5D78A

Structure of rrm3 domain of mip6 at 1.25 a resolution
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
80
Chain Sequence
GPLGSMKTILVKNLPSDTTQEEVLDYFSTIGPIKSVFISEKQANTPHKAFVTYKNEEESKKAQKLNKTIFKNHTIWVGPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA-binding protein MIP6
publication title Structure of RRM3 Domain of Mip6 at 1.25 A Resolution
rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Rna binding protein
total genus 20
structure length 80
sequence length 81
ec nomenclature
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5d78A00
3PIOQ 3CCMS 4F02A 3B4DA 2RS8A 3VAFA 1Q82T 1WELA 5GMKa 1DZ5A 2F3JA 2F9JA 4LJMA 3G4SS 1FT8A 2DNQA 1RK8A 1UW4A 4C7QA 3CTRA 2DO0A 1WTBA 1U1NA 2X1FA 3UCUP 2BZ2A 4IO9Q 2CPYA 2DGWA 3CD6S 2HGNA 2MY8A 3JB9k 1WHXA 3G8TA 1VQLS 3ULHA 1P27B 2OTLS 1VQKS 3G8SA 2CQ2A 4ZKAA 1VQ5S 4RU2A 1U6FA 2MJNA 3ZZZA 5HO4A 2BOPA 2CQBA 2DHAA 4UQTA 2MQMA 3J7ZT 1YWXA 2I2YA 3CULA 1N54B 2VOPA 5JVHQ 1L3KA 2AD9A 1VQNS 3UCZP 5LJ3Y 3IRWP 4QU7A 2RQ4A 2KM8C 1NO8A 2QFJA 1KOHA 1FJEB 1X4GA 2DGQA 2B0GA 1WEYA 1U1LA 1WI6A 1M5OC 3CCQS 1X0FA 2K8GA 2MMYA 1YHQS 2U2FA 5DDQC 1W2BR 4FXVA 2RVJA 2RRAA 1WHWA 2AYMA 2M4MA 3LPYA 4YB1P 3EGNA 2XS7A 2KG0A 2K3KA 1H2TZ 2HGLA 3TP2A 3HI9A 2MZRA 2N7CA 2KHCA 4WIIA 3MUTP 2LEBA 1X4BA 4A8XA 2J0SD 5IM0A 3CMES 3NNAA 3UD3P 3S01A 5D77A 3MD1A 1U1QA 3EGZA 1UP1A 2X1BA 5MLCV 1SJ3P 1OPIA 4TU9A 1HD0A 5EN1A 4PRFA 2CPIA 1JMTA 2LKZA 1M5KC 5GAHU 1HL6A 2LEAA 4W90B 4IOCQ 2J0QD 2J76E 2JRSA 4OZ0A 2YH1A 1ZH5A 1WHVA 2LYVA 2MKJA 1F9FA 3SMZA 2M7SA 2ZJQQ 2MXYA 2KXHA 2X1GA 4WFAQ 1DHMA 2I38A 3THTA 1VQPS 2M52A 3SDEB 4WKRA 2MJUA 3U1LA 5LXYA 1VQ6S 2JX2A 2LECA 2CQCA 1K73T 5D78A 4YOEA 1VQ4S 3UE2A 1DRZA 2MZQA 2DGXA 1R8PA 2E5HA 2HYIB 3G9CA 1JJ2R 2NLWA 2L08A 3CCVS 1OO0B 2CPXA 2LMIA 4BS2A 3EX7B 3UD4P 1OWXA 3CCRS 1SJ4P 4P6QA 1SJFA 4C4WA 4LMZA 2LA4A 4F25A 5DDOC 3CCJS 2O3DA 3MD3A 1Q86T 1X4AA 3VAKA 2DNGA 1VQOS 3CUNA 1U1PA 3BS9A 3TYTA 2MQLA 2QEXS 1FJCA 2OSQA 1YIJS 1HD1A 2OIHA 2MKCA 2FC9A 4TU8A 4W92B 2DO4A 4CH0S 1IQTA 5CXTA 2DH9A 2Q79A 1WF2A 2DNMA 5CA5A 2MB0B 1JJHA 2MZJA 1QM9A 2E5IA 2L41A 3CC2S 2CPFA 1X4DA 4WF9Q 2QA4S 2YKAA 2RUGA 2N3LA 3BO4A 3P6YC 3UWTA 1H2UX 2XSFA 2G0CA 2YH0A 2DIVA 2CQ4A 2MZSA 3MURP 1WI8A 3L3CA 2DGOA 2ADCA 2MKHA 4WCEQ 2A3JA 5DDPC 2DHXA 3CC7S 3FEYB 2DK2A 4CIOA 1WF1A 3I55S 2VODA 4PR6A 1SJRA 3CF5Q 2DGTA 2DNYA 2MKIA 1KQSR 2DH8A 3FEXB 2XNRA 5DM6Q 2KXFA 3CCES 2FC8A 1NU4A 2CQ3A 1S79A 2MGZB 3R1HA 1X5TA 3NS6A 2CQ0A 2CQ1A 3MXHP 3H2VE 1WEZA 1VBYA 3V4MA 1NJIT 1A9NB 2DNLA 1VC6A 2CPZA 2KYXA 1A7GE 5GAGU 1KD1T 2MHNA 2OSRA 2DB1A 2L9WA 1WG4A 2X1AA 1U2FA 1YI2S 2PE8A 5LXRA 2KN4A 2KVIA 2M0GB 2MKSA 2RNEA 2MSTA 1FJ7A 3VAMA 2MSSA 5JVGQ 2MZTA 4ERDA 3G71S 2AYEA 3CMAS 2CJKA 5DM7Q 3ZZYA 2RU3A 2ZJPQ 1X4EA 4CQ1A 2JVOA 1VBZA 3NNCA 1VQ7S 3VAHA 2CQPA 5LJ5Y 2MY7A 3K0JA 2DNHA 2FPHX 2ERRA 2V94A 1ZZFA 4PKDB 4V19X 1SXLA 2KI2A 3UCGA 1O0PA 1DBDA 4M5DB 2G1DA 1YTYA 1FNXH 1CVJA 2E44A 3HHNB 3TO8A 2DNPA 2RRBA 2KXNB 1X4CA 2PEHA 3VALA 4QPTA 2M2BA 5IQQA 3G6ES 2DHGA 2DGUA 3S8SA 1UFWA 1WHYA 1Q81T 3US5A 2MQQA 2KH9A 2RQCA 2CPEA 1PO6A 1FHTA 1YJ9S 1WG1A 1YJWS 4FXWA 4ED5A 2DITA 2DNOA 2F9DA 4QQBA 3S6EA 3THPA 4U67Q 1VQMS 1SJQA 3D2WA 4IOAQ 3CCLS 1D8ZA 2DNNA 1R8HA 2EVZA 2OTJS 1YJNS 3BEGB 1VC5A 3DXBA 5LSOA 1URNA 2EK6A 2YTCA 2AYGA 5IM0B 2MQPA 3DLLQ 5HL7Q 2JVRA 2GO9A 2FY1A 3NNHA 4Y00A 3NS5A 2MKKA 2MGZA 4IUFA 2M8HA 2LXIA 3P3DA 1XN9A 1VC0A 3U1MA 2DNZA 2G4BA 1YITS 4OZ1A 1VBXA 2DHSA 1WF0A 2CQIA 1ZZNA 2VOOA 1UAWA 2XS2A 5H1SV 3CXCR 1U6BA 3S7RA 3MUVP 2M8DB 2CQHA 2KFYA 1X4HA 2N82B 3VAIA 3MUMP 2KU7A 1N52B 1BY9A 3MI7X 5LSLA 2SXLA 2J8AA 3CCUS 1K9MT 2MQNA 2KRRA 1S72S 3SXLA 5FJ4A 2HVZA 5GAEU 3B4MA 2GHPA 3LQVA 4YUDA 2KRBA 3CPWR 1U1OA 1QVFR 2DGVA 2FHOB 2AYBA 4QU6A 1QVGR 2EK1A 1M5PC 3MOJB 1KC8T 1N8RT 3H2UB 1KOOA 4J5OA 2DNKA 3Q2SC 4WFBQ 3SDEA 2HZCA 2LXUA 3I56S 2N3OA 2D9PA 3VAGA 3BO3A 3PIPQ 1U1MA 2CQGA 3VAJA 3VF0B 3RW6A 2DISA 1PGZA 2DGSA 3N9UC 1JJ4A 2KM8B 2OJ3A 3J7YU 2XB2D 2VONA 1B7FA 1RKJA 2ZJRQ 3P49B 5GVQA 1H2VZ 2NZ4A 1WEXA 1FXLA 1VQ9S 3CCSS 2HGMA 4WFNQ 5BJRA 1U1KA 2MPUA 2CQDA 4C0OC 3P5TL 5DETA 1K8AT 2MQOA 1WG5A 1X5PA 1X5SA 2E5GA 2U1AA 3CC4S 4LIRA 4CH1A 5DDRC 1M1KT 2DIUA 2CPJA 2MZ1A 2RS2A 2M88A 3IWNC 2UP1A 3OW2R 5GADU 2XS5A 4F26A 4Z2XA 1P1TA 1X4FA 2MYFA 2ADBA 2LCWA 2DNRA 3G96A 1D9AA 2D9OA 2RT3A 3R27A 2DH7A 4TU7A 5ITHA 2CPDA 2CPHA 1G2EA 2YWKA 4TLQA 3MDFA 1N88A 1Q7YT 2M9KA 3R1LA 4EGLA 1M5VC 3Q2TC 3NMRA 2JWNA 1FO1A 1H6KX 4UY8T 2M70A 1OIAA 2LQ5A 1U1RA 1AUDA 1M90T 2WBRA 3RW7A 1X5OA 2KT5A 2LA6A 2KG1A 2D3OR 1HA1A 2E5JA 1VQ8S 3BO2A 5CYJA 5IFMA 2XNQA 4Y0FA 1WWHA
chains in the Genus database with same CATH superfamily
2Z4PA 2BW2A 1FK9A 2F3JA 3MFHA 1RK8A 2YNIB 3CTRA 2C3OA 5DO2A 1VFJA 3DLKA 2P2CB 4X4QA 2DBBA 3N01A 3OVBA 3G8SA 1VQ5S 4OHZA 3LALA 4NPOA 3RBEA 2ACMA 2QA4G 2Q3PA 3VGVA 2IBKA 1RISA 5C42B 4KV8A 4LF5F 2CRLA 3A8KA 3N5FA 4C8KA 2HRUA 3PVXA 2YBVA 2VV5A 4F0HA 4YDXA 2N7CA 3KUEA 4DPYA 3I87A 3UI3A 4DFMA 3PNIA 2Y0SD 4HACB 3DDKA 2V67A 1Q79A 2OD4A 3PDNA 2FJWA 3V4IB 3LA0A 4PWDB 1TL7B 3W60A 1T03B 1RBLA 2J0QD 5KFBA 5KFTA 4QR1A 3CDWA 4QBUA 1NDPA 2GIRA 1TL3A 1CLFA 4K4XA 2QE5A 1MMDA 2EWHA 2G2ZA 3G9CA 1REVB 1FFSB 3UD4P 4K4ZA 1O51A 3GONA 4OI4A 1HR0F 2J0WA 3NXZA 4Q0BA 5A8RB 4QWEA 1Q8LA 3H42A 3NS7B 3TZXA 2MQLA 3A13A 1Q8IA 1J27A 4ZLNA 3Q83A 2VBXA 4ED2A 3J7YI 2VKZG 4C8OA 3TVKA 2NYIA 3KLEA 2YKAA 4P72A 2LU2A 2RUGA 4ALZA 1PYSB 3BO4A 1C4AA 2XSFA 2R7OA 3OL8A 2XZDB 4X4RA 1CEZA 1HNIB 3IBFB 4JI0J 1WSRA 3CO0P 3ONQA 1IM6A 2I1RA 3CC7S 5HMYA 3W9JA 4ANEA 1ULRA 3NAIA 1T3OA 2HVDA 1WC3A 3D1OA 1VRTA 1B64A 1IR1A 2XHWA 2XGQA 3VAMA 5KG5A 3TJ9A 2F4VJ 4U6PA 4AL6A 1JKHB 3SSRA 2CG8A 3RU0A 1LOUA 2FHKA 1TV6A 3V6JA 5KAKA 1HWJA 3FEZA 3AY0A 1SCJB 5IZHA 3QJLA 1VISA 1B0VA 1OMSA 5L46A 4KAIA 1EARA 2IJNA 1B0TA 1K0VA 3M9OB 4USUA 1FCAA 3PHTA 2UUAF 1XR7A 2H5JB 2XMUA 1U24A 3HHLD 5KG4A 3PX0A 2FDNA 2VFVA 2IM0A 3P45B 4QWCA 1NK0A 3DRSB 2AZ3A 1DTQB 4NXNJ 1U6ZA 2HQGA 1DQAA 2CAJA 3MUVP 1NK9A 4K4YA 3R7SB 1BY9A 1M5HA 3TZYA 4NX9A 2HZAA 2R2UA 1HNVB 4MK9A 3GJSB 3WZ0A 2EK1A 1M5PC 3H2UB 2DNKA 5HVHA 1I1GA 4AFFA 4DS4A 1EX8A 2D9PA 5AT1B 2W4CA 5M2PA 2VBYA 2ZNYA 4RNOA 2UVVA 1TMJA 3UN5A 3BSCA 5BJRA 4TYAA 4MIWA 1X5PA 3KKFA 2YKPA 2ZKUA 5K20B 4CCHA 3C6UB 3DLEA 5DDRC 2DIUA 4YDDB 2C42A 4CTAB 2GGPB 5A2QU 2GHWA 4A4JA 2D3ZA 4NRTA 3Q2TC 4OZ3A 2I6WA 4QR0A 2QJ3A 3DI6A 4NLOA 3GE9A 4DSEA 5D4NA 1AUDA 3OTEA 4L74A 2KT5A 1GX5A 1C0TA 2AWZA 2F7VA 4MKYA 2XNQA 2L3MA 1KEKA 5ETQA 2C2EA 4J9KA 5ADZA 3UD5A 3DOLA 3KDNA 1U1NA 4K4TA 2CPYA 5BXIA 1ZTTA 2LU1A 1HI0P 4QYZK 4ZJLA 4P2XA 3DXSX 1N32J 1S57A 1R0BG 3OFEA 4EYHB 4HL9A 5F9NA 2DHAA 4NWBA 1YWXA 4C97A 3A3PB 3FGVA 3AD7C 2HNZB 3K8VA 2QFJA 1JLBB 4ECQA 5KOWA 1FJEB 2B4OA 1U1LA 2XMKA 2DR5A 2DHHA 2W2NP 1RWKB 1PAEX 3DM2B 4IDKB 4NZ0A 3N5BA 1S12A 3K5PA 3V6DA 3DRRB 3TP2A 4DQQA 2A0FB 5D0RA 3M6XA 4F0MA 1GMWA 3CMES 2UU9J 3IA0A 2X1BA 3UDEA 4M5HA 1GXTA 4TU9A 1T8EA 3GILA 5GMDA 2DRAA 5B7WA 2J76E 3KK1B 1P1LA 3SMZA 1XTZA 1D3WA 5A0YB 3HJFA 3TUJC 1RJJA 1U0HB 3U1LA 3EXYA 3SCKE 4KYZA 5AE1A 1R0AB 1RTIB 3T5JA 2NLWA 4YHHF 2LMIA 4CO5A 3HT0A 3AT1B 3CCRS 1LW0A 1XWLA 2DJWA 1X4AA 4KFBA 1F3FA 1QLNA 3K89A 3VHQA 1RT7A 4Q44A 2XTJP 2Q79A 4EMDA 2MB0B 1PCAA 5L1IA 3KK2A 2C2NA 3GYXB 1F5BA 2YNFA 2KT2A 2KFNA 3QZ7A 3TRGA 1IBKF 2FJAB 1SUQA 3F0NA 3I0SA 1N5SA 2HHHJ 1S1XA 3TW0A 2BJ9A 2OUGA 5LMUJ 1WEZA 1A9NB 1ZM4A 2HW3A 5GAGU 3GV8B 2W01A 3K59A 3H20A 2MSSA 2ZDPA 4X4NA 3ZZYA 1GTEA 5KFZA 4TY8A 3J80Y 1NLKL 1VBZA 3AFGA 3K0JA 4ID5B 3QIDA 4NLUA 2OMOA 1SH0A 2OEJA 4DV0F 2EXUA 2V8GA 1ZM2A 4F67A 3G6VA 2Q6CA 1AFIA 2JLEA 2K3IA 1MWYA 2DHGA 4NYZA 2QV6A 4U8YA 3US5A 4ANCA 1T0TV 2ATLA 1TZ0A 3N28A 2DNOA 4G1IA 4LUBA 4CRJA 2YX4A 3UFCX 4DCOB 3D67A 3W66A 5B0EA 3BGFA 3C6TA 4WK1A 2BYCA 1QY7A 4ECRA 2YTCA 4NLWA 3DLLQ 3WHIA 5HJYA 1RAOA 2PDAA 1BWVA 1KLMA 2FVRA 1KONA 4DWIA 2XZTB 2VOOA 4B3MJ 4B02A 3LOUA 1F60B 3ETOA 1L3TA 4B9VA 3GG1A 1HYSA 3QWUA 3J7A1 3EPGA 5I3PA 4ILMA 3MI7X 3C14B 4L3NA 1S72S 4IG0B 1EZZB 1HWLA 4OL8A 2I5JA 3ZC4A 2VH7A 1RE1B 5F8IA 3BREA 3SQGB 3Q2SC 3SDEA 4WKYA 2XG8A 3KHLA 1EP4A 3H0PA 4UW2A 3JQJA 1VDHA 2HBYB 3BDEA 2N3OA 3RW6A 2XO7A 2WHOA 1PGZA 2B56A 4LBPA 4J9PA 4NLYA 1HR0J 4ZK7M 3NBPB 3LGMA 4OV1A 1TU0B 2CQDA 4WTYA 1OYDA 2RUSA 3TVZA 3IGVA 3SQOP 3LWMA 1UVNA 1RCXB 4P52A 1SQFA 4QW8A 3G96A 2BJ1A 4DX5A 4I6AA 4CT9A 1G1XA 2CPDA 1QAIA 1RBAA 2VG6B 3LP1B 1RHQB 1VYAA 5J2NB 2XBPA 2WOMA 5E3PA 1IBLF 3NY0A 3T1YJ 4EZ9A 2BJ3A 2NPFA 4B3RF 3J81j 2D3O1 2Y8WA 4Y0FA 3MHYA 1N33J 2DKOB 1YRXA 1Q82T 2F9JA 3M8YA 4O3NA 4TKTA 5D3GA 1HQUB 1U48A 1Q95G 3OV7A 3BPDA 3POTB 3IXQA 4RZRA 4ICLB 4B9LA 1RUSA 3R5AA 4I64A 1VQKS 3PW4A 2NCKL 4J7CA 1PJ6A 4ZVSB 3GV7B 3LANA 2Z8QA 2ILYA 1G7CB 2JHEA 3PR5B 1R6YA 4DU8A 1AW0A 2AD9A 2ZZTA 3O3LA 4RW4B 2X3DA 2KM8C 2IIHA 3MPDA 3C16B 3MPVA 1VIOA 1QSYA 1QTMA 1HIYA 4LF6F 4N77A 5T7LB 1DTTB 3RYLA 1QAXA 1LWEB 1HPZB 3GIMA 2HGLA 3T5LA 1DLOB 1Q7LB 3D54A 1QE1A 3NNAA 3GCWP 2GIFA 4I67A 4K5RA 3OJSA 8AT1B 2AJ1A 4Y2KA 2AX0A 4M8LA 1KP6A 4ED4A 1VR6A 3E01A 3KG4A 4RWXA 1N56A 4WFAQ 2FLLA 3THTA 1BLUA 4KHRA 1JLCA 3KFWX 1H7WA 1R8PA 4DSIA 3RR7A 5KTQA 5GAEI 1OO0B 3Q22A 4R25A 3JQKA 5CYQB 3SCLE 3QRPA 5CHCB 2F4FA 3NGDA 2OGUA 2IM3A 4I2PB 1RBOB 2Z57B 1H0HB 2A2CA 4AL7A 1C1CB 5DGAA 3CDAA 3IBWA 2Y9HA 1RAHB 5I3UB 1VLOA 1SV5A 1JLQA 2E29A 3L3CA 2ROPA 2ZHOA 2HS3A 4GVLA 3M8PB 3OHAA 4MYUA 3CF5Q 2DNYA 1KQSR 4OX9J 2OPRB 4AXJA 3OUYA 1SPBP 5IV3A 1N48A 2QLXA 4H4MA 4DL0C 4OI0A 1VC6A 2KYXA 2RAQA 1KD1T 2COLA 2MHNA 4GVBB 5B0BA 1NSAA 2DB1A 2FVCA 2ZHAA 3A3NB 1LWCB 4LR8A 5FLXY 1YI2S 3MCNA 1NAQA 1KKHA 3M1VA 1KQKA 1VQ7S 4LBHA 3DU6A 2IRUA 4ZPBA 4PKDB 4ZLJA 1RHRB 5J2MB 4WP8A 5KT3A 1FDDA 3MMJA 1KS2A 1HHQA 1NB7A 5EUHA 1VJQA 2O5DA 4USWA 2KB2A 3TR5A 2XY7A 1W7WA 1RSCA 1FDBA 2RQMA 1IKXB 1EETB 2DNNA 1U7LA 4ELTA 3U1NA 1N0UA 4DV1J 2UV8G 2FZCB 2QFIA 4KC5A 2QLFB 1NEEA 2M8HA 4P10A 2LXIA 1XN9A 5KFNA 1D9DA 1VBXA 1RT4B 5L39A 2XS2A 4NL5A 3CXCR 1YG0A 4C2MA 2ZWOA 4LRFA 2E9ZA 5DLFA 3KYLA 2H4YB 5I42A 1IR0A 3UN2A 3D1HA 1U8SA 3MOJB 3OXLA 1FRJA 2YPZA 4RW8B 2E5LJ 2RD5C 2ZBPA 1NJZA 3AD9C 3QPIA 3JSMB 3DHWC 3N9UC 3J7YU 4Q5VA 1RKJA 4PAAA 2O01C 4DQRA 4ED0A 3VVUA 1NPKA 1Y7PA 3CCSS 4XDDA 1K8AT 2E66A 4EEYA 3I0RA 3IRXA 5LT5A 1C0UA 1SI9A 3IC1A 2K2PA 3BYPA 3MMAA 2PMWA 3OR2A 4JI8F 2HVEA 2B9EA 4K4UA 1MMLA 1M5VC 5LSRA 2W2OP 3M2UB 3NMRA 2LQJA 5LMNF 1VQYA 1Q53A 2FQQB 1YJRA 3IM9A 4X84A 4EBCA 5JJBA 1WC4A 1HA1A 4TQSA 4ECVA 1RI7A 2ZD1A 1X8DA 3U7JA 4F02A 2RS8A 1FXDA 1S9GB 2QGFB 1S1UB 2QX0A 3C46A 4IO9Q 4BBYA 2DGWA 3CJQA 4YB6A 1VQLS 4EO6A 2GMHA 1P27B 7FD1A 3M8SA 2VD3A 1OJ4A 4DX8H 3CGIA 2CQ2A 4O44B 3TA2A 4KE5A 4JI6J 2GIQA 4NRUA 4DV0J 3DMJA 1L3KA 1IWAA 3KHHA 3GFYA 2R8KA 4DV4F 5AJ3J 4LSNA 3BV8A 3W2VA 3KLFB 3C3LA 3Q8RB 2Q43A 4QW9A 3PM9A 4TLRA 1S9EB 1X0FA 2U2FA 4DR7J 1IXKA 2Q66A 4RO0A 2E1RA 3OPKA 5C7PA 3H5UA 3A3OB 3GV5B 2UXCF 3ICLA 3EMTA 2N7YA 1D1UA 5D77A 4A8SA 4WZMA 2IYIA 4IH6A 1RTJB 1HWUA 3GMGA 1CSJA 1KSPA 1OPIA 1HD0A 2AGQA 5DG7A 4XK8C 5ETVA 4N41A 2QLJB 3EE3A 1LXJA 4RBVA 2ZBRA 1TQLA 2Z58B 1VQPS 4IYQA 3FFIB 4HH0A 1ZM9A 2R4FA 1IKWA 1ZAXA 2BE9B 4KGKA 2H5EA 2WVCA 3M8RA 3ZZRA 4MIAA 5FDLB 4GC7A 1SJFA 1YKWA 5DDOC 3V5RA 1NJXA 1AUSL 4UT4A 5KG1A 1UWBB 3QO9B 2VBWA 2HLUA 1FNMA 2FC9A 2FZGB 5KFJA 3AD8C 3KOAA 1TK5A 4HVZA 3DCAA 3AJ1A 4G1QA 2E5IA 2VPWB 1RAFB 2WB4A 2N3LA 4BDPA 1HNWJ 2CUYA 2NXCA 5RUBA 2QN6B 4OX6A 5ETMA 4IKAA 2IRYA 2DGOA 1U2RA 1NSPA 3QLHB 1WF1A 4O23A 1HNXJ 4MK8A 5L8RC 1WORA 2HQ3A 2P5VA 3R1HA 1RACB 1VBYA 3V4MA 4MFBA 4ETXA 3H25A 3FUYA 4B3RJ 3M30A 3MM6A 4N76A 4DF8A 4JI7F 1UJ5A 2PE8A 5LXRA 4LREA 4N5SA 4DUYF 1IBMF 1YJUA 4ERDA 1QUPA 2RB7A 3UW1A 3RAXA 4H4OA 4X62J 2YX7A 4IFVB 2LP4A 2Q1LA 2XI2A 4JV2A 4RLEA 2YNGA 4Y3CA 1Y3KA 2DNHA 1ZZFA 3TARA 2JEGA 2V2KA 2GA7A 2XWXA 1RYSA 4GKKJ 4UOCA 2YKMA 3T3FA 1Y5IB 4LRAA 3B6BA 1FDNA 2HHQA 4XTTA 3M8ZA 3QRRA 1YZ6A 2AQ4A 3UDVA 4J9UE 2BM1A 4CI0B 1UAWA 4DQIA 4RKUC 4ZN1A 3ENQA 5D0HA 2J7KA 4OJ1A 2HQCA 4F2RA 5LSLA 4OYAA 4OYWA 4KGZB 1V3RA 1T95A 2GHPA 5CCLA 1U4BA 4ZPDA 3ILLA 5J2PB 1QVGR 1HFEL 4DU7A 5KFRA 4PABA 5K8OA 3QGHA 3T5HA 3UR3C 2LXUA 2JEJA 4GMKA 1NH8A 1MLAA 3ZZOA 2CZ9A 3IR5B 4PXEA 3MEEA 2KM8B 4GKJJ 1CPZA 1NXIA 3QYYA 1V9OA 2GJIA 2V4QA 2VPZB 5CH7B 3IG1B 2XCAA 5EWEA 4Y2AA 2IA6A 1WG5A 1F9EB 3CNQP 2ZZMA 3RB3A 4CH1A 4DR5F 3PYFA 4X66J 3KLHB 4OI1A 3R5CA 2B5JB 4YFUA 1CJVA 2RS2A 1KRPA 1T9TA 3D6FB 4C3KA 4UZCA 4I6WA 2ADBA 4KSEB 1VK8A 2YKNA 1OQ3A 1YK9A 5KFGA 4QWBA 4I2QB 2GMJA 1U1RA 1SH3A 5J2QA 4K2JA 3H98A 2KG1A 2ZITA 3GWCA 3VAFA 5HVGA 3SV3A 5EX3A 4QJVA 1CS4B 1HBUA 1JLAB 3VQTA 5A8KB 2UUCF 5HO4A 4FYDA 1FRIA 3GCXP 3BZQA 3CWJA 2KKHA 4KKOA 1CBKA 3CULA 1GMWD 1RAGB 1RAEB 2E9RX 4MYTA 5LJ3Y 3CSKA 2JLFA 4MMOA 1NO8A 3E8OA 4J9VA 1KOHA 1S9FA 1BQMB 4ANDA 1KNZA 1V5IB 4NXMF 2GQCA 1XR5A 1AZSB 2LLZA 2VG5B 4NA1A 2RVJA 2RRAA 3BGRA 3IR6B 3W8PA 1PBUA 3Q8VA 2OI2A 2A18A 2MZRA 2C3UA 4JOUA 2AV5A 4ZP8A 4NLTA 3S01A 1WDTA 2CFXA 2KTQA 1X60A 3D5MA 2E7WA 4FS1A 1RGVA 1M5KC 3I6PA 2JRSA 2LYVA 2M7SA 2VHGA 2KXHA 4OYIA 4DPUA 1UA0A 2CKWA 3OTBA 2MJUA 1JX4A 4P7VA 5KFOA 4YOEA 4RUAA 2HPUA 2E5HA 1Q16B 1VRUA 2IA0A 2L08A 3CCVS 4ZP6A 4BS2A 1R8AA 3GIKA 3OR1A 3PRVA 5B08A 2HNDB 2XMWA 4I56A 2WSCC 1NDLA 1SJ4P 3W64A 1NMEB 3M8WA 2QRRA 3H5SA 4LF7F 1FJCA 2OSQA 1HD1A 1HKAA 3L09A 2DH9A 2QTWA 2PA3A 2H3EB 2Y1RI 2R9LA 4PQUB 4BC9A 1FKOA 2IM2A 3P6YC 4GC6A 4I4BA 1RWWB 3J81Y 4FNIA 2HHPA 3W62A 2YH0A 2ZHBA 3MM8B 3ETMA 5KT5A 3C15B 2BX6A 3HSDA 4HH1A 2ILZA 2OEMA 2VG7A 2MKIA 4BWJA 1F6TA 3P96A 1T02A 3GJQB 5LOQA 1CJUA 4AL5A 4DF4A 4R5PA 2HNYB 5LMNJ 1E6YA 2DNLA 4K50A 3PY8A 1DAXA 3P4UB 2R2TA 3EGWB 1BQNA 3G86A 2M0GB 3N6MA 2GW8A 4V19J 4J9QA 2ZUAA 4PYDA 4RW6A 4LFBJ 1KTVA 4DV2F 3ITHB 1RWMB 3GLJA 5K8MA 2IC3A 4WE1A 1DBDA 4F8RA 3JQMA 3EZOA 4DPOA 2PEHA 4FVMA 1B70B 2ZEJA 2KH9A 1WG1A 4FXWA 2PA8D 4JV5J 5IS2A 3AJDA 3S6EA 2K7KA 1SL2A 4FN5A 5BYSA 2X7IA 2B4PA 4ZPTR 3QJPA 4DV6J 1HW8A 4DV4J 4DR3F 5LSOA 1M1HA 1CULB 6FD1A 4R8UB 4DPXA 4YQWA 3CJ0A 1WOSA 3OXFA 2DNZA 1S7IA 5DQIA 2GFFA 3GJRB 1UVKA 1Y10A 1T9VA 2B6AB 4HACA 1FVQA 1RHJB 2G0IA 5KT4A 3C19A 4X4SA 4LFAF 1TL7A 2ASJA 1YDLA 3S1TA 3OSNA 5GAEU 1T03A 3M8QA 2W2MP 2EFGA 5U47A 1KC8T 2B7BB 4ILLA 5ETSA 4JP8A 4WYWA 2IJFA 1FK9B 2VICA 3TVYA 4AXIA 5HSPA 3BH6B 5T14A 3L9ZA 1N5YA 4I6YA 3R5GA 3R9LA 5M2RA 3DLKB 2DR6A 3CEDA 2XB2D 2Z2YB 5BYQA 2V68A 1Q0NA 4TXSA 3P49B 1X9SA 2ZOFA 4HKQA 1VQ9S 3MM7B 5G0RA 2MQOA 2DT9A 2K7JA 4FKXA 1M1KT 1QSLA 1JJCB 3IWNC 2LCWA 4KV8B 1KN6A 3T6JA 4IRDA 3OFGA 3H8YA 5ITHA 3O8WA 2HVHA 3WIVA 1RU1A 3W2WA 3B82A 2QA1A 4USIA 2B9YA 2B4UA 3QJJA 2LA6A 4DX6A 4DR4J 2RDIA 4CO4A 1S77D 3ISZA 3AOAA 2O1PA 3G4SS 4QYZJ 2P9GA 2I8EA 2AU0A 2QMUB 4QCLA 1WHXA 4IQXA 2GNKA 4L6V3 1FESA 4KY3A 3ULHA 1HI8A 1XNQJ 1M5SA 4CZCA 1WC1A 2F8MA 1TL3B 4ZKAA 3WX4A 2ZH3A 3PJ9A 4TVAB 4L73A 1X9MA 2P9EA 3M9NB 3J7ZT 4F4YA 2XULA 4B9SA 3JYTB 4DN9A 1UWAA 3IFEA 2YWHA 4QZVB 5HN0A 3TZZA 2G13A 2V2VA 4F04B 2BBEA 3IBCB 1JNZB 3RZAA 3KLEB 2JFKA 3M32A 3MUTP 2EFQA 3M2RA 3DYAB 1XMQF 2P9CA 2V50A 3BGUA 1U1QA 2ALZA 1I6JA 1UEUA 3PW5A 1RA6A 3CDUA 2IY5B 2ZM6J 3LO3A 3OL9A 1FRXA 4ZVGA 2ZJQQ 1YQHA 4X4OA 4CO1A 5B0GA 4C8YA 2LECA 1YJ7A 2EKNA 5B0DA 2CQCA 2QG9B 3ZZUA 1QDUB 1VRTB 4CH7A 1TUWA 2JC1A 3EX7B 2XGPA 4NMLA 2V2ZA 2IRXA 5HQLA 2HWHA 1R89A 3KUHA 2HHXA 1L3VA 3FRYA 3G82A 4AT1B 4RR5A 3LP0A 3FCWA 4NLVA 2HK3A 4YY3F 1TV6B 1JQGA 2YNHA 3JSRA 2EPIA 3ILOA 3H5XA 4ZHRB 2PT0A 5CAAA 2MZSA 4B9MA 4ZP7A 3KLIA 2J5AA 4U7UD 1VS3A 2EI5A 3MF5A 1RQ0A 5DDPC 2E1MC 5EWGA 3W3SA 3KJQB 1RWOB 3SI8A 1NU4A 1JXEA 1RADB 4IH7A 3FCVA 2CPZA 2OSRA 4NCBA 4OQJA 2X1AA 2HAFA 4Q43A 4RL1A 3G71S 1P6TA 4WBFA 5L9XA 2FZKB 4HI2A 1U02A 4JI2J 2ZKTA 3NGRA 2CQPA 2DR7A 4WFYA 3TOQA 3TO8A 1Z4UA 3LAMA 3WDOA 5CABA 3MR5A 1FA0A 1X4CA 4FBTA 1FHTA 2C2RA 2XZWA 2BE2A 1YJWS 4FVCA 2HRYA 2FTRA 2CJQA 1U45A 1O5JA 4M5LA 2NXUA 3D2WA 3X3UA 2HNZA 5J1EA 3R5BA 2H9ZA 2RH3A 4CYUA 3SFUA 4OYBA 3DLEB 3DU5A 1SB6A 4C8NA 3D9BA 1Y4ZB 2G4BA 3DRRA 4OZ1A 1NKEA 2DHSA 1VJWA 3FSIA 4ED7A 2C28A 2CWXA 4FYYB 3N6LA 3NOCA 5KFAA 4IRKA 2GC8A 3BPSP 4KGXB 2J8AA 3DI6B 1NZAA 2CNOB 3B4MA 3LQVA 3BR8A 1T9XA 3KG0A 4M95A 1C0TB 4J5OA 4HR2A 2PGCA 5CCMA 1J5OB 1R0AA 2J6UA 2R8IA 3FKBA 4DPWA 1JXVA 2HQFA 3HVTB 1SJ1A 4HDHA 3RB4A 2PI4A 1BQXA 2A1BA 5DZ6A 3CCZA 1WEXA 6AT1B 4TNOA 4OX7A 5AXKA 4C0OC 5DETA 3CC4S 3MGJA 3T9NA 4F26A 4NI2B 3GZ7A 3K2YA 3MEGA 1D9AA 1TKTA 3HPOA 4ED1A 1PYTA 4TLQA 4Y2CA 3MECB 4MK7A 5KFUA 9ATCB 3K58A 1MU2A 3V6DB 2ZOMA 4JB8B 5DZ7A 4OX8A 2IVMA 3WX8A 1VQ8S 5IFMA 3VGTA 1PIEA 4IFYA 3L7PA 1DZ5A 4C7QA 5BYRA 2X1FA 3QFWA 4A8YA 1MWZA 2AHOB 1YJTA 4URGA 3N4WA 2F65A 3TAMA 4XPEA 2HFUA 4ZVUB 2XLIA 2J7UA 4ZVFA 4DV3J 3DOMA 3P8BB 4DV2J 3DNCA 2HFZA 1NB2A 2W9CA 2FJDB 2AZ1A 1I5OB 4C11A 5JVHQ 1V3SA 3U27A 4DN0A 1LW0B 2C2MB 1S6PA 2RQ4A 4DR2J 3V6HA 4KFBB 4NMXA 5C25A 5IT9U 3OTOJ 1RT7B 4FXDA 3QT6A 2MMYA 4AUKA 1VMBA 2QL5B 2M4MA 3F73A 2BKNA 1R3NA 1J5EJ 3KK2B 4DR3J 1PSDA 4ES2A 2HEKA 3UNYA 2FUG9 2YNFB 1I94J 1WD6A 4OZJA 3JTOA 3NEKA 1WKJA 3N79A 2LEAA 4N8NA 2GMLA 1SUQB 1WHVA 2HSEB 4QIFA 3AXKA 1S1XB 2MXYA 2HHVA 2C3MA 3KJVA 1NK7A 2Z30B 2AEMA 3QQCD 4LFAJ 3AB4B 3C14A 3KLGB 2V8DA 4X65F 2JSXA 4RBUA 5ETOA 4DS5A 3UE2A 4IG0A 2EBEA 4AD6A 4C3MA 3D28A 2FLOA 2BKPA 2QIFA 4M5GA 3IWLA 2GHVC 1E6VA 3SQGA 2OMLA 4ZJOA 1WOOA 3CJ5A 4HYKA 3CUNA 4EWTA 3TYTA 2VQEF 2NUUG 4EYIB 4IH5A 3HSJA 3GYNA 1NK4A 2OIHA 3TEHB 1RXOB 4ZDNA 4A8MP 4WTOB 5E0OA 4P71A 1JLEA 2EBGA 3RBDA 4QPXA 4LRDA 3NCQA 2I0XA 1R7IA 4YB7A 4C3LA 3TJ8A 2C2KB 3HVWA 4AYBD 3C6TB 3VGSA 3DLBA 1RHMB 2OD6A 2AW0A 3PJWA 4PR6A 4LRBA 2DGTA 1FNOA 3LP1A 2K1RB 1R27B 4RW7A 3KHGA 1LW2A 5IWAF 1KLMB 3R7NB 3W1YC 3BSOA 2L9WA 1HYSB 2IAJA 2KN4A 1EHWA 1HW9A 1RKIA 3VAHA 4KGMA 2DYAA 2W8LA 3H90A 3DOKB 4JI5J 3R8YA 3POTA 4K8RA 5D4LA 3QSIA 3AQOA 4CWBA 2W25A 3HHNB 5IT4A 3D66A 2HWIA 1GNKA 1D8YA 1HBNB 4OZLA 3Q24A 3FSXA 1HNZF 4N7TA 4RW4A 3H59A 2VPYB 5JMNA 5KT7A 5A6PA 1IKYA 2VQFF 2AF6A 3MR2A 4WXOA 1Y00A 3HMJG 3G87A 4XDCA 4URQU 3D6HB 1NKCA 1SKUB 2ZBCA 4O3SA 2KJWA 1NHUA 1S59A 5GMEA 1LFWA 4ZLPA 3JS9A 2HIYA 1SC6A 2WOMB 4PXCA 2ZH9A 1TKDA 5EDWA 2DGVA 4F50A 1AYEA 4KH0B 5DRKA 2DCUB 3MCMA 4BLGA 3CO9A 1GK8A 5L1KA 4LR9A 3HM9A 2VONA 1JIHA 4M5MA 2P6SA 3CVKA 2WW4A 5GVQA 3DLJA 2QT7A 4JI3F 4L3KA 1Y9OA 3P5TL 4N8OA 2XSJB 1U09A 4UOHA 2KHDA 1XJWB 1NZ8A 1KR4A 2W8KA 3LW5C 4YY3J 3LP2A 5CZVA 2XYHB 1X4FA 1HHSA 2J9DA 2GS8A 3VZHA 3UVJA 4KO0A 4JUZA 2CPHA 1G4CA 5I3UA 2DTJA 3MDFA 3R1LA 1S1WA 2F8EX 5AXNA 5H9FK 5E2QA 1ELOA 1QE1B 4P74A 4JI4F 3KHRA 1VOMA 2FVPA 2UXDJ 4LJMA 4J9SA 4JI1J 2CJXB 4O4GA 4ZOSA 1LWCA 1RP5A 4HT5A 5A76A 1NCLA 5A6WA 3A4TA 4NYOA 3BQ1A 5SUHA 1JLCB 2ROEA 2FVSA 1TFYA 3LTOA 2PI5A 3A8JA 2XMTA 3SCIE 5DG8A 2XLKA 1F1BB 1RU2A 1BD6A 1RHKB 3BYRA 2YKQA 2QYGA 4ZVEA 1GTHA 2DCLA 1K1QA 1M5OC 3HK2A 3CCQS 3D0IE 1W2BR 1WKKA 3CDBA 1NNDA 2EW9A 1CJKA 2AJQA 2CJBA 3V6KA 2OH2A 2NSCA 2LEBA 4PPDA 3FNNA 3M4XA 4AQYF 4EZ6A 1RDRA 2HFVA 1SV5B 1JLQB 3DRPA 4OYXA 2YWFA 4U96A 4A8OA 3HULA 2D69A 3IP0A 3OUYB 3BN7A 3EZ5A 4H4MB 5LL6d 1UPMB 1DRZA 2PN6A 1IM4A 4I7FB 1JB0C 1VCTA 8ATCB 2QSWA 5KFCA 4P6QA 1SC4B 3M1VB 3OXGA 5HK4A 3VAKA 3KJFB 1UEVA 3BS9A 3MAAB 3ET6B 1NPPA 1LNQA 4W92B 3PO4A 1X4DA 5A2QY 2ZH4A 2GQ2A 2VC0A 4KHPF 4C6AA 5K8PA 2MLZA 4NCGA 3T19A 3CB4A 1S1TA 1GT8A 4LF1A 2HBRB 3HSGA 3BBCA 3HSZA 3FZBA 3BKUA 4ZVQB 3ZZTA 4KJIA 4WIQA 2QL9B 4OJ3A 1KHWA 1W26A 1HMVA 3I9ZA 3TEGA 2AJ0A 3HHLC 3FBCA 2HMIA 4ETZA 1S48A 4DV5J 1SC3B 2KVIA 5JVGQ 3MFIA 4P2FA 4ZPVR 5I42B 1S1UA 2MY7A 1TK0A 1VK3A 2G1DA 1YTYA 1N4LA 5B0FA 1UPPA 5D6GA 3G6ES 2RQCA 4B3TF 1B3TA 5DG9A 2KZZA 4O3PA 3EDRB 4CT8A 4CNYA 2GQQA 1TAQA 4EUVA 2UXBF 2D3UA 2ZVIA 2EFPA 4NOHA 2BEFA 1YJNS 3ZTSA 2V9WA 2VL1A 2ROGA 4X64J 5E3AA 3O5TB 3W9IA 2NYHA 3I0RB 3IRXB 3KUGA 2CYYA 1QJHA 1YITS 3RRGA 3V81B 3MMAB 5LM7E 1ZZNA 3OR2B 5H1SV 5EWFA 2M8DB 2J6SA 1ZA2B 4DR6J 1RTJA 2VUGA 1N52B 4HI1A 1S49A 5HQMA 2QYCA 4FYVB 2Y1IA 3A8IA 3SXLA 4E98A 1Y5LB 3K7RA 2HHUA 4M5DA 4A8WA 1TFWA 3ENVA 3FFIA 2HFOA 3EVOA 4HHJA 1N0VC 5HAOA 2HZCA 2IYGA 3EWGA 1U1MA 5E5NA 2DISA 2Z56B 2WB1D 4RW9A 2IBOA 5FDLA 1XMOJ 2ZJRQ 3UPFA 3D0GE 1U2CA 3GYGA 1CJTA 1FXLA 2BACA 2VQEJ 4LF4J 2ZH1A 2GZOA 2XYGB 4ECXA 3BR9A 3I4HX 4O3RA 1UL3A 2ACYA 4P7TA 4BCAA 4OV6A 1IN0A 3ZTOA 4RNHA 2NUHA 3THVA 3PXGa 1H38A 2MYFA 4LSNB 3W2VB 1C2PA 4EFAC 4PG8A 3DDNA 4DR1J 1WC6A 4V1Ak 2ZZNA 2BM0A 3AH6A 4YR3A 2IJRA 2YPYA 1NDCA 5HMXA 2XMMA 4ZVHA 4QYRA 2PMZD 2WBMA 2WRMA 3A12A 1WWHA 1PG5B 1RWXB 5IWAJ 4QWDA 3VTIA 1UJ6A 2M5YA 4NA2A 1FDAA 1H74A 4A47A 1GMUA 3R97A 2NPIA 3G8TA 1RT2A 1F5AA 4IFVA 1IKWB 2VA3A 2DEIA 1IR2A 3UNGC 2HQIA 3A8EA 2I2YA 4Y65A 1N54B 3TX0A 2VOPA 1DJ0A 3UCZP 4DG1A 1PC4A 2GJ2A 3PO5A 3G6YA 4DL5A 1HBOA 3BM7A 1N6QA 1XK8A 2PO4A 3GU0A 4RUCA 1FXRA 4CLSA 3QSYB 4TQRA 3CJ4A 3ZTPA 3K17A 4ATNA 3J7AN 1T05B 1MWQA 4A8XA 1NK8A 2J0SD 3QIPA 2GVDB 1ZOTA 5E41A 3O6QA 2H48B 5ETPA 4JI0F 2CPIA 2LKZA 1TUVA 4USHA 4B3SF 3PKYA 3TUZC 1XNRF 5LXYA 1KLNA 3RR8A 4MFBB 2HYIB 1JJ2R 3D0HE 4PWWA 3M30B 3MM6B 1FWLA 2B7CB 3R6LB 3CJ3A 4RUHA 4LMZA 2HS4A 3BH7B 1BUXA 2F4VF 1NSQA 4H4OB 2BUNA 1RT5B 2LFVA 4O4RA 4OLPA 4LF5J 3PRDA 2YNGB 2QLBB 1T9YA 1GX6A 1N36F 2JLGA 3AA9A 3TQ1A 1JK9B 1IKVA 3VZIA 3KJNB 3WIUA 4ZP9A 2CPFA 3IG1A 3RB0A 3NCRA 2UVRA 1WKLA 4ZMMA 2B5JA 3SBMA 1HQ2A 4Y34A 2G0CA 2YKMB 1RT3A 3DGPA 3MURP 2YX1A 4CLTA 5GADI 2BJEA 1HLWA 3CD5A 1H73A 3NMAA 2DHXA 3RTVA 2MHEA 2W2PP 2DK2A 1SJRA 2MLYA 2LXFA 1JLGA 5ETLA 4NCAA 2CQ0A 4K59A 5KG3A 4NXNF 4Q7AA 2VJUA 4WZQA 3BQ2A 1DQ8A 4ZCKA 4BC7A 2YXLA 4MH8A 5KG6A 4F36A 2B51A 3CCWA 2CJKA 2AYEA 3CMAS 5DM7Q 1IJEB 1S0OA 3N6NA 4DEZA 3MEKA 2V0NA 2ZBIA 3GP9A 2OPQA 3JTPA 4NASA 4V19X 3U02A 1O0PA 1CS4A 1FNXH 5A8KA 3FDSA 1UVIA 4K2XA 1AFJA 4J9LA 3HHDA 1L5UA 3RG6A 4ZPCA 1PO6A 2A6OA 1SVDA 2FB0A 5HP1A 2H1YA 3GIJA 2B8QA 1C1BA 4OYPA 3PJXA 4U67Q 3MEEB 3ZFVA 1SJQA 4OHVA 4IOAQ 2HWTA 4EBDA 4ELVA 2EVZA 1RABB 4DDFA 1VC5A 2CWKA 1GH8A 3CW2C 4RBTA 1SKSA 2JVRA 4ZA1A 2ZOGA 3NS5A 4IUFA 3ZTRA 2P8IA 4OZ5A 4B17A 2CQIA 2OEKA 2VB6A 4K7QA 1U6BA 1X31C 4AQYJ 4DQPA 5F8MA 2YKNB 4PCQA 4DL6A 4RJVA 1D9FA 3DRYA 2V69A 4OYOA 5J2QB 5GAHI 2ZC3A 2BW7A 4OIXA 1HARA 1A6LA 2CG4A 1YVFA 3M6WA 5FIIA 3BO3A 2EFOA 3HLUA 2UUAJ 3RJMB 2ZH6A 1YBAA 1HBUB 3FRZA 4DJBA 2KVQE 3R5JB 1N32F 3ZZ0A 5E33A 5K14A 5DGBA 4KBIA 4CLWA 4KKOB 1NHKL 5KFFA 4DSJA 1YZ7A 3OQ2A 3ZZPA 3NRBA 2M88A 5HATA 2HIQA 4Z7YA 4B3OB 4LSLB 1Q7YT 3BGRB 2BANA 3NL0A 4UY8T 3PW2A 3C15A 5KT2A 1M90T 2RHQB 3QAUA 1YLXA 3BO2A 2UU9F 2AGOA 2QL7B 2V4JA 4KRWA 3NGUA 2QSFA 3EM1A 2DNQA 3CD7A 4CLLA 4D3HA 3I5AA 3X1LB 2E7VA 1IVZA 2WTFA 2A10A 3OL7A 2JNJA 2OTLS 5KFKA 4JV1A 3BKTA 1VRUB 4NZ7A 4NLRA 3LAKA 2MQMA 4IOBA 4DFPA 3Q8UA 1Q78A 4NLQA 1JLFA 4PZVA 4DXLA 2KFZA 3NWRA 2CDQA 2KT3A 4DZ6A 1WHWA 2RF2B 2UXBJ 3W8GA 1YRUA 1FKOB 2B9XA 3KWMA 4QIVA 4WIIA 5HBMA 3J7Z5 2DPJA 1RLCL 3BJYA 1X0PA 2AIRB 4J37A 3HHLB 3M9MB 4A48A 3H5YA 2XQCA 1ZBTA 2OFGX 5EN1A 5G4DA 1APSA 2VJVA 4K5SA 3OVSA 1JMTA 1HL6A 2B6AA 4DCPB 5KFYA 3D4JA 2PFFB 3GSIA 2PMHA 2I38A 2M52A 1CJUB 4R5PB 2FHJA 5LMUF 4NA3A 1E6YB 1KTQA 1PJ7A 3PEHA 1BC6A 2OP5A 3ZTQA 2IVYA 4P9SA 2RDJA 2MTLA 1BQNB 1OWXA 4H4KC 1UZDA 3R3TA 1T9UA 2DRDA 4WP9A 5HMWA 1UFLA 2O3DA 2VFRA 3MD3A 1RT6A 3KTQA 2BA9A 1FERA 3HHKA 1YGYA 4A8QA 4RW6B 2UZAA 3F41A 4FP9A 2NREA 4Y2MA 2G2YA 4TU8A 2IC3B 3CT9A 4WE1B 2JZ5A 1IQTA 2IFXA 1BGXT 4P75A 3FCHA 4IG3A 1JJHA 2MZJA 3QMQA 4DCJB 2L41A 4DV7F 8RUCA 2GCFA 3MM7A 5KFEA 3FJ2A 2JL9A 2V6AA 4FPRA 1F2HA 5L1JA 1H2UX 3QWPA 2E7XA 3PTWA 2R7SA 1I51B 1ZYQA 5DQGA 3PW0A 2R2SA 2L48A 3T1HF 1NHVA 2ADCA 2ZE2B 4EO8A 2MKHA 5KFXA 3VCDA 2VZ9A 3I55S 1TAUA 3CCES 2FC8A 3IO1A 4PG5A 3HD2A 5A8WA 2CQ1A 3MXHP 5FD1A 1PKUA 5ETTA 4U7UK 1XR6A 1ZPWX 2ZH5A 4YHHJ 4B3MF 1WG4A 1P9YA 2MSTA 1OY8A 1S1VA 5F8LA 4OHYA 2DXEA 3W65A 4A8FA 4USTA 4PG7A 2V5HG 3M8QB 5LJ5Y 3EYZA 4USKA 3DN9A 1YJVA 2JFDA 3LGHA 1RB0A 3EVWA 1S4FA 2R7XA 2RRBA 1RWVB 2RQKA 4DL4A 3C8YA 4FF3A 4ECZA 1NRKA 4OHWA 4ED5A 1Q4RA 2CVIA 1N5YB 3I31A 2DEJA 1IBKJ 3JYTA 4DLEA 3T6BA 5G0RB 3ILJA 3NCPA 1SL0A 2W7OA 3HVAA 4ECSA 5IM0B 3VWSA 2QLWA 1HQEB 4Y00A 2MGZA 2UUTA 1UJ4A 1WF0A 4MKVA 3DYAA 1SC1B 3MMCA 4CLFA 4HT7A 1D09B 1X4HA 1YX2A 3VAIA 1Z1ZA 3MUMP 3BBFA 2NR0A 1WACA 2BRKA 2SXLA 5DQHA 3DFEA 3W2WB 3CCUS 1T3NA 2XY6A 3R2CJ 3T1YF 1TL1A 1YBTA 1U1OA 4B3SJ 1GMVA 1XNRJ 3RB6A 4ER8A 5E3QA 4WFBQ 2D41A 3EXCX 4FDFA 2IMWP 5KFPA 1N33F 3GFXA 2X51A 4DUZF 2JEFA 1HBMB 1SIZA 2JH3A 4QIGA 1FE4A 2AJ4A 2RJZA 5L38A 3H40A 1NK5A 2DY9A 2R7QA 2WONB 1R8CA 4GRSA 1FJGF 1GXLA 3MM5A 1T11A 2GVZA 3GR1A 4FPIA 1MMNA 5C24A 1TP7A 3MMBA 1OPZA 1N36J 3HX9A 4FYXB 2FJVA 2N4DA 1SIWB 2MZ1A 3Q23A 4J9RA 3GPAA 3H4BA 3UO0A 1TKXA 1FX4A 1WC5A 1NJWA 4DI6A 4ZHRA 5D4PA 2XWYA 4CO0A 4EGLA 4LFCF 2ATCB 2PSZA 4OHXA 4HTJA 2DXDA 5KFVA 3M2RB 3M32B 3RW7A 2W9BB 4Q2LA 3D6MB 4F4AA 1S6QB 1G3OA 3FK4A 2Y0BB 4HEA9 1CQNA 1UW4A 3FBBA 2DO0A 1P8GA 1R8BA 1P9QC 4YS2A 4Q2MA 1PYOB 1IJFB 2J9DE 1MNEA 3ZZZA 5F3TA 1D0EA 2CQBA 1MG7A 1VQNS 3MPUB 2OPSB 4QU7A 2P6TA 2B0GA 3R5DA 3ENWA 4YR0A 4MJKA 2GAHC 3G82B 1S6OA 4UQGA 5DDQC 3LP0B 1R43A 2MDAA 3R2DJ 1RAAB 1V6HA 3QZ8A 2KG0A 2BOAA 2FGCA 1IBLJ 3IS9A 2YNHB 1RA7A 1MROA 3TJAA 3MD1A 2AKWB 4UUWA 4WJBA 2FHMA 1RT1B 3CIMA 3KLIB 2WAQD 3MEDA 2BVZA 5H9EK 1FE0A 4G1PA 1XIQA 4OX9F 1FFWB 3BN4A 3OHBA 1CG2A 4ZLLA 3EZUA 2R7WA 3M6VA 5D78A 1AROP 2MZQA 3TUIC 3VV2B 4R0JA 4IR9A 1RCOB 5IC4B 1ZAWA 5D8HB 2LA4A 1J5OA 1U0SA 4ED6A 2ZC4A 3CJKA 3M2VA 1U1PA 4LF6J 3HJVA 1DFDA 7AT1B 3HVTA 4J9NA 3D7SB 1H3DA 2BABA 2DD8S 1H72C 1QM9A 4KHMA 5ETNA 2BE2B 1FF2A 2GAGC 4YB5A 3VGUA 3AQPA 2DIVA 1RWNB 3OLBA 5EHHA 4WFZA 5J1EB 3MOZA 4NI2A 4R0EA 3HFKA 2BQ3A 2DVIA 3LWLA 4DV1F 1G6BA 4CYUB 2DH8A 3DRXA 3MECA 1MW7A 3NGTA 3BKFA 3H2VE 2HLTA 4CNZA 1FI4A 3FC9A 1A7GE 1O6XA 4AE5A 1UMJA 4ED8A 5I4MA 5L1LA 2RIJA 3KXDA 2LDIA 3WC0A 1X4EA 2V63A 1PILA 3DLGA 4RWWA 3RAMA 3JTNA 3AJ2A 3AOBA 2KDOA 3QBCA 2KI2A 3Q0AA 4F4KA 1RZMA 1FRMA 1LEOA 2KXNB 1LQ9A 4HDGA 2IPOB 2E5LF 1Q81T 4XPCA 2J0XA 2CJYB 3RAQA 2W9AA 1RTHA 3EVMA 5SZTA 1Y11A 1S6UA 3CCLS 1IQZA 2POKA 4MAKA 2BRLA 2EKYA 4WU2A 5F8NA 1KVIA 3FBEA 6FDRA 1URNA 1UVLA 2G2OA 5F0UA 2HG4A 4FNHA 5DLGA 3W61A 2AX1A 4X4PA 2D74B 4DL2A 3MEGB 5HMZA 1TKTB 4ZIWA 2NXNA 1LV5A 1UKUA 3GIRA 1WTFA 3PG9A 1S76D 2ASYA 2HRTA 4PUOA 2VKRA 1TKZA 4O3QA 1MU2B 4CP5A 1TVRA 3OL6A 2O67A 2KRBA 4MIBA 1QVFR 3L7UA 2FHOB 1VBKA 2XMVA 1WUUA 3E3XA 3TQEA 4FBUA 5BR8F 3K5OA 1PC5A 3KLGA 4K4WA 4IFYB 4NZ6A 4RU9A 1FKPB 4LBIA 2F40A 2FD2A 3E51A 5B0AA 2V2QA 4KQZA 3VF0B 2G1HA 4ECTA 1UVMA 1UZHA 2FIUA 3TAMB 3TI0A 4KR0B 3D6TB 1LWFA 3DOMB 4WFNQ 2AEJA 4C8ZA 4JI6F 2W9CB 4USVA 4C11B 2OO4A 2L9NA 5HROA 1S0VA 4DV7J 5GADU 4K0KF 2HFSA 1JWWA 2WSFC 1S6PB 3QFHA 2IMOA 3ISND 2ALYB 5AJ3F 5C25B 1ZS6A 2WVEA 1ACMB 3PYDA 1K0TA 2DRBA 4DR7F 5H9FJ 1U26A 1FO1A 3T1HJ 4K4SA 4U9RA 3OFHA 2LQ5A 3MZIA 4ZVOB 2HHTA 1X5OA 4F2SA 2KO1A 4FKYA 1LWXA 2K1RA 3JSBA 4DX7A 5HLFB 1F9HA 3MM9B 2EEYA 2CNNB 1A0OB 3JSYA 2VIHA 2ZUGA 2RKIA 5MAOA 3RUBL 4C0HA 1ZPVA 1T94A 3SSQA 3KJVB 3IAM9 3J80U 3PFOA 3DOKA 4F7VA 3ISNC 3UR0A 4UQTA 2M3DA 4LQ9A 1E6VB 3BB5A 1RTDA 1RHUB 3CE8A 2H51B 3SFGA 4KPCA 4JI8J 1X4GA 3P5BP 2AEFA 3GTYX 4MTPA 1HBNA 2K8GA 3KK3A 4DUTA 2AYMA 4CO2A 1N34F 5F3ZA 2K3KA 5CYMB 1JLEB 1HNWF 1L3UA 3EGZA 1TL5A 1FTRA 3NGSA 1B0PA 2OPPB 2C2DA 5HVFA 2XLJA 1M1GA 2YNIA 2WZ1A 5GAHU 4C0BA 4IOCQ 4ZVRB 1HNXF 1F3VA 1DHMA 4RW7B 3I5BA 1LW2B 2G0JA 1K73T 1NDKA 3BQ0A 4U95A 3RRHA 3HF5A 2IAJB 2ZNZA 3EGVA 2R42A 2B43A 3MPYA 4X62F 2F5GA 4DUZJ 3QATA 4ZCIA 5C42A 3LH2S 2LDYA 1AA1B 2XEXA 5CXTA 1FJGJ 1WF2A 1VHFA 3R7BB 3HO1A 3PKMA 2UXCJ 2GV1A 2YWEA 3KG1A 3TA1A 2QO3A 2XSJA 4GKKF 2CVEA 3V4IA 4PWDA 2BXJA 1IKYB 1Z2LA 2A3JA 2C3PA 4CIOA 4QR2A 1FRHA 2E9TA 3SZ2A 3T41A 5DM6Q 4LFCJ 2YKOA 1SQEA 3FQKA 2PIIA 2NS1B 3I5CA 4ZCMA 3FQLA 2OKQA 1REVA 2BV3A 2IDLA 3W5ZA 2K06A 1FJ7A 3N0VA 4RNNA 5KT6A 2PD1A 5A8RA 2FPHX 1CVJA 2DNPA 4PWUA 1ROFA 1FWKA 3NAHA 5M2UA 1UFWA 1XQIA 1AXQA 2CPEA 5IV4A 4ITSA 1LFPA 2DITA 3FZ2A 2F9DA 4Y2IA 3AB2B 4GKJF 2QA2A 1HNIA 2XYPB 2CXEA 2HBZB 3BEGB 3MR3A 3H4DA 4IO1A 5EGYA 1NSKL 5HL7Q 4X66F 2KL8A 4F4XA 2GO9A 3HZGA 4FYWB 3MTKA 1J2VA 4H54A 3LP2B 2ZH2A 3NGKA 4DHVA 4UZBA 1PJ5A 1TTHB 4ECUA 4JI7J 3UVJB 3NWGA 4KO0B 3BF4A 3PFEA 1Q5VA 4DUYJ 1IBMJ 1NPRA 3OVAA 2WW8A 2CDRB 2RE1A 4WK3A 1S1WB 1FVSA 4ELUA 2VF3A 2KRRA 1JKHA 4LQ3A 3TANA 1REGX 3CJRA 2Z0GA 4QU6A 2AYBA 4X4VA 2DXFA 1SL1A 1KOOA 3LGNA 3CIZA 2X3GA 4FF2A 3Q8SB 4Q0BB 2Z2LA 4I7FA 4O4GB 2DR9A 3PX4A 4DL7A 2OJ3A 3B8HA 3ENAA 1VIXA 2F63A 2NZ4A 5KG2A 3MAAA 4XIUA 3ET6A 1X5SA 3I9V9 1N5TA 4Y28C 4LSZB 3DRSA 4KH1B 3SYZA 2FY8A 4ILRA 2CPJA 1DTQA 3G8QA 3W9HA 1UEKA 3MCOA 3NG8A 2GX8A 2YQ3A 3HKZD 4ZJQA 3DDIA 2YWKA 4DFJA 4UUXA 3EUNA 2M9KA 4ED3A 1N5QA 5KFWA 1CJKB 1HNVA 2NQPA 5D0EA 4MT1A 3HT3A 3TA0A 1TK8A 4PXBA 3WQPA 3B4DA 3DRPB 5GMKa 2VFUA 3UCUP 2IM1A 1S5ZA 3T5KA 2A6MA 1GFWB 5FLXU 1IWGA 4OMFG 1KDNA 2ZH7A 1HI1A 2V8PA 4LVOP 1WC0A 2BOPA 3W5YA 2IVFB 4DR5J 3C6UA 4CLZA 1WDDA 3IWXA 4CTAA 3AAWB 3Q8QB 2BJ8A 1MN7A 2GGPA 1L3SA 3K5NA 2YWGA 3MR7A 3QT8A 2GJFA 1WI6A 1IBCB 4OI2A 1F5CA 2V34A 3HD1A 3EGNA 1GQEA 3HI9A 3PYEA 1U47A 2FHJD 4YEAA 5L9NA 4NLXA 2RU9A 2Y1JA 4NCGB 3CJSA 1S1TB 4JYAF 1UP1A 3V81A 3PYGA 4OZ0A 5HJXA 1ZH5A 2MKJA 3QGGA 2Y3YA 1HMVB 2WK4A 5KFDA 1FFGB 4E2FB 2UUCJ 1VQ4S 7FDRA 2HMIB 3TUPA 4O3OA 4W98A 1UFKA 5BR8J 2Q6BA 2VDHA 3PZPA 1Q86T 1JLBA 5D15A 1RAIB 4PQAA 4NXMJ 2CA9A 4C9DA 2QEXS 4LFBF 5F8JA 1RLDA 5C2GA 3OD2A 3AOCA 3DM2A 4IDKA 4OZNA 3IGNA 4CO3A 3PHEA 1Q8BA 1CQMA 2ZH8A 5EX0A 2VPXB 3NKYA 3UWTA 2XMAA 4JV5F 1LKZA 2D7SA 1Q1KA 4IR1A 2CQ4A 3QT5A 4K0KJ 1WI8A 4DV6F 4F4ZA 3HDSA 2FYXA 3HHEA 2MLXA 2C1EB 5IXUA 3KK1A 4O0NA 2ZVSA 3G2XA 4HTIA 5A0YA 2W4PA 5IQ6A 1S79A 1U0HA 2HHWA 1R31A 4ZITA 3UQSA 1NJIT 1RTIA 3BSAA 3MAQA 4TY9A 4ZIVA 3DOLB 3HXMA 2Z2ZA 4I1TA 2LEPA 1KHVA 1SBRA 4OZ2A 2IDEA 2QZ8A 3FSYA 1OY6A 2MKSA 4ZCLA 2MZTA 4I0WA 1EQ0A 2RU3A 4E0DA 4HHUA 4WXWA 4LF7J 3RRKA 2V94A 3BDPA 3O1LA 4OLOA 4M5DB 2QMWA 2BKOA 2M2BA 5IQQA 5ETKA 2W4DA 4DZDA 2DGUA 5IT9Y 2JJ4D 3DLHA 3T1AA 1Q8KA 5E3CA 4RW9B 3CJ8A 3WBZA 1VQMS 4DMZA 4ENOA 2PFDA 1JNRB 5E3RA 3Q8PB 2HBQB 1CJTB 4KB7A 1OYEA 3IM8A 4WWSA 3KMSA 1N34J 2MKKA 3P3DA 3U1MA 3HP6A 1KVJA 3WC2A 3JXOA 1T05A 5KFIA 2HHSA 4RNFA 4P2SA 4N47A 4IRCA 2GVDA 1Y0HA 1SQGA 3O2IA 2A2DA 4G65A 2NXJA 4ID5A 1FKAF 5F0WA 2NZCA 4DR4F 3GJTB 4D3GA 2OHDA 3MWBA 4DSFA 1FD8A 4TN2A 5JXSA 3PR4A 1B99A 2BMBA 5KG7A 3GG0A 1RT2B 4YR2A 1XNQF 1RT5A 2VFTA 3K5MA 2ZWPA 1U1KA 4JV0A 2E5GA 5THWA 2YQ1A 2J9EA 4I69A 1F2GA 2UP1A 3OW2R 4DG1B 1P1TA 3CD0A 2DR8A 2DNRA 4K4VA 1HBOB 4LF9F 1N6QB 3SEOA 1NBEB 3TAPA 3I0SB 2DH7A 5CQGA 4NEZA 3QGIA 3EICA 1TUGB 5AE3A 4L76A 1DURA 3C2PA 4PPZA 5IC6B 4RNMA 2D3OR 4DFKA 2E5JA 3QIPB 2FJEB 3L95X 4PYAA 2ZM6F 1WELA 4TY8B 2Y8YA 1EJ7L 4I68A 2RDDA 3NBPA 5DJBA 4UY85 3QNWB 1PBAA 1K44A 2R8GA 4NLSA 1U6FA 2MJNA 4ZS6A 2J9CA 3V2UC 4WPAA 1GAOA 1FTCA 3IRWP 1RAJA 5CD4H 2DGQA 2CZVC 4LR7A 2RILA 2VG6A 3K8WA 5J2NA 4YB1P 1IKVB 1H2TZ 3C66A 2KHCA 1SKRA 2HURA 5K8NA 2C2OB 2C3YA 1UW9A 2DY1A 1RT3B 3I32A 3DGPB 1NUEA 4O0IA 2CADA 1HQUA 2D1CA 4W90B 3LUYA 2I5JB 3K57A 2FLPA 2UV8A 2B9WA 4ICLA 2QMXA 2X1GA 4Z37A 1UETA 1JLGB 3SDEB 2MQ8A 1EP4B 1VQ6S 2JX2A 4U7CA 4MKAA 2DGXA 5F41A 5KFSA 3G6XA 5IOLA 2CPXA 4C48A 3NOGA 3ADAC 5F8HA 3FBFA 2VC1A 2NSBA 4C4WA 1VI7A 3QRQA 1K1SA 3C16A 4JI2F 3RBZA 2OPQB 2XC9A 4BWMA 5KFLA 1YIJS 5T7LA 3H2LA 1DTTA 4UOGA 2EFNA 3H7HB 3OT9A 1LWEA 1QUVA 1HPZA 3D3CJ 2DNMA 3QGPA 3DKDA 1PAUB 1JXLA 3M05A 1XMQJ 1DLOA 5HP1B 5K9FA 1C1BB 2RHSB 2VBZA 1TELA 4USMA 1LXNA 4OI6A 3TNVA 4TYBA 3FEYB 2UUWA 3BGOP 5KG0A 4B3OA 1T9WA 2W7AA 2R8HA 4LSLA 1KQFB 3SCJE 1X9WA 2KJVA 4G6VB 2CQ3A 3W5XA 1X5TA 3NS6A 5D3GB 1VQSA 5HI7A 5HANA 5CYQA 2VDIA 4PEOA 3NP5A 4M1KA 1NM2A 4XAKA 4M5NA 1QAYA 2JVOA 1YSJA 3UDLA 2H5IB 2KYZA 4WU3A 2HVIA 5AXMA 4CLUA 1FWPA 2E44A 2V4RA 3TWZA 3MAHA 4I2PA 4NYPA 3VALA 4QPTA 4J91A 3DGVA 2MQQA 2JEIA 1C1CA 4Q8FA 1XERA 2GO8A 1NH7A 4QQBA 1Q5YA 4DOZA 1BXNA 3A1YG 1DY3A 3IAS9 4BHQA 4J90A 1R8HA 3GQCA 1FEEA 2ZFHA 2RRNA 5K14B 4KT0C 3M8PA 3DC2A 3E2EA 2EK6A 4WP3A 2AYGA 4HLBA 2I9SA 2OPRA 2BE7D 1YRTA 2FY1A 2RF2A 2O66A 3SSSA 4NLDA 4NEYA 4ECWA 4GVBA 3M6UA 1H7XA 2CQHA 3E01B 3HHLA 4UF4A 1XMBA 4JYAJ 2KU7A 2BANB 1RWUA 1BWEA 2MQNA 5FJ4A 4F3OA 4YUDA 4J9MA 3RGIA 1SH2A 3BGLA 5J2MA 1BHNA 3KLVA 3HVRA 2Z2MA 2F1FA 4E8UA 4GO5X 2V4JB 3D3BJ 4M5IA 4OYMA 3I56S 2WVBA 3VAGA 3GFZA 1NJYA 1N5VA 1YBUA 1B7FA 1WNEA 1MSWD 2AJFE 1IKXA 1EETA 4ID8A 3AODA 1T7PA 3PEJA 3GB0A 4M63A 4OFZA 4DV3F 2U1AA 5D0GA 2C2ZB 5IT0A 1RTZA 2XY5A 1FRKA 4Z2XA 1JLFB 1RT4A 3SV4A 4DR2F 2RT3A 5T41A 3OTOF 3IN5A 5F8GA 1XC9A 3UN3A 3J81U 4YMEA 4P2MA 1EQMA 2JWNA 4LT6A 2M70A 1X7VA 2ZE2A 1J5EF 2RMLA 4LF8F 1OIAA 3KNGA 2DPIA 2E1CA 1OQ6A 5HBMB 1QSSA 2UVWA 1EAYC 2ZDOA 4DPTA 3PX6A 1CC7A 3EDQB 5CYJA 1I94F 2EG1A 4RW8A 3CCMS 3M7VA 1BMQB 1S97A 2UUBF 1WTBA 1S4EA 3JSMA 2BZ2A 4F4WA 4USJC 2YWWA 4CM2A 3TZWA 2HGNA 4DLGA 3JB9k 2V8HA 4B9UA 3TAQA 4RU2A 2V8VA 2FGOA 1SKWA 3L4BC 2WCXA 1RT6B 1Y5NB 3VVTA 3HKWA 1YHQS 5I3QA 4FXVA 2R3VA 3M2UA 3LPYA 2J6TA 4C8LA 2XS7A 4IG3B 3KDOA 1W25A 1S10A 1X4BA 5IM0A 3UD3P 5H9EJ 1F0XA 2V9KA 1HQEA 1KFDA 1B4SA 4OJGA 3IMQJ 5MLCV 1S9GA 4M5KA 3AHPA 1F9FA 4ZN3A 2HKEA 4WKRA 5A8WB 4PXDA 2VFSA 4O44A 4KPYA 1H98A 1O8BA 3B78A 4LIWA 2H54B 1S1VB 2MEWA 3CCJS 3BBBA 2DNGA 3KLFA 1HBMA 1VQOS 2FVQA 1S9EA 4X2BA 2ABYA 4JI5F 1WOPA 2L9DA 3GSDA 3HZEA 1ZETA 2DO4A 2WONA 4CH0S 4OYZA 1C0UB 5CA5A 5J1PA 4CDIA 4WF9Q 2FLNA 1TL4A 4X4TA 3I82A 4OI3A 4B9NA 2OLWA 4M5JA 4EK2A 2AMCB 4LRCA 3F44A 4C98A 4U8VA 4QWAA 3ZNUA 4LF9J 3OLAA 3OTDA 3GFHA 1S0NA 2VODA 3JAMY 4ECYA 2KXFA 4IQMA 2ZD1B 2MGZB 4X65J 2AJ2A 2KZMA 4HHHA 1UCNA 2B4VA 1S99A 2E1PA 4X4UA 3MMCB 3R6GB 2W9BA 4W4MA 4YP3A 4EI2A 2PEBA 1S6QA 3W7BA 3CJ2A 3NNCA 1UVJA 2IHR1 3MTJA 1UWBA 3QO9A 1M0SA 1TL1B 1R6VA 1SXLA 2ZBQA 5KOXA 3DMJB 3EPIA 4FF4A 1LK7A 1HWKA 4CLKA 1WHYA 2EFVA 2F8HA 1YJ9S 4ZVPB 5DS7A 3THPA 1R0CB 1MN9A 2AGPA 2WVFA 2OPSA 4J9OA 1D8ZA 3MM5B 2GVZB 2R7VA 4CLYA 2OTJS 4QOTA 5C24B 1QAJA 3QLHA 3F56A 1EKRA 4DL3A 3MMBB 2MQPA 1OSDA 5C2CA 3JAMU 3NNHA 4NE9C 2CZ4A 4URSA 2APOA 4FF1A 2VA2A 1VC0A 2XHCA 4CLPA 3OFFA 2R7RA 1TKXB 1KQGB 2G9OA 1ZA1B 2KFYA 5CD4A 1GXUA 1QTNB 4L72B 2HQDA 4DQSA 4KGVB 1RT1A 2H65B 4NLGA 1K9MT 4DBQA 2HVZA 2MKYA 2H4WB 4FZVA 3PACA 1VLYA 2CNLB 4RUBA 1WSVA 3HFVA 1KWMA 2UXDF 1W2IA 4JI1F 1KVKA 3PIPQ 2FJXA 2CQGA 3VAJA 3PW7A 4P73A 1OSCA 4ZPAA 2LVWA 1JJ4A 1HNZJ 2LQ8A 3OSPA 1OY9A 3MPWA 1H2VZ 4G1QB 2VQFJ 4LVNP 1VGYA 2XI3A 5KFHA 1V3ZA 1ZTWA 2BQRA 1C4CA 1TR0A 4LIRA 1FRLA 2QC3A 3CCTA 2W7PA 2R7UA 4UOFA 3LPEA 3Q86A 2YY3A 5JUMA 3B54A 2XS5A 1WJ9A 2D9OA 1ZAVA 3R27A 4TU7A 1G2EA 4B9TA 1N88A 5C5JA 3OTCA 4DSLA 2XCPA 1CC8A 1DQ9A 3IS9B 2WSEC 3FMBA 4Z7CA 3TX8A 1MROB 2B3TB 5J2PA 2EC2A 2YVSA 1S7HA 4M94A 3PIOQ 2C22A 2N4CA 1EIYB 1FT8A 3MEDB 1DARA 1BE4A 4UTGA 5GAGI 4WYLA 3CD6S 2MY8A 4F3MA 5J1NA 3ZXWA 4JI3J 2NXEA 1U49A 3FMWA 1FX2A 5K5MA 3KLHA 5ETRA 3AXMA 4CM0A 4Q8EA 1GEHA 4L75A 3CJKB 3M2VB 4LF2A 4YN3B 1WEYA 2VU5A 2RSQA 1IUJA 4NLPA 2LQ9A 3QAEA 3PRBA 2LQBA 3PCOB 1TMMA 4JBCA 4ES1A 1NKBA 4ES3A 2HAIA 4I2QA 2W24A 2ASDA 1RYRA 1HHTP 2BQUA 2JC0A 4JI4J 1EB0A 1Z2ZA 2B8PA 1SJ3P 1KFSA 4PRFA 2CJAA 2CJ9A 3T9ZA 2ASLA 3NLCA 2YH1A 1XEZA 4OJHA 3EJMA 2AP6A 3O44A 1OS5A 1JLAA 2OAUA 4DV5F 3MCSA 2CNKB 4QIWD 4Q45A 3PV8A 3DHXA 4F25A 1U25A 1FKPA 1FEHA 4ZPWR 1BQMA 2FJBB 4EBEA 3DLGB 3OBIA 2BJ7A 1AZSA 2VG5A 3I4PA 4F3QA 2MKCA 3HFZB 1UA1A 3SIPB 1CJVB 3QT7A 1K47A 4GO7X 3D68A 2HFNA 3CC2S 4QIEA 2QA4S 1VRQC 1AT1B 1ICEB 4S0MA 1RTHB 2BDPA 3KNAA 3RBXA 1B7YB 4G3IA 9RUBA 1QD1A 1AB8A 2E1AA 4WCEQ 2EC0A 1HWIA 2XO6A 4X64F 1UTAA 3GIIA 5F9LA 3FEXB 2XNRA 2OFHX 4EU0A 4LF8J 4N56A 2UVUA 1LK5A 4PG4A 4PG6A 4RPFA 1U2FA 2OELA 5AE2A 3CDEA 5HLFA 1ITPA 2HNDA 2RNEA 5KFQA 4DR6F 3K5LA 3MM9A 4PUOB 1TKZB 4F0KA 2ZJPQ 4CQ1A 4H4KA 2UUBJ 1TVRB 1FD2A 3Q89A 5E7OB 2ERRA 4KIAA 2Y1LB 3UCGA 2J8SA 3MR6A 2W2QP 1I3OB 3S8SA 4PQUA 5B09A 4KHPJ 3D1QA 3MM8A 1XMOF 5HQ8A 2CIMA 3Q8YA 4RX6A 1LWFB 3IR7B 1U8WA 1URRA 3DXBA 4LF4F 3ELHA 1KBRA 2R8JA 3BSNA 2WVDA 1ZM3A 3I96A 2VASA 3HCXA 5HROB 2HNYA 2BR0A 3ZNJ1 5CYMA 5B0CA 3VQSA 2EG2A 1Y3JA 3S7RA 4DR1F 2HZVA 3AA8A 2N82B 2XM3A 3L7OA 2R2RA 2AT1B 2OPPA 1RWPB 1V5VA 4WFXA 3ITHA 2YQ0A 3CMQA 2JOQA 3CPWR 1N8RT 3OR1B 3ZO7A 3KMQA 4Y6IA 4B3TJ 2RKIB 4DSKA 2DGSA 3FVYA 3ILIA 3W63A 2R7TA 4B08A 3OJUA 2BJDA 2HGMA 2MPUA 4KTQA 4FS2A 1CULA 3VR1A 4R8UA 1EKSA 4ZVTB 1RTDB 2XMJA 1VHIA 4MKBA 3UDCA 1XBWA 2HHHF 2VG7B 3KK3B 3CJTA 4C8MA 3GR0A 1NK6A 4A46A 3LF0A 1S0MA 5D4OA 1H6KX 2HS0A 5AXLA 2PC6A 2WBRA 2HK2A 5KFMA 4XO0A 4A8KA 2J7WA 2JDJA 5CZXA 2W1BA
chains in the Genus database with same CATH topology
3B4DA 2Z4PA 2BW2A 3VAFA 3DRPB 1FK9A 5GMKa 3SV3A 2F3JA 4QWDA 3MFHA 1RK8A 3VTIA 2YNIB 3CTRA 2VFUA 1UJ6A 2M5YA 4NA2A 1FDAA 2C3OA 3UCUP 2IM1A 5DO2A 1VFJA 3DLKA 5EX3A 4A47A 3T5KA 4QJVA 4X4QA 1HBUA 2NPIA 3G8TA 1RT2A 4OMFG 1F5AA 1JLAB 3VQTA 2DBBA 5A8KB 2ZH7A 1HI1A 3N01A 4IFVA 3OVBA 3G8SA 2UUCF 1VQ5S 1IKWB 4OHZA 3LALA 4LVOP 5HO4A 4FYDA 1FRIA 2VA3A 2BOPA 4NPOA 3BZQA 3RBEA 2IVFB 3CWJA 3C6UA 2KKHA 3UNGC 2HQIA 4KKOA 3IWXA 3A8EA 2I2YA 4Y65A 3CULA 1N54B 2VOPA 4CTAA 3AAWB 3Q8QB 2QA4G 1DJ0A 2E9RX 2Q3PA 2GGPA 4MYTA 4DG1A 5LJ3Y 1PC4A 2GJ2A 3CSKA 3UCZP 2JLFA 4MMOA 3PO5A 1L3SA 3K5NA 3G6YA 1NO8A 2IBKA 4DL5A 3E8OA 1KOHA 2YWGA 1HBOA 1S9FA 3BM7A 1BQMB 1RISA 5C42B 4KV8A 1N6QA 1XK8A 4LF5F 1KNZA 4NXMF 1WI6A 2GQCA 2CRLA 4OI2A 1XR5A 1F5CA 3N5FA 2LLZA 2VG5B 2PO4A 4NA1A 4RUCA 2RVJA 4C8KA 2HRUA 2RRAA 3BGRA 3PVXA 1FXRA 3IR6B 3EGNA 1GQEA 4TQRA 2VV5A 3CJ4A 4YDXA 2A18A 3HI9A 2MZRA 2N7CA 4ATNA 2C3UA 1U47A 3I87A 2FHJD 4JOUA 3UI3A 4DFMA 4YEAA 3PNIA 2Y0SD 2AV5A 5L9NA 1T05B 4ZP8A 3DDKA 4NLXA 2RU9A 4A8XA 1NK8A 2Y1JA 1Q79A 2OD4A 3PDNA 2J0SD 4NLTA 3QIPA 3S01A 4NCGB 2CFXA 2FJWA 1ZOTA 5E41A 2KTQA 1S1TB 3O6QA 3V4IB 1UP1A 4JYAF 3D5MA 2E7WA 4PWDB 4FS1A 4JI0F 1RGVA 3V81A 2CPIA 2LKZA 1M5KC 1T03B 1TUVA 3I6PA 2J0QD 4USHA 5KFBA 2JRSA 4OZ0A 1ZH5A 4B3SF 2LYVA 3PKYA 2MKJA 5KFTA 2M7SA 4QR1A 2KXHA 3QGGA 3TUZC 1XNRF 1UA0A 2CKWA 3OTBA 1HMVB 2MJUA 2WK4A 5LXYA 5KFDA 1JX4A 3CDWA 4QBUA 4P7VA 1KLNA 3RR8A 5KFOA 4YOEA 2GIRA 1TL3A 1VQ4S 4RUAA 1CLFA 7FDRA 2HPUA 4K4XA 4MFBB 2HMIB 2E5HA 2QE5A 1MMDA 1Q16B 2EWHA 2HYIB 3G9CA 1JJ2R 3D0HE 1VRUA 2IA0A 2L08A 3CCVS 4ZP6A 4O3OA 1REVB 3M30B 3MM6B 4BS2A 3UD4P 1R8AA 3GIKA 3OR1A 4K4ZA 1O51A 2B7CB 5B08A 2HNDB 2XMWA 4I56A 2Q6BA 2WSCC 1SJ4P 4OI4A 1HR0F 3CJ3A 3PZPA 4RUHA 2J0WA 2HS4A 4LMZA 2F4VF 1Q86T 4H4OB 4Q0BA 2BUNA 5A8RB 4QWEA 1JLBA 1Q8LA 1RT5B 4PQAA 2QRRA 4O4RA 4OLPA 3H5SA 3PRDA 4LF7F 2YNGB 4C9DA 2MQLA 2QEXS 4LFBF 1FJCA 1Q8IA 5F8JA 2OSQA 1HD1A 1GX6A 1N36F 2JLGA 3L09A 2VBXA 4ED2A 3J7YI 3AA9A 3DM2A 4IDKA 2DH9A 1JK9B 4OZNA 1IKVA 3TQ1A 2PA3A 3IGNA 3VZIA 4ZP9A 4CO3A 3PHEA 1Q8BA 2Y1RI 2CPFA 2VKZG 3IG1A 3TVKA 2NYIA 2R9LA 4C8OA 3KLEA 3RB0A 3NCRA 2YKAA 2UVRA 4PQUB 1CQMA 2LU2A 2RUGA 4BC9A 1FKOA 4ALZA 2IM2A 5EX0A 2ZH8A 3BO4A 4ZMMA 3P6YC 2VPXB 3NKYA 3UWTA 4GC6A 1C4AA 4I4BA 4JV5F 2XSFA 3J81Y 2B5JA 1LKZA 2D7SA 4FNIA 2R7OA 2HHPA 3OL8A 1Q1KA 4Y34A 2G0CA 2YKMB 2YH0A 1RT3A 3MM8B 2ZHBA 4IR1A 3DGPA 2CQ4A 4X4RA 1CEZA 3MURP 2YX1A 1WI8A 5KT5A 1HNIB 4DV6F 4F4ZA 3HDSA 3ONQA 5GADI 2BJEA 3CD5A 3HHEA 2I1RA 3NMAA 2DHXA 5HMYA 3CC7S 3RTVA 2MHEA 5IXUA 4HH1A 2DK2A 3KK1A 2ILZA 1SJRA 2ZVSA 1ULRA 2LXFA 2VG7A 2MKIA 4BWJA 4HTIA 3P96A 3NAIA 5A0YA 1JLGA 2W4PA 1T02A 5IQ6A 1S79A 4NCAA 2HHWA 1R31A 1T3OA 2CQ0A 4K59A 4AL5A 4DF4A 4R5PA 2HNYB 5KG3A 3UQSA 4NXNF 1E6YA 4Q7AA 1NJIT 3D1OA 2DNLA 4K50A 4WZQA 1RTIA 3BQ2A 3BSAA 3PY8A 1VRTA 3MAQA 1B64A 1DAXA 1DQ8A 4TY9A 3DOLB 3HXMA 4ZCKA 4I1TA 2LEPA 4BC7A 2R2TA 3EGWB 1KHVA 4MH8A 1SBRA 1BQNA 3G86A 2QZ8A 2XHWA 3FSYA 5KG6A 2XGQA 2B51A 2M0GB 2MKSA 3VAMA 3N6MA 4ZCLA 3CCWA 5KG5A 2MZTA 4I0WA 2GW8A 2AYEA 4U6PA 3CMAS 2CJKA 4V19J 5DM7Q 4J9QA 1IJEB 2RU3A 4E0DA 4AL6A 1S0OA 1JKHB 3N6NA 4WXWA 4RW6A 3MEKA 4DEZA 2V0NA 2ZBIA 1KTVA 4DV2F 3RRKA 2OPQA 3ITHB 3SSRA 3JTPA 2V94A 5K8MA 3BDPA 4V19X 3O1LA 4OLOA 3MUTP 2IC3A 4WE1A 3U02A 1O0PA 1DBDA 4M5DB 3RU0A 1LOUA 4F8RA 1FNXH 2QMWA 2FHKA 4DPOA 2PEHA 1TV6A 3FDSA 5A8KA 4FVMA 2M2BA 5IQQA 1UVIA 2W4DA 4K2XA 2DGUA 3V6JA 5KAKA 4J9LA 1AFJA 3HHDA 1L5UA 2KH9A 4ZPCA 1PO6A 2JJ4D 5IT9Y 1HWJA 3FEZA 3AY0A 5IZHA 1WG1A 3DLHA 3QJLA 3T1AA 1B0VA 2FB0A 2PA8D 4FXWA 5HP1A 4KAIA 5IS2A 2IJNA 1B0TA 3GIJA 1K0VA 3M9OB 1C1BA 5E3CA 3PJXA 3S6EA 4RW9B 2K7KA 1FCAA 4FN5A 4U67Q 5BYSA 3MEEB 1SL2A 3WBZA 3ZFVA 4DMZA 1VQMS 2UUAF 1XR7A 1SJQA 2XMUA 4OHVA 4IOAQ 1JNRB 1U24A 2HWTA 2B4PA 3HHLD 4EBDA 4ZPTR 3QJPA 5E3RA 1HW8A 3Q8PB 4ELVA 5KG4A 3PX0A 2EVZA 2FDNA 2VFVA 4KB7A 4DDFA 2IM0A 4DR3F 1VC5A 4QWCA 5LSOA 1GH8A 1NK0A 3DRSB 3KMSA 4RBTA 1SKSA 6FD1A 4R8UB 2JVRA 4ZA1A 2ZOGA 3NS5A 2MKKA 4YQWA 4IUFA 3CJ0A 1DTQB 3OXFA 3P3DA 4OZ5A 1U6ZA 3U1MA 2DNZA 3HP6A 1KVJA 5DQIA 3WC2A 4B17A 2GFFA 1T05A 2CQIA 1UVKA 1DQAA 2B6AB 5KFIA 2VB6A 1U6BA 2HHSA 4RNFA 3MUVP 4P2SA 1NK9A 4K4YA 4N47A 4DQPA 1FVQA 4IRCA 5F8MA 1Y0HA 5KT4A 2YKNB 4PCQA 4DL6A 1BY9A 1D9FA 1M5HA 4X4SA 3O2IA 4NX9A 4LFAF 3DRYA 2ASJA 3S1TA 3OSNA 2R2UA 1HNVB 5GAEU 1T03A 3M8QA 2A2DA 5J2QB 4MK9A 5GAHI 4ID5A 2ZC3A 2EFGA 5U47A 1FKAF 3WZ0A 2EK1A 5F0WA 1M5PC 1KC8T 3H2UB 4DR4F 2B7BB 2DNKA 4ILLA 1I1GA 4WYWA 4OIXA 4D3GA 4AFFA 1HARA 1A6LA 2IJFA 3MWBA 2CG4A 1FK9B 4DS4A 3TVYA 4DSFA 1FD8A 4AXIA 2D9PA 1YVFA 3M6WA 4TN2A 5FIIA 5JXSA 3PR4A 5T14A 3BO3A 2W4CA 2EFOA 5M2PA 3HLUA 5KG7A 1N5YA 4I6YA 2VBYA 5M2RA 3DLKB 2ZNYA 3CEDA 4RNOA 2XB2D 2ZH6A 3GG0A 5BYQA 2UVVA 1YBAA 1HBUB 3FRZA 4TXSA 4DJBA 1RT2B 3P49B 4YR2A 1X9SA