2XM3A

Deinococcus radiodurans isdra2 transposase left end dna complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
126
structure length
126
Chain Sequence
EMKKGRGYVYQLEYHLIWCVKYRHQVLVGEVADGLKDILRDIAAQNGLEVITMEVMPDHVHLLLSATPQQAIPDFVKALKGASARRMFVAYPQLKEKLWGGNLWNPSYCILTVSENTRAQIQKYIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords TRANSPOSASE
publication title DNA Recognition and the Precleavage State During Single-Stranded DNA Transposition in D. Radiodurans.
pubmed doi rcsb
source organism Deinococcus radiodurans
total genus 29
structure length 126
sequence length 126
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01797 Y1_Tnp Transposase IS200 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1290 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Transposase IS200-like 2xm3A00
2A6MA 2XQCA 2FYXA 2XM3A 2A6OA 2EC2A 2XMAA 2VJVA 2VICA 2VJUA 4ER8A 2XO6A 2VIHA 2F5GA 2VHGA 2F4FA
chains in the Genus database with same CATH superfamily
3QT8A 5F8NA 1UAWA 4C0BA 2XMAA 1OQ6A 2VG5A 4OYIA 2Z2MA 3DNCA 3R5JB 3CCLS 4R8UA 4UQTA 1TKXB 4I64A 5KAKA 2HHWA 2C2OB 2HSEB 1DARA 2IPOB 5FDLA 3CMES 2BEFA 3FFIB 4L75A 5D4LA 4DQQA 1U0HB 2KB2A 2ZHAA 4JI3F 2J9DA 2U1AA 1MSWD 4CTAB 2OPQB 4F4AA 5C5JA 4OJ1A 2C3YA 2O1PA 2HQCA 1PC5A 4LBIA 3M2RA 3H25A 1SJFA 3UR3C 3DU5A 1N8RT 1ACMB 4HHUA 4X66F 1S59A 1GMWD 3H5YA 4WJBA 2W2NP 1N54B 1TKTB 1MU2A 5CQGA 3HHKA 4LIWA 1CG2A 1REGX 3NS7B 2HMIB 5CA5A 3CJ3A 2CFXA 5F0UA 4DEZA 2VDIA 3Q83A 4DBQA 2H1YA 2VPXB 4I2PA 3DOMA 3OR2A 4OYWA 5A8RB 4EZ6A 1SKSA 4USKA 1FNOA 1T3OA 4JOUA 3MPDA 4UUWA 2R8IA 4KH0B 3MM5B 5I3PA 5KFTA 2XHCA 2VG6B 3R1LA 2FJEB 4YY3F 1FVSA 1YQHA 1GTHA 1UVKA 1C4CA 3POTA 4HTJA 3HVWA 1NHVA 1WNEA 1XN9A 4DV5F 3VAMA 1NPRA 1BWVA 4DS5A 1OYDA 1GXLA 5LOQA 3L7OA 1F3FA 3CC2S 2BJ3A 3TUJC 2A18A 4LF1A 3K58A 4ATNA 5IV4A 2J0XA 3CSKA 1CJUB 1B7FA 1F2GA 5GAGU 2QA4G 5EWFA 4DUYF 3W9JA 1FXDA 2JEIA 4PEOA 2Z2YB 3AD9C 5LSOA 1HPZA 2ZVIA 1CEZA 1AB8A 4PAAA 1Y11A 5L1IA 2ZFHA 3MCMA 1FDDA 3CUNA 3W61A 1RABB 1VBZA 1UW9A 3MTJA 3Q23A 1DLOA 4ZVPB 3G96A 4DLGA 2YKOA 2IAJB 2MZTA 3EX7B 4BLGA 1Q8KA 1RZMA 4JBCA 1WC6A 4P6QA 1OPIA 3FJ2A 1M5OC 1HWLA 2A6MA 3D6HB 1TKDA 3LWLA 2V63A 4LQ9A 3MWBA 4Y65A 4KE5A 1BXNA 1Q5YA 2HIYA 3EVWA 3BO3A 1NJIT 2YVSA 5CZVA 4RL1A 1WSRA 3R1HA 3L7UA 4JI1F 1SL1A 2PE8A 2IYGA 2CQBA 3OV7A 3J80U 2BANA 4NYZA 3RRHA 3PRBA 5J2PA 1NK7A 5L1JA 4I6YA 3KKFA 1YJ7A 4RWXA 4IG0B 3I0RB 4KYZA 1CPZA 1PAUB 2K3IA 1C0UB 4EBCA 4BC9A 4FF4A 1NB2A 4NRTA 3OL6A 5L9NA 1RAOA 2WVCA 1NO8A 1RHUB 2DISA 3P4UB 4FXDA 1B4SA 1QDUB 5CYMB 4OYZA 4ETXA 1H2TZ 2AJ2A 2HQGA 3GJTB 2IBKA 1R0AA 1NK4A 2B4OA 4WE1A 1FJGJ 2Y0BB 3A12A 1FWPA 1X4DA 2EK1A 1YJ9S 4OHWA 4A8WA 2VASA 2AHOB 4Y2MA 2IA6A 2ASDA 5BJRA 3OVBA 2V4JB 1HI8A 3O1LA 4IRDA 3Q2TC 4GO5X 2GIQA 1VJQA 1QM9A 1JLQA 5IC6B 3M32B 1UP1A 2HWHA 2ZEJA 3RBZA 5DQGA 2APOA 3K57A 1M1KT 4LFCF 1X0FA 4DS4A 3V6KA 3FDSA 2MEWA 2JX2A 1QUVA 3G2XA 2MQNA 3C15A 3CMAS 4IFVB 1S0MA 3THVA 2GJIA 1YJUA 3DRRA 6FDRA 3G8TA 3MPYA 3R7SB 2YNHA 3H2LA 2VA2A 2VICA 3PG9A 3DXSX 2RIJA 4Y28C 1IVZA 3L09A 3MEEA 4NXNJ 1PC4A 3CJ2A 3EGZA 1CJTA 4C8YA 5HVGA 1Y5LB 2MMYA 1NK8A 3FQLA 2HLTA 2OPPB 4NZ7A 3H59A 2XGQA 1V5VA 1AZSB 1N52B 4BWMA 9RUBA 2V8GA 4IH7A 3IG1A 2Y0SD 3FVYA 2IFXA 4Y2CA 2GW8A 3M9NB 5HQLA 1SV5A 2DB1A 1IR2A 4LRFA 2KT3A 3C6UB 5E5NA 5HP1A 3NAHA 5IOLA 1KLMA 4ZVSB 3IBCB 1WKKA 4K7QA 1Q79A 1VJWA 1D3WA 4OMFG 3A4TA 4YOEA 2DNNA 4ZPCA 1G1XA 1GNKA 4P2FA 4I1TA 1KHWA 2KJWA 4HTIA 1H72C 1UTAA 1S48A 1XMQJ 3C3LA 2XS7A 3ONQA 3QATA 4G3IA 1UETA 1I94F 1N0UA 4KAIA 2GMLA 3GWCA 2JZ5A 4IQMA 4IUFA 5J2MA 1FRXA 4CNYA 2LA6A 2BM0A 3OTOF 1VYAA 1DFDA 1SH0A 4LF4F 5JXSA 3DLEB 3TOQA 3K59A 1U1QA 2YNGA 1D8ZA 2B0GA 5A6WA 3QSIA 4F4KA 2W01A 4Y2IA 1U1MA 3VWSA 1N32F 4ER8A 4RNFA 5BYQA 4LF5F 3A3OB 1IBLF 2H4WB 2HHSA 3IMQJ 3HHLA 3GZ7A 3GONA 4QWDA 4KR0B 2J6TA 4XDDA 1U1OA 1U48A 5IWAF 1Q8LA 4MMOA 1RT5B 2XMMA 2K06A 4ZVOB 4UQGA 5ETVA 2CQ3A 1UL3A 1S12A 3T5KA 1B64A 2EBEA 3K5NA 2BV3A 4OYBA 3G87A 4M8LA 1T03A 4DV3F 3HMJG 4QIFA 2H9ZA 3U7JA 3VVUA 2ILYA 2HEKA 2W4CA 4UZBA 1SC6A 3DLGA 3HSDA 4DV7F 2CKWA 3AOCA 1R6YA 5KFSA 3IWLA 2YNIB 3MUMP 5HVFA 4IR1A 1T8EA 1S72S 3M1VA 2IIHA 4X62J 1H38A 1LFPA 2YKNB 2ERRA 2R8KA 1J5OA 3SQGB 3CD5A 4N7TA 1RHMB 1YWXA 4N5SA 2KYZA 3RBXA 1H3DA 3AD7C 1WC5A 2LFVA 4F0KA 2EC2A 1HNXJ 2BE9B 5A8WA 1AFIA 3ILLA 1H7WA 3H7HB 5KT4A 3VQTA 4YDXA 3U02A 4G1QA 2ZITA 5HN0A 2JVOA 2HAIA 4F26A 4F67A 5GADU 3RG6A 5T41A 4J9NA 3TEHB 1F9EB 2B4PA 1KQKA 2VG7B 3PX0A 1F9HA 4J9RA 1JLAA 3BQ0A 4NX9A 4OI0A 3M9OB 4MK8A 3AJDA 1PJ7A 4OJ3A 5L1KA 1R31A 3DLKA 4CZCA 4Q2MA 5J1EA 4F0MA 4UOCA 3GG1A 3FZ2A 1UKUA 3DGPB 1XMOF 1JNZB 1HBUA 1RK8A 4DR1J 2W9BA 4ZK7M 3O2IA 1G3OA 3FBCA 2NYHA 2V4RA 4LF6F 3QJPA 1X5OA 1SPBP 3N0VA 2CADA 3BN7A 2JOQA 5IFMA 2EI5A 2HHHJ 3IR6B 4ZP6A 4Q0BB 1LXJA 4I0WA 4LUBA 2UUWA 3S6EA 4ECUA 4OZNA 3CDWA 5BR8J 2M0GB 4IKAA 4DUYJ 1RBLA 2LDYA 4J9OA 3TJ8A 2V8PA 2V9KA 2ZBIA 1ZAWA 3CTRA 2UXCJ 4RBTA 2LXUA 3BPDA 2QIFA 2DXEA 3MFIA 2DGUA 2KKHA 2BACA 2HRTA 3PRDA 2XY7A 2DITA 2QG9B 4PUOA 3ZZPA 3MPWA 1HW8A 1NSKL 1F3VA 4ZS6A 1NKCA 2LXFA 3R2CJ 2XMTA 3JSMA 3ZTQA 4Q8FA 1X4CA 2MQOA 2ZZTA 3KYLA 1SUQA 3BKUA 3R7BB 1M1HA 1BC6A 4M5KA 4FYXB 4DPYA 4FF3A 4MK7A 4HACA 4HT5A 2P6TA 2R8GA 3MCSA 3VGUA 2EKYA 1WI8A 3R2DJ 1FRJA 3KMQA 3EPIA 4ECYA 1T9VA 2BQUA 4L74A 1R6VA 5KFCA 1Q86T 1XNRF 3LAMA 2QTWA 4DQSA 1VRTA 4ECRA 3NLCA 4ECXA 3MFHA 4CNZA 2ZBPA 4O23A 1VQMS 4PG7A 4C8LA 3H2UB 3MM6B 2CQ2A 2AMCB 2QMXA 2FJVA 4ZVHA 1D0EA 2UXDF 4LSNB 4NLTA 2GAGC 2MZQA 2RVJA 3C16B 3KUEA 2C2MB 4J5OA 1E6YA 3KK2B 2DNYA 2AW0A 4DL7A 1VQNS 4KSEB 4DG1A 2RNEA 3D3CJ 5F8MA 3J7YI 1XR6A 2VDHA 5H9EK 5B0EA 2A1BA 1JLFB 2XS5A 3I56S 2WVDA 4FPRA 1EP4A 3MM9A 2V2QA 1SB6A 4WPAA 3EUNA 4OX6A 2E1PA 3NCRA 5HMXA 4TXSA 4KT0C 4U67Q 2HHUA 3GFXA 4QWEA 4OHXA 1TFWA 4CH0S 2HNDB 2IVYA 2ZKTA 3QIPA 5D0EA 4IH6A 2BKPA 1EETB 2DGOA 2MQLA 1E6VB 3H8YA 4RW4A 4DR5F 3M6UA 3AY0A 2UUCJ 1NSPA 4WFBQ 4DUZF 1EX8A 3FK4A 1S6UA 5KFZA 1EIYB 1MMLA 2FTRA 1XJWB 1DQ8A 4NE9C 4WKRA 4DV6F 2FD2A 1NKEA 3BGRB 4LSZB 3GFHA 4EUVA 1N5YB 5C25A 4YR2A 2G9OA 2VKZG 3CCUS 1U09A 4K4WA 3OSPA 2XCAA 2LDIA 1SCJB 1IBKF 4FBUA 4WFYA 1ZM9A 2IYIA 3CEDA 5B0DA 2OEJA 6AT1B 5DDPC 4ZIVA 2UUAF 1TL7A 4H4OB 3DRSB 1RTJA 3LP0A 1RISA 2XI2A 3MAHA 3TZXA 1OIAA 2E29A 3IAS9 2MKKA 2R2TA 3QAUA 4DMZA 4OLPA 1EQMA 3PACA 1C1CA 2RT3A 3M4XA 4NEYA 3RAXA 3TQ1A 5IT4A 1VRQC 3UVJB 2HFNA 4ANCA 2KL8A 1EARA 1FCAA 5SZTA 4X4NA 3MM7A 5D4NA 2MZ1A 1N33F 4EFAC 3ZZOA 4JYAJ 4WIQA 2XYHB 5A0YA 2MHEA 2A2CA 4B3MF 2LEPA 3T3FA 3DI6A 5KTQA 1O51A 4ED7A 5E41A 1QUPA 4B9TA 1FXLA 5U47A 3HHDA 1U8SA 3M8ZA 4GVBB 3W5ZA 2LMIA 2BJ7A 2VJUA 3D5MA 3V4IA 5B09A 1WUUA 5E3RA 2PEHA 5ITHA 3JYTA 3DLLQ 4DFJA 4DV3J 4Q44A 2NXCA 1S6QA 1D9AA 2V2KA 5CYJA 2RU9A 1TL1B 3TUZC 1AUDA 3DLBA 3QGGA 1RT7A 2JRSA 2CQHA 1Q4RA 5LMNJ 1RTHA 4CO4A 3KLFB 2LLZA 1IKVB 1T02A 5LT5A 4MFBA 4X4SA 5CYQB 1R0BG 4LFBF 2BW7A 2HBYB 3F56A 3I9V9 3MPVA 2HNZA 4ZDNA 4RNOA 2BM1A 1NDPA 1RT3B 4DSIA 1WC1A 1WHYA 2HZAA 3UW1A 2B8PA 3T1YJ 4Z7CA 4ED8A 4CLWA 2FC9A 3KMSA 2VJVA 4YHHF 3KLIB 1NK5A 4LQ3A 5HMYA 2FHMA 5FJ4A 4K50A 4LFAF 1KD1T 4NZ6A 2WK4A 2QLWA 3D1QA 3MPUB 2W7PA 1TK5A 1UA1A 4QIVA 3GB0A 2QA2A 3J81Y 5GMKa 1Q53A 5K14B 4C0HA 5LMUJ 4IO1A 1GX6A 2RB7A 2DHAA 3C6TA 1FO1A 1SJ4P 4G6VB 3SSRA 1UPPA 2AQ4A 2QYCA 4PWDA 5L8RC 3UO0A 3TAMB 2NZCA 2VH7A 1U49A 5JUMA 2D3OR 1FT8A 2D7SA 2LQ5A 1KR4A 2AWZA 1X4GA 3IRWP 4ITSA 3NL0A 1M5HA 3MM8B 5F9LA 2DPJA 4CQ1A 3VAJA 5CH7B 2F9DA 4ECVA 2M2BA 3NGKA 4LF6J 4KGXB 4RW8A 3GIKA 4NXMF 2MZRA 2OMLA 1T9TA 4HYKA 2DTJA 3KG0A 2ATCB 4URQU 3ISNC 2DRDA 2BA9A 3I87A 3IXQA 5DO2A 2W7OA 3MGJA 1I51B 1KFDA 1VQLS 3IR5B 1RHKB 3CJSA 4TYAA 1FFSB 4K5RA 2RILA 3CCSS 2K7KA 3PW5A 4L72B 2IMOA 1DRZA 5KG3A 4LF8J 4Y2KA 2NXJA 2OPRA 2CWXA 2RAQA 1W2BR 1S7HA 4I56A 4A46A 1OS5A 2ZH1A 3TZYA 1A7GE 1FK9A 4OX7A 3RR7A 3NY0A 4K0KJ 2A3JA 3N28A 1SL2A 1FKOB 1GX5A 1TK8A 3GJQB 2JC0A 2AGQA 1LWXA 3CD0A 4ELUA 5RUBA 4KHMA 3G8SA 4DX6A 1ELOA 3J81U 5BXIA 3C2PA 4I68A 1KEKA 3W5YA 3W62A 1QAJA 2CPZA 2YX7A 3CJ0A 4MJKA 4DX5A 3P8BB 2DNMA 5F9NA 4LF7J 1YRXA 3V81B 2VQFJ 3MEGA 3OR1A 3FGVA 4TQRA 3RTVA 2NREA 3JSRA 3W2WA 1BQMA 1LV5A 4ILMA 2Q6CA 3EICA 3U1MA 1UCNA 4ID8A 3TAQA 3KLHB 4BWJA 5I4MA 4ECWA 3G6ES 2XMUA 2W25A 1WELA 5KG6A 2ZHOA 3DYAB 5LM7E 4WTYA 5IM0A 2UXDJ 4GMKA 4FF2A 1LQ9A 1GXUA 3CXCR 2Z58B 4WK3A 4ECQA 2MLXA 4ENOA 1NSAA 2GQCA 4TQSA 2CPIA 2YWWA 4GVLA 3N6NA 3FC9A 3BQ1A 3BF4A 2H3EB 1K0TA 4AQYF 5L46A 1KP6A 1RT4A 1FTCA 1U47A 4OIXA 4O3OA 2QEXS 5C42A 2FY8A 1S0VA 2JLGA 1JJ4A 4WIIA 1CULB 2B51A 1CS4B 1EHWA 1FWLA 5GADI 2BE2B 1FF2A 2E5IA 3G6VA 4CO0A 1CJKA 4ZHRA 4J9QA 2HHTA 4J9PA 2DNGA 1BE4A 5KFIA 2GV1A 2N4DA 1PJ5A 3V4MA 4DR5J 3ISZA 2D9PA 3FMBA 5KFKA 1GEHA 4DI6A 1SC3B 4MIAA 1D8YA 4RBUA 1DY3A 1NPKA 1GMVA 1JLBB 1YX2A 1F0XA 1IKXA 1AROP 2ZH2A 4BCAA 4RZRA 5ETQA 2V69A 1PBUA 4X4RA 5B08A 2LP4A 4DOZA 1JKHA 1RP5A 4JI0J 1XEZA 4OI1A 3WC0A 2CJXB 5B0BA 2XZWA 1HR0F 3TUPA 2VG5B 4I6WA 1S6PA 3GV8B 5AJ3F 3OTEA 4R8UB 3LO3A 1IBKJ 4RUCA 1SQFA 3THTA 2UUBJ 3I9ZA 3D9BA 4MK9A 2AYGA 4DN0A 4Y0FA 5HBMA 5FDLB 2W2MP 4LRDA 3DKDA 3AQOA 2H5IB 1Y9OA 1TUVA 4OV6A 3D7SB 2N7YA 5D77A 4NLPA 1CC7A 2XM3A 5IT9U 3M2RB 3DDKA 2B7BB 2YTCA 3PYGA 4CI0B 2NYIA 3SDEA 3B6BA 2E7XA 2W9AA 1MU2B 1GT8A 5DM7Q 4B3RJ 2EC0A 1XNQJ 1VLOA 2BW2A 3DFEA 3DOMB 3GLJA 4I2PB 3NGRA 3EWGA 3PW2A 3OR2B 4DV2J 3UCUP 1GH8A 1VQKS 1CLFA 4JI6F 2M3DA 4OZ3A 3OL8A 4QR2A 3AA9A 2U2FA 5GAHI 2V6AA 1RWNB 4LMZA 1Y0HA 4A8XA 4GRSA 2G0JA 1EKRA 2J5AA 1LOUA 3JTNA 4JI4J 2UXBF 4FDFA 2ZH8A 1FE4A 1NJXA 1WC4A 1X9SA 3POTB 1WACA 2N7CA 3V5RA 1U2CA 3EPGA 4AT1B 1PILA 1RAFB 3RW6A 2ZH3A 1FRKA 3IO1A 1TTHB 3WX8A 1JJCB 3UD5A 4PABA 1O5JA 3JTOA 3ZO7A 5E3AA 1RQ0A 2XHWA 3DRPA 5I42A 1IR0A 1WF0A 4OI3A 2I5JA 2ZUGA 2X1GA 2NUHA 2AJ4A 1HPZB 3ZNUA 4B3SF 2ZVSA 3GV5B 4E8UA 3N5FA 1RKIA 2C3UA 5DQIA 3PHTA 3T1HF 3FRYA 3VAKA 4NLVA 3ENQA 3T5LA 4FZVA 3SV3A 1DLOB 1ZTTA 5KFHA 3RBDA 3JAMY 1NLKL 1Y4ZB 2PMHA 3O44A 1SH3A 1JXVA 5GAEI 1OO0B 4IRKA 4F4XA 3GYNA 1IR1A 4YHHJ 3SBMA 1C0TA 2CQIA 2DIUA 2LKZA 1Q16B 4LFAJ 3BPSP 4J90A 2DIVA 3PM9A 2ZC3A 1NCLA 2N82B 2DH9A 1GK8A 2EKNA 3LGNA 1Q1KA 2BANB 2HZCA 4DZ6A 1PBAA 2PMZD 5J2PB 2VV5A 2HHPA 4F50A 4Y00A 1NMEB 2ZH6A 4O0IA 3FSIA 1KTVA 2COLA 2DVIA 3CCZA 4LJMA 5KFJA 3HD1A 5ETMA 1ICEB 3MAAA 3W2VA 1M5SA 3NCPA 3L7PA 3O5TB 3UPFA 3P45B 2N4CA 3QT6A 3BR8A 1VRUA 1R0AB 4AXJA 4WE1B 1SC4B 1D09B 3T6BA 2KXHA 4J91A 1N5SA 5IV3A 1FJCA 3W9IA 3NOGA 4PPDA 4O3PA 4NMXA 5AXNA 3ELHA 5KG1A 5F8GA 2RDJA 4NMLA 1JLQB 2CA9A 4ZJLA 4NXMJ 3QT7A 1JMTA 4X84A 5A2QY 2XYPB 3JS9A 2GVDA 2LVWA 2AU0A 1S9EA 3EVMA 3GJSB 3IGVA 1UJ4A 2BUNA 3C15B 4CT8A 2LECA 2VB6A 1MWZA 2EFQA 1XK8A 3DRRB 1S76D 2YNHB 2QLJB 3FBBA 1RBAA 4UOGA 1EJ7L 1CJTB 1YDLA 1U2FA 2JVRA 5K8NA 4E0DA 2D41A 3HLUA 2Y1LB 4GKKF 3N01A 4Y34A 2PEBA 3IG1B 1FNMA 1PKUA 3HULA 2DBBA 4W90B 1APSA 4DQIA 2AZ3A 2XNRA 1SV5B 4P7VA 2MKYA 4RNHA 2DEIA 1VC6A 2OPSA 4DR2F 4F02A 5HP1B 1NHKL 3SCJE 1KLMB 3FEYB 2OP5A 3MCNA 1HWIA 4DV4J 1M5PC 3VAHA 1TAQA 4DSFA 4DQRA 2HYIB 2IRUA 4ZLPA 1X7VA 2D74B 3PY8A 4V19J 2L3MA 3JSBA 1BY9A 5GMEA 4JP8A 1WWHA 4I6AA 2D3UA 3M30A 1TMMA 5DGAA 5J2QA 4WF9Q 5J2MB 2CIMA 3IFEA 4P2SA 3Q24A 4JV5F 4UT4A 4CLLA 3R5CA 5J1PA 1HHQA 3ZZZA 1MWYA 4ZJQA 3CO9A 3QGHA 5A2QU 2F9JA 2WBMA 2ACYA 4OZ5A 2P8IA 3H2VE 1IM6A 2DR8A 2LQBA 2YNGB 1KVKA 3RBEA 4CLSA 3I32A 3EXYA 4TYBA 2P9CA 3UFCX 2MKIA 2YKQA 2NXEA 1RGVA 2XZDB 3CCVS 1KSPA 3F41A 4MAKA 4ZPAA 2BMBA 3HHLB 1RWMB 4IR9A 2QFIA 5GVQA 3KNGA 2NUUG 2FB0A 4KPYA 1IXKA 1RTIA 4GKJJ 2BJEA 5HSPA 4U7UD 4MKYA 1T03B 3FBEA 1WTFA 1W7WA 1WEYA 4Q5VA 2EVZA 3TANA 4ANDA 1WTBA 1KOOA 4C7QA 2OSQA 4CLZA 1B99A 4H4MA 3GYXB 1VI7A 3TR5A 1REVA 3DLGB 1I6JA 1RTDA 4DCJB 1U45A 3FEXB 2V4QA 5HAOA 1S49A 1QAXA 3TVZA 2G2ZA 4WKYA 3M2UA 2PIIA 3M1VB 5CCLA 5HROA 3KHLA 5F3TA 1J5OB 4E98A 2LA4A 1X31C 4RUHA 4DR7F 1TZ0A 1RWWB 4UOFA 1RU2A 1PYTA 2HKEA 1H73A 1Y3JA 2F1FA 3V6DA 4ED1A 5KFVA 2Q6BA 2J8AA 5A8WB 3HHEA 3UDVA 4B3TF 4JI8J 3CC4S 2WTFA 4BS2A 1YK9A 4G1QB 1WF1A 2HHQA 3UNYA 3AXKA 3BYRA 4L76A 2AJ0A 1SJ1A 1FDAA 1KONA 2IM3A 3TYTA 1F60B 4RO0A 3H20A 4HT7A 1RADB 2L48A 1NZ8A 3RB4A 1CVJA 2XLKA 3R3TA 1JLAB 4JV1A 2JSXA 3CCQS 3R9LA 3HP6A 1UJ6A 2KG0A 1FRHA 1B70B 1NJWA 1IJFB 4CH7A 4DL2A 3ET6A 3HT0A 1GMUA 3K7RA 1KFSA 2B9XA 1HNWJ 1IUJA 2NSCA 3PHEA 5J1EB 4MTPA 3US5A 2EG1A 4O3RA 5T14A 3EM1A 2WAQD 1HBUB 4C8ZA 2W9BB 3R5BA 1XWLA 4JI7F 2C3MA 4WBFA 2FJXA 4NLOA 3DMJA 5ETOA 3NGTA 2AF6A 1XC9A 3KK3A 2Y1IA 4NRUA 2J9CA 1KVIA 1S1XA 4A48A 4PZVA 1N6QA 1HHSA 5C24A 3KG4A 1C0UA 5EWGA 2XMKA 4UY8T 4OX9F 2R9LA 4C6AA 1CJVB 2KI2A 3T1AA 2E1RA 4B3SJ 3ZTOA 3M6VA 4WYLA 5KFEA 3GE9A 1U24A 3CWJA 1RWKB 1TFYA 1N88A 3MEDA 1RWOB 4PUOB 3OUYA 3T1HJ 3D1HA 1OWXA 2C1EB 1Q82T 2DGSA 1RBOB 4P10A 1S1VA 2B9YA 2YPZA 3MDFA 3JSMB 4M5HA 3HSZA 4KHRA 4AFFA 1FRIA 4YUDA 2OKQA 1RA6A 2G13A 2MSSA 5E3QA 1SUQB 2ZH7A 2JH3A 1S10A 1FXRA 2VPYB 4HACB 2LEBA 2KM8C 2C2KB 2M9KA 2IRYA 1SXLA 4QBUA 3PYDA 4EBDA 3HO1A 3QGIA 1Y5IB 4I4BA 2I9SA 4USJC 2E1AA 3A13A 3HKWA 4KQZA 3DHWC 1KLNA 4IFVA 2D3ZA 3T41A 4ID5A 1ROFA 2FVQA 1VRTB 4CO5A 5EDWA 1M90T 1LKZA 1KQSR 1RHJB 2V68A 3P5BP 2OLWA 4ELVA 3DU6A 3OLAA 2CZ4A 4Q2LA 2CRLA 4NA3A 3G6XA 4QJVA 3C66A 1UVMA 2ZM6F 1SC1B 3FSYA 2JFKA 2KXFA 3GR1A 3SSSA 1E6YB 2IM2A 3TP2A 1RA7A 2ALYB 5AXLA 1NSQA 4M94A 1LW0A 4DG1B 2BQ3A 1G6BA 3TX0A 2HVIA 3AJ1A 5L1LA 2XQCA 4CO1A 1BQNA 4ZPTR 4I2QA 1UZHA 1AT1B 3H4BA 1EP4B 3MM9B 3E3XA 5F8IA 3GYGA 1A6LA 4IFYA 4IDKA 3NNCA 1VISA 3H5UA 2RMLA 3DLJA 5HQ8A 3HKZD 2ZOMA 4M5NA 1OYEA 3HF5A 3QIPB 2V0NA 1RAEB 1X5SA 2K7JA 2MDAA 3BZQA 2OI2A 5F8JA 4RW4B 3IS9A 3PFOA 4DL0C 3CT9A 1NAQA 4FXVA 4HKQA 4M5JA 4C8OA 1F5AA 4DL3A 4KFBA 1JB0C 1YVFA 5D8HB 2LCWA 2B6AA 3VAGA 3CPWR 1O0PA 5A8KA 3QRQA 3KXDA 1Q8BA 3ENWA 2DR7A 1RTZA 4PXEA 1T7PA 2ACMA 3DHXA 5C25B 1NK0A 1RXOB 2R2SA 2YWEA 1ZYQA 2WZ1A 3A3PB 1U7LA 2HBRB 4CLTA 4Y2AA 2PT0A 2HURA 3RUBL 3EGWB 4IQXA 2Z4PA 1YG0A 2HNYA 4DR2J 1VQOS 3LWMA 3DDIA 4FKXA 2P2CB 3ZZTA 2X1BA 3HVRA 5T7LA 1HFEL 3E8OA 1N0VC 2VODA 4L73A 4NCGA 4KJIA 3AA8A 4DN9A 4CO3A 1TL7B 4DV1F 2QC3A 5J1NA 2KO1A 1N36F 1OY8A 5IS2A 2RF2A 1RTJB 2AEFA 4AL7A 3LP0B 2O67A 3CJQA 3RGIA 2HFVA 3IA0A 1FRLA 2IY5B 5EWEA 1MN9A 4WFZA 5KFRA 3C8YA 1MWQA 4KGVB 1L3VA 1BD6A 3PJ9A 2CG4A 3H5XA 4OZ2A 1C1CB 5HL7Q 3TNVA 2AV5A 4EYHB 3J7YU 5IT0A 3C14A 2JNJA 2FC8A 3NWGA 2FHKA 5IC4B 3EDRB 1JQGA 2BJ9A 3U1LA 3MM7B 5K8PA 1DZ5A 3MMCA 5A0YB 1ZBTA 4RW7A 3NRBA 4DLEA 3DI6B 4EYIB 4USTA 4ICLA 8RUCA 3KJNB 5E3CA 3LGMA 2PD1A 1N48A 4F04B 7FD1A 2GO8A 1HNZJ 5JMNA 3BKTA 4TVAB 4C48A 3BS9A 2ZBCA 4I67A 3V4IB 3OTBA 3EDQB 1SBRA 1H0HB 1JK9B 3ZC4A 2XSFA 1FEHA 2KVQE 3MMBA 3JYTB 1S99A 1WOOA 2VOPA 1P6TA 4TY8A 1HWUA 1S6QB 1TVRA 2VQEF 4WU3A 2XSJA 2HS0A 4ETZA 2R2RA 5ADZA 4XDCA 3LA0A 4DR3F 3BJYA 1CQNA 1RT7B 2O01C 4WCEQ 4USIA 1RTHB 2GNKA 2AJFE 3ZTSA 1YJVA 2KRRA 4PWUA 1AA1B 1FX2A 5AE3A 4MFBB 4X64F 5DG8A 1U6ZA 2ZDOA 4IG3A 5KFDA 4ES3A 3LPYA 3KTQA 2AYMA 2A2DA 2HNZB 2OFGX 3TVYA 5E7OB 4DCOB 4NLWA 3PYFA 2R7OA 4DSEA 5KG0A 2VHGA 5KFFA 3CJTA 2XLIA 2DGWA 1HBMA 5FLXY 3D0IE 3VGSA 4DL6A 3TAPA 5F8HA 1C2PA 1JLCA 2J9EA 2WONA 2JC1A 4CIOA 1RWXB 2B5JA 2R7XA 5CD4A 2C22A 4LR8A 2F7VA 5CABA 2KH9A 4RU9A 1ZZFA 1SI9A 2FZGB 5F8LA 2XC9A 1UVJA 1PCAA 3MR5A 3C6TB 1KC8T 4FYVB 4F4YA 4YEAA 2E9TA 1BUXA 3QBCA 4YP3A 4CO2A 4PWDB 2GA7A 2AP6A 4MKAA 1P9QC 3NWRA 3I55S 2I6WA 3Q0AA 2K3KA 3G86A 2G2OA 4A8QA 2W9CA 1HI0P 2OD6A 5ETNA 5KFBA 4JI5F 3RRKA 5DQHA 3ZXWA 1VC5A 2ZZNA 4QWBA 4ZPBA 1Q95G 3KHHA 4JI7J 2V50A 3FCVA 1OJ4A 1FVQA 1VQ9S 5AE1A 4RW8B 3VZIA 2Z0GA 2UU9J 1UVNA 3JQKA 2V8DA 2J7WA 3D67A 3OJUA 3EVOA 5KT2A 2VA3A 2CG8A 2YKPA 4PG8A 1X0PA 1M1GA 2E9RX 3TA0A 2FGOA 4NI2A 3TQEA 2J7KA 1Y10A 4YMEA 2ZE2A 4LR7A 1VLYA 4OI6A 2R7UA 3NBPA 1ZTWA 2HFUA 1WOSA 2OPRB 3C16A 2A6OA 5K20B 4N77A 3ITHA 1IBMJ 4U8VA 5EHHA 5FLXU 4QW9A 1FK9B 2EBGA 2RRAA 5D0HA 3HHNB 4OYMA 5HANA 4C98A 1EKSA 2J0QD 2R4FA 2YXLA 4LRCA 2GAHC 4LBHA 1ITPA 3I31A 2FUG9 3IN5A 1U1RA 2E66A 2RKIA 4ZCIA 3QMQA 3NXZA 3DGVA 4Y3CA 1RT6A 1RWPB 1ZETA 1J27A 2D1CA 3ZTRA 2X7IA 3ENVA 1TAUA 2QA1A 2E5HA 4ELTA 4A8KA 3U27A 1FD2A 1VK8A 7FDRA 4USVA 2UVRA 1RB0A 3MEGB 3OR1B 3AB4B 3NKYA 5KG4A 2YY3A 3W2WB 2V94A 3RU0A 1BQMB 3KHGA 1BLUA 2CDRB 4FYWB 4ZVGA 5G0RA 1E6VA 3M8RA 1W2IA 2J0WA 1X4HA 3SCIE 3Q8UA 1C1BB 2KDOA 1U6BA 3IM9A 1RAIB 3A8JA 2GS8A 2DCLA 3C46A 5IM0B 5SUHA 2ZM6J 2UZAA 3J7ZT 2E44A 1QVGR 4C97A 1LWFA 2WW8A 4OI2A 2R7WA 2R3VA 3PZPA 3G82A 3V2UC 3JQMA 2HVDA 1R43A 4XAKA 4WU2A 1G7CB 3HVAA 2XYGB 3MR6A 3MZIA 1DTTB 3SZ2A 1RT4B 2DNLA 1P1LA 3PFEA 3W8GA 1UZDA 5C42B 4RW6A 2Z30B 2ABYA 2ZHBA 4KC5A 3BBFA 2RU3A 5HMWA 3QFWA 2YNFA 3OXFA 2E7WA 1QSYA 1RHRB 2Q79A 4EGLA 4J37A 2K1RA 4FNIA 2C28A 2CPHA 1CJKB 1FNXH 4ZHRB 3Q8VA 3RAMA 3AAWB 2QT7A 2CNNB 3OL9A 2E5LJ 5I3QA 1HYSA 4UZCA 2OO4A 3W64A 2C3OA 4RW9A 1B0TA 2DHGA 4DSJA 1X4AA 4USUA 1RT1B 3R8YA 4DV0J 3GV7B 1IKXB 3LP2A 2XS2A 2F4VJ 4QCLA 1YZ7A 3L4BC 1FKAF 3HCXA 3VZHA 2M52A 2G1HA 1GAOA 1MMNA 4L6V3 1JKHB 3HM9A 2YQ0A 3W65A 3M2VA 1ZH5A 4TKTA 4EMDA 1URRA 3KLEA 2EG2A 4M63A 2QN6B 4C8KA 2F63A 5KFXA 2MKHA 1S6PB 3E2EA 4K4SA 1B0VA 4B9UA 1XMBA 3N4WA 4UW2A 1ZPVA 5EN1A 2HG4A 4BDPA 1DQ9A 4OZJA 2AGPA 2J6UA 4C2MA 4X65F 5HBMB 1N36J 3LP1A 3CDBA 3OHBA 1NK9A 3W8PA 4KO0A 1GXTA 1KKHA 5DLGA 4PXDA 5KOWA 4RU2A 1D9FA 3IM8A 1RT2A 2X3GA 2IJNA 4C3KA 2E7VA 1Q7YT 3D0GE 2X3DA 2QL5B 3IC1A 4DHVA 2OAUA 5DJBA 3ILOA 4KH1B 2HFSA 4KKOA 2CQ0A 4R5PA 1O8BA 2CJBA 3TA1A 2VC1A 4JI3J 4EO6A 4F2SA 1RSCA 5MLCV 5D3GA 1HNVA 3NEKA 3EJMA 1QSSA 1FA0A 2FIUA 4X66J 4OZLA 4QWCA 2E5JA 3PDNA 4WK1A 2ZOFA 1NZAA 1BMQB 3LPEA 2H5EA 3BYPA 4QU6A 2G2YA 4M5IA 1NNDA 2FHJD 1NH7A 1VIOA 3MAQA 1OSCA 1HIYA 2YKMA 3LAKA 1KQGB 4FS2A 2RJZA 1KS2A 3L95X 4X4UA 3TJ9A 5LL6d 2FVPA 2D9OA 2VQEJ 3CGIA 4DF4A 1IKWA 1EAYC 3DRPB 3LQVA 2HGMA 3DM2A 2I5JB 4DR3J 4YY3J 1T05A 4DWIA 1FFWB 2DHXA 2J8SA 4H4KC 2BJ8A 5DZ6A 2BBEA 4LBPA 4DV5J 4K4ZA 5HI7A 1FJGF 3D6TB 2DY1A 4D3GA 1MLAA 2JHEA 2DGTA 3EZ5A 3QFHA 3BB5A 4B3OA 2JFDA 1ULRA 3M8WA 2CXEA 4ZKAA 1S4FA 4A8SA 3OT9A 4QR0A 1NDLA 3OJSA 5BYSA 3KUGA 3SFGA 3CIZA 2PN6A 3EMTA 2QMWA 2XY6A 2BE7D 3M8PA 2RQCA 2QLFB 1HQUA 3QGPA 3DN9A 3M8QA 2O5DA 1C0TB 2HHXA 3G71S 1S5ZA 2YWFA 4KGMA 2IMWP 1XIQA 5DLFA 1VGYA 3NGUA 4PYDA 3QIDA 1EB0A 4FPIA 3AXMA 1QD1A 4M95A 3CF5Q 2CVEA 4MYUA 4MT1A 1SKRA 1ZOTA 4KV8A 2V2ZA 3QPIA 4NXNF 4F4ZA 4LVOP 1WEXA 3MAAB 3W2VB 2C2ZB 1S79A 4P2MA 4P75A 2YWGA 3MR7A 4JI1J 1VRUB 3WBZA 3KDOA 2PFFB 1WHVA 5CHCB 1SH2A 1HD1A 2RS2A 3M05A 4NCBA 5KFNA 1RLCL 5GAHU 2CNLB 1HNIA 3EYZA 1NRKA 2HLUA 3TW0A 3MMAA 3LOUA 1HBOA 1QAYA 1O6XA 4B02A 2XB2D 5B0FA 3BN4A 5HJXA 1VC0A 4I69A 3BDEA 4RWWA 2R42A 1QSLA 1YSJA 1IKYA 5D6GA 1S9EB 3DOLA 2OIHA 4ED5A 3FCWA 4J9LA 3GQCA 1HHTP 1H98A 5KFYA 2OTJS 3CB4A 3GSIA 4KHPF 2MQQA 5CD4H 3D1OA 2FJWA 1G4CA 1V3RA 2HQ3A 1KN6A 1FKPA 4BBYA 3FKBA 2B9WA 2F5GA 1WSVA 4USMA 4YS2A 1UW4A 3I82A 5LSLA 1JLEA 5B0GA 4RPFA 4U7CA 4LFCJ 3TUIC 1LK7A 3PTWA 2F65A 5KFUA 5GAEU 1K1SA 1T11A 3ICLA 2HK3A 2NLWA 1H7XA 3N5BA 1YGYA 3QWUA 2XGPA 2IA0A 5KT7A 3OD2A 4NZ0A 3AFGA 1SKUB 1S57A 2C3PA 2QZ8A 4DXLA 5FIIA 2OPSB 5MAOA 3HFVA 3VV2B 4C9DA 3WDOA 3GP9A 1BWEA 2WVEA 3K5PA 2LQ9A 2CJKA 3AHPA 1S7IA 4NASA 1ZPWX 1PO6A 1OPZA 5E0OA 2KM8B 1YJTA 3BV8A 3Q8YA 1L3KA 3C19A 1X4FA 5F41A 2MLYA 1N5QA 2W8LA 2BZ2A 3CJ8A 1S1UB 5H9FJ 3GR0A 1IQZA 2AEMA 2SXLA 5J2QB 2DXFA 2CQPA 4AD6A 2A10A 3VF0B 3NAIA 4B17A 3TVKA 3PCOB 1K8AT 3TWZA 4U8YA 1U6FA 3UE2A 1LFWA 3R27A 3LF0A 2Y9HA 4X62F 1TV6A 1QTMA 2ZNZA 2EEYA 2VL1A 1I94J 4N47A 2DR6A 3WIVA 2OFHX 4FVMA 3S7RA 1WC3A 4QQBA 1R8AA 3B54A 2M88A 2ZH4A 5EX0A 5JVHQ 1T94A 3OTOJ 1U25A 1HNXF 1WD6A 3Q8SB 2EK6A 2AEJA 4LF4J 2NCKL 3QZ8A 2XNQA 4M5GA 2HGLA 4LSLA 4YQWA 1RTIB 3MD1A 3VALA 1N32J 2ZWOA 3EGNA 5K5MA 2POKA 2Z8QA 4LF5J 1LW2A 1IBLJ 3KNAA 5DDRC 1MROA 2BYCA 1YBTA 3KK1A 4J9KA 2V8VA 2X1FA 2CZVC 3J80Y 4H4MB 5IWAJ 4J7CA 1REVB 1RTDB 2VZ9A 4ZVRB 1T9WA 2XMWA 2EFGA 3M2UB 1H6KX 5HROB 2WVFA 3W3SA 5IQ6A 1NUEA 3EZOA 4OX8A 1S9GA 4DR1F 4CLPA 1VDHA 1QLNA 4CM2A 4F0HA 2HRYA 2HW3A 2CJQA 4X65J 2VFTA 3V6DB 1S0OA 1YTYA 3AJ2A 4DV7J 5EX3A 3OHAA 2HHHF 3W7BA 3HXMA 3UCGA 1WHWA 1JLGA 3TEGA 2YPYA 3IWNC 2UUTA 1R27B 2FVSA 4I7FA 3VTIA 4A47A 3E51A 2RQKA 5BR8F 1TL5A 1FERA 3NMAA 2NSBA 4ZLJA 3IBFB 2UXCF 1PAEX 2PFDA 3I5AA 4HDHA 4P9SA 4ZVFA 2Z56B 1HMVA 1Y5NB 1UWBA 1WG5A 5M2PA 2MJUA 2LU1A 1U2RA 3I4HX 1FESA 3IRXA 2B4VA 2XI3A 4C8NA 1VK3A 1FI4A 1FX4A 3ET6B 1X9WA 1TMJA 2QYGA 4FS1A 4O0NA 1LK5A 1R8PA 1KQFB 4ZVTB 2OD4A 1YRUA 4NYOA 4C8MA 1WHXA 3K8WA 2ATLA 1P9YA 3BSOA 3F73A 2YWKA 3A1YG 3BH7B 1HQEA 3PRVA 2XTJP 3DMJB 1NJZA 4R25A 2J76E 2QV6A 3KK3B 1S1XB 2B56A 1N6QB 2QLBB 1HLWA 2OHDA 5C24B 2ROEA 4XTTA 1N5VA 1V3ZA 3DRYA 4QU7A 4PG5A 4YFUA 1XMOJ 1UEVA 4L3NA 2IJRA 1YHQS 3LH2S 3MEDB 2NQPA 2WCXA 3OUYB 2QE5A 4DUTA 3PW4A 4NLGA 2OEMA 4ZOSA 2RHSB 1RKJA 1S1VB 2V5HG 1S1WA 2RD5C 2WB1D 3AOAA 1X4BA 2MQ8A 1AW0A 3PJWA 2ILZA 4ZP9A 3O8WA 4ES2A 2GCFA 1W26A 2F8MA 3UD3P 3H90A 3KJVA 1K9MT 3RB0A 1LWEA 3M6WA 2E1MC 2LXIA 3O3LA 4X2BA 3T9ZA 2I2YA 2KZZA 2UVWA 2UVUA 3VAIA 2L08A 4B9SA 2WSCC 3D54A 4UOHA 2WOMA 4ID5B 1BGXT 4J9MA 3OFFA 1MMDA 4NLYA 4QPTA 3GIMA 2UUCF 2AX0A 4IOAQ 2PO4A 4KGZB 2IBOA 4OFZA 4C0OC 4OZ1A 4NA1A 4XIUA 4L3KA 3HJFA 2HS3A 2RRNA 1XNRJ 3H0PA 3UN5A 1LW0B 7AT1B 4KBIA 5CCMA 3BGFA 1RUSA 3NGDA 3GU0A 5A6PA 4O4GA 1BQNB 2MHNA 1RAAB 2GJ2A 1UA0A 4I2QB 1PJ6A 3WQPA 4OZ0A 3QLHA 1JJHA 2KYXA 3N79A 3I5CA 4IFYB 4IDKB 5JVGQ 2BRLA 4NL5A 3AT1B 4PKDB 3R5GA 4EK2A 2IDEA 3SSQA 3QRPA 2KTQA 2C2DA 1GQEA 3OQ2A 4ZVUB 3K5LA 4KHPJ 3IS9B 1NU4A 5C2CA 4TNOA 2ZBRA 1FEEA 4ZLLA 3CVKA 3S01A 2Y1JA 4PPZA 4X4QA 4KFBB 1I1GA 2LQ8A 3PW0A 1UPMB 1UVIA 5LJ3Y 2B6AB 3CCMS 2O66A 5L38A 3SV4A 2EPIA 5A8KB 1SQGA 2GQQA 1TP7A 3QJLA 3KDNA 3CCRS 1S77D 2DNZA 4JYAF 2JEFA 4U6PA 2ZDPA 2G1DA 1RE1B 2VONA 3KLGA 4EI2A 4DUZJ 2HNYB 4MH8A 4R0JA 2BR0A 2M5YA 4P74A 1F6TA 4UF4A 5T7LB 3MHYA 4K4UA 3AD8C 4N56A 4NCGB 1LWCA 2YX1A 4DV6J 1Q78A 4M5LA 4F3MA 3NS5A 1ZAXA 2RF2B 4B08A 4CLFA 1T9YA 2CWKA 1VMBA 2Q1LA 1GMWA 4ZN1A 4LF2A 1L5UA 3JQJA 3SQOP 4DX7A 2BOAA 1Q81T 1TUGB 4K2JA 1AUSL 4A4JA 5LMNF 4WP8A 5KFGA 4CYUA 2UUAJ 4DJBA 2OTLS 2B7CB 3MMJA 2W1BA 3C14B 1NPPA 1KDNA 4NLDA 4FYDA 2HIQA 2AIRB 4ECZA 1VHFA 3FZBA 3MMCB 4NEZA 2HFOA 3UN2A 2VFSA 4RW7B 4YR3A 2YKAA 3T1YF 3I4PA 1VQ5S 3UCZP 2FGCA 4N76A 2FLLA 4ICLB 4N8OA 4DFMA 2DGQA 3SIPB 3TO8A 2IC3A 3BEGB 3ENAA 4OHVA 2ZD1A 4C11A 2A0FB 4X4VA 1SJ3P 2CPEA 1SKWA 3MI7X 2Q43A 1N33J 3V6JA 2W4DA 3QO9A 4ZVQB 3DOKA 3BREA 4U95A 5A76A 4B3MJ 4DPUA 2I38A 5ETPA 1FD8A 2VBXA 3MMBB 4Q7AA 4AXIA 1YJNS 4OV1A 4DR4F 5LMUF 4TY8B 1TVRB 4PR6A 4ZCMA 2BABA 3BO4A 2XSJB 3B4DA 1T0TV 4IOCQ 4OHZA 2G0IA 2ZZMA 1CQMA 2WHOA 2OH2A 5EGYA 1VS3A 2H54B 3PEJA 1U8WA 1QE1A 2ZUAA 3NMRA 1JXLA 4PG4A 2CJ9A 4HHJA 1OY6A 4IG3B 3OVSA 2ZJPQ 1WG1A 2M4MA 1P1TA 3PXGa 5J2NA 2KU7A 4EO8A 1TKZA 1KVJA 3QT5A 4IH5A 1HBMB 1QAIA 1TL3A 4O3QA 2J7UA 2BRKA 1XERA 3W63A 4RX6A 4IRCA 3W66A 4USWA 3VCDA 1UFKA 4NLXA 1JLCB 1HKAA 2L9DA 3PIOQ 2WONB 4DSLA 2IVMA 3M7VA 4LFBJ 2AD9A 2B5JB 1WF2A 3BSCA 4DFPA 1VIXA 1VBXA 3NNAA 4ZCLA 2IDLA 1RI7A 4KRWA 2DO0A 3P5TL 1CJVA 4PYAA 4LF8F 1YRTA 3VAFA 4USHA 3MXHP 4CH1A 4QZVB 2X51A 2VUGA 5K9FA 2UVVA 2L9WA 2R8HA 1TK0A 4ZPDA 1S1TA 1MG7A 4MIWA 4K0KF 3W60A 3R6GB 3CJKA 2JJ4D 2AJQA 3S8SA 2LYVA 4FBTA 1KOHA 3OXLA 2W2OP 5HLFA 1AYEA 3HI9A 2I0XA 4RKUC 3MD3A 2RQ4A 3JXOA 1N5TA 4A8MP 1IM4A 2W9CB 2LEAA 4RUAA 1BQXA 4OJGA 4XO0A 3GMGA 1UJ5A 4LF7F 3TI0A 1FHTA 2RDIA 5DG9A 4DPXA 2VQFF 2M8HA 2GVZA 1JWWA 2BKNA 4G1IA 2HRUA 3OTCA 2ZWPA 1U1LA 2FVCA 4QW8A 4M5MA 1RJJA 3K8VA 4D3HA 4NI2B 4YN3B 5D78A 5B7WA 3G6YA 2ZE2B 5DS7A 5KOXA 3VR1A 2MGZA 3CCTA 2DHSA 3NBPB 2K2PA 3DXBA 3HFZB 4WYWA 2NXUA 3ITHB 4YB1P 3OXGA 1RCOB 3GJRB 1U1KA 3BSAA 4ED4A 1IJEB 4U7UK 2GGPA 1T95A 1Z4UA 3P3DA 3CDEA 3HVTA 4NYPA 2JDJA 2QSWA 3D2WA 1UFWA 3HHLC 2NPFA 2RUGA 1B7YB 2AZ1A 3H40A 2L41A 2RKIB 2G4BA 1H2VZ 1M5KC 3JAMU 3BGOP 3I0SA 1NBEB 1RT6B 1PG5B 3IGNA 4KB7A 5E2QA 2GFFA 3MECA 2KVIA 1HBNA 3Q86A 3VGVA 3T19A 4XPCA 3SXLA 3MEEB 1SVDA 4WXOA 3Q8QB 2HZVA 5HVHA 4IOBA 4CP5A 3IAM9 4M5DA 4UUXA 3B82A 1FJEB 2C2NA 3KJFB 5KT3A 4DDFA 2ASYA 2DKOB 4QIEA 1WJ9A 3HJVA 5G0RB 3DLHA 2D3O1 1YKWA 3GCWP 2FZKB 5I3UA 3CDAA 4MKBA 2HGNA 3PNIA 3PX6A 4CDIA 1LWFB 2QX0A 3G82B 1Y3KA 5D4PA 1TUWA 2HAFA 5LSRA 4DL5A 2CZ9A 3OSNA 3SI8A 4PQUA 1Y00A 4JI0F 2CQCA 1M5VC 2GC8A 2GHVC 1HWJA 4HH0A 4ECTA 4O44A 5D0RA 3HK2A 3BDPA 4RW6B 2XBPA 1DTQA 4DPTA 4RBVA 3MUTP 3RB6A 4ED0A 2UUBF 2RRBA 5GAGI 2YNFB 2BDPA 3FSXA 4KPCA 3J7A1 2XMVA 4DX8H 4RNMA 4WP9A 2K1RB 2YQ1A 4B9VA 4ZCKA 3HZEA 4QPXA 2DNQA 2DK2A 5ETRA 5DDQC 4AQYJ 2R7VA 5AT1B 2NS1B 3E01A 1L3UA 2OELA 1FTRA 5THWA 3GCXP 1CBKA 2DJWA 1HYSB 1BHNA 2PI4A 2QLXA 1G2EA 3GFZA 1TKXA 4RW9B 4LVNP 2XZTB 5HK4A 3RZAA 2M8DB 1NDCA 3TZWA 1K1QA 2HVEA 2VPZB 4K4XA 4JB8B 4OYOA 4YB5A 3LP2B 4Z2XA 1I3OB 3FFIA 3NOCA 1U0HA 1QJHA 1P8GA 2KFYA 3HDSA 4CTAA 4B3RF 2OPQA 2FHOB 1XNQF 1WOPA 2Y3YA 4QIWD 9ATCB 3CMQA 1KRPA 1V6HA 4OI4A 2W2QP 2W4PA 4HR2A 1R8BA 4G1PA 2MXYA 5C2GA 1SQEA 4DV2F 2E5GA 3M2VB 1X5TA 1YIJS 2VFUA 3CE8A 2HWIA 3KLEB 3OBIA 2IJFA 1S9FA 4A8FA 1TKTA 2CJYB 2DNKA 2H48B 3GFYA 2PC6A 4JI4F 5DRKA 2HMIA 2B4UA 1T3NA 4FVCA 2P9GA 1JXEA 2KXNB 5IZHA 1VQ4S 2M7SA 4P73A 3ZZRA 3LP1B 5A8RA 1DAXA 1UVLA 1D9DA 3UDLA 1XR5A 2CPJA 2RUSA 4KO0B 2MPUA 4ERDA 4KGKA 5HQMA 1HR0J 3NG8A 3MM5A 4P52A 1F9FA 1RT2B 3U1NA 2EFVA 4ECSA 3T9NA 5AJ3J 2VG6A 3BM7A 5KG2A 2EFPA 2ROPA 2PGCA 2R7RA 2FHJA 4IYQA 4CRJA 1AXQA 4LT6A 3SCKE 2J0SD 4KKOB 4S0MA 4KY3A 1KWMA 4R5PB 3PYEA 1Y7PA 3O6QA 2W8KA 3CC7S 1CJUA 1UMJA 2YH0A 4AL6A 3GSDA 5D3GB 1HNVB 3MF5A 3UWTA 4K4YA 4TU8A 1YJWS 4OYAA 4CT9A 1XQIA 2DPIA 2MY7A 4PXCA 2DYAA 1VBYA 1RWUA 3ETOA 2DNHA 3D66A 2DGVA 5LXYA 1EZZB 3MEKA 3FNNA 1Z2LA 3Q22A 2DO4A 3BGLA 2CAJA 2GQ2A 3MURP 4NCAA 2KN4A 4F25A 3D0HE 2IAJA 3A3NB 2YKMB 3SCLE 4E2FB 2FZCB 5KFWA 3L3CA 4HI2A 5AXMA 4JI6J 3DLKB 1DBDA 4O3SA 3M8SA 2C2RA 5KFLA 4DR4J 5B0AA 4HH1A 3J7AN 4K8RA 1IKWB 2F3JA 1DHMA 3KLVA 4A8OA 3DM2B 2UV8A 1T05B 1RYRA 1FDNA 2UXBJ 4GO7X 4K59A 2MZJA 1U26A 1WKJA 3PJXA 3ILJA 5K8OA 5KFPA 1Q0NA 3WZ0A 3BGUA 4P7TA 3QSYB 4QYZK 4IG0A 3FQKA 3I0RA 3HPOA 3OFGA 2V9WA 2XY5A 4B3OB 1RAGB 2IRXA 2VIHA 3PV8A 1W25A 2ADCA 3ILIA 4AL5A 4PQAA 5CYMA 3M9MB 2VOOA 1NJYA 2R7SA 1D1UA 3KG1A 3M8PB 1PYSB 1HQUB 3KUHA 3M8QB 2MQMA 4ZVEA 2XEXA 2DXDA 1I5OB 4NLUA 3WHIA 2VD3A 2ZH9A 3DCAA 2KRBA 4LR9A 1R8HA 3CJ5A 2VFVA 2V4JA 2CUYA 3TARA 3EZUA 1M0SA 3M32A 2DH8A 3CNQP 1V5IB 5AE2A 4JV2A 3G9CA 4KV8B 4RUBA 2FJBB 4FN5A 2CQ4A 1PYOB 4W98A 4ZA1A 5HATA 2NR0A 2PI5A 1J5EF 2AJ1A 2MKJA 2ZC4A 2QJ3A 5ETSA 1F2HA 1AFJA 4OYXA 1YBAA 2XMJA 3QJJA 3OPKA 3Q89A 4ZN3A 2BVZA 3PR5B 4WFAQ 1HNIB 1NB7A 3MOJB 5GMDA 3MMAB 2XWXA 1K47A 2CNKB 4HHHA 1FFGB 2J6SA 1HBOB 3K5OA 4GC6A 3SEOA 5ETLA 3PKMA 4URGA 2RDDA 2KHCA 3UQSA 2W7AA 5G4DA 2OPPA 1SIZA 3GTYX 4DV4F 5DZ7A 4UY85 2JL9A 1AZSA 4W4MA 1OQ3A 2HQIA 1S0NA 2GIRA 3FBFA 4ZIWA 4C4WA 1TELA 4K4TA 3UI3A 1X5PA 1WDDA 1IKYB 2DRAA 4J9UE 3GILA 4MYTA 1C1BA 2NZ4A 3DOLB 3BH6B 2JWNA 2DH7A 2MSTA 3F44A 3C6UA 4O4RA 1TU0B 3ETMA 3QRRA 2KJVA 4FYYB 3MR2A 2DT9A 1FKPB 1FRMA 3ZZ0A 2Z2ZA 1RCXB 1NK6A 3G8QA 1WORA 1ZAVA 3LW5C 2GIFA 1DTTA 1JLEB 2HK2A 2XLJA 2RQMA 3PX4A 1DJ0A 3CO0P 1OSDA 5IT9Y 3M8YA 3KJQB 4W92B 2HVZA 2L9NA 3VVTA 1T9UA 3CCWA 3T5HA 1NKBA 3NP5A 2XCPA 1QY7A 4MKVA 3DC2A 1NEEA 2P5VA 4ZP8A 2CPDA 3CDUA 1SJRA 1WDTA 5M2RA 1KNZA 1H74A 3DLEA 4GKKJ 4ED2A 2HHVA 1ZA2B 3CCJS 1VQPS 3CCES 4GKJF 5F0WA 1ZS6A 1YITS 1VQSA 3UDCA 1WI6A 2FVRA 3HFKA 3Q8RB 4HDGA 4WZMA 1RT1A 3D6FB 2DR9A 1HI1A 3VGTA 4XPEA 2JEGA 4BHQA 5HO4A 2KT2A 5HMZA 2BQRA 1GFWB 1X9MA 4HEA9 1K44A 2BX6A 4DSKA 1RT5A 5EUHA 4LREA 4OJHA 4CLUA 2OGUA 3ADAC 1TV6B 3K17A 4EZ9A 2ROGA 3ZFVA 2M70A 5LXRA 4ZPVR 4HL9A 2MKSA 1YLXA 2ZJQQ 3CD7A 1UEUA 1B0PA 1RYSA 3FCHA 1LEOA 4JV5J 2QSFA 2MQPA 1HD0A 4DPWA 4A8YA 4ANEA 4OYPA 5KFAA 4TY9A 3K5MA 3R7NB 2OMOA 3HHLD 1S6OA 3P6YC 3B4MA 2YNIA 1FE0A 4JI8F 4RR5A 2RHQB 2YKNA 1RWVB 2J9DE 1RHQB 4LSLB 3SQGA 5H9EJ 3HX9A 1WKLA 2PA8D 4ILLA 1FJ7A 5L9XA 3RRGA 4ILRA 1XBWA 5AXKA 2QMUB 1OY9A 1LW2B 3GIJA 4H54A 3HT3A 4PCQA 2CPFA 4DPOA 1MROB 2YBVA 3KK1B 1DURA 4RNNA 1S4EA 8AT1B 1RU1A 2FLPA 3NCQA 3FUYA 2EWHA 4F2RA 1JX4A 1HNWF 4WWSA 3NNHA 3GPAA 3LGHA 3Q8PB 4KTQA 1RLDA 3VHQA 2CNOB 2XG8A 2VG7A 1Q5VA 2Q3PA 2UP1A 2OSRA 4Q45A 2BKOA 1DQAA 1S9GB 2GX8A 3ZNJ1 1Q7LB 2JLFA 1LNQA 1VQ7S 2AYBA 4Z37A 1UEKA 2DGXA 1N34F 2HBQB 1MNEA 4EBEA 4K5SA 2QL9B 2GZOA 4ED3A 5HJYA 1SIWB 3J81j 2ASLA 1JLGB 2EXUA 3FMWA 3KWMA 4WFXA 3QZ7A 2FQQB 4I7FB 2P6SA 5D0GA 2FPHX 3DGPA 2R8JA 4ES1A 1R7IA 4PXBA 1IBCB 2IM1A 4DR7J 1KTQA 3TJAA 3BBBA 4P2XA 3EE3A 1HMVB 1UWBB 4K4VA 4Y6IA 2CQ1A 3BR9A 3RYLA 2QFJA 2WW4A 4R0EA 3RB3A 2YWHA 4ZPWR 4B3TJ 1NXIA 2F8HA 4OL8A 1HA1A 4Q0BA 3IRXB 3TA2A 5D15A 1V9OA 4FP9A 2OUGA 4G65A 3AODA 3KHRA 4F4WA 4DFKA 4FF1A 5KT6A 4P71A 4C3LA 3THPA 2CPXA 2OEKA 1HW9A 3CJ4A 2KFNA 4NLQA 3H4DA 3A8IA 4LF9F 4TN2A 4DF8A 2V67A 4DQPA 1HQEB 4Q43A 1QTNB 2IHR1 2V2VA 2GHPA 3PKYA 3OLBA 4QIGA 2IVFB 4JI2F 4WP3A 1A0OB 3K0JA 8ATCB 5KG7A 5H9FK 4NOHA 1F1BB 2QGFB 3I5BA 1U02A 2KT5A 2DNRA 4WTOB 1EQ0A 5KFOA 3B8HA 1U0SA 1XR7A 4ZITA 3LALA 3PO5A 1U1NA 4B9MA 5DGBA 5KT5A 4O3NA 1ZA1B 3QAEA 1X8DA 2VPWB 2H51B 3P96A 3ULHA 3WIUA 1TQLA 1J2VA 1PIEA 3K89A 2H5JB 3S1TA 3MCOA 4N8NA 2VKRA 1S1WB 1YJRA 2FJDB 3P49B 4OX9J 3MM6A 4QR1A 3QWPA 4EWTA 1VHIA 3SYZA 4U9RA 2DRBA 1NHUA 4YB7A 4LSNA 3IP0A 3PVXA 3KK2A 3KJVB 1UFLA 3UN3A 1LWEB 3FEZA 4ALZA 2GMHA 3T6JA 1C4AA 2N3LA 1PSDA 2DHHA 2WB4A 1IN0A 4DZDA 3IBWA 3BO2A 4U96A 3N9UC 2W24A 2MJNA 1R8CA 2FDNA 2WOMB 1JLFA 4H4KA 1N4LA 2C42A 1RACB 4V1Ak 2JEJA 2WRMA 3SMZA 2UV8G 3A8EA 3HZGA 4TLQA 2CQDA 1R89A 5DETA 1OMSA 1ZM2A 1J5EJ 1ZM3A 3W1YC 2HNDA 1SJQA 1UWAA 4F36A 1EETA 3I6PA 4PWWA 6FD1A 2VBYA 1P27B 1WG4A 5FD1A 2ASJA 4O4GB 2RH3A 4HLBA 3CIMA 3CJRA 2HS4A 5E33A 3UR0A 1L3TA 2MY8A 4QOTA 3QLHB 4J9VA 2VBZA 4CWBA 3I96A 3RAQA 2AT1B 3L9ZA 2BOPA 2EW9A 1F5CA 2CPYA 1IQTA 3LANA 4RLEA 5CZXA 3BGRA 3G4SS 1N5YA 1CC8A 3ZZUA 2PA3A 1YI2S 1WEZA 4Z7YA 2VF3A 1KHVA 4TU9A 4DR6F 1S1UA 2WVBA 3BSNA 3PW7A 3AH6A 4QYZJ 5BYRA 4DCPB 4EU0A 2ZOGA 2HFZA 2XULA 2GJFA 2QO3A 2YQ3A 3BQ2A 3HSJA 2AYEA 3ISND 3RW7A 1TL4A 3MTKA 2WSEC 5KG5A 2BJ1A 2ALZA 4H4OA 3QYYA 3EXCX 3DRSA 2P9EA 4N41A 4FNHA 2EFNA 2F40A 1VQYA 1K0VA 3EGVA 4ZMMA 4C3MA 4CLYA 2WSFC 2Z2LA 2YH1A 3KLGB 3D68A 4NLSA 1HNZF 4HVZA 3UVJA 1Z1ZA 4TU7A 4EEYA 2F8EX 1LWCB 3NS6A 4CM0A 3RJMB 2HPUA 3JTPA 4ZJOA 3QQCD 3HD2A 3MR3A 3J7Z5 3DDNA 3R5DA 5DM6Q 1IWGA 1YZ6A 1ZM4A 1N56A 2Q66A 3OTDA 1PGZA 5F3ZA 1SL0A 2Z57B 3R97A 4GVBA 2XWYA 3D6MB 4M1KA 5K8MA 2PSZA 3H98A 4OLOA 1X60A 4CYUB 4F7VA 1VQ6S 4DV1J 2LQJA 2NPIA 1FWKA 1X4EA 1ZZNA 3V6HA 4ZLNA 2B43A 2FLNA 4QYRA 3LUYA 1LXNA 2O3DA 2IM0A 1NM2A 3IWXA 1TL1A 2ZKUA 1VOMA 3LTOA 3BBCA 4F8RA 2FJAB 3R6LB 4NPOA 3SDEB 5ETTA 3KLFA 2IC3B 1B3TA 1IKVA 1RDRA 2CQGA 4B9LA 2DY9A 2ZD1B 2XO7A 4OHYA 3OL7A 5CYQA 4C11B 2R7TA 2CDQA 2V34A 3UD4P 3ZTPA 2MYFA 2WBRA 2R7QA 2H4YB 1RT3A 3M6XA 3QO9B 3DOKB 2F4FA 3T5JA 1JIHA 2W2PP 3QNWB 2AKWB 4ED6A 1GTEA 3CULA 2D69A 3KLIA 5C7PA 1Q8IA 1K73T 2CVIA 3PIPQ 1HL6A 1V3SA 5LJ5Y 2MTLA 1VR6A 1QE1B 5CXTA 3MUVP 4JV0A 3B78A 1YBUA 4NWBA 2QA4S 2X1AA 2HVHA 4V19X 2Y8YA 4P72A 3PO4A 1RAHB 3TZZA 4X4PA 4HI1A 3OFHA 2E1CA 4LIRA 5K14A 1MW7A 2DEJA 3CD6S 2FY1A 2PMWA 1U1PA 5J2NB 5I42B 2XO6A 2NXNA 1TKZB 2N3OA 3OVAA 1JNRB 2E9ZA 4IO9Q 1TL3B 1N34J 3IR7B 5IXUA 1F5BA 3OFEA 3TAMA 1URNA 2UU9F 2MZSA 2B3TB 5KFMA 5B0CA 3DRXA 4WXWA 3FRZA 4X64J 1NDKA 4QWAA 2QL7B 3W9HA 3MM8A 3X3UA 4X4OA 2VFRA 4KIAA 2C2EA 3BKFA 1TR0A 4YDDB 1HQ2A 4YB6A 3A8KA 2AX1A 4K2XA 4JUZA 2ZH5A 1IBMF 1A9NB 3X1LB 4MIBA 3H5SA 1S1TB 1VBKA 1R0CB 2MLZA 2PDAA 5M2UA 3CJKB 1JJ2R 2FLOA 5HLFB 2BXJA 2B8QA 1S97A 1IWAA 3D3BJ 1VCTA 4LF9J 2QRRA 1VFJA 2K8GA 4NLRA 4DU8A 4BC7A 1U4BA 2BJDA 1WC0A 3JSYA 2ZBQA 5L39A 4YR0A 2VU5A 3VQSA 1FKOA 2GVZB 3KFWX 3GIRA 2Y1RI 5D4OA 4JI2J 3AQPA 1QVFR 3ZZYA 4NA2A 4ZP7A 1T9XA 2VC0A 4JI5J 3WX4A 2DCUB 3W5XA 4RJVA 2MGZB 4CCHA 2HBZB 2HQFA 5CAAA 3F0NA 3V81A 4PRFA 5DG7A 2G0CA 3GG0A 1RAJA 2GO9A 1HARA 2HWTA 1VQ8S 2DD8S 2GGPB 3HVTB 2GVDB 5IQQA 2GMJA 2DR5A 3KLHA 3WC2A 1XMQF 2DNOA 4OQJA 1HWKA 3DYAA 2KG1A 2DNPA 4UTGA 2JLEA 3I0SB 2ZJRQ 3D4JA 2RE1A 3MECB 4X4TA 3AOBA 3HSGA 1HBNB 1MN7A 3JB9k 3N6MA 2I1RA 3UDEA 2OJ3A 4AYBD 4F3QA 2YX4A 2Y8WA 5ETKA 2CJAA 2B9EA 2H65B 4GC7A 1XTZA 4M5DB 3CW2C 4AE5A 3AB2B 2AGOA 1CSJA 1L3SA 2RS8A 5E3PA 2E5LF 2EFOA 4TLRA 2GHWA 3KOAA 3PR4A 3RR8A 4WFNQ 1CULA 5H1SV 2KZMA 1CS4A 3UNGC 3TRGA 5I3UB 1Z2ZA 5KFQA 1KBRA 2BE2A 4DV0F 4XK8C 2MB0B 2F4VF 4FKYA 2I8EA 1FDBA 4B9NA 3OW2R 4URSA 1R3NA 3MOZA 2RSQA 3SFUA 2MKCA 4LRBA 3Q2SC 2ZNYA 4PQUB 1NH8A 2LU2A 4WZQA 3NGSA 3K2YA 4O44B 3TX8A 2FYXA 1H2UX 1DTQB 1JLBA 2VBWA 4DL4A 2ADBA 4AUKA 3M30B 4FXWA 2CYYA 3N6LA 3R5AA 2KFZA 3H42A 2R2UA 4F3OA 4CLKA 4J9SA 4DU7A 3GIIA 5JJBA 5DDOC 2KHDA 2V8HA 2HQDA 4LRAA 4Q8EA 3D28A 3E01B 3PEHA 4PG6A 4DR6J
chains in the Genus database with same CATH topology
2A6MA 2XQCA 2FYXA 2XM3A 2A6OA 2EC2A 2XMAA 2VJVA 2VICA 2VJUA 4ER8A 2XO6A 2VIHA 2F5GA 2VHGA 2F4FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A6M A;  2XQC A;  2FYX A;  2XM3 A;  2A6O A;  2EC2 A;  2XMA A;  2VJV A;  2VIC A;  2VJU A;  4ER8 A;  2XO6 A;  2VIH A;  2F5G A;  2VHG A;  2F4F A; 
#chains in the Genus database with same CATH topology
 3QT8 A;  5F8N A;  1UAW A;  4C0B A;  2XMA A;  1OQ6 A;  2VG5 A;  4OYI A;  2Z2M A;  3DNC A;  3R5J B;  3CCL S;  4R8U A;  4UQT A;  1TKX B;  4I64 A;  5KAK A;  2HHW A;  2C2O B;  2HSE B;  1DAR A;  2IPO B;  5FDL A;  3CME S;  2BEF A;  3FFI B;  4L75 A;  5D4L A;  4DQQ A;  1U0H B;  2KB2 A;  2ZHA A;  4JI3 F;  2J9D A;  2U1A A;  1MSW D;  4CTA B;  2OPQ B;  4F4A A;  5C5J A;  4OJ1 A;  2C3Y A;  2O1P A;  2HQC A;  1PC5 A;  4LBI A;  3M2R A;  3H25 A;  1SJF A;  3UR3 C;  3DU5 A;  1N8R T;  1ACM B;  4HHU A;  4X66 F;  1S59 A;  1GMW D;  3H5Y A;  4WJB A;  2W2N P;  1N54 B;  1TKT B;  1MU2 A;  5CQG A;  3HHK A;  4LIW A;  1CG2 A;  1REG X;  3NS7 B;  2HMI B;  5CA5 A;  3CJ3 A;  2CFX A;  5F0U A;  4DEZ A;  2VDI A;  3Q83 A;  4DBQ A;  2H1Y A;  2VPX B;  4I2P A;  3DOM A;  3OR2 A;  4OYW A;  5A8R B;  4EZ6 A;  1SKS A;  4USK A;  1FNO A;  1T3O A;  4JOU A;  3MPD A;  4UUW A;  2R8I A;  4KH0 B;  3MM5 B;  5I3P A;  5KFT A;  2XHC A;  2VG6 B;  3R1L A;  2FJE B;  4YY3 F;  1FVS A;  1YQH A;  1GTH A;  1UVK A;  1C4C A;  3POT A;  4HTJ A;  3HVW A;  1NHV A;  1WNE A;  1XN9 A;  4DV5 F;  3VAM A;  1NPR A;  1BWV A;  4DS5 A;  1OYD A;  1GXL A;  5LOQ A;  3L7O A;  1F3F A;  3CC2 S;  2BJ3 A;  3TUJ C;  2A18 A;  4LF1 A;  3K58 A;  4ATN A;  5IV4 A;  2J0X A;  3CSK A;  1CJU B;  1B7F A;  1F2G A;  5GAG U;  2QA4 G;  5EWF A;  4DUY F;  3W9J A;  1FXD A;  2JEI A;  4PEO A;  2Z2Y B;  3AD9 C;  5LSO A;  1HPZ A;  2ZVI A;  1CEZ A;  1AB8 A;  4PAA A;  1Y11 A;  5L1I A;  2ZFH A;  3MCM A;  1FDD A;  3CUN A;  3W61 A;  1RAB B;  1VBZ A;  1UW9 A;  3MTJ A;  3Q23 A;  1DLO A;  4ZVP B;  3G96 A;  4DLG A;  2YKO A;  2IAJ B;  2MZT A;  3EX7 B;  4BLG A;  1Q8K A;  1RZM A;  4JBC A;  1WC6 A;  4P6Q A;  1OPI A;  3FJ2 A;  1M5O C;  1HWL A;  2A6M A;  3D6H B;  1TKD A;  3LWL A;  2V63 A;  4LQ9 A;  3MWB A;  4Y65 A;  4KE5 A;  1BXN A;  1Q5Y A;  2HIY A;  3EVW A;  3BO3 A;  1NJI T;  2YVS A;  5CZV A;  4RL1 A;  1WSR A;  3R1H A;  3L7U A;  4JI1 F;  1SL1 A;  2PE8 A;  2IYG A;  2CQB A;  3OV7 A;  3J80 U;  2BAN A;  4NYZ A;  3RRH A;  3PRB A;  5J2P A;  1NK7 A;  5L1J A;  4I6Y A;  3KKF A;  1YJ7 A;  4RWX A;  4IG0 B;  3I0R B;  4KYZ A;  1CPZ A;  1PAU B;  2K3I A;  1C0U B;  4EBC A;  4BC9 A;  4FF4 A;  1NB2 A;  4NRT A;  3OL6 A;  5L9N A;  1RAO A;  2WVC A;  1NO8 A;  1RHU B;  2DIS A;  3P4U B;  4FXD A;  1B4S A;  1QDU B;  5CYM B;  4OYZ A;  4ETX A;  1H2T Z;  2AJ2 A;  2HQG A;  3GJT B;  2IBK A;  1R0A A;  1NK4 A;  2B4O A;  4WE1 A;  1FJG J;  2Y0B B;  3A12 A;  1FWP A;  1X4D A;  2EK1 A;  1YJ9 S;  4OHW A;  4A8W A;  2VAS A;  2AHO B;  4Y2M A;  2IA6 A;  2ASD A;  5BJR A;  3OVB A;  2V4J B;  1HI8 A;  3O1L A;  4IRD A;  3Q2T C;  4GO5 X;  2GIQ A;  1VJQ A;  1QM9 A;  1JLQ A;  5IC6 B;  3M32 B;  1UP1 A;  2HWH A;  2ZEJ A;  3RBZ A;  5DQG A;  2APO A;  3K57 A;  1M1K T;  4LFC F;  1X0F A;  4DS4 A;  3V6K A;  3FDS A;  2MEW A;  2JX2 A;  1QUV A;  3G2X A;  2MQN A;  3C15 A;  3CMA S;  4IFV B;  1S0M A;  3THV A;  2GJI A;  1YJU A;  3DRR A;  6FDR A;  3G8T A;  3MPY A;  3R7S B;  2YNH A;  3H2L A;  2VA2 A;  2VIC A;  3PG9 A;  3DXS X;  2RIJ A;  4Y28 C;  1IVZ A;  3L09 A;  3MEE A;  4NXN J;  1PC4 A;  3CJ2 A;  3EGZ A;  1CJT A;  4C8Y A;  5HVG A;  1Y5L B;  2MMY A;  1NK8 A;  3FQL A;  2HLT A;  2OPP B;  4NZ7 A;  3H59 A;  2XGQ A;  1V5V A;  1AZS B;  1N52 B;  4BWM A;  9RUB A;  2V8G A;  4IH7 A;  3IG1 A;  2Y0S D;  3FVY A;  2IFX A;  4Y2C A;  2GW8 A;  3M9N B;  5HQL A;  1SV5 A;  2DB1 A;  1IR2 A;  4LRF A;  2KT3 A;  3C6U B;  5E5N A;  5HP1 A;  3NAH A;  5IOL A;  1KLM A;  4ZVS B;  3IBC B;  1WKK A;  4K7Q A;  1Q79 A;  1VJW A;  1D3W A;  4OMF G;  3A4T A;  4YOE A;  2DNN A;  4ZPC A;  1G1X A;  1GNK A;  4P2F A;  4I1T A;  1KHW A;  2KJW A;  4HTI A;  1H72 C;  1UTA A;  1S48 A;  1XMQ J;  3C3L A;  2XS7 A;  3ONQ A;  3QAT A;  4G3I A;  1UET A;  1I94 F;  1N0U A;  4KAI A;  2GML A;  3GWC A;  2JZ5 A;  4IQM A;  4IUF A;  5J2M A;  1FRX A;  4CNY A;  2LA6 A;  2BM0 A;  3OTO F;  1VYA A;  1DFD A;  1SH0 A;  4LF4 F;  5JXS A;  3DLE B;  3TOQ A;  3K59 A;  1U1Q A;  2YNG A;  1D8Z A;  2B0G A;  5A6W A;  3QSI A;  4F4K A;  2W01 A;  4Y2I A;  1U1M A;  3VWS A;  1N32 F;  4ER8 A;  4RNF A;  5BYQ A;  4LF5 F;  3A3O B;  1IBL F;  2H4W B;  2HHS A;  3IMQ J;  3HHL A;  3GZ7 A;  3GON A;  4QWD A;  4KR0 B;  2J6T A;  4XDD A;  1U1O A;  1U48 A;  5IWA F;  1Q8L A;  4MMO A;  1RT5 B;  2XMM A;  2K06 A;  4ZVO B;  4UQG A;  5ETV A;  2CQ3 A;  1UL3 A;  1S12 A;  3T5K A;  1B64 A;  2EBE A;  3K5N A;  2BV3 A;  4OYB A;  3G87 A;  4M8L A;  1T03 A;  4DV3 F;  3HMJ G;  4QIF A;  2H9Z A;  3U7J A;  3VVU A;  2ILY A;  2HEK A;  2W4C A;  4UZB A;  1SC6 A;  3DLG A;  3HSD A;  4DV7 F;  2CKW A;  3AOC A;  1R6Y A;  5KFS A;  3IWL A;  2YNI B;  3MUM P;  5HVF A;  4IR1 A;  1T8E A;  1S72 S;  3M1V A;  2IIH A;  4X62 J;  1H38 A;  1LFP A;  2YKN B;  2ERR A;  2R8K A;  1J5O A;  3SQG B;  3CD5 A;  4N7T A;  1RHM B;  1YWX A;  4N5S A;  2KYZ A;  3RBX A;  1H3D A;  3AD7 C;  1WC5 A;  2LFV A;  4F0K A;  2EC2 A;  1HNX J;  2BE9 B;  5A8W A;  1AFI A;  3ILL A;  1H7W A;  3H7H B;  5KT4 A;  3VQT A;  4YDX A;  3U02 A;  4G1Q A;  2ZIT A;  5HN0 A;  2JVO A;  2HAI A;  4F26 A;  4F67 A;  5GAD U;  3RG6 A;  5T41 A;  4J9N A;  3TEH B;  1F9E B;  2B4P A;  1KQK A;  2VG7 B;  3PX0 A;  1F9H A;  4J9R A;  1JLA A;  3BQ0 A;  4NX9 A;  4OI0 A;  3M9O B;  4MK8 A;  3AJD A;  1PJ7 A;  4OJ3 A;  5L1K A;  1R31 A;  3DLK A;  4CZC A;  4Q2M A;  5J1E A;  4F0M A;  4UOC A;  3GG1 A;  3FZ2 A;  1UKU A;  3DGP B;  1XMO F;  1JNZ B;  1HBU A;  1RK8 A;  4DR1 J;  2W9B A;  4ZK7 M;  3O2I A;  1G3O A;  3FBC A;  2NYH A;  2V4R A;  4LF6 F;  3QJP A;  1X5O A;  1SPB P;  3N0V A;  2CAD A;  3BN7 A;  2JOQ A;  5IFM A;  2EI5 A;  2HHH J;  3IR6 B;  4ZP6 A;  4Q0B B;  1LXJ A;  4I0W A;  4LUB A;  2UUW A;  3S6E A;  4ECU A;  4OZN A;  3CDW A;  5BR8 J;  2M0G B;  4IKA A;  4DUY J;  1RBL A;  2LDY A;  4J9O A;  3TJ8 A;  2V8P A;  2V9K A;  2ZBI A;  1ZAW A;  3CTR A;  2UXC J;  4RBT A;  2LXU A;  3BPD A;  2QIF A;  2DXE A;  3MFI A;  2DGU A;  2KKH A;  2BAC A;  2HRT A;  3PRD A;  2XY7 A;  2DIT A;  2QG9 B;  4PUO A;  3ZZP A;  3MPW A;  1HW8 A;  1NSK L;  1F3V A;  4ZS6 A;  1NKC A;  2LXF A;  3R2C J;  2XMT A;  3JSM A;  3ZTQ A;  4Q8F A;  1X4C A;  2MQO A;  2ZZT A;  3KYL A;  1SUQ A;  3BKU A;  3R7B B;  1M1H A;  1BC6 A;  4M5K A;  4FYX B;  4DPY A;  4FF3 A;  4MK7 A;  4HAC A;  4HT5 A;  2P6T A;  2R8G A;  3MCS A;  3VGU A;  2EKY A;  1WI8 A;  3R2D J;  1FRJ A;  3KMQ A;  3EPI A;  4ECY A;  1T9V A;  2BQU A;  4L74 A;  1R6V A;  5KFC A;  1Q86 T;  1XNR F;  3LAM A;  2QTW A;  4DQS A;  1VRT A;  4ECR A;  3NLC A;  4ECX A;  3MFH A;  4CNZ A;  2ZBP A;  4O23 A;  1VQM S;  4PG7 A;  4C8L A;  3H2U B;  3MM6 B;  2CQ2 A;  2AMC B;  2QMX A;  2FJV A;  4ZVH A;  1D0E A;  2UXD F;  4LSN B;  4NLT A;  2GAG C;  2MZQ A;  2RVJ A;  3C16 B;  3KUE A;  2C2M B;  4J5O A;  1E6Y A;  3KK2 B;  2DNY A;  2AW0 A;  4DL7 A;  1VQN S;  4KSE B;  4DG1 A;  2RNE A;  3D3C J;  5F8M A;  3J7Y I;  1XR6 A;  2VDH A;  5H9E K;  5B0E A;  2A1B A;  1JLF B;  2XS5 A;  3I56 S;  2WVD A;  4FPR A;  1EP4 A;  3MM9 A;  2V2Q A;  1SB6 A;  4WPA A;  3EUN A;  4OX6 A;  2E1P A;  3NCR A;  5HMX A;  4TXS A;  4KT0 C;  4U67 Q;  2HHU A;  3GFX A;  4QWE A;  4OHX A;  1TFW A;  4CH0 S;  2HND B;  2IVY A;  2ZKT A;  3QIP A;  5D0E A;  4IH6 A;  2BKP A;  1EET B;  2DGO A;  2MQL A;  1E6V B;  3H8Y A;  4RW4 A;  4DR5 F;  3M6U A;  3AY0 A;  2UUC J;  1NSP A;  4WFB Q;  4DUZ F;  1EX8 A;  3FK4 A;  1S6U A;  5KFZ A;  1EIY B;  1MML A;  2FTR A;  1XJW B;  1DQ8 A;  4NE9 C;  4WKR A;  4DV6 F;  2FD2 A;  1NKE A;  3BGR B;  4LSZ B;  3GFH A;  4EUV A;  1N5Y B;  5C25 A;  4YR2 A;  2G9O A;  2VKZ G;  3CCU S;  1U09 A;  4K4W A;  3OSP A;  2XCA A;  2LDI A;  1SCJ B;  1IBK F;  4FBU A;  4WFY A;  1ZM9 A;  2IYI A;  3CED A;  5B0D A;  2OEJ A;  6AT1 B;  5DDP C;  4ZIV A;  2UUA F;  1TL7 A;  4H4O B;  3DRS B;  1RTJ A;  3LP0 A;  1RIS A;  2XI2 A;  3MAH A;  3TZX A;  1OIA A;  2E29 A;  3IAS 9;  2MKK A;  2R2T A;  3QAU A;  4DMZ A;  4OLP A;  1EQM A;  3PAC A;  1C1C A;  2RT3 A;  3M4X A;  4NEY A;  3RAX A;  3TQ1 A;  5IT4 A;  1VRQ C;  3UVJ B;  2HFN A;  4ANC A;  2KL8 A;  1EAR A;  1FCA A;  5SZT A;  4X4N A;  3MM7 A;  5D4N A;  2MZ1 A;  1N33 F;  4EFA C;  3ZZO A;  4JYA J;  4WIQ A;  2XYH B;  5A0Y A;  2MHE A;  2A2C A;  4B3M F;  2LEP A;  3T3F A;  3DI6 A;  5KTQ A;  1O51 A;  4ED7 A;  5E41 A;  1QUP A;  4B9T A;  1FXL A;  5U47 A;  3HHD A;  1U8S A;  3M8Z A;  4GVB B;  3W5Z A;  2LMI A;  2BJ7 A;  2VJU A;  3D5M A;  3V4I A;  5B09 A;  1WUU A;  5E3R A;  2PEH A;  5ITH A;  3JYT A;  3DLL Q;  4DFJ A;  4DV3 J;  4Q44 A;  2NXC A;  1S6Q A;  1D9A A;  2V2K A;  5CYJ A;  2RU9 A;  1TL1 B;  3TUZ C;  1AUD A;  3DLB A;  3QGG A;  1RT7 A;  2JRS A;  2CQH A;  1Q4R A;  5LMN J;  1RTH A;  4CO4 A;  3KLF B;  2LLZ A;  1IKV B;  1T02 A;  5LT5 A;  4MFB A;  4X4S A;  5CYQ B;  1R0B G;  4LFB F;  2BW7 A;  2HBY B;  3F56 A;  3I9V 9;  3MPV A;  2HNZ A;  4ZDN A;  4RNO A;  2BM1 A;  1NDP A;  1RT3 B;  4DSI A;  1WC1 A;  1WHY A;  2HZA A;  3UW1 A;  2B8P A;  3T1Y J;  4Z7C A;  4ED8 A;  4CLW A;  2FC9 A;  3KMS A;  2VJV A;  4YHH F;  3KLI B;  1NK5 A;  4LQ3 A;  5HMY A;  2FHM A;  5FJ4 A;  4K50 A;  4LFA F;  1KD1 T;  4NZ6 A;  2WK4 A;  2QLW A;  3D1Q A;  3MPU B;  2W7P A;  1TK5 A;  1UA1 A;  4QIV A;  3GB0 A;  2QA2 A;  3J81 Y;  5GMK a;  1Q53 A;  5K14 B;  4C0H A;  5LMU J;  4IO1 A;  1GX6 A;  2RB7 A;  2DHA A;  3C6T A;  1FO1 A;  1SJ4 P;  4G6V B;  3SSR A;  1UPP A;  2AQ4 A;  2QYC A;  4PWD A;  5L8R C;  3UO0 A;  3TAM B;  2NZC A;  2VH7 A;  1U49 A;  5JUM A;  2D3O R;  1FT8 A;  2D7S A;  2LQ5 A;  1KR4 A;  2AWZ A;  1X4G A;  3IRW P;  4ITS A;  3NL0 A;  1M5H A;  3MM8 B;  5F9L A;  2DPJ A;  4CQ1 A;  3VAJ A;  5CH7 B;  2F9D A;  4ECV A;  2M2B A;  3NGK A;  4LF6 J;  4KGX B;  4RW8 A;  3GIK A;  4NXM F;  2MZR A;  2OML A;  1T9T A;  4HYK A;  2DTJ A;  3KG0 A;  2ATC B;  4URQ U;  3ISN C;  2DRD A;  2BA9 A;  3I87 A;  3IXQ A;  5DO2 A;  2W7O A;  3MGJ A;  1I51 B;  1KFD A;  1VQL S;  3IR5 B;  1RHK B;  3CJS A;  4TYA A;  1FFS B;  4K5R A;  2RIL A;  3CCS S;  2K7K A;  3PW5 A;  4L72 B;  2IMO A;  1DRZ A;  5KG3 A;  4LF8 J;  4Y2K A;  2NXJ A;  2OPR A;  2CWX A;  2RAQ A;  1W2B R;  1S7H A;  4I56 A;  4A46 A;  1OS5 A;  2ZH1 A;  3TZY A;  1A7G E;  1FK9 A;  4OX7 A;  3RR7 A;  3NY0 A;  4K0K J;  2A3J A;  3N28 A;  1SL2 A;  1FKO B;  1GX5 A;  1TK8 A;  3GJQ B;  2JC0 A;  2AGQ A;  1LWX A;  3CD0 A;  4ELU A;  5RUB A;  4KHM A;  3G8S A;  4DX6 A;  1ELO A;  3J81 U;  5BXI A;  3C2P A;  4I68 A;  1KEK A;  3W5Y A;  3W62 A;  1QAJ A;  2CPZ A;  2YX7 A;  3CJ0 A;  4MJK A;  4DX5 A;  3P8B B;  2DNM A;  5F9N A;  4LF7 J;  1YRX A;  3V81 B;  2VQF J;  3MEG A;  3OR1 A;  3FGV A;  4TQR A;  3RTV A;  2NRE A;  3JSR A;  3W2W A;  1BQM A;  1LV5 A;  4ILM A;  2Q6C A;  3EIC A;  3U1M A;  1UCN A;  4ID8 A;  3TAQ A;  3KLH B;  4BWJ A;  5I4M A;  4ECW A;  3G6E S;  2XMU A;  2W25 A;  1WEL A;  5KG6 A;  2ZHO A;  3DYA B;  5LM7 E;  4WTY A;  5IM0 A;  2UXD J;  4GMK A;  4FF2 A;  1LQ9 A;  1GXU A;  3CXC R;  2Z58 B;  4WK3 A;  4ECQ A;  2MLX A;  4ENO A;  1NSA A;  2GQC A;  4TQS A;  2CPI A;  2YWW A;  4GVL A;  3N6N A;  3FC9 A;  3BQ1 A;  3BF4 A;  2H3E B;  1K0T A;  4AQY F;  5L46 A;  1KP6 A;  1RT4 A;  1FTC A;  1U47 A;  4OIX A;  4O3O A;  2QEX S;  5C42 A;  2FY8 A;  1S0V A;  2JLG A;  1JJ4 A;  4WII A;  1CUL B;  2B51 A;  1CS4 B;  1EHW A;  1FWL A;  5GAD I;  2BE2 B;  1FF2 A;  2E5I A;  3G6V A;  4CO0 A;  1CJK A;  4ZHR A;  4J9Q A;  2HHT A;  4J9P A;  2DNG A;  1BE4 A;  5KFI A;  2GV1 A;  2N4D A;  1PJ5 A;  3V4M A;  4DR5 J;  3ISZ A;  2D9P A;  3FMB A;  5KFK A;  1GEH A;  4DI6 A;  1SC3 B;  4MIA A;  1D8Y A;  4RBU A;  1DY3 A;  1NPK A;  1GMV A;  1JLB B;  1YX2 A;  1F0X A;  1IKX A;  1ARO P;  2ZH2 A;  4BCA A;  4RZR A;  5ETQ A;  2V69 A;  1PBU A;  4X4R A;  5B08 A;  2LP4 A;  4DOZ A;  1JKH A;  1RP5 A;  4JI0 J;  1XEZ A;  4OI1 A;  3WC0 A;  2CJX B;  5B0B A;  2XZW A;  1HR0 F;  3TUP A;  2VG5 B;  4I6W A;  1S6P A;  3GV8 B;  5AJ3 F;  3OTE A;  4R8U B;  3LO3 A;  1IBK J;  4RUC A;  1SQF A;  3THT A;  2UUB J;  3I9Z A;  3D9B A;  4MK9 A;  2AYG A;  4DN0 A;  4Y0F A;  5HBM A;  5FDL B;  2W2M P;  4LRD A;  3DKD A;  3AQO A;  2H5I B;  1Y9O A;  1TUV A;  4OV6 A;  3D7S B;  2N7Y A;  5D77 A;  4NLP A;  1CC7 A;  2XM3 A;  5IT9 U;  3M2R B;  3DDK A;  2B7B B;  2YTC A;  3PYG A;  4CI0 B;  2NYI A;  3SDE A;  3B6B A;  2E7X A;  2W9A A;  1MU2 B;  1GT8 A;  5DM7 Q;  4B3R J;  2EC0 A;  1XNQ J;  1VLO A;  2BW2 A;  3DFE A;  3DOM B;  3GLJ A;  4I2P B;  3NGR A;  3EWG A;  3PW2 A;  3OR2 B;  4DV2 J;  3UCU P;  1GH8 A;  1VQK S;  1CLF A;  4JI6 F;  2M3D A;  4OZ3 A;  3OL8 A;  4QR2 A;  3AA9 A;  2U2F A;  5GAH I;  2V6A A;  1RWN B;  4LMZ A;  1Y0H A;  4A8X A;  4GRS A;  2G0J A;  1EKR A;  2J5A A;  1LOU A;  3JTN A;  4JI4 J;  2UXB F;  4FDF A;  2ZH8 A;  1FE4 A;  1NJX A;  1WC4 A;  1X9S A;  3POT B;  1WAC A;  2N7C A;  3V5R A;  1U2C A;  3EPG A;  4AT1 B;  1PIL A;  1RAF B;  3RW6 A;  2ZH3 A;  1FRK A;  3IO1 A;  1TTH B;  3WX8 A;  1JJC B;  3UD5 A;  4PAB A;  1O5J A;  3JTO A;  3ZO7 A;  5E3A A;  1RQ0 A;  2XHW A;  3DRP A;  5I42 A;  1IR0 A;  1WF0 A;  4OI3 A;  2I5J A;  2ZUG A;  2X1G A;  2NUH A;  2AJ4 A;  1HPZ B;  3ZNU A;  4B3S F;  2ZVS A;  3GV5 B;  4E8U A;  3N5F A;  1RKI A;  2C3U A;  5DQI A;  3PHT A;  3T1H F;  3FRY A;  3VAK A;  4NLV A;  3ENQ A;  3T5L A;  4FZV A;  3SV3 A;  1DLO B;  1ZTT A;  5KFH A;  3RBD A;  3JAM Y;  1NLK L;  1Y4Z B;  2PMH A;  3O44 A;  1SH3 A;  1JXV A;  5GAE I;  1OO0 B;  4IRK A;  4F4X A;  3GYN A;  1IR1 A;  4YHH J;  3SBM A;  1C0T A;  2CQI A;  2DIU A;  2LKZ A;  1Q16 B;  4LFA J;  3BPS P;  4J90 A;  2DIV A;  3PM9 A;  2ZC3 A;  1NCL A;  2N82 B;  2DH9 A;  1GK8 A;  2EKN A;  3LGN A;  1Q1K A;  2BAN B;  2HZC A;  4DZ6 A;  1PBA A;  2PMZ D;  5J2P B;  2VV5 A;  2HHP A;  4F50 A;  4Y00 A;  1NME B;  2ZH6 A;  4O0I A;  3FSI A;  1KTV A;  2COL A;  2DVI A;  3CCZ A;  4LJM A;  5KFJ A;  3HD1 A;  5ETM A;  1ICE B;  3MAA A;  3W2V A;  1M5S A;  3NCP A;  3L7P A;  3O5T B;  3UPF A;  3P45 B;  2N4C A;  3QT6 A;  3BR8 A;  1VRU A;  1R0A B;  4AXJ A;  4WE1 B;  1SC4 B;  1D09 B;  3T6B A;  2KXH A;  4J91 A;  1N5S A;  5IV3 A;  1FJC A;  3W9I A;  3NOG A;  4PPD A;  4O3P A;  4NMX A;  5AXN A;  3ELH A;  5KG1 A;  5F8G A;  2RDJ A;  4NML A;  1JLQ B;  2CA9 A;  4ZJL A;  4NXM J;  3QT7 A;  1JMT A;  4X84 A;  5A2Q Y;  2XYP B;  3JS9 A;  2GVD A;  2LVW A;  2AU0 A;  1S9E A;  3EVM A;  3GJS B;  3IGV A;  1UJ4 A;  2BUN A;  3C15 B;  4CT8 A;  2LEC A;  2VB6 A;  1MWZ A;  2EFQ A;  1XK8 A;  3DRR B;  1S76 D;  2YNH B;  2QLJ B;  3FBB A;  1RBA A;  4UOG A;  1EJ7 L;  1CJT B;  1YDL A;  1U2F A;  2JVR A;  5K8N A;  4E0D A;  2D41 A;  3HLU A;  2Y1L B;  4GKK F;  3N01 A;  4Y34 A;  2PEB A;  3IG1 B;  1FNM A;  1PKU A;  3HUL A;  2DBB A;  4W90 B;  1APS A;  4DQI A;  2AZ3 A;  2XNR A;  1SV5 B;  4P7V A;  2MKY A;  4RNH A;  2DEI A;  1VC6 A;  2OPS A;  4DR2 F;  4F02 A;  5HP1 B;  1NHK L;  3SCJ E;  1KLM B;  3FEY B;  2OP5 A;  3MCN A;  1HWI A;  4DV4 J;  1M5P C;  3VAH A;  1TAQ A;  4DSF A;  4DQR A;  2HYI B;  2IRU A;  4ZLP A;  1X7V A;  2D74 B;  3PY8 A;  4V19 J;  2L3M A;  3JSB A;  1BY9 A;  5GME A;  4JP8 A;  1WWH A;  4I6A A;  2D3U A;  3M30 A;  1TMM A;  5DGA A;  5J2Q A;  4WF9 Q;  5J2M B;  2CIM A;  3IFE A;  4P2S A;  3Q24 A;  4JV5 F;  4UT4 A;  4CLL A;  3R5C A;  5J1P A;  1HHQ A;  3ZZZ A;  1MWY A;  4ZJQ A;  3CO9 A;  3QGH A;  5A2Q U;  2F9J A;  2WBM A;  2ACY A;  4OZ5 A;  2P8I A;  3H2V E;  1IM6 A;  2DR8 A;  2LQB A;  2YNG B;  1KVK A;  3RBE A;  4CLS A;  3I32 A;  3EXY A;  4TYB A;  2P9C A;  3UFC X;  2MKI A;  2YKQ A;  2NXE A;  1RGV A;  2XZD B;  3CCV S;  1KSP A;  3F41 A;  4MAK A;  4ZPA A;  2BMB A;  3HHL B;  1RWM B;  4IR9 A;  2QFI A;  5GVQ A;  3KNG A;  2NUU G;  2FB0 A;  4KPY A;  1IXK A;  1RTI A;  4GKJ J;  2BJE A;  5HSP A;  4U7U D;  4MKY A;  1T03 B;  3FBE A;  1WTF A;  1W7W A;  1WEY A;  4Q5V A;  2EVZ A;  3TAN A;  4AND A;  1WTB A;  1KOO A;  4C7Q A;  2OSQ A;  4CLZ A;  1B99 A;  4H4M A;  3GYX B;  1VI7 A;  3TR5 A;  1REV A;  3DLG B;  1I6J A;  1RTD A;  4DCJ B;  1U45 A;  3FEX B;  2V4Q A;  5HAO A;  1S49 A;  1QAX A;  3TVZ A;  2G2Z A;  4WKY A;  3M2U A;  2PII A;  3M1V B;  5CCL A;  5HRO A;  3KHL A;  5F3T A;  1J5O B;  4E98 A;  2LA4 A;  1X31 C;  4RUH A;  4DR7 F;  1TZ0 A;  1RWW B;  4UOF A;  1RU2 A;  1PYT A;  2HKE A;  1H73 A;  1Y3J A;  2F1F A;  3V6D A;  4ED1 A;  5KFV A;  2Q6B A;  2J8A A;  5A8W B;  3HHE A;  3UDV A;  4B3T F;  4JI8 J;  3CC4 S;  2WTF A;  4BS2 A;  1YK9 A;  4G1Q B;  1WF1 A;  2HHQ A;  3UNY A;  3AXK A;  3BYR A;  4L76 A;  2AJ0 A;  1SJ1 A;  1FDA A;  1KON A;  2IM3 A;  3TYT A;  1F60 B;  4RO0 A;  3H20 A;  4HT7 A;  1RAD B;  2L48 A;  1NZ8 A;  3RB4 A;  1CVJ A;  2XLK A;  3R3T A;  1JLA B;  4JV1 A;  2JSX A;  3CCQ S;  3R9L A;  3HP6 A;  1UJ6 A;  2KG0 A;  1FRH A;  1B70 B;  1NJW A;  1IJF B;  4CH7 A;  4DL2 A;  3ET6 A;  3HT0 A;  1GMU A;  3K7R A;  1KFS A;  2B9X A;  1HNW J;  1IUJ A;  2NSC A;  3PHE A;  5J1E B;  4MTP A;  3US5 A;  2EG1 A;  4O3R A;  5T14 A;  3EM1 A;  2WAQ D;  1HBU B;  4C8Z A;  2W9B B;  3R5B A;  1XWL A;  4JI7 F;  2C3M A;  4WBF A;  2FJX A;  4NLO A;  3DMJ A;  5ETO A;  3NGT A;  2AF6 A;  1XC9 A;  3KK3 A;  2Y1I A;  4NRU A;  2J9C A;  1KVI A;  1S1X A;  4A48 A;  4PZV A;  1N6Q A;  1HHS A;  5C24 A;  3KG4 A;  1C0U A;  5EWG A;  2XMK A;  4UY8 T;  4OX9 F;  2R9L A;  4C6A A;  1CJV B;  2KI2 A;  3T1A A;  2E1R A;  4B3S J;  3ZTO A;  3M6V A;  4WYL A;  5KFE A;  3GE9 A;  1U24 A;  3CWJ A;  1RWK B;  1TFY A;  1N88 A;  3MED A;  1RWO B;  4PUO B;  3OUY A;  3T1H J;  3D1H A;  1OWX A;  2C1E B;  1Q82 T;  2DGS A;  1RBO B;  4P10 A;  1S1V A;  2B9Y A;  2YPZ A;  3MDF A;  3JSM B;  4M5H A;  3HSZ A;  4KHR A;  4AFF A;  1FRI A;  4YUD A;  2OKQ A;  1RA6 A;  2G13 A;  2MSS A;  5E3Q A;  1SUQ B;  2ZH7 A;  2JH3 A;  1S10 A;  1FXR A;  2VPY B;  4HAC B;  2LEB A;  2KM8 C;  2C2K B;  2M9K A;  2IRY A;  1SXL A;  4QBU A;  3PYD A;  4EBD A;  3HO1 A;  3QGI A;  1Y5I B;  4I4B A;  2I9S A;  4USJ C;  2E1A A;  3A13 A;  3HKW A;  4KQZ A;  3DHW C;  1KLN A;  4IFV A;  2D3Z A;  3T41 A;  4ID5 A;  1ROF A;  2FVQ A;  1VRT B;  4CO5 A;  5EDW A;  1M90 T;  1LKZ A;  1KQS R;  1RHJ B;  2V68 A;  3P5B P;  2OLW A;  4ELV A;  3DU6 A;  3OLA A;  2CZ4 A;  4Q2L A;  2CRL A;  4NA3 A;  3G6X A;  4QJV A;  3C66 A;  1UVM A;  2ZM6 F;  1SC1 B;  3FSY A;  2JFK A;  2KXF A;  3GR1 A;  3SSS A;  1E6Y B;  2IM2 A;  3TP2 A;  1RA7 A;  2ALY B;  5AXL A;  1NSQ A;  4M94 A;  1LW0 A;  4DG1 B;  2BQ3 A;  1G6B A;  3TX0 A;  2HVI A;  3AJ1 A;  5L1L A;  2XQC A;  4CO1 A;  1BQN A;  4ZPT R;  4I2Q A;  1UZH A;  1AT1 B;  3H4B A;  1EP4 B;  3MM9 B;  3E3X A;  5F8I A;  3GYG A;  1A6L A;  4IFY A;  4IDK A;  3NNC A;  1VIS A;  3H5U A;  2RML A;  3DLJ A;  5HQ8 A;  3HKZ D;  2ZOM A;  4M5N A;  1OYE A;  3HF5 A;  3QIP B;  2V0N A;  1RAE B;  1X5S A;  2K7J A;  2MDA A;  3BZQ A;  2OI2 A;  5F8J A;  4RW4 B;  3IS9 A;  3PFO A;  4DL0 C;  3CT9 A;  1NAQ A;  4FXV A;  4HKQ A;  4M5J A;  4C8O A;  1F5A A;  4DL3 A;  4KFB A;  1JB0 C;  1YVF A;  5D8H B;  2LCW A;  2B6A A;  3VAG A;  3CPW R;  1O0P A;  5A8K A;  3QRQ A;  3KXD A;  1Q8B A;  3ENW A;  2DR7 A;  1RTZ A;  4PXE A;  1T7P A;  2ACM A;  3DHX A;  5C25 B;  1NK0 A;  1RXO B;  2R2S A;  2YWE A;  1ZYQ A;  2WZ1 A;  3A3P B;  1U7L A;  2HBR B;  4CLT A;  4Y2A A;  2PT0 A;  2HUR A;  3RUB L;  3EGW B;  4IQX A;  2Z4P A;  1YG0 A;  2HNY A;  4DR2 J;  1VQO S;  3LWM A;  3DDI A;  4FKX A;  2P2C B;  3ZZT A;  2X1B A;  3HVR A;  5T7L A;  1HFE L;  3E8O A;  1N0V C;  2VOD A;  4L73 A;  4NCG A;  4KJI A;  3AA8 A;  4DN9 A;  4CO3 A;  1TL7 B;  4DV1 F;  2QC3 A;  5J1N A;  2KO1 A;  1N36 F;  1OY8 A;  5IS2 A;  2RF2 A;  1RTJ B;  2AEF A;  4AL7 A;  3LP0 B;  2O67 A;  3CJQ A;  3RGI A;  2HFV A;  3IA0 A;  1FRL A;  2IY5 B;  5EWE A;  1MN9 A;  4WFZ A;  5KFR A;  3C8Y A;  1MWQ A;  4KGV B;  1L3V A;  1BD6 A;  3PJ9 A;  2CG4 A;  3H5X A;  4OZ2 A;  1C1C B;  5HL7 Q;  3TNV A;  2AV5 A;  4EYH B;  3J7Y U;  5IT0 A;  3C14 A;  2JNJ A;  2FC8 A;  3NWG A;  2FHK A;  5IC4 B;  3EDR B;  1JQG A;  2BJ9 A;  3U1L A;  3MM7 B;  5K8P A;  1DZ5 A;  3MMC A;  5A0Y B;  1ZBT A;  4RW7 A;  3NRB A;  4DLE A;  3DI6 B;  4EYI B;  4UST A;  4ICL A;  8RUC A;  3KJN B;  5E3C A;  3LGM A;  2PD1 A;  1N48 A;  4F04 B;  7FD1 A;  2GO8 A;  1HNZ J;  5JMN A;  3BKT A;  4TVA B;  4C48 A;  3BS9 A;  2ZBC A;  4I67 A;  3V4I B;  3OTB A;  3EDQ B;  1SBR A;  1H0H B;  1JK9 B;  3ZC4 A;  2XSF A;  1FEH A;  2KVQ E;  3MMB A;  3JYT B;  1S99 A;  1WOO A;  2VOP A;  1P6T A;  4TY8 A;  1HWU A;  1S6Q B;  1TVR A;  2VQE F;  4WU3 A;  2XSJ A;  2HS0 A;  4ETZ A;  2R2R A;  5ADZ A;  4XDC A;  3LA0 A;  4DR3 F;  3BJY A;  1CQN A;  1RT7 B;  2O01 C;  4WCE Q;  4USI A;  1RTH B;  2GNK A;  2AJF E;  3ZTS A;  1YJV A;  2KRR A;  4PWU A;  1AA1 B;  1FX2 A;  5AE3 A;  4MFB B;  4X64 F;  5DG8 A;  1U6Z A;  2ZDO A;  4IG3 A;  5KFD A;  4ES3 A;  3LPY A;  3KTQ A;  2AYM A;  2A2D A;  2HNZ B;  2OFG X;  3TVY A;  5E7O B;  4DCO B;  4NLW A;  3PYF A;  2R7O A;  4DSE A;  5KG0 A;  2VHG A;  5KFF A;  3CJT A;  2XLI A;  2DGW A;  1HBM A;  5FLX Y;  3D0I E;  3VGS A;  4DL6 A;  3TAP A;  5F8H A;  1C2P A;  1JLC A;  2J9E A;  2WON A;  2JC1 A;  4CIO A;  1RWX B;  2B5J A;  2R7X A;  5CD4 A;  2C22 A;  4LR8 A;  2F7V A;  5CAB A;  2KH9 A;  4RU9 A;  1ZZF A;  1SI9 A;  2FZG B;  5F8L A;  2XC9 A;  1UVJ A;  1PCA A;  3MR5 A;  3C6T B;  1KC8 T;  4FYV B;  4F4Y A;  4YEA A;  2E9T A;  1BUX A;  3QBC A;  4YP3 A;  4CO2 A;  4PWD B;  2GA7 A;  2AP6 A;  4MKA A;  1P9Q C;  3NWR A;  3I55 S;  2I6W A;  3Q0A A;  2K3K A;  3G86 A;  2G2O A;  4A8Q A;  2W9C A;  1HI0 P;  2OD6 A;  5ETN A;  5KFB A;  4JI5 F;  3RRK A;  5DQH A;  3ZXW A;  1VC5 A;  2ZZN A;  4QWB A;  4ZPB A;  1Q95 G;  3KHH A;  4JI7 J;  2V50 A;  3FCV A;  1OJ4 A;  1FVQ A;  1VQ9 S;  5AE1 A;  4RW8 B;  3VZI A;  2Z0G A;  2UU9 J;  1UVN A;  3JQK A;  2V8D A;  2J7W A;  3D67 A;  3OJU A;  3EVO A;  5KT2 A;  2VA3 A;  2CG8 A;  2YKP A;  4PG8 A;  1X0P A;  1M1G A;  2E9R X;  3TA0 A;  2FGO A;  4NI2 A;  3TQE A;  2J7K A;  1Y10 A;  4YME A;  2ZE2 A;  4LR7 A;  1VLY A;  4OI6 A;  2R7U A;  3NBP A;  1ZTW A;  2HFU A;  1WOS A;  2OPR B;  3C16 A;  2A6O A;  5K20 B;  4N77 A;  3ITH A;  1IBM J;  4U8V A;  5EHH A;  5FLX U;  4QW9 A;  1FK9 B;  2EBG A;  2RRA A;  5D0H A;  3HHN B;  4OYM A;  5HAN A;  4C98 A;  1EKS A;  2J0Q D;  2R4F A;  2YXL A;  4LRC A;  2GAH C;  4LBH A;  1ITP A;  3I31 A;  2FUG 9;  3IN5 A;  1U1R A;  2E66 A;  2RKI A;  4ZCI A;  3QMQ A;  3NXZ A;  3DGV A;  4Y3C A;  1RT6 A;  1RWP B;  1ZET A;  1J27 A;  2D1C A;  3ZTR A;  2X7I A;  3ENV A;  1TAU A;  2QA1 A;  2E5H A;  4ELT A;  4A8K A;  3U27 A;  1FD2 A;  1VK8 A;  7FDR A;  4USV A;  2UVR A;  1RB0 A;  3MEG B;  3OR1 B;  3AB4 B;  3NKY A;  5KG4 A;  2YY3 A;  3W2W B;  2V94 A;  3RU0 A;  1BQM B;  3KHG A;  1BLU A;  2CDR B;  4FYW B;  4ZVG A;  5G0R A;  1E6V A;  3M8R A;  1W2I A;  2J0W A;  1X4H A;  3SCI E;  3Q8U A;  1C1B B;  2KDO A;  1U6B A;  3IM9 A;  1RAI B;  3A8J A;  2GS8 A;  2DCL A;  3C46 A;  5IM0 B;  5SUH A;  2ZM6 J;  2UZA A;  3J7Z T;  2E44 A;  1QVG R;  4C97 A;  1LWF A;  2WW8 A;  4OI2 A;  2R7W A;  2R3V A;  3PZP A;  3G82 A;  3V2U C;  3JQM A;  2HVD A;  1R43 A;  4XAK A;  4WU2 A;  1G7C B;  3HVA A;  2XYG B;  3MR6 A;  3MZI A;  1DTT B;  3SZ2 A;  1RT4 B;  2DNL A;  1P1L A;  3PFE A;  3W8G A;  1UZD A;  5C42 B;  4RW6 A;  2Z30 B;  2ABY A;  2ZHB A;  4KC5 A;  3BBF A;  2RU3 A;  5HMW A;  3QFW A;  2YNF A;  3OXF A;  2E7W A;  1QSY A;  1RHR B;  2Q79 A;  4EGL A;  4J37 A;  2K1R A;  4FNI A;  2C28 A;  2CPH A;  1CJK B;  1FNX H;  4ZHR B;  3Q8V A;  3RAM A;  3AAW B;  2QT7 A;  2CNN B;  3OL9 A;  2E5L J;  5I3Q A;  1HYS A;  4UZC A;  2OO4 A;  3W64 A;  2C3O A;  4RW9 A;  1B0T A;  2DHG A;  4DSJ A;  1X4A A;  4USU A;  1RT1 B;  3R8Y A;  4DV0 J;  3GV7 B;  1IKX B;  3LP2 A;  2XS2 A;  2F4V J;  4QCL A;  1YZ7 A;  3L4B C;  1FKA F;  3HCX A;  3VZH A;  2M52 A;  2G1H A;  1GAO A;  1MMN A;  4L6V 3;  1JKH B;  3HM9 A;  2YQ0 A;  3W65 A;  3M2V A;  1ZH5 A;  4TKT A;  4EMD A;  1URR A;  3KLE A;  2EG2 A;  4M63 A;  2QN6 B;  4C8K A;  2F63 A;  5KFX A;  2MKH A;  1S6P B;  3E2E A;  4K4S A;  1B0V A;  4B9U A;  1XMB A;  3N4W A;  4UW2 A;  1ZPV A;  5EN1 A;  2HG4 A;  4BDP A;  1DQ9 A;  4OZJ A;  2AGP A;  2J6U A;  4C2M A;  4X65 F;  5HBM B;  1N36 J;  3LP1 A;  3CDB A;  3OHB A;  1NK9 A;  3W8P A;  4KO0 A;  1GXT A;  1KKH A;  5DLG A;  4PXD A;  5KOW A;  4RU2 A;  1D9F A;  3IM8 A;  1RT2 A;  2X3G A;  2IJN A;  4C3K A;  2E7V A;  1Q7Y T;  3D0G E;  2X3D A;  2QL5 B;  3IC1 A;  4DHV A;  2OAU A;  5DJB A;  3ILO A;  4KH1 B;  2HFS A;  4KKO A;  2CQ0 A;  4R5P A;  1O8B A;  2CJB A;  3TA1 A;  2VC1 A;  4JI3 J;  4EO6 A;  4F2S A;  1RSC A;  5MLC V;  5D3G A;  1HNV A;  3NEK A;  3EJM A;  1QSS A;  1FA0 A;  2FIU A;  4X66 J;  4OZL A;  4QWC A;  2E5J A;  3PDN A;  4WK1 A;  2ZOF A;  1NZA A;  1BMQ B;  3LPE A;  2H5E A;  3BYP A;  4QU6 A;  2G2Y A;  4M5I A;  1NND A;  2FHJ D;  1NH7 A;  1VIO A;  3MAQ A;  1OSC A;  1HIY A;  2YKM A;  3LAK A;  1KQG B;  4FS2 A;  2RJZ A;  1KS2 A;  3L95 X;  4X4U A;  3TJ9 A;  5LL6 d;  2FVP A;  2D9O A;  2VQE J;  3CGI A;  4DF4 A;  1IKW A;  1EAY C;  3DRP B;  3LQV A;  2HGM A;  3DM2 A;  2I5J B;  4DR3 J;  4YY3 J;  1T05 A;  4DWI A;  1FFW B;  2DHX A;  2J8S A;  4H4K C;  2BJ8 A;  5DZ6 A;  2BBE A;  4LBP A;  4DV5 J;  4K4Z A;  5HI7 A;  1FJG F;  3D6T B;  2DY1 A;  4D3G A;  1MLA A;  2JHE A;  2DGT A;  3EZ5 A;  3QFH A;  3BB5 A;  4B3O A;  2JFD A;  1ULR A;  3M8W A;  2CXE A;  4ZKA A;  1S4F A;  4A8S A;  3OT9 A;  4QR0 A;  1NDL A;  3OJS A;  5BYS A;  3KUG A;  3SFG A;  3CIZ A;  2PN6 A;  3EMT A;  2QMW A;  2XY6 A;  2BE7 D;  3M8P A;  2RQC A;  2QLF B;  1HQU A;  3QGP A;  3DN9 A;  3M8Q A;  2O5D A;  1C0T B;  2HHX A;  3G71 S;  1S5Z A;  2YWF A;  4KGM A;  2IMW P;  1XIQ A;  5DLF A;  1VGY A;  3NGU A;  4PYD A;  3QID A;  1EB0 A;  4FPI A;  3AXM A;  1QD1 A;  4M95 A;  3CF5 Q;  2CVE A;  4MYU A;  4MT1 A;  1SKR A;  1ZOT A;  4KV8 A;  2V2Z A;  3QPI A;  4NXN F;  4F4Z A;  4LVO P;  1WEX A;  3MAA B;  3W2V B;  2C2Z B;  1S79 A;  4P2M A;  4P75 A;  2YWG A;  3MR7 A;  4JI1 J;  1VRU B;  3WBZ A;  3KDO A;  2PFF B;  1WHV A;  5CHC B;  1SH2 A;  1HD1 A;  2RS2 A;  3M05 A;  4NCB A;  5KFN A;  1RLC L;  5GAH U;  2CNL B;  1HNI A;  3EYZ A;  1NRK A;  2HLU A;  3TW0 A;  3MMA A;  3LOU A;  1HBO A;  1QAY A;  1O6X A;  4B02 A;  2XB2 D;  5B0F A;  3BN4 A;  5HJX A;  1VC0 A;  4I69 A;  3BDE A;  4RWW A;  2R42 A;  1QSL A;  1YSJ A;  1IKY A;  5D6G A;  1S9E B;  3DOL A;  2OIH A;  4ED5 A;  3FCW A;  4J9L A;  3GQC A;  1HHT P;  1H98 A;  5KFY A;  2OTJ S;  3CB4 A;  3GSI A;  4KHP F;  2MQQ A;  5CD4 H;  3D1O A;  2FJW A;  1G4C A;  1V3R A;  2HQ3 A;  1KN6 A;  1FKP A;  4BBY A;  3FKB A;  2B9W A;  2F5G A;  1WSV A;  4USM A;  4YS2 A;  1UW4 A;  3I82 A;  5LSL A;  1JLE A;  5B0G A;  4RPF A;  4U7C A;  4LFC J;  3TUI C;  1LK7 A;  3PTW A;  2F65 A;  5KFU A;  5GAE U;  1K1S A;  1T11 A;  3ICL A;  2HK3 A;  2NLW A;  1H7X A;  3N5B A;  1YGY A;  3QWU A;  2XGP A;  2IA0 A;  5KT7 A;  3OD2 A;  4NZ0 A;  3AFG A;  1SKU B;  1S57 A;  2C3P A;  2QZ8 A;  4DXL A;  5FII A;  2OPS B;  5MAO A;  3HFV A;  3VV2 B;  4C9D A;  3WDO A;  3GP9 A;  1BWE A;  2WVE A;  3K5P A;  2LQ9 A;  2CJK A;  3AHP A;  1S7I A;  4NAS A;  1ZPW X;  1PO6 A;  1OPZ A;  5E0O A;  2KM8 B;  1YJT A;  3BV8 A;  3Q8Y A;  1L3K A;  3C19 A;  1X4F A;  5F41 A;  2MLY A;  1N5Q A;  2W8L A;  2BZ2 A;  3CJ8 A;  1S1U B;  5H9F J;  3GR0 A;  1IQZ A;  2AEM A;  2SXL A;  5J2Q B;  2DXF A;  2CQP A;  4AD6 A;  2A10 A;  3VF0 B;  3NAI A;  4B17 A;  3TVK A;  3PCO B;  1K8A T;  3TWZ A;  4U8Y A;  1U6F A;  3UE2 A;  1LFW A;  3R27 A;  3LF0 A;  2Y9H A;  4X62 F;  1TV6 A;  1QTM A;  2ZNZ A;  2EEY A;  2VL1 A;  1I94 J;  4N47 A;  2DR6 A;  3WIV A;  2OFH X;  4FVM A;  3S7R A;  1WC3 A;  4QQB A;  1R8A A;  3B54 A;  2M88 A;  2ZH4 A;  5EX0 A;  5JVH Q;  1T94 A;  3OTO J;  1U25 A;  1HNX F;  1WD6 A;  3Q8S B;  2EK6 A;  2AEJ A;  4LF4 J;  2NCK L;  3QZ8 A;  2XNQ A;  4M5G A;  2HGL A;  4LSL A;  4YQW A;  1RTI B;  3MD1 A;  3VAL A;  1N32 J;  2ZWO A;  3EGN A;  5K5M A;  2POK A;  2Z8Q A;  4LF5 J;  1LW2 A;  1IBL J;  3KNA A;  5DDR C;  1MRO A;  2BYC A;  1YBT A;  3KK1 A;  4J9K A;  2V8V A;  2X1F A;  2CZV C;  3J80 Y;  4H4M B;  5IWA J;  4J7C A;  1REV B;  1RTD B;  2VZ9 A;  4ZVR B;  1T9W A;  2XMW A;  2EFG A;  3M2U B;  1H6K X;  5HRO B;  2WVF A;  3W3S A;  5IQ6 A;  1NUE A;  3EZO A;  4OX8 A;  1S9G A;  4DR1 F;  4CLP A;  1VDH A;  1QLN A;  4CM2 A;  4F0H A;  2HRY A;  2HW3 A;  2CJQ A;  4X65 J;  2VFT A;  3V6D B;  1S0O A;  1YTY A;  3AJ2 A;  4DV7 J;  5EX3 A;  3OHA A;  2HHH F;  3W7B A;  3HXM A;  3UCG A;  1WHW A;  1JLG A;  3TEG A;  2YPY A;  3IWN C;  2UUT A;  1R27 B;  2FVS A;  4I7F A;  3VTI A;  4A47 A;  3E51 A;  2RQK A;  5BR8 F;  1TL5 A;  1FER A;  3NMA A;  2NSB A;  4ZLJ A;  3IBF B;  2UXC F;  1PAE X;  2PFD A;  3I5A A;  4HDH A;  4P9S A;  4ZVF A;  2Z56 B;  1HMV A;  1Y5N B;  1UWB A;  1WG5 A;  5M2P A;  2MJU A;  2LU1 A;  1U2R A;  3I4H X;  1FES A;  3IRX A;  2B4V A;  2XI3 A;  4C8N A;  1VK3 A;  1FI4 A;  1FX4 A;  3ET6 B;  1X9W A;  1TMJ A;  2QYG A;  4FS1 A;  4O0N A;  1LK5 A;  1R8P A;  1KQF B;  4ZVT B;  2OD4 A;  1YRU A;  4NYO A;  4C8M A;  1WHX A;  3K8W A;  2ATL A;  1P9Y A;  3BSO A;  3F73 A;  2YWK A;  3A1Y G;  3BH7 B;  1HQE A;  3PRV A;  2XTJ P;  3DMJ B;  1NJZ A;  4R25 A;  2J76 E;  2QV6 A;  3KK3 B;  1S1X B;  2B56 A;  1N6Q B;  2QLB B;  1HLW A;  2OHD A;  5C24 B;  2ROE A;  4XTT A;  1N5V A;  1V3Z A;  3DRY A;  4QU7 A;  4PG5 A;  4YFU A;  1XMO J;  1UEV A;  4L3N A;  2IJR A;  1YHQ S;  3LH2 S;  3MED B;  2NQP A;  2WCX A;  3OUY B;  2QE5 A;  4DUT A;  3PW4 A;  4NLG A;  2OEM A;  4ZOS A;  2RHS B;  1RKJ A;  1S1V B;  2V5H G;  1S1W A;  2RD5 C;  2WB1 D;  3AOA A;  1X4B A;  2MQ8 A;  1AW0 A;  3PJW A;  2ILZ A;  4ZP9 A;  3O8W A;  4ES2 A;  2GCF A;  1W26 A;  2F8M A;  3UD3 P;  3H90 A;  3KJV A;  1K9M T;  3RB0 A;  1LWE A;  3M6W A;  2E1M C;  2LXI A;  3O3L A;  4X2B A;  3T9Z A;  2I2Y A;  2KZZ A;  2UVW A;  2UVU A;  3VAI A;  2L08 A;  4B9S A;  2WSC C;  3D54 A;  4UOH A;  2WOM A;  4ID5 B;  1BGX T;  4J9M A;  3OFF A;  1MMD A;  4NLY A;  4QPT A;  3GIM A;  2UUC F;  2AX0 A;  4IOA Q;  2PO4 A;  4KGZ B;  2IBO A;  4OFZ A;  4C0O C;  4OZ1 A;  4NA1 A;  4XIU A;  4L3K A;  3HJF A;  2HS3 A;  2RRN A;  1XNR J;  3H0P A;  3UN5 A;  1LW0 B;  7AT1 B;  4KBI A;  5CCM A;  3BGF A;  1RUS A;  3NGD A;  3GU0 A;  5A6P A;  4O4G A;  1BQN B;  2MHN A;  1RAA B;  2GJ2 A;  1UA0 A;  4I2Q B;  1PJ6 A;  3WQP A;  4OZ0 A;  3QLH A;  1JJH A;  2KYX A;  3N79 A;  3I5C A;  4IFY B;  4IDK B;  5JVG Q;  2BRL A;  4NL5 A;  3AT1 B;  4PKD B;  3R5G A;  4EK2 A;  2IDE A;  3SSQ A;  3QRP A;  2KTQ A;  2C2D A;  1GQE A;  3OQ2 A;  4ZVU B;  3K5L A;  4KHP J;  3IS9 B;  1NU4 A;  5C2C A;  4TNO A;  2ZBR A;  1FEE A;  4ZLL A;  3CVK A;  3S01 A;  2Y1J A;  4PPZ A;  4X4Q A;  4KFB B;  1I1G A;  2LQ8 A;  3PW0 A;  1UPM B;  1UVI A;  5LJ3 Y;  2B6A B;  3CCM S;  2O66 A;  5L38 A;  3SV4 A;  2EPI A;  5A8K B;  1SQG A;  2GQQ A;  1TP7 A;  3QJL A;  3KDN A;  3CCR S;  1S77 D;  2DNZ A;  4JYA F;  2JEF A;  4U6P A;  2ZDP A;  2G1D A;  1RE1 B;  2VON A;  3KLG A;  4EI2 A;  4DUZ J;  2HNY B;  4MH8 A;  4R0J A;  2BR0 A;  2M5Y A;  4P74 A;  1F6T A;  4UF4 A;  5T7L B;  3MHY A;  4K4U A;  3AD8 C;  4N56 A;  4NCG B;  1LWC A;  2YX1 A;  4DV6 J;  1Q78 A;  4M5L A;  4F3M A;  3NS5 A;  1ZAX A;  2RF2 B;  4B08 A;  4CLF A;  1T9Y A;  2CWK A;  1VMB A;  2Q1L A;  1GMW A;  4ZN1 A;  4LF2 A;  1L5U A;  3JQJ A;  3SQO P;  4DX7 A;  2BOA A;  1Q81 T;  1TUG B;  4K2J A;  1AUS L;  4A4J A;  5LMN F;  4WP8 A;  5KFG A;  4CYU A;  2UUA J;  4DJB A;  2OTL S;  2B7C B;  3MMJ A;  2W1B A;  3C14 B;  1NPP A;  1KDN A;  4NLD A;  4FYD A;  2HIQ A;  2AIR B;  4ECZ A;  1VHF A;  3FZB A;  3MMC B;  4NEZ A;  2HFO A;  3UN2 A;  2VFS A;  4RW7 B;  4YR3 A;  2YKA A;  3T1Y F;  3I4P A;  1VQ5 S;  3UCZ P;  2FGC A;  4N76 A;  2FLL A;  4ICL B;  4N8O A;  4DFM A;  2DGQ A;  3SIP B;  3TO8 A;  2IC3 A;  3BEG B;  3ENA A;  4OHV A;  2ZD1 A;  4C11 A;  2A0F B;  4X4V A;  1SJ3 P;  2CPE A;  1SKW A;  3MI7 X;  2Q43 A;  1N33 J;  3V6J A;  2W4D A;  3QO9 A;  4ZVQ B;  3DOK A;  3BRE A;  4U95 A;  5A76 A;  4B3M J;  4DPU A;  2I38 A;  5ETP A;  1FD8 A;  2VBX A;  3MMB B;  4Q7A A;  4AXI A;  1YJN S;  4OV1 A;  4DR4 F;  5LMU F;  4TY8 B;  1TVR B;  4PR6 A;  4ZCM A;  2BAB A;  3BO4 A;  2XSJ B;  3B4D A;  1T0T V;  4IOC Q;  4OHZ A;  2G0I A;  2ZZM A;  1CQM A;  2WHO A;  2OH2 A;  5EGY A;  1VS3 A;  2H54 B;  3PEJ A;  1U8W A;  1QE1 A;  2ZUA A;  3NMR A;  1JXL A;  4PG4 A;  2CJ9 A;  4HHJ A;  1OY6 A;  4IG3 B;  3OVS A;  2ZJP Q;  1WG1 A;  2M4M A;  1P1T A;  3PXG a;  5J2N A;  2KU7 A;  4EO8 A;  1TKZ A;  1KVJ A;  3QT5 A;  4IH5 A;  1HBM B;  1QAI A;  1TL3 A;  4O3Q A;  2J7U A;  2BRK A;  1XER A;  3W63 A;  4RX6 A;  4IRC A;  3W66 A;  4USW A;  3VCD A;  1UFK A;  4NLX A;  1JLC B;  1HKA A;  2L9D A;  3PIO Q;  2WON B;  4DSL A;  2IVM A;  3M7V A;  4LFB J;  2AD9 A;  2B5J B;  1WF2 A;  3BSC A;  4DFP A;  1VIX A;  1VBX A;  3NNA A;  4ZCL A;  2IDL A;  1RI7 A;  4KRW A;  2DO0 A;  3P5T L;  1CJV A;  4PYA A;  4LF8 F;  1YRT A;  3VAF A;  4USH A;  3MXH P;  4CH1 A;  4QZV B;  2X51 A;  2VUG A;  5K9F A;  2UVV A;  2L9W A;  2R8H A;  1TK0 A;  4ZPD A;  1S1T A;  1MG7 A;  4MIW A;  4K0K F;  3W60 A;  3R6G B;  3CJK A;  2JJ4 D;  2AJQ A;  3S8S A;  2LYV A;  4FBT A;  1KOH A;  3OXL A;  2W2O P;  5HLF A;  1AYE A;  3HI9 A;  2I0X A;  4RKU C;  3MD3 A;  2RQ4 A;  3JXO A;  1N5T A;  4A8M P;  1IM4 A;  2W9C B;  2LEA A;  4RUA A;  1BQX A;  4OJG A;  4XO0 A;  3GMG A;  1UJ5 A;  4LF7 F;  3TI0 A;  1FHT A;  2RDI A;  5DG9 A;  4DPX A;  2VQF F;  2M8H A;  2GVZ A;  1JWW A;  2BKN A;  4G1I A;  2HRU A;  3OTC A;  2ZWP A;  1U1L A;  2FVC A;  4QW8 A;  4M5M A;  1RJJ A;  3K8V A;  4D3H A;  4NI2 B;  4YN3 B;  5D78 A;  5B7W A;  3G6Y A;  2ZE2 B;  5DS7 A;  5KOX A;  3VR1 A;  2MGZ A;  3CCT A;  2DHS A;  3NBP B;  2K2P A;  3DXB A;  3HFZ B;  4WYW A;  2NXU A;  3ITH B;  4YB1 P;  3OXG A;  1RCO B;  3GJR B;  1U1K A;  3BSA A;  4ED4 A;  1IJE B;  4U7U K;  2GGP A;  1T95 A;  1Z4U A;  3P3D A;  3CDE A;  3HVT A;  4NYP A;  2JDJ A;  2QSW A;  3D2W A;  1UFW A;  3HHL C;  2NPF A;  2RUG A;  1B7Y B;  2AZ1 A;  3H40 A;  2L41 A;  2RKI B;  2G4B A;  1H2V Z;  1M5K C;  3JAM U;  3BGO P;  3I0S A;  1NBE B;  1RT6 B;  1PG5 B;  3IGN A;  4KB7 A;  5E2Q A;  2GFF A;  3MEC A;  2KVI A;  1HBN A;  3Q86 A;  3VGV A;  3T19 A;  4XPC A;  3SXL A;  3MEE B;  1SVD A;  4WXO A;  3Q8Q B;  2HZV A;  5HVH A;  4IOB A;  4CP5 A;  3IAM 9;  4M5D A;  4UUX A;  3B82 A;  1FJE B;  2C2N A;  3KJF B;  5KT3 A;  4DDF A;  2ASY A;  2DKO B;  4QIE A;  1WJ9 A;  3HJV A;  5G0R B;  3DLH A;  2D3O 1;  1YKW A;  3GCW P;  2FZK B;  5I3U A;  3CDA A;  4MKB A;  2HGN A;  3PNI A;  3PX6 A;  4CDI A;  1LWF B;  2QX0 A;  3G82 B;  1Y3K A;  5D4P A;  1TUW A;  2HAF A;  5LSR A;  4DL5 A;  2CZ9 A;  3OSN A;  3SI8 A;  4PQU A;  1Y00 A;  4JI0 F;  2CQC A;  1M5V C;  2GC8 A;  2GHV C;  1HWJ A;  4HH0 A;  4ECT A;  4O44 A;  5D0R A;  3HK2 A;  3BDP A;  4RW6 B;  2XBP A;  1DTQ A;  4DPT A;  4RBV A;  3MUT P;  3RB6 A;  4ED0 A;  2UUB F;  2RRB A;  5GAG I;  2YNF B;  2BDP A;  3FSX A;  4KPC A;  3J7A 1;  2XMV A;  4DX8 H;  4RNM A;  4WP9 A;  2K1R B;  2YQ1 A;  4B9V A;  4ZCK A;  3HZE A;  4QPX A;  2DNQ A;  2DK2 A;  5ETR A;  5DDQ C;  4AQY J;  2R7V A;  5AT1 B;  2NS1 B;  3E01 A;  1L3U A;  2OEL A;  1FTR A;  5THW A;  3GCX P;  1CBK A;  2DJW A;  1HYS B;  1BHN A;  2PI4 A;  2QLX A;  1G2E A;  3GFZ A;  1TKX A;  4RW9 B;  4LVN P;  2XZT B;  5HK4 A;  3RZA A;  2M8D B;  1NDC A;  3TZW A;  1K1Q A;  2HVE A;  2VPZ B;  4K4X A;  4JB8 B;  4OYO A;  4YB5 A;  3LP2 B;  4Z2X A;  1I3O B;  3FFI A;  3NOC A;  1U0H A;  1QJH A;  1P8G A;  2KFY A;  3HDS A;  4CTA A;  4B3R F;  2OPQ A;  2FHO B;  1XNQ F;  1WOP A;  2Y3Y A;  4QIW D;  9ATC B;  3CMQ A;  1KRP A;  1V6H A;  4OI4 A;  2W2Q P;  2W4P A;  4HR2 A;  1R8B A;  4G1P A;  2MXY A;  5C2G A;  1SQE A;  4DV2 F;  2E5G A;  3M2V B;  1X5T A;  1YIJ S;  2VFU A;  3CE8 A;  2HWI A;  3KLE B;  3OBI A;  2IJF A;  1S9F A;  4A8F A;  1TKT A;  2CJY B;  2DNK A;  2H48 B;  3GFY A;  2PC6 A;  4JI4 F;  5DRK A;  2HMI A;  2B4U A;  1T3N A;  4FVC A;  2P9G A;  1JXE A;  2KXN B;  5IZH A;  1VQ4 S;  2M7S A;  4P73 A;  3ZZR A;  3LP1 B;  5A8R A;  1DAX A;  1UVL A;  1D9D A;  3UDL A;  1XR5 A;  2CPJ A;  2RUS A;  4KO0 B;  2MPU A;  4ERD A;  4KGK A;  5HQM A;  1HR0 J;  3NG8 A;  3MM5 A;  4P52 A;  1F9F A;  1RT2 B;  3U1N A;  2EFV A;  4ECS A;  3T9N A;  5AJ3 J;  2VG6 A;  3BM7 A;  5KG2 A;  2EFP A;  2ROP A;  2PGC A;  2R7R A;  2FHJ A;  4IYQ A;  4CRJ A;  1AXQ A;  4LT6 A;  3SCK E;  2J0S D;  4KKO B;  4S0M A;  4KY3 A;  1KWM A;  4R5P B;  3PYE A;  1Y7P A;  3O6Q A;  2W8K A;  3CC7 S;  1CJU A;  1UMJ A;  2YH0 A;  4AL6 A;  3GSD A;  5D3G B;  1HNV B;  3MF5 A;  3UWT A;  4K4Y A;  4TU8 A;  1YJW S;  4OYA A;  4CT9 A;  1XQI A;  2DPI A;  2MY7 A;  4PXC A;  2DYA A;  1VBY A;  1RWU A;  3ETO A;  2DNH A;  3D66 A;  2DGV A;  5LXY A;  1EZZ B;  3MEK A;  3FNN A;  1Z2L A;  3Q22 A;  2DO4 A;  3BGL A;  2CAJ A;  2GQ2 A;  3MUR P;  4NCA A;  2KN4 A;  4F25 A;  3D0H E;  2IAJ A;  3A3N B;  2YKM B;  3SCL E;  4E2F B;  2FZC B;  5KFW A;  3L3C A;  4HI2 A;  5AXM A;  4JI6 J;  3DLK B;  1DBD A;  4O3S A;  3M8S A;  2C2R A;  5KFL A;  4DR4 J;  5B0A A;  4HH1 A;  3J7A N;  4K8R A;  1IKW B;  2F3J A;  1DHM A;  3KLV A;  4A8O A;  3DM2 B;  2UV8 A;  1T05 B;  1RYR A;  1FDN A;  2UXB J;  4GO7 X;  4K59 A;  2MZJ A;  1U26 A;  1WKJ A;  3PJX A;  3ILJ A;  5K8O A;  5KFP A;  1Q0N A;  3WZ0 A;  3BGU A;  4P7T A;  3QSY B;  4QYZ K;  4IG0 A;  3FQK A;  3I0R A;  3HPO A;  3OFG A;  2V9W A;  2XY5 A;  4B3O B;  1RAG B;  2IRX A;  2VIH A;  3PV8 A;  1W25 A;  2ADC A;  3ILI A;  4AL5 A;  4PQA A;  5CYM A;  3M9M B;  2VOO A;  1NJY A;  2R7S A;  1D1U A;  3KG1 A;  3M8P B;  1PYS B;  1HQU B;  3KUH A;  3M8Q B;  2MQM A;  4ZVE A;  2XEX A;  2DXD A;  1I5O B;  4NLU A;  3WHI A;  2VD3 A;  2ZH9 A;  3DCA A;  2KRB A;  4LR9 A;  1R8H A;  3CJ5 A;  2VFV A;  2V4J A;  2CUY A;  3TAR A;  3EZU A;  1M0S A;  3M32 A;  2DH8 A;  3CNQ P;  1V5I B;  5AE2 A;  4JV2 A;  3G9C A;  4KV8 B;  4RUB A;  2FJB B;  4FN5 A;  2CQ4 A;  1PYO B;  4W98 A;  4ZA1 A;  5HAT A;  2NR0 A;  2PI5 A;  1J5E F;  2AJ1 A;  2MKJ A;  2ZC4 A;  2QJ3 A;  5ETS A;  1F2H A;  1AFJ A;  4OYX A;  1YBA A;  2XMJ A;  3QJJ A;  3OPK A;  3Q89 A;  4ZN3 A;  2BVZ A;  3PR5 B;  4WFA Q;  1HNI B;  1NB7 A;  3MOJ B;  5GMD A;  3MMA B;  2XWX A;  1K47 A;  2CNK B;  4HHH A;  1FFG B;  2J6S A;  1HBO B;  3K5O A;  4GC6 A;  3SEO A;  5ETL A;  3PKM A;  4URG A;  2RDD A;  2KHC A;  3UQS A;  2W7A A;  5G4D A;  2OPP A;  1SIZ A;  3GTY X;  4DV4 F;  5DZ7 A;  4UY8 5;  2JL9 A;  1AZS A;  4W4M A;  1OQ3 A;  2HQI A;  1S0N A;  2GIR A;  3FBF A;  4ZIW A;  4C4W A;  1TEL A;  4K4T A;  3UI3 A;  1X5P A;  1WDD A;  1IKY B;  2DRA A;  4J9U E;  3GIL A;  4MYT A;  1C1B A;  2NZ4 A;  3DOL B;  3BH6 B;  2JWN A;  2DH7 A;  2MST A;  3F44 A;  3C6U A;  4O4R A;  1TU0 B;  3ETM A;  3QRR A;  2KJV A;  4FYY B;  3MR2 A;  2DT9 A;  1FKP B;  1FRM A;  3ZZ0 A;  2Z2Z A;  1RCX B;  1NK6 A;  3G8Q A;  1WOR A;  1ZAV A;  3LW5 C;  2GIF A;  1DTT A;  1JLE B;  2HK2 A;  2XLJ A;  2RQM A;  3PX4 A;  1DJ0 A;  3CO0 P;  1OSD A;  5IT9 Y;  3M8Y A;  3KJQ B;  4W92 B;  2HVZ A;  2L9N A;  3VVT A;  1T9U A;  3CCW A;  3T5H A;  1NKB A;  3NP5 A;  2XCP A;  1QY7 A;  4MKV A;  3DC2 A;  1NEE A;  2P5V A;  4ZP8 A;  2CPD A;  3CDU A;  1SJR A;  1WDT A;  5M2R A;  1KNZ A;  1H74 A;  3DLE A;  4GKK J;  4ED2 A;  2HHV A;  1ZA2 B;  3CCJ S;  1VQP S;  3CCE S;  4GKJ F;  5F0W A;  1ZS6 A;  1YIT S;  1VQS A;  3UDC A;  1WI6 A;  2FVR A;  3HFK A;  3Q8R B;  4HDG A;  4WZM A;  1RT1 A;  3D6F B;  2DR9 A;  1HI1 A;  3VGT A;  4XPE A;  2JEG A;  4BHQ A;  5HO4 A;  2KT2 A;  5HMZ A;  2BQR A;  1GFW B;  1X9M A;  4HEA 9;  1K44 A;  2BX6 A;  4DSK A;  1RT5 A;  5EUH A;  4LRE A;  4OJH A;  4CLU A;  2OGU A;  3ADA C;  1TV6 B;  3K17 A;  4EZ9 A;  2ROG A;  3ZFV A;  2M70 A;  5LXR A;  4ZPV R;  4HL9 A;  2MKS A;  1YLX A;  2ZJQ Q;  3CD7 A;  1UEU A;  1B0P A;  1RYS A;  3FCH A;  1LEO A;  4JV5 J;  2QSF A;  2MQP A;  1HD0 A;  4DPW A;  4A8Y A;  4ANE A;  4OYP A;  5KFA A;  4TY9 A;  3K5M A;  3R7N B;  2OMO A;  3HHL D;  1S6O A;  3P6Y C;  3B4M A;  2YNI A;  1FE0 A;  4JI8 F;  4RR5 A;  2RHQ B;  2YKN A;  1RWV B;  2J9D E;  1RHQ B;  4LSL B;  3SQG A;  5H9E J;  3HX9 A;  1WKL A;  2PA8 D;  4ILL A;  1FJ7 A;  5L9X A;  3RRG A;  4ILR A;  1XBW A;  5AXK A;  2QMU B;  1OY9 A;  1LW2 B;  3GIJ A;  4H54 A;  3HT3 A;  4PCQ A;  2CPF A;  4DPO A;  1MRO B;  2YBV A;  3KK1 B;  1DUR A;  4RNN A;  1S4E A;  8AT1 B;  1RU1 A;  2FLP A;  3NCQ A;  3FUY A;  2EWH A;  4F2R A;  1JX4 A;  1HNW F;  4WWS A;  3NNH A;  3GPA A;  3LGH A;  3Q8P B;  4KTQ A;  1RLD A;  3VHQ A;  2CNO B;  2XG8 A;  2VG7 A;  1Q5V A;  2Q3P A;  2UP1 A;  2OSR A;  4Q45 A;  2BKO A;  1DQA A;  1S9G B;  2GX8 A;  3ZNJ 1;  1Q7L B;  2JLF A;  1LNQ A;  1VQ7 S;  2AYB A;  4Z37 A;  1UEK A;  2DGX A;  1N34 F;  2HBQ B;  1MNE A;  4EBE A;  4K5S A;  2QL9 B;  2GZO A;  4ED3 A;  5HJY A;  1SIW B;  3J81 j;  2ASL A;  1JLG B;  2EXU A;  3FMW A;  3KWM A;  4WFX A;  3QZ7 A;  2FQQ B;  4I7F B;  2P6S A;  5D0G A;  2FPH X;  3DGP A;  2R8J A;  4ES1 A;  1R7I A;  4PXB A;  1IBC B;  2IM1 A;  4DR7 J;  1KTQ A;  3TJA A;  3BBB A;  4P2X A;  3EE3 A;  1HMV B;  1UWB B;  4K4V A;  4Y6I A;  2CQ1 A;  3BR9 A;  3RYL A;  2QFJ A;  2WW4 A;  4R0E A;  3RB3 A;  2YWH A;  4ZPW R;  4B3T J;  1NXI A;  2F8H A;  4OL8 A;  1HA1 A;  4Q0B A;  3IRX B;  3TA2 A;  5D15 A;  1V9O A;  4FP9 A;  2OUG A;  4G65 A;  3AOD A;  3KHR A;  4F4W A;  4DFK A;  4FF1 A;  5KT6 A;  4P71 A;  4C3L A;  3THP A;  2CPX A;  2OEK A;  1HW9 A;  3CJ4 A;  2KFN A;  4NLQ A;  3H4D A;  3A8I A;  4LF9 F;  4TN2 A;  4DF8 A;  2V67 A;  4DQP A;  1HQE B;  4Q43 A;  1QTN B;  2IHR 1;  2V2V A;  2GHP A;  3PKY A;  3OLB A;  4QIG A;  2IVF B;  4JI2 F;  4WP3 A;  1A0O B;  3K0J A;  8ATC B;  5KG7 A;  5H9F K;  4NOH A;  1F1B B;  2QGF B;  3I5B A;  1U02 A;  2KT5 A;  2DNR A;  4WTO B;  1EQ0 A;  5KFO A;  3B8H A;  1U0S A;  1XR7 A;  4ZIT A;  3LAL A;  3PO5 A;  1U1N A;  4B9M A;  5DGB A;  5KT5 A;  4O3N A;  1ZA1 B;  3QAE A;  1X8D A;  2VPW B;  2H51 B;  3P96 A;  3ULH A;  3WIU A;  1TQL A;  1J2V A;  1PIE A;  3K89 A;  2H5J B;  3S1T A;  3MCO A;  4N8N A;  2VKR A;  1S1W B;  1YJR A;  2FJD B;  3P49 B;  4OX9 J;  3MM6 A;  4QR1 A;  3QWP A;  4EWT A;  1VHI A;  3SYZ A;  4U9R A;  2DRB A;  1NHU A;  4YB7 A;  4LSN A;  3IP0 A;  3PVX A;  3KK2 A;  3KJV B;  1UFL A;  3UN3 A;  1LWE B;  3FEZ A;  4ALZ A;  2GMH A;  3T6J A;  1C4A A;  2N3L A;  1PSD A;  2DHH A;  2WB4 A;  1IN0 A;  4DZD A;  3IBW A;  3BO2 A;  4U96 A;  3N9U C;  2W24 A;  2MJN A;  1R8C A;  2FDN A;  2WOM B;  1JLF A;  4H4K A;  1N4L A;  2C42 A;  1RAC B;  4V1A k;  2JEJ A;  2WRM A;  3SMZ A;  2UV8 G;  3A8E A;  3HZG A;  4TLQ A;  2CQD A;  1R89 A;  5DET A;  1OMS A;  1ZM2 A;  1J5E J;  1ZM3 A;  3W1Y C;  2HND A;  1SJQ A;  1UWA A;  4F36 A;  1EET A;  3I6P A;  4PWW A;  6FD1 A;  2VBY A;  1P27 B;  1WG4 A;  5FD1 A;  2ASJ A;  4O4G B;  2RH3 A;  4HLB A;  3CIM A;  3CJR A;  2HS4 A;  5E33 A;  3UR0 A;  1L3T A;  2MY8 A;  4QOT A;  3QLH B;  4J9V A;  2VBZ A;  4CWB A;  3I96 A;  3RAQ A;  2AT1 B;  3L9Z A;  2BOP A;  2EW9 A;  1F5C A;  2CPY A;  1IQT A;  3LAN A;  4RLE A;  5CZX A;  3BGR A;  3G4S S;  1N5Y A;  1CC8 A;  3ZZU A;  2PA3 A;  1YI2 S;  1WEZ A;  4Z7Y A;  2VF3 A;  1KHV A;  4TU9 A;  4DR6 F;  1S1U A;  2WVB A;  3BSN A;  3PW7 A;  3AH6 A;  4QYZ J;  5BYR A;  4DCP B;  4EU0 A;  2ZOG A;  2HFZ A;  2XUL A;  2GJF A;  2QO3 A;  2YQ3 A;  3BQ2 A;  3HSJ A;  2AYE A;  3ISN D;  3RW7 A;  1TL4 A;  3MTK A;  2WSE C;  5KG5 A;  2BJ1 A;  2ALZ A;  4H4O A;  3QYY A;  3EXC X;  3DRS A;  2P9E A;  4N41 A;  4FNH A;  2EFN A;  2F40 A;  1VQY A;  1K0V A;  3EGV A;  4ZMM A;  4C3M A;  4CLY A;  2WSF C;  2Z2L A;  2YH1 A;  3KLG B;  3D68 A;  4NLS A;  1HNZ F;  4HVZ A;  3UVJ A;  1Z1Z A;  4TU7 A;  4EEY A;  2F8E X;  1LWC B;  3NS6 A;  4CM0 A;  3RJM B;  2HPU A;  3JTP A;  4ZJO A;  3QQC D;  3HD2 A;  3MR3 A;  3J7Z 5;  3DDN A;  3R5D A;  5DM6 Q;  1IWG A;  1YZ6 A;  1ZM4 A;  1N56 A;  2Q66 A;  3OTD A;  1PGZ A;  5F3Z A;  1SL0 A;  2Z57 B;  3R97 A;  4GVB A;  2XWY A;  3D6M B;  4M1K A;  5K8M A;  2PSZ A;  3H98 A;  4OLO A;  1X60 A;  4CYU B;  4F7V A;  1VQ6 S;  4DV1 J;  2LQJ A;  2NPI A;  1FWK A;  1X4E A;  1ZZN A;  3V6H A;  4ZLN A;  2B43 A;  2FLN A;  4QYR A;  3LUY A;  1LXN A;  2O3D A;  2IM0 A;  1NM2 A;  3IWX A;  1TL1 A;  2ZKU A;  1VOM A;  3LTO A;  3BBC A;  4F8R A;  2FJA B;  3R6L B;  4NPO A;  3SDE B;  5ETT A;  3KLF A;  2IC3 B;  1B3T A;  1IKV A;  1RDR A;  2CQG A;  4B9L A;  2DY9 A;  2ZD1 B;  2XO7 A;  4OHY A;  3OL7 A;  5CYQ A;  4C11 B;  2R7T A;  2CDQ A;  2V34 A;  3UD4 P;  3ZTP A;  2MYF A;  2WBR A;  2R7Q A;  2H4Y B;  1RT3 A;  3M6X A;  3QO9 B;  3DOK B;  2F4F A;  3T5J A;  1JIH A;  2W2P P;  3QNW B;  2AKW B;  4ED6 A;  1GTE A;  3CUL A;  2D69 A;  3KLI A;  5C7P A;  1Q8I A;  1K73 T;  2CVI A;  3PIP Q;  1HL6 A;  1V3S A;  5LJ5 Y;  2MTL A;  1VR6 A;  1QE1 B;  5CXT A;  3MUV P;  4JV0 A;  3B78 A;  1YBU A;  4NWB A;  2QA4 S;  2X1A A;  2HVH A;  4V19 X;  2Y8Y A;  4P72 A;  3PO4 A;  1RAH B;  3TZZ A;  4X4P A;  4HI1 A;  3OFH A;  2E1C A;  4LIR A;  5K14 A;  1MW7 A;  2DEJ A;  3CD6 S;  2FY1 A;  2PMW A;  1U1P A;  5J2N B;  5I42 B;  2XO6 A;  2NXN A;  1TKZ B;  2N3O A;  3OVA A;  1JNR B;  2E9Z A;  4IO9 Q;  1TL3 B;  1N34 J;  3IR7 B;  5IXU A;  1F5B A;  3OFE A;  3TAM A;  1URN A;  2UU9 F;  2MZS A;  2B3T B;  5KFM A;  5B0C A;  3DRX A;  4WXW A;  3FRZ A;  4X64 J;  1NDK A;  4QWA A;  2QL7 B;  3W9H A;  3MM8 A;  3X3U A;  4X4O A;  2VFR A;  4KIA A;  2C2E A;  3BKF A;  1TR0 A;  4YDD B;  1HQ2 A;  4YB6 A;  3A8K A;  2AX1 A;  4K2X A;  4JUZ A;  2ZH5 A;  1IBM F;  1A9N B;  3X1L B;  4MIB A;  3H5S A;  1S1T B;  1VBK A;  1R0C B;  2MLZ A;  2PDA A;  5M2U A;  3CJK B;  1JJ2 R;  2FLO A;  5HLF B;  2BXJ A;  2B8Q A;  1S97 A;  1IWA A;  3D3B J;  1VCT A;  4LF9 J;  2QRR A;  1VFJ A;  2K8G A;  4NLR A;  4DU8 A;  4BC7 A;  1U4B A;  2BJD A;  1WC0 A;  3JSY A;  2ZBQ A;  5L39 A;  4YR0 A;  2VU5 A;  3VQS A;  1FKO A;  2GVZ B;  3KFW X;  3GIR A;  2Y1R I;  5D4O A;  4JI2 J;  3AQP A;  1QVF R;  3ZZY A;  4NA2 A;  4ZP7 A;  1T9X A;  2VC0 A;  4JI5 J;  3WX4 A;  2DCU B;  3W5X A;  4RJV A;  2MGZ B;  4CCH A;  2HBZ B;  2HQF A;  5CAA A;  3F0N A;  3V81 A;  4PRF A;  5DG7 A;  2G0C A;  3GG0 A;  1RAJ A;  2GO9 A;  1HAR A;  2HWT A;  1VQ8 S;  2DD8 S;  2GGP B;  3HVT B;  2GVD B;  5IQQ A;  2GMJ A;  2DR5 A;  3KLH A;  3WC2 A;  1XMQ F;  2DNO A;  4OQJ A;  1HWK A;  3DYA A;  2KG1 A;  2DNP A;  4UTG A;  2JLE A;  3I0S B;  2ZJR Q;  3D4J A;  2RE1 A;  3MEC B;  4X4T A;  3AOB A;  3HSG A;  1HBN B;  1MN7 A;  3JB9 k;  3N6M A;  2I1R A;  3UDE A;  2OJ3 A;  4AYB D;  4F3Q A;  2YX4 A;  2Y8W A;  5ETK A;  2CJA A;  2B9E A;  2H65 B;  4GC7 A;  1XTZ A;  4M5D B;  3CW2 C;  4AE5 A;  3AB2 B;  2AGO A;  1CSJ A;  1L3S A;  2RS8 A;  5E3P A;  2E5L F;  2EFO A;  4TLR A;  2GHW A;  3KOA A;  3PR4 A;  3RR8 A;  4WFN Q;  1CUL A;  5H1S V;  2KZM A;  1CS4 A;  3UNG C;  3TRG A;  5I3U B;  1Z2Z A;  5KFQ A;  1KBR A;  2BE2 A;  4DV0 F;  4XK8 C;  2MB0 B;  2F4V F;  4FKY A;  2I8E A;  1FDB A;  4B9N A;  3OW2 R;  4URS A;  1R3N A;  3MOZ A;  2RSQ A;  3SFU A;  2MKC A;  4LRB A;  3Q2S C;  2ZNY A;  4PQU B;  1NH8 A;  2LU2 A;  4WZQ A;  3NGS A;  3K2Y A;  4O44 B;  3TX8 A;  2FYX A;  1H2U X;  1DTQ B;  1JLB A;  2VBW A;  4DL4 A;  2ADB A;  4AUK A;  3M30 B;  4FXW A;  2CYY A;  3N6L A;  3R5A A;  2KFZ A;  3H42 A;  2R2U A;  4F3O A;  4CLK A;  4J9S A;  4DU7 A;  3GII A;  5JJB A;  5DDO C;  2KHD A;  2V8H A;  2HQD A;  4LRA A;  4Q8E A;  3D28 A;  3E01 B;  3PEH A;  4PG6 A;  4DR6 J; 
#chains in the Genus database with same CATH homology
 2A6M A;  2XQC A;  2FYX A;  2XM3 A;  2A6O A;  2EC2 A;  2XMA A;  2VJV A;  2VIC A;  2VJU A;  4ER8 A;  2XO6 A;  2VIH A;  2F5G A;  2VHG A;  2F4F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...