2XM3A

Deinococcus radiodurans isdra2 transposase left end dna complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
126
structure length
126
Chain Sequence
EMKKGRGYVYQLEYHLIWCVKYRHQVLVGEVADGLKDILRDIAAQNGLEVITMEVMPDHVHLLLSATPQQAIPDFVKALKGASARRMFVAYPQLKEKLWGGNLWNPSYCILTVSENTRAQIQKYIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSPOSASE
publication title DNA Recognition and the Precleavage State During Single-Stranded DNA Transposition in D. Radiodurans.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Dna binding protein/dna
total genus 29
structure length 126
sequence length 126
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01797 Y1_Tnp Transposase IS200 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1290 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Transposase IS200-like 2xm3A00
2A6OA 2XQCA 2A6MA 2XMAA 2VHGA 2VIHA 2VJVA 2XO6A 2VJUA 2FYXA 2F5GA 2F4FA 2XM3A 4ER8A 2VICA 2EC2A
chains in the Genus database with same CATH superfamily
2HRUA 3KNAA 3J7Z5 3DYAA 3H4BA 3DXSX 3BJYA 5K14B 3CJ2A 3Q8YA 4R0JA 1DHMA 2OI2A 3QJJA 1X4AA 1B0TA 3M2UB 1S4FA 3A8JA 5DJBA 5IC4B 3PNIA 1F3VA 4F67A 2OSRA 1TV6B 4J9KA 5EWFA 4ZPWR 2FYXA 1JJCB 1HI8A 1VQKS 3HM9A 3W5XA 1LOUA 2DPJA 4J9VA 1WC4A 1LWEA 1QTNB 1C4CA 1S6PA 1VBYA 1SJFA 5L39A 4ED2A 4FYDA 1XIQA 1SI9A 4LSLA 1CJKB 1JLCB 2YKMA 4OFZA 4MMOA 5G0RB 2GAGC 4I0WA 4NLSA 2BQRA 3D3CJ 3CB4A 3KG4A 2R7QA 1HHTP 2VG5A 4WP9A 2BM1A 3H98A 2XYGB 2L9WA 4MK9A 3TW0A 1O6XA 2LXUA 2LECA 1SC3B 4LF1A 3G96A 1S6QA 4EK2A 2LU2A 5A6PA 1FXRA 3NOGA 2QFJA 1D9FA 4CLKA 4X4SA 1S97A 2MQNA 3R3TA 5DGAA 1NSQA 2P8IA 4CDIA 2FJDB 3Q0AA 2UXCF 2IRUA 2FVCA 3BR9A 2I9SA 1IVZA 3KTQA 3AA8A 2V8DA 1U8SA 1J27A 1JLGA 1PILA 2BVZA 3GCWP 4JI3J 1Q7LB 4ZP9A 1SL2A 5IQQA 3H59A 2Y9HA 3JYTA 2CQBA 1DRZA 3DOMA 2N7CA 3MMCB 2R7WA 1Y11A 4DV3F 1XR5A 1ZZNA 1Y9OA 4AFFA 3UO0A 3G6VA 5CCMA 2PMHA 4DR3J 1FD8A 5H9EJ 4WF9Q 3NWRA 4RW8B 2FLNA 1AFIA 4MTPA 3F56A 3RAMA 1AZSB 4B3OB 3EXCX 5IWAF 3A8KA 3DU6A 4O4RA 3CJQA 3J7YI 3JAMY 2UUAF 4DR4J 1EKSA 3IG1A 2LDIA 4C11A 2MLXA 3TR5A 4ZVGA 2B4VA 2B4OA 3W5ZA 4C8YA 1Q8LA 3TX8A 2KXFA 4FF1A 3D6MB 3MUTP 3GPAA 4RLEA 2KH9A 5C42A 3B82A 2NXCA 1SJQA 2QE5A 3QO9B 2RUSA 3T9ZA 1TKTB 2NXNA 2NZCA 3VQSA 3A8IA 2BQUA 2Z4PA 4Q8EA 2DCUB 3ISNC 1K1QA 3MMBB 1N33J 1OY6A 4RW6B 4A8WA 4CNYA 2ZWOA 4G1QA 2WBMA 3HHLB 1A0OB 1CJTB 5IZHA 4MAKA 3VZIA 2XMAA 1Q7YT 3RYLA 4UOFA 4N41A 4OL8A 4N56A 3UD4P 4P7VA 3PDNA 4I1TA 5ETLA 2XY5A 1CQNA 3DDKA 1SH3A 1R0BG 2HWIA 3MMJA 4I68A 4UUXA 3DLKA 4TY8B 3I5CA 1FVSA 4IDKB 2RAQA 2K3KA 1JLQA 1WC6A 1S10A 1WHWA 5HMYA 1N8RT 4URSA 2A0FB 5DZ7A 5ETVA 3LW5C 2NXUA 3OUYB 2DYAA 4FBTA 4BLGA 2IM3A 1Y00A 2GNKA 4CH1A 4RUAA 1T9XA 3HVAA 1YZ6A 4EZ9A 1ZBTA 3I56S 1TQLA 3JSMA 4NL5A 4AUKA 4N47A 2ZHOA 4HT7A 5IQ6A 1S48A 1TKZB 3JXOA 4W90B 1JKHB 4I6YA 1IKYA 2WVEA 3FSYA 4KFBB 1X9WA 2OPQB 2V2QA 4YY3J 2VPXB 3T5KA 4B3SJ 2WVBA 1UPPA 1HNWJ 3M8QA 4ED0A 2DNNA 4BBYA 4DPTA 4ZVFA 2Y8WA 1HBMB 4Y2CA 3CSKA 1S9GB 1JLAA 2V94A 3VV2B 5A8WB 2PD1A 1Q86T 1SQFA 3QT8A 4K4YA 3QWUA 1KP6A 4LF4J 3O3LA 2ASJA 5LXRA 4DR2J 2HZVA 2BOPA 3LGNA 4PQUA 1HARA 1QAIA 1QVFR 5E3CA 1VYAA 5KFAA 3H8YA 3VAGA 2IBOA 4PPDA 5GMDA 2HFUA 1OY8A 3AH6A 2WVDA 5F3TA 1SCJB 5KOXA 3AD7C 4UY8T 2FHOB 3DRXA 3O44A 3SQOP 1MROA 1T03B 3SCLE 3B4DA 3DRSA 1B7YB 3D4JA 2B9YA 3PX0A 4ID5A 1HQ2A 1VQ7S 5ETSA 5ETNA 2HQ3A 1NSAA 1FTCA 4I6AA 3NL0A 4DV5F 3M8YA 4Y0FA 3PX6A 1A7GE 2A18A 3JAMU 2XWXA 1FEHA 3SV4A 2GHWA 1VRUA 2W2OP 3E01A 1SKSA 3BSNA 1M5SA 3AD8C 4AD6A 3NY0A 1VIOA 4LF7F 2G2OA 1MG7A 4CYUB 4QYRA 3OL9A 1M1GA 3SQGB 3HJVA 2VG7A 5KFIA 3HF5A 4CM0A 3T1YJ 2MXYA 4J9UE 2A3JA 4G1PA 4CCHA 3T1HF 4ZCLA 3A3PB 3TUZC 2OD6A 3G86A 2IMWP 3MEKA 3K17A 4LJMA 2E7WA 2MJNA 2ABYA 1JLBB 1U1OA 2W2MP 1E6VA 5J2QB 3G6YA 3M8PA 4Y00A 2IAJB 3TA1A 3Q8RB 1X0FA 1FHTA 2DNMA 4I69A 4ZPBA 2CZVC 2M5YA 4YDDB 2N82B 3U27A 1C2PA 4NRUA 2MQMA 1HYSA 1VBXA 3FMBA 4P73A 2Z2LA 1BQNB 3D1HA 2K2PA 4LFCF 3MXHP 3SDEA 1XERA 4DL3A 5HMXA 3CEDA 3T6BA 1APSA 1YJNS 1IKXB 4RW9B 3H42A 4DDFA 3FVYA 1NJXA 3ULHA 2CWKA 2CPYA 3PEJA 1YQHA 2V63A 3THTA 1V5IB 4DSFA 5KG6A 5T14A 3QJLA 3TZWA 2UVUA 3GQCA 4NLOA 2HFNA 1HWUA 2OPSA 4N8OA 5A8RA 2WSEC 1DQ9A 3K59A 3VGUA 4MIAA 4FKXA 5B08A 3MTKA 3AOAA 4PG4A 4ZVHA 3EWGA 2GIRA 1WC1A 2O1PA 5FJ4A 4ZK7M 2XB2D 4TYAA 3TJAA 3JTOA 3KLHA 1MU2A 2G9OA 4WZQA 4JI1F 2F9DA 3TUIC 5D78A 1BMQB 5AE3A 4NI2B 5DGBA 3HSGA 4Q44A 1VRQC 1FERA 4YB5A 2GMLA 4DLEA 3DOKA 1MW7A 3HSJA 2V8GA 1FDNA 1ZM3A 4AXIA 5GADU 3KUGA 1VQNS 3MAAA 4DQIA 3D5MA 4B9UA 2QL5B 3GCXP 2F63A 2VOPA 2L3MA 2VICA 5A2QY 1FA0A 3FFIA 3VHQA 3I6PA 1TL3B 2BJ1A 4RUBA 4R5PA 3MM6B 1VQOS 1PYSB 3M30A 1X4FA 2G2YA 1BHNA 1S1VB 3UW1A 1ZM9A 4WFYA 2HQFA 3NCRA 2J8AA 1XNRJ 1I6JA 4WIIA 3B54A 3OFGA 2DXFA 1SL1A 1L3TA 2HVEA 5AE1A 2XM3A 1S1WB 1OYEA 2ZM6F 1PKUA 4NPOA 5K14A 4C48A 5J2MB 1RAOA 3AD9C 3J80Y 3GYNA 5LT5A 3M2UA 1YSJA 1NK0A 2HEKA 2ZOGA 3R5JB 4DX6A 1IUJA 4IFYB 1SJRA 1V3ZA 2X3GA 1QTMA 1TV6A 2D3OR 3IBCB 4HL9A 2E9RX 1WOSA 2MZSA 2C2RA 2KDOA 3HMJG 2OMOA 4USJC 1QD1A 2VQEJ 4DR7F 3PKMA 2UVRA 3SEOA 1DQAA 5J2NB 5I42B 3HHNB 4G6VB 3VAMA 3IN5A 2OPPB 1YJTA 1CJKA 1JLCA 2E7XA 3PFOA 3MD3A 4EU0A 5G0RA 2NYIA 2RRNA 4LF9F 1Q5YA 3FBEA 5HROB 4P72A 4NZ0A 5LMNF 2KHDA 2CQ0A 3AODA 5KT4A 1T9YA 4ID8A 4J9QA 2G0CA 5ITHA 5CYMB 2J0XA 3BREA 2LKZA 1QAXA 1JNZB 2W7OA 3ZNJ1 2VUGA 4ZVPB 3BGUA 2HS3A 1TFYA 7FDRA 7FD1A 1HBNB 3GWCA 2YKQA 3SYZA 1RWVB 3T9NA 1VQYA 1D3WA 4DUTA 2QN6B 4ANEA 4LBPA 5K8PA 5DDOC 2PEHA 4PABA 3UFCX 1P9YA 5J1EB 4V19X 3ZTQA 4B3RF 4WU2A 4J37A 2Q6BA 3D9BA 3D6HB 3I55S 1HW8A 5HJXA 1GTHA 3W65A 4ZA1A 1RWXB 4IH5A 3KOAA 3CIZA 1PC4A 4CT8A 4LRCA 2I6WA 5E33A 2XQCA 4C97A 3MMCA 1WF1A 3T3FA 4F50A 3HJFA 1UKUA 3OQ2A 2XMMA 4HHHA 4AE5A 4RW8A 2EFQA 4DL2A 1DTTB 1OQ3A 3VQTA 4FP9A 1AZSA 2CZ4A 2K1RB 2PI4A 5L9XA 5DQIA 4ZJOA 1EKRA 4U7CA 3P4UB 2Y3YA 3N01A 4B3OA 1AT1B 4X66J 5H9EK 1FWKA 2CJXB 1ZM2A 4CIOA 2FHMA 4NLGA 5BR8F 2F40A 2ADBA 3FZ2A 3RR8A 3FGVA 2E29A 1NMEB 3HHEA 2PFDA 4F0KA 2M9KA 3F41A 2E5JA 4WFZA 2AGPA 4CP5A 3RB0A 3BF4A 2RF2B 1N34F 3HHLD 3QO9A 3MFIA 1HHSA 2IBKA 1TKTA 3MCSA 3NP5A 1M5KC 4F36A 3KLGB 2DJWA 4OX7A 1IBCB 3MMBA 2RMLA 4RW6A 5DQHA 1CS4B 3UDLA 3HHLA 1CJTA 4LSNB 4JI4F 3HKWA 2FB0A 2V4JB 5LMUF 3I96A 1HQEB 3EVOA 3V6HA 4BCAA 2DHXA 4NWBA 4P2SA 2J0SD 3V81A 1F3FA 4ZVQB 2RDJA 4ZVEA 4P9SA 1AA1B 4USMA 5IT4A 3J80U 2KRBA 1YIJS 2CQHA 1HNVB 2J7WA 4TY8A 4IDKA 4PG6A 2P9GA 2QA2A 2IMOA 2ZD1B 3C3LA 2RUGA 3KG1A 3ZFVA 2KHCA 2MEWA 2CPDA 1S6OA 1FRXA 1U1RA 4CLPA 1RTIB 3OUYA 3EM1A 5HAOA 1N0VC 4YDXA 3HX9A 3TZZA 4NOHA 2MKJA 4NCBA 2DTJA 3PVXA 4HR2A 5HSPA 2BJDA 1KR4A 3H25A 4UZCA 4HYKA 2R4FA 4KR0B 1TKZA 2C3UA 5KFQA 4IFVB 1JKHA 3QAEA 3HVTB 2IYGA 3CULA 1NDPA 2IFXA 5AE2A 4KFBA 2R2UA 2HHHJ 2ZH5A 4OV1A 2OPQA 3LQVA 2Q66A 2AYEA 2WB1D 2C2KB 1SQGA 4AYBD 4YS2A 3PM9A 4FZVA 2HVIA 1HBMA 1S9GA 1EETB 3NGUA 4RW4B 4QWBA 5A8WA 3IXQA 1FDBA 3ITHB 3C6UB 3GILA 1HMVB 2EFNA 2KU7A 4OLOA 3N0VA 3KDOA 2XO6A 2F8HA 5KG4A 2FJWA 1SKUB 4PEOA 2EVZA 4CLUA 2OH2A 2UUTA 3U02A 5K20B 2OLWA 2LFVA 3G8QA 2QSFA 2MZJA 4ZCIA 2QYCA 1X5PA 2K06A 2HQCA 5D0GA 3KHHA 3B4MA 4IG3B 2MZQA 4DHVA 3UNGC 1HBOB 1ITPA 3K57A 3PO5A 3W60A 3EYZA 1N32J 2ZUGA 2XMTA 1X4EA 1JJ2R 3U1LA 3UWTA 2V2ZA 3R1LA 1T03A 2ZJQQ 3KJFB 3OLAA 1UZDA 4ECWA 4L3NA 5FD1A 2IPOB 4QR0A 2RU3A 3RW6A 4U7UK 3BM7A 1FRMA 1KTVA 4FS1A 5DG8A 1K1SA 4ZN3A 1YJ7A 4LFAJ 2OIHA 1I5OB 4Y34A 3AB2B 2ZVIA 3BBCA 3H90A 3WX8A 2FDNA 3V4IB 3CDWA 5BYSA 4DUYJ 1RHUB 2CQCA 2HFZA 4LBIA 1S7HA 4Z37A 1NHUA 5HANA 1RJJA 3OBIA 1IKWB 5DETA 4CYUA 3KJQB 2E1MC 1O5JA 1RB0A 4DR4F 1DARA 4G1IA 3H7HB 2DHSA 2VPWB 3SQGA 1N54B 1EIYB 2YWEA 1G2EA 3W66A 5BYQA 2M8DB 1JLBA 3FMWA 3OW2R 4KH1B 2OSQA 2RRBA 3EUNA 5J2QA 2DNRA 4OZ0A 1WG5A 2IAJA 3MCNA 3IAM9 1CVJA 3ILIA 4GO5X 1RT7B 1QJHA 3RU0A 2NXEA 4PXDA 3NWGA 2QC3A 1RTHB 4DSEA 1BQNA 2PFFB 4CTAB 2BJ3A 5IXUA 1T3NA 2EFOA 5H1SV 2ZH9A 1IKXA 3VAKA 1VQ6S 4RW9A 4MJKA 1RAAB 2HKEA 4RNMA 2EWHA 3QRQA 5KAKA 2UXDJ 4MK8A 3VTIA 2CPJA 3MEDB 3DC2A 2Y0SD 2BW2A 2D1CA 2MKKA 2N7YA 3IM9A 1NDCA 3D7SB 3HLUA 1NK4A 1S77D 5A0YB 4X2BA 1KVIA 1FT8A 2RE1A 1RKIA 1ICEB 3ZXWA 3PHEA 2B56A 5C2GA 3CCLS 3J7YU 1B99A 5KFRA 4JUZA 4Y6IA 3BV8A 4ECSA 3R2DJ 4M5NA 2FTRA 4P74A 2M3DA 2YKNB 4R8UB 1RXOB 3FBFA 4DBQA 4NI2A 2LVWA 2ZH6A 3HPOA 1GMWD 4YY3F 2XG8A 1S1UB 4B3SF 2HMIB 2HYIB 3GSIA 3HP6A 5FIIA 4OZLA 4HTIA 3QATA 3KLIB 3MEGB 2ZBPA 1GMWA 1O8BA 2VD3A 1GXLA 1LK7A 5F3ZA 3C14B 1WC5A 4MIBA 1NBEB 4RKUC 2BR0A 2YWKA 3K89A 1TTHB 2PGCA 3RGIA 3GB0A 1TL3A 4LF4F 4GC7A 4DR2F 1OSCA 3MM7B 3M9MB 2BOAA 3MM6A 4ZLNA 2V69A 2EBEA 2OELA 2Z2YB 4OZ5A 2DVIA 3D0IE 2DXDA 3DLGB 1U49A 1S1VA 1H6KX 1TMJA 3A13A 1Y3KA 2KN4A 2HQDA 1CSJA 5DG9A 3NS6A 4BDPA 2WONB 2YWWA 4FPIA 4ZVUB 2EK1A 2AIRB 3HKZD 1JLEB 3ILOA 3PW7A 1S1WA 1Y5LB 5J2MA 4USTA 1FK9B 3TVYA 1YBAA 3QZ8A 4QIEA 1UVIA 1KQGB 1LFWA 4AQYJ 1UEVA 2GZOA 5KT7A 2HHQA 2J9DE 2R8JA 1RUSA 4IFYA 2RQ4A 4NZ6A 3W63A 1UEKA 4DX5A 3LA0A 1RT2B 1DURA 2RU9A 5HVFA 2R7TA 1U48A 2NPFA 3CJ5A 1XBWA 2PE8A 1RAEB 3LF0A 2DCLA 3K8VA 5J2NA 5I42A 2YNFB 4J9SA 2OPPA 1SH0A 2DPIA 4WJBA 5CH7B 1PGZA 3I9ZA 5CA5A 3B78A 3WIUA 1FFWB 3D6TB 2KG0A 2YKOA 3T1YF 1UJ4A 4NXMJ 5HROA 1Q5VA 4RX6A 2LA4A 4QYZJ 5KFKA 4C9DA 4QWEA 2KJWA 3CCES 5LJ5Y 3VF0B 1FJ7A 5CYMA 1BWEA 4DR5J 3BN7A 2DHHA 2VBZA 2DRDA 4M5JA 3LGHA 1TUVA 3OR2B 4XPCA 4OIXA 1HBNA 3AB4B 4C0BA 2FC8A 2VHGA 4Y2AA 3PTWA 2E9ZA 2ASYA 1N36J 4KHMA 1UJ6A 2E7VA 1HWIA 3CD5A 1RWKB 5J1EA 2XCAA 2PA3A 3V6JA 4DQQA 2JJ4D 5RUBA 2ZHBA 4HVZA 1B0PA 2DH9A 2P2CB 7AT1B 4A8KA 4KH0B 4GVBB 1FRHA 2J7UA 1LWFB 3ISZA 1HHQA 1KQSR 2C3MA 3R2CJ 1Y4ZB 1DTTA 5HLFB 2CAJA 2C28A 3DMJB 4OV6A 3AFGA 2K1RA 2ZKTA 1X4HA 2W9BB 4OZ3A 3UI3A 4EO8A 2WAQD 1WUUA 2CG4A 5D8HB 3RW7A 5B0EA 2AMCB 5C5JA 4ILRA 1URRA 2J7KA 2LQ8A 1VQ8S 4ELVA 1RT1B 3KHLA 4B9NA 2ZBIA 3AJ1A 3WC2A 3KMQA 4ZVTB 2KFZA 1B70B 3FC9A 3QGPA 5ETKA 4ZITA 4MK7A 1NU4A 3SMZA 5B0DA 5M2RA 1EARA 1NJZA 2CRLA 1WHVA 5KFHA 2RF2A 1SQEA 4BWMA 5E3QA 2A10A 2BJ9A 4DSIA 1B0VA 4YB1P 3ZZ0A 3N4WA 4M5DB 3KLGA 4ED7A 4RBVA 3DGPB 4TU8A 3LTOA 3BKFA 1CS4A 1AUDA 4LSNA 5EX0A 2V4JA 1K73T 1HQEA 2F7VA 2GW8A 4LREA 3FK4A 4DR1F 1P9QC 3GJSB 1R8AA 1PJ6A 1NUEA 1RYRA 1XNRF 2KZMA 3EGVA 4RW7B 3RR7A 3V6DB 5JMNA 2EPIA 3L7PA 1FF2A 1WD6A 3PW5A 2IHR1 3GFZA 1S59A 5D15A 2ZD1A 4DL5A 5E2QA 4A48A 2JRSA 1CC7A 1WNEA 2PMZD 2QA4S 2ZITA 4A8SA 4DPUA 1RTIA 5KG2A 3GE9A 1FNXH 1UEUA 2G13A 3UQSA 2A2CA 1U2RA 2BE2B 3IGVA 3IRXB 3PCOB 1FJEB 2RNEA 4WP3A 4ZP7A 3CC4S 3W8GA 3DFEA 1WWHA 4KPCA 4TN2A 2HNZB 1TL4A 1TUWA 1JXLA 1SJ3P 4IFVA 2QLWA 2VG6B 2GJIA 1FJGJ 3HVTA 2VQEF 3AJDA 3DRYA 3UDCA 4DOZA 2ZC3A 2BEFA 1VRTB 3CO9A 4ZMMA 3GR1A 1VOMA 2YNHB 2ZH4A 2CQGA 4YB6A 1EETA 1ZPVA 4RW4A 1Q53A 2EKYA 4F4YA 3ITHA 3C6UA 1RABB 3QT7A 5CAAA 1HMVA 2VIHA 2WVCA 3THVA 4LF2A 3ADAC 3US5A 1RU1A 4Z7YA 2B43A 4YHHF 2GX8A 4K5SA 1F9FA 4DQPA 2IJFA 4DMZA 4KGZB 1JMTA 3NNCA 5LSOA 1NSPA 4M94A 4DPWA 2QA4G 5KFSA 5KFYA 2EFVA 2WOMB 1HI0P 4XK8C 3PV8A 2F8MA 4KGVB 1TU0B 2DNKA 3S01A 4UOCA 2QTWA 3KFWX 1HL6A 1J5EJ 1LK5A 4IG3A 1HBOA 5GMKa 1RAGB 4EFAC 2L48A 3RB6A 5DZ6A 4MFBA 3VGSA 1FNOA 4K8RA 2D74B 1UMJA 1X4CA 2NUHA 4Y2MA 2I2YA 1WOPA 1KQFB 3JQKA 2EXUA 4DXLA 2YWFA 3IO1A 1ROFA 2HS0A 2CZ9A 5F8JA 3NS5A 3V4IA 4QR1A 1CPZA 4FYXB 2ZJRQ 2EG2A 2LXIA 2W2PP 2Z2ZA 4KGXB 2IVFB 2NYHA 4A8MP 2DR5A 4E0DA 4QOTA 2XCPA 2GMJA 3KNGA 3IWLA 1RCOB 2J76E 3CT9A 5KT2A 1IKWA 1GTEA 4QZVB 2MPUA 3GMGA 2FY8A 2EW9A 5DRKA 4UQTA 2EFGA 5DQGA 1TL1B 3PY8A 2V5HG 2ZJPQ 1N48A 5U47A 2CWXA 4RNFA 2HBZB 3ZZZA 3NEKA 2OO4A 2AEMA 3MR7A 2RRAA 3L95X 4USVA 2EK6A 4OYMA 1RT7A 3DOLB 1KS2A 3GV5B 2QX0A 3W64A 1RTHA 3PRDA 2B3TB 1VS3A 4CTAA 3N6MA 3R27A 4N77A 4Q45A 4Q0BB 1N5QA 1KFDA 1VK8A 4ECZA 2ZBCA 4URGA 3GV7B 2XYPB 4OYOA 4C6AA 2WSCC 4YN3B 4CNZA 3QYYA 3HVWA 3MEDA 1KC8T 3OSPA 1YRXA 3ET6B 3N9UC 1KOOA 2Q43A 1UJ5A 2ZNZA 3UDVA 4PWUA 2W25A 1UETA 1PSDA 1SJ4P 2MKYA 3C15B 2BE7D 4TYBA 5A0YA 4F2SA 2OFGX 1QVGR 4YQWA 2KVQE 2IA0A 1X0PA 2EBGA 4HHJA 3LALA 3DI6B 4YFUA 3FZBA 4E2FB 1UVKA 3EMTA 2DNLA 2RT3A 4FXVA 4I2PA 4DX7A 2MKSA 2ZDPA 3CMQA 3MHYA 4Q2LA 2YQ1A 3JSYA 1TAQA 2YKNA 4R8UA 1H3DA 2AQ4A 5CYJA 3KLEB 2Y1IA 2RDDA 3OFEA 4M5IA 2R8HA 1WTFA 2HHHF 1WHXA 4J7CA 3FCVA 4B9LA 3G6XA 1S1UA 1Z1ZA 2FJEB 3NOCA 4NA2A 2A6MA 2HMIA 5I3PA 3W8PA 2FLLA 1RWOB 3KLIA 3MEGA 3Q8QB 3T1HJ 2Z0GA 2BABA 3D1OA 3ZZTA 2V4QA 3C14A 1AW0A 2ATLA 3R5AA 1UW9A 1AFJA 1QSLA 2BJEA 2UUBJ 2V34A 5D4LA 1REVB 4DR6J 4NYZA 3MM7A 2AP6A 5GADI 3KK1B 1MWQA 2RB7A 3OTOJ 5G4DA 1S9EB 3DLGA 1JNRB 1KVJA 4WPAA 2DR6A 1SBRA 5HMWA 1Q0NA 1VCTA 4MYTA 2IM0A 4LFCJ 2KI2A 2YX1A 2WONA 2HURA 3TA0A 1V3RA 1JLEA 3Q8UA 1N32F 4K4UA 2ZHAA 3RBZA 4F4WA 4N5SA 1FK9A 1Q8IA 3W2VB 4ES1A 4Q7AA 1MN9A 4B08A 2GS8A 4KKOB 4BWJA 2XO7A 5D3GB 2WBRA 4CZCA 3JSBA 4LFAF 1IWAA 2HGMA 2LCWA 3FEXB 1NAQA 2C2MB 1RT2A 2FJVA 3ISND 2W8KA 1NB7A 4DUYF 4PUOB 1NM2A 3KK3B 5IFMA 2MKHA 3I0RB 2KT2A 2B4PA 4IUFA 1M5OC 3GTYX 4LQ3A 4EI2A 2YNFA 4ZN1A 3I4PA 1RWMB 4NLDA 2OHDA 2BJ8A 2AD9A 2ILYA 4YMEA 3BYPA 2DNHA 1EP4B 1L3SA 2DH8A 3CC2S 1YJWS 2FJBB 2U1AA 3LPEA 5J1NA 4RL1A 1IR1A 1WC0A 4KE5A 3UR3C 2K7KA 4GKJJ 3NGRA 4RPFA 3ZZPA 3K0JA 4RU2A 4QYZK 3OR2A 4O3NA 3R7NB 2RS8A 4XPEA 3R5GA 2CQIA 2HGNA 1X4BA 2GA7A 3IRWP 1S7IA 5KFNA 4ZLJA 2V68A 3EXYA 2QEXS 3MWBA 2AV5A 1TAUA 2KZZA 2HIYA 3MR2A 1VK3A 2FVQA 1T0TV 1Y5IB 5KFJA 5L38A 1SB6A 4H54A 2GJ2A 3QMQA 2UXDF 4I56A 2GFFA 1QAYA 1W25A 1P6TA 3VALA 1QY7A 2NLWA 2W9CB 4GVBA 2V8HA 2NREA 2AJQA 2VF3A 1LWFA 1FRJA 4NEZA 4DFKA 3OXFA 3NCQA 5HLFA 4CO1A 3DMJA 3OTDA 4WZMA 1BGXT 2WCXA 4ZIVA 2W9BA 2ZUAA 3N79A 2ZKUA 2UU9J 1RI7A 3E2EA 1H0HB 3R6GB 3P96A 1RLCL 4O44B 3A3NB 1H74A 4PZVA 3HVRA 5B0BA 5KFDA 1N5TA 1RT1A 4JI6F 4CO5A 2A6OA 3PIOQ 3OVSA 1YVFA 3QIPB 3CDEA 3GFYA 1MSWD 3I0SB 4JB8B 2OGUA 4IOAQ 1R8CA 5AXLA 2NSBA 5DDPC 2W9AA 3CTRA 2LQ5A 2H4YB 2DRBA 4ITSA 4M5DA 5K5MA 3DGVA 3OLBA 3IFEA 4F2RA 3DGPA 8AT1B 2YH1A 1TMMA 1N5SA 1NDLA 3WDOA 3RJMB 3P49B 1WJ9A 3GSDA 1CJUB 4Z2XA 3C16B 3OR1A 3X3UA 2G0IA 3W9JA 4NLTA 1F0XA 4B3RJ 1MWZA 4RW7A 3V6DA 2Z2MA 4QU7A 2QSWA 4E8UA 3W61A 1BQMB 3GZ7A 2JSXA 4QIWD 3GV8B 1U02A 4DG1B 5DDQC 3ZTSA 4AQYF 2DGXA 3CD7A 2MHEA 2BE2A 2YX4A 5K8OA 3IRXA 1CULB 1RAFB 1ZAWA 1PC5A 3TQEA 3TZYA 4ECXA 2UV8G 2BZ2A 1KTQA 2HNZA 2OEKA 3EE3A 3WZ0A 3UCUP 4HI2A 2VG6A 1HA1A 2DEJA 4FNIA 4DS5A 4PKDB 1UA1A 4ETXA 3VAJA 2DY1A 4KYZA 2UP1A 4L73A 3MAHA 3TOQA 1UW4A 5BR8J 4NMXA 2POKA 1MWYA 3DRRB 2VKZG 1VRTA 3Q86A 2RD5C 2C2ZB 4NXMF 4QIVA 4F7VA 3QSIA 2YNHA 4CO2A 4P10A 2HHPA 2PT0A 4J9RA 3IR7B 2E1CA 4CRJA 3MPWA 3RTVA 3WX4A 2JEJA 3PG9A 4DR5F 3FFIB 5KFMA 4W98A 3DDNA 4ES2A 4WXOA 1NK5A 2QL9B 5LMUJ 4XAKA 2WOMA 1LW0B 4BC9A 4ZVOB 4F04B 3LP2B 2YNIB 3VGTA 5C2CA 5HJYA 1C4AA 5DG7A 2NQPA 4CWBA 3W62A 2ZZNA 3H40A 5LJ3Y 4C0HA 5J1PA 1O0PA 3BYRA 4LF6F 1VLYA 2H54B 1FKOB 2W4CA 2ZC4A 5IV4A 4OJHA 5E41A 4DV1F 3PW4A 2DNGA 1RHJB 2PO4A 2D9OA 4LT6A 1Q79A 2UUWA 3ELHA 3EPIA 2KM8C 4ZHRB 1QSYA 1YX2A 4RWWA 3I32A 2DISA 2WB4A 3MI7X 1R6YA 4F4ZA 2HLUA 4JV0A 2ZOFA 2F8EX 2HIQA 5GMEA 1Q4RA 3ZNUA 2YWGA 1TL1A 4F3QA 5HVHA 4OJGA 1D1UA 1T9VA 3HI9A 3Q8VA 1TK0A 3DLBA 5KT6A 2YX7A 1RA7A 1XQIA 4DV4F 3DHXA 2XYHB 3DOLA 5F0UA 4IRKA 2VKRA 4I6WA 3S6EA 3P5BP 3LWMA 2WK4A 2QLBB 3K5PA 4Q0BA 3J7ZT 2X3DA 2FJAB 5BYRA 2LQ9A 2LLZA 5KG1A 4DL7A 3RG6A 1H2TZ 2WVFA 3OD2A 3C46A 4WTYA 1ZTTA 3MCOA 1XC9A 1KEKA 2O01C 2CJQA 3RBDA 2RIJA 4L72B 4KGKA 3ET6A 2W01A 2V2KA 3W7BA 3C15A 3LP1B 2KG1A 2W8LA 3DI6A 4IQMA 1C0TB 1HFEL 2H5IB 1X9SA 2C3OA 2YVSA 4TVAB 4ENOA 1NJIT 1VQLS 5CHCB 3OJSA 1B4SA 2FHKA 5AT1B 3IC1A 1F2HA 1FJGF 2V9KA 4WTOB 3BGOP 2F5GA 3KLEA 4J9LA 1UVNA 5KFPA 1VQSA 2SXLA 1R27B 1SXLA 3MUVP 3KUEA 2XLJA 1O51A 4JI0J 3KLFB 3TJ9A 2G0JA 8RUCA 3A12A 5HL7Q 3HFVA 3QIDA 4FBUA 3CCRS 1R8PA 1RYSA 2ZWPA 5EX3A 3ZZYA 4XO0A 1F5CA 4Z7CA 1HD0A 3CCMS 3DHWC 2BM0A 4EEYA 3PACA 3NXZA 5D4OA 3L4BC 3D67A 1MMLA 3IS9B 1REVA 3E8OA 3BQ1A 3MUMP 3KK1A 3TZXA 1KLNA 2NZ4A 2JLGA 4LRBA 1S9EA 2C2NA 1HBUB 4DF8A 2VJVA 3HHDA 1LV5A 2FGCA 3TANA 3S8SA 1KNZA 3M05A 1U8WA 2VPYB 3BPSP 4HKQA 4HHUA 3V81B 2LYVA 1XTZA 1J5EF 1B64A 3H4DA 1C0UB 3GJQB 1XR7A 2FZKB 1YZ7A 1JJHA 3I5AA 4B3TJ 2VB6A 4M5LA 3W2VA 1H7XA 1TVRB 4YP3A 4KGMA 2KTQA 3IAS9 2XZTB 4EZ6A 3M6XA 2QLJB 1W26A 4KKOA 1FO1A 2R7VA 4ZVSB 4OYXA 5D3GA 3UCGA 1L3UA 4GVLA 3SIPB 4DV6J 2OD4A 4A8OA 1XK8A 1VQ9S 1TR0A 1FX4A 4WWSA 2Y1RI 4WKYA 4PUOA 2CQDA 3UD5A 3KK3A 2FJXA 2UUCJ 3M9OB 1YJUA 3I0RA 3OV7A 4FDFA 4NLVA 4X62F 3R7BB 2GQQA 1VMBA 1GX5A 4UT4A 3OVAA 1FTRA 3M6UA 2GC8A 2YXLA 3TRGA 3CJKB 1ZETA 2H51B 4FXWA 3HT3A 3GIRA 4DQSA 1LFPA 4MT1A 1X7VA 3OXGA 1WEXA 5B0AA 3BSAA 2OAUA 2VC0A 1EP4A 3UR0A 2DNZA 2GIFA 4USIA 4B9VA 1RQ0A 3FEZA 1OWXA 1IM6A 2ALZA 5EWGA 4DV2F 1NXIA 2CPZA 3PRVA 3I82A 4DI6A 3BEGB 4U95A 4UOGA 5HVGA 4A46A 2UXBJ 5KFEA 3CJTA 3GR0A 5CZXA 1LNQA 5SUHA 2VODA 5KFOA 1RT5B 3I9V9 4NLQA 1HQUB 1NO8A 4DCPB 2XMWA 1F9HA 2BE9B 1FE0A 2K8GA 4EUVA 4DWIA 4J5OA 4EYHB 3IMQJ 2X51A 3SCJE 2FIUA 1VFJA 4RU9A 2W9CA 1RISA 1U45A 1RHQB 3PYFA 2RDIA 4KB7A 2YH0A 3AJ2A 3KJNB 4QPXA 4BC7A 4TU7A 1F5AA 2E5LF 1HLWA 1FVQA 3K5MA 3D54A 1NKBA 4OZ2A 3Q8PB 1M5PC 2E66A 4O44A 4ELTA 2QYGA 4K4XA 3CD0A 4XTTA 2J9CA 4X4NA 1OPZA 3ZC4A 3QIPA 2PIIA 4G3IA 2RQCA 1HW9A 2C22A 4U8VA 1RBOB 3I0SA 2CUYA 4IO9Q 2XGQA 5B09A 4ED1A 4C2MA 4H4KA 3BO2A 2H3EB 3EGNA 2C2OB 2UUBF 4DR6F 3CMAS 4V1Ak 3BN4A 3OTOF 3P6YC 2ZOMA 4NLXA 1NRKA 1CJUA 2H48B 3FRYA 4OLPA 4OYZA 5D4NA 3C16A 3BSOA 2MSSA 5KFCA 2JFDA 1QAJA 4DL0C 3HO1A 1HNIA 3AA9A 1EHWA 2XTJP 2BBEA 3GU0A 4ES3A 3FDSA 4J90A 3PXGa 5CD4A 4HDHA 2E1AA 5DS7A 1BQMA 3QRRA 3HFKA 2R2RA 5C24B 1WI8A 1QUVA 2XSFA 4DG1A 3HZGA 4UF4A 1YG0A 3R5BA 1WF2A 4DU8A 1CULA 1S0NA 3MTJA 4K4TA 1K9MT 2DR7A 6FD1A 1BUXA 5L1LA 4N7TA 1FXLA 2HFOA 1BE4A 3TVZA 2VFRA 2FC9A 2V9WA 3WC0A 3QJPA 4ED8A 3HD2A 2FQQB 3DXBA 3WQPA 2J6UA 3DRPB 2ZNYA 4OJ3A 2FUG9 2NXJA 2DGTA 2HW3A 4DS4A 2ZZTA 3DRRA 1TZ0A 4PWDB 4FF2A 4Q8FA 2LP4A 3ZO7A 3P8BB 4DFMA 3EJMA 5LL6d 3MAQA 4IYQA 1VC5A 4C8LA 2ZEJA 2IRXA 1GMVA 1XNQF 5F8GA 4NYPA 4CLSA 4GKJF 1U1MA 2XLKA 2B6AB 2O3DA 1RT4B 1VR6A 4C98A 1YRTA 1W2IA 4IOCQ 3FSXA 3OTCA 1NK8A 3CE8A 2IIHA 3QZ7A 1B3TA 1OSDA 1YI2S 3R5DA 4USWA 1LW0A 2FVRA 5HO4A 3TEHB 4DR1J 2AJ2A 5F8LA 2J6TA 1Q95G 4A8QA 3H5SA 4DV7J 3LP2A 2KL8A 2MLYA 3CCJS 2YNIA 2GVZB 4K50A 3UN2A 1SC4B 3VVTA 1T8EA 3FNNA 2DIUA 3A1YG 3AAWB 4IOBA 4O4GB 2ATCB 4O3SA 2XMKA 1XMOJ 4IQXA 2VU5A 3R6LB 3ZTRA 3R8YA 3CCUS 1FKOA 3QGIA 1BD6A 2HNDB 3CXCR 3KMSA 1FRIA 3PYEA 5CABA 2X1BA 2P5VA 3QGHA 3DKDA 4N8NA 4WFNQ 2JC0A 3SFUA 2XGPA 4ZHRA 1TL7B 4LF8J 1R6VA 4M1KA 1U26A 3M2VB 4R0EA 2UU9F 3Q83A 1D8ZA 1WELA 3MFHA 1OIAA 4HACB 1FXDA 1TELA 5E0OA 3NRBA 3RRKA 1Q8BA 5A8KB 2RSQA 1BXNA 4OQJA 2D3ZA 3GIKA 4FF3A 1U7LA 3BH6B 2XHCA 2HFVA 3C6TB 5A76A 4OX8A 4FF4A 1NK7A 3NMRA 2CVEA 4WKRA 3CCWA 4CLZA 4LF5J 5B7WA 4YHHJ 2XI2A 4UW2A 1JIHA 2BACA 1XJWB 4IKAA 4IR9A 1TK5A 1WOOA 3TAPA 3ZTPA 2X1FA 3W9HA 1U25A 3J81Y 2IM1A 2VL1A 3ONQA 2R2SA 2J5AA 1S49A 2AX0A 4KPYA 1JB0C 4ZKAA 2CJYB 2JVRA 1SL0A 3BDEA 2M0GB 3QFHA 1S0OA 3BQ2A 4EBCA 2COLA 3LP1A 5KFZA 3N6NA 3SCKE 4LRDA 3NAHA 1TFWA 4ECVA 1WG4A 1NLKL 1IKVB 1C0TA 1QLNA 1UAWA 2DD8S 2W2QP 3LAMA 5HATA 4GKKF 3NKYA 2KFYA 4X4UA 4L76A 4EGLA 4K4VA 2MYFA 2WZ1A 2MQPA 4E98A 4DSJA 4L75A 1RTJB 1WKLA 1MLAA 4IO1A 1FWLA 4U67Q 2XLIA 3KLFA 5BXIA 5HMZA 2ASLA 2ILZA 2HPUA 3AXKA 2AYMA 4DFPA 2BKPA 1G6BA 1T05B 4DCJB 2CQ4A 1WDDA 4I7FB 2MGZB 2QMUB 2EC2A 3AY0A 1UWAA 1FRLA 5K8MA 3IS9A 3MZIA 3WIVA 3CPWR 4B9TA 3O2IA 3Q89A 4OYAA 2WHOA 1HBUA 5FLXU 2ZBRA 4PXCA 3PYGA 2BV3A 2AHOB 1NKCA 3M8ZA 2YPZA 3SZ2A 2IY5B 3VVUA 1G7CB 1U2FA 2J8SA 2KXHA 2D3O1 1FX2A 4OYIA 1C0UA 3KKFA 2DR9A 4U9RA 2OJ3A 4MKBA 2QT7A 3ENQA 2D41A 1FWPA 2BW7A 1TVRA 2CPFA 5A6WA 3SSRA 2KT3A 1NJYA 3RB4A 3NGSA 4DL6A 3JS9A 4U7UD 2KYXA 3FCWA 5E7OB 2GGPB 1DFDA 2F65A 1LW2B 2MQ8A 5M2PA 2V6AA 4OI2A 1EX8A 5H9FJ 3CJSA 3C66A 4DX8H 3EX7B 2WW8A 2CQ2A 1NH7A 2QLXA 2VFVA 1H2UX 1RU2A 3POTB 4TU9A 1RBAA 1X8DA 2W7PA 3W3SA 4F0MA 4LSZB 3CJKA 1VHFA 3CGIA 2R9LA 4LIRA 1F6TA 2ZH3A 2BYCA 3HXMA 2MDAA 3M8RA 3UN3A 4RJVA 4C8NA 2LEPA 3QLHB 3H2UB 4QBUA 3CO0P 2AZ3A 2FZCB 4OHWA 2VOOA 1XR6A 1BLUA 1QE1B 3LO3A 2H5EA 3N5BA 2DGQA 4M5MA 5GVQA 2E5IA 4QU6A 1DBDA 4QIGA 2KKHA 3SBMA 3J81U 2V8PA 4F8RA 6AT1B 1ULRA 2XEXA 1RT5A 4D3HA 1WACA 5HBMB 1FKAF 3ICLA 4Q2MA 1HQUA 1QM9A 1H98A 2M70A 4B9MA 2CKWA 3OHAA 1KHWA 4WYWA 2QMXA 1HNXF 2HQGA 5ETOA 3HDSA 4OYPA 5KFTA 3S7RA 3ETOA 4KV8B 2FPHX 4DFJA 1JQGA 4MFBB 1GEHA 1FESA 1R3NA 3QPIA 1M5HA 5IT9Y 2BA9A 4WP8A 1T94A 2QO3A 3PYDA 4PQAA 1PAEX 4USUA 2C3PA 4WBFA 2O66A 3IGNA 4RR5A 4C0OC 3MDFA 2HWTA 4FYVB 2N4CA 4JI8F 4DZDA 1RTDB 2GVDB 4JI0F 1A9NB 2R7UA 3PX4A 3IP0A 2XS5A 2G4BA 4I2QB 3L3CA 4M5GA 3PW0A 2LA6A 3HULA 4QW8A 2EI5A 3BGLA 4LIWA 4M95A 4XIUA 4O3OA 5ETRA 4P2FA 5KT5A 5KTQA 4ECRA 2JZ5A 4ED6A 2VONA 3MPDA 1JLFB 2JVOA 3NBPB 2HHUA 3ZZRA 3EVWA 3TARA 4NZ7A 4CH0S 2GHVC 2QJ3A 5DO2A 5L1KA 4C4WA 2RHSB 4OZ1A 1VQ5S 4S0MA 4UTGA 4X4TA 5F9NA 1WSVA 1S9FA 2QA1A 2HAFA 2KM8B 4HDGA 5F8NA 4DPXA 4Y65A 3O1LA 4B3TF 2JLEA 1N4LA 4B3MF 1XEZA 2HNYB 4RWXA 2ZBQA 3ZTOA 2FLOA 2B0GA 1VC6A 5C24A 3M6WA 4PCQA 1M1KT 4DV6F 4PPZA 3MF5A 4UY85 2R8IA 4FKYA 4X64J 5T7LB 3CDAA 3M1VB 4YEAA 2I8EA 3T19A 4A8FA 1IXKA 4H4MB 4O23A 2HZAA 4I2PB 2UUCF 1KKHA 2EG1A 1X4DA 3MR6A 3UN5A 3DRPA 3DLEB 1ELOA 4K0KJ 3PJ9A 4NMLA 3QT6A 4ZIWA 5B0GA 4JI6J 3TYTA 2AWZA 4PWDA 1IQZA 3QSYB 1DAXA 1RSCA 3DDIA 4ZCKA 1UFWA 3CDBA 5M2UA 2HHSA 3MM5B 2RQKA 3M4XA 1SVDA 3H2VE 2V50A 2YKPA 2DNQA 5HP1B 3IWNC 2Y8YA 2HHVA 2B6AA 1RT4A 4ANDA 2CYYA 2UXBF 2YQ3A 2D9PA 4MH8A 4X4PA 3K7RA 3SSSA 2FZGB 1FD2A 2CA9A 2W4DA 4LR9A 1FDAA 1X5OA 2MQQA 2ZH2A 2E9TA 2C2DA 1IBLJ 2GVZA 1BWVA 1U1LA 2J9DA 2B8QA 2JDJA 2HBRB 5IT9U 5KFUA 3IBWA 3C19A 4O4GA 5F8IA 3AT1B 5E5NA 2D7SA 2PSZA 3RUBL 3HD1A 5IV3A 3PEHA 4MIWA 3QGGA 3EZUA 1T02A 2HNDA 2XS2A 1DTQB 3J7AN 2R7RA 4PXBA 4TKTA 1PYTA 1SJ1A 3RRHA 1MMNA 1XN9A 1Q16B 5AJ3J 2OPRB 4NCAA 1RDRA 3D66A 1N6QB 1U4BA 1VDHA 4LVNP 4X4VA 4P2MA 5HQMA 1TL7A 1JX4A 2OEJA 3M2VA 5E3AA 4GMKA 3DM2B 1W7WA 5JUMA 4A4JA 2CJ9A 2Q1LA 4TY9A 4HACA 1BC6A 3UE2A 3MOZA 3DLHA 3FRZA 3L7UA 3D1QA 5A8KA 2Q79A 2MKIA 4PG7A 2F4FA 1IQTA 1S79A 1ZM4A 3UVJB 3RAQA 3L7OA 3CJ8A 3C6TA 2X1GA 3ETMA 2LQBA 2KJVA 2MHNA 4PYDA 4O3PA 3NAIA 3MM8B 2JH3A 2MTLA 5AXKA 1WSRA 2W2NP 3OFFA 3T5LA 5GAHU 2FVSA 1N5YB 4DL4A 2AYBA 3M32B 1HWJA 3Q8SB 1YRUA 2MY7A 3MEEB 5FDLB 4RNHA 4NRTA 1UL3A 1EQMA 3TP2A 2I0XA 5KFFA 1U0SA 1NZ8A 1U24A 3TJ8A 1D0EA 1L3KA 3TEGA 5DLGA 3LWLA 3BBBA 2JWNA 5LSRA 3G2XA 5EGYA 3FEYB 1KWMA 2NPIA 2Y1JA 3Q2TC 2MZRA 4LF6J 2CPHA 1K47A 3IWXA 2DKOB 1KFSA 4DJBA 1FKPB 2VBXA 3D68A 1HR0J 4NA3A 5ETQA 4DV1J 3OL6A 5DLFA 1IKVA 3FCHA 4C3MA 2DGUA 1N0UA 1RE1B 1M90T 4DCOB 5KG5A 2DO4A 3RAXA 1S6UA 1RT3B 4FYYB 1S57A 1DQ8A 2P6SA 4IR1A 1RTJA 3FUYA 3BKUA 3UDEA 5KOWA 1LEOA 1H72C 3HCXA 4OZJA 1GXTA 2P6TA 1HD1A 1P27B 1T05A 1X4GA 4I7FA 1ZH5A 1P1LA 2MGZA 2E44A 1GAOA 1YGYA 4LBHA 2AU0A 2HAIA 1YJVA 1H2VZ 4DV4J 1W2BR 3AXMA 1SH2A 3PR4A 2D69A 1DY3A 4ECTA 4AL5A 3BO4A 3PRBA 2PI5A 3D0GE 3OR1B 1CC8A 1P8GA 4DV7F 2CDQA 2DEIA 3CC7S 3KHGA 4PRFA 1UWBB 4B9SA 5I4MA 1XMOF 1JK9B 4JV2A 2L9NA 3MCMA 1G1XA 3RBEA 2VH7A 2H9ZA 2IDLA 1OS5A 1Q82T 2MLZA 5IM0B 1AB8A 2GGPA 2AJ1A 3ENAA 1LW2A 1NSKL 4CLFA 1YHQS 3B8HA 9ATCB 1S1TB 3Q24A 3PJWA 4LF8F 3PHTA 2V0NA 4Q43A 4W92B 4J9OA 3D28A 3MPVA 5KFVA 1IR0A 3FJ2A 1VJQA 3POTA 3GFXA 1EJ7L 5H9FK 1VBZA 2DNPA 5GAGI 2VDIA 2XMVA 2XMUA 5KG3A 4A8YA 5KFGA 2MZ1A 2IVYA 2L41A 3PJXA 1RLDA 4JBCA 1YITS 1KLMB 2AW0A 3QLHA 4GO7X 3QAUA 1ZOTA 3PO4A 4C3LA 1RA6A 1QE1A 2K3IA 3L9ZA 1NPPA 1PJ7A 2X7IA 3WBZA 1PIEA 1SKWA 2AJFE 4OI0A 3NNAA 5HQLA 1I94J 4LF5F 4DU7A 4AL6A 4KO0B 4ZLPA 2AYGA 4ILLA 2KT5A 1X31C 4C3KA 2DR8A 4ICLB 1XMBA 4KT0C 1PYOB 1UA0A 5HBMA 5GAEI 4X65J 3MPUB 1IBMJ 4B17A 2ZH1A 5MLCV 1IJEB 2NR0A 2LEAA 3CCSS 2ROEA 4K4SA 1RTZA 1VI7A 1K0TA 4DSKA 4KV8A 1RHMB 3UD3P 2NSCA 2JFKA 3TUPA 2NS1B 1ACMB 1GMUA 5ETPA 2CJAA 1T9WA 2AT1B 3EGWB 1U0HB 5JJBA 3PIPQ 4ZVRB 2A2DA 5ETTA 3NNHA 1Y10A 3MD1A 3HZEA 2XSJB 2ZDOA 1SC1B 2J0WA 1MMDA 4JV5J 3KJVB 2B9WA 3K58A 1H38A 1UVMA 2DGSA 5JVHQ 3ILJA 4WK1A 4X62J 1AROP 1ZA1B 1RTDA 1X9MA 1NDKA 2GVDA 1NPKA 3SXLA 4MKAA 3BH7B 4JI2J 4I2QA 2ALYB 3GYGA 4N76A 2VFUA 4Y3CA 1RT6B 1RHKB 3P45B 3LOUA 4ZPDA 3RBXA 1OQ6A 2DB1A 2F4VF 1RP5A 4ZLLA 5L8RC 1FI4A 3DN9A 3QRPA 3KYLA 3CMES 5A2QU 2H1YA 2P9CA 3MGJA 3KXDA 4KRWA 3G82B 2FLPA 4DV2J 1WF0A 1GQEA 3CNQP 4HH0A 1BY9A 4F3MA 1JLFA 3NBPA 4ER8A 5T41A 5F8MA 2DRAA 2YY3A 1FDDA 3TNVA 4LFBJ 2QMWA 3QNWB 2JOQA 1SC6A 2C3YA 4HI1A 1VIXA 1I1GA 2M2BA 2BKNA 1CBKA 1KSPA 3JB9k 2O5DA 1SKRA 3J7A1 3IM8A 3QWPA 4P71A 4OX6A 1LWCB 2HNYA 3GLJA 4LQ9A 2O67A 2XBPA 3U1MA 4K2JA 1U6BA 4ZPVR 1A6LA 5J2PB 2CNLB 3K5LA 1DJ0A 2RHQB 4QPTA 3JQJA 1UCNA 2DGVA 2FGOA 2GIQA 2CJKA 1VGYA 2HZCA 5T7LA 3EDQB 4NCGB 3E51A 1F2GA 3M1VA 2B8PA 2WRMA 2FD2A 4H4MA 1M5VC 2VQFJ 2E5LJ 2BXJA 2HS4A 2RH3A 3P5TL 1IR2A 1UVJA 3HSZA 2CADA 4OHYA 2DY9A 3CCVS 2JEGA 3DLEA 4F0HA 2BMBA 4CT9A 1VHIA 1SUQB 2AX1A 2VASA 1VQ4S 1GNKA 2HBYB 3J81j 5L1IA 1J5OB 2QG9B 3MURP 4DUZJ 1B7FA 2AJ4A 3MM5A 1PJ5A 1SV5B 2D3UA 1WC3A 3NCPA 5HP1A 5L9NA 2JEIA 2HK3A 4ETZA 1KONA 3G6ES 4WYLA 4DPOA 3CUNA 4FVCA 3AOCA 2JC1A 4F3OA 4J9NA 5EDWA 2XZWA 4L74A 1YBUA 3MECB 3GFHA 2LU1A 5JXSA 1SIWB 4MKVA 2KB2A 2DHGA 1KQKA 3TWZA 4V19J 4RNOA 4TNOA 2MSTA 1IM4A 3TA2A 4F4KA 2A1BA 4M63A 1VC0A 1FNMA 4ZPTR 4G65A 1DTQA 2W7AA 2E1PA 3OFHA 4JI3F 1LXJA 4OX9J 2IYIA 4H4KC 3MR5A 3PFEA 2YNGB 3S1TA 2ZZMA 4LRAA 1L3VA 2OPRA 1URNA 4C8KA 1N6QA 4OHXA 1E6YB 3FBCA 3LGMA 4DR3F 3GG1A 4R25A 4I67A 2BX6A 4LRFA 3DM2A 3TVKA 3M6VA 1RZMA 4NLYA 1RWUA 2JL9A 3RRGA 4O0IA 3LUYA 3AQOA 4JYAJ 1MN7A 1WEYA 1S72S 3CCTA 1IJFB 5KFLA 4AXJA 2PMWA 4TXSA 2R42A 5HK4A 3BDPA 3CJ0A 2QL7B 1D9DA 3UVJA 2GO8A 5CQGA 4M5HA 1M0SA 4DN0A 1S1XB 2B4UA 1XNQJ 3MM8A 1NH8A 3CVKA 3TX0A 1S76D 2VPZB 2EFPA 4GRSA 2ADCA 2W4PA 2HG4A 1C1CB 1YJ9S 4QQBA 2RKIB 2CPIA 3GIJA 2HHXA 2IJNA 1K8AT 5K8NA 1N5YA 3C2PA 2CQ3A 3M32A 3NMAA 3KK2B 4QJVA 1HNZJ 4CLLA 3VAHA 3MEEA 4IH6A 3R97A 5FDLA 5THWA 2GQCA 1PAUB 2R7XA 1N33F 3P3DA 4QWCA 3I31A 3VZHA 4KHPJ 2GO9A 1HPZB 4EYIB 1LXNA 3TAMB 2DIVA 3N5FA 3GG0A 1SPBP 4H4OB 1NCLA 2LMIA 3AQPA 1CJVB 1F5BA 4XDDA 2N3OA 6FDRA 2H65B 4RO0A 4JI5J 5B0CA 1U2CA 2OP5A 1S99A 2RQMA 1FKPA 1GFWB 1IBKJ 5LSLA 1TKXB 4X64F 5E3PA 3F73A 1UTAA 3I5BA 1TKDA 2ERRA 2DGWA 1R8HA 2QFIA 2B5JB 4CI0B 1ZS6A 2EKNA 2U2FA 5CZVA 1G4CA 1RT3A 1FEEA 4I4BA 4DV0J 2R3VA 2N3LA 2BANB 1R89A 4K0KF 3OJUA 3G8SA 1WTBA 4P75A 4FS2A 3VAIA 3UCZP 2DHAA 1XMQJ 4ECYA 4OYWA 3ZZUA 2UV8A 1C1BB 1YJRA 1YDLA 2QGFB 1U6ZA 1HNWF 1FCAA 2IC3B 3H0PA 2BRLA 4U96A 4FPRA 3FBBA 4O3QA 4FNHA 2PEBA 1H7WA 4TLQA 2XI3A 1XWLA 1GH8A 3X1LB 3SV3A 2PC6A 3AHPA 4OI6A 3IR6B 2OEMA 1QSSA 2Z56B 4LR8A 4ZCMA 2JLFA 3U1NA 3OXLA 1MNEA 3BGFA 1FFSB 4C7QA 2JHEA 2C42A 4IG0B 1HNIB 1IBLF 4UQGA 1TK8A 1YTYA 1UPMB 2R8KA 2QLFB 1Z2LA 4NXNJ 3G87A 3ZZOA 1UWBA 3H20A 2ROGA 2HHTA 1VQPS 2YTCA 2MJUA 1S0MA 4JI7J 2E1RA 1F9EB 2CNOB 4KTQA 5IM0A 2GMHA 4P52A 1TL5A 5KFXA 2VJUA 1RAJA 3OT9A 4JOUA 3ENWA 3KWMA 4WFXA 2Z58B 5D4PA 3T6JA 1FRKA 1NPRA 5AJ3F 5L1JA 1TUGB 3CWJA 1T9UA 4UOHA 1VBKA 3BQ0A 1Q1KA 2W1BA 1S1TA 1YWXA 2NCKL 5K9FA 3CJ3A 2C2EA 4GKKJ 4QIFA 1UZHA 2V2VA 1U1NA 1EQ0A 3BZQA 3W2WB 4F4AA 1NNDA 3KG0A 3D3BJ 2I38A 4ZJQA 1RAIB 2Y1LB 4CO0A 1D8YA 1V6HA 2WW4A 1KLMA 3R7SB 1OPIA 3MMAB 2OKQA 2PDAA 4W4MA 1L5UA 4NLPA 1HIYA 2B9EA 4WXWA 2CVIA 2Z8QA 3W1YC 4KIAA 2ACYA 4KO0A 2HBQB 4IH7A 3LP0B 1ZAXA 1ZAVA 2AEFA 4M8LA 3TAQA 2YKAA 3NGTA 4ICLA 3HSDA 3K2YA 4LUBA 2GAHC 3FQKA 1U09A 1Y7PA 3M9NB 4WFAQ 1KBRA 2DITA 1U1QA 2FVPA 1T11A 2DNOA 3LAKA 1RWWB 3EICA 3K8WA 3KUHA 2LEBA 3M2RB 2VFTA 3IBFB 4F26A 2KRRA 4DPYA 5IS2A 3VAFA 2ACMA 4TLRA 2NUUG 1U0HA 3H5XA 1V3SA 1Q81T 4NA1A 2I5JB 3BGRB 4RUHA 1HR0F 4PWWA 4ZP8A 3G9CA 4USHA 3KDNA 2XSJA 3HFZB 5JVGQ 3PKYA 1DLOB 3HHLC 3KJVA 1VLOA 5HN0A 4CLYA 3GJTB 1YKWA 4KQZA 2ZH8A 2UZAA 2P9EA 5EWEA 4OHZA 3BPDA 2K7JA 1LQ9A 1PO6A 2R7OA 1KDNA 3V5RA 5EUHA 5AXMA 5D6GA 4WK3A 1T3OA 2OUGA 1KN6A 1I51B 5CD4H 2Z30B 4K59A 2EEYA 2M4MA 4K7QA 2YQ0A 5C25B 5I3UB 3MM9B 2C1EB 1FJCA 2XNRA 1RT6A 2DNYA 2ZE2B 3RZAA 2KXNB 5AXNA 3H5UA 4DSLA 3CJRA 3G82A 5KFBA 3G8TA 5D0RA 3ILLA 1JJ4A 1NJWA 2I1RA 2HVHA 4EBDA 4KC5A 3T5HA 3RB3A 4A8XA 2CJBA 4NYOA 3VR1A 5DDRC 2AKWB 3V4MA 2LDYA 1AXQA 4HLBA 2APOA 2B51A 2HQIA 1F60B 3MOJB 2CNKB 1EZZB 2VV5A 1HNXJ 2FHJD 3I4HX 4J91A 1OJ4A 3F44A 2UXCJ 1GX6A 4IRDA 2BQ3A 4NE9C 3K5OA 4AT1B 1LWCA 1Q8KA 4P6QA 4KHRA 2FHJA 5J2PA 1HNVA 4BS2A 2VZ9A 1PCAA 5IC6B 5CYQB 5IT0A 1R0AB 2R8GA 5EN1A 3CCQS 4DQRA 4Y2IA 4NCGA 4DV3J 1JWWA 3BS9A 5CXTA 4DN9A 4WU3A 5F8HA 4WE1B 4DEZA 3QFWA 4RUCA 5EHHA 2KVIA 2HRYA 1IWGA 4JV1A 5ETMA 1HWLA 4JI8J 1WHYA 3JSRA 1SUQA 4UZBA 1BQXA 4NX9A 2YWHA 2Y0BB 2QIFA 2YBVA 3Q22A 1AYEA 1KD1T 2ZH7A 5IWAJ 2IRYA 4JP8A 1V5VA 1J5OA 3OSNA 2CFXA 5I3QA 2H4WB 2UUAJ 3CCZA 1S12A 3SFGA 1SV5A 3R9LA 3TO8A 4KJIA 4PAAA 1UFLA 3OTBA 1GT8A 2VBYA 2XNQA 2J6SA 2LQJA 1I94F 1YLXA 1Z4UA 1WEZA 3CJ4A 2V8VA 1GK8A 1N5VA 1RAHB 4X65F 1IBMF 1EAYC 3NG8A 5LOQA 3MECA 1TP7A 1X60A 3GONA 1HWKA 1WI6A 2IDEA 2MMYA 2KO1A 1Y5NB 2UVWA 4B3MJ 5HI7A 1K44A 2R7SA 2CNNB 2H5JB 3DYAB 1X5TA 5MAOA 4OI1A 3F0NA 3O8WA 2YNGA 1R43A 5KG0A 3PR5B 1NB2A 2MQLA 3TUJC 1VJWA 4CO4A 5L46A 5KFWA 1E6YA 4P2XA 4BHQA 4JV5F 2ZVSA 4CO3A 5GAGU 3G4SS 4ERDA 2OMLA 3THPA 3MPYA 2E5HA 4Q5VA 4FYWB 1Z2ZA 4X66F 4K4WA 2XHWA 5F0WA 4C8ZA 1LWEB 4JI2F 3SCIE 3I87A 4URQU 2LXFA 3O6QA 4EBEA 1S6PB 3D0HE 1U47A 1Y0HA 1K0VA 1GXUA 1S4EA 1RACB 4LSLB 1S0VA 1OMSA 5CCLA 1RBLA 2YKMB 1S1XA 2R2TA 4RBTA 2N4DA 2XY7A 1VQMS 1RADB 2JNJA 3LPYA 2VG5B 5GAEU 1C1CA 2RKIA 1PBUA 3KK2A 3HT0A 4ZS6A 4LFBF 2OFHX 1WKKA 1U1KA 2Z57B 1S6QB 2IA6A 2VBWA 2RILA 3VGVA 3JTNA 4YR2A 4ED4A 3TQ1A 4USKA 2CPXA 4DLGA 5GAHI 4OI3A 2M88A 4ATNA 1HPZA 4CQ1A 2G1DA 3EVMA 4YOEA 1WDTA 2EC0A 3TAMA 1JXVA 5LM7E 2HLTA 3VCDA 4H4OA 3A4TA 2HRTA 1H73A 2VC1A 2DH7A 4ANCA 1CJVA 4ED3A 2XC9A 1CEZA 1JLGB 3BKTA 4U8YA 3R1HA 5D0EA 2BJ7A 3UNYA 5KT3A 4LVOP 3JYTB 3BO3A 4ZJLA 1TKXA 2B7BB 3DOMB 4OYBA 1R8BA 3T1AA 2W24A 3VWSA 1T95A 1NHKL 2B9XA 2VQFF 2B5JA 2XS7A 2CDRB 4ZOSA 4DV5J 4WCEQ 4K4ZA 4TQSA 2GHPA 1NK9A 3CD6S 4ILMA 4YR0A 2BANA 1HKAA 3OVBA 1U6FA 3M8WA 2HK2A 4FXDA 2Q6CA 2V4RA 4LF7J 2GQ2A 2V67A 2IVMA 2AF6A 1PBAA 3K5NA 2CQ1A 4QWDA 2F9JA 4O3RA 4KAIA 1C1BA 3H5YA 2DBBA 3E3XA 3IG1B 4CM2A 2IJRA 4C11B 4DUZF 2IC3A 4RBUA 3DLLQ 2BDPA 1ZZFA 3FQLA 4PG8A 4YUDA 1R31A 5C42B 1LWXA 4ECUA 4ZPCA 2M8HA 4B02A 2HFSA 1PG5B 1R0CB 4MKYA 1LKZA 4EO6A 2L08A 3NS7B 1KVKA 4ED5A 4L3KA 3A3OB 4DF4A 1M1HA 3U7JA 4LR7A 4PR6A 4IG0A 1IN0A 2DO0A 2PN6A 4G1QB 4ECQA 1NZAA 2KFNA 2L9DA 4X4RA 3B6BA 1KHVA 3BB5A 4J9MA 1X5SA 4IRCA 1S5ZA 4K2XA 3PZPA 1T7PA 5B0FA 1CG2A 3GP9A 3DLKB 1WKJA 2F3JA 4HT5A 4OX9F 2RJZA 4WIQA 3QQCD 3M8SA 1JLQB 1WORA 3GJRB 2J9EA 3DCAA 4OHVA 2ZFHA 3T41A 1N56A 1N52B 3CF5Q 1R7IA 2MZTA 4NASA 4ZPAA 4HEA9 2WSFC 2XZDB 1QUPA 3PW2A 4C8OA 4OI4A 3NGDA 1EB0A 4CLTA 3JSMB 1D09B 3W2WA 1Q78A 1UFKA 3LH2S 2HWHA 4JYAF 4CLWA 4JI1J 1RGVA 4MYUA 4OMFG 1IKYB 2JEFA 1N88A 4OJ1A 2OTJS 2HHWA 3M8QB 1RK8A 5DM6Q 3MMAA 3TI0A 2RVJA 3W5YA 1RWPB 3EZ5A 1YK9A 2BKOA 1ZA2B 1JLAB 4Y28C 4FN5A 4HH1A 2VA3A 1F1BB 3LP0A 1WG1A 2CPEA 5DM7Q 3EPGA 5E3RA 1HNZF 2IM2A 2PA8D 3EDRB 2MB0B 2DK2A 3DNCA 1VISA 2J0QD 8ATCB 4PQUB 3OHBA 3MR3A 3D6FB 4UUWA 3KLVA 2DT9A 1JXEA 2ROPA 4C8MA 3KHRA 4KHPF 5FLXY 4KY3A 2XMJA 3M2RA 4GC6A 1ZPWX 1D9AA 3W9IA 4YR3A 4NLRA 4ELUA 5D77A 2ZM6J 4JI5F 1MROB 2RS2A 1P1TA 2M52A 2CXEA 3DRSB 3UPFA 2MQOA 1U1PA 2M7SA 4QR2A 3QBCA 2HGLA 2HVDA 2I5JA 3BGRA 2E5GA 1IBKF 2FY1A 4OZNA 3FKBA 4X84A 3GYXB 4Y2KA 4WFBQ 1RKJA 4ID5B 3NLCA 4RNNA 4A47A 3CIMA 1J2VA 4PXEA 1DLOA 2ASDA 2AJ0A 2Q3PA 1REGX 4PG5A 3DU5A 4I64A 5F9LA 5SZTA 1UVLA 3OPKA 2DXEA 4NEYA 5D0HA 4TQRA 2X1AA 1KRPA 3BBFA 3Q23A 3EGZA 3L09A 4DV0F 2AGQA 2BUNA 1SIZA 3CDUA 1VRUB 3E01B 3LANA 5LXYA 1RWNB 1XMQF 2VDHA 4DR7J 5C25A 3SI8A 2HSEB 5I3UA 2KYZA 3MM9A 4F4XA 3BR8A 2OTLS 4LMZA 2ZE2A 3JQMA 1OO0B 4QCLA 2AEJA 3ENVA 5BJRA 4DZ6A 2VG7B 4LF9J 2XULA 2WTFA 2AGOA 3CW2C 3N28A 5LMNJ 2GCFA 4HTJA 4D3GA 1CLFA 1AUSL 3OTEA 2QZ8A 1E6VB 1NEEA 3BSCA 3IA0A 3DLJA 1KOHA 2GJFA 3M8PB 2CQPA 3OL8A 2G2ZA 5F41A 4ZDNA 2MY8A 4KSEB 3EZOA 3D2WA 1RCXB 1HI1A 3HHKA 3V6KA 4EMDA 5C7PA 1HYSB 4CH7A 3WHIA 1NHVA 9RUBA 4RZRA 5HQ8A 1YBTA 1Y3JA 2AZ1A 1NKEA 4NXNF 2MKCA 4FVMA 3SDEB 2QV6A 4F02A 4PYAA 1V9OA 5KG7A 4JI7F 3N6LA 1G3OA 3IR5B 3R5CA 1UP1A 3FSIA 5CYQA 1R0AA 1FFGB 4NLUA 2B7CB 4X4QA 3M7VA 3AOBA 1ZTWA 1ZYQA 4M5KA 2CIMA 3Q2SC 4WE1A 3QT5A 4KBIA 2G1HA 4U6PA 2VA2A 4O0NA 2OPSB 3GIMA 5A8RB 4F25A 2QRRA 4J9PA 1QDUB 2XWYA 5IOLA 4AL7A 2XY6A 3KLHB 1MU2B 1DZ5A 2CG8A 1T9TA 2HVZA 2UVVA 3NGKA 3T5JA 4X4OA 3GIIA 3DOKB 2F4VJ 4YB7A 4NLWA 3OL7A 4XDCA 1I3OB 3C8YA 2VFSA 1CQMA 2BRKA 2JX2A 3MAAB 4ZP6A 1N34J 4EWTA 3O5TB 1OYDA 1NK6A 3H2LA 3A8EA 2F1FA 3SSQA 4ALZA 2DGOA 5ADZA 2YPYA 4R5PB 1FE4A 1OY9A 1RHRB 3M30B 3JTPA 4L6V3 4JI4J 3V2UC 4K5RA 2GV1A 3G71S 4P7TA 1N36F 4QW9A 4QWAA 3HK2A
chains in the Genus database with same CATH topology
2A6OA 2XQCA 2A6MA 2XMAA 2VHGA 2VIHA 2VJVA 2XO6A 2VJUA 2FYXA 2F5GA 2F4FA 2XM3A 4ER8A 2VICA 2EC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A6O A;  2XQC A;  2A6M A;  2XMA A;  2VHG A;  2VIH A;  2VJV A;  2XO6 A;  2VJU A;  2FYX A;  2F5G A;  2F4F A;  2XM3 A;  4ER8 A;  2VIC A;  2EC2 A; 
#chains in the Genus database with same CATH topology
 2HRU A;  3KNA A;  3J7Z 5;  3DYA A;  3H4B A;  3DXS X;  3BJY A;  5K14 B;  3CJ2 A;  3Q8Y A;  4R0J A;  1DHM A;  2OI2 A;  3QJJ A;  1X4A A;  1B0T A;  3M2U B;  1S4F A;  3A8J A;  5DJB A;  5IC4 B;  3PNI A;  1F3V A;  4F67 A;  2OSR A;  1TV6 B;  4J9K A;  5EWF A;  4ZPW R;  2FYX A;  1JJC B;  1HI8 A;  1VQK S;  3HM9 A;  3W5X A;  1LOU A;  2DPJ A;  4J9V A;  1WC4 A;  1LWE A;  1QTN B;  1C4C A;  1S6P A;  1VBY A;  1SJF A;  5L39 A;  4ED2 A;  4FYD A;  1XIQ A;  1SI9 A;  4LSL A;  1CJK B;  1JLC B;  2YKM A;  4OFZ A;  4MMO A;  5G0R B;  2GAG C;  4I0W A;  4NLS A;  2BQR A;  3D3C J;  3CB4 A;  3KG4 A;  2R7Q A;  1HHT P;  2VG5 A;  4WP9 A;  2BM1 A;  3H98 A;  2XYG B;  2L9W A;  4MK9 A;  3TW0 A;  1O6X A;  2LXU A;  2LEC A;  1SC3 B;  4LF1 A;  3G96 A;  1S6Q A;  4EK2 A;  2LU2 A;  5A6P A;  1FXR A;  3NOG A;  2QFJ A;  1D9F A;  4CLK A;  4X4S A;  1S97 A;  2MQN A;  3R3T A;  5DGA A;  1NSQ A;  2P8I A;  4CDI A;  2FJD B;  3Q0A A;  2UXC F;  2IRU A;  2FVC A;  3BR9 A;  2I9S A;  1IVZ A;  3KTQ A;  3AA8 A;  2V8D A;  1U8S A;  1J27 A;  1JLG A;  1PIL A;  2BVZ A;  3GCW P;  4JI3 J;  1Q7L B;  4ZP9 A;  1SL2 A;  5IQQ A;  3H59 A;  2Y9H A;  3JYT A;  2CQB A;  1DRZ A;  3DOM A;  2N7C A;  3MMC B;  2R7W A;  1Y11 A;  4DV3 F;  1XR5 A;  1ZZN A;  1Y9O A;  4AFF A;  3UO0 A;  3G6V A;  5CCM A;  2PMH A;  4DR3 J;  1FD8 A;  5H9E J;  4WF9 Q;  3NWR A;  4RW8 B;  2FLN A;  1AFI A;  4MTP A;  3F56 A;  3RAM A;  1AZS B;  4B3O B;  3EXC X;  5IWA F;  3A8K A;  3DU6 A;  4O4R A;  3CJQ A;  3J7Y I;  3JAM Y;  2UUA F;  4DR4 J;  1EKS A;  3IG1 A;  2LDI A;  4C11 A;  2MLX A;  3TR5 A;  4ZVG A;  2B4V A;  2B4O A;  3W5Z A;  4C8Y A;  1Q8L A;  3TX8 A;  2KXF A;  4FF1 A;  3D6M B;  3MUT P;  3GPA A;  4RLE A;  2KH9 A;  5C42 A;  3B82 A;  2NXC A;  1SJQ A;  2QE5 A;  3QO9 B;  2RUS A;  3T9Z A;  1TKT B;  2NXN A;  2NZC A;  3VQS A;  3A8I A;  2BQU A;  2Z4P A;  4Q8E A;  2DCU B;  3ISN C;  1K1Q A;  3MMB B;  1N33 J;  1OY6 A;  4RW6 B;  4A8W A;  4CNY A;  2ZWO A;  4G1Q A;  2WBM A;  3HHL B;  1A0O B;  1CJT B;  5IZH A;  4MAK A;  3VZI A;  2XMA A;  1Q7Y T;  3RYL A;  4UOF A;  4N41 A;  4OL8 A;  4N56 A;  3UD4 P;  4P7V A;  3PDN A;  4I1T A;  5ETL A;  2XY5 A;  1CQN A;  3DDK A;  1SH3 A;  1R0B G;  2HWI A;  3MMJ A;  4I68 A;  4UUX A;  3DLK A;  4TY8 B;  3I5C A;  1FVS A;  4IDK B;  2RAQ A;  2K3K A;  1JLQ A;  1WC6 A;  1S10 A;  1WHW A;  5HMY A;  1N8R T;  4URS A;  2A0F B;  5DZ7 A;  5ETV A;  3LW5 C;  2NXU A;  3OUY B;  2DYA A;  4FBT A;  4BLG A;  2IM3 A;  1Y00 A;  2GNK A;  4CH1 A;  4RUA A;  1T9X A;  3HVA A;  1YZ6 A;  4EZ9 A;  1ZBT A;  3I56 S;  1TQL A;  3JSM A;  4NL5 A;  4AUK A;  4N47 A;  2ZHO A;  4HT7 A;  5IQ6 A;  1S48 A;  1TKZ B;  3JXO A;  4W90 B;  1JKH B;  4I6Y A;  1IKY A;  2WVE A;  3FSY A;  4KFB B;  1X9W A;  2OPQ B;  2V2Q A;  4YY3 J;  2VPX B;  3T5K A;  4B3S J;  2WVB A;  1UPP A;  1HNW J;  3M8Q A;  4ED0 A;  2DNN A;  4BBY A;  4DPT A;  4ZVF A;  2Y8W A;  1HBM B;  4Y2C A;  3CSK A;  1S9G B;  1JLA A;  2V94 A;  3VV2 B;  5A8W B;  2PD1 A;  1Q86 T;  1SQF A;  3QT8 A;  4K4Y A;  3QWU A;  1KP6 A;  4LF4 J;  3O3L A;  2ASJ A;  5LXR A;  4DR2 J;  2HZV A;  2BOP A;  3LGN A;  4PQU A;  1HAR A;  1QAI A;  1QVF R;  5E3C A;  1VYA A;  5KFA A;  3H8Y A;  3VAG A;  2IBO A;  4PPD A;  5GMD A;  2HFU A;  1OY8 A;  3AH6 A;  2WVD A;  5F3T A;  1SCJ B;  5KOX A;  3AD7 C;  4UY8 T;  2FHO B;  3DRX A;  3O44 A;  3SQO P;  1MRO A;  1T03 B;  3SCL E;  3B4D A;  3DRS A;  1B7Y B;  3D4J A;  2B9Y A;  3PX0 A;  4ID5 A;  1HQ2 A;  1VQ7 S;  5ETS A;  5ETN A;  2HQ3 A;  1NSA A;  1FTC A;  4I6A A;  3NL0 A;  4DV5 F;  3M8Y A;  4Y0F A;  3PX6 A;  1A7G E;  2A18 A;  3JAM U;  2XWX A;  1FEH A;  3SV4 A;  2GHW A;  1VRU A;  2W2O P;  3E01 A;  1SKS A;  3BSN A;  1M5S A;  3AD8 C;  4AD6 A;  3NY0 A;  1VIO A;  4LF7 F;  2G2O A;  1MG7 A;  4CYU B;  4QYR A;  3OL9 A;  1M1G A;  3SQG B;  3HJV A;  2VG7 A;  5KFI A;  3HF5 A;  4CM0 A;  3T1Y J;  2MXY A;  4J9U E;  2A3J A;  4G1P A;  4CCH A;  3T1H F;  4ZCL A;  3A3P B;  3TUZ C;  2OD6 A;  3G86 A;  2IMW P;  3MEK A;  3K17 A;  4LJM A;  2E7W A;  2MJN A;  2ABY A;  1JLB B;  1U1O A;  2W2M P;  1E6V A;  5J2Q B;  3G6Y A;  3M8P A;  4Y00 A;  2IAJ B;  3TA1 A;  3Q8R B;  1X0F A;  1FHT A;  2DNM A;  4I69 A;  4ZPB A;  2CZV C;  2M5Y A;  4YDD B;  2N82 B;  3U27 A;  1C2P A;  4NRU A;  2MQM A;  1HYS A;  1VBX A;  3FMB A;  4P73 A;  2Z2L A;  1BQN B;  3D1H A;  2K2P A;  4LFC F;  3MXH P;  3SDE A;  1XER A;  4DL3 A;  5HMX A;  3CED A;  3T6B A;  1APS A;  1YJN S;  1IKX B;  4RW9 B;  3H42 A;  4DDF A;  3FVY A;  1NJX A;  3ULH A;  2CWK A;  2CPY A;  3PEJ A;  1YQH A;  2V63 A;  3THT A;  1V5I B;  4DSF A;  5KG6 A;  5T14 A;  3QJL A;  3TZW A;  2UVU A;  3GQC A;  4NLO A;  2HFN A;  1HWU A;  2OPS A;  4N8O A;  5A8R A;  2WSE C;  1DQ9 A;  3K59 A;  3VGU A;  4MIA A;  4FKX A;  5B08 A;  3MTK A;  3AOA A;  4PG4 A;  4ZVH A;  3EWG A;  2GIR A;  1WC1 A;  2O1P A;  5FJ4 A;  4ZK7 M;  2XB2 D;  4TYA A;  3TJA A;  3JTO A;  3KLH A;  1MU2 A;  2G9O A;  4WZQ A;  4JI1 F;  2F9D A;  3TUI C;  5D78 A;  1BMQ B;  5AE3 A;  4NI2 B;  5DGB A;  3HSG A;  4Q44 A;  1VRQ C;  1FER A;  4YB5 A;  2GML A;  4DLE A;  3DOK A;  1MW7 A;  3HSJ A;  2V8G A;  1FDN A;  1ZM3 A;  4AXI A;  5GAD U;  3KUG A;  1VQN S;  3MAA A;  4DQI A;  3D5M A;  4B9U A;  2QL5 B;  3GCX P;  2F63 A;  2VOP A;  2L3M A;  2VIC A;  5A2Q Y;  1FA0 A;  3FFI A;  3VHQ A;  3I6P A;  1TL3 B;  2BJ1 A;  4RUB A;  4R5P A;  3MM6 B;  1VQO S;  1PYS B;  3M30 A;  1X4F A;  2G2Y A;  1BHN A;  1S1V B;  3UW1 A;  1ZM9 A;  4WFY A;  2HQF A;  3NCR A;  2J8A A;  1XNR J;  1I6J A;  4WII A;  3B54 A;  3OFG A;  2DXF A;  1SL1 A;  1L3T A;  2HVE A;  5AE1 A;  2XM3 A;  1S1W B;  1OYE A;  2ZM6 F;  1PKU A;  4NPO A;  5K14 A;  4C48 A;  5J2M B;  1RAO A;  3AD9 C;  3J80 Y;  3GYN A;  5LT5 A;  3M2U A;  1YSJ A;  1NK0 A;  2HEK A;  2ZOG A;  3R5J B;  4DX6 A;  1IUJ A;  4IFY B;  1SJR A;  1V3Z A;  2X3G A;  1QTM A;  1TV6 A;  2D3O R;  3IBC B;  4HL9 A;  2E9R X;  1WOS A;  2MZS A;  2C2R A;  2KDO A;  3HMJ G;  2OMO A;  4USJ C;  1QD1 A;  2VQE J;  4DR7 F;  3PKM A;  2UVR A;  3SEO A;  1DQA A;  5J2N B;  5I42 B;  3HHN B;  4G6V B;  3VAM A;  3IN5 A;  2OPP B;  1YJT A;  1CJK A;  1JLC A;  2E7X A;  3PFO A;  3MD3 A;  4EU0 A;  5G0R A;  2NYI A;  2RRN A;  4LF9 F;  1Q5Y A;  3FBE A;  5HRO B;  4P72 A;  4NZ0 A;  5LMN F;  2KHD A;  2CQ0 A;  3AOD A;  5KT4 A;  1T9Y A;  4ID8 A;  4J9Q A;  2G0C A;  5ITH A;  5CYM B;  2J0X A;  3BRE A;  2LKZ A;  1QAX A;  1JNZ B;  2W7O A;  3ZNJ 1;  2VUG A;  4ZVP B;  3BGU A;  2HS3 A;  1TFY A;  7FDR A;  7FD1 A;  1HBN B;  3GWC A;  2YKQ A;  3SYZ A;  1RWV B;  3T9N A;  1VQY A;  1D3W A;  4DUT A;  2QN6 B;  4ANE A;  4LBP A;  5K8P A;  5DDO C;  2PEH A;  4PAB A;  3UFC X;  1P9Y A;  5J1E B;  4V19 X;  3ZTQ A;  4B3R F;  4WU2 A;  4J37 A;  2Q6B A;  3D9B A;  3D6H B;  3I55 S;  1HW8 A;  5HJX A;  1GTH A;  3W65 A;  4ZA1 A;  1RWX B;  4IH5 A;  3KOA A;  3CIZ A;  1PC4 A;  4CT8 A;  4LRC A;  2I6W A;  5E33 A;  2XQC A;  4C97 A;  3MMC A;  1WF1 A;  3T3F A;  4F50 A;  3HJF A;  1UKU A;  3OQ2 A;  2XMM A;  4HHH A;  4AE5 A;  4RW8 A;  2EFQ A;  4DL2 A;  1DTT B;  1OQ3 A;  3VQT A;  4FP9 A;  1AZS A;  2CZ4 A;  2K1R B;  2PI4 A;  5L9X A;  5DQI A;  4ZJO A;  1EKR A;  4U7C A;  3P4U B;  2Y3Y A;  3N01 A;  4B3O A;  1AT1 B;  4X66 J;  5H9E K;  1FWK A;  2CJX B;  1ZM2 A;  4CIO A;  2FHM A;  4NLG A;  5BR8 F;  2F40 A;  2ADB A;  3FZ2 A;  3RR8 A;  3FGV A;  2E29 A;  1NME B;  3HHE A;  2PFD A;  4F0K A;  2M9K A;  3F41 A;  2E5J A;  4WFZ A;  2AGP A;  4CP5 A;  3RB0 A;  3BF4 A;  2RF2 B;  1N34 F;  3HHL D;  3QO9 A;  3MFI A;  1HHS A;  2IBK A;  1TKT A;  3MCS A;  3NP5 A;  1M5K C;  4F36 A;  3KLG B;  2DJW A;  4OX7 A;  1IBC B;  3MMB A;  2RML A;  4RW6 A;  5DQH A;  1CS4 B;  3UDL A;  3HHL A;  1CJT A;  4LSN B;  4JI4 F;  3HKW A;  2FB0 A;  2V4J B;  5LMU F;  3I96 A;  1HQE B;  3EVO A;  3V6H A;  4BCA A;  2DHX A;  4NWB A;  4P2S A;  2J0S D;  3V81 A;  1F3F A;  4ZVQ B;  2RDJ A;  4ZVE A;  4P9S A;  1AA1 B;  4USM A;  5IT4 A;  3J80 U;  2KRB A;  1YIJ S;  2CQH A;  1HNV B;  2J7W A;  4TY8 A;  4IDK A;  4PG6 A;  2P9G A;  2QA2 A;  2IMO A;  2ZD1 B;  3C3L A;  2RUG A;  3KG1 A;  3ZFV A;  2KHC A;  2MEW A;  2CPD A;  1S6O A;  1FRX A;  1U1R A;  4CLP A;  1RTI B;  3OUY A;  3EM1 A;  5HAO A;  1N0V C;  4YDX A;  3HX9 A;  3TZZ A;  4NOH A;  2MKJ A;  4NCB A;  2DTJ A;  3PVX A;  4HR2 A;  5HSP A;  2BJD A;  1KR4 A;  3H25 A;  4UZC A;  4HYK A;  2R4F A;  4KR0 B;  1TKZ A;  2C3U A;  5KFQ A;  4IFV B;  1JKH A;  3QAE A;  3HVT B;  2IYG A;  3CUL A;  1NDP A;  2IFX A;  5AE2 A;  4KFB A;  2R2U A;  2HHH J;  2ZH5 A;  4OV1 A;  2OPQ A;  3LQV A;  2Q66 A;  2AYE A;  2WB1 D;  2C2K B;  1SQG A;  4AYB D;  4YS2 A;  3PM9 A;  4FZV A;  2HVI A;  1HBM A;  1S9G A;  1EET B;  3NGU A;  4RW4 B;  4QWB A;  5A8W A;  3IXQ A;  1FDB A;  3ITH B;  3C6U B;  3GIL A;  1HMV B;  2EFN A;  2KU7 A;  4OLO A;  3N0V A;  3KDO A;  2XO6 A;  2F8H A;  5KG4 A;  2FJW A;  1SKU B;  4PEO A;  2EVZ A;  4CLU A;  2OH2 A;  2UUT A;  3U02 A;  5K20 B;  2OLW A;  2LFV A;  3G8Q A;  2QSF A;  2MZJ A;  4ZCI A;  2QYC A;  1X5P A;  2K06 A;  2HQC A;  5D0G A;  3KHH A;  3B4M A;  4IG3 B;  2MZQ A;  4DHV A;  3UNG C;  1HBO B;  1ITP A;  3K57 A;  3PO5 A;  3W60 A;  3EYZ A;  1N32 J;  2ZUG A;  2XMT A;  1X4E A;  1JJ2 R;  3U1L A;  3UWT A;  2V2Z A;  3R1L A;  1T03 A;  2ZJQ Q;  3KJF B;  3OLA A;  1UZD A;  4ECW A;  4L3N A;  5FD1 A;  2IPO B;  4QR0 A;  2RU3 A;  3RW6 A;  4U7U K;  3BM7 A;  1FRM A;  1KTV A;  4FS1 A;  5DG8 A;  1K1S A;  4ZN3 A;  1YJ7 A;  4LFA J;  2OIH A;  1I5O B;  4Y34 A;  3AB2 B;  2ZVI A;  3BBC A;  3H90 A;  3WX8 A;  2FDN A;  3V4I B;  3CDW A;  5BYS A;  4DUY J;  1RHU B;  2CQC A;  2HFZ A;  4LBI A;  1S7H A;  4Z37 A;  1NHU A;  5HAN A;  1RJJ A;  3OBI A;  1IKW B;  5DET A;  4CYU A;  3KJQ B;  2E1M C;  1O5J A;  1RB0 A;  4DR4 F;  1DAR A;  4G1I A;  3H7H B;  2DHS A;  2VPW B;  3SQG A;  1N54 B;  1EIY B;  2YWE A;  1G2E A;  3W66 A;  5BYQ A;  2M8D B;  1JLB A;  3FMW A;  3OW2 R;  4KH1 B;  2OSQ A;  2RRB A;  3EUN A;  5J2Q A;  2DNR A;  4OZ0 A;  1WG5 A;  2IAJ A;  3MCN A;  3IAM 9;  1CVJ A;  3ILI A;  4GO5 X;  1RT7 B;  1QJH A;  3RU0 A;  2NXE A;  4PXD A;  3NWG A;  2QC3 A;  1RTH B;  4DSE A;  1BQN A;  2PFF B;  4CTA B;  2BJ3 A;  5IXU A;  1T3N A;  2EFO A;  5H1S V;  2ZH9 A;  1IKX A;  3VAK A;  1VQ6 S;  4RW9 A;  4MJK A;  1RAA B;  2HKE A;  4RNM A;  2EWH A;  3QRQ A;  5KAK A;  2UXD J;  4MK8 A;  3VTI A;  2CPJ A;  3MED B;  3DC2 A;  2Y0S D;  2BW2 A;  2D1C A;  2MKK A;  2N7Y A;  3IM9 A;  1NDC A;  3D7S B;  3HLU A;  1NK4 A;  1S77 D;  5A0Y B;  4X2B A;  1KVI A;  1FT8 A;  2RE1 A;  1RKI A;  1ICE B;  3ZXW A;  3PHE A;  2B56 A;  5C2G A;  3CCL S;  3J7Y U;  1B99 A;  5KFR A;  4JUZ A;  4Y6I A;  3BV8 A;  4ECS A;  3R2D J;  4M5N A;  2FTR A;  4P74 A;  2M3D A;  2YKN B;  4R8U B;  1RXO B;  3FBF A;  4DBQ A;  4NI2 A;  2LVW A;  2ZH6 A;  3HPO A;  1GMW D;  4YY3 F;  2XG8 A;  1S1U B;  4B3S F;  2HMI B;  2HYI B;  3GSI A;  3HP6 A;  5FII A;  4OZL A;  4HTI A;  3QAT A;  3KLI B;  3MEG B;  2ZBP A;  1GMW A;  1O8B A;  2VD3 A;  1GXL A;  1LK7 A;  5F3Z A;  3C14 B;  1WC5 A;  4MIB A;  1NBE B;  4RKU C;  2BR0 A;  2YWK A;  3K89 A;  1TTH B;  2PGC A;  3RGI A;  3GB0 A;  1TL3 A;  4LF4 F;  4GC7 A;  4DR2 F;  1OSC A;  3MM7 B;  3M9M B;  2BOA A;  3MM6 A;  4ZLN A;  2V69 A;  2EBE A;  2OEL A;  2Z2Y B;  4OZ5 A;  2DVI A;  3D0I E;  2DXD A;  3DLG B;  1U49 A;  1S1V A;  1H6K X;  1TMJ A;  3A13 A;  1Y3K A;  2KN4 A;  2HQD A;  1CSJ A;  5DG9 A;  3NS6 A;  4BDP A;  2WON B;  2YWW A;  4FPI A;  4ZVU B;  2EK1 A;  2AIR B;  3HKZ D;  1JLE B;  3ILO A;  3PW7 A;  1S1W A;  1Y5L B;  5J2M A;  4UST A;  1FK9 B;  3TVY A;  1YBA A;  3QZ8 A;  4QIE A;  1UVI A;  1KQG B;  1LFW A;  4AQY J;  1UEV A;  2GZO A;  5KT7 A;  2HHQ A;  2J9D E;  2R8J A;  1RUS A;  4IFY A;  2RQ4 A;  4NZ6 A;  3W63 A;  1UEK A;  4DX5 A;  3LA0 A;  1RT2 B;  1DUR A;  2RU9 A;  5HVF A;  2R7T A;  1U48 A;  2NPF A;  3CJ5 A;  1XBW A;  2PE8 A;  1RAE B;  3LF0 A;  2DCL A;  3K8V A;  5J2N A;  5I42 A;  2YNF B;  4J9S A;  2OPP A;  1SH0 A;  2DPI A;  4WJB A;  5CH7 B;  1PGZ A;  3I9Z A;  5CA5 A;  3B78 A;  3WIU A;  1FFW B;  3D6T B;  2KG0 A;  2YKO A;  3T1Y F;  1UJ4 A;  4NXM J;  5HRO A;  1Q5V A;  4RX6 A;  2LA4 A;  4QYZ J;  5KFK A;  4C9D A;  4QWE A;  2KJW A;  3CCE S;  5LJ5 Y;  3VF0 B;  1FJ7 A;  5CYM A;  1BWE A;  4DR5 J;  3BN7 A;  2DHH A;  2VBZ A;  2DRD A;  4M5J A;  3LGH A;  1TUV A;  3OR2 B;  4XPC A;  4OIX A;  1HBN A;  3AB4 B;  4C0B A;  2FC8 A;  2VHG A;  4Y2A A;  3PTW A;  2E9Z A;  2ASY A;  1N36 J;  4KHM A;  1UJ6 A;  2E7V A;  1HWI A;  3CD5 A;  1RWK B;  5J1E A;  2XCA A;  2PA3 A;  3V6J A;  4DQQ A;  2JJ4 D;  5RUB A;  2ZHB A;  4HVZ A;  1B0P A;  2DH9 A;  2P2C B;  7AT1 B;  4A8K A;  4KH0 B;  4GVB B;  1FRH A;  2J7U A;  1LWF B;  3ISZ A;  1HHQ A;  1KQS R;  2C3M A;  3R2C J;  1Y4Z B;  1DTT A;  5HLF B;  2CAJ A;  2C28 A;  3DMJ B;  4OV6 A;  3AFG A;  2K1R A;  2ZKT A;  1X4H A;  2W9B B;  4OZ3 A;  3UI3 A;  4EO8 A;  2WAQ D;  1WUU A;  2CG4 A;  5D8H B;  3RW7 A;  5B0E A;  2AMC B;  5C5J A;  4ILR A;  1URR A;  2J7K A;  2LQ8 A;  1VQ8 S;  4ELV A;  1RT1 B;  3KHL A;  4B9N A;  2ZBI A;  3AJ1 A;  3WC2 A;  3KMQ A;  4ZVT B;  2KFZ A;  1B70 B;  3FC9 A;  3QGP A;  5ETK A;  4ZIT A;  4MK7 A;  1NU4 A;  3SMZ A;  5B0D A;  5M2R A;  1EAR A;  1NJZ A;  2CRL A;  1WHV A;  5KFH A;  2RF2 A;  1SQE A;  4BWM A;  5E3Q A;  2A10 A;  2BJ9 A;  4DSI A;  1B0V A;  4YB1 P;  3ZZ0 A;  3N4W A;  4M5D B;  3KLG A;  4ED7 A;  4RBV A;  3DGP B;  4TU8 A;  3LTO A;  3BKF A;  1CS4 A;  1AUD A;  4LSN A;  5EX0 A;  2V4J A;  1K73 T;  1HQE A;  2F7V A;  2GW8 A;  4LRE A;  3FK4 A;  4DR1 F;  1P9Q C;  3GJS B;  1R8A A;  1PJ6 A;  1NUE A;  1RYR A;  1XNR F;  2KZM A;  3EGV A;  4RW7 B;  3RR7 A;  3V6D B;  5JMN A;  2EPI A;  3L7P A;  1FF2 A;  1WD6 A;  3PW5 A;  2IHR 1;  3GFZ A;  1S59 A;  5D15 A;  2ZD1 A;  4DL5 A;  5E2Q A;  4A48 A;  2JRS A;  1CC7 A;  1WNE A;  2PMZ D;  2QA4 S;  2ZIT A;  4A8S A;  4DPU A;  1RTI A;  5KG2 A;  3GE9 A;  1FNX H;  1UEU A;  2G13 A;  3UQS A;  2A2C A;  1U2R A;  2BE2 B;  3IGV A;  3IRX B;  3PCO B;  1FJE B;  2RNE A;  4WP3 A;  4ZP7 A;  3CC4 S;  3W8G A;  3DFE A;  1WWH A;  4KPC A;  4TN2 A;  2HNZ B;  1TL4 A;  1TUW A;  1JXL A;  1SJ3 P;  4IFV A;  2QLW A;  2VG6 B;  2GJI A;  1FJG J;  3HVT A;  2VQE F;  3AJD A;  3DRY A;  3UDC A;  4DOZ A;  2ZC3 A;  2BEF A;  1VRT B;  3CO9 A;  4ZMM A;  3GR1 A;  1VOM A;  2YNH B;  2ZH4 A;  2CQG A;  4YB6 A;  1EET A;  1ZPV A;  4RW4 A;  1Q53 A;  2EKY A;  4F4Y A;  3ITH A;  3C6U A;  1RAB B;  3QT7 A;  5CAA A;  1HMV A;  2VIH A;  2WVC A;  3THV A;  4LF2 A;  3ADA C;  3US5 A;  1RU1 A;  4Z7Y A;  2B43 A;  4YHH F;  2GX8 A;  4K5S A;  1F9F A;  4DQP A;  2IJF A;  4DMZ A;  4KGZ B;  1JMT A;  3NNC A;  5LSO A;  1NSP A;  4M94 A;  4DPW A;  2QA4 G;  5KFS A;  5KFY A;  2EFV A;  2WOM B;  1HI0 P;  4XK8 C;  3PV8 A;  2F8M A;  4KGV B;  1TU0 B;  2DNK A;  3S01 A;  4UOC A;  2QTW A;  3KFW X;  1HL6 A;  1J5E J;  1LK5 A;  4IG3 A;  1HBO A;  5GMK a;  1RAG B;  4EFA C;  2L48 A;  3RB6 A;  5DZ6 A;  4MFB A;  3VGS A;  1FNO A;  4K8R A;  2D74 B;  1UMJ A;  1X4C A;  2NUH A;  4Y2M A;  2I2Y A;  1WOP A;  1KQF B;  3JQK A;  2EXU A;  4DXL A;  2YWF A;  3IO1 A;  1ROF A;  2HS0 A;  2CZ9 A;  5F8J A;  3NS5 A;  3V4I A;  4QR1 A;  1CPZ A;  4FYX B;  2ZJR Q;  2EG2 A;  2LXI A;  2W2P P;  2Z2Z A;  4KGX B;  2IVF B;  2NYH A;  4A8M P;  2DR5 A;  4E0D A;  4QOT A;  2XCP A;  2GMJ A;  3KNG A;  3IWL A;  1RCO B;  2J76 E;  3CT9 A;  5KT2 A;  1IKW A;  1GTE A;  4QZV B;  2MPU A;  3GMG A;  2FY8 A;  2EW9 A;  5DRK A;  4UQT A;  2EFG A;  5DQG A;  1TL1 B;  3PY8 A;  2V5H G;  2ZJP Q;  1N48 A;  5U47 A;  2CWX A;  4RNF A;  2HBZ B;  3ZZZ A;  3NEK A;  2OO4 A;  2AEM A;  3MR7 A;  2RRA A;  3L95 X;  4USV A;  2EK6 A;  4OYM A;  1RT7 A;  3DOL B;  1KS2 A;  3GV5 B;  2QX0 A;  3W64 A;  1RTH A;  3PRD A;  2B3T B;  1VS3 A;  4CTA A;  3N6M A;  3R27 A;  4N77 A;  4Q45 A;  4Q0B B;  1N5Q A;  1KFD A;  1VK8 A;  4ECZ A;  2ZBC A;  4URG A;  3GV7 B;  2XYP B;  4OYO A;  4C6A A;  2WSC C;  4YN3 B;  4CNZ A;  3QYY A;  3HVW A;  3MED A;  1KC8 T;  3OSP A;  1YRX A;  3ET6 B;  3N9U C;  1KOO A;  2Q43 A;  1UJ5 A;  2ZNZ A;  3UDV A;  4PWU A;  2W25 A;  1UET A;  1PSD A;  1SJ4 P;  2MKY A;  3C15 B;  2BE7 D;  4TYB A;  5A0Y A;  4F2S A;  2OFG X;  1QVG R;  4YQW A;  2KVQ E;  2IA0 A;  1X0P A;  2EBG A;  4HHJ A;  3LAL A;  3DI6 B;  4YFU A;  3FZB A;  4E2F B;  1UVK A;  3EMT A;  2DNL A;  2RT3 A;  4FXV A;  4I2P A;  4DX7 A;  2MKS A;  2ZDP A;  3CMQ A;  3MHY A;  4Q2L A;  2YQ1 A;  3JSY A;  1TAQ A;  2YKN A;  4R8U A;  1H3D A;  2AQ4 A;  5CYJ A;  3KLE B;  2Y1I A;  2RDD A;  3OFE A;  4M5I A;  2R8H A;  1WTF A;  2HHH F;  1WHX A;  4J7C A;  3FCV A;  4B9L A;  3G6X A;  1S1U A;  1Z1Z A;  2FJE B;  3NOC A;  4NA2 A;  2A6M A;  2HMI A;  5I3P A;  3W8P A;  2FLL A;  1RWO B;  3KLI A;  3MEG A;  3Q8Q B;  3T1H J;  2Z0G A;  2BAB A;  3D1O A;  3ZZT A;  2V4Q A;  3C14 A;  1AW0 A;  2ATL A;  3R5A A;  1UW9 A;  1AFJ A;  1QSL A;  2BJE A;  2UUB J;  2V34 A;  5D4L A;  1REV B;  4DR6 J;  4NYZ A;  3MM7 A;  2AP6 A;  5GAD I;  3KK1 B;  1MWQ A;  2RB7 A;  3OTO J;  5G4D A;  1S9E B;  3DLG A;  1JNR B;  1KVJ A;  4WPA A;  2DR6 A;  1SBR A;  5HMW A;  1Q0N A;  1VCT A;  4MYT A;  2IM0 A;  4LFC J;  2KI2 A;  2YX1 A;  2WON A;  2HUR A;  3TA0 A;  1V3R A;  1JLE A;  3Q8U A;  1N32 F;  4K4U A;  2ZHA A;  3RBZ A;  4F4W A;  4N5S A;  1FK9 A;  1Q8I A;  3W2V B;  4ES1 A;  4Q7A A;  1MN9 A;  4B08 A;  2GS8 A;  4KKO B;  4BWJ A;  2XO7 A;  5D3G B;  2WBR A;  4CZC A;  3JSB A;  4LFA F;  1IWA A;  2HGM A;  2LCW A;  3FEX B;  1NAQ A;  2C2M B;  1RT2 A;  2FJV A;  3ISN D;  2W8K A;  1NB7 A;  4DUY F;  4PUO B;  1NM2 A;  3KK3 B;  5IFM A;  2MKH A;  3I0R B;  2KT2 A;  2B4P A;  4IUF A;  1M5O C;  3GTY X;  4LQ3 A;  4EI2 A;  2YNF A;  4ZN1 A;  3I4P A;  1RWM B;  4NLD A;  2OHD A;  2BJ8 A;  2AD9 A;  2ILY A;  4YME A;  3BYP A;  2DNH A;  1EP4 B;  1L3S A;  2DH8 A;  3CC2 S;  1YJW S;  2FJB B;  2U1A A;  3LPE A;  5J1N A;  4RL1 A;  1IR1 A;  1WC0 A;  4KE5 A;  3UR3 C;  2K7K A;  4GKJ J;  3NGR A;  4RPF A;  3ZZP A;  3K0J A;  4RU2 A;  4QYZ K;  3OR2 A;  4O3N A;  3R7N B;  2RS8 A;  4XPE A;  3R5G A;  2CQI A;  2HGN A;  1X4B A;  2GA7 A;  3IRW P;  1S7I A;  5KFN A;  4ZLJ A;  2V68 A;  3EXY A;  2QEX S;  3MWB A;  2AV5 A;  1TAU A;  2KZZ A;  2HIY A;  3MR2 A;  1VK3 A;  2FVQ A;  1T0T V;  1Y5I B;  5KFJ A;  5L38 A;  1SB6 A;  4H54 A;  2GJ2 A;  3QMQ A;  2UXD F;  4I56 A;  2GFF A;  1QAY A;  1W25 A;  1P6T A;  3VAL A;  1QY7 A;  2NLW A;  2W9C B;  4GVB A;  2V8H A;  2NRE A;  2AJQ A;  2VF3 A;  1LWF A;  1FRJ A;  4NEZ A;  4DFK A;  3OXF A;  3NCQ A;  5HLF A;  4CO1 A;  3DMJ A;  3OTD A;  4WZM A;  1BGX T;  2WCX A;  4ZIV A;  2W9B A;  2ZUA A;  3N79 A;  2ZKU A;  2UU9 J;  1RI7 A;  3E2E A;  1H0H B;  3R6G B;  3P96 A;  1RLC L;  4O44 B;  3A3N B;  1H74 A;  4PZV A;  3HVR A;  5B0B A;  5KFD A;  1N5T A;  1RT1 A;  4JI6 F;  4CO5 A;  2A6O A;  3PIO Q;  3OVS A;  1YVF A;  3QIP B;  3CDE A;  3GFY A;  1MSW D;  3I0S B;  4JB8 B;  2OGU A;  4IOA Q;  1R8C A;  5AXL A;  2NSB A;  5DDP C;  2W9A A;  3CTR A;  2LQ5 A;  2H4Y B;  2DRB A;  4ITS A;  4M5D A;  5K5M A;  3DGV A;  3OLB A;  3IFE A;  4F2R A;  3DGP A;  8AT1 B;  2YH1 A;  1TMM A;  1N5S A;  1NDL A;  3WDO A;  3RJM B;  3P49 B;  1WJ9 A;  3GSD A;  1CJU B;  4Z2X A;  3C16 B;  3OR1 A;  3X3U A;  2G0I A;  3W9J A;  4NLT A;  1F0X A;  4B3R J;  1MWZ A;  4RW7 A;  3V6D A;  2Z2M A;  4QU7 A;  2QSW A;  4E8U A;  3W61 A;  1BQM B;  3GZ7 A;  2JSX A;  4QIW D;  3GV8 B;  1U02 A;  4DG1 B;  5DDQ C;  3ZTS A;  4AQY F;  2DGX A;  3CD7 A;  2MHE A;  2BE2 A;  2YX4 A;  5K8O A;  3IRX A;  1CUL B;  1RAF B;  1ZAW A;  1PC5 A;  3TQE A;  3TZY A;  4ECX A;  2UV8 G;  2BZ2 A;  1KTQ A;  2HNZ A;  2OEK A;  3EE3 A;  3WZ0 A;  3UCU P;  4HI2 A;  2VG6 A;  1HA1 A;  2DEJ A;  4FNI A;  4DS5 A;  4PKD B;  1UA1 A;  4ETX A;  3VAJ A;  2DY1 A;  4KYZ A;  2UP1 A;  4L73 A;  3MAH A;  3TOQ A;  1UW4 A;  5BR8 J;  4NMX A;  2POK A;  1MWY A;  3DRR B;  2VKZ G;  1VRT A;  3Q86 A;  2RD5 C;  2C2Z B;  4NXM F;  4QIV A;  4F7V A;  3QSI A;  2YNH A;  4CO2 A;  4P10 A;  2HHP A;  2PT0 A;  4J9R A;  3IR7 B;  2E1C A;  4CRJ A;  3MPW A;  3RTV A;  3WX4 A;  2JEJ A;  3PG9 A;  4DR5 F;  3FFI B;  5KFM A;  4W98 A;  3DDN A;  4ES2 A;  4WXO A;  1NK5 A;  2QL9 B;  5LMU J;  4XAK A;  2WOM A;  1LW0 B;  4BC9 A;  4ZVO B;  4F04 B;  3LP2 B;  2YNI B;  3VGT A;  5C2C A;  5HJY A;  1C4A A;  5DG7 A;  2NQP A;  4CWB A;  3W62 A;  2ZZN A;  3H40 A;  5LJ3 Y;  4C0H A;  5J1P A;  1O0P A;  3BYR A;  4LF6 F;  1VLY A;  2H54 B;  1FKO B;  2W4C A;  2ZC4 A;  5IV4 A;  4OJH A;  5E41 A;  4DV1 F;  3PW4 A;  2DNG A;  1RHJ B;  2PO4 A;  2D9O A;  4LT6 A;  1Q79 A;  2UUW A;  3ELH A;  3EPI A;  2KM8 C;  4ZHR B;  1QSY A;  1YX2 A;  4RWW A;  3I32 A;  2DIS A;  2WB4 A;  3MI7 X;  1R6Y A;  4F4Z A;  2HLU A;  4JV0 A;  2ZOF A;  2F8E X;  2HIQ A;  5GME A;  1Q4R A;  3ZNU A;  2YWG A;  1TL1 A;  4F3Q A;  5HVH A;  4OJG A;  1D1U A;  1T9V A;  3HI9 A;  3Q8V A;  1TK0 A;  3DLB A;  5KT6 A;  2YX7 A;  1RA7 A;  1XQI A;  4DV4 F;  3DHX A;  2XYH B;  3DOL A;  5F0U A;  4IRK A;  2VKR A;  4I6W A;  3S6E A;  3P5B P;  3LWM A;  2WK4 A;  2QLB B;  3K5P A;  4Q0B A;  3J7Z T;  2X3D A;  2FJA B;  5BYR A;  2LQ9 A;  2LLZ A;  5KG1 A;  4DL7 A;  3RG6 A;  1H2T Z;  2WVF A;  3OD2 A;  3C46 A;  4WTY A;  1ZTT A;  3MCO A;  1XC9 A;  1KEK A;  2O01 C;  2CJQ A;  3RBD A;  2RIJ A;  4L72 B;  4KGK A;  3ET6 A;  2W01 A;  2V2K A;  3W7B A;  3C15 A;  3LP1 B;  2KG1 A;  2W8L A;  3DI6 A;  4IQM A;  1C0T B;  1HFE L;  2H5I B;  1X9S A;  2C3O A;  2YVS A;  4TVA B;  4ENO A;  1NJI T;  1VQL S;  5CHC B;  3OJS A;  1B4S A;  2FHK A;  5AT1 B;  3IC1 A;  1F2H A;  1FJG F;  2V9K A;  4WTO B;  3BGO P;  2F5G A;  3KLE A;  4J9L A;  1UVN A;  5KFP A;  1VQS A;  2SXL A;  1R27 B;  1SXL A;  3MUV P;  3KUE A;  2XLJ A;  1O51 A;  4JI0 J;  3KLF B;  3TJ9 A;  2G0J A;  8RUC A;  3A12 A;  5HL7 Q;  3HFV A;  3QID A;  4FBU A;  3CCR S;  1R8P A;  1RYS A;  2ZWP A;  5EX3 A;  3ZZY A;  4XO0 A;  1F5C A;  4Z7C A;  1HD0 A;  3CCM S;  3DHW C;  2BM0 A;  4EEY A;  3PAC A;  3NXZ A;  5D4O A;  3L4B C;  3D67 A;  1MML A;  3IS9 B;  1REV A;  3E8O A;  3BQ1 A;  3MUM P;  3KK1 A;  3TZX A;  1KLN A;  2NZ4 A;  2JLG A;  4LRB A;  1S9E A;  2C2N A;  1HBU B;  4DF8 A;  2VJV A;  3HHD A;  1LV5 A;  2FGC A;  3TAN A;  3S8S A;  1KNZ A;  3M05 A;  1U8W A;  2VPY B;  3BPS P;  4HKQ A;  4HHU A;  3V81 B;  2LYV A;  1XTZ A;  1J5E F;  1B64 A;  3H4D A;  1C0U B;  3GJQ B;  1XR7 A;  2FZK B;  1YZ7 A;  1JJH A;  3I5A A;  4B3T J;  2VB6 A;  4M5L A;  3W2V A;  1H7X A;  1TVR B;  4YP3 A;  4KGM A;  2KTQ A;  3IAS 9;  2XZT B;  4EZ6 A;  3M6X A;  2QLJ B;  1W26 A;  4KKO A;  1FO1 A;  2R7V A;  4ZVS B;  4OYX A;  5D3G A;  3UCG A;  1L3U A;  4GVL A;  3SIP B;  4DV6 J;  2OD4 A;  4A8O A;  1XK8 A;  1VQ9 S;  1TR0 A;  1FX4 A;  4WWS A;  2Y1R I;  4WKY A;  4PUO A;  2CQD A;  3UD5 A;  3KK3 A;  2FJX A;  2UUC J;  3M9O B;  1YJU A;  3I0R A;  3OV7 A;  4FDF A;  4NLV A;  4X62 F;  3R7B B;  2GQQ A;  1VMB A;  1GX5 A;  4UT4 A;  3OVA A;  1FTR A;  3M6U A;  2GC8 A;  2YXL A;  3TRG A;  3CJK B;  1ZET A;  2H51 B;  4FXW A;  3HT3 A;  3GIR A;  4DQS A;  1LFP A;  4MT1 A;  1X7V A;  3OXG A;  1WEX A;  5B0A A;  3BSA A;  2OAU A;  2VC0 A;  1EP4 A;  3UR0 A;  2DNZ A;  2GIF A;  4USI A;  4B9V A;  1RQ0 A;  3FEZ A;  1OWX A;  1IM6 A;  2ALZ A;  5EWG A;  4DV2 F;  1NXI A;  2CPZ A;  3PRV A;  3I82 A;  4DI6 A;  3BEG B;  4U95 A;  4UOG A;  5HVG A;  4A46 A;  2UXB J;  5KFE A;  3CJT A;  3GR0 A;  5CZX A;  1LNQ A;  5SUH A;  2VOD A;  5KFO A;  1RT5 B;  3I9V 9;  4NLQ A;  1HQU B;  1NO8 A;  4DCP B;  2XMW A;  1F9H A;  2BE9 B;  1FE0 A;  2K8G A;  4EUV A;  4DWI A;  4J5O A;  4EYH B;  3IMQ J;  2X51 A;  3SCJ E;  2FIU A;  1VFJ A;  4RU9 A;  2W9C A;  1RIS A;  1U45 A;  1RHQ B;  3PYF A;  2RDI A;  4KB7 A;  2YH0 A;  3AJ2 A;  3KJN B;  4QPX A;  4BC7 A;  4TU7 A;  1F5A A;  2E5L F;  1HLW A;  1FVQ A;  3K5M A;  3D54 A;  1NKB A;  4OZ2 A;  3Q8P B;  1M5P C;  2E66 A;  4O44 A;  4ELT A;  2QYG A;  4K4X A;  3CD0 A;  4XTT A;  2J9C A;  4X4N A;  1OPZ A;  3ZC4 A;  3QIP A;  2PII A;  4G3I A;  2RQC A;  1HW9 A;  2C22 A;  4U8V A;  1RBO B;  3I0S A;  2CUY A;  4IO9 Q;  2XGQ A;  5B09 A;  4ED1 A;  4C2M A;  4H4K A;  3BO2 A;  2H3E B;  3EGN A;  2C2O B;  2UUB F;  4DR6 F;  3CMA S;  4V1A k;  3BN4 A;  3OTO F;  3P6Y C;  2ZOM A;  4NLX A;  1NRK A;  1CJU A;  2H48 B;  3FRY A;  4OLP A;  4OYZ A;  5D4N A;  3C16 A;  3BSO A;  2MSS A;  5KFC A;  2JFD A;  1QAJ A;  4DL0 C;  3HO1 A;  1HNI A;  3AA9 A;  1EHW A;  2XTJ P;  2BBE A;  3GU0 A;  4ES3 A;  3FDS A;  4J90 A;  3PXG a;  5CD4 A;  4HDH A;  2E1A A;  5DS7 A;  1BQM A;  3QRR A;  3HFK A;  2R2R A;  5C24 B;  1WI8 A;  1QUV A;  2XSF A;  4DG1 A;  3HZG A;  4UF4 A;  1YG0 A;  3R5B A;  1WF2 A;  4DU8 A;  1CUL A;  1S0N A;  3MTJ A;  4K4T A;  1K9M T;  2DR7 A;  6FD1 A;  1BUX A;  5L1L A;  4N7T A;  1FXL A;  2HFO A;  1BE4 A;  3TVZ A;  2VFR A;  2FC9 A;  2V9W A;  3WC0 A;  3QJP A;  4ED8 A;  3HD2 A;  2FQQ B;  3DXB A;  3WQP A;  2J6U A;  3DRP B;  2ZNY A;  4OJ3 A;  2FUG 9;  2NXJ A;  2DGT A;  2HW3 A;  4DS4 A;  2ZZT A;  3DRR A;  1TZ0 A;  4PWD B;  4FF2 A;  4Q8F A;  2LP4 A;  3ZO7 A;  3P8B B;  4DFM A;  3EJM A;  5LL6 d;  3MAQ A;  4IYQ A;  1VC5 A;  4C8L A;  2ZEJ A;  2IRX A;  1GMV A;  1XNQ F;  5F8G A;  4NYP A;  4CLS A;  4GKJ F;  1U1M A;  2XLK A;  2B6A B;  2O3D A;  1RT4 B;  1VR6 A;  4C98 A;  1YRT A;  1W2I A;  4IOC Q;  3FSX A;  3OTC A;  1NK8 A;  3CE8 A;  2IIH A;  3QZ7 A;  1B3T A;  1OSD A;  1YI2 S;  3R5D A;  4USW A;  1LW0 A;  2FVR A;  5HO4 A;  3TEH B;  4DR1 J;  2AJ2 A;  5F8L A;  2J6T A;  1Q95 G;  4A8Q A;  3H5S A;  4DV7 J;  3LP2 A;  2KL8 A;  2MLY A;  3CCJ S;  2YNI A;  2GVZ B;  4K50 A;  3UN2 A;  1SC4 B;  3VVT A;  1T8E A;  3FNN A;  2DIU A;  3A1Y G;  3AAW B;  4IOB A;  4O4G B;  2ATC B;  4O3S A;  2XMK A;  1XMO J;  4IQX A;  2VU5 A;  3R6L B;  3ZTR A;  3R8Y A;  3CCU S;  1FKO A;  3QGI A;  1BD6 A;  2HND B;  3CXC R;  3KMS A;  1FRI A;  3PYE A;  5CAB A;  2X1B A;  2P5V A;  3QGH A;  3DKD A;  4N8N A;  4WFN Q;  2JC0 A;  3SFU A;  2XGP A;  4ZHR A;  1TL7 B;  4LF8 J;  1R6V A;  4M1K A;  1U26 A;  3M2V B;  4R0E A;  2UU9 F;  3Q83 A;  1D8Z A;  1WEL A;  3MFH A;  1OIA A;  4HAC B;  1FXD A;  1TEL A;  5E0O A;  3NRB A;  3RRK A;  1Q8B A;  5A8K B;  2RSQ A;  1BXN A;  4OQJ A;  2D3Z A;  3GIK A;  4FF3 A;  1U7L A;  3BH6 B;  2XHC A;  2HFV A;  3C6T B;  5A76 A;  4OX8 A;  4FF4 A;  1NK7 A;  3NMR A;  2CVE A;  4WKR A;  3CCW A;  4CLZ A;  4LF5 J;  5B7W A;  4YHH J;  2XI2 A;  4UW2 A;  1JIH A;  2BAC A;  1XJW B;  4IKA A;  4IR9 A;  1TK5 A;  1WOO A;  3TAP A;  3ZTP A;  2X1F A;  3W9H A;  1U25 A;  3J81 Y;  2IM1 A;  2VL1 A;  3ONQ A;  2R2S A;  2J5A A;  1S49 A;  2AX0 A;  4KPY A;  1JB0 C;  4ZKA A;  2CJY B;  2JVR A;  1SL0 A;  3BDE A;  2M0G B;  3QFH A;  1S0O A;  3BQ2 A;  4EBC A;  2COL A;  3LP1 A;  5KFZ A;  3N6N A;  3SCK E;  4LRD A;  3NAH A;  1TFW A;  4ECV A;  1WG4 A;  1NLK L;  1IKV B;  1C0T A;  1QLN A;  1UAW A;  2DD8 S;  2W2Q P;  3LAM A;  5HAT A;  4GKK F;  3NKY A;  2KFY A;  4X4U A;  4L76 A;  4EGL A;  4K4V A;  2MYF A;  2WZ1 A;  2MQP A;  4E98 A;  4DSJ A;  4L75 A;  1RTJ B;  1WKL A;  1MLA A;  4IO1 A;  1FWL A;  4U67 Q;  2XLI A;  3KLF A;  5BXI A;  5HMZ A;  2ASL A;  2ILZ A;  2HPU A;  3AXK A;  2AYM A;  4DFP A;  2BKP A;  1G6B A;  1T05 B;  4DCJ B;  2CQ4 A;  1WDD A;  4I7F B;  2MGZ B;  2QMU B;  2EC2 A;  3AY0 A;  1UWA A;  1FRL A;  5K8M A;  3IS9 A;  3MZI A;  3WIV A;  3CPW R;  4B9T A;  3O2I A;  3Q89 A;  4OYA A;  2WHO A;  1HBU A;  5FLX U;  2ZBR A;  4PXC A;  3PYG A;  2BV3 A;  2AHO B;  1NKC A;  3M8Z A;  2YPZ A;  3SZ2 A;  2IY5 B;  3VVU A;  1G7C B;  1U2F A;  2J8S A;  2KXH A;  2D3O 1;  1FX2 A;  4OYI A;  1C0U A;  3KKF A;  2DR9 A;  4U9R A;  2OJ3 A;  4MKB A;  2QT7 A;  3ENQ A;  2D41 A;  1FWP A;  2BW7 A;  1TVR A;  2CPF A;  5A6W A;  3SSR A;  2KT3 A;  1NJY A;  3RB4 A;  3NGS A;  4DL6 A;  3JS9 A;  4U7U D;  2KYX A;  3FCW A;  5E7O B;  2GGP B;  1DFD A;  2F65 A;  1LW2 B;  2MQ8 A;  5M2P A;  2V6A A;  4OI2 A;  1EX8 A;  5H9F J;  3CJS A;  3C66 A;  4DX8 H;  3EX7 B;  2WW8 A;  2CQ2 A;  1NH7 A;  2QLX A;  2VFV A;  1H2U X;  1RU2 A;  3POT B;  4TU9 A;  1RBA A;  1X8D A;  2W7P A;  3W3S A;  4F0M A;  4LSZ B;  3CJK A;  1VHF A;  3CGI A;  2R9L A;  4LIR A;  1F6T A;  2ZH3 A;  2BYC A;  3HXM A;  2MDA A;  3M8R A;  3UN3 A;  4RJV A;  4C8N A;  2LEP A;  3QLH B;  3H2U B;  4QBU A;  3CO0 P;  2AZ3 A;  2FZC B;  4OHW A;  2VOO A;  1XR6 A;  1BLU A;  1QE1 B;  3LO3 A;  2H5E A;  3N5B A;  2DGQ A;  4M5M A;  5GVQ A;  2E5I A;  4QU6 A;  1DBD A;  4QIG A;  2KKH A;  3SBM A;  3J81 U;  2V8P A;  4F8R A;  6AT1 B;  1ULR A;  2XEX A;  1RT5 A;  4D3H A;  1WAC A;  5HBM B;  1FKA F;  3ICL A;  4Q2M A;  1HQU A;  1QM9 A;  1H98 A;  2M70 A;  4B9M A;  2CKW A;  3OHA A;  1KHW A;  4WYW A;  2QMX A;  1HNX F;  2HQG A;  5ETO A;  3HDS A;  4OYP A;  5KFT A;  3S7R A;  3ETO A;  4KV8 B;  2FPH X;  4DFJ A;  1JQG A;  4MFB B;  1GEH A;  1FES A;  1R3N A;  3QPI A;  1M5H A;  5IT9 Y;  2BA9 A;  4WP8 A;  1T94 A;  2QO3 A;  3PYD A;  4PQA A;  1PAE X;  4USU A;  2C3P A;  4WBF A;  2O66 A;  3IGN A;  4RR5 A;  4C0O C;  3MDF A;  2HWT A;  4FYV B;  2N4C A;  4JI8 F;  4DZD A;  1RTD B;  2GVD B;  4JI0 F;  1A9N B;  2R7U A;  3PX4 A;  3IP0 A;  2XS5 A;  2G4B A;  4I2Q B;  3L3C A;  4M5G A;  3PW0 A;  2LA6 A;  3HUL A;  4QW8 A;  2EI5 A;  3BGL A;  4LIW A;  4M95 A;  4XIU A;  4O3O A;  5ETR A;  4P2F A;  5KT5 A;  5KTQ A;  4ECR A;  2JZ5 A;  4ED6 A;  2VON A;  3MPD A;  1JLF B;  2JVO A;  3NBP B;  2HHU A;  3ZZR A;  3EVW A;  3TAR A;  4NZ7 A;  4CH0 S;  2GHV C;  2QJ3 A;  5DO2 A;  5L1K A;  4C4W A;  2RHS B;  4OZ1 A;  1VQ5 S;  4S0M A;  4UTG A;  4X4T A;  5F9N A;  1WSV A;  1S9F A;  2QA1 A;  2HAF A;  2KM8 B;  4HDG A;  5F8N A;  4DPX A;  4Y65 A;  3O1L A;  4B3T F;  2JLE A;  1N4L A;  4B3M F;  1XEZ A;  2HNY B;  4RWX A;  2ZBQ A;  3ZTO A;  2FLO A;  2B0G A;  1VC6 A;  5C24 A;  3M6W A;  4PCQ A;  1M1K T;  4DV6 F;  4PPZ A;  3MF5 A;  4UY8 5;  2R8I A;  4FKY A;  4X64 J;  5T7L B;  3CDA A;  3M1V B;  4YEA A;  2I8E A;  3T19 A;  4A8F A;  1IXK A;  4H4M B;  4O23 A;  2HZA A;  4I2P B;  2UUC F;  1KKH A;  2EG1 A;  1X4D A;  3MR6 A;  3UN5 A;  3DRP A;  3DLE B;  1ELO A;  4K0K J;  3PJ9 A;  4NML A;  3QT6 A;  4ZIW A;  5B0G A;  4JI6 J;  3TYT A;  2AWZ A;  4PWD A;  1IQZ A;  3QSY B;  1DAX A;  1RSC A;  3DDI A;  4ZCK A;  1UFW A;  3CDB A;  5M2U A;  2HHS A;  3MM5 B;  2RQK A;  3M4X A;  1SVD A;  3H2V E;  2V50 A;  2YKP A;  2DNQ A;  5HP1 B;  3IWN C;  2Y8Y A;  2HHV A;  2B6A A;  1RT4 A;  4AND A;  2CYY A;  2UXB F;  2YQ3 A;  2D9P A;  4MH8 A;  4X4P A;  3K7R A;  3SSS A;  2FZG B;  1FD2 A;  2CA9 A;  2W4D A;  4LR9 A;  1FDA A;  1X5O A;  2MQQ A;  2ZH2 A;  2E9T A;  2C2D A;  1IBL J;  2GVZ A;  1BWV A;  1U1L A;  2J9D A;  2B8Q A;  2JDJ A;  2HBR B;  5IT9 U;  5KFU A;  3IBW A;  3C19 A;  4O4G A;  5F8I A;  3AT1 B;  5E5N A;  2D7S A;  2PSZ A;  3RUB L;  3HD1 A;  5IV3 A;  3PEH A;  4MIW A;  3QGG A;  3EZU A;  1T02 A;  2HND A;  2XS2 A;  1DTQ B;  3J7A N;  2R7R A;  4PXB A;  4TKT A;  1PYT A;  1SJ1 A;  3RRH A;  1MMN A;  1XN9 A;  1Q16 B;  5AJ3 J;  2OPR B;  4NCA A;  1RDR A;  3D66 A;  1N6Q B;  1U4B A;  1VDH A;  4LVN P;  4X4V A;  4P2M A;  5HQM A;  1TL7 A;  1JX4 A;  2OEJ A;  3M2V A;  5E3A A;  4GMK A;  3DM2 B;  1W7W A;  5JUM A;  4A4J A;  2CJ9 A;  2Q1L A;  4TY9 A;  4HAC A;  1BC6 A;  3UE2 A;  3MOZ A;  3DLH A;  3FRZ A;  3L7U A;  3D1Q A;  5A8K A;  2Q79 A;  2MKI A;  4PG7 A;  2F4F A;  1IQT A;  1S79 A;  1ZM4 A;  3UVJ B;  3RAQ A;  3L7O A;  3CJ8 A;  3C6T A;  2X1G A;  3ETM A;  2LQB A;  2KJV A;  2MHN A;  4PYD A;  4O3P A;  3NAI A;  3MM8 B;  2JH3 A;  2MTL A;  5AXK A;  1WSR A;  2W2N P;  3OFF A;  3T5L A;  5GAH U;  2FVS A;  1N5Y B;  4DL4 A;  2AYB A;  3M32 B;  1HWJ A;  3Q8S B;  1YRU A;  2MY7 A;  3MEE B;  5FDL B;  4RNH A;  4NRT A;  1UL3 A;  1EQM A;  3TP2 A;  2I0X A;  5KFF A;  1U0S A;  1NZ8 A;  1U24 A;  3TJ8 A;  1D0E A;  1L3K A;  3TEG A;  5DLG A;  3LWL A;  3BBB A;  2JWN A;  5LSR A;  3G2X A;  5EGY A;  3FEY B;  1KWM A;  2NPI A;  2Y1J A;  3Q2T C;  2MZR A;  4LF6 J;  2CPH A;  1K47 A;  3IWX A;  2DKO B;  1KFS A;  4DJB A;  1FKP B;  2VBX A;  3D68 A;  1HR0 J;  4NA3 A;  5ETQ A;  4DV1 J;  3OL6 A;  5DLF A;  1IKV A;  3FCH A;  4C3M A;  2DGU A;  1N0U A;  1RE1 B;  1M90 T;  4DCO B;  5KG5 A;  2DO4 A;  3RAX A;  1S6U A;  1RT3 B;  4FYY B;  1S57 A;  1DQ8 A;  2P6S A;  4IR1 A;  1RTJ A;  3FUY A;  3BKU A;  3UDE A;  5KOW A;  1LEO A;  1H72 C;  3HCX A;  4OZJ A;  1GXT A;  2P6T A;  1HD1 A;  1P27 B;  1T05 A;  1X4G A;  4I7F A;  1ZH5 A;  1P1L A;  2MGZ A;  2E44 A;  1GAO A;  1YGY A;  4LBH A;  2AU0 A;  2HAI A;  1YJV A;  1H2V Z;  4DV4 J;  1W2B R;  3AXM A;  1SH2 A;  3PR4 A;  2D69 A;  1DY3 A;  4ECT A;  4AL5 A;  3BO4 A;  3PRB A;  2PI5 A;  3D0G E;  3OR1 B;  1CC8 A;  1P8G A;  4DV7 F;  2CDQ A;  2DEI A;  3CC7 S;  3KHG A;  4PRF A;  1UWB B;  4B9S A;  5I4M A;  1XMO F;  1JK9 B;  4JV2 A;  2L9N A;  3MCM A;  1G1X A;  3RBE A;  2VH7 A;  2H9Z A;  2IDL A;  1OS5 A;  1Q82 T;  2MLZ A;  5IM0 B;  1AB8 A;  2GGP A;  2AJ1 A;  3ENA A;  1LW2 A;  1NSK L;  4CLF A;  1YHQ S;  3B8H A;  9ATC B;  1S1T B;  3Q24 A;  3PJW A;  4LF8 F;  3PHT A;  2V0N A;  4Q43 A;  4W92 B;  4J9O A;  3D28 A;  3MPV A;  5KFV A;  1IR0 A;  3FJ2 A;  1VJQ A;  3POT A;  3GFX A;  1EJ7 L;  5H9F K;  1VBZ A;  2DNP A;  5GAG I;  2VDI A;  2XMV A;  2XMU A;  5KG3 A;  4A8Y A;  5KFG A;  2MZ1 A;  2IVY A;  2L41 A;  3PJX A;  1RLD A;  4JBC A;  1YIT S;  1KLM B;  2AW0 A;  3QLH A;  4GO7 X;  3QAU A;  1ZOT A;  3PO4 A;  4C3L A;  1RA6 A;  1QE1 A;  2K3I A;  3L9Z A;  1NPP A;  1PJ7 A;  2X7I A;  3WBZ A;  1PIE A;  1SKW A;  2AJF E;  4OI0 A;  3NNA A;  5HQL A;  1I94 J;  4LF5 F;  4DU7 A;  4AL6 A;  4KO0 B;  4ZLP A;  2AYG A;  4ILL A;  2KT5 A;  1X31 C;  4C3K A;  2DR8 A;  4ICL B;  1XMB A;  4KT0 C;  1PYO B;  1UA0 A;  5HBM A;  5GAE I;  4X65 J;  3MPU B;  1IBM J;  4B17 A;  2ZH1 A;  5MLC V;  1IJE B;  2NR0 A;  2LEA A;  3CCS S;  2ROE A;  4K4S A;  1RTZ A;  1VI7 A;  1K0T A;  4DSK A;  4KV8 A;  1RHM B;  3UD3 P;  2NSC A;  2JFK A;  3TUP A;  2NS1 B;  1ACM B;  1GMU A;  5ETP A;  2CJA A;  1T9W A;  2AT1 B;  3EGW B;  1U0H B;  5JJB A;  3PIP Q;  4ZVR B;  2A2D A;  5ETT A;  3NNH A;  1Y10 A;  3MD1 A;  3HZE A;  2XSJ B;  2ZDO A;  1SC1 B;  2J0W A;  1MMD A;  4JV5 J;  3KJV B;  2B9W A;  3K58 A;  1H38 A;  1UVM A;  2DGS A;  5JVH Q;  3ILJ A;  4WK1 A;  4X62 J;  1ARO P;  1ZA1 B;  1RTD A;  1X9M A;  1NDK A;  2GVD A;  1NPK A;  3SXL A;  4MKA A;  3BH7 B;  4JI2 J;  4I2Q A;  2ALY B;  3GYG A;  4N76 A;  2VFU A;  4Y3C A;  1RT6 B;  1RHK B;  3P45 B;  3LOU A;  4ZPD A;  3RBX A;  1OQ6 A;  2DB1 A;  2F4V F;  1RP5 A;  4ZLL A;  5L8R C;  1FI4 A;  3DN9 A;  3QRP A;  3KYL A;  3CME S;  5A2Q U;  2H1Y A;  2P9C A;  3MGJ A;  3KXD A;  4KRW A;  3G82 B;  2FLP A;  4DV2 J;  1WF0 A;  1GQE A;  3CNQ P;  4HH0 A;  1BY9 A;  4F3M A;  1JLF A;  3NBP A;  4ER8 A;  5T41 A;  5F8M A;  2DRA A;  2YY3 A;  1FDD A;  3TNV A;  4LFB J;  2QMW A;  3QNW B;  2JOQ A;  1SC6 A;  2C3Y A;  4HI1 A;  1VIX A;  1I1G A;  2M2B A;  2BKN A;  1CBK A;  1KSP A;  3JB9 k;  2O5D A;  1SKR A;  3J7A 1;  3IM8 A;  3QWP A;  4P71 A;  4OX6 A;  1LWC B;  2HNY A;  3GLJ A;  4LQ9 A;  2O67 A;  2XBP A;  3U1M A;  4K2J A;  1U6B A;  4ZPV R;  1A6L A;  5J2P B;  2CNL B;  3K5L A;  1DJ0 A;  2RHQ B;  4QPT A;  3JQJ A;  1UCN A;  2DGV A;  2FGO A;  2GIQ A;  2CJK A;  1VGY A;  2HZC A;  5T7L A;  3EDQ B;  4NCG B;  3E51 A;  1F2G A;  3M1V A;  2B8P A;  2WRM A;  2FD2 A;  4H4M A;  1M5V C;  2VQF J;  2E5L J;  2BXJ A;  2HS4 A;  2RH3 A;  3P5T L;  1IR2 A;  1UVJ A;  3HSZ A;  2CAD A;  4OHY A;  2DY9 A;  3CCV S;  2JEG A;  3DLE A;  4F0H A;  2BMB A;  4CT9 A;  1VHI A;  1SUQ B;  2AX1 A;  2VAS A;  1VQ4 S;  1GNK A;  2HBY B;  3J81 j;  5L1I A;  1J5O B;  2QG9 B;  3MUR P;  4DUZ J;  1B7F A;  2AJ4 A;  3MM5 A;  1PJ5 A;  1SV5 B;  2D3U A;  1WC3 A;  3NCP A;  5HP1 A;  5L9N A;  2JEI A;  2HK3 A;  4ETZ A;  1KON A;  3G6E S;  4WYL A;  4DPO A;  3CUN A;  4FVC A;  3AOC A;  2JC1 A;  4F3O A;  4J9N A;  5EDW A;  2XZW A;  4L74 A;  1YBU A;  3MEC B;  3GFH A;  2LU1 A;  5JXS A;  1SIW B;  4MKV A;  2KB2 A;  2DHG A;  1KQK A;  3TWZ A;  4V19 J;  4RNO A;  4TNO A;  2MST A;  1IM4 A;  3TA2 A;  4F4K A;  2A1B A;  4M63 A;  1VC0 A;  1FNM A;  4ZPT R;  4G65 A;  1DTQ A;  2W7A A;  2E1P A;  3OFH A;  4JI3 F;  1LXJ A;  4OX9 J;  2IYI A;  4H4K C;  3MR5 A;  3PFE A;  2YNG B;  3S1T A;  2ZZM A;  4LRA A;  1L3V A;  2OPR A;  1URN A;  4C8K A;  1N6Q A;  4OHX A;  1E6Y B;  3FBC A;  3LGM A;  4DR3 F;  3GG1 A;  4R25 A;  4I67 A;  2BX6 A;  4LRF A;  3DM2 A;  3TVK A;  3M6V A;  1RZM A;  4NLY A;  1RWU A;  2JL9 A;  3RRG A;  4O0I A;  3LUY A;  3AQO A;  4JYA J;  1MN7 A;  1WEY A;  1S72 S;  3CCT A;  1IJF B;  5KFL A;  4AXJ A;  2PMW A;  4TXS A;  2R42 A;  5HK4 A;  3BDP A;  3CJ0 A;  2QL7 B;  1D9D A;  3UVJ A;  2GO8 A;  5CQG A;  4M5H A;  1M0S A;  4DN0 A;  1S1X B;  2B4U A;  1XNQ J;  3MM8 A;  1NH8 A;  3CVK A;  3TX0 A;  1S76 D;  2VPZ B;  2EFP A;  4GRS A;  2ADC A;  2W4P A;  2HG4 A;  1C1C B;  1YJ9 S;  4QQB A;  2RKI B;  2CPI A;  3GIJ A;  2HHX A;  2IJN A;  1K8A T;  5K8N A;  1N5Y A;  3C2P A;  2CQ3 A;  3M32 A;  3NMA A;  3KK2 B;  4QJV A;  1HNZ J;  4CLL A;  3VAH A;  3MEE A;  4IH6 A;  3R97 A;  5FDL A;  5THW A;  2GQC A;  1PAU B;  2R7X A;  1N33 F;  3P3D A;  4QWC A;  3I31 A;  3VZH A;  4KHP J;  2GO9 A;  1HPZ B;  4EYI B;  1LXN A;  3TAM B;  2DIV A;  3N5F A;  3GG0 A;  1SPB P;  4H4O B;  1NCL A;  2LMI A;  3AQP A;  1CJV B;  1F5B A;  4XDD A;  2N3O A;  6FDR A;  2H65 B;  4RO0 A;  4JI5 J;  5B0C A;  1U2C A;  2OP5 A;  1S99 A;  2RQM A;  1FKP A;  1GFW B;  1IBK J;  5LSL A;  1TKX B;  4X64 F;  5E3P A;  3F73 A;  1UTA A;  3I5B A;  1TKD A;  2ERR A;  2DGW A;  1R8H A;  2QFI A;  2B5J B;  4CI0 B;  1ZS6 A;  2EKN A;  2U2F A;  5CZV A;  1G4C A;  1RT3 A;  1FEE A;  4I4B A;  4DV0 J;  2R3V A;  2N3L A;  2BAN B;  1R89 A;  4K0K F;  3OJU A;  3G8S A;  1WTB A;  4P75 A;  4FS2 A;  3VAI A;  3UCZ P;  2DHA A;  1XMQ J;  4ECY A;  4OYW A;  3ZZU A;  2UV8 A;  1C1B B;  1YJR A;  1YDL A;  2QGF B;  1U6Z A;  1HNW F;  1FCA A;  2IC3 B;  3H0P A;  2BRL A;  4U96 A;  4FPR A;  3FBB A;  4O3Q A;  4FNH A;  2PEB A;  1H7W A;  4TLQ A;  2XI3 A;  1XWL A;  1GH8 A;  3X1L B;  3SV3 A;  2PC6 A;  3AHP A;  4OI6 A;  3IR6 B;  2OEM A;  1QSS A;  2Z56 B;  4LR8 A;  4ZCM A;  2JLF A;  3U1N A;  3OXL A;  1MNE A;  3BGF A;  1FFS B;  4C7Q A;  2JHE A;  2C42 A;  4IG0 B;  1HNI B;  1IBL F;  4UQG A;  1TK8 A;  1YTY A;  1UPM B;  2R8K A;  2QLF B;  1Z2L A;  4NXN J;  3G87 A;  3ZZO A;  1UWB A;  3H20 A;  2ROG A;  2HHT A;  1VQP S;  2YTC A;  2MJU A;  1S0M A;  4JI7 J;  2E1R A;  1F9E B;  2CNO B;  4KTQ A;  5IM0 A;  2GMH A;  4P52 A;  1TL5 A;  5KFX A;  2VJU A;  1RAJ A;  3OT9 A;  4JOU A;  3ENW A;  3KWM A;  4WFX A;  2Z58 B;  5D4P A;  3T6J A;  1FRK A;  1NPR A;  5AJ3 F;  5L1J A;  1TUG B;  3CWJ A;  1T9U A;  4UOH A;  1VBK A;  3BQ0 A;  1Q1K A;  2W1B A;  1S1T A;  1YWX A;  2NCK L;  5K9F A;  3CJ3 A;  2C2E A;  4GKK J;  4QIF A;  1UZH A;  2V2V A;  1U1N A;  1EQ0 A;  3BZQ A;  3W2W B;  4F4A A;  1NND A;  3KG0 A;  3D3B J;  2I38 A;  4ZJQ A;  1RAI B;  2Y1L B;  4CO0 A;  1D8Y A;  1V6H A;  2WW4 A;  1KLM A;  3R7S B;  1OPI A;  3MMA B;  2OKQ A;  2PDA A;  4W4M A;  1L5U A;  4NLP A;  1HIY A;  2B9E A;  4WXW A;  2CVI A;  2Z8Q A;  3W1Y C;  4KIA A;  2ACY A;  4KO0 A;  2HBQ B;  4IH7 A;  3LP0 B;  1ZAX A;  1ZAV A;  2AEF A;  4M8L A;  3TAQ A;  2YKA A;  3NGT A;  4ICL A;  3HSD A;  3K2Y A;  4LUB A;  2GAH C;  3FQK A;  1U09 A;  1Y7P A;  3M9N B;  4WFA Q;  1KBR A;  2DIT A;  1U1Q A;  2FVP A;  1T11 A;  2DNO A;  3LAK A;  1RWW B;  3EIC A;  3K8W A;  3KUH A;  2LEB A;  3M2R B;  2VFT A;  3IBF B;  4F26 A;  2KRR A;  4DPY A;  5IS2 A;  3VAF A;  2ACM A;  4TLR A;  2NUU G;  1U0H A;  3H5X A;  1V3S A;  1Q81 T;  4NA1 A;  2I5J B;  3BGR B;  4RUH A;  1HR0 F;  4PWW A;  4ZP8 A;  3G9C A;  4USH A;  3KDN A;  2XSJ A;  3HFZ B;  5JVG Q;  3PKY A;  1DLO B;  3HHL C;  3KJV A;  1VLO A;  5HN0 A;  4CLY A;  3GJT B;  1YKW A;  4KQZ A;  2ZH8 A;  2UZA A;  2P9E A;  5EWE A;  4OHZ A;  3BPD A;  2K7J A;  1LQ9 A;  1PO6 A;  2R7O A;  1KDN A;  3V5R A;  5EUH A;  5AXM A;  5D6G A;  4WK3 A;  1T3O A;  2OUG A;  1KN6 A;  1I51 B;  5CD4 H;  2Z30 B;  4K59 A;  2EEY A;  2M4M A;  4K7Q A;  2YQ0 A;  5C25 B;  5I3U B;  3MM9 B;  2C1E B;  1FJC A;  2XNR A;  1RT6 A;  2DNY A;  2ZE2 B;  3RZA A;  2KXN B;  5AXN A;  3H5U A;  4DSL A;  3CJR A;  3G82 A;  5KFB A;  3G8T A;  5D0R A;  3ILL A;  1JJ4 A;  1NJW A;  2I1R A;  2HVH A;  4EBD A;  4KC5 A;  3T5H A;  3RB3 A;  4A8X A;  2CJB A;  4NYO A;  3VR1 A;  5DDR C;  2AKW B;  3V4M A;  2LDY A;  1AXQ A;  4HLB A;  2APO A;  2B51 A;  2HQI A;  1F60 B;  3MOJ B;  2CNK B;  1EZZ B;  2VV5 A;  1HNX J;  2FHJ D;  3I4H X;  4J91 A;  1OJ4 A;  3F44 A;  2UXC J;  1GX6 A;  4IRD A;  2BQ3 A;  4NE9 C;  3K5O A;  4AT1 B;  1LWC A;  1Q8K A;  4P6Q A;  4KHR A;  2FHJ A;  5J2P A;  1HNV A;  4BS2 A;  2VZ9 A;  1PCA A;  5IC6 B;  5CYQ B;  5IT0 A;  1R0A B;  2R8G A;  5EN1 A;  3CCQ S;  4DQR A;  4Y2I A;  4NCG A;  4DV3 J;  1JWW A;  3BS9 A;  5CXT A;  4DN9 A;  4WU3 A;  5F8H A;  4WE1 B;  4DEZ A;  3QFW A;  4RUC A;  5EHH A;  2KVI A;  2HRY A;  1IWG A;  4JV1 A;  5ETM A;  1HWL A;  4JI8 J;  1WHY A;  3JSR A;  1SUQ A;  4UZB A;  1BQX A;  4NX9 A;  2YWH A;  2Y0B B;  2QIF A;  2YBV A;  3Q22 A;  1AYE A;  1KD1 T;  2ZH7 A;  5IWA J;  2IRY A;  4JP8 A;  1V5V A;  1J5O A;  3OSN A;  2CFX A;  5I3Q A;  2H4W B;  2UUA J;  3CCZ A;  1S12 A;  3SFG A;  1SV5 A;  3R9L A;  3TO8 A;  4KJI A;  4PAA A;  1UFL A;  3OTB A;  1GT8 A;  2VBY A;  2XNQ A;  2J6S A;  2LQJ A;  1I94 F;  1YLX A;  1Z4U A;  1WEZ A;  3CJ4 A;  2V8V A;  1GK8 A;  1N5V A;  1RAH B;  4X65 F;  1IBM F;  1EAY C;  3NG8 A;  5LOQ A;  3MEC A;  1TP7 A;  1X60 A;  3GON A;  1HWK A;  1WI6 A;  2IDE A;  2MMY A;  2KO1 A;  1Y5N B;  2UVW A;  4B3M J;  5HI7 A;  1K44 A;  2R7S A;  2CNN B;  2H5J B;  3DYA B;  1X5T A;  5MAO A;  4OI1 A;  3F0N A;  3O8W A;  2YNG A;  1R43 A;  5KG0 A;  3PR5 B;  1NB2 A;  2MQL A;  3TUJ C;  1VJW A;  4CO4 A;  5L46 A;  5KFW A;  1E6Y A;  4P2X A;  4BHQ A;  4JV5 F;  2ZVS A;  4CO3 A;  5GAG U;  3G4S S;  4ERD A;  2OML A;  3THP A;  3MPY A;  2E5H A;  4Q5V A;  4FYW B;  1Z2Z A;  4X66 F;  4K4W A;  2XHW A;  5F0W A;  4C8Z A;  1LWE B;  4JI2 F;  3SCI E;  3I87 A;  4URQ U;  2LXF A;  3O6Q A;  4EBE A;  1S6P B;  3D0H E;  1U47 A;  1Y0H A;  1K0V A;  1GXU A;  1S4E A;  1RAC B;  4LSL B;  1S0V A;  1OMS A;  5CCL A;  1RBL A;  2YKM B;  1S1X A;  2R2T A;  4RBT A;  2N4D A;  2XY7 A;  1VQM S;  1RAD B;  2JNJ A;  3LPY A;  2VG5 B;  5GAE U;  1C1C A;  2RKI A;  1PBU A;  3KK2 A;  3HT0 A;  4ZS6 A;  4LFB F;  2OFH X;  1WKK A;  1U1K A;  2Z57 B;  1S6Q B;  2IA6 A;  2VBW A;  2RIL A;  3VGV A;  3JTN A;  4YR2 A;  4ED4 A;  3TQ1 A;  4USK A;  2CPX A;  4DLG A;  5GAH I;  4OI3 A;  2M88 A;  4ATN A;  1HPZ A;  4CQ1 A;  2G1D A;  3EVM A;  4YOE A;  1WDT A;  2EC0 A;  3TAM A;  1JXV A;  5LM7 E;  2HLT A;  3VCD A;  4H4O A;  3A4T A;  2HRT A;  1H73 A;  2VC1 A;  2DH7 A;  4ANC A;  1CJV A;  4ED3 A;  2XC9 A;  1CEZ A;  1JLG B;  3BKT A;  4U8Y A;  3R1H A;  5D0E A;  2BJ7 A;  3UNY A;  5KT3 A;  4LVO P;  3JYT B;  3BO3 A;  4ZJL A;  1TKX A;  2B7B B;  3DOM B;  4OYB A;  1R8B A;  3T1A A;  2W24 A;  3VWS A;  1T95 A;  1NHK L;  2B9X A;  2VQF F;  2B5J A;  2XS7 A;  2CDR B;  4ZOS A;  4DV5 J;  4WCE Q;  4K4Z A;  4TQS A;  2GHP A;  1NK9 A;  3CD6 S;  4ILM A;  4YR0 A;  2BAN A;  1HKA A;  3OVB A;  1U6F A;  3M8W A;  2HK2 A;  4FXD A;  2Q6C A;  2V4R A;  4LF7 J;  2GQ2 A;  2V67 A;  2IVM A;  2AF6 A;  1PBA A;  3K5N A;  2CQ1 A;  4QWD A;  2F9J A;  4O3R A;  4KAI A;  1C1B A;  3H5Y A;  2DBB A;  3E3X A;  3IG1 B;  4CM2 A;  2IJR A;  4C11 B;  4DUZ F;  2IC3 A;  4RBU A;  3DLL Q;  2BDP A;  1ZZF A;  3FQL A;  4PG8 A;  4YUD A;  1R31 A;  5C42 B;  1LWX A;  4ECU A;  4ZPC A;  2M8H A;  4B02 A;  2HFS A;  1PG5 B;  1R0C B;  4MKY A;  1LKZ A;  4EO6 A;  2L08 A;  3NS7 B;  1KVK A;  4ED5 A;  4L3K A;  3A3O B;  4DF4 A;  1M1H A;  3U7J A;  4LR7 A;  4PR6 A;  4IG0 A;  1IN0 A;  2DO0 A;  2PN6 A;  4G1Q B;  4ECQ A;  1NZA A;  2KFN A;  2L9D A;  4X4R A;  3B6B A;  1KHV A;  3BB5 A;  4J9M A;  1X5S A;  4IRC A;  1S5Z A;  4K2X A;  3PZP A;  1T7P A;  5B0F A;  1CG2 A;  3GP9 A;  3DLK B;  1WKJ A;  2F3J A;  4HT5 A;  4OX9 F;  2RJZ A;  4WIQ A;  3QQC D;  3M8S A;  1JLQ B;  1WOR A;  3GJR B;  2J9E A;  3DCA A;  4OHV A;  2ZFH A;  3T41 A;  1N56 A;  1N52 B;  3CF5 Q;  1R7I A;  2MZT A;  4NAS A;  4ZPA A;  4HEA 9;  2WSF C;  2XZD B;  1QUP A;  3PW2 A;  4C8O A;  4OI4 A;  3NGD A;  1EB0 A;  4CLT A;  3JSM B;  1D09 B;  3W2W A;  1Q78 A;  1UFK A;  3LH2 S;  2HWH A;  4JYA F;  4CLW A;  4JI1 J;  1RGV A;  4MYU A;  4OMF G;  1IKY B;  2JEF A;  1N88 A;  4OJ1 A;  2OTJ S;  2HHW A;  3M8Q B;  1RK8 A;  5DM6 Q;  3MMA A;  3TI0 A;  2RVJ A;  3W5Y A;  1RWP B;  3EZ5 A;  1YK9 A;  2BKO A;  1ZA2 B;  1JLA B;  4Y28 C;  4FN5 A;  4HH1 A;  2VA3 A;  1F1B B;  3LP0 A;  1WG1 A;  2CPE A;  5DM7 Q;  3EPG A;  5E3R A;  1HNZ F;  2IM2 A;  2PA8 D;  3EDR B;  2MB0 B;  2DK2 A;  3DNC A;  1VIS A;  2J0Q D;  8ATC B;  4PQU B;  3OHB A;  3MR3 A;  3D6F B;  4UUW A;  3KLV A;  2DT9 A;  1JXE A;  2ROP A;  4C8M A;  3KHR A;  4KHP F;  5FLX Y;  4KY3 A;  2XMJ A;  3M2R A;  4GC6 A;  1ZPW X;  1D9A A;  3W9I A;  4YR3 A;  4NLR A;  4ELU A;  5D77 A;  2ZM6 J;  4JI5 F;  1MRO B;  2RS2 A;  1P1T A;  2M52 A;  2CXE A;  3DRS B;  3UPF A;  2MQO A;  1U1P A;  2M7S A;  4QR2 A;  3QBC A;  2HGL A;  2HVD A;  2I5J A;  3BGR A;  2E5G A;  1IBK F;  2FY1 A;  4OZN A;  3FKB A;  4X84 A;  3GYX B;  4Y2K A;  4WFB Q;  1RKJ A;  4ID5 B;  3NLC A;  4RNN A;  4A47 A;  3CIM A;  1J2V A;  4PXE A;  1DLO A;  2ASD A;  2AJ0 A;  2Q3P A;  1REG X;  4PG5 A;  3DU5 A;  4I64 A;  5F9L A;  5SZT A;  1UVL A;  3OPK A;  2DXE A;  4NEY A;  5D0H A;  4TQR A;  2X1A A;  1KRP A;  3BBF A;  3Q23 A;  3EGZ A;  3L09 A;  4DV0 F;  2AGQ A;  2BUN A;  1SIZ A;  3CDU A;  1VRU B;  3E01 B;  3LAN A;  5LXY A;  1RWN B;  1XMQ F;  2VDH A;  4DR7 J;  5C25 A;  3SI8 A;  2HSE B;  5I3U A;  2KYZ A;  3MM9 A;  4F4X A;  3BR8 A;  2OTL S;  4LMZ A;  2ZE2 A;  3JQM A;  1OO0 B;  4QCL A;  2AEJ A;  3ENV A;  5BJR A;  4DZ6 A;  2VG7 B;  4LF9 J;  2XUL A;  2WTF A;  2AGO A;  3CW2 C;  3N28 A;  5LMN J;  2GCF A;  4HTJ A;  4D3G A;  1CLF A;  1AUS L;  3OTE A;  2QZ8 A;  1E6V B;  1NEE A;  3BSC A;  3IA0 A;  3DLJ A;  1KOH A;  2GJF A;  3M8P B;  2CQP A;  3OL8 A;  2G2Z A;  5F41 A;  4ZDN A;  2MY8 A;  4KSE B;  3EZO A;  3D2W A;  1RCX B;  1HI1 A;  3HHK A;  3V6K A;  4EMD A;  5C7P A;  1HYS B;  4CH7 A;  3WHI A;  1NHV A;  9RUB A;  4RZR A;  5HQ8 A;  1YBT A;  1Y3J A;  2AZ1 A;  1NKE A;  4NXN F;  2MKC A;  4FVM A;  3SDE B;  2QV6 A;  4F02 A;  4PYA A;  1V9O A;  5KG7 A;  4JI7 F;  3N6L A;  1G3O A;  3IR5 B;  3R5C A;  1UP1 A;  3FSI A;  5CYQ A;  1R0A A;  1FFG B;  4NLU A;  2B7C B;  4X4Q A;  3M7V A;  3AOB A;  1ZTW A;  1ZYQ A;  4M5K A;  2CIM A;  3Q2S C;  4WE1 A;  3QT5 A;  4KBI A;  2G1H A;  4U6P A;  2VA2 A;  4O0N A;  2OPS B;  3GIM A;  5A8R B;  4F25 A;  2QRR A;  4J9P A;  1QDU B;  2XWY A;  5IOL A;  4AL7 A;  2XY6 A;  3KLH B;  1MU2 B;  1DZ5 A;  2CG8 A;  1T9T A;  2HVZ A;  2UVV A;  3NGK A;  3T5J A;  4X4O A;  3GII A;  3DOK B;  2F4V J;  4YB7 A;  4NLW A;  3OL7 A;  4XDC A;  1I3O B;  3C8Y A;  2VFS A;  1CQM A;  2BRK A;  2JX2 A;  3MAA B;  4ZP6 A;  1N34 J;  4EWT A;  3O5T B;  1OYD A;  1NK6 A;  3H2L A;  3A8E A;  2F1F A;  3SSQ A;  4ALZ A;  2DGO A;  5ADZ A;  2YPY A;  4R5P B;  1FE4 A;  1OY9 A;  1RHR B;  3M30 B;  3JTP A;  4L6V 3;  4JI4 J;  3V2U C;  4K5R A;  2GV1 A;  3G71 S;  4P7T A;  1N36 F;  4QW9 A;  4QWA A;  3HK2 A; 
#chains in the Genus database with same CATH homology
 2A6O A;  2XQC A;  2A6M A;  2XMA A;  2VHG A;  2VIH A;  2VJV A;  2XO6 A;  2VJU A;  2FYX A;  2F5G A;  2F4F A;  2XM3 A;  4ER8 A;  2VIC A;  2EC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...