2RKIB

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with a triazole derived nnrti
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
424
structure length
402
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Triazole derivatives as non-nucleoside inhibitors of HIV-1 reverse transcriptase-structure-activity relationships and crystallographic analysis.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 reverse transcriptase (RT) p66
total genus 111
structure length 402
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2rkiB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rkiB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rkiB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rkiB04
4R0EA 5KG7A 1TV6B 2FJVA 3MEGA 2ATLA 2O5DA 2UVVA 5DG7A 2QV6A 2BR0A 1REVA 3QIPA 4Y2AA 5KFLA 4ECYA 3FFIB 4LQ9A 1T94A 5J1EA 4XPCA 5FDLB 4IFVB 1JX4A 4Q8FA 1RT5A 3DI6A 4ICLB 3RBEA 4K4ZA 4DEZA 3KLEB 2W7PA 3FFIA 2R8HA 3LAMA 4ECSA 3V6HA 5CYMB 3V81A 1LW0A 1LWCA 1TL1B 5KT3A 4ZVEA 3MR6A 1JLAA 5KFKA 1UWBA 4DL2A 3LP1A 3M9NB 3IRXB 3DRPA 4IH5A 3DMJA 2FVSA 5EDWA 4J9KA 4EYIB 3PW5A 4U6PA 2FLPA 3GIJA 2IM1A 3VQSA 5HP1A 2BRLA 4B3OB 2W9CB 4IG3B 3H40A 3LANA 1SH2A 5KFEA 3V6JA 1IKWA 1N6QA 2B6AA 1RA6A 2VG5B 1D1UA 4IDKB 3DMJB 3KLFB 5C25A 4XPEA 1K1SA 1S4FA 2WRMA 3H4DA 4U7CA 4NLVA 3V81B 3RAQA 3OL9A 1FKOA 2YKMA 3V4IB 2FVRA 1S1WB 2UUTA 1HMVB 4FBTA 5KFOA 2ASLA 2JC0A 4ZPDA 2V0NA 4KO0A 1BQMA 2I5JB 2JLEA 3HVTB 5D3GA 4NLWA 4K4WA 2IM2A 3PJWA 1FKPB 2ILZA 4IG3A 4RNOA 1RT6B 1GX5A 3T5LA 1JLFB 5I3UB 5KG3A 1R0AA 1SH3A 3I0SA 5F8GA 3Q8RB 3M8QB 2V4QA 2ALZA 1S0MA 3H4BA 1RTJB 5HBMA 5J2PB 4ZPCA 2XCAA 4IRDA 1SV5A 4JV2A 3DLGA 4MK8A 3MR5A 2C2EA 2CKWA 5CYQA 3KJVB 5KFYA 2HNZA 3TAMB 4KV8B 2WCXA 4Y2CA 4J9SA 1S9EA 2AWZA 4NLQA 4DL6A 3HHKA 1IKYA 1TKXB 1IKXB 3MECB 3I0RB 3QIPB 5CYMA 4NLRA 1C0UB 4WE1A 1C0TB 3DYAB 1RT1B 5T14A 2JEJA 1EETA 5K14B 3FQLA 3GYNA 3G6XA 2IBKA 2R8JA 2GC8A 4G1QB 3KLIB 4MIBA 4RW8B 3DDKA 2V9WA 2J6TA 5KFHA 4B3OA 3GIKA 4TQRA 2W9CA 4O4GB 3TAMA 2F8EX 4KB7A 4WFZA 3Q8SB 1TV6A 1T05A 5CYQB 3KLIA 3KJVA 3GV7B 1S0NA 3CJ3A 4MH8A 4KHMA 3QZ8A 5L1KA 2OPSA 3DM2A 2J6UA 4PWDA 1HNVB 4O3OA 4ZHRB 4ICLA 4YR3A 1S1VB 1C0TA 3DYAA 4KO0B 4NCGA 3IGNA 2YKNA 4RUCA 2V4RA 3LP2B 1HYSA 4JV0A 5DGAA 3TQ1A 2R8GA 2AGQA 4RNMA 4G1QA 4Q43A 4R8UB 1REVB 2WOMA 4RW6A 1N56A 4ZHRA 5DQHA 1HNVA 3PHEA 4RW9B 4JUZA 4WE1B 3IS9B 5HBMB 3JYTA 5J2PA 1T03A 2OPQA 1RT7B 5KG6A 2BQ3A 1JLCA 4RW7A 3KLHB 1YVFA 4FBUA 1U09A 2D3UA 1D0EA 4LSNB 4RW9A 1S1TB 5KFRA 5F8IA 4NLDA 4WZQA 1W25A 4O4GA 3H2LA 4KFBA 3IRXA 3MEEB 3MEDB 3LP1B 3KK3B 3E51A 4ZP8A 4ZVHA 4EYHB 4RW7B 1S48A 3T5HA 5C5JA 2YNIB 5KFXA 2DPJA 1S1WA 1HYSB 1EETB 5K14A 3MTKA 3NMAA 1RTHA 4RW6B 1RT7A 2OPPB 3KLFA 1K1QA 2XC9A 4IDKA 4TY9A 4HKQA 2I1RA 1DTTB 2BE2B 4XO0A 3EPIA 4YR2A 5FDLA 4URGA 1HMVA 1N48A 2HNYB 1VRTB 3OL8A 5KFSA 1JLEA 1SUQA 1BQNB 4YR0A 4F4ZA 4NLSA 1HQEA 3H59A 5KFDA 3DRRA 3SI8A 1LW0B 1LWCB 4M95A 2VG6A 3FSIA 4NZ0A 5EWGA 3PR4A 4EBEA 3CJ4A 5KFWA 3KLHA 3GIMA 1MU2A 1R0AB 4URSA 3I0SB 5I3UA 4QPXA 4O3PA 1BQNA 5KG2A 3OLBA 1JLEB 4O3SA 3SFGA 5KT6A 4WYLA 1IKXA 3MECA 2IJNA 4ED3A 5J2QA 3KHRA 3QGGA 3HKWA 2OPRA 3KK1B 5C24B 2WOMB 1TKTA 4Q45A 4ECRA 3H98A 3PW2A 4IFYA 3OSNA 5JXSA 1VRUA 4DG1B 4RW8A 2W9AA 1RT2B 2IC3A 2E9RX 3T19A 2CJQA 3DLGB 1RT4A 3KLVA 4YMEA 1XR5A 3I0RA 4MKAA 1FK9B 3DRRB 3CWJA 4MKBA 3MR3A 2B5JA 4J9NA 4F4XA 2WONB 4HYKA 3MEEA 1NHVA 2FJXA 4RU9A 1FKPA 1HARA 2HNYA 4MIAA 3GIIA 4WFYA 4GC6A 3JSMA 4K4YA 2BQRA 3LALA 2HNDB 4F50A 3M8QA 3LP0A 3DLKA 4WFXA 5F8NA 1HNIA 1N5YA 2YKMB 3V4IA 1RTIA 1IM4A 3QO9A 5KFQA 2IM0A 4TYAA 4ECUA 2ZD1A 3HVTA 1NHUA 2RDIA 4TXSA 4O3QA 3PZPA 1S1XB 5KFGA 2OPRB 3GILA 3NGDA 2D41A 2WB4A 2AX0A 2W8LA 3QO9B 5F9LA 4NCGB 4H4MB 1S1VA 1TVRB 3CDEA 1ZTWA 4K4XA 4Y34A 5J2MB 1TQLA 1S1TA 4MK9A 3DLEB 4OL8A 4ZVFA 4Y3CA 3JSMB 1IKWB 3ISND 1N6QB 3E01B 3KHGA 2WTFA 4RW4B 4ZP9A 1TVRA 3N6NA 5F9NA 1SUQB 4R5PB 3JYTB 1T03B 3IS9A 4IKAA 4YP3A 1JLBA 4Q0BB 5HLFB 2HWIA 1S1XA 3FRZA 1QE1A 4RW4A 1C1CB 3RBDA 2I5JA 5D3GB 1RDRA 3RAXA 2UVUA 4JV1A 1HNIB 3MEGB 4QWCA 1TKTB 1EP4A 4TY8B 3IG1B 4K4UA 1CSJA 2GIRA 1C1CA 2BRKA 1LWFB 4O44B 1Z4UA 3LP2A 2HAIA 3UPFA 3OL6A 2W8KA 4PQUA 3KHLA 4IR1A 4KFBB 2AX1A 2YNGA 1JLBB 1T05B 5HLFA 2RDJA 3MFIA 2IJFA 3NL0A 3M9OB 5L9XA 4J9PA 4ID5A 3G6VA 4J9MA 4O4RA 2GIQA 1JLAB 3KLGA 3RB0A 4KBIA 5DQIA 5KFUA 3UR0A 3KMSA 3H5UA 3BREA 3BSCA 5EUHA 1HQEB 3EPGA 1VRUB 4ZVGA 4ID5B 1C0UA 4GC7A 1RT2A 5KFBA 4IRCA 2JEFA 4I2PA 1HPZB 5F8JA 4O44A 3G86A 5KG4A 4K4VA 5J2QB 3OLAA 3KK2A 3T1AA 3MF5A 2VG6B 1XR6A 3DRSA 4EO8A 4KHRA 3D28A 4DG1A 3Q8QB 1MU2B 3GQCA 1RYSA 5J2MA 1S10A 1KHWA 4IH7A 4NLXA 3KK3A 3N6LA 4M94A 5DLFA 1RT6A 4IH6A 3UDLA 5DG8A 1S9GA 4O3RA 1VRTA 3E01A 1DLOB 3I5AA 2QE5A 2B5JB 1FK9A 3CO9A 4WXWA 2C2DA 4R5PA 4TLRA 4ED8A 5KFCA 1JXLA 2W9BA 4F4WA 1RTHB 3FDSA 1S1UA 1QUVA 4ECTA 2FVQA 4R8UA 3SFUA 4TY8A 5KT7A 4KSEB 2WHOA 1QAIA 4QWDA 3DLKB 4Q8EA 3LP0B 3ITHB 3OHAA 2VG7B 3QIDA 2DPIA 4F4YA 2ZD1B 2YNFA 4IG0A 4J9QA 3V6KA 3PW7A 3PR5B 3RB6A 2IA6A 5KFMA 3TVKA 2W9BB 5C25B 1RTIB 5F8MA 4NRTA 2BANA 2FVPA 3UQSA 2XCPA 2YNIA 1LW2B 3M8PA 5J2NA 2R8IA 3KNAA 3KMQA 2WONA 1TL3B 4TN2A 5EWEA 3HVWA 4IFYB 1HPZA 1BQMB 4I2PB 4ZP6A 3BQ2A 1ZETA 4DL3A 1DTTA 2HMIA 2BE2A 3QLHA 3BSOA 5KT2A 2YNHB 4KE5A 3KK2B 2OPSB 4ECQA 5EWFA 1RT4B 1N5YB 1JIHA 4PWDB 3C6TB 1RT3A 4J9OA 2XGQA 1S6QA 4NLPA 2JEIA 3QLHB 2RKIB 3BQ0A 2OH2A 4IRKA 2HNZB 3LAKA 1JLQB 3C6UB 2R2SA 4RUAA 1OS5A 4NYZA 2ASJA 3IN5A 2J6SA 1SH0A 3PJXA 4PQUB 3DRPB 3RB3A 3NBPA 5L1IA 1JLCB 3V6DB 1LWEA 4H4OB 5I42B 3D5MA 4TQSA 1EP4B 3C6UA 2XI3A 4EBCA 2AGOA 1JLGA 4RZRA 1S0OA 4MFBA 3H5SA 2VG7A 2IC3B 3ITHA 3CIZA 5KG1A 4ED6A 2R2TA 1S6QB 1N4LA 3KHHA 4K4SA 3OL7A 4EEYA 2FLNA 1JLGB 2UVRA 4ECWA 5JUMA 4QWAA 4LSLA 4FS2A 1ZTTA 2OPPA 2EC0A 4I7FA 4DL7A 3V6DA 1LWEB 3M8PB 3BGRA 3BQ1A 1J5OB 2B43A 4QWBA 2HNDA 1RTDB 2W7OA 4ECVA 4Q0BA 3GV5B 3QZ7A 2VA2A 2YNGB 2UVWA 3BGRB 3RB4A 1I6JA 5KFFA 2ZKUA 1RTDA 4IR9A 4URQU 2XWYA 4DL5A 5KG0A 3ISNC 1TL1A 4I7FB 3EZUA 4H4MA 4DL4A 4IG0B 4RNHA 3OHBA 4LSLB 5KFVA 1C1BB 1S9FA 1RYRA 3NKYA 1JKHA 2C28A 4YQWA 4G3IA 4TYBA 5KFIA 5C24A 2HWHA 5HP1B 1XR7A 3GV8B 2R2UA 1T3NA 1MMLA 2BQUA 1DLOA 4NRUA 5C42A 3MR2A 3MEDA 4NLOA 3PW0A 5J2NB 3KLGB 3BSAA 2R2RA 4WZMA 2RKIA 3OSPA 1S1UB 4KKOB 4KAIA 3QGHA 2XI2A 2IAJA 1KHVA 1J5OA 1JLQA 1UWBB 3H5YA 3T5JA 4QW8A 4ZMMA 1TKZB 2YNHA 3KLEA 2C2RA 5KT4A 3PVXA 2ZE2A 3IG1A 5KG5A 2VA3A 2E9ZA 1RT3B 1QAJA 1JKHB 3Q8PB 1LWFA 2WK4A 3DRSB 3CJ0A 1DTQA 1S97A 2E9TA 1TKXA 2HMIB 1LW2A 1SV5B 2UUWA 3PW4A 2JEGA 2D3ZA 2B6AB 2AU0A 2VG5A 2C22A 1TL3A 2XGPA 2RF2B 3T5KA 3NBPB 1TKZA 1S9GB 5KFNA 4ZPBA 4KV8A 4NLYA 5KT5A 3DLEA 1IKVB 5HROA 3I5CA 3ICLA 4KKOA 3NAIA 4NLUA 4RNFA 4K50A 3H5XA 1RT1A 4QWEA 3CJ5A 5F8LA 1RTJA 4ED7A 3NAHA 4RNNA 5KFZA 3QYYA 3HVAA 4J9RA 3DOKA 2R8KA 4LQ3A 1JLFA 1QE1B 4Q44A 3N6MA 2YNFB 4ED1A 2ZE2B 5J1EB 1WNEA 3M9MB 1FKOB 1S9EB 1HQUB 4MFBB 3DOKB 3CDUA 4PUOB 1S6PA 1IKVA 2BANB 5HROB 2IAJB 4H4OA 5I42A 1KLMA 4J9LA 4FS1A 4IQXA 3BJYA 3IGVA 1GX6A 4I2QB 3CJ2A 4X2BA 3DOLA 2AGPA 4EBDA 1HQUA 4QW9A 1NNDA 2RF2A 2IM3A 5DQGA 4PUOA 1TP7A 3MFHA 4LSNA 3CDWA 3FQKA 5DGBA 3DOLB 4I2QA 3BSNA 1S49A 1C1BA 2FVCA 3CVKA 4WYWA 2ILYA 1DTQB 2D7SA 4NLGA 1RAJA 3C6TA 1S6PB 4MK7A 4ZPAA 5L1JA 3I5BA 2JC1A 2ASDA 4ED0A 4ZP7A 4K4TA 5KFJA 3KK1A 2FJWA 4IFVA 5DG9A 3KOAA 1IKYB 5DLGA 4WXOA 1RT5B 3DI6B 3BR9A 5F8HA 2YKNB 5KFAA 5KFPA 2FLLA 4ECXA 3QGIA 4NLTA 5KFTA 4O3NA 4IOBA 3G6YA 3DM2B 4ECZA 5L1LA 2AQ4A 1RA7A 1C2PA 4ED2A 2IMWP 1KLMB 4EO6A 4H54A 2OPQB 5C42B
chains in the Genus database with same CATH superfamily
5KG7A 2GQCA 1WJ9A 2FJVA 1HW8A 2KL8A 2O5DA 4IOCQ 2D3OR 2QV6A 4Y65A 2XTJP 3QIPA 4JV5J 1U1PA 4YB1P 2QL5B 4P2SA 1H7WA 4Q8FA 4PYAA 2RJZA 1NSAA 1RT5A 2YTCA 4DR3J 1U1NA 3M2UB 1M0SA 4Q2MA 3MOZA 1IQTA 5A76A 3IC1A 1LWCA 3MR6A 2ZH3A 5KFKA 1U2FA 2HQIA 3LP1A 1UFLA 3DRPA 5EDWA 3VALA 2FVSA 5D4PA 3U1LA 3WHIA 4BDPA 2B4OA 1YRXA 1XIQA 4X84A 1CVJA 2MPUA 3POTB 3B4MA 5E3CA 4QYZJ 2EWHA 3ONQA 1JJ4A 4XAKA 2CG8A 2GZOA 2W9CB 4J37A 2VJUA 3VVUA 3L95X 5K8OA 4DFJA 4E98A 2UUAF 1REGX 2M0GB 1T02A 4QR2A 4TVAB 4XPEA 1BY9A 4ATNA 5B0BA 2MGZA 4CIOA 3H4DA 1HNXJ 1FXLA 1ZA1B 1CJKB 1VS3A 4YHHF 4U7CA 4NLVA 3D6TB 1NDKA 4OZLA 2JVRA 2V67A 2YVSA 4WU2A 4C0HA 2F40A 2JJ4D 1VQOS 4LF8J 4OYIA 2ZHBA 5IOLA 4ZPDA 5GAGI 4Q7AA 4KO0A 1KQKA 2UXDJ 3KNGA 5SZTA 1UJ5A 5RUBA 4X4PA 2VDHA 3UR3C 4DBQA 2DGOA 4IG3A 4USWA 2XYHB 1HNZF 5I3UB 5KG3A 5CD4A 1QM9A 4R25A 3FCVA 2V4QA 1S0MA 4YB6A 2ZOGA 1N33F 4ZPCA 4A4JA 1YRTA 1IUJA 5IWAF 2B0GA 3NCRA 4F8RA 2NLWA 4DR5J 3AJDA 1SQEA 3KJVB 1RLCL 3S6EA 5KFYA 2J7WA 4OV1A 3VVTA 4CLWA 1CG2A 4EZ6A 1RBOB 4NA2A 3A8JA 4USJC 1ZH5A 1TKXB 4M5JA 4RLEA 1P9QC 1SJ1A 1C0UB 4NLRA 4N41A 2IMOA 5ETKA 2JEJA 3PKYA 4C3LA 3FUYA 3DC2A 1YDLA 2GC8A 3KLIB 3DDKA 2CNNB 4FNIA 1LXNA 4JI4J 2EFQA 2KVIA 4P2MA 1FF2A 2W9CA 1IJEB 2N4CA 2Q3PA 1E6VA 3EUNA 1FWPA 2F8EX 3MM6A 1YG0A 4RBVA 1TV6A 1GT8A 2LQBA 1O51A 2RB7A 2ZFHA 2FJAB 3CJ3A 3GG1A 2HQFA 3I87A 1DARA 2EPIA 4P7TA 1S0NA 2DR8A 4KPYA 4KRWA 3R1HA 2VFVA 3QJJA 3V2UC 1KWMA 3MHYA 3VTIA 1NK7A 4LF7F 1RWWB 2HQGA 3TQEA 4AD6A 2E44A 2NR0A 1RK8A 4PWDA 1HNVB 1KDNA 4QIGA 4CO3A 4YR3A 5F8NA 1AT1B 3IGNA 4NCGA 4OZNA 4LF6J 1C4AA 1UVNA 3PJ9A 3SQGB 3K5PA 1FD2A 2W4CA 2A18A 4JV5F 4Q43A 4R8UB 3TNVA 4RW6A 4B3TF 4ZHRA 1HNVA 2ZJQQ 3SBMA 4L3KA 4RW9B 1T9UA 2RQ4A 3R5CA 4JUZA 4CO0A 1X4CA 4NXMJ 3I4PA 2L41A 3R7NB 1BUXA 1LFPA 2D3UA 1UVIA 1NJZA 1S1TB 3HZEA 3OD2A 1X4HA 4O4GA 2V2KA 3IRXA 3MEEB 4ZP8A 1NKBA 3WC2A 4FYWB 1G2EA 3TYTA 2VBXA 1CEZA 4WJBA 3K89A 2A2CA 2Y1JA 2XZTB 3L4BC 3PTWA 1YLXA 1XNRJ 3QJLA 3H2VE 1QTNB 2GV1A 1RTHA 4YHHJ 2C1EB 3VAIA 4TY9A 3MM5B 4F2SA 4LIWA 2I9SA 3MTJA 3HVRA 4O0NA 3PXGa 2KN4A 3MM9A 1U1OA 2NREA 2JOQA 5FDLA 2F9DA 2UXDF 1TL5A 4URGA 1HMVA 1N48A 2HNYB 3J80Y 2PN6A 3VAHA 1KFSA 4C8OA 2SXLA 3THPA 3HDSA 1BQNB 1AXQA 1SVDA 2HLTA 2QLFB 2MQ8A 2KRBA 1RHRB 4I69A 4F4ZA 3DRRA 1RWPB 3AD7C 1WSVA 4NA1A 2G4BA 3FSIA 2FZCB 4LF4F 2HW3A 1RAAB 3CJ4A 3TI0A 1ZBTA 1MU2A 1R0AB 1N52B 3I0SB 5I3UA 2BKNA 3W9IA 1T95A 2UUBJ 2CWXA 5DDPC 2H65B 1WHWA 3SFGA 5L38A 2CJAA 5U47A 3MECA 2EEYA 2KM8C 5LT5A 2YWHA 3UD4P 1YITS 2HG4A 1NK6A 1WOSA 2GX8A 2QA4G 1U1QA 5C24B 5JVHQ 4Q45A 3EJMA 4YDDB 4DG1B 1EHWA 4B9VA 2ZEJA 4I6AA 1RT2B 3K5OA 1KONA 4FF1A 4A8WA 1S59A 1H2VZ 2DNNA 2LKZA 4EU0A 4DUYF 3VGUA 1RT4A 1LNQA 2QSWA 2GMJA 2EKNA 2Z0GA 4MKAA 4J9NA 2DHHA 2B5JA 4NMLA 4W90B 2WONB 5F3ZA 1NJXA 4X4QA 3HJFA 3MEEA 1NHVA 1IBMF 2FJXA 3UW1A 1O8BA 4N77A 5A2QY 2ZH4A 1OWXA 3JSMA 2MHEA 4ZCMA 1OSDA 4GC6A 3RBZA 3LWLA 4OI6A 4ZVOB 2Y1LB 5LMNF 4B3RF 4NYPA 2OMOA 2BJDA 1N5YA 3V4IA 2QG9B 1U2RA 2QLBB 1IM4A 1HBMA 5KFQA 2B7BB 4LMZA 4TYAA 4WK3A 4ECUA 1CPZA 4FXVA 3KFWX 3SCKE 3VR1A 1NCLA 5B09A 2RDIA 1SXLA 4O3QA 1S1XB 4LF6F 2VQFJ 4UOGA 3NNCA 1YBTA 2D41A 2AX0A 3AFGA 1HBMB 3DOMA 5F9LA 2N3OA 2ZUGA 1P6TA 2CNKB 3DGVA 2RRAA 4MK9A 3KDOA 4QIEA 4ZVFA 4LFBJ 5ETQA 2K1RB 3JSMB 5C7PA 1N6QB 3DHWC 4B3MF 2RQMA 4RW4B 5F9NA 1TVRA 4R5PB 1MN7A 1ICEB 3PDNA 2PA3A 5ETNA 4YOEA 1M90T 1B4SA 1G1XA 2ZVSA 1B0TA 1VDHA 3QT8A 1VQ8S 4CRJA 2I5JA 1FWKA 1RDRA 4QIWD 1MWQA 3V5RA 1UMJA 4B17A 3CCQS 4PXBA 3RAXA 1FERA 2Y9HA 3M6XA 1N5VA 2FGOA 4HTIA 3IG1B 4CI0B 2BOPA 1RKIA 4C4WA 2E5LF 2EFPA 3OL6A 4DV6F 3UPFA 4UZBA 2LLZA 3C15A 1ELOA 2H4YB 4KTQA 1JXVA 3D66A 4PXCA 3NL0A 3LH2S 1SC6A 2ZOFA 2BKOA 3ZNUA 3I56S 4ID5A 4FVCA 4DPUA 3G6VA 3RR7A 2HIQA 3ZO7A 1W2BR 3KLGA 1FDNA 1RWMB 2VB6A 3CJSA 2K1RA 5KOXA 1M5HA 3RB0A 2KZMA 2H51B 3H5UA 1IR0A 5EUHA 4DSLA 1YKWA 3OQ2A 2CQCA 1RHMB 3DU6A 2Z2YB 4L76A 2E1RA 4MKVA 2PI4A 2VFUA 1FD8A 2F4VJ 1WACA 3ILOA 3AHPA 4ZCIA 3CUNA 3UVJB 3CCES 4X4VA 4A8OA 4F3QA 5F8JA 3ILLA 1AB8A 3BGLA 4K4VA 3KG0A 4ZPVR 5GAGU 1D09B 2XMMA 3OLAA 2Q66A 3QJPA 3MF5A 2G2YA 2VG6B 1ZAVA 4EO8A 2KFNA 2WVFA 1Q0NA 2DNRA 3D28A 2UZAA 2WB1D 2RU3A 4DUYJ 2HHUA 3GQCA 1URRA 2ZC4A 2KT3A 2XMWA 3GP9A 3MMBA 2U1AA 3B82A 1M1GA 5FLXU 4NLXA 3KK3A 1NUEA 2CXEA 2GQQA 1E6YB 4OIXA 1RT6A 1T9YA 4OX6A 2BZ2A 1S9GA 2LDYA 1VRTA 4PG4A 3ULHA 3VGTA 5I3QA 4A8QA 3CO9A 1PCAA 3OFFA 4WXWA 2OEJA 1CJTA 1WC4A 2PMHA 1HQ2A 1S1UA 4DR2J 5D8HB 2FVQA 2K7JA 3MD1A 3OV7A 1IBKF 5KT7A 4OHXA 2BM1A 5GVQA 4L74A 5IQ6A 3DLKB 4Q8EA 3QATA 3PYGA 4K8RA 3OHAA 1CJTB 1WC1A 2OJ3A 4EGLA 3DDIA 3HF5A 4FN5A 1Q78A 1FA0A 4WTOB 1VK8A 2V34A 3CSKA 2AJQA 2HHSA 2FPHX 4DPYA 5C25B 2Y3YA 2UP1A 3C14A 4OI4A 2FVPA 5AT1B 5F8MA 2YNIA 1LW2B 1HBUB 2CDQA 2O01C 3O3LA 5J2NA 2ZH5A 1HWKA 2VOOA 2WONA 1RXOB 4JOUA 4TN2A 4YFUA 2Z56B 3UCZP 4IFYB 4RKUC 3GTYX 3RZAA 1BQMB 4C9DA 4I2PB 3BQ2A 2XY7A 1DTTA 1GMWD 1F1BB 4BS2A 3QLHA 4L75A 3Q8YA 4PG8A 3JAMY 3DLLQ 3KK2B 1GEHA 2JLFA 3R5BA 2P2CB 4JI0J 5E3PA 2YWFA 1H38A 5KT3A 3EDQB 3W9HA 4RWXA 1NJIT 3ZZTA 2QMWA 2JEIA 1LK7A 3QLHB 2DYAA 2J9CA 2VC0A 1NXIA 4ANDA 3BQ0A 5DDOC 3G4SS 1JB0C 5HVHA 5CA5A 3EGZA 2KKHA 3J7YU 1QD1A 3LAKA 5LJ3Y 2ASJA 2R2SA 1TFYA 1XJWB 2DEJA 3IN5A 1CS4A 1SH0A 3PJXA 3DRPB 2YH1A 2V2QA 2X51A 3OR1B 4M5MA 3G8TA 1Y0HA 5FIIA 1LWEA 4MJKA 3C14B 4OYZA 4H4OB 5IZHA 1X9MA 4TQSA 3P49B 4K5SA 3C19A 1JLGA 2LYVA 2OSRA 3H5SA 1S0OA 2VG7A 2IC3B 3ITHA 1S0VA 1K0VA 1N88A 2PO4A 5GADI 2AJ0A 4LF9J 2R2TA 2KG0A 3L9ZA 9ATCB 1HLWA 2GW8A 3MAQA 2M8DB 1I3OB 4HL9A 3PIOQ 4EEYA 2CQPA 2NSCA 4HT5A 1BLUA 4LSLA 5HVFA 3SCLE 4TU8A 4QWAA 2OPPA 1UWAA 2ZHOA 4OJGA 4AE5A 4F67A 8ATCB 3BGRA 1YJWS 4RWWA 4ZA1A 4X4NA 2HNDA 1MROA 2AZ1A 2BJ7A 4M63A 4PEOA 3CB4A 2BKPA 3FVYA 1SIZA 1Z1ZA 2BUNA 2JZ5A 4B9MA 4J91A 3PO4A 3R97A 3G9CA 1TAQA 1VQPS 3BGRB 3NY0A 4Z7CA 4K7QA 3EX7B 3ISZA 3CCUS 1PYTA 2XNQA 2ZHAA 2MKCA 3NCQA 1IR2A 3Q2SC 1X9SA 1CC8A 1GAOA 1N32J 1T0TV 1OYDA 4CO1A 3ISNC 1TL1A 4LBPA 2M3DA 2KHDA 3CULA 4CDIA 4DL4A 1M5SA 4IG0B 4DI6A 3OHBA 4LSLB 1UZHA 2AEJA 3IWXA 5KFVA 2NXNA 1U45A 1NZ8A 4Y00A 5C24A 2HWHA 1URNA 5HP1B 2CJYB 1S5ZA 2E5GA 2PEHA 2R2UA 3D9BA 1F9FA 1U26A 2LDIA 3HSZA 4NRUA 3U27A 5E3QA 3MEDA 2BDPA 2M7SA 3PW0A 2E1MC 3HX9A 3RBXA 4WZMA 1RWNB 2RKIA 4KKOB 2J0QD 1NK4A 4ED5A 2HBYB 1LEOA 1U48A 2XI2A 4DPOA 3MPUB 4Y2IA 3AH6A 2IHR1 2B8PA 4DSKA 1VBYA 2YWEA 3LA0A 2HS4A 3N01A 4ZMMA 2Y1IA 2E1AA 4QIFA 3PVXA 2ZWOA 3W5ZA 1NK5A 1PSDA 3GMGA 1F3VA 2L9NA 3VWSA 1QAJA 3UDEA 4A8KA 3C66A 1NPPA 4CO5A 1Q4RA 1ZOTA 3DRSB 4C11A 1KQFB 1NSPA 2E9TA 3C3LA 1TKXA 1FRXA 2R7RA 3K0JA 4QQBA 3FSYA 1F2HA 2CPHA 2EC2A 5DDRC 1ZM2A 3TJAA 2DH9A 4GKJJ 2AU0A 3O1LA 2J7KA 1TL3A 2LA4A 4QR1A 4DV2J 2J5AA 2EG2A 3P45B 5KFNA 4V19X 2DH8A 1YJVA 2GS8A 3D6MB 1VLYA 4MT1A 3TARA 4JI6J 1X5TA 2F8HA 2DKOB 1EAYC 2F65A 5IT0A 3CCSS 5ETSA 3ICLA 4KKOA 3RRGA 3GCWP 5BJRA 3HM9A 3H5XA 2ZNZA 2POKA 1RTJA 1HHQA 3W62A 1R43A 3BBCA 2W4DA 5A2QU 1HWUA 4F2RA 2D74B 3MGJA 1JQGA 3QYYA 4J9RA 3DOKA 1UKUA 4LQ3A 1JLFA 4ES3A 2MB0B 1UFWA 3QWUA 4NPOA 2W24A 4Q44A 2YNFB 5HATA 3H25A 5J1EB 4ED1A 4ZCKA 1WNEA 3M9MB 1GXLA 3M2VA 4MFBB 3MWBA 2QFIA 4QYZK 4J9VA 4CTAA 2RHSB 1KP6A 4ETZA 1RU1A 1IKVA 2BANB 2FJDB 2RNEA 4FF2A 2MY8A 2NXCA 2MZ1A 1NKCA 4IQXA 2BOAA 1HBOB 1N0UA 2K06A 1FVQA 2CZ4A 1U0HB 1U7LA 2HFOA 2W7AA 4EBDA 2AGPA 4WCEQ 1UEUA 4JI4F 1WF0A 3I96A 1TP7A 2C3YA 3M1VB 3J81j 4LSNA 2WW8A 2BJEA 1AA1B 2NUHA 4P2FA 3EZ5A 4NCAA 1I1GA 2VFRA 1TR0A 3DOLB 3AD8C 2LFVA 3AJ1A 2J76E 4KGZB 1S49A 1C1BA 2FVCA 2HURA 3ZTSA 4CLUA 1I5OB 3L7OA 1S6PB 5L1JA 4ILMA 1KR4A 1X4EA 4ED0A 1KRPA 4F26A 4WFAQ 3DRXA 1YBAA 3D54A 3TW0A 4WXOA 3DI6B 3BR9A 2FGCA 2N4DA 1CJVA 3PFOA 2FLLA 2HBZB 3NMRA 1NU4A 2A6MA 5K8PA 3J7A1 2VH7A 3QRQA 2CPEA 3EVWA 3G2XA 1J2VA 4HHUA 1R8CA 3RAMA 1WI6A 1UFKA 2AQ4A 2J9EA 2KXNB 4DFPA 1C2PA 2HZAA 2LQ9A 4EO6A 3EICA 2OPQB 3W7BA 5CD4H 4OHWA 4KPCA 1XC9A 2J9DE 2LQ5A 2CPZA 4OLOA 3QQCD 5IT4A 4FYYB 4DV4F 2UVVA 1REVA 1Q95G 2LXIA 5KFLA 4ECYA 2FJEB 4M5LA 3NEKA 4XPCA 4IFVB 2B9YA 5GAEU 3ZNJ1 1AYEA 4DPTA 3BV8A 1XNQF 4ICLB 4QCLA 2IVYA 1F2GA 4MYTA 2E7VA 2DTJA 2QN6B 3ELHA 3FFIA 1UW4A 2VC1A 2OD6A 3JSBA 1JK9B 4ZS6A 3V6HA 1LW0A 4ERDA 2COLA 1M5PC 3W8PA 1R7IA 5D6GA 3DMJA 5ETOA 1LFWA 1Y4ZB 3SCJE 4I56A 4QU7A 3GIJA 2HRTA 4LR9A 5BYSA 1HNWJ 2VFSA 3BBBA 2BRLA 3W8GA 1NK8A 4B3OB 4KJIA 4IG3B 3MAHA 2G0CA 3NWRA 3WDOA 1N6QA 1RA6A 1D1UA 2DRDA 3DMJB 1FX4A 2UV8G 5C25A 3MUTP 2WRMA 4UQGA 2HHQA 3R5AA 1X0PA 3S01A 2B9XA 1AZSB 2EBEA 1HWIA 3OL9A 3GPAA 2YKMA 2FVRA 2Z2LA 2UUTA 3FMWA 4C97A 2FD2A 2Z30B 1XBWA 2JC0A 3BF4A 5KFOA 2C3MA 4X4OA 1KLNA 4NXNJ 1BQMA 2I5JB 4NLWA 4NI2B 3BS9A 5GAHI 2ZOMA 4LFCF 4QU6A 4ZVQB 3J7YI 3Q24A 2ILZA 3IAS9 2L9DA 1ZA2B 1GX5A 4DR1F 2E5HA 1R89A 4DLEA 3Q8RB 2WVBA 2YKQA 4ZVSB 1RKJA 4X66J 4HHJA 5HBMA 5J2PB 3ILIA 3MAAA 4KC5A 5A8WA 2XCAA 5H9EJ 3TUJC 4JV2A 1VC0A 2ZM6J 3A1YG 5CYQA 1VQ5S 3DLJA 1Q8LA 2HNZA 2EG1A 2OTLS 2QA1A 4Y2CA 1LXJA 1ZAWA 1XERA 4DV3J 4KIAA 4C3KA 3CJKA 2NCKL 1IKYA 1NPRA 3HHKA 4OV6A 1IKXB 5CYMA 3CXCR 4OQJA 4J5OA 5A0YB 3DYAB 1JXEA 1RT1B 1O0PA 4P52A 1T9VA 3IR7B 4NWBA 3GYNA 3J81Y 3G6XA 3BO4A 4NZ6A 1VRQC 1XK8A 4PWWA 2IBKA 4RBUA 4G1QB 3M6WA 4YY3J 3CJKB 3VAMA 1Y3JA 4FXWA 4HI1A 2B9WA 3CCTA 4DQRA 2H5EA 5M2RA 3GIKA 4TQRA 2AJ1A 3U7JA 3G8SA 4EUVA 4WFZA 4DZDA 3AB2B 5A6WA 2E66A 5CYQB 3KLIA 2HWTA 3EXCX 4OYMA 3GV7B 1SKSA 2GHVC 2BABA 4S0MA 3TJ9A 1LOUA 5AE3A 1Y5NB 3MAAB 4PPZA 4X4SA 2G0JA 2QL9B 2W2OP 3CEDA 2XMVA 2WSCC 2J6UA 3DXBA 4O3OA 2MKJA 4HACA 5A8KA 1S1VB 1C0TA 4RUCA 4I68A 3QWPA 3PNIA 1RCOB 3LP2B 1HYSA 1APSA 2WBMA 1UVMA 2R8GA 4LUBA 4RNMA 3AAWB 4OZ2A 4P71A 4ER8A 4O23A 5AXKA 4CT8A 2QSFA 5LL6d 1FHTA 5MLCV 3GU0A 3MXHP 5EGYA 1Q16B 3Q86A 3MPYA 3IS9B 1RU2A 5HBMB 5J2PA 1T03A 1BMQB 1SC3B 4N7TA 5HK4A 5HQMA 3CPWR 4AYBD 1JLCA 2RS8A 4QZVB 2X1FA 1FJEB 1MG7A 2KI2A 4X65J 4DV5J 1FFSB 1TUVA 3FMBA 4WZQA 4Y2KA 1UTAA 3MEDB 2K7KA 3HKZD 4ZVHA 3ETOA 4EYHB 1HNWF 3GFHA 2YNIB 1HBUA 4F7VA 2QJ3A 5G0RB 4WKYA 4ZJOA 2RU9A 2G9OA 5I3PA 2DNPA 5HJYA 4E0DA 3OXGA 5E33A 4B9UA 4HKQA 1U2CA 5CZVA 2I1RA 1DTTB 1CJKA 1P1LA 4OX8A 4XO0A 3EPIA 2QFJA 1B3TA 4JI2J 3N5FA 4QBUA 4YR2A 1NPKA 3MM7A 2MZQA 3KUGA 4AQYJ 4K2JA 2DHXA 2UUCJ 2XO6A 2K3KA 4DPWA 2E29A 1R31A 4NLSA 4K0KF 3CMQA 1WDDA 3W61A 1PYOB 1LW0B 4M95A 3PR4A 4EBEA 4ANEA 3R9LA 5HVGA 3RG6A 2M88A 3ZFVA 1FRMA 2HPUA 3BDEA 4X66F 3OFEA 4U9RA 4DUZJ 4C0BA 3R7SB 1NBEB 4YS2A 1NO8A 4DX8H 2ABYA 5KT6A 4ED3A 2XY5A 5J2QA 1WSRA 2V8HA 2XMKA 2I6WA 4WWSA 3QGGA 3HFKA 3M32B 3TZZA 3CD6S 1TKTA 2XLJA 2J8SA 1RHQB 2LA6A 4IFYA 3OSNA 3HT3A 3O2IA 4B9TA 1FRHA 2W9AA 2VIHA 4GMKA 2M70A 3G82A 1YX2A 2IC3A 1FESA 3PX0A 3AQOA 2HVHA 1FFWB 2E5IA 2DNOA 2CJQA 3R7BB 3DLGB 4RX6A 5LSOA 4E8UA 1DQ9A 4LF5F 3NS5A 3PRDA 2MZSA 4JI1F 2CQGA 4OYXA 1RGVA 3MR3A 2JLGA 4F4XA 2DCLA 3LPYA 1YZ7A 3D3BJ 3D6FB 4HYKA 4JI7J 3FBEA 1UA1A 4RU9A 1FKPA 1HARA 1FEHA 2QRRA 3F44A 3I9V9 1NSQA 2YXLA 3GIIA 2BQRA 1S10A 4EZ9A 3LALA 2HNDB 2Q6CA 4F50A 1HWLA 2GMHA 1HR0F 3LP0A 2CPFA 1KQSR 3DLKA 2CQIA 4OJ1A 4WFXA 1VHIA 1HNIA 2IM0A 4L6V3 4UF4A 2ZD1A 2ALYB 5IFMA 4DSEA 3LW5C 4DOZA 3W66A 4CQ1A 3NLCA 3QT7A 3C2PA 2OPRB 1RAFB 3NGDA 3QPIA 2E1CA 3QO9B 3EMTA 2J0SD 2HFNA 2DNLA 2YQ3A 3BEGB 1ZTWA 3MPWA 1S6UA 2UUAJ 4WIQA 2WVEA 3JB9k 5JVGQ 3GG0A 3M8WA 1XN9A 1UJ4A 4Y3CA 3BM7A 4X64F 1SQFA 2E5LJ 1VISA 4ZP9A 2AW0A 2MGZB 3JYTB 2Q1LA 3IS9A 5LXRA 4IKAA 4YP3A 4Q0BB 2ROEA 3JXOA 4A48A 3FRZA 3ZTPA 5AJ3F 1QE1A 2UXBF 1FNXH 1D9AA 2JX2A 4LF1A 4RW4A 2B8QA 3TAQA 4M5KA 1C1CB 2C2KB 4I1TA 4OZ5A 3FZ2A 3QNWB 4JV1A 3GWCA 2CNOB 3CNQP 4FF3A 4LREA 1N33J 4DF8A 4QWCA 1QVFR 2CPIA 4K4UA 1T9WA 5I4MA 1MSWD 1T9XA 1SBRA 2JVOA 3OVSA 4O44B 5DETA 3LP2A 4IR1A 3W63A 3ZTRA 2FHJD 4JI2F 3NGTA 1T05B 1YJNS 3MM8A 1Z2LA 4P74A 3W1YC 2IJFA 2HGNA 3TP2A 5DJBA 2XYGB 4LSZB 3M9OB 3OTBA 3J7Z5 2GQ2A 5FJ4A 2GIQA 3PM9A 3ENAA 5GMKa 4OHYA 4K0KJ 3JSRA 4UTGA 3THTA 2F1FA 5C2GA 3NOGA 3EPGA 1HQEB 1VRUB 1XEZA 3HULA 2VICA 1HFEL 4H4KC 2JEFA 1WC0A 3UNYA 3MMCB 4KR0B 4ZLPA 2XS2A 4I2PA 3IBCB 2ZUAA 4O44A 3U1NA 3RW6A 2LXFA 5D4LA 3QRPA 5J2QB 4RPFA 3T1AA 3BGUA 3J7ZT 1FI4A 4F25A 1IBKJ 3PIPQ 4DG1A 4WP3A 5D4OA 4GVBA 3SDEB 4OZ1A 1GTEA 2VFTA 2ZNYA 1TK5A 2GAGC 3EGNA 4C8YA 3KUEA 4F0MA 1RYSA 4DSJA 3G8QA 4IH7A 2DGVA 4PRFA 1SQGA 2CRLA 4BWJA 4DV0F 5CZXA 9RUBA 5DLFA 3UN5A 4O3RA 2KYZA 1UPMB 2B5JB 2QE5A 5B0FA 5E41A 5GADU 2C2DA 4OZJA 1V5VA 2IJRA 2QL7B 4PQAA 4DS4A 1JXLA 4B3TJ 1JJHA 3FDSA 1TU0B 1YSJA 1HR0J 2UV8A 1WHYA 4K59A 3SFUA 4RUBA 3TANA 5IM0A 5ETLA 8RUCA 3UFCX 1RCXB 3QAEA 4NEYA 1H2UX 4XTTA 3ITHB 1WC5A 2LMIA 4W4MA 1GMWA 3M32A 2IBOA 1OY6A 4TKTA 1DBDA 2O67A 5B0GA 4ITSA 5DZ6A 1S76D 1UJ6A 3BO2A 4RU2A 3AXMA 2R7SA 3N79A 2W9BB 1WC3A 4DFKA 1RTIB 2BANA 1FE4A 2KXHA 3DLHA 1X31C 3M8PA 1MMNA 2E1PA 3HHLD 4C6AA 4F04B 2R8IA 1N34F 1TL3B 5EWEA 4UY8T 3LOUA 3MD3A 4C8NA 3CC7S 1HPZA 2DGWA 3TWZA 4KGKA 4CH7A 4CLKA 1ZETA 3M6UA 1LV5A 2V4JA 4DCPB 3BSOA 2CJKA 3UDCA 2YNHB 4YB7A 4ECQA 2OPSB 3IBWA 5JJBA 1MWZA 1VLOA 2X1GA 4OYAA 1B70B 3C6TB 1PAEX 2ERRA 3IM9A 1S6QA 4NLPA 1WDTA 4IO1A 4LR8A 2QMXA 2OH2A 3TA1A 2MQQA 3CCLS 1FWLA 2NZCA 1KKHA 2DK2A 3M30B 4FF4A 1JLQB 3C6UB 1Y7PA 3DN9A 1OS5A 1R0CB 2ROPA 3HSJA 4NYZA 3MPVA 4RUAA 2XO7A 3HP6A 1EARA 4CLSA 2A2DA 2VQEF 3RB3A 2AYEA 3RW7A 3V6DB 4L72B 5I42B 4WU3A 3VGVA 2RUGA 1VQSA 3C6UA 3CJQA 2AGOA 4ILLA 1KSPA 2CPYA 4RZRA 1F60B 1PJ6A 2D9OA 3OVAA 4ED6A 1FNOA 2HRUA 3QBCA 1S6QB 2ZBPA 5E7OB 1IBMJ 2V2VA 4XK8C 4DU8A 1PILA 5J1PA 3TA0A 1F9HA 3EVOA 3Q0AA 4DQSA 2D3O1 1ZTTA 2EC0A 2B56A 3ENVA 1VBKA 4DL7A 4B3RJ 1LWEB 2HVDA 1SIWB 2GJIA 2B43A 4CH1A 1UPPA 5HL7Q 2ZDPA 3F0NA 3LGHA 3TEHB 2HYIB 5EN1A 5H1SV 2ZH8A 4LRCA 5LSRA 3I31A 2A0FB 1MWYA 4M5GA 3LGNA 4KHPF 2MKYA 2RQKA 2VHGA 1I51B 1C4CA 3DU5A 1R27B 3OFGA 4IR9A 2XWYA 3SSRA 5GMEA 3K8WA 4I7FB 4H4MA 3CJRA 3SV3A 3FEXB 2RVJA 2DNGA 4RNHA 4EFAC 3QSYB 1UEVA 4YQWA 4G3IA 4H4KA 5KFIA 2QT7A 3PYDA 3AA8A 2VKRA 1WEXA 1EKSA 1XR7A 2M52A 2DIVA 1X5SA 2HBRB 2GVZB 3ETMA 1DLOA 4LVOP 3GJTB 1T3NA 1PAUB 5C42A 2LEBA 1ACMB 2MZTA 2NPIA 5J2NB 3KLGB 3BSAA 5AXMA 4UOCA 3OSPA 2DNHA 5C2CA 2M9KA 3KJFB 2F5GA 4GKJF 1WKJA 4L3NA 1YJ9S 2KXFA 2HKEA 1S79A 3AOBA 5J1NA 5HN0A 2R7WA 3C8YA 3T5JA 1B99A 5F0WA 4FYDA 2M8HA 2B51A 3KLEA 4Q2LA 4JI6F 5KT4A 1N34J 2DEIA 5EHHA 2AJ4A 1UW9A 3IG1A 1Q5YA 3IBFB 3KKFA 2OP5A 4F36A 3PX6A 5HSPA 1M1KT 2E9ZA 1U6FA 1MW7A 1QUPA 3GFZA 5FD1A 3M8ZA 2CPDA 2WK4A 2X7IA 3MDFA 3CJ0A 4NE9C 5HANA 1S97A 1WG1A 1V3ZA 2OO4A 3M2RA 4ZVRB 4XDDA 3O8WA 3QFHA 4Z2XA 2CA9A 2EFOA 2O1PA 3MCNA 3TO8A 3KJQB 2VOPA 2N7YA 4DV7J 1H6KX 3MOJB 2JEGA 1O6XA 4OI0A 4ZPWR 2RF2B 3NBPB 1S9GB 4ZPBA 4KV8A 4NLYA 4F0KA 4ZIVA 3FK4A 4DR4J 3N0VA 4UW2A 3GE9A 1RWKB 2P6SA 4PCQA 5KT5A 5D0EA 5HROA 3A13A 3NAIA 4NLUA 1VQKS 3A8IA 2NXEA 1YJUA 3CJ5A 5A8WB 2ZH6A 1XMBA 2GFFA 4ED7A 3VAGA 4GVLA 1ZM4A 2Z4PA 3D3CJ 3NAHA 3UD3P 2VL1A 5KFZA 3TVYA 3HVAA 2EBGA 3M2UA 3PEHA 2R8KA 3R2DJ 1KTQA 2MZJA 4F4AA 1EKRA 5M2PA 2KFZA 3TVZA 2FC8A 5IT9Y 3HHLC 3MUMP 4UT4A 3HSGA 4ZJQA 3AA9A 3DOKB 2YPYA 2R7UA 4TU9A 4MTPA 2FQQB 1KLMA 1GXUA 3TZXA 2R3VA 3IP0A 4P10A 2HS3A 1FRKA 1H98A 1U8WA 2RRNA 4FXDA 1VYAA 2IFXA 4QR0A 4QW9A 2RF2A 1VI7A 5DQGA 3CF5Q 3MM8B 2J7UA 1U25A 3UNGC 1MROB 2IYGA 2X1BA 2CJ9A 2EK1A 4KHPJ 3R5JB 4WYWA 2IDEA 5HI7A 1DTQB 4P73A 2MY7A 3M8RA 2DJWA 4ZPAA 1HD0A 2JC1A 4CNZA 2DCUB 4K4TA 5MAOA 2FC9A 4RJVA 5DG9A 1IXKA 2GHPA 3SZ2A 1CULB 3NGUA 5F8HA 4C8ZA 1J5EF 3FRYA 5KFAA 2WVCA 1NMEB 2H48B 3QGIA 2IVFB 2FY8A 1NJWA 1TUGB 3DDNA 3LTOA 3ZTQA 3T1YF 1U49A 5L1LA 1Q79A 1Q53A 2HZVA 1UL3A 3A8KA 2IMWP 3CMES 4H54A 3IR6B 2QYCA 3M4XA 4GO5X 2J9DA 1FRLA 3K17A 4BLGA 1GTHA 2XM3A 3MEGA 2ATLA 2YBVA 1ZM9A 4JI5F 3CD5A 3VHQA 2AEFA 4C11B 3FFIB 4LQ9A 5IT9U 1T94A 1XTZA 2CQDA 5J1EA 2WSEC 3F41A 3W65A 5FDLB 1MMDA 1JX4A 3FSXA 4HH1A 3I55S 1VC5A 1U1KA 1EB0A 3NOCA 3RBEA 5A8KB 1F6TA 2H54B 4DEZA 1OSCA 3KLEB 2GO9A 2W7PA 2R8HA 1UP1A 1X0FA 4ECSA 3V81A 3CTRA 2ZZNA 3EE3A 2ZBIA 1KBRA 3D67A 2XS7A 1IBCB 2XYPB 2JFKA 3M9NB 2KHCA 3CE8A 4IH5A 3SYZA 2XLIA 4CO2A 4JYAJ 4U6PA 2FLPA 3VQSA 1SJFA 1BQXA 4DJBA 3KYLA 4C2MA 3H40A 3LANA 1V3SA 5K8NA 1EIYB 1TZ0A 2B6AA 1NH8A 2KJWA 1S12A 3KLFB 2OELA 4QPTA 2FUG9 4NMXA 2A3JA 3PEJA 3WC0A 2ZM6F 3RAQA 1N8RT 2IPOB 2VJVA 1FKOA 3HD1A 1EQMA 2F4FA 1FXRA 5D0HA 5E3RA 2LEAA 1UVJA 4JI8J 3AJ2A 3L7PA 4ZLJA 4ZLLA 2ZVIA 5F3TA 3OFHA 3T9ZA 3PJWA 4DHVA 5H9EK 1RT6B 4DU7A 1U24A 1LKZA 3T5LA 1AUDA 4B3SF 1SH3A 2FLOA 4X4UA 5F8GA 5H9FK 1OPZA 1SC1B 2BA9A 1RTJB 4TLQA 4IRDA 1R0BG 1SV5A 2DNZA 4B9LA 3DLGA 2C2EA 4IUFA 3R3TA 5CABA 2DR6A 1CLFA 5D78A 2DNMA 2R9LA 3TAMB 4KV8B 4J9SA 4NI2A 3KWMA 2Z2ZA 5T7LB 2P5VA 5BXIA 1RHUB 4DL6A 2KDOA 5F0UA 1NH7A 2NXJA 3RYLA 4JI0F 3QIPB 4FDFA 4WE1A 3UWTA 3H42A 2ZJRQ 1EETA 5K14B 3FQLA 1ZYQA 4MKYA 3HHNB 3QRRA 3Q22A 4ETXA 3US5A 1SJ3P 3A4TA 4PG6A 2J6TA 1NJYA 5E3AA 1GMUA 3HHLA 4O4GB 3K7RA 1J5EJ 2MQNA 4KB7A 3JS9A 2OEKA 1G4CA 3Q8SB 1T05A 3KJVA 2VUGA 2C2NA 2LECA 2UU9J 3TX8A 4MH8A 2H5IB 2IRUA 5HAOA 2VPXB 3WX8A 2KFYA 4OYWA 4CYUA 3RGIA 7AT1B 3P6YC 1JWWA 4BC7A 3FC9A 1X7VA 4ICLA 1IVZA 4KO0B 2PEBA 1CJVB 1MLAA 2HZCA 2Q43A 3GYXB 4HTJA 4N8OA 1S57A 3I6PA 2QA2A 2V4RA 3K57A 2KM8B 2F63A 3QT5A 5LJ5Y 2ZH7A 1RBAA 2DHAA 1REVB 2WOMA 2R7OA 2BBEA 2D9PA 5DO2A 2RQCA 1YHQS 2AZ3A 3BKUA 4NASA 2YH0A 3PHEA 4WE1B 2MQMA 3JYTA 4NEZA 5KG6A 2OPQA 4U8YA 1PGZA 3MURP 4OHZA 5HMYA 1CQMA 3KLHB 3W5YA 4FBUA 2DY9A 2DGXA 1WG4A 4PPDA 2H4WB 1YWXA 4USHA 4LSNB 5IC4B 5BYRA 2QTWA 2C2MB 5KFRA 1F5AA 5F8IA 4A46A 3OJUA 1KNZA 4JYAF 3GONA 1W25A 1E6VB 1QDUB 4KFBA 3H2LA 3HHLB 4NOHA 3LP1B 5DG8A 3GIMA 2HVIA 1CJUB 4C3MA 1S48A 4ELUA 3MM5A 5KFXA 1S1WA 2ZBRA 3ILJA 3NNAA 4AL6A 1RJJA 2PE8A 3N4WA 4LFCJ 1EETB 5K14A 1VIXA 3GSIA 3MTKA 3OTOJ 3NMAA 2HK3A 4RW6B 1RT7A 1DJ0A 3P8BB 2OPPB 3CCZA 4PZVA 1K1QA 3MR7A 4QYRA 1XMOF 2XB2D 2CIMA 3S7RA 2BACA 3ZZUA 1Q82T 4X4RA 3PHTA 1Y9OA 2JNJA 4MYUA 2UVUA 4TU7A 2AEMA 3BPSP 4ILRA 2LP4A 1VRTB 2VU5A 1FTCA 5KFSA 1JLEA 1SUQA 4YR0A 1YJTA 2EW9A 1BD6A 3CD7A 3CJTA 1HQEA 3FEZA 4ZITA 1VBZA 3H59A 3FZBA 5KFDA 3SI8A 2XLKA 1LWCB 2ASYA 1NLKL 1DQAA 3WQPA 4OFZA 1HI0P 5KFWA 4OYBA 3KLHA 3SDEA 2MKIA 1QJHA 3M30A 4GRSA 4QPXA 4O3PA 1NM2A 2GJFA 2AJ2A 1JLEB 5HQLA 1K47A 4G1PA 4W92B 1RAGB 4WYLA 1IKXA 1IQZA 2HQ3A 2IJNA 3M05A 1KOOA 2JL9A 5D4NA 3KHRA 3HKWA 4DZ6A 3OUYB 2KZZA 4ECRA 2WOMB 3AODA 1YZ6A 2F3JA 3H98A 1L3TA 4EI2A 1VRUA 5LM7E 1PBUA 2JRSA 3KJNB 4RW8A 1A0OB 5CQGA 3UI3A 3OBIA 1TFWA 4KGMA 2MYFA 3IA0A 2GO8A 1JNRB 1RWXB 3AXKA 3T19A 1KS2A 2RILA 4FZVA 1XR5A 4YMEA 5KOWA 3I0RA 1S6OA 3DRRB 2G13A 2IYIA 3CWJA 2QLJB 3HT0A 3JQMA 4MKBA 4DR7J 4DQPA 2HHVA 4DCOB 4P6QA 1G3OA 2J0WA 3FCHA 4G65A 4Z37A 1FXDA 2HNYA 2X3GA 4MIAA 4WFYA 2BJ9A 4OZ0A 3BGOP 4DMZA 2IIHA 2P6TA 2UU9F 4CP5A 4EK2A 2G1DA 4A8FA 2XHCA 3OTDA 2YWKA 3RRHA 2I8EA 4X64J 2YKMB 4F02A 1RTIA 1NEEA 4C8KA 2EXUA 2L9WA 4DFMA 3DRYA 4WFNQ 2UXCJ 3HVTA 1NHUA 1IR1A 3MM9B 5IS2A 2KO1A 4DXLA 3AOAA 1SJRA 2LU1A 5KFGA 3GILA 4F4KA 2WB4A 4ZCLA 5T7LA 2C2ZB 1U4BA 4H4MB 4BC9A 1Z2ZA 2X3DA 3CIMA 5J2MB 1TQLA 4YN3B 1X60A 1WKLA 4PWUA 1R8HA 3BPDA 2YX4A 2RT3A 1RAEB 4ES2A 1IKWB 3ZZZA 1SKRA 3E01B 2WTFA 4IYQA 3GJRB 2ADCA 5CH7B 4B9SA 1SUQB 1NDPA 1T03B 1B7FA 3AOCA 1WF1A 4NXNF 1JLBA 2NYHA 1P1TA 4JI3F 2V2ZA 3D0GE 1NSKL 2Y0BB 5CYJA 2HS0A 1VFJA 2DY1A 4AUKA 2LCWA 2W4PA 5D3GB 3G82B 3RBDA 2MZRA 2WW4A 3NCPA 3MEGB 1B64A 3THVA 4IOAQ 2LXUA 1EP4A 1HL6A 1CSJA 1R6VA 3MUVP 1YTYA 2GIRA 2PFDA 2B3TB 1LWFB 2BRKA 4DR6J 2Z8QA 2HAIA 3HFZB 4PQUA 2OIHA 3MMCA 1ITPA 3UCUP 2ZDOA 3OR2A 5HLFA 4GO7X 5KTQA 3R1LA 2LVWA 4LR7A 2DH7A 5D15A 4ZDNA 3HHEA 1FJGJ 5ETMA 4PR6A 3P96A 4DV3F 4J9MA 2RE1A 4O4RA 2P8IA 5E5NA 1U02A 2I0XA 4CLZA 5L39A 2CDRB 3HSDA 3UN2A 3BREA 4DV4J 1PJ5A 4LBHA 2HRYA 4ID5B 2ROGA 5A0YA 4ES1A 3EXYA 5CCLA 4GC7A 1YI2S 4IRCA 1L3UA 1WOOA 1XNQJ 4A47A 1NB2A 1DURA 1H3DA 5CXTA 1V9OA 3G86A 5KG4A 3R2CJ 4DR3F 3PG9A 2AT1B 1K44A 2BE9B 1D8ZA 3BN7A 1WC6A 1ZAXA 2XSJB 2YKPA 4M5IA 2OFGX 2MEWA 4KHRA 3Q8QB 1I94J 2L3MA 1FRJA 1NRKA 4EMDA 2HEKA 5J2MA 1RE1B 3HPOA 4DR7F 1CQNA 3C15B 1VR6A 3CCWA 5D0GA 2DR7A 2HFVA 3UDLA 3CCJS 3X1LB 2HHTA 4PXDA 3E01A 1DLOB 3I5AA 3T1HJ 4ELTA 1TMJA 4R5PA 4ED8A 5KFCA 2W9BA 4F4WA 1GQEA 1YJ7A 4CM0A 1QUVA 2ZBQA 2RMLA 4ECTA 2AD9A 4TY8A 1X4BA 2MJNA 3DLBA 2GVZA 4DSFA 2FZKB 1PIEA 3UN3A 1X8DA 2CQ0A 2VKZG 2VG7B 3EDRB 3QIDA 1X4FA 4X65F 3OUYA 4F4YA 2ZD1B 2K2PA 3FJ2A 5IXUA 7FD1A 3E3XA 2JSXA 3PR5B 1UVKA 2YX1A 3G87A 5KFMA 2M5YA 1X4GA 3TVKA 3VZIA 4CM2A 2QLXA 4NRTA 3UQSA 4PG5A 2W25A 2YKAA 1DFDA 1FTRA 4USUA 1RAHB 3TA2A 4AXIA 2CQBA 2R4FA 1FO1A 1UETA 2GAHC 1HIYA 1D9FA 2HHHJ 2GHWA 3KNAA 2ZZTA 2ZBCA 3HVWA 2MTLA 2C42A 3A3PB 3NRBA 4N8NA 1FDDA 3S1TA 4ZP6A 4E2FB 3AQPA 2HMIA 2BE2A 3CT9A 1F5CA 3H20A 1RSCA 1HBNA 4OI1A 5KT2A 3BO3A 4B08A 4KE5A 3IWNC 1F9EB 1V6HA 2EFVA 5DZ7A 4CYUB 2MSTA 1N5YB 2FB0A 1QAYA 2HHPA 3GR0A 3ZTOA 4PWDB 4X62J 4DV1J 2XBPA 4ZIWA 1RT3A 1WUUA 3PKMA 1Q1KA 4J9OA 2U2FA 2XGQA 3IWLA 2H9ZA 2V68A 3MCOA 4EWTA 3JAMU 3VCDA 3OT9A 3VZHA 2RKIB 1OPIA 1NKEA 2KRRA 4DR6F 1RISA 3GLJA 3MCMA 3QSIA 2AMCB 3E8OA 1RP5A 3ZZYA 2QIFA 4CLPA 3TJ8A 2HNZB 1U1LA 2FY1A 5GAHU 5L8RC 2DGUA 3NWGA 1FKAF 4I6YA 2XMUA 1FJGF 3EVMA 2K8GA 3NBPA 1O5JA 4U8VA 5L1IA 2EVZA 2G1HA 3QGPA 2P9GA 4UOHA 1UA0A 3D5MA 1DZ5A 1MNEA 3W5XA 3SQOP 4RL1A 4BCAA 3K58A 3J7AN 3B4DA 4OX9F 3Q89A 4MFBA 3DNCA 2ZH2A 2HHXA 3CIZA 2V8PA 3LUYA 5KG1A 1U1MA 2HHWA 1PYSB 2MLYA 3G71S 4JI7F 1RABB 1BGXT 1BC6A 3KHHA 4UUWA 5K9FA 1SCJB 5BYQA 2FLNA 1JLGB 4QJVA 2MDAA 5JUMA 4OYOA 3BKFA 2UVRA 4LRAA 3L7UA 1IBLF 1UAWA 2PA8D 4I7FA 3V6DA 1YGYA 1SL0A 3BQ1A 1J5OB 2OLWA 1HHSA 4QWBA 1R8AA 2VDIA 4CH0S 2XWXA 1RTDB 2MQOA 2V8VA 3IM8A 4USIA 4Q0BA 3GV5B 4ECVA 2GMLA 2OD4A 3QZ7A 3CGIA 1YIJS 2DRBA 2RH3A 3RUBL 3HJVA 2UVWA 2ZH9A 2IY5B 3ET6A 2HGMA 2J0XA 3W2VA 3RB4A 3NNHA 5KFFA 2KB2A 1VQ9S 1RTDA 2B7CB 2KT2A 2L48A 1RLDA 4WP9A 3TEGA 4DL5A 2QLWA 4JBCA 5CCMA 1D8YA 3M6VA 3EZUA 1PO6A 3LGMA 4N76A 1S9FA 3J80U 1Q5VA 1RYRA 4WF9Q 5LMUJ 3Q8VA 2LQ8A 4TYBA 5AE1A 1F3FA 1TL4A 4OHVA 5B7WA 1QTMA 1Y5IB 2ZZMA 2XS5A 1OYEA 3WBZA 5DDQC 2BQUA 5AJ3J 2UXBJ 3SXLA 3MR2A 2GVDB 1GNKA 5LOQA 2R2RA 2DBBA 2RRBA 4KAIA 4BHQA 3W2WA 4WP8A 6FD1A 2IAJA 4DV7F 3GR1A 1KHVA 1J5OA 4LF4J 3HLUA 1HHTP 2QEXS 2UUBF 3E2EA 4QW8A 1QVGR 2YNHA 4WTYA 2GCFA 3PRVA 3M8SA 2ZE2A 2OMLA 2VASA 3C16A 3H0PA 2CJXB 3U1MA 1PC4A 2JDJA 1VGYA 1DTQA 4FKYA 4CWBA 4LF7J 3NGRA 2DHSA 4PAAA 2KVQE 3HHDA 3OVBA 2CQHA 3A12A 3BGFA 2QX0A 1LQ9A 2D3ZA 2MQLA 2W2PP 2VG5A 1WHXA 2CZVC 4FKXA 1A6LA 1U0SA 1KEKA 4XIUA 3G96A 2WVDA 1TKZA 3MEKA 4PABA 1R8PA 2JHEA 4UUXA 3ZZ0A 4DN0A 3OJSA 5B0CA 2DNQA 4HR2A 5DM7Q 4WK1A 3MM6B 1K73T 3D1QA 1RAOA 4DSIA 1H73A 4PG7A 1U0HA 3I5CA 2RSQA 4G1IA 3T41A 2KH9A 4DF4A 2FTRA 5F41A 4C8LA 2CG4A 4K50A 4KT0C 1RT1A 5DS7A 5IM0B 1T3OA 5LMNJ 4NXMF 3WIUA 3DXSX 4C0OC 1FVSA 4LRDA 4CTAB 3MCSA 1H74A 4GKKF 1EX8A 1Y00A 4OX9J 2G2OA 1WG5A 2ZE2B 3CDAA 4ELVA 2CZ9A 1FKOB 2Q79A 1HNZJ 5CAAA 2CVIA 3CDUA 4YUDA 2C3OA 2VBZA 3ZZRA 5HROB 1YRUA 1GXTA 2IAJB 1Q8BA 5I42A 1SI9A 1IBLJ 1EJ7L 3BJYA 1N36J 3IGVA 1GX6A 2APOA 4I2QB 3CJ2A 4B3MJ 3M2VB 3JSYA 1VQNS 4CLFA 1L3SA 2L08A 3FKBA 1NNDA 1PBAA 3KG4A 4DCJB 2VF3A 1N5TA 4ZN3A 2AYGA 2XMTA 5CHCB 5DGBA 1LK5A 4DUTA 4I2QA 1QSYA 4CCHA 1SPBP 1X4AA 4FVMA 2Y8YA 2ILYA 3HZGA 4M5NA 1T7PA 4NLGA 1RAJA 3C6TA 2B4UA 2BYCA 2VBYA 4FP9A 3I5BA 2DNKA 1H2TZ 3N28A 4YDXA 5B0EA 2ASDA 3M7VA 3TRGA 2W01A 1VCTA 5KFJA 2DR5A 3X3UA 1JNZB 4IFVA 4HDHA 5ETTA 1VQ7S 1QLNA 3H7HB 3HCXA 2PGCA 4QIVA 5KFPA 4DV6J 2DHGA 1M5KC 3Q2TC 4NLTA 5KFTA 3DFEA 3CC2S 2PFFB 4DQIA 1HA1A 3ENWA 3G6YA 2DPJA 1CULA 1JJCB 1IJFB 1FX2A 4LRFA 2ZJPQ 4ED2A 3W64A 2B4VA 5C42B 3PCOB 4R0EA 1TV6B 1FDBA 1T11A 2PD1A 2Z57B 3I82A 2PI5A 1WKKA 2BE7D 2EK6A 2FHJA 5DG7A 2BR0A 3GFYA 4Y2AA 2OEMA 3O6QA 1N54B 3EYZA 3NS7B 4KY3A 3DI6A 3FGVA 4K4ZA 2CJBA 4C7QA 2QA4S 4LFAJ 3EGWB 2XZDB 4MAKA 3LAMA 5CYMB 4U67Q 1TL1B 3TR5A 2ACYA 3CO0P 1B0PA 1JLAA 2NYIA 2E7XA 1UWBA 2NUUG 3I32A 4ZVEA 3SSSA 3HMJG 3D2WA 3IRXB 4DL2A 3R6LB 4J9KA 4EYIB 3PW5A 1AW0A 2PC6A 3I9ZA 3FBBA 3M1VA 3ZC4A 2VQFF 1U1RA 2IM1A 2X1AA 2KU7A 5HP1A 2QZ8A 3HD2A 3N5BA 2HAFA 3VAFA 1NB7A 4DWIA 3V6JA 1MN9A 1SH2A 5KFEA 4M5DB 1IKWA 3NS6A 2VG5B 1RB0A 1SC4B 4IDKB 1K1SA 4L73A 1S4FA 3SCIE 4LFBF 3G6ES 1RWVB 4V1Ak 3V81B 2AYMA 5AXLA 2DR9A 2R42A 4FYVB 3V4IB 2IRYA 1S1WB 2Y1RI 1HMVB 3V4MA 4FBTA 3KDNA 2ASLA 1KQGB 2O3DA 2V0NA 4GKKJ 4K4WA 2JLEA 3HVTB 5D3GA 3PRBA 2ATCB 3OTEA 2IM2A 4OMFG 5ETRA 4DDFA 1BHNA 3B78A 4ZVUB 1FKPB 3FBCA 4N56A 2YKOA 4RNOA 1VQMS 1SL2A 4ZKAA 2DITA 2MMYA 1JLFB 3T6BA 2ADBA 2V9KA 4DX5A 1R0AA 3I0SA 4D3HA 3M8QB 2WSFC 5L9NA 3GIRA 3HI9A 2ALZA 4AT1B 3DKDA 4CNYA 2V6AA 3H4BA 3P3DA 3MR5A 4MK8A 1DRZA 3DGPA 2HGLA 3DHXA 1N36F 2CKWA 2BJ8A 2Y0SD 1SJ4P 4UZCA 2OSQA 4DL0C 4F3OA 2N3LA 2WCXA 4P9SA 2FJBB 2IDLA 3GJQB 5B0DA 1S9EA 2AWZA 3CDBA 4RBTA 4NLQA 4RUHA 1UEKA 1D9DA 3OXFA 2JH3A 3M2RB 3MECB 2OKQA 3I0RB 2I38A 4P75A 5LXYA 1S77D 1C0TB 5T14A 3RR8A 4IQMA 1KTVA 1P8GA 3RTVA 2R8JA 1VIOA 3TUPA 2CQ1A 3BBFA 4USVA 4MIBA 4RW8B 3ZZOA 4M8LA 2V9WA 3SQGA 4DR5F 5KFHA 4B3OA 3TAMA 2DISA 2VODA 2OHDA 2VQEJ 4ZVPB 1M5VC 4X4TA 2J8AA 2AJFE 2V5HG 2VBWA 3WX4A 5SUHA 3HO1A 4KHMA 6AT1B 3VGSA 1EZZB 3NGKA 3QZ8A 1SKWA 5L1KA 2OPSA 3DM2A 3F56A 2OGUA 2VONA 3LPEA 4LF2A 4ZHRB 3AY0A 3NGSA 3PW7A 3DYAA 2K3IA 3ENQA 3SMZA 4HVZA 2YKNA 5IV4A 5DM6Q 4JV0A 5DGAA 2KG1A 3TQ1A 4LF9F 2AGQA 4G1QA 3O44A 3D4JA 3B8HA 2C2OB 1N56A 4DR4F 5DQHA 4U95A 4HACB 3H8YA 2XHWA 4DR2F 5D77A 4JP8A 1WEYA 1RT7B 2BQ3A 4A8XA 2DXFA 1S99A 4AL5A 3LO3A 1KVIA 4RW7A 3FCWA 4M5HA 1YVFA 2YWGA 1U09A 3CC4S 4OJ3A 1D0EA 2RIJA 4RW9A 4TNOA 2VPYB 3SSQA 1YQHA 3D1HA 4NLDA 3MMBB 2OUGA 4F3MA 3E51A 2E9RX 2GVDA 1XMQF 3KK3B 1ULRA 1RWOB 3BB5A 3R5DA 4RW7B 1FRIA 1RHJB 5HMXA 3IXQA 5C5JA 3T5HA 1VC6A 2YPZA 1HYSB 3RU0A 4HHHA 2PT0A 1OO0B 3MPDA 1IN0A 3EM1A 1UVLA 2F8MA 1AFJA 4I64A 1VBXA 1HI1A 3KLFA 2XC9A 3R8YA 4IDKA 3CMAS 1QSSA 1P9YA 1TKDA 2BE2B 3RJMB 2Z2MA 6FDRA 3TX0A 1TTHB 5G0RA 4V19J 3PYFA 4DLGA 1RI7A 2NQPA 3K5NA 1LWXA 1OQ3A 3RRKA 5FLXY 3OL8A 3TZYA 2G0IA 2E5JA 2MKHA 1Q81T 3L3CA 1H7XA 1S7IA 4HEA9 2AYBA 2VG6A 4NZ0A 5EWGA 4KGVB 1XNRF 3WZ0A 3LF0A 4Y28C 4URSA 5KG2A 5JMNA 1BQNA 2CADA 4LT6A 3OLBA 1WORA 4DQQA 3CW2C 1CS4B 2BVZA 4O3SA 2AKWB 1OIAA 2DXEA 1X5OA 2HQDA 1OQ6A 2OPRA 3LWMA 2XNRA 1S7HA 3KK1B 1DQ8A 1IWGA 1SJQA 1VJWA 3PW2A 4CLLA 1Q7YT 4GVBB 2LEPA 5JXSA 3BDPA 1VQ6S 3OPKA 2VPZB 2AV5A 3W9JA 2MLXA 4KQZA 1N5QA 1L5UA 3HK2A 1L3KA 3KLVA 3K5MA 1NK0A 4DN9A 1FK9B 1L3VA 1FJCA 5H9FJ 1QY7A 4FYXB 4JB8B 1Q8IA 2N7CA 5E2QA 4ENOA 3K5LA 3GCXP 3UDVA 4DV2F 4K2XA 2C3PA 2AP6A 2BJ3A 2CPJA 2XMAA 2KT5A 4K4YA 2ZWPA 2DGSA 3UE2A 1RWUA 2QC3A 1H72C 3M8QA 1DHMA 2DIUA 5GMDA 4OJHA 1HW9A 1HWJA 4OZ3A 1FDAA 3BN4A 1S72S 3QO9A 3CCRS 3L09A 2RS2A 2PDAA 5EX3A 3I4HX 4WFBQ 2FHMA 4TXSA 3PZPA 4PYDA 2R7QA 4AFFA 3TAPA 5IC6B 3SEOA 3IFEA 3KG1A 2W8LA 4NCGB 1S1VA 1TVRB 2JWNA 3CDEA 3NP5A 5ADZA 3POTA 4Y34A 4K4XA 3OW2R 2NSBA 4M1KA 1S1TA 2PSZA 4Q5VA 1WWHA 3EWGA 3DLEB 4ANCA 4OL8A 2JFDA 3P4UB 1Y10A 2VZ9A 2W2NP 3ISND 1IWAA 3LQVA 3KHGA 1CJUA 4HH0A 2BXJA 4NX9A 3N6NA 1KVJA 2CQ3A 3ADAC 3GYGA 4C48A 2NZ4A 1BWEA 4C8MA 2H1YA 3PACA 1JMTA 3OR2B 5BR8J 5HLFB 2HWIA 3FNNA 1S1XA 2A1BA 1GH8A 3R27A 3J81U 1M5OC 2I2YA 4LIRA 2CNLB 1B0VA 3PV8A 1XMQJ 4RO0A 1F0XA 3A8EA 1NK9A 2VD3A 3A3NB 4ZK7M 1N0VC 3UCGA 2XQCA 1HNIB 3QMQA 4NA3A 4MMOA 1WEZA 2W1BA 5HMWA 1TKTB 2EKYA 4TY8B 1UCNA 3C16B 1P27B 2H5JB 3KXDA 2BX6A 2VPWB 1C1CA 1DY3A 2PMWA 2WAQD 1RUSA 1Z4UA 2YY3A 5EX0A 5IV3A 2W8KA 3KHLA 8AT1B 1FJ7A 4KFBB 2AX1A 2QYGA 2YNGA 1JLBB 2V8GA 3MMAB 4HDGA 3UVJA 4DX7A 3MFIA 1M1HA 4K5RA 2RDJA 1TL7A 3T1YJ 1NDCA 5L9XA 3PX4A 3CD0A 4J9PA 4F0HA 5A8RA 2B4PA 1UZDA 1SB6A 3FBFA 1JLAB 1I94F 3K59A 3EZOA 4KBIA 5HMZA 1JJ2R 5DQIA 2DB1A 3D0IE 3O5TB 4PXEA 5KFUA 3W2WB 2OFHX 3BSCA 4ZLNA 3UR0A 3KMSA 4JI5J 4ZVGA 1VOMA 2V69A 1C0UA 2HFZA 1RT2A 5KFBA 4ID8A 1XQIA 2HBQB 2CPXA 1N5SA 2P9CA 4HI2A 5HO4A 4IO9Q 1WTBA 3AD9C 1HPZB 2EI5A 2RUSA 4CLYA 3W3SA 4G6VB 1R8BA 1WELA 4P7VA 3KK2A 2CQ4A 1AZSA 1HI8A 1XR6A 3DRSA 1S4EA 1RTZA 2IA0A 2VV5A 1RZMA 2OI2A 5DRKA 5HJXA 5IQQA 1MU2B 1WTFA 4WPAA 2NPFA 2MLZA 2XEXA 5A8RB 3BYRA 3R5GA 4ALZA 1RBLA 1Y3KA 1KHWA 1PC5A 3IAM9 1VMBA 3EGVA 4M94A 3MMAA 3MM7B 3N6LA 2DO0A 1ZZNA 4IH6A 4DS5A 4IRKA 2KJVA 3OXLA 2F4VF 1TL7B 1EQ0A 2ACMA 1FK9A 2DO4A 2IVMA 5B08A 4TLRA 1VQLS 1H0HB 4BWMA 1RTHB 3S8SA 2M2BA 4USTA 4Z7YA 2XSJA 2HIYA 4R8UA 2LQJA 3GB0A 3DOMB 1SKUB 4KSEB 2WHOA 5G4DA 3TOQA 2HHHF 1QAIA 2GJ2A 4OYPA 4QWDA 3LP0B 4UOFA 1V5IB 2YWWA 5B0AA 3BZQA 1FCAA 1XWLA 2DPIA 3P5TL 5GAEI 2YX7A 3IMQJ 5THWA 2YNFA 2MSSA 1FT8A 4IG0A 2FHKA 5K20B 4B3SJ 2Y8WA 4Y2MA 4YB5A 4CLTA 4J9QA 3V6KA 1HD1A 3D1OA 3VF0B 3RB6A 4LVNP 2IA6A 4I67A 4AXJA 4X62F 4U7UD 4DV1F 2CQ2A 1R3NA 3UD5A 1RQ0A 1X4DA 4P2XA 4DX6A 3OTOF 2XCPA 4OX7A 5E0OA 1OY8A 2Q6BA 1HBOA 3F73A 1D3WA 1KD1T 1VK3A 1XMOJ 4LJMA 3KMQA 1TAUA 1T9TA 3JTPA 3U02A 4WBFA 1QSLA 4J90A 2MHNA 2GNKA 3D68A 2KYXA 1Y5LB 4KH0B 4ZN1A 5AE2A 4J7CA 3JTOA 5BR8F 2A10A 4DL3A 4HLBA 3CJ8A 1CBKA 4Y6IA 3GSDA 2LU2A 2V50A 4NCBA 5EWFA 2QO3A 1RT4B 2HSEB 1JIHA 1KVKA 1VHFA 5ITHA 1A7GE 5K5MA 3K8VA 4OI3A 4CT9A 1YK9A 1IM6A 1G6BA 1HBNB 4KGXB 2V4JB 4XDCA 4ZPTR 5HQ8A 1TK0A 1RAIB 3OR1A 2NXUA 1A9NB 1T8EA 2KTQA 1E6YA 2HLUA 1WOPA 4NL5A 5M2UA 2DNYA 2GIFA 2J6SA 2CVEA 2F7VA 3IR5B 1ZZFA 3QFWA 1OMSA 3GZ7A 4PQUB 2YQ0A 3D7SB 3MI7X 3ZZPA 3K2YA 2PMZD 3VV2B 1OY9A 4D3GA 4A8YA 2FZGB 1JLCB 4NZ7A 3T6JA 5ETPA 3GFXA 4B9NA 2AHOB 4DPXA 1KN6A 1FNMA 1G7CB 1EP4B 1KFDA 3R6GB 2XI3A 4ZVTB 3WIVA 2DXDA 4ED4A 4EBCA 2BMBA 5L46A 2R7VA 1FFGB 1PG5B 2N82B 3HXMA 2R7XA 3D6HB 4LRBA 3QT6A 3M8YA 2BEFA 1N4LA 4K4SA 1Q7LB 1WD6A 1U8SA 3OL7A 1K0TA 4P72A 1PJ7A 2RHQB 2GA7A 2V8DA 1FE0A 4ECWA 2RD5C 2XG8A 1VQYA 4FS2A 2D69A 1B7YB 1YJRA 4I6WA 4B02A 4NYOA 3M8PB 2CAJA 3ET6B 3BKTA 3JQKA 3W2VB 5LMUF 1BWVA 2O66A 2V94A 3OTCA 2W7OA 2Z58B 3B54A 2DGQA 4I4BA 1GK8A 1QAXA 2UXCF 1BXNA 2BM0A 2VA2A 2YNGB 2F9JA 3PO5A 1ZPWX 5LSLA 4DR1J 3DCAA 1WF2A 1YBUA 1I6JA 4ZOSA 4RR5A 2ZKUA 4URQU 2WBRA 5KAKA 4QOTA 5KG0A 2ZKTA 1OJ4A 4UQTA 1GMVA 4UY85 1C1BB 1R6YA 3Q83A 3TUIC 3NKYA 3T3FA 1JKHA 2C28A 2W2MP 3SV4A 3FEYB 3CCVS 3GV8B 2HFSA 1GFWB 1MMLA 2HVEA 1ROFA 1W2IA 2QGFB 3HFVA 3UO0A 1CC7A 4C98A 3TUZC 3BR8A 4AQYF 4NLOA 2FHOB 2XMJA 2DD8S 3CCMS 4O0IA 1S1UB 1X5PA 4ZJLA 3QGHA 4R0JA 3H90A 3Q8UA 4LBIA 2DRAA 5ETVA 1N32F 5AXNA 2ZITA 1JLQA 1UWBB 4YY3F 3H5YA 1Q86T 4WIIA 2E7WA 4KH1B 1TKZB 5K8MA 2MQPA 1DAXA 2C2RA 3KUHA 4PKDB 4USMA 5KG5A 2VA3A 2XY6A 1RT3B 4N47A 1JKHB 3Q8PB 1K8AT 1LWFA 2HQCA 2DVIA 3P5BP 4A8MP 2XULA 4HT7A 1W26A 4YEAA 7FDRA 2HK2A 1VJQA 3Q23A 2HMIB 1LW2A 1SV5B 2EFNA 4BBYA 2MXYA 4OLPA 4LF5J 3JQJA 2UUWA 3PW4A 2B6AB 4M5DA 3TZWA 2C22A 4JI1J 2XGPA 2GGPB 3T5KA 4OI2A 2HFUA 1TELA 1ZM3A 2RDDA 4N5SA 1AROP 1Q8KA 2HVZA 2OTJS 2CUYA 2FYXA 1U6BA 2H3EB 2MJUA 1HNXF 4WKRA 1HKAA 3DLEA 3KTQA 2D1CA 1IKVB 2EFGA 4RNFA 4QWEA 5F8LA 3B6BA 4LF8F 2BW2A 4RNNA 4DV5F 1RADB 1ZS6A 4FPRA 5A6PA 4CZCA 1K9MT 4Y0FA 1QE1B 1KOHA 2ZH1A 1J27A 1PKUA 1TMMA 1WI8A 3N6MA 2C3UA 2MKSA 2XZWA 3PYEA 2DT9A 1U6ZA 1ZPVA 3VAJA 1S9EB 1KC8T 2OAUA 1HQUB 2PIIA 1NHKL 3IO1A 3T1HF 4KYZA 2FIUA 3DGPB 4PUOB 1S6PA 2CYYA 2QMUB 3IRWP 4U96A 3VAKA 2IRXA 2V63A 4H4OA 2DGTA 2B9EA 4W98A 4J9LA 4FS1A 2ZC3A 5T41A 2YQ1A 3D0HE 5IWAJ 2A6OA 4X2BA 3DOLA 3A3OB 2CWKA 1HQUA 4J9UE 2FDNA 4AL7A 1V3RA 1W7WA 2GGPA 2IM3A 3W60A 4PUOA 4MIWA 2MKKA 3MFHA 1SL1A 4JI3J 3CDWA 4FPIA 3BYPA 3FQKA 2RAQA 4USKA 2UUCF 1AUSL 2P9EA 4FNHA 4U7UK 3SIPB 3BSNA 2AIRB 3CVKA 3C46A 3BH7B 2D7SA 1VQ4S 1FEEA 3JTNA 4MK7A 4A8SA 3NG8A 3BH6B 2G2ZA 2WZ1A 3VQTA 4DUZF 3NXZA 1TUWA 1BE4A 4ZP7A 4CO4A 4I0WA 3KK1A 3PY8A 2FJWA 2BJ1A 3T9NA 3KOAA 1IKYB 2NS1B 5DLGA 1AFIA 3AB4B 5D0RA 1RT5B 3GJSB 1NDLA 3MZIA 2YKNB 1U47A 3H2UB 3QAUA 1WHVA 2R7TA 4JI8F 3ZXWA 4ECXA 3AT1B 3PFEA 2AF6A 2BW7A 2M4MA 2XSFA 4IOBA 4O3NA 2CFXA 3DM2B 2W2QP 4DV0J 1F5BA 4LFAF 1NZAA 4ECZA 1X9WA 1TK8A 3MMJA 2BV3A 1NAQA 1RA7A 1RACB 1Y11A 1KLMB 3N9UC 1RHKB
chains in the Genus database with same CATH topology
5KG7A 2GQCA 2FJVA 1HW8A 2O5DA 2D3OR 4IOCQ 2QV6A 4Y65A 3QIPA 1U1PA 4YB1P 4P2SA 1H7WA 4Q8FA 2RJZA 1U1NA 1RT5A 2YTCA 3M2UB 1M0SA 4Q2MA 3MOZA 1IQTA 3IC1A 1LWCA 3MR6A 2ZH3A 5KFKA 1U2FA 2HQIA 3LP1A 1UFLA 3DRPA 5EDWA 3VALA 2FVSA 5D4PA 3U1LA 4BDPA 1CVJA 2B4OA 1YRXA 4X84A 2MPUA 3POTB 3B4MA 5E3CA 4QYZJ 2EWHA 3ONQA 1JJ4A 4XAKA 2W9CB 4J37A 3L95X 5K8OA 4DFJA 4E98A 2UUAF 2M0GB 1T02A 4QR2A 5B0BA 4XPEA 1BY9A 4ATNA 2MGZA 4CIOA 3H4DA 1FXLA 1VS3A 4YHHF 4U7CA 4NLVA 4OZLA 2JVRA 2YVSA 4WU2A 4C0HA 2F40A 2JJ4D 1VQOS 2ZHBA 4ZPDA 5GAGI 4Q7AA 4KO0A 1KQKA 3KNGA 5SZTA 1UJ5A 4X4PA 4DBQA 3UR3C 2DGOA 4IG3A 1HNZF 5I3UB 5KG3A 1QM9A 4R25A 2V4QA 1S0MA 4YB6A 2ZOGA 1N33F 4ZPCA 4A4JA 1YRTA 1IUJA 5IWAF 2B0GA 3NCRA 4F8RA 2NLWA 1SQEA 3KJVB 3S6EA 5KFYA 2J7WA 4OV1A 1CG2A 4EZ6A 4NA2A 4USJC 1ZH5A 1TKXB 4RLEA 1P9QC 1SJ1A 1C0UB 4NLRA 4N41A 2IMOA 2JEJA 3PKYA 4C3LA 3DC2A 2GC8A 3KLIB 3DDKA 4FNIA 1LXNA 2EFQA 2KVIA 1FF2A 2W9CA 1IJEB 2N4CA 2Q3PA 1E6VA 3EUNA 2F8EX 3MM6A 1YG0A 4RBVA 1TV6A 1GT8A 2LQBA 1O51A 2RB7A 2ZFHA 2FJAB 3CJ3A 3GG1A 3I87A 4P7TA 1DARA 2EPIA 1S0NA 4KPYA 2DR8A 4KRWA 3R1HA 2VFVA 3V2UC 3MHYA 3VTIA 1NK7A 4LF7F 2E44A 2NR0A 1RK8A 4PWDA 1HNVB 4QIGA 4CO3A 5F8NA 4YR3A 3IGNA 4NCGA 4OZNA 1C4AA 1UVNA 3SQGB 3K5PA 1FD2A 2W4CA 2A18A 4JV5F 4Q43A 4R8UB 3TNVA 4RW6A 4B3TF 4ZHRA 1HNVA 2ZJQQ 4RW9B 3R5CA 2RQ4A 4JUZA 4CO0A 1X4CA 3I4PA 2L41A 1LFPA 2D3UA 1UVIA 1NJZA 1S1TB 3HZEA 1X4HA 4O4GA 2V2KA 3IRXA 3MEEB 4ZP8A 1NKBA 3WC2A 1G2EA 3TYTA 2VBXA 1CEZA 4WJBA 2A2CA 2Y1JA 3QJLA 3H2VE 2GV1A 1RTHA 3VAIA 4TY9A 3MM5B 4F2SA 4LIWA 2I9SA 3MTJA 3HVRA 3PXGa 2KN4A 3MM9A 1U1OA 2NREA 2JOQA 5FDLA 2F9DA 2UXDF 1TL5A 4URGA 1HMVA 1N48A 2HNYB 3J80Y 2PN6A 3VAHA 1KFSA 4C8OA 2SXLA 3THPA 3HDSA 1BQNB 1AXQA 2HLTA 4F4ZA 1U49A 2KRBA 4I69A 3DRRA 2HW3A 2G4BA 4NA1A 5IT9Y 3FSIA 4LF4F 3CJ4A 3TI0A 1ZBTA 1MU2A 1R0AB 1N52B 3I0SB 5I3UA 1T95A 4DF8A