4EZ6A 1RBAA 2XLJA 2E5IA 2CPYA 1VQKS 1WDDA 3D6MB 2Y1RI 2OAUA 3CCTA 1UMJA 5LXYA 1QSLA 3SCIE 2O3DA 2DGVA 5HLFA 4E2FB 3P3DA 4P2XA 3KNAA 4HACB 3I56S 3UCGA 3F73A 1Q16B 5DZ6A 2XCAA 4IG3B 2GX8A 3CF5Q 5D0EA 2L3MA 4DSFA 1NDKA 1U2FA 3PJ9A 3GFYA 4PG7A 4E8UA 5I4MA 2HQGA 1HBMB 4JI6J 1FK9B 3MI7X 3O44A 5B7WA 1T3OA 4DUTA 4XO0A 2QT7A 3M7VA 5KFZA 3OLAA 4P2FA 4J5OA 3BKTA 4NXMJ 2FJBB 3PRDA 3CW2C 1Y0HA 2E1AA 2Z4PA 4PKDB 3NRBA 1P9YA 2ALZA 2KH9A 1FXLA 2HFUA 3MAHA 2AJFE 3IWXA 5C25B 2ZBQA 3LPYA 4WTOB 4FS1A 3WBZA 3TEHB 2KDOA 4LF1A 2E5JA 5M2PA 3IBWA 1L3TA 4NLVA 4Q43A 1SB6A 3UDLA 3AQPA 3MM5A 2XG8A 3CD6S 2H4WB 3NAIA 4NA3A 1JLEB 3NP5A 1SKSA 3MHYA 5J2PA 3W9HA 3VAHA 1EIYB 4F4XA 3GYNA 5A8RB 2I2YA 2WSFC 1VHIA 4A8XA 1QD1A 1GH8A 2G4BA 4F8RA 3VAMA 4DR4F 4J9LA 4NYPA 3SDEB 4P9SA 4B3MJ 2W2NP 4NZ0A 4H4KC 2XS5A 5KOXA 1LW0A 3RW7A 3BEGB 2QYCA 1J5EJ 2E66A 3N9UC 3PV8A 3MMAB 3BKFA 4PCQA 3OTCA 5BYQA 1YJVA 4W92B 1FRXA 1KDNA 4DSJA 1HNVA 4WFBQ 4Q5VA 2FLNA 1NCLA 1SH0A 3M1VA 4JI3J 3GPAA 2G0IA 3DLKA 3DOMB 4K4SA 1SVDA 1N5YA 2CVEA 2B9EA 2FHJD 5T14A 1IBKF 1WACA 1CSJA 1C1CB 3WX4A 4ZA1A 5ETTA 2R2SA 1GMWA 3M6VA 4KHPF 1F5AA 2R8JA 2MQNA 1JLFB 5HJXA 2AKWB 5AXLA 4CDIA 2IJNA 1TP7A 2XMKA 3FJ2A 4KQZA 4CLKA 1YJUA 4QJVA 3OL7A 2HBYB 1KEKA 1QLNA 1XMOJ 1O6XA 4G1QB 1KFDA 3ZTRA 1S1TA 3LP0B 4Y0FA 3VQSA 4M95A 1VYAA 1TL4A 2AEFA 1LQ9A 4ZP6A 2CQ2A 3PFOA 4KR0B 4P2MA 3VZHA 3GIMA 5DDPC 4GRSA 4N8OA 5GADI 3GFZA 4DV3F 2W2OP 3GIRA 3UN3A 3EZUA 3B54A 2YKAA 3R5JB 1HLWA 4M5GA 5GAHU 2HNZA 1T03B 2R8IA 5EGYA 3IAS9 4JV0A 2OEKA 1BUXA 2V9KA 3TA2A 3ZZRA 1XIQA 1RHMB 3D66A 1CJUB 2RKIA 2J0SD 4C0HA 1JQGA 4F3QA 3Q23A 2C2ZB 3TRGA 2PMHA 5IWAF 3M2RA 4EWTA 2HHXA 1JLBA 1SPBP 3LPEA 1U6BA 4WFXA 2CDRB 4HTJA 1SL2A 2HHPA 3BSNA 1AZSB 3PVXA 1UWBB 3IA0A 5CYMA 4CLZA 4DR1J 4TYAA 3AD7C 5LSOA 4ZPDA 1T9UA 4OFZA 1NDCA 1S0OA 3KDOA 4KKOB 2RRBA 2F8HA 3THTA 3CMES 2KO1A 1KQKA 2YWKA 3PYFA 4O0IA 3GLJA 1QTNB 3DOLA 1XN9A 2JC0A 4DF8A 1NKEA 2X3DA 1NHKL 2KFZA 1UVMA 2WSCC 1RXOB 3UD4P 1RISA 2YKMB 4DSEA 1SL1A 1FXRA 4RWWA 1CQNA 1FVSA 4ID8A 2IYGA 2YPZA 3K8WA 2LQBA 3ZO7A 3DRPA 3SSSA 4P7VA 2VZ9A 2WONB 1RT7A 4UZBA 4ZCKA 2V69A 1RT6A 1JXVA 3TZZA 3A8JA 2GO9A 4O3SA 1S9FA 3UVJB 2UVUA 4QCLA 4A8MP 2UU9J 3HVTB 4PUOA 1NPKA 4OHZA 4ED8A 4NLDA 4FYXB 1S1VB 3QJPA 5KTQA 2ERRA 3CJKB 1TKTA 2A0FB 3AOAA 2XLKA 2B4PA 5E3PA 4GC7A 2DK2A 2A2DA 2EBEA 2G0CA 2YH1A 5C2CA 3QJLA 3QT7A 2CJKA 2FZGB 4B3RF 4OYXA 3AODA 2MMYA 2MZQA 1UW4A 1D09B 3GB0A 2BKNA 3MD1A 3ITHA 4P2SA 3I82A 3HZGA 1SJ3P 1DLOA 4M5IA 3H25A 1KP6A 1XMQJ 2QRRA 3AHPA 4P72A 2WW4A 1TTHB 3THPA 2GFFA 1KQSR 1IKXB 2BACA 5I3PA 3DRXA 5KFXA 1RT1B 5D8HB 1SC3B 4N41A 1VQ8S 1NJIT 4U7UD 3LF0A 4DV2J 1H73A 5EX0A 2MQPA 4DV4J 2E5GA 4LJMA 1FD2A 2GHWA 3OFFA 3GCWP 2RD5C 3QO9A 4HEA9 3SMZA 2DXEA 1RT2B 4OHWA 2QEXS 2K7KA 3V4IB 3AH6A 1SH2A 1SJRA 2I0XA 1S0VA 2ZH1A 5JMNA 3DU6A 2XZDB 3A1YG 1F2HA 4ZJOA 4F4WA 4F04B 2WBRA 3C8YA 3SZ2A 4JI5J 4AYBD 1N32F 4J9OA 2EFVA 2WVEA 2AJ2A 1QY7A 1HNZF 2UUAF 1YJ7A 2DEJA 4IG0A 4NLRA 2F4FA 4C98A 4RNHA 2X3GA 4K0KJ 4FZVA 2CADA 1FWKA 4K59A 1UVNA 3EPIA 1SKRA 3MEDA 4ZPBA 1RTIA 4MKBA 1U1LA 4DQRA 3K59A 2DJWA 5KT6A 2CPDA 1CEZA 2V8HA 4FF4A 2MY8A 1QE1A 4KAIA 1FKOA 3LGMA 1Q5YA 5A8WA 3MMBB 2V68A 1U7LA 1E6YA 1S10A 4TY9A 2C3PA 2OPRA 1S7HA 4PXBA 3UPFA 2R2UA 4J9RA 3QBCA 3MCSA 5LSRA 3QFWA 1SQEA 5KFQA 3DN9A 3HLUA 3V4MA 1WC4A 4QWAA 2EI5A 5A8KA 3I9ZA 3DDIA 2HHHF 1S1WA 3W66A 2WZ1A 2XI2A 2FHOB 3BPDA 1WKKA 2DEIA 1GMUA 3M9MB 1RWOB 4XDCA 3EX7B 2UZAA 3UW1A 4EO8A 5GAEI 3QAUA 1RU2A 1Z2LA 4JUZA 3R7SB 1S9EB 2CDQA 4JI0J 4K4VA 4C11B 1NJZA 4XPCA 1HWUA 2LDIA 3KJQB 3FCWA 4H4MB 3H5YA 3UDEA 2OMLA 1MN7A 2F65A 1FDNA 1Q95G 2J9EA 2L9WA 4DV7J 4RW9A 5KFSA 3LAKA 2YBVA 3TJAA 2M3DA 3ICLA 3LP1B 1PJ6A 1PKUA 1RQ0A 2N3LA 4RNOA 3CXCR 4EEYA 2CNLB 1XR7A 2CJYB 2FVQA 4JYAF 1AFIA 3IG1A 2DGSA 4WZQA 3PR4A 1FRJA 2NCKL 2Z58B 4I2PB 5J1EA 2LYVA 2LMIA 2EC2A 3SV3A 4YEAA 3IN5A 2BJEA 3CMQA 2FYXA 3TA0A 5HJYA 2D3UA 1N5SA 2OI2A 1EP4A 5D4LA 1J5OA 2ZKTA 3IWNC 3FEYB 1WKJA 3T6JA 2FHJA 2JX2A 5DG7A 2JEJA 3R6GB 6AT1B 2KB2A 3I87A 1RTZA 2SXLA 4N47A 1MMDA 1HKAA 5F8HA 4DR6J 2XSJA 2DGXA 3AT1B 2HWHA 1LEOA 4MK8A 1JNRB 1YHQS 4LIRA 4DR3J 3VAKA 1VQ5S 1EX8A 1N5VA 5LL6d 3BBBA 4LRAA 3NLCA 2QN6B 5KAKA 4F50A 5KFTA 2AMCB 2WVBA 4DSLA 1X60A 2RMLA 4EYIB 1UETA 1MMLA 1JLQB 4F67A 3I55S 1S6UA 2AIRB 3I5BA 2PD1A 4P75A 5F3ZA 2DT9A 1T95A 4ZDNA 4X64J 4RX6A 1VBKA 2GV1A 2OD6A 1WF1A 1SI9A 5LMNF 1N34F 3DRSB 1VC5A 1JLCB 5D78A 1SIZA 5DLFA 2JHEA 2OD4A 2KYZA 4CLFA 1XMBA 4D3HA 2ZE2A 3M9NB 2YNGA 2ZBCA 1IBMJ 2CPZA 4NCBA 1R0BG 4IOAQ 1H2UX 2HFSA 3GZ7A 2CZVC 1SIWB 3CD5A 2QLBB 1NSQA 4DX6A 1VQPS 1VJQA 3C66A 4MYUA 2OELA 3CCMS 1FTRA 3BGRA 2ZDOA 4I6WA 1P9QC 1L5UA 4L6V3 3QJJA 2LU1A 4B9LA 1U1NA 4M5DA 5JJBA 5KT5A 5F8NA 3O3LA 4FF1A 2H4YB 4YY3J 2HNDA 4QYZJ 1UEKA 4LVOP 2JDJA 3NMRA 2UXCJ 3MFHA 1H7WA 2P2CB 4ZOSA 3U1NA 5K9FA 4F36A 1H74A 3NMAA 4I1TA 2FHMA 5D0HA 5L1LA 1IM6A 3ISNC 3W65A 1HI8A 3IBFB 3ILIA 2F3JA 4ZP9A 1S9GB 3EE3A 4ZIWA 3TANA 3SEOA 1ZYQA 1U1MA 2IAJA 3A4TA 4WXOA 2HQDA 4MIAA 2VUGA 3OPKA 1FT8A 4OJGA 2AZ1A 5HVHA 4MMOA 1OS5A 2WVCA 2CPJA 3CD0A 5EWEA 3AQOA 4NXMF 4USHA 4MJKA 3J7YU 5F8IA 3ZTQA 5C24A 2W8LA 1VQ4S 5MLCV 1RAIB 1URRA 1TZ0A 1HBUB 2BKOA 2Y9HA 3UI3A 4ZK7M 5F41A 4YDDB 3UD3P 4DL3A 3I9V9 2OPQB 1P1TA 2RUGA 4WCEQ 4A8QA 3CEDA 1EQMA 3GJQB 2I9SA 2IYIA 4DFPA 4CTAB 3U7JA 4WP3A 3MEEA 3VGUA 2CQHA 1RTHB 3F41A 3PXGa 1F6TA 2ZC4A 2WCXA 2JC1A 4PPDA 2NREA 4I68A 2VB6A 3IR5B 3LH2S 4M5MA 4AT1B 3OQ2A 1G3OA 1HR0J 1TKZA 2FVCA 6FD1A 1V9OA 4M5NA 3BDPA 4C6AA 2JJ4D 1FXDA 5CABA 1GEHA 3VVTA 1HNIB 1K0TA 1UEUA 3BPSP 2V8VA 2XULA 3HD2A 5KFOA 5HQLA 3HJVA 4M5LA 3K8VA 2J7WA 3AOBA 4CLSA 3EYZA 3RYLA 2VG6B 1WEXA 3WIUA 2JLFA 3MM9B 5CZVA 5KFLA 1IQTA 4JI3F 2BE2A 1JLGB 2PIIA 1QUVA 2HBZB 3D0GE 4QOTA 4FXWA 2XYPB 2W4DA 1VMBA 1CVJA 2DNMA 5CAAA 3M8QA 4DG1A 2MXYA 4QQBA 4PQUA 4B3SJ 4IO1A 4LRFA 4YR0A 1PSDA 5KG6A 5HLFB 4KYZA 3HD1A 4EU0A 3DNCA 3V6JA 4QZVB 3MAQA 4ECQA 2ZZTA 2QA4G 2OMOA 3R3TA 4V19J 3P5BP 2ABYA 3L7OA 1LNQA 5CCMA 1S5ZA 4FNHA 2HBRB 3K7RA 5B08A 1TMMA 4TNOA 2M8DB 2K1RA 1T9VA 3CDBA 1T7PA 3SQOP 1BHNA 1I5OB 3I0SB 3Q2TC 2WBMA 4WXWA 2LDYA 3BO3A 4YN3B 3L7UA 1YJWS 3MCOA 3D3BJ 1IQZA 5E2QA 1Q4RA 3BN4A 2RH3A 3A13A 5AXMA 1LKZA 1GXTA 1VBZA 4ANEA 3MR7A 1VHFA 5GAGI 2Y0BB 3PYDA 2DTJA 2Z2MA 4LF4J 2Q3PA 4PXCA 2XMWA 5K5MA 4Q0BA 1FRMA 5KFKA 5J2PB 5RUBA 8ATCB 3LW5C 4NYZA 4DR1F 1HYSA 3HM9A 4ZHRA 1LOUA 1HHSA 3MGJA 2BW2A 1X9SA 3M05A 2IC3A 3DYAA 2B8PA 5HP1A 1SJ4P 3JS9A 3D4JA 4ZJQA 2UVWA 2QMWA 5LSLA 3H40A 3T19A 4NLXA 3MMCA 2HRUA 1WD6A 1RT5A 2HHSA 2IRUA 3HHNB 1M90T 1RGVA 4PWUA 3GFHA 3IGNA 4PG5A 1RU1A 1Y9OA 2GJIA 4OJ1A 2B4VA 4EBDA 3G82A 3KK1A 4C0OC 2NSCA 4QWDA 2LLZA 1TK8A 2R2RA 4BHQA 3PKYA 5EN1A 2VOPA 4U9RA 2CQ3A 3M1VB 3CDUA 1T0TV 2MY7A 2VICA 1V5IB 3I0RA 1NJYA 2HZCA 3BH7B 3VWSA 1DURA 2PMZD 2ATCB 1SC6A 2YWWA 2IVYA 2ZDPA 3MR3A 3FQLA 3I32A 2BBEA 3OT9A 5CA5A 3T41A 2KJVA 1KNZA 2Q66A 1WWHA 5G4DA 3C16B 2EKNA 2RJZA 2YKQA 3OV7A 4K4TA 4LSLB 4G1PA 1B0VA 2HNYA 5KFEA 1FRKA 2ZM6F 2P9EA 2BE7D 2DCLA 2Q79A 4J9UE 2RDIA 4C7QA 4DL2A 2R7WA 3MUMP 2VODA 3MFIA 3HT0A 3TWZA 4W90B 1AFJA 3PHEA 4ID5A 3CCZA 5KFNA 1BMQB 2CXEA 1NJXA 5IT9U 2MKKA 4HT5A 1EKSA 4C48A 4WFAQ 4DI6A 3L4BC 4OZ1A 4DV2F 2RKIB 1U1PA 3MWBA 3CUNA 2W8KA 4DV4F 2W4PA 4OZNA 3M2RB 1FCAA 2XMVA 3NCRA 2HGLA 1JLBB 2CQGA 2F9DA 2DNLA 2CQCA 2FUG9 1G6BA 2NPIA 2H1YA 1QVGR 1H0HB 2QLWA 2VBXA 4J9MA 1NK6A 4USWA 1HHTP 5K14A 5CYMB 1X5TA 3OVSA 4J9KA 1O8BA 1SV5B 5D0RA 3V2UC 3DLGA 4MTPA 3GILA 2BJ3A 2KT5A 4NA2A 4NLYA 3QGIA 3PRVA 2VU5A 2ZZNA 4IRCA 4JI5F 1UKUA 3ISND 4A8OA 1IKYA 4ELUA 3TVYA 4GKKJ 4NLSA 5A6WA 3DOLB 1HBOB 1IJFB 4ECSA 4K0KF 1EHWA 2C3YA 2ASYA 1WHVA 2VKRA 2B9WA 5T7LA 5H9FJ 3OBIA 3NY0A 1U09A 2ZBRA 5B0FA 5D4OA 2MJNA 4BC9A 1H2VZ 1RBOB 3PYEA 1OY6A 2VFTA 2Z56B 2GMLA 2UXBJ 1OIAA 2PC6A 4C3MA 4O3PA 3DRPB 1YJTA 1RT7B 4HYKA 3NS6A 5KFBA 2QTWA 1U1RA 1HW8A 3D54A 1VQLS 3K2YA 3M4XA 2MKYA 3G96A 2WTFA 5IC4B 1WELA 2M8HA 1S0NA 4PUOB 3D68A 2QL7B 1GTEA 1WUUA 1TKTB 4KB7A 1I3OB 3J81U 3HPOA 3D1OA 2Z57B 3FDSA 4CLPA 1U45A 5FIIA 2DHXA 1DTQA 5AT1B 1LK5A 2ZD1B 4O3OA 2UUTA 5LT5A 3ILOA 5F0WA 3ITHB 1XR6A 2HRYA 5G0RA 4WYWA 4NL5A 4JI0F 2G2YA 3FMWA 4O44B 4OYOA 4JV5J 4DF4A 3DOKB 3UDVA 3CGIA 2LP4A 5C2GA 4C3KA 2HWTA 4KE5A 4YB1P 4DV7F 4ILRA 2HHTA 2BA9A 4X4NA 5AE3A 2DCUB 3GSDA 2CG8A 3G87A 3K57A 4B3TJ 2DGTA 3QO9B 1FJCA 4AL6A 1HPZA 3HXMA 3HKWA 1FA0A 2CJXB 1NPRA 2WW8A 3ILJA 3KJVB 3CO9A 3GQCA 3PO4A 4DU7A 3HJFA 2QYGA 5HMXA 2XNQA 2F4VJ 3M8SA 3GG1A 3EXYA 3QFHA 1I94J 3A12A 2PEHA 1FE0A 2DR9A 4OV1A 1RAGB 2RILA 2MKCA 3VVUA 4NLQA 2W9BB 4DX5A 2ILZA 2DNNA 4DR6F 1RTIB 4CYUA 5HI7A 4DR3F 3HVRA 1EJ7L 2COLA 1MN9A 2R7TA 5J2QB 2DPJA 2DRDA 1QVFR 2VKZG 2LFVA 1QE1B 3CB4A 1FX4A 3US5A 2VC0A 5A8WB 3BREA 5B0BA 4V19X 4PG6A 1NK9A 3MMAA 2HHWA 2CNOB 1FFSB 5CYQA 2OPRB 1C2PA 1JLAA 5KG0A 4UTGA 4F2SA 2EFQA 2XNRA 1LW2A 1NZ8A 1WHXA 3OFGA 2YXLA 3A8EA 1HNXF 1UJ6A 4YR3A 2VPYB 3DOMA 3PW4A 2V34A 2GQ2A 2F63A 5A8KB 3JYTB 1C1CA 4NLPA 5DG9A 4LF6J 2OO4A 2G13A 2J9DA 4IRKA 2LEAA 1IBMF 2MKSA 2V2KA 1V5VA 1NB7A 2CPHA 2ALYB 4CO0A 3X1LB 4DL0C 1KHWA 2L9NA 2Z2YB 4LR7A 4QPTA 2FZKB 1VGYA 1D9AA 2W2PP 2AYBA 4EMDA 4G3IA 4BWJA 4U96A 2ACYA 2QG9B 1Q78A 4LT6A 4YY3F 1QSSA 2DB1A 2UXCF 4RW9B 3D1QA 3GIJA 3A3NB 2QLJB 3C15B 1RAOA 5K8MA 5EWGA 3L09A 4X66J 2MGZA 3P5TL 3PIOQ 1URNA 2ZVSA 3K17A 4OZLA 2CUYA 2A18A 4QYZK 3IG1B 3QRRA 4LBHA 1H3DA 3IC1A 1UFWA 1WDTA 2XMTA 2NXUA 2XZTB 5F8MA 4YDXA 1VQ6S 5J1EB 1RDRA 4RU2A 2W7OA 2DXFA 3Q8RB 4EFAC 8RUCA 1AUSL 3W8GA 1XNQJ 3V5RA 4CRJA 3RTVA 5DRKA 4MFBB 1J5OB 2QLFB 1NSAA 1VQMS 4C3LA 1UWBA 3IRWP 3TA1A 2CPEA 3TW0A 2RF2A 5AXNA 4P52A 1T94A 3EVOA 5ETLA 3TX8A 1KTVA 2GJFA 4IR9A 1FD8A 2V4QA 2CQBA 1YTYA 3CVKA 1VIOA 1N5QA 2ADBA 4DSKA 4OJ3A 1FVQA 4ZITA 1S6QB 2FHKA 2JRSA 2MLYA 2G2ZA 3W5YA 3ISZA 4DX8H 4UUXA 3AD9C 4HHJA 4WK1A 1VRUA 3MD3A 3P4UB 4FVCA 2NLWA 2Q1LA 2POKA 4KH1B 1KKHA 3BQ1A 2HW3A 5IT9Y 1HQEB 1QTMA 2VFUA 2DRAA 1M1GA 2DH8A 3J7Z5 2GNKA 3PW0A 3PO5A 1HR0F 4N7TA 4D3GA 4WIIA 3ULHA 5HATA 2GIQA 1KN6A 2YVSA 3MMJA 1TU0B 4U67Q 2QFJA 2ZE2B 1NB2A 2BJ8A 2EVZA 5KFIA 3HVTA 5E3RA 3DLEB 4DPUA 3IS9A 3H20A 4ZPTR 3CJKA 2EC0A 1WF0A 3DRYA 4Q2MA 3KLGB 4RL1A 4LFAJ 4Z7YA 4EZ9A 3MPYA 4DSIA 2F1FA 3JQKA 4AFFA 1H72C 4GVLA 3TEGA 1GNKA 4ZVTB 2HNDB 3T5KA 5F0UA 4DUZJ 4B3SF 1GXLA 2V63A 2G1DA 3TP2A 4A4JA 3FGVA 1Y10A 1NKBA 3E8OA 4ER8A 1WC3A 4C8YA 3MAAB 4RBUA 4W4MA 3GP9A 5E33A 4J37A 2XGQA 4HI2A 4NLWA 3MPUB 2AT1B 1RT1A 1XWLA 3C6UB 7FDRA 3IR7B 2FLLA 1XBWA 3Q8VA 3TAQA 3CD7A 3SI8A 1RWWB 4NLTA 2M4MA 2IAJB 1KONA 5DETA 2PMWA 2XC9A 1YBUA 2DXDA 1YBTA 4WKYA 2B8QA 5EDWA 2Y8WA 5E5NA 4K50A 4FYVB 4K4XA 3V4IA 1WC5A 1RK8A 2B4OA 3H4DA 1HW9A 3HP6A 4C9DA 2C2RA 4RW4A 2MQ8A 2Z2LA 3VAFA 3CCVS 4XIUA 3A8IA 3J81Y 1NKCA 4CWBA 4URQU 4ZVHA 4QPXA 2Z8QA 1TL7B 3AJ1A 2E7VA 1MMNA 3SQGA 2ZH5A 3KUEA 1X5OA 4TU7A 2ASDA 2Z2ZA 4LF4F 1FE4A 2FY8A 3MEEB 3FZBA 4DR5J 3EVMA 4CCHA 3QLHB 3FC9A 2BM0A 2W2MP 1F9FA 2MLXA 3ZZZA 2HGNA 4NA1A 3DLJA 3SIPB 2B51A 4KRWA 3TQ1A 2LKZA 2HVIA 3MMBA 3U02A 1DAXA 2W01A 3KLFA 2C2MB 3VQTA 4LF5J 1UVIA 5F8GA 1TAUA 2FPHX 2U2FA 2HQIA 3TZXA 1B99A 2OHDA 3CDAA 3AB4B 2W9CB 3SYZA 4ELTA 3KLHA 2AX0A 2VFRA 1SH3A 4WKRA 2HVDA 1TL1B 5KFPA 4M5JA 2IFXA 3R5GA 4H4OB 2JEFA 3S8SA 2KM8C 2KFYA 4LRCA 2XGPA 5E7OB 3G6ES 4ENOA 3RRKA 1U8WA 3OL9A 2BEFA 4CT8A 3M8QB 4DG1B 5FDLB 4GO7X 2JL9A 5SUHA 4PQUB 1BQXA 4OX9J 3ONQA 1KOOA 4ZKAA 3BDEA 4IH7A 2XMUA 3EGVA 1GX6A 4LQ3A 3TO8A 1Z2ZA 3Q86A 3RAQA 4KFBA 2YQ1A 1VBXA 2JLGA 4LFCF 3H2LA 5KFYA 1TVRA 2RHSB 2K8GA 2VASA 2BZ2A 3R5AA 3CIMA 1S1UA 4CNZA 3OL6A 2GS8A 1RTJA 4NRUA 3BSAA 3IMQJ 5HL7Q 4PEOA 3ZZPA 3LP1A 2AJ1A 3KK2B 2K1RB 3HI9A 3DLHA 3QYYA 3GR1A 2MKHA 1LWXA 2FC9A 1VK3A 1VBYA 3PY8A 3M6XA 3TJ8A 1RWUA 3WX8A 3JSBA 4OHXA 3AXKA 4I2PA 1T9TA 1PBAA 3OR1A 4O0NA 2R7XA 4DLEA 3TR5A 1ULRA 3KUHA 4ED0A 1Q81T 3CJ2A 3TNVA 2KZMA 1NLKL 4X4TA 1U0SA 3O8WA 3O5TB 3N6NA 1R6YA 1SKUB 2A6OA 3RAXA 2IRXA 4O3RA 2CIMA 3Q8UA 4PWDA 1LV5A 2V4JB 3JQMA 1HWLA 2QLXA 1RACB 4NZ7A 3ZZYA 4Q0BB 4FF2A 3OUYB 4FDFA 4RJVA 2DNGA 5J1PA 1SXLA 1HYSB 5C42B 2ZJQQ 2Y1IA 2QL5B 4DL7A 1FESA 2GC8A 3N4WA 3DYAB 1AW0A 4MK9A 2D9PA 2G9OA 5HP1B 1XC9A 4J91A 3C3LA 2ROEA 4ERDA 4GKKF 1SQFA 1PBUA 4NCGB 2QSFA 1JLQA 2RAQA 4JBCA 4DQPA 2H54B 4ZVRB 2UUBJ 3QRQA 2L48A 4YUDA 4O4RA 2P6SA 3DRSA 3R7BB 2GO8A 3G82B 1JLCA 2OTJS 3KK1B 5GAHI 4B9MA 4FBTA 1RABB 4WP8A 3HHLC 5E0OA 3NCPA 1U02A 4ZPCA 3P6YC 5KG5A 3L3CA 1VRTA 2UXBF 3EXCX 2MDAA 2HWIA 4EBCA 4QWCA 3MPDA 5I3QA 3I96A 5H9FK 1RHJB 3I0RB 3R27A 3BYRA 4X65F 3MZIA 4LF9J 4C8KA 2B4UA 2WB1D 1PAEX 2C1EB 2LECA 2LXFA 1W7WA 5KFRA 1DY3A 5HMWA 3I4PA 4XPEA 1KVKA 3CJTA 2BRLA 5DQGA 1MWZA 4OZJA 4R8UA 2P8IA 4LUBA 1OPIA 1JJCB 1IR0A 4OYIA 1OO0B 1U25A 4NEYA 2HNYB 2BW7A 2JH3A 3GIIA 2CPIA 1RCOB 5F8JA 4Q44A 2J6UA 5IT4A 3G8SA 5EUHA 1WSRA 4OQJA 5DLGA 3OVBA 4FP9A 3IP0A 1RB0A 2AEJA 2QJ3A 4ILMA 4OHYA 4ZPWR 2YKNB 2M0GB 2L08A 2R4FA 3B4DA 1H2TZ 3VAGA 3PTWA 2E1PA 1N6QB 4YOEA 2V94A 1LK7A 2CAJA 2HQFA 5A6PA 4ZVEA 3RUBL 4F0HA 2MZTA 4DU8A 1Y3KA 1WKLA 2L9DA 2QGFB 2MZ1A 4H54A 4B3TF 3GCXP 3EDRB 2R2TA 2J7KA 2RT3A 4DZ6A 4K2JA 2HFVA 3HHEA 4Z7CA 4RUBA 2XMAA 2OPQA 5ETPA 3DLGB 3CJ8A 4OYAA 2F4VF 4CTAA 2YX7A 4DL6A 4DV6J 1I94F 3A3PB 4ZCLA 2Y3YA 2NUUG 2QMUB 4ED1A 5T7LB 4NCAA 1X7VA 5LM7E 2GIFA 3OXGA 2E9TA 2OEJA 3R97A 1QUPA 2DR5A 4IUFA 1RLCL 1UL3A 2C2KB 1UW9A 1HNIA 1ZM4A 4YHHJ 2NYHA 4P73A 3MURP 2LQ5A 3BSOA 1R31A 2C2NA 1RJJA 3LWMA 1XTZA 1GQEA 2YTCA 3DHWC 3ZNJ1 4AD6A 2W7PA 2V4RA 5JVGQ 1VQ9S 3G8QA 3PJXA 3FSYA 4L72B 1FTCA 3MM9A 3C2PA 4LF7J 4TU8A 4K4ZA 2ZNYA 3E51A 4S0MA 1R27B 2FY1A 3MPWA 2FTRA 3GFXA 1DTQB 4A46A 4N5SA 1LWFB 3RBDA 5FJ4A 3M8RA 5G0RB 2GVZA 1YK9A 2VOOA 5KOWA 4OZ5A 3FSXA 1HMVA 3DRRB 2CJBA 3RBXA 1TV6A 2MHEA 5KG2A 4ZLPA 4QR0A 3BS9A 2I8EA 1R43A 3CC7S 3K5NA 1YBAA 2OFHX 3HF5A 1D8YA 1XQIA 1NU4A 3ENAA 4AE5A 3I0SA 3Q22A 1IBCB 4ECYA 4W98A 4OLOA 3KOAA 4NE9C 1AT1B 4L3KA 5LOQA 2ZKUA 4OLPA 4X66F 3R7NB 3M2UB 4DFMA 2V8DA 2BQUA 4DQIA 1K8AT 4JI8J 3H98A 4OIXA 1HPZB 3BB5A 1VQSA 1VLOA 1R0CB 2J76E 2AJ0A 5ETSA 4TU9A 4USTA 5E3AA 2IDEA 3NOCA 2OPPA 2Y1LB 2ZFHA 2MSTA 2RE1A 3N79A 1FF2A 2UP1A 5E3QA 4DPWA 4GKJJ 3UNYA 3I6PA 4ED2A 4CLYA 2YX1A 3ZXWA 3W2WA 2PSZA 1KC8T 2ZHBA 1V3RA 3PR5B 4TLQA 1S59A 1QAYA 2RS8A 4PXDA 1N56A 1RYRA 1FNXH 1R0AA 4WYLA 2OPSA 1NXIA 4B9TA 4CYUB 5EWFA 3DM2A 2PN6A 3NGRA 2IM1A 1WOOA 4DS5A 1BE4A 3T9NA 2AGQA 4HHUA 4OZ3A 1SQGA 5CYQB 3CMAS 4YQWA 4RR5A 1JLAB 2LA4A 5C5JA 1LWCB 1LW2B 1PAUB 3NWRA 3DLLQ 1REVA 4NMLA 3KLVA 2BE9B 2HS4A 2AQ4A 3W61A 1QAJA 1F1BB 4CT9A 5HK4A 2KT2A 2YNIA 2LQJA 4M63A 1TL3B 1DHMA 3CO0P 2HMIA 3IM8A 2VL1A 2BUNA 4OI4A 3K58A 1EKRA 5L9XA 2CPFA 3VF0B 4JI2J 1ZA2B 3C16A 3N6MA 3QATA 4LBPA 4C4WA 3TZWA 1EAYC 4LSLA 4LFAF 3NXZA 2NXJA 3ZZ0A 4KBIA 1VR6A 4CP5A 4B08A 1CULB 5K8PA 2KXNB 2BXJA 3A8KA 4X4PA 2UVRA 1YKWA 3HHLD 1A0OB 2GMJA 2LXUA 3GV8B 2DGQA 4Y00A 2PA3A 4DLGA 2HYIB 4UF4A 2MGZB 3W64A 1CPZA 4UQTA 3DXBA 5KFMA 2VG5A 4EYHB 5IQQA 5CXTA 3VGTA 4J9SA 1TQLA 1JNZB 2Z30B 1C1BA 3EGZA 1RWXB 2EW9A 1WOPA 1JJHA 3M30B 3ELHA 2LA6A 4U95A 3NCQA 1CQMA 3R1HA 2NXNA 4IDKA 3M2VB 2GAGC 1YGYA 1QM9A 1YG0A 4J9PA 2KRRA 2HSEB 2CWKA 2KRBA 5AJ3J 2RF2B 2D3OR 3H2UB 1SV5A 2N4DA 2GJ2A 1CJTA 5ADZA 2IJRA 1X0PA 4DFKA 2GQCA 4F4AA 1T9WA 1HBOA 3HHDA 4LMZA 4C8ZA 5AE2A 1ZM3A 1U1KA 1RAJA 2VQEJ 1RHUB 4M8LA 4KO0A 3C46A 1YQHA 3T6BA 4DR5F 5H1SV 1IM4A 2KG0A 1VRUB 4LR8A 1RT4A 1I6JA 4TQSA 2HAIA 4DQSA 4HVZA 2DHAA 5THWA 2VA2A 2BJDA 4F25A 2HZVA 5AXKA 3ZFVA 2XEXA 1F9HA 1ZS6A 4ED7A 2G1HA 1RHRB 5KFDA 4LF5F 4UUWA 1IWGA 3KHHA 3Q8YA 5J2MB 2HS3A 2R9LA 5ETVA 1U26A 3J7YI 4ZJLA 1B7YB 4ANDA 3NKYA 3HMJG 4RUAA 3MDFA 3IS9B 4DX7A 2KU7A 1PJ7A 4YB6A 3N5FA 3QSYB 2DKOB 1Q7YT 4ZVSB 1NSPA 3GIKA 4NLUA 4ICLB 3H59A 1ZAWA 2PT0A 3QZ7A 2VH7A 2ZD1A 5D4PA 4AUKA 1W26A 4WTYA 4DCPB 1AA1B 4UOGA 4USJC 4WK3A 4R5PA 1X4GA 2H5JB 4KC5A 1U6ZA 2BMBA 2EFOA 2VBWA 4DN0A 4MIBA 1JKHB 4O44A 3FRZA 3DOKA 4RWXA 3CC2S 1A9NB 1M5OC 3GJRB 4Y34A 2UUWA 4USIA 5B0DA 5GMEA 3AA9A 2QA4S 2VPXB 3ETMA
chains in the Genus database with same CATH topology
2V0NA 2DO4A 2LXIA 1FRLA 5F0WA 3ITHB 3KHGA 3I31A 1XR6A 2GGPA 1JLGA 3LP2B 4EZ6A 2BABA 4QYRA 2HRYA 2FJAB 2XLJA 5G0RA 3OTDA 2E5IA 4WYWA 2CPYA 4FPRA 4NL5A 4JI0F 3VR1A 4ECTA 2CQPA 2RRAA 1VQKS 3QIPB 4HLBA 2DO0A 5IT0A 2Y1RI 1J2VA 2OAUA 3CCTA 5DJBA 1UMJA 3FMWA 1SBRA 4I7FB 4O44B 1X5PA 4Y28C 2ZOGA 3U1LA 4DN9A 5LXYA 1QSLA 4DF4A 3DOKB 5ITHA 2IBKA 3CGIA 2O3DA 3SCIE 3CULA 2DGVA 5HLFA 4C3KA 3SFUA 5AE1A 2HWTA 3GR0A 3RB0A 3KJVA 2OSRA 3P3DA 4OMFG 4KE5A 2ZITA 4YB1P 4DV7F 3KNAA 4ILRA 4N77A 2R7VA 3OTEA 2XWXA 1KQGB 4RW4B 2HHTA 2BA9A 4K5RA 4X4NA 4LQ9A 3POTB 3HZEA 5AE3A 3EGNA 2NSBA 2DCUB 3T5HA 3PJWA 1KFSA 2VFSA 3GSDA 3I56S 2GGPB 1X4HA 3BR8A 3K57A 3UCGA 3F73A 5F8LA 1Q16B 2XCAA 1U6FA 4FNIA 3L95X 3UCUP 1RKJA 4IG3B 1DQ8A 2DGTA 2XLIA 3QO9B 3M8PB 2GX8A 3CF5Q 2L3MA 4DSFA 4P7TA 3LGNA 1U2FA 3MOZA 2NPFA 1XEZA 1FJCA 3GFYA 4PG7A 2HG4A 4E8UA 5I4MA 1HBMB 3UCZP 4AL6A 1DQAA 1HPZA 3HXMA 5HROA 2KKHA 3SQGB 1FK9B 4LVNP 2MSSA 3HKWA 1TKXA 2K2PA 1FA0A 4A47A 3G9CA 3HX9A 2W9BA 3MI7X 2GMHA 3O44A 2JFKA 5B7WA 2WW8A 1C4CA 1T3OA 3KJVB 4LSNA 2DGUA 3HVWA 3CO9A 3GQCA 1WTBA 4ECVA 3PZPA 1DZ5A 3PO4A 3HJFA 4XO0A 1VS3A 5HMXA 2QT7A 2WRMA 3CCJS 5B0CA 2XNQA 1KRPA 2F8MA 5KFZA 5KFJA 2JFDA 3OLAA 4J5OA 2BV3A 5U47A 1NHVA 1VQYA 4DR2F 3M8SA 5H9EJ 1ZZNA 2FJBB 3GG1A 5DM6Q 3PRDA 5L1KA 5J2QA 3EXYA 1Y0HA 2E1AA 1B0TA 2Z4PA 4PKDB 3NRBA 2PEHA 1FE0A 2ALZA 2DR9A 1C0UA 2JOQA 4OV1A 2KH9A 1S4FA 2RILA 1FXLA 4I69A 3ZC4A 3MAHA 2MKCA 2UVVA 2AJFE 3BN7A 3IGVA 4M94A 3IWXA 2VG7B 5C25B 3N28A 4NLQA 3KLFB 2W9BB 4MKAA 2ILZA 3LPYA 1RT3B 1I1GA 2RSQA 2DNNA 2UUBF 4DR6F 1RTIB 5DDRC 2JEGA 4FS1A 3PW5A 3WBZA 2KDOA 3IAM9 3HO1A 1YJRA 2XMMA 2E5JA 5GVQA 4HL9A 5M2PA 1Q82T 4B9NA 2XB2D 2A3JA 5HI7A 4DR3F 3IBWA 3HVRA 1L3TA 4NLVA 2COLA 3KLHB 2R7TA 4Q43A 5J2QB 2DPJA 3PACA 1QVFR 4FYDA 1T3NA 1SB6A 3UDLA 2VKZG 1F60B 1QE1B 3AQPA 3CB4A 2BYCA 1MROA 3MM5A 2XG8A 3CD6S