5D78A

Structure of rrm3 domain of mip6 at 1.25 a resolution
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
80
Chain Sequence
GPLGSMKTILVKNLPSDTTQEEVLDYFSTIGPIKSVFISEKQANTPHKAFVTYKNEEESKKAQKLNKTIFKNHTIWVGPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of RRM3 Domain of Mip6 at 1.25 A Resolution
rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Rna binding protein
molecule keywords RNA-binding protein MIP6
total genus 20
structure length 80
sequence length 81
ec nomenclature
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5d78A00
2CPHA 3NS6A 1M5PC 1VQ8S 3UCGA 2DIUA 1WTBA 2A3JA 2U2FA 2XS5A 3BS9A 2ADCA 3BO3A 2DH8A 2L08A 2I38A 1ZZFA 2DGOA 3G6ES 5DDOC 2N7CA 1YJNS 1X0FA 2RVJA 1VC6A 2DGWA 4TLQA 2MZTA 2OJ3A 1VBXA 2DNRA 1HD1A 3MUMP 1JJ2R 3ULHA 1N8RT 3US5A 5LSOA 4IO9Q 3D2WA 3NNCA 1R8HA 2GO9A 2CQPA 1ZH5A 1FJCA 1U1MA 1QVGR 3U1LA 1L3KA 2VOOA 5FJ4A 1U6BA 4YOEA 2HGNA 1U2FA 2LCWA 3I55S 2DHAA 1U1KA 2OIHA 4PKDB 3UD3P 1WELA 2MQMA 1NJIT 1VBZA 2KG1A 4Y0FA 1WHVA 2F3JA 2MMYA 3R1HA 3CULA 4WFBQ 2DB1A 3IWNC 3VAMA 3VF0B 4C4WA 2MQNA 2MKSA 3H2VE 2E44A 5GAEU 3MOJB 3NS5A 2RS8A 1YI2S 2DHXA 1WG4A 1X4CA 1U1QA 1RKJA 4QU6A 2DNQA 3TP2A 3K0JA 2OTJS 2CQHA 2KXNB 2DNKA 2M70A 5DDPC 2E5JA 2CPJA 4Z2XA 2DH7A 1VBYA 2CQDA 5D77A 3SMZA 1YWXA 1WEYA 2M52A 2CQ2A 2DGTA 3Q2SC 1X4DA 2I2YA 2CQCA 3EGZA 2CQBA 2CPXA 1M5OC 3PIOQ 2VODA 2BOPA 4ZKAA 5GMKa 2F9DA 1M90T 2CPDA 2G0CA 5IFMA 1M5KC 1K73T 2MQLA 4TU9A 1FO1A 1OPIA 1Q86T 1YIJS 1VQPS 3VAJA 4WFAQ 3CMAS 3CC2S 2K3KA 1G2EA 1KOOA 2Q79A 4FXVA 1SJ3P 4WF9Q 2MQQA 1VQLS 1N88A 3TO8A 4OZ0A 1WF0A 3JB9k 3CUNA 3RW6A 4LIRA 3IRWP 2WBRA 3HHNB 5HO4A 1FJ7A 5LXYA 2CJKA 2G4BA 3P49B 3ZZZA 1N52B 2N3LA 4QQBA 5IM0A 2DGVA 3S6EA 2E5GA 2DO4A 2MHNA 1OO0B 1DBDA 3RW7A 5GAGU 1X4EA 1SJQA 2K8GA 4V19X 2DHSA 1WHYA 2MSSA 2YTCA 3VAIA 2YH1A 2L9WA 4EGLA 1OIAA 4LJMA 4C0OC 1RK8A 1AUDA 1HL6A 1R8PA 4BS2A 3CMES 3UCUP 1VQ6S 1SXLA 2M8HA 1VQNS 1SJRA 1Q81T 2J0QD 4CH0S 2XS2A 2M4MA 5GVQA 2AYMA 1JJHA 1U1OA 2VOPA 2LA4A 4P6QA 2CPIA 3G4SS 4QPTA 1B7FA 3CCSS 2RT3A 3MUTP 3R27A 3CCRS 3I56S 2M0GB 2DITA 1WI8A 1U1RA 2JRSA 2LMIA 2KH9A 2RS2A 4WKRA 2YKAA 1X5TA 2KI2A 3SXLA 2QA4S 3G96A 2D3OR 3VAHA 1PGZA 2OSRA 1KQSR 2QEXS 3HI9A 1M5VC 1QM9A 2MY7A 3SDEB 1X4GA 1SJFA 1M1KT 3VAGA 5DDRC 1A9NB 1YITS 2YWKA 1VQ4S 2UP1A 1IQTA 3MXHP 4F25A 1O0PA 2KU7A 2MKIA 2DNOA 2KG0A 4RU2A 4PR6A 5LSLA 3V4MA 1NU4A 2N3OA 2DNMA 4Y00A 2M7SA 5IQQA 1WI6A 2MB0B 5DETA 3CCMS 2MYFA 2JVRA 2DNLA 2KRBA 2LXUA 1HD0A 2PEHA 3UE2A 2LEBA 4IOAQ 5CYJA 5DM7Q 3H2UB 1X4FA 2DNGA 3P6YC 2KM8C 1SJ4P 1JMTA 4CIOA 3THPA 2EK6A 2LYVA 2HGLA 1WEZA 1KC8T 1WWHA 2V94A 1FT8A 1FHTA 1H2VZ 3DXBA 2KRRA 2NLWA 3L3CA 3P5TL 2D9OA 2MKHA 3S01A 1HA1A 3NNHA 4WCEQ 2J8AA 2MSTA 1ZZNA 2OSQA 2L41A 2DNZA 4ERDA 3CD6S 1U1PA 2DGXA 2X1FA 2JWNA 2CQIA 2DIVA 5IM0B 2X1GA 2KN4A 2LECA 5HL7Q 2AYGA 2CQGA 3CCVS 2XSFA 4FXWA 2RRAA 3BEGB 2DNPA 2CQ1A 1WHWA 2RQCA 3LPYA 3MUVP 3R1LA 2D9PA 2B0GA 5LJ5Y 1X5OA 1FXLA 2QFJA 2KFYA 3NNAA 2BZ2A 1KOHA 3MURP 5MLCV 4YB1P 1UW4A 1F9FA 4WIIA 2RU3A 1FJEB 1JJ4A 5GAHU 1W2BR 4PRFA 1D8ZA 1S72S 4F26A 3LQVA 3MDFA 1K8AT 4M5DB 4J5OA 2LXIA 3CXCR 1CVJA 2X1AA 4UQTA 2XNRA 3CC4S 1XN9A 2VONA 2FPHX 1H2UX 1PO6A 4IUFA 3N9UC 1WEXA 2MGZB 3P3DA 5BJRA 3NMRA 3ZZYA 2AYBA 3BO4A 1U1NA 1DRZA 1DZ5A 3CF5Q 2MXYA 2E5IA 3EX7B 3CPWR 4WFNQ 2DHGA 1X5PA 2EVZA 3PIPQ 2KVIA 5JVGQ 4U67Q 3CTRA 2MPUA 2AYEA 1UFWA 1WF1A 2RRBA 4TU8A 3CCUS 2KYXA 1D9AA 3J7ZT 2JX2A 2FHOB 1U6FA 2XNQA 2DGSA 3G8SA 2FC9A 3G8TA 1Q7YT 3UCZP 2MZJA 3VAKA 5CXTA 2XS7A 4W90B 1VC0A 1DHMA 1UP1A 3MD3A 2DNHA 1X5SA 1YTYA 4F02A 1A7GE 1WF2A 1YHQS 2DNYA 1U1LA 2CPYA 3VAFA 2MJNA 1VQMS 1VQKS 3UWTA 2G1DA 3VALA 1WHXA 5LJ3Y 2U1AA 2MQOA 2MJUA 3DLLQ 2M88A 3CCES 1BY9A 2ERRA 3B4DA 1YJ9S 3FEYB 4ED5A 2DGQA 5H1SV 3J7YU 3CCJS 5CA5A 1X4AA 1X4BA 2MGZA 2N82B 2M8DB 5LXRA 3B4MA 2MZ1A 2LA6A 2J76E 2MZQA 2RNEA 2DNNA 2MZRA 3MD1A 2FY1A 1K9MT 2LQ5A 2JVOA 3THTA 2O3DA 2DH9A 3OW2R 2ADBA 3G9CA 5EN1A 2EK1A 4IOCQ 2MQPA 2ZJQQ 2DK2A 3MI7X 2LKZA 3S8SA 4CQ1A 3EGNA 2CPFA 1KD1T 2CQ3A 2F9JA 2OTLS 1VC5A 2CQ4A 3U1MA 3SDEA 1QVFR 3G71S 1H2TZ 2KT5A 1N54B 2DISA 1VQ5S 3UD4P 3CCQS 2HVZA 1S79A 1YJWS 1WG1A 2YH0A 3CC7S 3FEXB 1H6KX 2PE8A 1WG5A 2KXFA 2DO0A 2X1BA 1URNA 2M9KA 5ITHA 2DGUA 1NO8A 3BO2A 3S7RA 1VQ9S 3TYTA 2KHCA 4QU7A 1Q82T 2MZSA 2AD9A 2RUGA 2XB2D 2MY8A 3Q2TC 2M2BA 2HZCA 1VQOS 5DM6Q 2CPEA 4A8XA 1P1TA 2CPZA 2CQ0A 2FC8A 4CH1A 1X4HA 1OWXA 4YUDA 1UAWA 4C7QA 2LEAA 2HYIB 2GHPA 2ZJPQ 5DDQC 4TU7A 1FNXH 2KXHA 1VQ7S 2MKJA 4UY8T 2MKKA 2RQ4A 5D78A 5GADU 2MKCA 5JVHQ 3CCLS 2J0SD 2E5HA 2NZ4A 2ZJRQ 2HGMA 4W92B 2KM8B 4OZ1A 1P27B 4LMZA 2SXLA
chains in the Genus database with same CATH superfamily
2CPHA 4ZPCA 1M5PC 4R8UB 3K17A 1FKOA 5A2QU 3VWSA 1QDUB 4K4ZA 1FNOA 1QLNA 4DHVA 1EQMA 2AJFE 2DIUA 5D4PA 3OJSA 1WTBA 3DLKA 4DCPB 4BLGA 1WKJA 5ETRA 2UXCF 1PJ5A 3GONA 1JLFB 3R6LB 1E6VA 5CQGA 5ETQA 3J80Y 2ADCA 3BN4A 2DH8A 2PMZD 1SH0A 2CJ9A 3T1HJ 1NZ8A 4NI2B 3G6ES 1U49A 3N5BA 1FDBA 3I32A 5KFZA 3PZPA 4IG0B 2AGOA 1U09A 2L9NA 1YJNS 4ZPDA 7FD1A 2F4VJ 3BYPA 2J6SA 2BJEA 2POKA 4DOZA 4B9TA 3ZZRA 4IG3A 4TLQA 4TN2A 1T94A 2DHHA 1W25A 2BYCA 3P96A 3IP0A 1GXTA 3R5AA 2AIRB 2VFVA 1VBXA 4USJC 1K0TA 1NPKA 3EPIA 2F4FA 5LSOA 4P9SA 4DDFA 1S1TA 2IYGA 2Y0BB 5KG6A 4CI0B 4DR2J 2E1RA 1U47A 1JLCA 3R9LA 2E1CA 1UA1A 3DLEA 1RAAB 4AQYF 1MNEA 4K4SA 4WK1A 5D3GA 1R8HA 3QGIA 2Q6BA 2R7TA 4C9DA 4GO5X 1ZAXA 4JOUA 2GO9A 2Y8WA 3MR5A 2H51B 3BGOP 1MW7A 4FYDA 1RT4B 4DV7F 2B5JA 3KLIB 1VS3A 3L7PA 2LDYA 4WYWA 1HMVA 3U1LA 4K50A 1U6BA 1KVJA 3I55S 2OIHA 2LCWA 4C0BA 2XZTB 3T1YJ 4PKDB 4DFMA 3FFIB 2ZZMA 3HK2A 3UVJB 1WELA 2MQMA 3TEHB 1I3OB 1N0VC 1F3FA 2IM0A 2BE9B 1JXEA 2VBWA 1DLOA 3FDSA 3MEEA 4RBVA 4Y0FA 3M8SA 4FKYA 1FKPB 1HBNB 1WHVA 3M32B 4NLRA 2DRAA 5D15A 3ETOA 2V4RA 2R7VA 1HARA 1N5VA 2QE5A 3QSIA 1CULB 1B7YB 5A6WA 3S1TA 5KFIA 4WFBQ 3QZ8A 3VAMA 4HVZA 2AP6A 4CH7A 5KFAA 4M95A 1ACMB 5KFCA 1S9EA 3KHRA 2E44A 5GAEU 3Q22A 5KFBA 4KGKA 3HVAA 1YI2S 1HNWF 2DHXA 2KTQA 3BYRA 2IDEA 2VPYB 3KLHA 3R7NB 4ATNA 1RKJA 3NGRA 2CG8A 5BYRA 3DRPA 3TJ9A 3TZXA 2B9XA 1KEKA 1GXLA 2DNQA 3H7HB 4DF8A 1NSPA 1BGXT 3PW0A 1G3OA 4Q0BB 1GTEA 1YJUA 3N4WA 4FKXA 3W5YA 3KUGA 4BC7A 4DX8H 5DDPC 3PO4A 3TVKA 2EC0A 1UL3A 1EQ0A 2V68A 1J5EF 2Q66A 1AUSL 5D77A 3JSBA 1F5BA 3H5UA 1Q1KA 1JLGB 1FEHA 1NHKL 2XC9A 1FRMA 2M52A 1S1WB 3KJNB 2NXNA 4OI0A 3T1HF 1PBAA 5HATA 1R27B 3G6XA 3KG1A 4JI1F 3C2PA 2APOA 1NK9A 3N79A 1M90T 5IWAJ 3C6TB 2G0CA 1HNVA 3KJQB 4I0WA 2B3TB 2PC6A 4IFVB 4WYLA 4YDDB 2C1EB 3ZTSA 1SUQA 4OYBA 4PXDA 2V69A 2ZBPA 4LBHA 3W65A 4N56A 3VAJA 4DSLA 3X1LB 1HBMA 3BJYA 2Q79A 4FXVA 4B17A 4WF9Q 4GRSA 4DLGA 3KK2B 1N88A 2Z8QA 5F9LA 3GMGA 2HQIA 1PCAA 3NCQA 2W1BA 1WOOA 5D0EA 3CUNA 1K0VA 4OX8A 1FERA 2ABYA 2KL8A 2WBRA 4DV0F 3PX0A 1MWZA 1XMBA 3HHNB 4EZ6A 3QSYB 2ZFHA 1FD2A 3DHWC 2VG6A 3QIDA 4KPCA 4KHMA 3I56S 4PABA 1HR0J 2UUBF 1FVQA 3IGVA 1PAEX 3IMQJ 5LXYA 3P49B 4E8UA 1M5HA 1ZM9A 5AJ3J 2H1YA 3U02A 2RAQA 3J7Z5 3K59A 3O6QA 4LFCJ 1HW8A 4ID8A 4DV3J 2XLIA 4ZVTB 2YQ3A 2DO4A 2VHGA 3G86A 4WFXA 4CCHA 2IFXA 2KB2A 1JLQA 2ZC4A 1TKDA 1I94J 1AYEA 1M1HA 3Q8SB 4CLFA 1DTQA 2K8GA 4DFJA 2DHSA 3GILA 2IM2A 4X66J 3HHLD 4LUBA 4HTIA 1NDPA 5HP1A 3DHXA 3OSPA 5DG7A 4O0IA 2DT9A 5HLFB 2PMHA 3GJQB 1AUDA 1R8PA 2HURA 4J9OA 1UEVA 3CMES 1V5VA 1JIHA 2Y1LB 1N5QA 4ILLA 1TL7A 1N5TA 3LF0A 1RA6A 4WK3A 1TL3B 2KT2A 4J9QA 5HLFA 3IGNA 1VQNS 1S1VB 3EE3A 1SJRA 1F6TA 4YB5A 3BN7A 4AT1B 2BJ9A 3TNVA 2OPQA 5KT5A 3TANA 2HFOA 5ETOA 2UUCJ 2P2CB 1U1OA 2GMJA 3POTB 2G0JA 3QATA 5I3UA 1U45A 2LA4A 4P6QA 3MFIA 1R0AB 3CCSS 4K4WA 3FCWA 1N48A 1HMVB 4L75A 2DBBA 4F36A 3MAAB 3R27A 5ETPA 2IM3A 4F4XA 3L7UA 2QZ8A 2M0GB 1HI0P 3AJDA 1SV5A 1U1RA 2JRSA 4J37A 4QW9A 3HO1A 3MR7A 1SC3B 3NWGA 4WKRA 4OHVA 4OMFG 5LM7E 1V5IB 3QJLA 2ILZA 4JI5J 1WACA 1UZDA 2PO4A 3MMCA 3C6UB 4HDHA 1PYOB 2OSRA 4HDGA 1KQSR 2GO8A 2VC1A 1S76D 2GX8A 5B0CA 1O6XA 4R5PA 2WB1D 1JLQB 2AJ0A 3MPUB 3SDEB 1X4GA 4CLLA 3PYGA 1H74A 4ANCA 3LTOA 5DDRC 2VZ9A 3HSDA 4NEZA 3A3PB 3SCIE 2EFVA 1QAYA 3ITHB 1UA0A 1HBMB 1D9FA 3GV5B 2LQ8A 4HH0A 1VLOA 4NLDA 3OVAA 4CZCA 4K2XA 3CJ3A 2AF6A 4MYUA 1HNVB 1JLFA 4LF5F 1NCLA 2FIUA 3MEGA 4HL9A 2DNOA 2V63A 3DOLA 3IG1A 4KE5A 4LRDA 4ZA1A 5K8MA 4PR6A 4IRKA 5LSLA 1M5SA 1NU4A 2Z0GA 2J9DE 3ILIA 2ROGA 4S0MA 4U9RA 2RMLA 1KBRA 2AJ2A 2JHEA 1WI6A 3CIZA 4G1QA 4OI1A 4BBYA 5DETA 1UFLA 1EZZB 2MB0B 2KFZA 2QLFB 2YNGA 1TK8A 4NWBA 3NGTA 1AFJA 3A13A 2ZHBA 1DTTA 1YBUA 5ADZA 3L7OA 1HYSA 2PEHA 3PR5B 4IOAQ 2E9ZA 1HIYA 4LF7J 2QG9B 4PG5A 1KNZA 3IR5B 1QAJA 1BC6A 2E1AA 2QLJB 1KS2A 4MAKA 1LEOA 1JMTA 4WP9A 1X7VA 2ZBQA 4C97A 4L73A 1VIXA 3UDVA 3W2WB 2EK6A 4LT6A 4NYPA 4C4WA 2HLUA 2LYVA 1QUVA 3HP6A 1KC8T 2R7QA 4DPTA 3D3CJ 2ZKUA 3JSMB 1HQUB 4AYBD 3LP0A 1FT8A 1VJWA 3TZWA 3FJ2A 2OH2A 3C66A 2H48B 4JI6J 1FKPA 2CXEA 2L9DA 1N56A 3ZZPA 2HNDB 2MKHA 3FZBA 1HA1A 2K1RB 2UV8G 2HFVA 2V8PA 4EFAC 1FFGB 2OP5A 4WCEQ 5J1EB 4WXOA 1TKZB 3P45B 4M5IA 4UQGA 3KLHB 2DNZA 4NLQA 1ZZNA 3CD6S 1Q8BA 1Z1ZA 1BD6A 2BX6A 2W7PA 4DL7A 2X1FA 2B5JB 3KLIA 1RWKB 2PI5A 1S9EB 2CQIA 2DIVA 2C3PA 2WVDA 4RW7B 4U8VA 1O8BA 2GIRA 1XC9A 5GMEA 1HNIA 2UUCF 1YG0A 4I1TA 2Y1IA 2IRUA 2VF3A 2XSFA 2HAIA 3BEGB 2DNPA 4Q2MA 5C7PA 4IR9A 1HHQA 3J7A1 3W8PA 2CQ1A 2XMKA 2RQCA 2K2PA 5M2RA 4KO0B 4Y28C 3DDKA 2XWYA 2CZ4A 4ECRA 1NKCA 1WOSA 4F04B 4DWIA 1H7WA 3MURP 3HULA 4WP8A 4CTAB 3GFZA 1UW9A 4PWWA 2CDRB 5HJXA 4CO1A 2Z2YB 4Q8EA 5JJBA 4V19J 3HVWA 1REVB 2ZC3A 1FJEB 3I31A 1KR4A 4KYZA 3IAS9 4QCLA 4DFPA 1KSPA 1LFWA 2VC0A 4UOFA 5GAHU 5L39A 1JLCB 4PRFA 5HQMA 3HHDA 2VU5A 1NLKL 1IUJA 4JI0J 4ANDA 4J5OA 1RHUB 2IM1A 5GADI 2LDIA 2ZNYA 3HKWA 4ZP9A 2H9ZA 2UU9F 4DCOB 3ZNJ1 4O0NA 3CC4S 4WE1A 1VRUB 3PYFA 3KHHA 1PIEA 4PXCA 2J7WA 4TYBA 2XHWA 1SV5B 3I0SB 4DR4J 4HHUA 2MGZB 2WAQD 3MAHA 5BJRA 2KVQE 4JV1A 3GYXB 5D8HB 2RF2A 1J2VA 1W7WA 4F3QA 4ES2A 2R2RA 3BO4A 4AQYJ 2AYBA 1VLYA 5ETNA 2ZH1A 3BDEA 1JKHA 1GFWB 3HMJG 1DRZA 1TVRB 4CT8A 4FF4A 3R3TA 4JV0A 3K8WA 1XMOF 3CPWR 3F41A 4QWDA 4USUA 3T9ZA 3TUZC 1PKUA 3G8QA 4NLVA 4YR2A 1R31A 4U95A 1UWBA 4WJBA 1Q8LA 1TL3A 4ZPBA 2EVZA 5JVGQ 4IH7A 3GJRB 1CJUB 1RTIA 2E5LF 1LWEB 3D6FB 3MHYA 2GGPB 2HRYA 3KJFB 4TXSA 5K9FA 3QRQA 2V2ZA 1N32F 4DL5A 3D6MB 3FUYA 5J1NA 4QWCA 1NJZA 1XR6A 1D9AA 3R5CA 5EGYA 3J7ZT 1JJCB 4CT9A 3T1AA 3W9IA 1XNRJ 2FHOB 1J5EJ 1L3UA 4Q43A 3G8TA 1LOUA 1Z2LA 3VAKA 2XMJA 2KZZA 2IRXA 2BEFA 1TUVA 3FFIA 4WZMA 3GTYX 4RW9B 1NDLA 4I64A 5CXTA 5E2QA 3MD3A 1IR1A 4JI8F 3JXOA 3TEGA 3DRRB 2W4DA 5IV4A 3H4DA 3ISZA 4UTGA 3CWJA 1YTYA 1A7GE 2ZNZA 2R2TA 2F1FA 2GVDB 5DGBA 4TY8B 5AE3A 2OPPA 3VAFA 1UCNA 4USMA 2Z58B 2W2QP 1VQMS 4W4MA 3WIUA 3R97A 4OL8A 1SPBP 3OVBA 4DSIA 5LJ3Y 3DM2A 2JEIA 1D3WA 5A8KA 1F5AA 1FRIA 1WDDA 3GPAA 1SL2A 3JQJA 5GAEI 1BY9A 4KHRA 3B4DA 4NCBA 1YJ9S 1FRHA 3J7YU 2R2SA 5THWA 4WU3A 2P9CA 2EFGA 1VI7A 5A76A 2MGZA 1HWKA 2YWWA 4PXBA 4CO0A 2GIFA 1HR0F 2DR6A 2UUBJ 1AROP 1NK5A 1TMJA 2Z30B 4F0MA 2Z4PA 2HHXA 4ICLA 3UN5A 5KG5A 3OSNA 5EX0A 3M30A 1K9MT 1U25A 4B02A 1NK4A 4PUOA 2B7CB 2LQ5A 2JVOA 4DV3F 1Q8IA 2O3DA 2DH9A 2DPIA 2UVRA 2F65A 2XSJB 3FMBA 1NHVA 2ZH2A 1RWNB 2MQPA 4LF8F 3TI0A 2DK2A 4UZCA 3I5AA 3N0VA 3M2UB 4G6VB 4J9PA 1GNKA 3M2VB 2HHQA 4JI0F 4ZK7M 2GHWA 5AT1B 5J2NA 3UI3A 1KD1T 4YR3A 1FWKA 1QSSA 2FLOA 4ZJQA 4L3NA 2QA4G 1YJRA 4H4OA 2F9JA 2DXEA 3FMWA 2CQ4A 3KLGA 3SDEA 1C2PA 4A4JA 2DCUB 1QVFR 4LVNP 2IYIA 1EKRA 4KH1B 2BA9A 4DPWA 1RCOB 2W25A 4K5SA 4XIUA 2GQQA 5E0OA 3OTOF 2JH3A 3AAWB 1D0EA 3GCXP 1IKYA 4DQSA 1N36F 3M2VA 3H40A 1FKAF 1AFIA 4DR7J 2JLFA 3UD4P 2W01A 3EMTA 4IFYA 3JQMA 3CCQS 3MMAA 2YH0A 3CC7S 3SI8A 1GMUA 3CDWA 4C11B 4ZCMA 4AL7A 4HH1A 3R8YA 2KXFA 4LR9A 4MIBA 3ZZTA 2Q6CA 2X1BA 5DRKA 2M9KA 4B3OA 2YKOA 3LGMA 2DXFA 3H0PA 3TYTA 3E01B 3LP2A 4MT1A 2FQQB 3I9V9 4MJKA 1BQXA 2J5AA 3CNQP 2XTJP 1RYSA 2Z2LA 1S5ZA 2XI3A 4LQ9A 3BPDA 2QSWA 2YKMA 5CYMB 4ELVA 3OFEA 2HZCA 3RBXA 4X4SA 3PJWA 4KY3A 2VJVA 1T3NA 2JZ5A 1VRTB 3PW5A 3NOCA 4FYWB 1RWUA 4MK8A 4RUHA 2ZH5A 4M8LA 2FB0A 4ZVQB 3A3NB 5AXNA 4DR1F 1RAIB 1NJYA 2J9DA 4CNZA 4K4TA 1X4HA 3PO5A 3DM2B 4MK7A 1UAWA 1Q78A 2BJ3A 2G2OA 2LEAA 1UJ4A 4C7QA 4QIEA 4N8NA 4X4NA 4TU7A 1TAQA 2LLZA 3HHLC 4NLYA 7FDRA 2XI2A 2KXHA 3TA1A 5DLGA 2C2KB 1SKRA 2EW9A 5F8NA 4IH6A 4RZRA 2PA8D 4PWDA 4ZP6A 1TL1B 1RBOB 2RQ4A 4HACA 2MKKA 3V5RA 3DLGA 2HMIA 1RT5B 3PTWA 4NMXA 1WDTA 1YLXA 2G2YA 3QZ7A 4DS4A 4NI2A 4Y2MA 4Y2CA 4I2QB 2B56A 2YPYA 4JI2F 3NKYA 4W92B 4NXNJ 3P8BB 4E2FB 4CM0A 4G1PA 3BSOA 2CJBA 2DCLA 2V94A 2CRLA 4PG6A 4W98A 5HQLA 3BH7B 4U7UK 4F4KA 2LQJA 4OYIA 2WONA 1NK8A 1JLEA 3TZYA 5KT2A 2V4JB 1CEZA 3AQPA 4IKAA 3LANA 1JLBA 1UZHA 4OYXA 3JS9A 3HLUA 2BV3A 4ECYA 2U2FA 3QQCD 3DMJA 4ZHRA 2XWXA 3CE8A 4CM2A 2XS5A 1EETA 3AJ1A 1NK6A 2HVHA 2VBZA 3QFHA 4ZVHA 3H59A 4LF9F 1RWOB 1UWAA 2L08A 4IO1A 3DCAA 2FVQA 1RWVB 1ZZFA 2DGOA 1KWMA 3NAIA 2DY1A 2RF2B 1X0FA 4DLEA 3FSIA 3DI6A 1TK5A 3DOKA 4KC5A 5FIIA 1QTNB 1S9FA 1U02A 4DUYF 3RBDA 2GAHC 2DGWA 2J6TA 3VVTA 5HN0A 2HS3A 2OKQA 1S1WA 3K7RA 1LWCA 4K5RA 4KR0B 4ALZA 3MUMP 1T03B 3A1YG 4USTA 1B64A 3D2WA 2BBEA 3N5FA 3UDEA 2BUNA 5J1PA 2B9YA 2XZWA 1V3RA 3VQTA 2UXBJ 3EZOA 3ZFVA 3T5KA 3ENQA 3MAQA 3IS9A 2DEIA 1MWQA 3AT1B 3TJ8A 1C0TB 3VV2B 4FYYB 1JNRB 4X66F 1ZH5A 1FJCA 1U2RA 4DV4J 1WKKA 4KGZB 4TKTA 5KFUA 1QE1A 2JDJA 1QAIA 4LIWA 3SQOP 4G65A 2KYZA 4ELTA 2VPXB 3D9BA 3UD3P 2VB6A 2O5DA 3TWZA 2XBPA 3ZTQA 4A8OA 3BQ1A 1NJIT 2WBMA 1T9XA 1UFKA 2CVIA 5C2GA 2KG1A 4ECZA 4DQIA 3B82A 3OXLA 1B70B 1FA0A 1VDHA 2A2DA 2COLA 3M8QB 4KIAA 2MMYA 5LSRA 2H54B 3E8OA 4U96A 5H9EJ 1Y00A 2EG1A 3CULA 2KDOA 2YWGA 4Q7AA 2DB1A 4N77A 4RW8A 3IWNC 4LF4F 3AJ2A 3OL9A 2EPIA 4DUTA 5AE2A 1DY3A 4LSLA 3VQSA 1UVMA 5CYQB 2AZ3A 4UZBA 1URRA 3R5JB 2IIHA 2V67A 3NAHA 5F9NA 1X4CA 4AXIA 4F4YA 3TAMB 3FVYA 3MECA 4P52A 4HHHA 1VQSA 4RUBA 1FI4A 1KVKA 4R0JA 2RKIA 4PYDA 3SQGB 4QWAA 3TAQA 2XMMA 3TP2A 3K0JA 2OTJS 3Q83A 2HPUA 2ZVSA 3UW1A 1OSCA 1XTZA 2QTWA 1WORA 2M70A 9ATCB 4CP5A 1M1GA 2CPJA 3AH6A 2W4CA 3Q86A 4MKAA 1TP7A 4PPDA 3LP0B 2AEFA 1QY7A 1WEYA 3DRSA 2DRBA 2CQ2A 2HS0A 5LMUF 3Q2SC 3NEKA 3JTOA 2CJYB 2OFHX 2CQBA 4Y65A 2W9BB 2I2YA 3EGZA 1FFSB 2LVWA 4A8WA 2OI2A 4EK2A 3HT3A 5GMKa 1NAQA 2CPDA 3ONQA 5C42B 1PYTA 3D0IE 5LMNJ 2MQLA 4O44B 1FO1A 2WTFA 1LW2A 3QT5A 3SV4A 5H9EK 1N34F 4U7CA 1S7IA 4HEA9 1S6QA 2GZOA 2NYHA 3EJMA 3TQEA 4WFAQ 4DPXA 1C0TA 4DR2F 5D0HA 1C1CA 1N32J 1SQGA 1N6QB 3ISNC 4U8YA 4C6AA 2NREA 1F1BB 3FBBA 2CIMA 3TJAA 2J8SA 3A8EA 1X9WA 1S1UA 2B4OA 3RW6A 1RT3A 2RQKA 2RE1A 4NYZA 2NUHA 2H4WB 4M5DA 3IRWP 1L5UA 4RWXA 4DV7J 3CCTA 1SC1B 4QIFA 1S77D 2BJ7A 2VA3A 3R5GA 1S1UB 3BZQA 1SB6A 3VZIA 4QIVA 4PQUA 3GLJA 2HBZB 2ILYA 2KJVA 1SKSA 2VG5A 4NL5A 1ZA1B 2N3LA 4MFBB 1HQEB 2XEXA 3AOAA 3DOMB 3KK3A 5IM0A 2IAJA 3CEDA 3T9NA 4ETXA 2VQFF 3S6EA 1UEUA 1W26A 2RB7A 1Y3KA 3R7SB 4EO8A 4X62F 4A8SA 2MHNA 1T9UA 2CZVC 2EBGA 2HKEA 4KB7A 3UD5A 4DMZA 2WOMB 1SL0A 4LF6F 4K4YA 1X4EA 4QWBA 1SJQA 1NKBA 4FPRA 2VG7B 3BGRA 1RGVA 1T9WA 1WHYA 2AT1B 3C46A 2VKRA 2YH1A 1T3OA 3N28A 1OIAA 4EU0A 4NA1A 4UUXA 4ECXA 3T3FA 1NBEB 8AT1B 1CULA 1RHQB 2GC8A 3PKMA 4LQ3A 1RK8A 4ES3A 5K14B 3UR0A 1YBAA 2GNKA 1RADB 2PT0A 4OI4A 4ILRA 2XQCA 2W8KA 2D3ZA 3J81Y 2PFFB 1FWLA 2J0QD 2HQGA 4CH0S 5E33A 2XS2A 1H7XA 2AYMA 2EI5A 3HHLA 4JBCA 3U1NA 3EZUA 2A10A 4O3QA 3SQGA 2J0XA 2XMAA 1L3SA 2R8GA 3MECB 3FZ2A 4M5LA 2VOPA 2CPIA 1DQAA 4TQRA 3G4SS 1BUXA 1ZTWA 2C2DA 2CNNB 1WC6A 2DR8A 1QE1B 2V6AA 3NL0A 4FDFA 1RTZA 1P6TA 1AA1B 3KK3B 1IR2A 1I1GA 4L76A 3DU6A 2FUG9 1ZS6A 4BWJA 4I69A 3TA0A 2YKAA 2EC2A 1X5TA 3D1HA 3HSGA 3VGTA 1HBUA 3T5HA 3CJRA 3DGVA 4UOGA 5I42A 4P74A 1HBOA 2YQ1A 2FZGB 4DV2F 1N34J 1R0BG 2D3OR 3LGNA 3VAHA 3W8GA 1Y9OA 1PGZA 2C2EA 4IG3B 4OZ2A 3BGRB 2HRTA 3FQLA 3WIVA 1IJEB 3OVSA 5KFWA 1FTRA 1RACB 4DV6F 5A6PA 3KLVA 1RCXB 3KXDA 3P4UB 2R8HA 1SJFA 3C16B 3IA0A 1ICEB 3MMBA 3GJSB 1WOPA 4LSNB 4QWEA 4DR7F 3DLBA 2GA7A 3IRXB 1YITS 4ZS6A 4PZVA 4F3MA 3PEHA 2AWZA 4DV0J 4RL1A 4M5JA 2UP1A 2K3IA 3IS9B 2PMWA 1YRTA 1Q5VA 3IRXA 3PFOA 1IQTA 1KLMB 3ENWA 5KT7A 2YWFA 2P9EA 1IBLJ 1EETB 4CO3A 5BR8F 5LMNF 2J7UA 2MKIA 3V6JA 3AA9A 3RBEA 1IQZA 5KG4A 4CNYA 3KOAA 3K2YA 2GVZB 3QBCA 4RNOA 3G6YA 3PW4A 2R7SA 1Q4RA 3V4MA 4ZITA 2NSBA 4Z37A 2N3OA 4QPXA 3H98A 2GHVC 3W61A 1YKWA 8RUCA 3QMQA 5F8IA 1VHFA 2AZ1A 2MYFA 3VTIA 5I42B 2JVRA 6FD1A 3OL6A 2MDAA 2DNLA 2KRBA 1O51A 3E51A 4EMDA 4KGVB 3J81j 1SC4B 2LXUA 3CMQA 1HD0A 2HHPA 3P5BP 3IR7B 1KP6A 3LUYA 3KLFB 2J6UA 4O44A 3H2UB 4ZVFA 2N4CA 4ED3A 3GG0A 3ILOA 3UQSA 2F63A 1WNEA 1SJ4P 5CCLA 1V9OA 3AODA 2K06A 4CIOA 1U7LA 1HNZF 3M8YA 4ZCKA 2IMOA 1XNRF 3WHIA 4C8YA 1RT1A 5IT0A 1HI8A 2GJIA 4DCJB 4J9NA 3R7BB 4GVBA 4FS2A 2IBOA 3KJVA 3C6UA 4H4KC 1HBUB 3GYNA 2FVRA 1WC3A 5K14A 3JYTA 4OHZA 1FHTA 1UEKA 1NB7A 4DG1B 4A8MP 2VPZB 4TY8A 2HHHF 1HNIB 1T8EA 1Y5NB 2ZD1A 5KG0A 3OFFA 2FJDB 1RTJB 2FDNA 3P5TL 4M63A 3S01A 3NG8A 2JLGA 1QJHA 3NNHA 2J8AA 3H90A 3CD5A 4Q0BA 2FLPA 4KRWA 2OSQA 5CYMA 1CC8A 3ELHA 3OFHA 5T41A 1RTJA 1KN6A 1S59A 5CD4A 3UN2A 3HD1A 2W4PA 3GZ7A 2JWNA 3W9JA 2VA2A 1NEEA 1B4SA 2FVSA 1MROA 2KHDA 2X1GA 2W2PP 2AKWB 3HJVA 4FZVA 3NGDA 1RBLA 2LECA 1ZYQA 4L3KA 3GIRA 1LWXA 2C42A 2K7KA 2LU2A 3QGHA 4I4BA 4USWA 1X9MA 3B54A 3D4JA 2HEKA 1S6PB 3MPYA 2ZBIA 1EKSA 4EEYA 1DAXA 1Q16B 2RRAA 1S0NA 1TFYA 4DQQA 1EJ7L 1CC7A 3G82A 2UUWA 3VZHA 2ASJA 2W2OP 2AEJA 3IM9A 3LPYA 4USKA 3MUVP 1RT3B 2ZKTA 3W2WA 1S48A 1X9SA 2HVEA 2ZBCA 1SQFA 5KFVA 4JUZA 4I7FB 3NGSA 1G4CA 5HBMA 2KFYA 1KOHA 2R2UA 1N6QA 2ZM6F 5J2QB 4NXMF 1IKVB 1EARA 4YB1P 1RYRA 3TRGA 1N5YB 3UFCX 4OQJA 4WIIA 2UUAJ 4M5GA 4Y2KA 2F5GA 4QR2A 2PD1A 2RUSA 4QIGA 2O66A 2EFPA 4DV6J 2DRDA 1EX8A 1RHMB 3ILJA 4I2PB 4WWSA 4C3MA 3G87A 3RRHA 1JJ4A 1S0VA 4WZQA 2BVZA 4CLZA 1FE0A 4M94A 2EG2A 2Q3PA 2RH3A 1FX2A 4DU7A 3LQVA 4DSJA 1A0OB 4M5DB 4XO0A 4DV5F 5D6GA 1YZ7A 2DYAA 4YP3A 3NP5A 1L3TA 2LXIA 3M2RA 3CXCR 4DR6J 3M6XA 3PRVA 3CO9A 2H5IB 4C8LA 3TQ1A 3MEGB 2VONA 1AW0A 2OEJA 1PO6A 1YSJA 2Z2ZA 1IKXB 1WEXA 2F8MA 2PN6A 3N9UC 3P3DA 4IUFA 3GSDA 3ZZYA 3JQKA 4J9RA 2EXUA 1T9VA 3I0SA 2HQFA 3V6KA 3A12A 1DZ5A 5JUMA 1EIYB 2QN6B 4OZNA 3BB5A 3KK1A 5HAOA 3TUPA 2HNYB 3HFKA 2JC0A 4I68A 4N8OA 4R0EA 4WFYA 4F2SA 1OY8A 2V8VA 2XMWA 3CDEA 3RUBL 4F4ZA 4DSFA 4B3TJ 3QIPB 1ROFA 3O5TB 3OTBA 5KFTA 3H2LA 2FGOA 1JLEB 3KG4A 1X5PA 2EEYA 3RAMA 3L09A 2IA6A 4U67Q 4EUVA 2IJNA 1ZOTA 4X4PA 3ZC4A 3QLHA 2NQPA 2MPUA 2AYEA 2QA1A 3OTEA 1WF1A 3Q8PB 3CCUS 1SL1A 4ID5A 2KYXA 3RB3A 4I2QA 2GVDA 4ED8A 2DVIA 4TNOA 4ZPVR 1Q8KA 1N5SA 1S1XB 1IKWB 4NOHA 2I9SA 5F8GA 3UCZP 2WVBA 1FDDA 1RT2A 4O3RA 1RWPB 2HIQA 1XJWB 3MM7B 3T6JA 4QBUA 3PJ9A 3WX8A 3HXMA 3MEDA 1BQNA 1RWMB 4WTYA 3UDLA 1X5SA 3Q8VA 5EWGA 4O23A 2RD5C 1RAGB 1WF2A 4WIQA 4ECUA 2R4FA 4NZ7A 1YHQS 3QGGA 2DNYA 4YDXA 1R43A 5FDLA 3KMSA 3PHEA 4GC6A 1F2HA 2MJNA 3FK4A 4H4MB 4LF2A 1I6JA 1RT1B 1UPMB 1ZM3A 3M6UA 1WHXA 2HAFA 1NUEA 2KKHA 1KVIA 1TELA 1LXJA 1VHIA 3BBFA 1VYAA 1NSQA 3M1VB 4NXNF 4DJBA 1RU1A 4XTTA 1R89A 4I6WA 1W2IA 3T5LA 2HW3A 4JI4J 4M5KA 3LP1B 3AD8C 2KT3A 3A4TA 3C8YA 3CCJS 1S6UA 2IJFA 3E2EA 2VQEJ 4H4OB 3WZ0A 2N82B 2M8DB 4OHYA 4TY9A 3DFEA 3QNWB 4Y34A 4DR6F 1HKAA 3B4MA 4KFBA 2UU9J 2MZ1A 2HHTA 3D5MA 5B0GA 2MZQA 1UVIA 3R5BA 4MK9A 2RNEA 2AJ1A 3HD2A 4NRUA 2DNNA 1MSWD 2GQCA 4N5SA 3LO3A 2ACMA 3DYAB 3PYEA 3SV3A 4NXMJ 4X64F 4G1QB 4NCAA 2A1BA 2UZAA 2VG6B 4MH8A 1NHUA 3B6BA 3KHGA 3OW2R 2ADBA 2EK1A 2X51A 2D7SA 4M5MA 4C8KA 4G3IA 4IOCQ 3G9CA 2AMCB 3M8WA 4I2PA 2CJXB 3MI7X 2LKZA 4GKKJ 2AEMA 2C2ZB 1CBKA 4CO4A 1UPPA 3CVKA 3S8SA 1FEEA 3CJ5A 1DFDA 3BQ2A 1S6QB 4CLKA 4DR1J 4DF4A 1FWPA 4CWBA 4FXDA 2KFNA 3DKDA 2P9GA 4BHQA 3GV8B 3ITHA 3LALA 2BM0A 4NLSA 1PYSB 2HHVA 1N54B 2ZH9A 1TL1A 4HACB 1F0XA 3AXKA 2DISA 5AXKA 2CWKA 2BM1A 3FKBA 1T11A 3PCOB 4ZJOA 2VJUA 1VQ5S 2WVCA 2XG8A 3M8PA 4X4RA 2HK2A 2OELA 3DRSB 2CADA 4OYMA 3OLAA 4M5NA 3OUYA 3PW7A 1SCJB 1MU2B 2HVZA 1YJWS 4OJ3A 1TAUA 1R3NA 1HWIA 2PE8A 1FE4A 2G2ZA 5B0EA 2RIJA 1T05B 3ENVA 4B08A 1VCTA 5ITHA 2DGUA 1NJWA 4OV6A 3S7RA 5KFMA 4CLYA 2AQ4A 2KHCA 1Q82T 2MZSA 5CZVA 3GE9A 2A0FB 4OZ5A 3C3LA 2J9EA 1YRXA 2XYGB 2XB2D 2MY8A 3IBFB 3Q2TC 1RHJB 5HVGA 3LOUA 3RRGA 2HSEB 2CUYA 4AE5A 3KDOA 5HVHA 2ZH4A 4LF4J 4NYOA 2RU9A 4R25A 3L3CA 4DG1A 3BSNA 2ZUAA 2CPEA 2DKOB 3MF5A 5CD4H 3CW2C 1KDNA 1V3ZA 1XQIA 2CJAA 2R42A 5E3PA 4QOTA 1F5CA 1OWXA 1PILA 3PNIA 5ETLA 4YUDA 1X0PA 1CQNA 1U2CA 4P2XA 5KFQA 1KONA 1R8CA 5HSPA 1T7PA 2HG4A 3C15B 2AJQA 1LWCB 1LW0B 2C2OB 4IH5A 3OR2A 2C3OA 4URGA 2N4DA 1KTVA 3MZIA 2I8EA 3TX0A 4RW9A 3GG1A 2OEMA 3EVMA 4PPZA 5KFXA 1H3DA 4MIWA 5D78A 2DR7A 5HQ8A 2NXJA 5GADU 2ZH8A 2YY3A 3N6MA 1UTAA 4USVA 2VBXA 2W8LA 3CCLS 2J0SD 1HQ2A 3EWGA 5L46A 4O4GA 1REGX 4F4WA 2VDHA 2ZJRQ 4GC7A 1EP4A 5B08A 2HGMA 5C25A 1F3VA 2HK3A 1U0HB 3K89A 2XULA 2YNGB 1Y0HA 2XY7A 3E3XA 3JSMA 2AJ4A 1U8SA 4LMZA 4JYAJ 3NS6A 4RU9A 1JQGA 2BXJA 1T03A 2FY8A 2IDLA 2V50A 4C2MA 2BRKA 2XSJA 3G6VA 2VICA 3QRPA 4OJ1A 4WTOB 3GP9A 2CA9A 4GKJJ 2A3JA 3OUYB 2OEKA 1IJFB 3CCWA 3M9OB 3M30B 5F8HA 2GW8A 1YJTA 3BS9A 5C24A 3GFHA 3EICA 3TA2A 5KFYA 2AGQA 1C0UA 1JNZB 5KFRA 3KK1B 2I38A 4JV5J 3W60A 4PG8A 2HQ3A 2Z2MA 2HFNA 1TL4A 2C28A 5DDOC 5D0GA 3UN3A 2GMLA 2R3VA 1HI1A 5L1KA 3GCWP 3M4XA 1BLUA 2RSQA 2RDJA 1IN0A 1HNWJ 2CFXA 4FYXB 4CYUA 2DNRA 2X3DA 3OHAA 3EUNA 4ZCIA 4Q45A 1JJ2R 3ULHA 3L9ZA 5KFFA 3US5A 2HZVA 3J7AN 4X4OA 5B0FA 4NCGA 3OR1A 1RA7A 4QJVA 2XM3A 3NNCA 2RHQB 4K4XA 4NA3A 1WSRA 2OPPB 5F3TA 5AXLA 4RO0A 5IC6B 3HM9A 5L38A 5CAAA 3PX4A 1U1MA 2FZCB 1QVGR 1VJQA 1L3KA 3CJTA 4BDPA 4P2FA 1QUPA 5FJ4A 2HGNA 1U2FA 1T0TV 2BKNA 2PSZA 4OYWA 1U1KA 1FJGF 2GJFA 4Y2IA 5KT4A 1QD1A 3OXFA 4A8QA 3PY8A 1AZSA 4CLSA 5GAHI 3X3UA 2L48A 5F3ZA 2HNDA 4UOCA 4B9VA 3Q8QB 4QR1A 3GB0A 2RQMA 2WVFA 2F3JA 3CCZA 3JYTB 3MMJA 3R1HA 1J5OB 2WZ1A 2B7BB 4C3LA 3VHQA 3KJVB 1KQFB 4X4TA 2F4VF 4WPAA 4ZLLA 3VF0B 2PIIA 2FTRA 2MQNA 4H4MA 3WDOA 1ZPVA 5L1IA 2OO4A 4RW7A 4KPYA 3LAKA 4LFAJ 3H2VE 2WW8A 1NDKA 2BE2A 1CJTB 1RZMA 3NS5A 2YX4A 2IRYA 1MWYA 2RS8A 2FHMA 3IFEA 4F3OA 4DUZJ 3KMQA 2GIQA 2QMWA 3FNNA 5A8RA 3QFWA 2IPOB 4KKOA 3W1YC 2QMUB 4RNMA 3PW2A 2ASLA 1VISA 3KLGB 1XMQJ 1HQEA 1GH8A 2CQHA 9RUBA 5SZTA 4AUKA 2DNKA 3NLCA 2ZOGA 2ZHAA 4YR0A 3Q0AA 4DL3A 2E5JA 3BV8A 5C2CA 4Z2XA 3H4BA 4A8KA 1VBYA 1LWEA 3SMZA 2XCPA 2AV5A 3AY0A 5KAKA 4DL4A 4NLUA 1YWXA 4RUCA 1A6LA 4KHPF 1JLAB 2QL7B 4K8RA 3GR0A 2R7XA 1HHSA 3H25A 4F4AA 3D68A 1IKYB 1X4DA 2YKQA 2CQCA 2CPXA 1M5OC 2Y1JA 3VGVA 1I94F 3CSKA 3M8PB 3PIOQ 2VODA 4OLOA 4DUYJ 3DI6B 2F9DA 1IBLF 4G1IA 2ZBRA 1RB0A 4JI7J 3DGPA 4TU9A 3ZO7A 5E3RA 1M5KC 1Q86T 4RUAA 3HCXA 2ASYA 1XNQF 1IWGA 1YIJS 4LF1A 3BGLA 1WC4A 1CS4B 3K5LA 3L95X 1T9TA 4J9KA 2K3KA 1VQPS 3QJJA 1KOOA 1G2EA 1SJ3P 1FK9A 3DMJB 4ZHRB 3NY0A 4GO7X 1R8AA 2MQQA 2KO1A 3LPEA 1OQ3A 3TO8A 2W7AA 1FF2A 1NKEA 1MMNA 2UUTA 2ZUGA 3SCKE 1WF0A 3NOGA 1HNZJ 2C2RA 4LIRA 2IVYA 2FJWA 3VGUA 5HJYA 2R8JA 2V4QA 4DV4F 3AOBA 5HO4A 2BJDA 3W64A 1T95A 5IZHA 1FJ7A 2IJRA 3AA8A 3CD0A 1S9GA 3UNYA 1IBCB 2C22A 4LRBA 1FJGJ 3OHBA 4F50A 2ZHOA 4JI8J 4LRFA 2E9RX 1GX5A 1RXOB 3V81A 5H9FK 2FHKA 4RW6B 4D3HA 1FXDA 4QQBA 4E98A 3H20A 2B4PA 1HPZA 1RT6B 2DGVA 3DLGB 4ZVEA 1KQKA 2BRLA 4P7VA 4ZOSA 3HSZA 3ZZ0A 2ATCB 1IBMF 3LWMA 4P75A 1OO0B 1S4FA 3QYYA 1DBDA 3T19A 4GMKA 1C4AA 5A8RB 3POTA 4DQRA 4LSNA 5HK4A 2OHDA 4JI3J 4LFAF 2BJ1A 3GYGA 4PWUA 5DQGA 3MR2A 4B3RF 4ZPTR 4J9MA 2QLXA 4ZMMA 2I6WA 2B4VA 4LJMA 2DR5A 3PG9A 3C15A 2VH7A 1FDAA 3CJKB 2FHJA 4R8UA 3W9HA 5KG2A 3PKYA 3MCNA 1HL6A 5RUBA 3R2CJ 1ZM4A 2ZZTA 3R5DA 1VRQC 3DLHA 5HMYA 1WC0A 2OMOA 3CJKA 1SXLA 2M8HA 5ETMA 1VQ6S 3W3SA 1FDNA 1Q7LB 2BE7D 1YK9A 2WHOA 2WSEC 3D0GE 5F8JA 2M4MA 5GVQA 2E29A 3BF4A 4X84A 2VASA 5GMDA 3SCLE 3F73A 5J2MA 2FJVA 1Y10A 4TYAA 4KKOB 3MOZA 1QSLA 1JKHB 2HFZA 1ZAVA 1D1UA 2QGFB 4B9UA 4WKYA 4OYZA 2RT3A 5HANA 4ZLPA 2XGQA 4RKUC 3HFZB 1CJTA 4ZVOB 3Q8UA 3T41A 3MUTP 2NYIA 1LW0A 1RISA 1SIZA 3HF5A 3NS7B 3OD2A 1Y4ZB 4ANEA 4CLPA 2LMIA 1RWWB 2RS2A 4C0HA 4WE1B 3KLEB 1CJUA 3SXLA 5E3AA 2OPSB 1IBKJ 2Z57B 4OI2A 3BBBA 3EVWA 5LT5A 2UUAF 5ETKA 3ICLA 2V0NA 3KWMA 1HWLA 2OAUA 1D09B 1TVRA 4Y3CA 4TVAB 3TR5A 3QT7A 4OYOA 4Y6IA 4KV8A 1R6VA 4N7TA 4A48A 1NH8A 3SEOA 3VAGA 3GIMA 4U7UD 2PEBA 3BPSP 4IQXA 3MM6B 2ZWOA 2C2MB 5F0UA 2YWKA 6FDRA 1TTHB 2NZCA 3NXZA 4RW6A 3FSXA 4FP9A 4FYVB 5A0YA 3WQPA 4WFZA 4FF1A 4YHHJ 1CLFA 5IT4A 4USIA 1IKXA 1KTQA 4B3OB 1R8BA 2OPRB 3R6GB 4F25A 5C24B 1L3VA 1O0PA 2KU7A 3KG0A 1VQYA 4NCGB 5HMXA 1S1TB 2HIYA 2N7YA 2KG0A 4HKQA 1B0TA 1BQMA 4DPOA 2E7XA 2ZOFA 2JOQA 4PQAA 4XPEA 4Y00A 2ZOMA 5DQIA 2BW7A 1PC4A 2GVZA 1XR5A 1OYDA 2M7SA 2V2VA 2WCXA 1RBAA 2ZVIA 2PDAA 3NCRA 4KAIA 5IQQA 3W5XA 3CCMS 3AB2B 4JI3F 1R0CB 4CO5A 1OQ6A 3BR8A 4O3NA 3FQKA 2MKYA 3RGIA 3TAMA 3GIIA 1S99A 2NXUA 1RSCA 5KFHA 4XDCA 3DGPB 4DV1F 2RRNA 2LEBA 2WRMA 3KUHA 3QO9B 5DM7Q 1Q95G 1X4FA 2OD4A 3HVRA 1S6OA 4CRJA 2KM8C 3MMBB 1TR0A 5A8KB 1JXVA 3EXYA 1ZETA 4DZDA 1EB0A 1TKXB 1S1VA 3THPA 1ZPWX 2IMWP 1RLDA 4MKVA 3BM7A 1WEZA 5KFLA 3HPOA 4FNHA 4FVMA 4FBUA 3CDAA 3QT8A 3KLEA 1X8DA 1CPZA 1P1LA 4OZJA 3CJSA 3BGUA 2YKPA 2BDPA 4XDDA 1U6ZA 1H2VZ 3DXBA 2KRRA 3J81U 2UVWA 1OYEA 2XMTA 4O4GB 1DLOB 4C8MA 4ED4A 1HLWA 4JYAF 3C14B 3A8KA 2W9AA 1TFWA 2P5VA 3WC0A 4DV2J 2IC3A 2AU0A 1FRXA 3QO9A 3VGSA 3AQOA 4ITSA 5DJBA 2W9CA 4DV5J 3H5SA 1U1PA 1RT2B 2Y8YA 3GJTB 4X4QA 1DQ9A 3CJ8A 3M1VA 1H38A 2RJZA 3HHLB 2YX1A 2WSCC 2EBEA 2KN4A 3Q8RB 5HL7Q 3V6DB 2AYGA 2VDIA 2CQGA 5U47A 2HBYB 1XBWA 2B9WA 1DJ0A 3DLEB 4LF9J 1UWBB 5MLCV 2HNZB 2HZAA 1OMSA 2MLYA 4LRAA 1KHWA 1WHWA 2V9KA 2YXLA 3FCVA 2NUUG 3KNGA 4P72A 1D9DA 2NCKL 1IWAA 2B0GA 3L4BC 2QT7A 3DNCA 5DO2A 4RNFA 5LJ5Y 1S97A 4C8OA 4OZ3A 1FXLA 2H65B 2HWTA 2VG7A 5KOXA 4F2RA 3NNAA 4YY3F 4PXEA 1Y7PA 1Q53A 1E6YA 1TU0B 3TVYA 4DXLA 1GMWA 2MLXA 3BKFA 1BXNA 1UW4A 2H3EB 3DLJA 3DU5A 4UT4A 1CS4A 2RU3A 2E5LJ 4J9LA 3V81B 1FRLA 1HHTP 2R7UA 1IVZA 3ADAC 3DXSX 3IXQA 2IAJB 4HT5A 3N6LA 5KT6A 4DL2A 3OR1B 4HI1A 1D8ZA 1W2BR 2ZEJA 3K8VA 3OQ2A 1RU2A 2YQ0A 1LFPA 4NLGA 4GVLA 4DL0C 2HVIA 1BQMB 3MDFA 1K8AT 3QPIA 3H5YA 2H5EA 2Y3YA 4X2BA 2AW0A 5J2PB 1Z4UA 2MTLA 1FKOB 1CVJA 1SH2A 2FYXA 2NPIA 2ZH3A 3FGVA 2JEJA 5DZ6A 2FPHX 1H2UX 4ED6A 1REVA 3EZ5A 1OSDA 2QX0A 3D28A 4OHXA 4EBDA 3FRZA 2HHWA 2Y1RI 1VBKA 2I0XA 1E6YB 3H8YA 4NLOA 3EDQB 2ATLA 4K4VA 1WD6A 3NMRA 1JWWA 1RTDB 4YB7A 1NSKL 1R0AA 2I5JA 1KLNA 4R5PB 3CF5Q 2MXYA 3LP1A 4NPOA 1WC5A 5J2MB 1RI7A 4Q44A 3EX7B 4F7VA 4NLXA 2QJ3A 4WBFA 4XPCA 3G2XA 2K7JA 3MM5A 3OR2B 4ZVPB 5KT3A 3CIMA 3EPGA 2C3MA 2DHGA 3IO1A 2B6AB 4JI4F 1SVDA 2MLZA 2JFDA 5DG9A 5G0RB 1NXIA 2LQBA 2V4JA 3AXMA 1UMJA 1S4EA 2CVEA 3CTRA 3D6TB 4USHA 4WU2A 1QTMA 1XMQF 2RRBA 4PG4A 1OS5A 5K8NA 1YGYA 3D3BJ 4P7TA 4B3SJ 2DD8S 1WTFA 1HBNA 2JX2A 3M32A 4HTJA 5FLXY 4DSKA 2LXFA 1Q79A 2XNQA 3KUEA 1N33J 3G8SA 1U4BA 2IC3B 4NMLA 1Q7YT 3HZEA 1TKTA 4J9VA 2MZJA 1FTCA 4FS1A 1HNXJ 2FLNA 4K0KF 3LW5C 2JJ4D 1VC0A 1UP1A 4LR7A 4J9UE 2UV8A 1GEHA 4OHWA 5B0AA 3B8HA 1HPZB 3U7JA 4JI7F 1JXLA 4F02A 3IAM9 3IWXA 2F40A 2GGPA 2RDDA 3GU0A 5T7LB 4LSLB 1JK9B 1SC6A 1ZAWA 4YY3J 4IFYB 1VQKS 1TKXA 2W24A 2XYPB 4PAAA 3VALA 3PV8A 1RHKB 2VD3A 4EWTA 3DLLQ 2M88A 4ES1A 7AT1B 4OV1A 2QA2A 1VIOA 5H9FJ 3CCES 2ERRA 3GQCA 2IA0A 1LXNA 1QAXA 4OX9F 2XGPA 4DN0A 5M2UA 3RZAA 3M9MB 2YX7A 4ED5A 2DGQA 5H1SV 3SFUA 3RG6A 1DTTB 1X4BA 4ED7A 1KFDA 3A8IA 4QIWD 3I87A 3MGJA 4OZLA 2ZE2B 2VFTA 3I82A 4ID5B 3NWRA 1FX4A 2HBQB 2HVDA 3BGFA 1C1BA 4PEOA 3Q89A 4P73A 5K5MA 3WBZA 5HROB 3GIJA 4DR3J 1UVJA 3BSCA 2ROEA 1NJXA 1TUWA 4FBTA 2M5YA 2VQFJ 1GMVA 4GVBB 2DEJA 4O3PA 3THTA 3TX8A 1U48A 3QIPA 1MMDA 4A46A 2XO7A 2YWEA 3IM8A 2O67A 3KK2A 3TAPA 1R7IA 2C3UA 4ZCLA 1I51B 1PAUB 3T6BA 1DQ8A 3EGWB 3KLFA 3JAMU 2CPFA 4KFBB 4ZN3A 5F0WA 5DLFA 2CQ3A 1EAYC 1F60B 3AOCA 5E3CA 4RNHA 3W7BA 2CKWA 3PEJA 3QAEA 4KV8B 1VC5A 2OTLS 5D4OA 1IKVA 2KT5A 4N76A 2AHOB 2CG4A 3QT6A 1PC5A 2ZDOA 3HSJA 3N01A 4O4RA 5B09A 2XY6A 1S0MA 3NMAA 2BOAA 4LBIA 2PGCA 4I6AA 3MPVA 4IRDA 3Q24A 4DPUA 1JLGA 1V6HA 4UW2A 6AT1B 1NSAA 3I96A 1SQEA 1DARA 3FEXB 2XMUA 1H6KX 4IRCA 2OMLA 4LSZB 1VR6A 1HBOB 2MHEA 5FDLB 3RBZA 2YNFB 2DO0A 3FEZA 4EBEA 1S57A 1NO8A 1RAOA 3BO2A 3F0NA 1VQ9S 3LGHA 2QYGA 1FVSA 4QU7A 1MN9A 2ZE2A 2AD9A 1FRKA 2QLBB 2RUGA 3JTPA 5J2QA 1Y3JA 3TZZA 1K47A 3MM7A 2GV1A 1LNQA 3C16A 3DC2A 3ZTOA 1APSA 5DM6Q 1NZAA 2ZZNA 3GR1A 2VIHA 3O44A 2LQ9A 4O3SA 2G0IA 2IVFB 2OUGA 3OL8A 5KFNA 2WK4A 2CPZA 1RHRB 1RTIB 2CQ0A 3F56A 2FC8A 3BKTA 2A2CA 4UUWA 4LF7F 2YBVA 3G71S 2HYIB 4B3MJ 3O1LA 2HQDA 1G6BA 2ZJPQ 3OJUA 5DDQC 1TZ0A 1B0VA 3UPFA 1KQGB 4Y2AA 5D4NA 1N36J 1NM2A 4O3OA 3ENAA 4EI2A 2JL9A 3IWLA 3RR8A 2AGPA 2FGCA 1GQEA 1XIQA 2MKCA 2X7IA 3QWUA 4CDIA 3OL7A 2ASDA 1MN7A 4BC9A 2CWXA 2E5HA 3CO0P 4K4UA 2NZ4A 2RILA 3IBCB 1H98A 1T05A 4I56A 1FFWB 5E7OB 2KM8B 3MPWA 1S9GB 4OZ1A 5E41A 3I0RB 4Q2LA 4ECVA 2Y0SD 3QWPA 4AFFA 3M2RB 3GV7B 4C11A 1VQ8S 3KFWX 3UCGA 2BMBA 4DV1J 5EUHA 4LRCA 3ZXWA 3IN5A 2YNHB 1MLAA 2ZDPA 3ILLA 3CB4A 1IR0A 2WOMA 4QW8A 1UKUA 3AD9C 4ZVUB 5A0YB 3RB4A 3FBFA 1UVKA 3BO3A 1O5JA 1F9EB 1EP4B 2A6MA 5C25B 2YNIA 1LKZA 5K8PA 5MAOA 4CTAA 1QSYA 5LL6d 4J7CA 2HWHA 2FJAB 4JB8B 4JV5F 1CQMA 2NS1B 4ECQA 1RTDA 2N7CA 5K20B 1MG7A 2YNIB 3DDNA 1CJKB 1CJVB 4YEAA 2RVJA 3RJMB 5T14A 4E0DA 2UXDJ 1VC6A 3F44A 2BR0A 4YMEA 1T9YA 2VFRA 2DJWA 2MZTA 1VK8A 3FBEA 4NZ6A 4OLPA 2OJ3A 1VRUA 1LK7A 3I9ZA 1JLAA 4ZN1A 2D3UA 4DUZF 1N4LA 5L9NA 1HD1A 1OY9A 1N8RT 2V9WA 4IO9Q 3DYAA 3O8WA 3K57A 2RDIA 2FJBB 3PRDA 4JI2J 1U0HA 5KG3A 2HQCA 2V34A 2ZITA 4J91A 1GK8A 3I0RA 2V8HA 1SH3A 2E1PA 2R7OA 3PYDA 2XMVA 4OYPA 1MROB 4B3RJ 2CQPA 3QGPA 4Q8FA 4BCAA 1BQNB 2VOOA 2G13A 2ZH7A 2LP4A 2VPWB 3M6VA 3A8JA 4P2SA 4YOEA 2DHAA 2BQUA 4ZVGA 2XLKA 4XK8C 5L8RC 3SSQA 2CJQA 3MM9B 1GTHA 2BE2B 2EWHA 3MPDA 5CCMA 5LMUJ 5DZ7A 1VBZA 3HZGA 2XLJA 2JNJA 3ZTPA 4YB6A 4QZVB 5KFJA 5AJ3F 3QJPA 2BKPA 2Z56B 1RDRA 3H42A 4LFCF 3RYLA 4FNIA 4ECSA 4OX7A 1F9HA 3ZZOA 1XNQJ 2OGUA 3T5JA 1S0OA 4B3MF 1BMQB 2W2NP 3LWLA 1J5OA 2E7VA 2VFSA 3VVUA 2MKSA 3RB0A 3HX9A 2E9TA 2H5JB 3CJ2A 3HHEA 3MEDB 4CLTA 3MOJB 3OT9A 5CZXA 4K0KJ 1WG4A 1VRTA 3A3OB 1VOMA 2M3DA 1U1QA 1HYSB 2V5HG 5A8WB 3BDPA 4QU6A 4DU8A 1SKWA 3W63A 5C5JA 2OFGX 5HP1B 2BANA 5J1EA 2KXNB 1ELOA 1LQ9A 3M8RA 3WC2A 1U8WA 3UNGC 2MQ8A 2D3O1 3TW0A 4GKJF 2ALYB 2R8IA 1XR7A 5DG8A 2MEWA 1UVNA 2DH7A 1Z2ZA 2CQDA 4FPIA 4F67A 3HJFA 4LVOP 2NPFA 3D1OA 3SIPB 1RP5A 1WKLA 1U0SA 2QFJA 1G1XA 3BSAA 2L3MA 3RB6A 5ETVA 1AT1B 2DGTA 5DGAA 3PX6A 2OPRA 1NK0A 4B9MA 4WP3A 2BOPA 4XAKA 4ZKAA 2YVSA 2QO3A 3FRYA 3OXGA 3MTKA 4ECWA 4YN3B 5IFMA 2FZKB 1K73T 1LWFA 5KFGA 3GIKA 1OPIA 2IVMA 1OJ4A 4JI5F 2D69A 4LFBF 4A8YA 3KNAA 5BYSA 3ZTRA 3CMAS 3CC2S 1P9YA 4KSEB 2Q1LA 2Q43A 3LAMA 3SFGA 4ECTA 1N5YA 4IR1A 1H0HB 2WVEA 1VQLS 4ILMA 4PYAA 1VK3A 1S10A 4OZ0A 1Y5IB 4ED0A 3JB9k 2GQ2A 3MMCB 4RBUA 4MKYA 1N33F 4ZPWR 2VKZG 3D6HB 1M0SA 3G82B 3BKUA 5L9XA 1HWUA 3CCRS 4RNNA 1I5OB 1YDLA 3H5XA 5EWEA 1NMEB 2CJKA 1K1SA 5CHCB 1AB8A 1EHWA 2XHCA 1GT8A 2GCFA 5ETSA 3V4IB 2G4BA 2FVCA 1XERA 1N52B 3D7SB 3DOKB 2E1MC 2D74B 3NGUA 4RW4B 3AHPA 3ZZZA 1K44A 2IBKA 3DRXA 1SBRA 3FCHA 3ETMA 4DN9A 5G4DA 2E5GA 4C48A 3Q23A 1C4CA 1NPRA 1IBKF 3SZ2A 3CD7A 3MM8B 2CNKB 2F8EX 3N6NA 5E5NA 4K2JA 3VCDA 5A8WA 4HT7A 3RW7A 5GAGU 4V19X 2YNHA 2AX1A 2MSSA 2YTCA 3VAIA 1CSJA 4J9SA 2L9WA 4EGLA 5GAGI 4C0OC 3JSRA 4IOBA 3NRBA 4RLEA 3NBPA 1X31C 3T1YF 4BS2A 3UCUP 3RRKA 5EWFA 2D1CA 4YFUA 3GFYA 2PA3A 1GX6A 4PG7A 4YHHF 3V6DA 1Q81T 3HVTB 3UVJA 1RWXB 3K5NA 1BWEA 1UJ6A 1JJHA 4DBQA 3I4PA 2QYCA 4HLBA 4DL6A 3U27A 3OTCA 2H4YB 4RBTA 1IKWA 3MM8A 4QPTA 1B7FA 4HHJA 3ET6B 1LV5A 1NB2A 1JB0C 3MCMA 4ZIWA 1Q0NA 4OFZA 5JMNA 3RAXA 1WUUA 2K1RA 2GMHA 3OTDA 4JI6F 2DITA 1WI8A 3OBIA 4C3KA 2KH9A 3NCPA 4MFBA 3QAUA 3D0HE 1B3TA 5IC4B 1HW9A 3W66A 4RW8B 3V4IA 4H54A 4X62J 2KI2A 2QA4S 3G96A 1UETA 2AX0A 2IHR1 4LREA 5KFEA 3SYZA 3MR3A 3HT0A 2QEXS 4PCQA 3I5CA 3HI9A 3TUIC 1SJ1A 3RU0A 3TVZA 3MFHA 3MM9A 5EDWA 1YVFA 1M5VC 2BABA 2HLTA 1QM9A 2MY7A 4ZPAA 4UOHA 4ED2A 2EFNA 2JFKA 1M1KT 2JLEA 3VR1A 4ER8A 2OLWA 3AFGA 4F8RA 1CJKA 1A9NB 4KQZA 4OJGA 1VFJA 1KKHA 2GAGC 4NLTA 1VQ4S 3E01A 3LP2B 1E6VB 3V2UC 4JI1J 3C19A 1XEZA 1RT6A 2O1PA 2WB4A 3V6HA 4DFKA 4I7FA 5HBMB 1OPZA 2P8IA 3PDNA 1ZBTA 4JP8A 4C8NA 5IWAF 3MXHP 4P2MA 1NH7A 4EYHB 1MMLA 2WSFC 1K1QA 1WJ9A 2HFUA 2X3GA 1U26A 3UR3C 3W2VA 2JEGA 4ZLJA 4RU2A 4YS2A 5CABA 4LFBJ 2XYHB 5KG7A 3CDBA 2DNMA 2CYYA 3W5ZA 1V3SA 1WC1A 4N41A 2QLWA 2CZ9A 3BREA 1IBMJ 4KJIA 4PUOB 1KRPA 3MWBA 1RQ0A 2VV5A 3FSYA 3DDIA 3MCSA 3JAMY 3RAQA 3MCOA 2ALZA 5SUHA 4Q5VA 4P10A 3IBWA 1RLCL 1FK9B 1WSVA 2A18A 3UE2A 2DTJA 1LWFB 5CYJA 4NASA 2G9OA 1TV6A 4QYRA 1OY6A 5K8OA 3CGIA 1YRUA 1TMMA 2DNGA 1SIWB 4FN5A 3P6YC 3EM1A 3SSSA 4IFVA 2UXCJ 1HWJA 2CNLB 2QIFA 4N47A 1J27A 3D1QA 3PM9A 3BH6B 4OI3A 4HYKA 5M2PA 2FJXA 2DPJA 1TUGB 3PACA 1T02A 2HGLA 4L74A 1WWHA 2ZM6J 1KHVA 2P6TA 4ELUA 1XWLA 4IYQA 2HFSA 2HNZA 2JEFA 3SCJE 5KFKA 4L72B 4QYZJ 3ZZUA 4U6PA 2WW4A 3BR9A 5T7LA 3OFGA 4KBIA 4AL5A 1XK8A 3AB4B 4HI2A 2NLWA 4M1KA 1Y5LB 2D9OA 3MEKA 5E3QA 4DR5J 5FLXU 4YQWA 1P8GA 3HDSA 3I6PA 1RT5A 2EKNA 3BBCA 3D66A 4ZP8A 2MSTA 2R8KA 3M6WA 4UF4A 3DN9A 2L41A 3HHKA 3LA0A 4ERDA 1G7CB 3DRPB 2DGXA 3IC1A 2UXBF 2HHSA 1TL5A 1IM4A 3HVTA 2ACYA 5D3GB 5DQHA 5IM0B 4I67A 2PI4A 2B8QA 2R9LA 2HRUA 4ZVRB 4RW4A 4A47A 1RTHA 1MU2A 2B8PA 3NGKA 3CCVS 4FXWA 2CDQA 4ED1A 1HQUA 1RAHB 2BW2A 4ZDNA 2PFDA 1ZA2B 2O01C 4DS5A 5LOQA 1SKUB 3RTVA 1YZ6A 4MKBA 2YPZA 3W2VB 2BKOA 2HNYA 3R1LA 2D9PA 1RJJA 1Y11A 1X5OA 2A6OA 5L1LA 1TV6B 4J90A 4FF2A 1RAEB 2V8GA 3FBCA 1YBTA 3CT9A 1KLMA 3IR6B 3K5PA 2BZ2A 4FVCA 1CJVA 1S12A 4H4KA 1AZSB 1RAFB 3EDRB 3KDNA 3M05A 3PRBA 4KGMA 3OV7A 4ZJLA 1F9FA 1B99A 4MTPA 2QV6A 2VL1A 2QC3A 4ZLNA 2XY5A 3DRYA 4K7QA 3J80U 2J0WA 2DR9A 4B3SF 3M2UA 3RR7A 3I4HX 3MMAB 1D8YA 4F0KA 1S72S 1PG5B 4F26A 4EZ9A 2R7RA 2B6AA 2QSFA 4QYZK 4X4VA 1RT7B 2KJWA 3EVOA 3I5BA 1RE1B 5IXUA 2LU1A 3J7YI 2WONB 3KYLA 3ISND 2X1AA 4UQTA 3EYZA 2XNRA 2UVUA 5B0BA 1XN9A 4RR5A 4AXJA 1C1CB 4CYUB 2W9BA 2UVVA 3D67A 4EYIB 2YKNB 5KTQA 2G1HA 3EGVA 3R2DJ 5KFSA 3KHLA 3O3LA 3WX4A 3TARA 1LW2B 2NR0A 1U24A 4IG0A 3JTNA 3FC9A 1HFEL 1U1NA 3CDUA 3MM6A 4LF8J 1H72C 1SUQB 4JV2A 3CJQA 2E5IA 4OYAA 8ATCB 1GXUA 2DXDA 4DX5A 5F8LA 4IDKA 5KG1A 3C6TA 1JLBB 3OPKA 4NRTA 2LFVA 1UJ5A 1PJ7A 3GWCA 5D0RA 3O2IA 3ZNUA 5HVFA 4WFNQ 4KO0A 1S6PA 4X65F 4EO6A 4Z7YA 4DR5F 1DURA 3PIPQ 2XCAA 2KVIA 2XO6A 1RTHB 1PSDA 4DPYA 5HMZA 2BQ3A 2VQEF 1SI9A 2RHSB 4OX6A 1UFWA 3GFXA 3HKZD 4KH0B 4TU8A 4L6V3 5HMWA 2J9CA 2D41A 2CNOB 3PFEA 4MYTA 1NK7A 4DR3F 3B78A 3ET6A 4NZ0A 1U6FA 4MIAA 4DX7A 2DGSA 2BACA 2FC9A 4F0HA 1ZM2A 5L1JA 2NXCA 4X64J 4RWWA 5JXSA 4KHPJ 4PWDB 1GMWD 2W9CB 3TOQA 2XS7A 4W90B 1DHMA 4NA2A 5I3PA 1FRJA 1TKTB 5CYQA 4EBCA 5IS2A 2DNHA 2EFOA 4NLPA 5IQ6A 1VGYA 4RJVA 1NDCA 4DR4F 1R6YA 3QLHB 4QR0A 1B0PA 2YWHA 5HI7A 4KT0C 5BYQA 4BWMA 1PJ6A 2CPYA 4CO2A 2HBRB 4ETZA 1U1LA 4PQUB 2B51A 4D3GA 1LK5A 3UWTA 2G1DA 4DI6A 4RPFA 3M8QA 4LF6J 2MQOA 2U1AA 4URSA 2MJUA 4DSEA 4IDKB 3PJXA 1XMOJ 2CAJA 4OIXA 1Q5YA 1ULRA 3DRRA 4B3TF 3MM5B 2V2QA 2FJEB 3K5OA 1KFSA 2YKMB 2ZH6A 4X4UA 2J7KA 3MEEB 4CLWA 3UO0A 1TK0A 4AD6A 2HHUA 4ZP7A 5IV3A 3FEYB 5A2QY 4FF3A 1VMBA 5CA5A 2I5JB 1X4AA 4B9NA 2XZDB 3DOMA 2YKNA 1BE4A 1YX2A 3D54A 1RKIA 4OI6A 2BJ8A 4ZVSB 5LXRA 5KFDA 2QFIA 2VBYA 5J2NB 1BWVA 2LA6A 2J76E 3MTJA 1S49A 2W2MP 1ZTTA 2C2NA 2MZRA 2F7VA 3MD1A 5KFPA 1FXRA 3PHTA 4TQSA 3MR6A 1RT7A 4CLUA 2JC1A 5G0RA 5F8MA 1RUSA 2FY1A 2IY5B 2F8HA 5IT9Y 4A8FA 2R7WA 3AD7C 5EN1A 5DS7A 3KTQA 5B7WA 2EKYA 4URQU 1FESA 3K58A 4B9SA 3HFVA 2ZJQQ 3DOLB 3IG1B 5BXIA 1S7HA 2FD2A 2E66A 3Q8YA 2QL9B 3CJ4A 3M7VA 4ICLB 2EFQA 4CQ1A 4NE9C 2QMXA 3EGNA 4HR2A 5EX3A 5AE1A 1H73A 4X65J 4M5HA 2QRRA 2BANB 4NLWA 3M8ZA 3U1MA 4ZIVA 5C42A 4DZ6A 2B43A 1H2TZ 2C3YA 1C0UB 4KGXB 1CG2A 1TQLA 4RX6A 2VFUA 1F2GA 2HS4A 2B4UA 5J2PA 1YJVA 3DLKB 3EXCX 5I3QA 1YQHA 2JSXA 4Z7CA 1RABB 3PXGa 5B0DA 1S79A 1JX4A 1WG1A 1HNXF 3M9NB 2HMIB 4I6YA 1C1BB 1NRKA 5HROA 1WG5A 1X60A 3SSRA 2W7OA 4NX9A 4ENOA 2P6SA 3K5MA 3THVA 4LBPA 1IXKA 5BR8J 2QL5B 4LF5J 1URNA 4C8ZA 4MMOA 1FD8A 4NEYA 4B9LA 5D4LA 4TLRA 2RKIB 5IOLA 2BQRA 1FNMA 2NSCA 2Y9HA 3MAAA 5CH7B 1NPPA 2GS8A 4DX6A 5KOWA 3QRRA 2M2BA 4WXWA 3GSIA 4OJHA 3OLBA 4AL6A 1TKZA 2ZD1B 3SBMA 3JSYA 1VQOS 4GKKF 2FVPA 2HWIA 2ZWPA 1BHNA 3LH2S 2OPQB 4A8XA 1P1TA 5F41A 5AXMA 2GJ2A 3NBPB 4OX9J 2OPSA 1N0UA 1YJ7A 4V1Ak 4CH1A 3UDCA 3OTOJ 2FHJD 2OD6A 1PBUA 1AXQA 4C98A 1UVLA 2GHPA 1IM6A 2VUGA 5ETTA 2B9EA 2V8DA 2NXEA 1FNXH 2I1RA 3TUJC 5FD1A 2UXDF 3W62A 1VQ7S 2MKJA 4IQMA 3BQ0A 1NNDA 5I4MA 1DTQB 1P9QC 5EHHA 2LEPA 4DEZA 5I3UB 3KKFA 3PVXA 4DQPA 4UY8T 5IT9U 1ITPA 3C14A 5JVHQ 4UY85 1FCAA 1RAJA 2GFFA 4P71A 4LR8A 2VG5B 2FLLA 1RT4A 2E7WA 1GAOA 2YNFA 3CJ0A 1S1XA 5KFOA 3PR4A 2HHHJ 2ROPA 2V2KA 4KTQA 1TL7B 2KZMA 2DY9A 4K59A 1P27B 2SXLA
chains in the Genus database with same CATH topology
2CPHA 4ZPCA 1M5PC 4R8UB 1FKOA 3VWSA 4K4ZA 1FNOA 1QLNA 4DHVA 2AJFE 2DIUA 5D4PA 3OJSA 1WTBA 3DLKA 2UXCF 5CQGA 1JLFB 1E6VA 3J80Y 2ADCA 3BN4A 2DH8A 2PMZD 1SH0A 2CJ9A 1U49A 3G6ES 3N5BA 1FDBA 3I32A 5KFZA 3PZPA 4IG0B 2AGOA 1U09A 2L9NA 1YJNS 4ZPDA 7FD1A 2J6SA 2BJEA 2POKA 4DOZA 4B9TA 3ZZRA 4IG3A 4TLQA 4TN2A 1T94A 1W25A 2BYCA 3P96A 1VBXA 1GXTA 3R5AA 2VFVA 1K0TA 4USJC 3EPIA 5LSOA 4DDFA 1S1TA 2IYGA 5KG6A 4CI0B 1U47A 2E1RA 1JLCA 2E1CA 1UA1A 3DLEA 4K4SA 1MNEA 4WK1A 5D3GA 1R8HA 3QGIA 2Q6BA 2R7TA 4C9DA 4GO5X 1ZAXA 4JOUA 2GO9A 3MR5A 4FYDA 1MW7A 1RT4B 4DV7F 2B5JA 3KLIB 1VS3A 3L7PA 2LDYA 4WYWA 1HMVA 3U1LA 4K50A 1U6BA 3I55S 2OIHA 2LCWA 4C0BA 4PKDB 4DFMA 3FFIB 3HK2A 1WELA 2MQMA 1N0VC 2IM0A 3FDSA 3MEEA 1JXEA 2VBWA 1DLOA 4RBVA 3M8SA 4Y0FA 2DRAA 1FKPB 1HBNB 1WHVA 3M32B 4NLRA 3ETOA 2V4RA 2R7VA 1HARA 1N5VA 2QE5A 5A6WA 3S1TA 5KFIA 4WFBQ 3QZ8A 3VAMA 4HVZA 2AP6A 4CH7A 5KFAA 4M95A 5KFCA 1S9EA 3KHRA 2E44A 5GAEU 3Q22A 5KFBA 4KGKA 3HVAA 1YI2S 1HNWF 2DHXA 2KTQA 2VPYB 3KLHA 4ATNA 1RKJA 2XCPA 5BYRA 3DRPA 2B9XA 1KEKA 1GXLA 2DNQA 4DF8A 1BGXT 3PW0A 1G3OA 4Q0BB 1GTEA 1YJUA 3N4WA 4BC7A 4DX8H 5DDPC 3PO4A 3TVKA 2EC0A 1UL3A 1J5EF 2Q66A 5D77A 3JSBA 1F5BA 3H5UA 1Q1KA 1JLGB 1FEHA 2XC9A 1FRMA 2M52A 1S1WB 4OI0A 3T1HF 1R27B 3G6XA 3KG1A 4JI1F 3C2PA 2APOA 1NK9A 3N79A 1M90T 3C6TB 2G0CA 1HNVA 4I0WA 4YDDB 2B3TB 2PC6A 4IFVB 4WYLA 1SUQA 4PXDA 4N56A 3X1LB 3VAJA 4DSLA 1HBMA 3BJYA 2Q79A 4FXVA 4B17A 4WF9Q 4DLGA 3KK2B 1N88A 2Z8QA 5F9LA 3GMGA 2HQIA 3NCQA 3CUNA 1K0VA 4OX8A 1FERA 2ABYA 2WBRA 3PX0A 4DV0F 3HHNB 1MWZA 1XMBA 4EZ6A 2ZFHA 1FD2A 3DHWC 2VG6A 3QIDA 4KHMA 2UUBF 1FVQA 3IGVA 5LXYA 3P49B 4E8UA 1M5HA 1ZM9A 3U02A 3K59A 3J7Z5 3O6QA 1HW8A 4ID8A 2XLIA 2YQ3A 2DO4A 3G86A 4WFXA 4CCHA 1JLQA 2IFXA 2KB2A 2ZC4A 1TKDA 3Q8SB 1DTQA 2K8GA 4DFJA 2DHSA 3GILA 2IM2A 3HHLD 4LUBA 4HTIA 3DHXA 3OSPA 5DG7A 4O0IA 2DT9A 5HLFB 2PMHA 1AUDA 1R8PA 4J9OA 1UEVA 3CMES 1JIHA 4ILLA 1N5QA 1N5TA 3LF0A 1RA6A 4WK3A 1TL3B 2KT2A 4J9QA 5HLFA 3IGNA 1VQNS 1S1VB 1SJRA 4YB5A 3BN7A 5KT5A 2OPQA 3TANA 2HFOA 1U1OA 2GMJA 3POTB 5I3UA 1U45A 2LA4A 4P6QA 3MFIA 1R0AB 3CCSS 4K4WA 1N48A 1HMVB 2DBBA 3R27A 4F4XA 2IM3A 1HI0P 2QZ8A 2M0GB 1U1RA 1SV5A 2JRSA 4J37A 4QW9A 3HO1A 3NWGA 4WKRA 4OHVA 4OMFG 3QJLA 2ILZA 1WACA 2PO4A 3MMCA 3C6UB 4HDHA 2OSRA 1KQSR 4HDGA 2GO8A 2VC1A 1S76D 2GX8A 5B0CA 4R5PA 2WB1D 1JLQB 2AJ0A 3SDEB 1X4GA 5DDRC 2VZ9A 3SCIE 2EFVA 1QAYA 3ITHB 1UA0A 1HBMB 1D9FA 3GV5B 3OVAA 4HH0A 4NLDA 4CZCA 4K2XA 3CJ3A 2AF6A 4MYUA 1HNVB 1JLFA 4LF5F 2FIUA 3MEGA 4HL9A 2DNOA 4KE5A 3DOLA 3IG1A 4ZA1A 5K8MA 4PR6A 4IRKA 5LSLA 1M5SA 1NU4A 2Z0GA 2J9DE 4U9RA 2ROGA 2RMLA 2JHEA 4OI1A 4G1QA 1WI6A 3CIZA 4BBYA 5DETA 2MB0B 1UFLA 2KFZA 2YNGA 1TK8A 4NWBA 1AFJA 2ZHBA 1DTTA 5ADZA 3L7OA 1HYSA 2PEHA 3PR5B 4IOAQ 2E9ZA 4PG5A 1KNZA 3IR5B 1QAJA 1BC6A 2E1AA 1KS2A 4MAKA 1JMTA 4C97A 1X7VA 1VIXA 3W2WB 2EK6A 4LT6A 4NYPA 4C4WA 2HLUA 2LYVA 1QUVA 3HP6A 1KC8T 2R7QA 2ZKUA 3JSMB 1HQUB 4AYBD 3LP0A 1FT8A 1VJWA 3FJ2A 2OH2A 3C66A 1FKPA 2L9DA 1N56A 3ZZPA 2HNDB 2MKHA 3FZBA 1HA1A 2K1RB 2UV8G 4EFAC 4WCEQ 2OP5A 5J1EB 4WXOA 1TKZB 3KLHB 1ZZNA 4UQGA 2DNZA 4NLQA 3CD6S 1Q8BA 1Z1ZA 1BD6A 2W7PA 4DL7A 2X1FA 2B5JB 3KLIA 2PI5A 1S9EB 2CQIA 2DIVA 2C3PA 4RW7B 1XC9A 1O8BA 2GIRA 2UUCF 1HNIA 1YG0A 4I1TA 2Y1IA 2IRUA 2XSFA 2HAIA 3BEGB 2DNPA 4Q2MA 4IR9A 3J7A1 2CQ1A 2XMKA 2RQCA 2K2PA 5M2RA 4KO0B 4Y28C 3DDKA 2XWYA 2CZ4A 4ECRA 1NKCA 4DWIA 1H7WA 3MURP 4CTAB 3GFZA 4Q8EA 4CO1A 4V19J 5JJBA 3HVWA 1REVB 2ZC3A 1FJEB 3I31A 1KR4A 3IAS9 4QCLA 4DFPA 1KSPA 1LFWA 2VC0A 5GAHU 5L39A 1JLCB 4PRFA 3HHDA 1IUJA 4J5OA 2IM1A 5GADI 2LDIA 2ZNYA 3HKWA 4ZP9A 2H9ZA 2UU9F 3CC4S 4WE1A 1VRUB 3KHHA 4PXCA 2J7WA 4TYBA 2XHWA 1SV5B 3I0SB 2MGZB 2WAQD 3MAHA 5BJRA 4JV1A 3GYXB 5D8HB 2RF2A 1J2VA 4F3QA 2R2RA 4ES2A 3BO4A 2AYBA 1VLYA 2ZH1A 1DRZA 3BDEA 1JKHA 3HMJG 2ZZMA 1TVRB 4CT8A 4FF4A 3R3TA 4JV0A 3K8WA 1XMOF 3CPWR 3F41A 4QWDA 3T9ZA 3TUZC 3G8QA 4NLVA 4YR2A 1R31A 1UWBA 4WJBA 1Q8LA 1TL3A 4ZPBA 2EVZA 5JVGQ 4IH7A 1RTIA 2E5LF 1LWEB 3MHYA 2GGPB 2HRYA 4TXSA 5K9FA 1N32F 4DL5A 5J1NA 4QWCA 1NJZA 1XR6A 1D9AA 3R5CA 5EGYA 3J7ZT 4CT9A 3T1AA 2FHOB 1L3UA 4Q43A 3G8TA 1LOUA 1Z2LA 3VAKA 2XMJA 2KZZA 2IRXA 1TUVA 3FFIA 4WZMA 4RW9B 4I64A 5CXTA 5E2QA 3MD3A 4JI8F 3DRRB 2W4DA 3H4DA 3ISZA 1YTYA 3CWJA 1A7GE 2ZNZA 2R2TA 2F1FA 5DGBA 4TY8B 5AE3A 2OPPA 3VAFA 1VQMS 4OL8A 3OVBA 4DSIA 5LJ3Y 3DM2A 2JEIA 1D3WA 5A8KA 1F5AA 1FRIA 1SL2A 5GAEI 1BY9A 4KHRA 3B4DA 4NCBA 1YJ9S 1FRHA 3J7YU 2R2SA 5THWA 4WU3A 2P9CA 2EFGA 1VI7A 2MGZA 1HWKA 4PXBA 4CO0A 1HR0F 1AROP 1NK5A 2Z4PA 2HHXA 4ICLA 5KG5A 3OSNA 5EX0A 3M30A 1K9MT 1U25A 4B02A 1NK4A 4PUOA 2B7CB 2LQ5A 2JVOA 4DV3F 1Q8IA 2O3DA 2DH9A 2DPIA 2UVRA 2XSJB 3FMBA 1NHVA 2ZH2A 2MQPA 4LF8F 3TI0A 2DK2A 3I5AA 3N0VA 3M2UB 4G6VB 4J9PA 1GNKA 3M2VB 2HHQA 4JI0F 4ZK7M 2GHWA 5J2NA 3UI3A 1KD1T 4YR3A 1QSSA 2FLOA 4L3NA 2QA4G