5D78A

Structure of rrm3 domain of mip6 at 1.25 a resolution
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
80
Chain Sequence
GPLGSMKTILVKNLPSDTTQEEVLDYFSTIGPIKSVFISEKQANTPHKAFVTYKNEEESKKAQKLNKTIFKNHTIWVGPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords RNA-binding protein MIP6
publication title Structure of RRM3 Domain of Mip6 at 1.25 A Resolution
rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
total genus 20
structure length 80
sequence length 81
ec nomenclature
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5d78A00
4LIRA 1HL6A 2KT5A 1SJFA 3THTA 1VQ5S 2RU3A 2XS5A 3NS5A 1HA1A 2DH9A 3UCGA 1M1KT 5LXYA 1VQPS 2MB0B 4WFNQ 3SDEA 2N7CA 1U1OA 3MUVP 3SXLA 4TLQA 3FEXB 2LYVA 2F9DA 1R8PA 1D9AA 3L3CA 2J0SD 5DDQC 3US5A 3VAIA 2MPUA 2KRRA 5GMKa 4W92B 2CPIA 2CPHA 1U1QA 1FXLA 2DB1A 2RUGA 4A8XA 2DISA 1SXLA 3MD3A 4YOEA 2DGQA 2CPZA 1JJHA 2EK6A 4M5DB 3CMAS 2CPYA 4UY8T 4P6QA 2M52A 3BS9A 4PRFA 1WHWA 2CQ0A 2RQCA 4QU6A 2M0GB 2ERRA 1JJ4A 2HYIB 2DGUA 2FHOB 1IQTA 2KVIA 5CYJA 2MKKA 1VQNS 2AYBA 1B7FA 3NS6A 1OO0B 1SJ3P 4FXVA 2RS8A 2LA6A 1Q86T 3HHNB 3P5TL 3G4SS 2CQHA 1UAWA 2CQIA 3S6EA 4BS2A 3CUNA 1VBZA 2Q79A 3NNAA 1YJNS 1FO1A 1VQMS 2OJ3A 3CCVS 1WF2A 1M5KC 1FHTA 5LJ5Y 1X4BA 2DNNA 2WBRA 4C7QA 1U1RA 3TYTA 5GADU 3S01A 3R27A 3CC2S 2MKHA 4ZKAA 1FT8A 4IO9Q 1NU4A 2DH8A 4LMZA 5IFMA 3I55S 1X4EA 2MKCA 1N52B 2DIUA 1RK8A 2DNMA 2M8DB 2CPEA 4Y00A 1X5OA 3CCSS 3CD6S 1DZ5A 1OWXA 2NZ4A 1VQ4S 4YUDA 1YHQS 2RS2A 4IUFA 5GVQA 2HZCA 2DNQA 2KM8C 5GAEU 2E5HA 2BZ2A 1M5OC 2D9PA 2AD9A 2DNLA 2VOPA 2RVJA 2DNZA 2D3OR 3CF5Q 3P6YC 2QFJA 1KC8T 4U67Q 2X1AA 3MUTP 3IRWP 1X4AA 2CQ1A 2CJKA 2DO4A 3DXBA 1ZH5A 3I56S 2OSRA 1VBYA 2EK1A 2YWKA 5DDOC 2RRBA 2L9WA 1O0PA 2QEXS 4FXWA 2YH0A 2O3DA 2RNEA 2OIHA 5H1SV 1U6BA 1HD1A 1NO8A 2KM8B 5DM7Q 3UD3P 1S79A 3UCZP 2MZSA 2EVZA 1D8ZA 3NNCA 2CQ2A 3CTRA 2DGXA 5LXRA 3OW2R 1VQ7S 1KOOA 2JRSA 5ITHA 2LCWA 4OZ0A 3MI7X 3TO8A 2OTJS 2BOPA 1FJ7A 2KHCA 1UW4A 2DNHA 3B4MA 3FEYB 3CCUS 3R1LA 2V94A 2JWNA 2KXFA 4OZ1A 4RU2A 5LJ3Y 2ADCA 1SJRA 3G8TA 1WG4A 5CA5A 1N54B 1JJ2R 2J76E 1WHYA 2HGLA 2G1DA 1QVFR 2MXYA 3CCLS 2U2FA 2DGWA 3G96A 2M9KA 1VBXA 2FC8A 1VQ8S 1WF1A 2LEAA 2MZTA 3RW6A 3SDEB 2JVRA 2MQNA 2KXNB 2DNGA 2E44A 2MGZA 1K73T 2CQBA 2KN4A 1YTYA 1Q81T 3K0JA 2G4BA 2XS7A 1QM9A 3V4MA 3THPA 2ZJPQ 1OPIA 2CPXA 3P3DA 2M88A 2YKAA 2CPJA 2E5JA 2GHPA 1A7GE 2MGZB 1U1PA 2L08A 3B4DA 4J5OA 2DGVA 1VQ6S 2VODA 5LSOA 5D78A 1BY9A 1XN9A 4Y0FA 2VOOA 2MQOA 1X4HA 2MQQA 2FY1A 1DBDA 3H2VE 2HVZA 5HL7Q 5IM0A 2VONA 4LJMA 2SXLA 2LKZA 3G8SA 4F26A 1H2TZ 3PIPQ 2MKSA 2XSFA 3G71S 2DHAA 1N8RT 1OIAA 5HO4A 2DGTA 2LEBA 1H2UX 2CPFA 2M7SA 2K3KA 2MZJA 3H2UB 4Z2XA 3BO3A 2RT3A 3SMZA 2LA4A 1WELA 3CCJS 3VAKA 4CIOA 2JX2A 1RKJA 2LXIA 2MKIA 1WI8A 2HGMA 1ZZFA 4CH1A 1CVJA 1U2FA 1WWHA 3CCQS 2K8GA 3MDFA 2U1AA 1L3KA 3IWNC 1Q82T 2CQCA 3U1MA 1W2BR 3UD4P 1Q7YT 1YIJS 2KXHA 2ZJRQ 3ULHA 1H6KX 2MYFA 1N88A 2PEHA 4PR6A 2DGSA 5GAHU 5D77A 4TU7A 3VALA 3G9CA 1VQLS 1WI6A 2LECA 4WFAQ 2JVOA 2MKJA 4C0OC 1X4FA 4F25A 3S7RA 1YWXA 1YJWS 1PGZA 4IOAQ 5MLCV 4WF9Q 1U1LA 2F3JA 1P27B 1ZZNA 4QPTA 3BO2A 1YI2S 2MZRA 2N3LA 4QQBA 3PIOQ 2XB2D 2HGNA 4TU8A 2KFYA 1VQOS 3DLLQ 4W90B 1WG1A 2DNOA 3EGNA 2AYGA 3VF0B 3CCRS 1X5TA 3LQVA 2DO0A 1WTBA 2KRBA 2MY7A 3U1LA 1WHVA 2KG0A 3CMES 1PO6A 2DHGA 2KI2A 1VC6A 2MSTA 2M2BA 2RRAA 1M90T 2NLWA 4YB1P 3UWTA 3MURP 3N9UC 1R8HA 2CQDA 3EX7B 2KU7A 3J7ZT 2N82B 5JVGQ 1P1TA 1WG5A 2CQ4A 2MMYA 2MJNA 1JMTA 2XNQA 1URNA 2OTLS 1FJEB 2RQ4A 2KYXA 5DM6Q 1K9MT 4F02A 3Q2SC 1WF0A 1VC5A 3BO4A 3UCUP 1YJ9S 2AYMA 2N3OA 3S8SA 2OSQA 3G6ES 1M5PC 5GAGU 2MSSA 5LSLA 3VAJA 3CC7S 1U6FA 5JVHQ 2YTCA 1U1KA 1VQ9S 2DNYA 2KH9A 3MOJB 4UQTA 2DNKA 2MQLA 2MQPA 4ERDA 2YH1A 1WEYA 2DGOA 5IQQA 5DDPC 3CCMS 2D9OA 1NJIT 1M5VC 3MD1A 1U1NA 2UP1A 2GO9A 3BEGB 1AUDA 3MXHP 4CQ1A 2B0GA 2E5GA 1S72S 2DIVA 1X5SA 1KOHA 1HD0A 4WIIA 3Q2TC 3JB9k 4WKRA 3D2WA 2DNRA 5IM0B 1VQKS 3CULA 2ADBA 3RW7A 3VAFA 2X1BA 2DH7A 2MY8A 2XS2A 2MZQA 4QU7A 2PE8A 3J7YU 2DHXA 3CCES 4V19X 1X5PA 1KQSR 2E5IA 4WCEQ 4TU9A 5BJRA 1A9NB 1YITS 2FPHX 2LMIA 3CPWR 1G2EA 2F9JA 2M70A 1SJQA 2CPDA 2DHSA 2DITA 1X0FA 4PKDB 1X4DA 1DHMA 3NMRA 2M4MA 3VAMA 2AYEA 2X1FA 2MZ1A 1WEZA 2LXUA 5CXTA 5EN1A 1X4GA 2ZJQQ 3P49B 2FC9A 2DNPA 4WFBQ 3CXCR 1DRZA 1FJCA 3EGZA 3MUMP 1WEXA 2J0QD 2LQ5A 3HI9A 5DETA 2G0CA 4C4WA 1UFWA 2J8AA 1SJ4P 5FJ4A 1FNXH 2X1GA 1UP1A 2MJUA 4EGLA 3ZZZA 2CQGA 3VAGA 3CC4S 1H2VZ 1X4CA 3ZZYA 1F9FA 1VC0A 3LPYA 2QA4S 2CQ3A 4CH0S 1K8AT 2MHNA 2M8HA 1U1MA 2A3JA 1KD1T 3NNHA 3TP2A 2KG1A 3VAHA 3UE2A 2L41A 3R1HA 2XNRA 2MQMA 2I2YA 2I38A 2CQPA 2DK2A 1QVGR 4ED5A 1WHXA 4IOCQ 5DDRC
chains in the Genus database with same CATH superfamily
3TVYA 5E3CA 1R89A 4N56A 3T3FA 3KG0A 1JWWA 3M8PB 5AXLA 5HLFB 4H54A 1HNXJ 4FBTA 2RRNA 2MB0B 3M9OB 4OIXA 1U1OA 3MUVP 1PCAA 3GV5B 5L1JA 5HQ8A 4DQSA 3D0HE 1QTMA 3FC9A 1I6JA 2BJ8A 1SXLA 1KQFB 1LW0A 3DGPA 3MM6A 1Y00A 3A4TA 4PRFA 4QWBA 1LV5A 5ETRA 3M05A 4X66F 4FPRA 1OO0B 3PO4A 1FE0A 5B0AA 1DQ9A 3BGRA 2IJRA 3OTBA 4U7CA 1FKOA 2OJ3A 1FHTA 4ZPWR 5KFEA 3TW0A 5KG3A 1F3VA 2V8VA 1C1BA 5C24A 1N0VC 5F8GA 3MOZA 4DPYA 2J9DA 4ZIVA 1S1WA 2RH3A 5L1KA 2JEIA 4I6YA 1S9FA 1VIOA 4KYZA 4EEYA 4H4OB 3V6HA 4UOHA 4NCAA 4GKKF 2FJDB 4RW7B 2E9TA 3DXBA 4LVNP 4B3OB 3KXDA 5DQHA 1HFEL 4USJC 2RRBA 5K8OA 2AX0A 3PHTA 1HD1A 3HD2A 4RX6A 1E6VB 3RU0A 1VLOA 1VYAA 2YBVA 3CIMA 1RU2A 3D1QA 1V3RA 2DTJA 2W4CA 4B3MF 1SJRA 5L1IA 5CA5A 1N54B 2MQ8A 3TR5A 4CZCA 8RUCA 3AOCA 1LKZA 5CYMB 4ENOA 4DUZJ 4ZCIA 3I9V9 2ASLA 4EWTA 1YGYA 3BBBA 1K73T 2HAFA 1RTHB 3KK3A 3OHAA 4RW6A 1LWXA 1Q81T 4M5NA 1IKWB 3MMAB 2RF2A 5RUBA 2M88A 4I6WA 2O66A 3R2CJ 2QO3A 3KHLA 3PW0A 1T9XA 1VLYA 5D78A 8ATCB 2FY1A 1R7IA 2Q1LA 5HL7Q 2VONA 1SV5A 3UN3A 4EUVA 1NEEA 2NZCA 4O23A 1NM2A 3PYFA 3R8YA 1PC5A 2ZE2B 4RJVA 2LA4A 2W8LA 1RZMA 4MIWA 2YPYA 1HIYA 2KDOA 4G1QB 1CC8A 2GGPA 2GIRA 3OSPA 1ITPA 2ZNYA 4DQIA 4RW4A 5KFMA 3HFZB 1ZA2B 4M5GA 1VGYA 1V5IB 1S10A 1VQLS 2JVOA 4FZVA 4ID5A 2AW0A 2DPJA 5KFVA 1MROB 3W2VB 2D3O1 3PIOQ 1ZAXA 2L9DA 1V3SA 3M8YA 1YJUA 3TVZA 3QJJA 3Q8VA 3CCRS 4LSZB 4NEZA 4M5HA 2J6SA 3MPDA 2B9YA 3JTNA 3BREA 2ZWPA 4WKYA 1VC6A 3GSDA 2Q66A 2P2CB 3M8PA 2GAGC 5HLFA 5DS7A 1T8EA 3KFWX 4ZLLA 4ZHRA 1CQMA 2CA9A 3J7ZT 3EZ5A 4RUAA 1S6PB 2CNNB 2CVIA 4ZVPB 1EX8A 1BD6A 3K7RA 5ETMA 3T1YF 3S8SA 3KHGA 3HKWA 3EWGA 2DNYA 2MQLA 5IQQA 1Y0HA 3IGNA 3MAHA 1U0SA 1OY6A 4EU0A 4MT1A 3MXHP 3NEKA 1VQSA 2RU9A 5HQLA 4WKRA 2DNRA 3FGVA 1J5EF 1FTCA 1SL2A 4K5SA 1RU1A 1O51A 3RB4A 2E5IA 3TQEA 3DYAB 1RAGB 2HBYB 3A1YG 3CD5A 3D7SB 5J1NA 1QJHA 1NPKA 5DG9A 3C15B 3VAMA 4JI6F 3HSGA 1HBOB 2ZITA 4NYZA 2C1EB 5CCMA 2OD6A 2V68A 1WEXA 1LWEB 4RW7A 2PI5A 1UFWA 2J8AA 5D6GA 4B3OA 1DTQB 3A8KA 1JQGA 3G6VA 4XO0A 1C0TB 3A13A 1F9FA 4EO6A 2QA4S 1NZ8A 5F8MA 1VOMA 3GJRB 1E6VA 5GAGI 1G3OA 1SIZA 3UO0A 3UE2A 1KP6A 3L95X 3OL6A 5A6PA 5LT5A 2RU3A 5CYMA 2E1MC 1VS3A 2W2QP 2UV8G 3M2UB 3DI6B 1WACA 1TUWA 1RTHA 2ZH2A 3ILOA 2A6OA 1C2PA 5L38A 1IKWA 2VHGA 3MMAA 2CZVC 2BEFA 4YOEA 2E1AA 2QYGA 3KJNB 4CRJA 3TZWA 1WHWA 2L3MA 1H3DA 1GEHA 5E41A 1XR5A 1QD1A 2VUGA 3D6FB 3D1OA 4B9NA 2ZC3A 3G4SS 2CQHA 2ZE2A 3DMJB 1AXQA 5F9LA 1FJGJ 2R9LA 1T9UA 3SFGA 3IO1A 4G1QA 4K8RA 2LFVA 3L7OA 3GILA 4WJBA 3KLVA 3CSKA 3BGFA 5KFCA 3QIPB 4ES1A 3ZNUA 4Y34A 3IM9A 2BV3A 2BJ1A 2FJXA 1TKTB 4TN2A 2VU5A 4RZRA 3IRXA 4YUDA 3MECB 5GVQA 3R5AA 1TAUA 4KTQA 4IG3B 2D9PA 2AD9A 2DBBA 3R6GB 5D4LA 1HARA 1Q5VA 4XK8C 3W2VA 3KG1A 3TNVA 2CQ1A 2CJKA 3LP2A 1ZM4A 3ZTRA 1HYSA 3I56S 2HHSA 1U0HB 2H5EA 4Y65A 2Q3PA 1QSYA 3CNQP 4JYAJ 5I42B 2QA4G 4Z37A 3DNCA 1EKRA 3E51A 5ITHA 1FRJA 3K5NA 2YKNA 2EW9A 1UW4A 3NWRA 4YB5A 1Q8LA 3DOMB 2AQ4A 4YHHF 3RYLA 2V6AA 1EQMA 3BSNA 2MZTA 2VDIA 2JVRA 3N79A 2DNGA 4DF4A 2DXDA 2OO4A 4Z7CA 4BHQA 5GADI 3Q86A 1S99A 2G4BA 3H8YA 2YKOA 1FNOA 3D5MA 5CH7B 3D6TB 1F3FA 4FPIA 3W8GA 4NXMF 1GH8A 4M5MA 4BLGA 1APSA 3HM9A 1OQ3A 5HBMB 5E3AA 4ELVA 3ET6B 5D4OA 4IR1A 3EVMA 3MMBB 3DYAA 5KT4A 5HN0A 3DRSB 2RT3A 1FRLA 2Z30B 4Q2LA 2ILZA 2BW2A 1M5HA 1WWHA 2CKWA 3M2RB 3C15A 1HBOA 2XYPB 1YIJS 1N34F 1RHMB 4R0EA 2MHEA 4Y2AA 1TK8A 3CT9A 1HQUB 1LWEA 1DTQA 1C0TA 4DV4J 1IR2A 4WF9Q 2V2ZA 3MR7A 1ZZNA 2DPIA 2F4FA 4ER8A 4R25A 1YG0A 2FLPA 2LQBA 5AXNA 4I1TA 5HVHA 1S49A 2VC0A 1OY9A 4K0KF 1Q4RA 4S0MA 4C0BA 4B9VA 4A48A 1REGX 3W66A 4LF6J 1H98A 5E33A 5DG7A 1U6ZA 3DI6A 3OPKA 2AV5A 4NLWA 4ES3A 3LALA 3M4XA 2O1PA 3KLHB 5D0HA 3ENQA 3EGVA 2YY3A 4EZ6A 1QE1B 2AYMA 1NBEB 2XLIA 2R8GA 3ELHA 2B4OA 1VQ9S 3CJRA 1BWVA 1H7WA 4DX5A 3C19A 1RT1B 1HW9A 3DLJA 3CVKA 3BN4A 4NOHA 5E3QA 1VCTA 3DMJA 3FBFA 1NK6A 1N5VA 2HHUA 4NE9C 4LF8F 5HROB 1WKJA 3IAS9 4DV2F 2OMOA 5K8PA 2MY8A 3KLIB 3VV2B 1UA0A 3QIPA 1RWKB 5HMWA 4WK1A 1TKTA 2BMBA 1NPPA 3VTIA 3MECA 2M4MA 4IG3A 1URRA 4OLOA 2MZ1A 3VZHA 3ILLA 4L73A 3HZEA 4LIWA 2E9RX 4DL6A 2MLXA 2MJUA 4M94A 4PG7A 3ZZYA 4KV8B 5LMUJ 1TVRA 2ZEJA 5I42A 4KGKA 4A8FA 5I3PA 4E0DA 2PGCA 3Q8PB 1RAIB 1I5OB 5BR8F 2OKQA 2I38A 2GMHA 1U2RA 4LBPA 4USVA 3DOMA 4DJBA 4RBVA 2F40A 4TY9A 4LR8A 3N5BA 1T95A 1HA1A 1RABB 1OSCA 5F3ZA 2YQ0A 2P6SA 1S76D 3FZ2A 4DR3F 2MPUA 2KRRA 1SCJB 3HF5A 5J2MB 1WDDA 1FKPB 4IFYB 4DL3A 4OYWA 2KB2A 2EK6A 2FVQA 3F73A 2IMOA 5HBMA 2BUNA 1AZSA 1BQNB 5CYJA 2V50A 1UAWA 2ZBIA 3MMBA 1SIWB 3S6EA 3FRYA 5HI7A 1VQMS 1M5KC 1X4BA 1HHTP 1X9MA 3M2RA 3K8WA 2YQ3A 2DR9A 3R5CA 2IJNA 2I9SA 1HQUA 4HL9A 3H98A 2RS2A 3OTCA 2JH3A 3KJFB 3MM9B 3WX4A 3MMCA 3PJ9A 2KT3A 3A12A 3QYYA 3Q89A 4L3KA 4ETXA 1IBLJ 3HLUA 2DO4A 2IC3B 1ZH5A 1O6XA 2R7RA 2W24A 1XNRJ 4NLUA 2QLWA 2G1HA 2P9GA 3OFHA 4DSEA 3H59A 4JI3J 1DFDA 2RB7A 1NDKA 3CTRA 4MIAA 2JRSA 4AQYF 4K4TA 2OTJS 5AJ3J 4AYBD 3R1LA 3PXGa 4I56A 2B9WA 2PDAA 3GB0A 2OP5A 2KXFA 3OL9A 2W7OA 3KUHA 3OSNA 2HURA 2G1DA 4X84A 2U2FA 4P52A 1QE1A 4DLEA 2XMTA 4HI1A 2QMWA 3AA8A 1KRPA 3VGSA 3C46A 3THPA 2KZZA 1JLBB 1RT1A 2IM3A 4K4XA 1H38A 3ZO7A 1JKHB 2L08A 3HVRA 2DGVA 1VQ6S 1TUGB 4WZMA 1S1UB 4KHMA 2SXLA 3LAKA 1RLCL 5HROA 2XMUA 2ZH7A 2XSFA 1S1TA 2RJZA 1OYEA 2LDIA 3KLIA 2M3DA 2XYHB 1OIAA 2IAJB 1Z4UA 5KFWA 2MZJA 3RG6A 3SMZA 1RCXB 3J80U 2VBXA 2HHHF 3KUGA 3BGUA 2ZWOA 3LP0B 2VQFJ 1YQHA 2GVDB 1IKYA 2JDJA 1Q82T 1Q7YT 2GC8A 4WK3A 3VALA 4CLTA 2LECA 1RCOB 4F25A 1PGZA 5KFUA 4ZPBA 2J9DE 3ZNJ1 1EZZB 3TJAA 3O2IA 4PXBA 4KV8A 1UWBB 4KGXB 3BO2A 3E8OA 1U49A 3ZTQA 1DTTB 2JLEA 4ZJLA 3RRKA 1JXLA 4XPEA 4AUKA 3LQVA 4CTAB 4UOGA 2V8PA 3NG8A 5D3GB 2RAQA 1UVIA 4P9SA 5J1EB 1FWPA 4J9VA 3NS7B 3HPOA 5ETOA 5F8LA 3BSOA 1QAJA 4AL6A 1CSJA 2P8IA 3MCNA 1WG5A 2FZCB 4OQJA 4Y28C 3HK2A 2CG4A 1N5TA 2W2PP 3CMQA 1VBKA 5J2MA 1XTZA 1FKPA 4IFYA 1LEOA 4RNFA 4DR2F 2MSSA 3GQCA 3DXSX 2IDLA 3MOJB 3AA9A 1HBNB 3O5TB 3D0IE 5HMYA 2LEPA 5A0YB 4EO8A 1BQNA 3KJQB 3VGVA 4P74A 1YBUA 5B7WA 3S1TA 1AUDA 3I32A 4DDFA 1S6UA 3Q2TC 4NZ0A 5IM0B 2H4YB 4I69A 2JFDA 1VQKS 4FBUA 1ULRA 4IQXA 2A6MA 2OPSB 3PX4A 2K7KA 4OHZA 1G2EA 4AFFA 4UF4A 1X4DA 3GE9A 3T19A 3KK2B 1UZHA 1C4CA 3G2XA 2WB1D 1KQGB 2J0QD 2IC3A 4DR6F 3TUZC 1SJ4P 3J80Y 5FIIA 1H2VZ 4K4WA 2G13A 3BR8A 5B0DA 1Q16B 2VPZB 5HVGA 3H5XA 2XMKA 4YB6A 2W9BA 3JQKA 4CWBA 1OPZA 4ECZA 4QJVA 3FSIA 1ZTWA 2CUYA 4ZCLA 4NLOA 3KWMA 3EVWA 3ISZA 4TLQA 2VB6A 1FA0A 2VICA 1FE4A 2OFGX 1M1HA 2D3UA 3UD5A 1NK4A 2AZ3A 1JLBA 4LF7J 2RUGA 1TR0A 2DGQA 2WTFA 4K2XA 3HULA 4P6QA 1S1UA 2CAJA 3UR3C 4QWAA 4DMZA 3KNAA 4KC5A 1AUSL 3ILJA 2YNIB 1FI4A 4O3NA 4NXNF 2IAJA 2E1CA 3HHLA 2CQIA 3EM1A 2BXJA 2IY5B 4BS2A 2F8MA 1CJTB 3BDEA 2Q79A 3AJ1A 4LFBF 2HQFA 2V8GA 3VQTA 1WF2A 3LP0A 3BYRA 4I64A 2HHQA 4J91A 4DV1F 1JLFB 2GIFA 2HHVA 2UXCJ 2ROEA 3BM7A 3EXYA 3UN2A 5G0RB 2HZCA 3V2UC 4Q2MA 2QA1A 1ZOTA 3Q83A 1IR1A 2D3OR 1UWBA 2QFJA 4FS1A 1DTTA 4KGMA 3LPEA 5ETLA 3NRBA 1RKIA 4CTAA 2R2SA 2OD4A 5H1SV 2Q43A 4JI1J 5D3GA 3NAHA 2QL9B 4JV1A 2EVZA 2CQ2A 3D3CJ 5J1EA 4TYAA 3OW2R 2C2MB 3TO8A 3D1HA 4MKVA 4B3TJ 1MLAA 4NEYA 4J37A 4OZ1A 2LU1A 4IRKA 4B9SA 4U7UK 1TV6B 1XIQA 5EWEA 2DGWA 2YX7A 4PUOA 2FC8A 3C8YA 3B8HA 5E3PA 2HK2A 2ZKUA 3HHLC 5A0YA 1OPIA 4BWMA 2VQEF 2MGZB 2LXFA 1GX5A 1XN9A 3NCQA 5IM0A 5H9FK 5H9FJ 4CO1A 5GAHI 2D69A 2OPSA 3KDNA 2HIQA 1H72C 1NDCA 2CPFA 4AL7A 3DM2A 2HNZB 1ZZFA 4TQSA 5KFFA 4M1KA 3MDFA 2IRYA 3QGIA 3KK2A 5IQ6A 3TX0A 3I4HX 2P9CA 2PEHA 4FNHA 1UPMB 2UVRA 2MKJA 1MW7A 4M5KA 1TL1B 3SIPB 4DR4J 1P27B 3AQPA 3M32B 4FP9A 3SV4A 3VGTA 3JSYA 1XR6A 3W3SA 3H0PA 5EUHA 4ED6A 1RBOB 1S5ZA 2GW8A 2WB4A 2XY5A 1XMQJ 4L72B 1B0VA 2UUCF 1B0PA 4PABA 1JLAB 3U1LA 3MR5A 4ELTA 4MTPA 1D0EA 3FFIA 2O67A 1M90T 2H5JB 2R7UA 1RT5B 2HLUA 2FHMA 3L9ZA 5AXMA 1KVIA 2AEMA 2NXCA 4CLWA 3RBXA 5IS2A 1KNZA 1RT7B 3FK4A 4PWUA 2HBZB 3RUBL 5ETTA 2OSQA 1TK0A 3PDNA 4WFYA 1YBAA 3WZ0A 2BDPA 3O8WA 4ERDA 3AOAA 2IBKA 3MR3A 2YNIA 1T9VA 2B7BB 2D7SA 1BQMB 2B0GA 1X5SA 3TWZA 1R8BA 1CJTA 3BSCA 4DV6F 5HJYA 3UW1A 2ADBA 4LVOP 4KB7A 2GO8A 1OYDA 1AYEA 1U02A 2GA7A 4YY3F 1JLFA 3MTJA 2PE8A 3J7YU 3QT5A 1YITS 2V63A 3J81j 2NYHA 3RR8A 1MU2B 4C11B 4K2JA 8AT1B 2B9EA 1P6TA 4OJ3A 1T03A 3H2LA 1T05B 2LP4A 1D9DA 1IVZA 2B8QA 4UT4A 2PIIA 2FC9A 4WFBQ 1NSAA 1R43A 2HW3A 3JQJA 2LQ5A 2D3ZA 4LRFA 2HQIA 1HNWF 2F8HA 1WC5A 1LFWA 1X4CA 2DXEA 3HJFA 1GMWD 3EPGA 3NNHA 3IR7B 1RE1B 2I0XA 4OX9F 5J2NB 4CO4A 4IOCQ 4LIRA 1E6YA 3PJXA 3T6BA 3FCHA 1TV6A 2FVCA 3HJVA 3GFHA 2C2RA 3PKMA 2RHQB 3GYNA 5B0CA 1SPBP 2QSWA 2RE1A 1XMOJ 3NGKA 4ZVQB 4F4YA 1RWVB 4W92B 4NYPA 3IWXA 2OAUA 4X4QA 5J2PB 3EJMA 4HTJA 4ZPVR 2NXJA 4J9SA 4DQRA 4FKYA 1JLGB 1T0TV 1N6QB 3ZTOA 3BKTA 2J8SA 2ABYA 2E29A 4M8LA 4DV0J 4PZVA 3ZZ0A 4DL5A 2HNZA 2HFZA 5JJBA 2FDNA 5LJ5Y 3NP5A 5EDWA 2L48A 3FBEA 2J9CA 4JI2J 1QDUB 1NU4A 2VFUA 4U8YA 2COLA 3D4JA 2R8IA 1RT4B 2M8DB 4R5PB 1X5OA 1QSLA 2DY1A 3RR7A 4IUFA 4TYBA 2DNQA 1HHQA 3MAQA 4AE5A 1TL1A 2VOPA 4IFVA 3M32A 2QC3A 4PXCA 3B82A 2CJ9A 3Q8YA 4ITSA 2D1CA 2X1AA 1SJ1A 3M8QA 4QYRA 1TL3A 4PCQA 4FYVB 3DKDA 2UUAF 1FKAF 4NA2A 1HR0F 4ED0A 4U96A 1KTQA 1SC3B 5KFNA 4X64J 3CJ3A 3NXZA 1RT5A 2BOPA 3I31A 2XWYA 4LRBA 4DS4A 4NLQA 2R7WA 4NLTA 1UFKA 1RT7A 4HR2A 3M9NB 2RKIB 4LREA 4DV3J 3SDEB 3HHKA 2HQ3A 4HI2A 2KN4A 4F3MA 3OTOF 3C6TB 1V9OA 4ELUA 2IHR1 1Q95G 2QLBB 4ES2A 1BQMA 1VJWA 1W7WA 3I6PA 2V9WA 2VOOA 1X4HA 1DBDA 2HVZA 4KGZB 2EKYA 2IJFA 2V0NA 1Y5IB 1RYSA 1FWKA 1RHUB 1F0XA 1V5VA 3FSXA 3R7NB 4Z2XA 1MU2A 4LBHA 4C11A 1WELA 4CIOA 3NAIA 3MPVA 2B51A 1L3KA 2X3DA 3GZ7A 2V8DA 3UD4P 1EQ0A 4EBCA 4Y2MA 4HKQA 3H90A 2DGSA 3BBCA 5AT1B 2B5JB 4WYLA 2IM1A 2OPPB 3CJ8A 3MPWA 4JBCA 4N7TA 2ZDPA 3G87A 5AE3A 4ECYA 1R6YA 2J7KA 5KFHA 4HHUA 1IWGA 2UUBF 5J2NA 2VFVA 2DR6A 1AB8A 2D74B 4CLUA 3DU5A 3Q8SB 4LUBA 2YPZA 4X62F 3D67A 5JMNA 4DU8A 4YB1P 1NHVA 5DRKA 3GFZA 3KNGA 4DSKA 4LFAF 1R8HA 4TKTA 2BQRA 3NGDA 5HQMA 4P2SA 5I3QA 4Q5VA 2QLXA 1FDDA 3PRVA 5KFQA 3R97A 4AXIA 2KFNA 2W2OP 3DHXA 5C25A 4ECTA 3NOGA 5KFDA 4K50A 4Y2IA 2AZ1A 2O01C 4E8UA 4UQTA 1JLGA 2DGOA 5KG6A 3OJSA 2WBMA 1UJ6A 1XC9A 2E5GA 3DHWC 2R2TA 2DIVA 3DN9A 2OFHX 2BE2A 2MEWA 3IA0A 4EYHB 3RRGA 1RAHB 4R5PA 2K2PA 4DUZF 2V69A 3OQ2A 2CJYB 3AAWB 3NOCA 2Y1JA 1OMSA 4AD6A 9RUBA 3SSQA 4X66J 1Z1ZA 4QIGA 2CDQA 2E9ZA 1HNZF 2HLTA 1GTHA 2OEKA 4LSLB 5D0GA 6AT1B 2D41A 2KG1A 1T9WA 3VAHA 3W9JA 3N6MA 4F8RA 3IGVA 4X65F 3HHEA 2IA0A 2ZHOA 3SDEA 4BCAA 4RWWA 1R8PA 4LSNB 2HS3A 3US5A 4GKKJ 4EFAC 3C6TA 1OS5A 3UPFA 3RJMB 2R7XA 1R0AB 3BQ2A 4NLDA 4MJKA 1ZAVA 4OX6A 3PYGA 1MN7A 4OHWA 2HYIB 4IYQA 3M7VA 3DLGB 1SJ3P 1QAIA 2LA6A 4CO3A 1S59A 1DJ0A 3OR1B 4X4RA 4B3MJ 4LT6A 3SEOA 4F04B 3BN7A 4C7QA 4ZMMA 5KFBA 4LFCF 2B8PA 3DFEA 1EIYB 5IFMA 4G65A 2XLKA 4DI6A 2V9KA 3T41A 4NWBA 1K44A 4FKXA 2OPPA 4ZA1A 2RVJA 2DR5A 1KC8T 2VASA 1NNDA 2YWKA 1T9YA 3NCPA 1TK5A 2J7WA 3UD3P 2B6AB 2MZSA 2XMJA 1D8ZA 2KO1A 1N36F 4LQ3A 1GAOA 1BWEA 3C3LA 4OZJA 3TZYA 3CCUS 3C2PA 2WRMA 3IBWA 2LVWA 4LF4F 4B9TA 1QVFR 1S12A 4DQQA 1RWOB 3CIZA 1UKUA 4WU3A 1VBXA 2W1BA 1TUVA 1UPPA 1RT2B 2ZM6F 2MQNA 2JEJA 2FVSA 1EETB 3HHDA 2CPXA 5F0UA 2E5JA 4P75A 2UVUA 2HWIA 1Q8KA 1IJEB 2E7XA 2MQOA 4UUXA 4LJMA 2R8KA 4C8ZA 1Y3JA 4F26A 2XGPA 3HVWA 1WOSA 2BJDA 2FYXA 4USMA 1F5AA 2QMXA 2K3KA 3H2UB 4C3MA 3V81A 3VAKA 1S9GA 3BB5A 4I4BA 3NMAA 1RYRA 3OTDA 5KT7A 4HYKA 1ROFA 3T1YJ 3KK1A 3ULHA 5HAOA 2VKZG 2GQCA 5HK4A 3IFEA 1ZETA 1LNQA 5AXKA 3FMWA 4CCHA 1X4FA 4NYOA 3D6MB 2NQPA 4UOCA 4O44B 3N01A 1RTIB 4ZIWA 1CULB 3CJKB 3BSAA 4QPTA 4J9PA 4LSLA 1J5EJ 2AHOB 4P72A 1ELOA 1S6QB 4KH1B 3VF0B 1MMNA 1HW8A 2J9EA 1WHVA 1MMLA 4ZPDA 3CMES 2BVZA 4NASA 4KH0B 1PILA 1HBUB 3N9UC 4JI6J 3BH6B 1HI1A 3FSYA 4X2BA 3M8WA 1LXNA 4LSNA 1URNA 2QLJB 2PFDA 3TARA 2KYXA 1KWMA 3BO4A 4ZCMA 4X4NA 4OYOA 3T9ZA 1M5PC 3UNYA 4DL2A 2ZZNA 5LSLA 4OZ3A 5JVHQ 3E2EA 1SH0A 2UZAA 2APOA 2EFOA 2MQPA 1CJKB 3M8SA 1B4SA 3EICA 3KDOA 2ZOFA 1M5VC 3MD1A 1U1NA 3LGMA 4JUZA 3OR1A 1HD0A 1WC4A 3HCXA 1QAXA 1FXDA 3G6YA 2RILA 3AJDA 4C3KA 3D28A 1KQSR 4NRUA 3IBFB 2FJVA 3QIDA 5DZ7A 4A46A 1SQEA 3FZBA 2YKMA 3GCXP 3AD9C 3EDRB 1OSDA 3HX9A 4KBIA 3NMRA 2V2QA 1S0OA 5AE1A 2X1FA 2AWZA 3MF5A 5K14B 4GVLA 3GPAA 2W8KA 1UMJA 4AT1B 3HD1A 2E66A 4XIUA 3N5FA 2V5HG 3VAGA 5KG1A 4RBUA 4TNOA 1FFGB 3DRRA 1KDNA 3D68A 2B6AA 1YRXA 2A3JA 4I2QB 4LRDA 3Q8UA 3BYPA 1S97A 1FTRA 2BM0A 2Z0GA 5IXUA 4L6V3 2QE5A 1SJFA 3BR9A 2GMJA 5LOQA 3HSJA 2Y1RI 3QFWA 1DLOB 1OQ6A 3QGGA 1RT2A 3OHBA 2N7CA 4IG0B 1FEEA 4ECRA 2HPUA 2PFFB 3J81U 4HT5A 1F2HA 1EETA 5DQIA 3OFEA 2RDJA 3NKYA 2DISA 4RNMA 3CMAS 5CQGA 1YRUA 1HWLA 4XDDA 4C2MA 3GIMA 2QJ3A 2RQCA 1NMEB 2RS8A 3HHNB 3O3LA 2HQGA 2MLYA 3K89A 1FO1A 1NK8A 2QL5B 4YHHJ 3ENWA 4USHA 4Z7YA 4PWDA 4U6PA 4GRSA 2ZBCA 4NLRA 1FKOB 1SQGA 1Y7PA 2FJWA 1RK8A 4WU2A 3CCSS 3EZUA 3CD6S 3BGOP 3EYZA 3FBBA 1U48A 3RBEA 1IM6A 3TAPA 3GIRA 2FZGB 4NXMJ 3A8EA 1S1WB 4O44A 2QIFA 2DNZA 1CULA 3CJKA 3CF5Q 2CDRB 4RUBA 3CCZA 4FF4A 5DDOC 3I9ZA 1SH2A 1DURA 1XNQF 2QL7B 1N33F 4M5JA 1NO8A 4A8QA 1NDPA 2CIMA 1XERA 3HT3A 2PO4A 4KY3A 2QTWA 3MEDB 5LXRA 5CD4A 1VQ7S 4LF5F 3ZXWA 2KHCA 1R6VA 4C0HA 1N34J 2ADCA 2BE7D 4ZVEA 4QBUA 2VDHA 3MEEB 2P6TA 4DF8A 4QIWD 3I5CA 2CQBA 3R5JB 1CJKA 2AGPA 2DRBA 1LK5A 2AJ2A 1F6TA 3CDBA 1U1PA 2VODA 1RI7A 4K0KJ 2LKZA 2MKSA 4M63A 2FGCA 2VKRA 4M5IA 3N28A 1SV5B 3N4WA 2KJVA 4EBDA 4J7CA 3LF0A 2AJFE 2EG1A 1H6KX 2C28A 1FXRA 2Z8QA 3Q22A 5GAHU 4QOTA 3PEHA 4RUCA 4B3SF 3EZOA 2EPIA 2PD1A 3LW5C 2VH7A 1YI2S 4ID5B 2HNYA 2JL9A 4LF8J 2DNOA 4GKJF 1NHUA 4DV2J 2LLZA 2AYGA 2AF6A 2C3YA 5KFRA 3PR4A 4DFPA 1UEVA 4C8LA 3R9LA 3QBCA 2DHGA 1Y3KA 2KT2A 5KT2A 1PC4A 2IVMA 1U7LA 1DLOA 1RTZA 4IG0A 5JVGQ 3W5ZA 2MJNA 1SUQB 3GYXB 2H3EB 1K9MT 2FLNA 2C3OA 4ZHRB 1VC5A 4WIQA 1R8CA 1U26A 5IT0A 1XK8A 1YJ9S 1Q1KA 1TL4A 4HTIA 4NI2B 4USWA 3DRPA 3OBIA 3TVKA 2GMLA 4DUTA 4HACB 2V34A 4PYDA 4QR1A 3OVAA 2EFPA 3QAUA 2O5DA 2UP1A 4ECSA 5BR8J 2ASYA 3KKFA 2AJ1A 4DR1F 1M1GA 2MDAA 2KVQE 3RW7A 2XQCA 2GQQA 3TA0A 1TZ0A 2MZQA 4QU7A 1FNMA 4HEA9 3A8IA 2BW7A 1GMWA 3CPWR 5DLGA 4DR3J 1TAQA 2EBEA 1U2CA 4MKYA 1NKCA 2XEXA 2KFZA 1FDNA 2YXLA 5CXTA 2RD5C 4P2MA 2E1RA 3HXMA 1HMVB 4OZ2A 3P49B 4LF1A 2DNPA 1DRZA 3MUMP 5DETA 1NK7A 2Z2YB 3HHLD 4JV5F 4KJIA 4ECVA 3OUYA 2M8HA 3ZZTA 2C3UA 3MEDA 2DK2A 4ICLB 1YJRA 3F44A 1P9YA 2I8EA 1VQ5S 1UCNA 4KPYA 5L46A 3RTVA 3MEEA 4DX7A 3HKZD 4ZN1A 3L3CA 3F41A 3V6KA 2VFSA 5GMKa 4UW2A 1U1QA 4DX8H 2EWHA 3M6VA 2CPYA 4UY8T 4DN9A 3BKUA 3BPDA 3F0NA 4F4ZA 3A3PB 2KVIA 2MKKA 2QV6A 4FXVA 3ZZPA 4PXDA 3ZZUA 2Z2LA 4AQYJ 2HZAA 5GMEA 2P9EA 2ZNZA 1BXNA 2Y8WA 1YJNS 1FVSA 4WXOA 3ZZOA 4YMEA 4HHJA 2DNNA 2WBRA 1JLQA 4ZKAA 2EC2A 5H9EK 2HAIA 4DPUA 1KHWA 4K4SA 3IXQA 5H9EJ 2CPEA 1PIEA 4DWIA 2IDEA 1YHQS 1RBLA 2BZ2A 3CJ4A 3CW2C 3HFVA 3IRXB 2ZH9A 3QWUA 4ECXA 4F3OA 4DV5F 2BA9A 4NL5A 4K4VA 1IBMF 1CEZA 2KYZA 5JUMA 3CO0P 5HJXA 3LP2B 1GNKA 3N6NA 1HYSB 5B08A 5A8WB 2HHHJ 2ASDA 2DGXA 4ECWA 2JC0A 4KGVB 2LCWA 3I5BA 1YVFA 3JTOA 3T5KA 1SUQA 3CE8A 2WVDA 4QWDA 1MSWD 2MXYA 2YWGA 2YKNB 1S0MA 3RW6A 1SVDA 1F5CA 4OI2A 2E5LJ 4NI2A 3M6WA 2F4VF 1WTFA 3K0JA 4HACA 1QM9A 1RTDB 2YKAA 3POTB 4DZDA 2Y0SD 1RISA 3T6JA 2DRDA 2I5JB 1H2TZ 3PIPQ 4JI4F 5KG5A 1IBKF 3I96A 4K4UA 4OV6A 3R5BA 1FDBA 2NXUA 5KFTA 4QW9A 1TKXB 3QNWB 4NLXA 4O0IA 1CVJA 3TUJC 1LQ9A 2CVEA 3FRZA 5GMDA 4FYYB 4NZ7A 4DR2J 2GFFA 2HBQB 1HMVA 2H9ZA 2C2EA 1RA6A 1RB0A 5ETSA 1BHNA 2UU9F 3QRRA 5CCLA 3RBZA 1R0BG 2XZTB 5A8KB 1WG1A 3W1YC 4B9LA 7AT1B 2CNOB 1YKWA 4FVCA 2AIRB 4ICLA 4CP5A 1KVJA 2KG0A 1ZTTA 1PO6A 1S1VB 3PFEA 2M2BA 2J6TA 3HSZA 3PRBA 2FVRA 2NCKL 2GJFA 2HVDA 4OJHA 2RSQA 1ZBTA 3W60A 3UVJB 1K1QA 2KTQA 4X4TA 4OZ5A 1UFLA 2PA8D 4DR6J 3LUYA 2DCLA 1B7YB 3R5GA 1S7IA 4DLGA 3TAQA 3G6XA 4TLRA 2GS8A 4CT8A 4TQRA 4CI0B 1HQ2A 3FEZA 1GTEA 1ZPWX 5IT4A 2GV1A 4IKAA 2X1BA 1RWUA 3CDAA 3D66A 3M2VB 4V19X 1X5PA 3UN5A 1Q8BA 1A9NB 4ANCA 4B3TF 2F9JA 3W9HA 1GFWB 3KUEA 2DITA 1JXVA 5D8HB 1QAYA 5D4NA 1DHMA 2WAQD 2GHWA 3IP0A 2KL8A 3LAMA 2AYEA 5HATA 3GR1A 4FN5A 3AXKA 3EGZA 3AD8C 3J7Z5 2JZ5A 4F2SA 4PWWA 4NXNJ 1CBKA 1SKRA 3PRDA 4NX9A 4WBFA 4ID8A 4ECQA 2WVEA 5A8WA 3H25A 4GVBB 4LFBJ 2I1RA 1IKVB 3TP2A 4NPOA 3GV8B 2VG6B 3AXMA 2ZD1A 1D9FA 1RWWB 1TVRB 5ETKA 4NA3A 2CJXB 4DL7A 1FWLA 4YS2A 4V1Ak 3IN5A 4I2PB 2JEFA 3QPIA 1Q79A 3KMSA 4FVMA 4G1IA 4LF9F 1U25A 1IUJA 3K5LA 4ZK7M 4TY8B 3NS5A 4YEAA 4ZVUB 1D3WA 4C98A 1NJXA 1N56A 2VV5A 3LWMA 3PFOA 1M5SA 3EXCX 2LYVA 1MMDA 3VVTA 5LL6d 1PYTA 4DFKA 3M8ZA 5KFJA 2CPHA 1RTDA 1FXLA 4CLFA 3MD3A 3POTA 2EFVA 4ZVRB 2CQ0A 3PNIA 5EX0A 3PHEA 2I5JA 4PPZA 3FJ2A 9ATCB 4WTYA 4C97A 3P5TL 3MMJA 4O3OA 1AZSB 2AGQA 5IZHA 2WSFC 1TKXA 1IN0A 3R27A 2JEGA 4C9DA 4B3RF 2DH8A 5T7LB 5U47A 2J6UA 2NZ4A 1VQ4S 1FRIA 2BOAA 2HBRB 1WOOA 5CD4H 3R7SB 2E5HA 3CJTA 2VQEJ 1Q5YA 4JI8F 3C6UB 4KPCA 3QQCD 4PAAA 3RB3A 4NCGB 5E3RA 5A6WA 4OJGA 3TUPA 4DPWA 5A8KA 4R8UB 3MMCB 3IMQJ 3O1LA 5MAOA 2POKA 1U6BA 4TXSA 2ZDOA 1S1VA 1S57A 1NLKL 3NCRA 1UETA 2EKNA 2XSJB 1HHSA 1FJ7A 2DNHA 4V19J 2HHXA 2B4VA 4A8SA 2EI5A 3UVJA 4RPFA 1N4LA 5K20B 4ZVFA 3TJ9A 4F2RA 2H65B 3MAAA 5FD1A 5G4DA 1WF1A 2LEAA 4CLSA 3A3NB 1I94F 1FEHA 2E44A 3M6UA 4ZP6A 2UXDF 3TQ1A 4B17A 3DLEA 5IWAF 1JIHA 2FHJD 2GHPA 4FYDA 4J5OA 2ZHAA 2UUCJ 3V6DB 1X7VA 4DPTA 1XEZA 2H4WB 5ADZA 4Y0FA 3T1AA 4O4GB 2XY7A 2PMWA 3K5MA 1XQIA 1N8RT 3M2VA 1ICEB 4URGA 5B0EA 4HLBA 1NJWA 3CCJS 2MTLA 2JX2A 4F3QA 1S1TB 1K47A 1RKJA 4CNZA 1WI8A 2FLLA 1KR4A 4LR7A 3IWNC 2BJ7A 3PR5B 5F3TA 1KFSA 4IRCA 3Q8QB 5D77A 2PI4A 1IKYB 2EXUA 1WI6A 1HWUA 4C0OC 4F4XA 4B9UA 3TJ8A 3BGLA 1TU0B 3BZQA 4DV6J 4GVBA 2KFYA 1IKVA 3EGNA 3M1VB 1TP7A 2VG6A 3VR1A 4YY3J 2VBYA 1UA1A 1KONA 1PJ7A 2VBWA 1HNIB 1NUEA 4I2PA 4DCJB 3UWTA 4TY8A 1H74A 1KS2A 2XLJA 3GJTB 3ITHB 1FDAA 3MWBA 5ETPA 5ETQA 3CJQA 1HNWJ 4GC7A 3KHHA 3VAJA 3FCWA 1U1KA 2BM1A 3VZIA 3WC0A 1W26A 2GJIA 4AXJA 3RZAA 3K59A 2AJ0A 2JSXA 4OX9J 1QTNB 2KKHA 1S72S 1Z2LA 4UUWA 3CJSA 3DDNA 3CULA 1O8BA 4BBYA 1OY8A 2DH7A 1RTJA 2XS2A 4XAKA 4TU9A 5T7LA 4X4UA 3NLCA 5CABA 4BC9A 4FS2A 4PKDB 1HI0P 4N76A 4OV1A 5B0GA 4ED7A 1L3TA 5HP1B 2H48B 3H40A 2ACMA 3AB2B 2DXFA 1SH3A 4FNIA 3C6UA 1X8DA 2W2NP 2ZJQQ 3BF4A 4NCGA 4R8UA 3QZ8A 1WC6A 1S0VA 3PW5A 3HMJG 3PX6A 3CC4S 2CWXA 4YR2A 1VC0A 1VHIA 1K8AT 2MHNA 3LP1B 3E01B 2NXEA 4WTOB 3R7BB 4WE1B 3GSIA 4KFBB 2MQMA 2XSJA 1C1CB 2I2YA 4JI7F 2CQPA 2R7TA 1WHXA 3MZIA 1NJYA 4OZNA 2ZH6A 2YWHA 2W9BB 1PKUA 1YRTA 3NGTA 3UCGA 4ZP9A 4MYUA 4DEZA 1NZAA 4P2FA 3SI8A 4J9QA 4M5DA 4ZVTB 3X1LB 3RB0A 3MEKA 2CADA 4CH7A 1TFWA 4ZN3A 2DB1A 4QCLA 2Y3YA 3AB4B 4K4YA 2G0IA 5EX3A 2UUAJ 3TOQA 3V6DA 4FYXB 1HR0J 2M52A 2FHKA 4NMLA 4RU9A 1BC6A 3MGJA 4O4GA 2UXBF 2DGUA 3ZTPA 1WKLA 3KJVB 1Q86T 1HI8A 4ED3A 1PG5B 1S4EA 2VBZA 3ZZRA 1VHFA 4H4MA 2ROPA 3HHLB 4IO9Q 3KYLA 2BANB 4LMZA 3PZPA 1X4EA 1N32F 4DR5F 1PBUA 4Y00A 1EKSA 1S1XB 2BABA 3OTOJ 5GAEU 2V4RA 5D0EA 3TZZA 4NCBA 4FF1A 1BGXT 5KT3A 4KAIA 2DHHA 4U67Q 4IOBA 3M1VA 4U8VA 2ZOGA 4JI5F 4OI4A 4Q8FA 1HNIA 3WQPA 2KM8B 3M8RA 4OI1A 5DM7Q 2HFSA 3UFCX 1HPZB 3DOKB 2NUHA 2Z58B 1T3NA 3MI7X 3FEYB 4EYIB 5CYQA 3ITHA 2QX0A 5AE2A 2H54B 1CPZA 5HANA 5B09A 4IO1A 1F60B 2LQ8A 5HMZA 1PSDA 1JB0C 4UOFA 4P2XA 2Z57B 1YBTA 4ZJOA 4L76A 4PUOB 3RGIA 1NRKA 3T5JA 4Y6IA 3B4DA 2UUBJ 1RWXB 2GJ2A 3PKYA 2XMVA 2YKPA 5I4MA 2DVIA 4X62J 3SCKE 1RHJB 2XWXA 4LFAJ 2LEBA 2Y1IA 1ZYQA 4CDIA 5EHHA 4UZCA 3CD0A 2WSEC 3IG1A 5HP1A 1WORA 2ROGA 4OHXA 2A1BA 3DM2B 2VFTA 1W2BR 2C42A 2ZJRQ 3AODA 4UTGA 3CJ2A 3GP9A 3GR0A 2CJBA 2XMAA 1X60A 4L3NA 1H0HB 2R7VA 5A76A 4DG1A 1RHKB 1AROP 4J9NA 3GJQB 3MCOA 2N3LA 3E01A 3LP1A 1I1GA 2HS4A 4WE1A 3O44A 4DR7F 2X7IA 4KFBA 1C1CA 1DAXA 3N0VA 3TANA 5FLXU 2XYGB 3W5YA 4ANDA 4USUA 4MK9A 2KI2A 2MSTA 3NGRA 2NLWA 5T14A 1RSCA 2C2DA 5BYRA 3EX7B 3FFIB 5A8RB 2K7JA 1W2IA 2FUG9 5K8MA 2R8HA 3Q2SC 1TQLA 1N5SA 1Q7LB 2WCXA 3G6ES 3SSRA 1HNZJ 5CZXA 2DNKA 4DCPB 2OPRB 2FIUA 1J27A 4EI2A 2D9OA 5BYSA 3KJVA 4ZP7A 2Y1LB 4I67A 5C42B 1Y4ZB 4X65J 2UV8A 4KHPF 3OD2A 1HLWA 3PW4A 4IDKB 2BANA 4HVZA 4DV7F 3MPUB 2VPWB 2DRAA 1S1XA 3I5AA 2JOQA 3OXFA 3T9NA 2LXUA 3T1HF 5ETNA 4NRTA 3CXCR 1T03B 1VDHA 4ZPTR 4JP8A 3KLFB 2NR0A 1RADB 2N4CA 5IC6B 4KE5A 4CH0S 2R2UA 3QGPA 1HPZA 3DOKA 3QT6A 3FQKA 1WC3A 1U45A 4JOUA 4LFCJ 5CAAA 2ASJA 3T5LA 2H5IB 1F5BA 2HFVA 1B0TA 2J0XA 5D15A 2DH9A 3MCMA 1E6YB 4YR3A 3SXLA 4OFZA 3U02A 3J7YI 4F0MA 5C7PA 3J7A1 3LGHA 5FLXY 3TA2A 4C48A 4KO0B 1JJHA 1KQKA 3H4DA 5CHCB 4KQZA 2EFNA 1QLNA 5JXSA 1WSRA 2R2RA 1G4CA 2W7PA 1CG2A 2ATCB 4NLPA 2FVPA 1N36J 2LQJA 3JXOA 3K8VA 1NAQA 3CCVS 4LF4J 3TYTA 4MKAA 3CC2S 2VZ9A 2XO6A 1L3VA 2ZM6J 1GXUA 2MKCA 5IV4A 3PW2A 2DIUA 2XI2A 2QZ8A 1U4BA 2F7VA 2FJAB 1OWXA 4H4OA 1AA1B 3I0RB 2KM8C 2J5AA 4MFBB 3TRGA 2PT0A 4I68A 2DNLA 2IM2A 5C5JA 4DHVA 2DKOB 1NH7A 1JLCB 2ZFHA 4IFVB 5LMNF 4ATNA 1F9HA 1VBYA 3I82A 4I7FB 2L9WA 1O0PA 4JB8B 4ZCKA 4DUYF 3M8QB 1F9EB 1TL3B 2HRYA 1UVKA 4RLEA 2BE9B 4EMDA 1T3OA 4MMOA 1GX6A 5A8RA 2C22A 5DJBA 4FXDA 1IR0A 1VK3A 1JJ2R 1B99A 2J76E 1WHYA 3D54A 1NSQA 2M9KA 4PEOA 1B3TA 3P4UB 4DQPA 4YFUA 2BRKA 3ISND 2XS7A 2FY8A 2OPRA 3DRXA 3GIKA 5DQGA 3L09A 1CJUB 5C42A 4USTA 1RDRA 5J1PA 3G8SA 1LFPA 4WYWA 3EMTA 2AGOA 1GXLA 1D09B 2J7UA 4IDKA 2M7SA 3RAMA 1GMUA 2MKIA 4WWSA 4JI0F 2F1FA 3CCQS 2U1AA 4F0HA 4O3PA 1KLMB 1YX2A 1MROA 1IBCB 1N88A 3U7JA 2EBGA 4TU7A 4RW8B 3G9CA 4B02A 4RWXA 4J9OA 3S7RA 2FD2A 3KLFA 1KTVA 3G8QA 3KHRA 1UL3A 4ZPCA 2ZZMA 4G3IA 4PG4A 1C0UB 5F41A 3DLLQ 4DOZA 2CNLB 3GYGA 2ZVIA 2B56A 2MY7A 2IYGA 2OI2A 2HQDA 4FDFA 4DSLA 3DLKB 3T5HA 1L3SA 2Z2ZA 2RRAA 4XTTA 1S6PA 4RKUC 2N82B 1VJQA 1JMTA 4C6AA 4TVAB 4NZ6A 4F02A 2ZVSA 4F4AA 2I6WA 4KO0A 1TKZB 3UCUP 5GAGU 3OXLA 5IOLA 5C25B 1JX4A 4QWEA 2BQ3A 1LWCB 2NYIA 2XULA 2IBOA 5KFYA 3HVAA 3EVOA 2FJBB 3G82B 4ZVHA 4WP3A 4KKOB 2RDDA 3K58A 4DSIA 2G0JA 3ZFVA 1Z2ZA 4CM0A 4DPOA 4C8KA 3TUIC 2FPHX 4ILMA 4ILLA 2BE2B 2AMCB 4DFJA 3I0RA 1UEKA 1XJWB 4MFBA 4JV2A 2PA3A 1S7HA 5L8RC 3G86A 2YNGB 2A0FB 4G6VB 1JLCA 2HK3A 2XHCA 3QAEA 1G1XA 4I7FA 2OGUA 1G7CB 2V67A 2G2YA 3CDEA 2Z4PA 4A8YA 1KD1T 2HVEA 2JLGA 3KLGB 2L41A 3ETOA 3W62A 1FESA 3M2UA 3AOBA 1HL6A 2KT5A 4IH7A 2XS5A 1Q78A 2DR7A 3MM8B 3QO9B 4Y3CA 4Q7AA 4USIA 3TX8A 4YDXA 2CPIA 3MCSA 3CJ0A 2VIHA 3OL8A 2CPZA 1GK8A 1CJUA 3BJYA 1YZ6A 1XNQJ 1N33J 3BQ0A 5KAKA 4QU6A 2ERRA 2BX6A 4UZBA 1VQNS 2AYBA 2XHWA 2EC0A 3NL0A 4LF5J 1C4AA 1RHRB 1N48A 1YJVA 4BC7A 1VBZA 3PYEA 1FX4A 3MR2A 1BUXA 2WSCC 2HVIA 5GADU 2AT1B 3IAM9 1PYSB 1PBAA 3D0GE 1KLMA 1N52B 5M2RA 2DNMA 4YR0A 2HRUA 4ILRA 1DZ5A 4RW8A 1A6LA 3VVUA 3WHIA 1HNXF 4ZOSA 3QZ7A 4ZP8A 1M5OC 3SCIE 5KFXA 3WIVA 2W9CB 2NPIA 4BWJA 2ZH3A 1S4FA 4EBEA 2JNJA 1U0HA 2DD8S 3KLEB 1C0UA 3ONQA 2A18A 4URQU 3BQ1A 3DDIA 4OX8A 3SZ2A 1BLUA 3GV7B 2RNEA 3OFFA 2FZKB 3DLKA 3V4IB 4USKA 1ZA1B 2FHJA 3R3TA 3IBCB 2RUSA 1NK0A 4ED8A 5BYQA 5KOXA 2W9AA 3B4MA 3A8JA 1YDLA 5HVFA 4RU2A 3RBDA 5LJ3Y 2R42A 2N4DA 2HGLA 3HP6A 4B3SJ 3OTEA 1TKZA 5IV3A 4F7VA 3TI0A 1YTYA 4MK8A 3CDUA 1MNEA 1LWCA 1IQZA 4DFMA 3TEGA 2FJEB 4GKJJ 3ET6A 1A7GE 1D1UA 2VG7B 5LM7E 3G82A 3BV8A 5L9NA 3JSMB 4KKOA 1JNRB 2HRTA 3NWGA 3DRSA 2Y8YA 1KVKA 1P1LA 3MM7B 3QJLA 4ZDNA 2DHAA 3I87A 4Q45A 5EWFA 3K17A 4OYZA 1TMJA 1K1SA 1KLNA 1U2FA 1IXKA 1F1BB 3GTYX 3FUYA 3V81B 2WHOA 2JFKA 1AFIA 3PV8A 1TELA 3CCWA 1S9GB 2WZ1A 2W4PA 2VJUA 3FMBA 2YNGA 1ZM3A 3VHQA 4FF3A 4E2FB 4WFAQ 2WVCA 2YVSA 3OV7A 3KK1B 2ZH4A 2B3TB 1U1LA 4I6AA 5THWA 4DR1J 4WFXA 1I3OB 4RBTA 3LOUA 3KLGA 4YP3A 1UW9A 4B08A 2AU0A 1X5TA 2KHDA 3AHPA 2CG8A 3SYZA 1VISA 2ZHBA 2KJWA 4QPXA 3RB6A 5KFGA 2W2MP 2GAHC 2XMWA 1PAUB 2OEMA 3BH7B 3FQLA 3MM8A 3KLHA 3QO9A 2R3VA 3H42A 4N8NA 1VRUB 3QFHA 2XBPA 5DM6Q 1N5YB 2AJQA 5C2GA 4ZLNA 4F4KA 3NGSA 3C16B 2PN6A 3ZTSA 3KG4A 3NY0A 2N3OA 4WXWA 4JV5J 4H4KA 1PJ6A 1H7XA 1RT3B 1HNVB 4F36A 2XZWA 2IYIA 2VC1A 2AJ4A 3F56A 1T7PA 2GO9A 5HSPA 3CCTA 2HWHA 3H5SA 3D2WA 4IR9A 2P5VA 2ZBRA 3GIIA 1TTHB 4K59A 3MM5B 4HHHA 1Q8IA 2LMIA 2M70A 2DHSA 4J9MA 1RP5A 1KN6A 1NPRA 3EE3A 4GC6A 2W9CA 1TMMA 5EN1A 2YKMB 3DRYA 3KLEA 5L1LA 2E5LF 3OLAA 3FVYA 4MK7A 1SQFA 5DGAA 1RT6B 1FNXH 3ZZZA 1PJ5A 4PPDA 2CQ3A 3PO5A 3V5RA 3K5PA 3V4IA 5KFLA 3NBPB 4OYXA 3DRRB 1QVGR 4ED5A 2BYCA 1Y5LB 4LRAA 3ETMA 2AX1A 4H4KC 1FCAA 3UR0A 3CO9A 3SQGB 1VQPS 3P45B 4PYAA 1AT1B 1UVLA 3FEXB 4HDHA 1D9AA 2J0SD 4N5SA 4DV5J 4D3GA 4J9UE 1IBMJ 4U9RA 2VG7A 1RWMB 2ACYA 3AH6A 3W5XA 3JSMA 3D9BA 1RBAA 2M0GB 1RWNB 3MM7A 2FHOB 2BKNA 1SKUB 3WIUA 1J2VA 1EJ7L 2ZOMA 1FERA 3LH2S 3UDLA 3JAMU 4WFZA 3CUNA 1NK5A 2C3MA 1JXEA 4Y2KA 4C8OA 1B64A 4C3LA 3R5DA 3MM9A 2B9XA 2YNFB 1VFJA 2F4VJ 4PWDB 5K9FA 3O6QA 2OHDA 3LWLA 3DCAA 1NB2A 1Y9OA 3GWCA 4UQGA 2Y0BB 1R27B 4OYPA 3P6YC 2ZH1A 3MUTP 3IRWP 1AW0A 3FBCA 4HT7A 1IM4A 4GO5X 4JI4J 2KZMA 2MLZA 2EG2A 3L7UA 2WK4A 2VD3A 2QEXS 2YH0A 1IBKJ 2E7WA 1JLEB 3UCZP 2F63A 2L9NA 2CYYA 4Y2CA 3WBZA 4OZ0A 1T9TA 3P96A 2VL1A 2YWWA 3P5BP 2V94A 2JWNA 1FJGF 1VRUA 2XM3A 4M95A 3C66A 1N5YA 3C16A 2FGOA 4F50A 3W63A 1EHWA 2UU9J 1JKHA 2CNKB 4RL1A 2QSFA 2WVBA 4QIVA 4CO0A 1RT3A 1QUPA 1HNVA 2XG8A 3V4MA 2RQKA 3H7HB 2GZOA 3P3DA 4U7UD 2GIQA 4OMFG 4W98A 2OEJA 2XC9A 3FNNA 5F8NA 3SSSA 3RRHA 1F2GA 4Q8EA 1RGVA 4N47A 4A4JA 1NB7A 3MM5A 5HO4A 3JSBA 2CXEA 2DGTA 1SC6A 2GVDA 4JYAF 3X3UA 1W25A 4Q0BB 2K8GA 4O3SA 2CZ4A 1FFSB 2J0WA 3IS9B 4ZJQA 1RACB 4P7TA 3JAMY 1V3ZA 2CJQA 1U24A 1RT6A 2GVZB 4DZ6A 3QGHA 1GT8A 5MLCV 2HHWA 2FB0A 2DEJA 5F0WA 2VJVA 4NLYA 1O5JA 1XBWA 1ZS6A 2XB2D 3HO1A 4TU8A 3NBPA 5DO2A 3VWSA 5E7OB 3PM9A 2KRBA 4MIBA 2HNYB 3HDSA 2C2NA 1M0SA 2Q6BA 3MURP 2NPFA 3SQGA 2CQDA 4PQUB 2FTRA 1P1TA 3TA1A 5F8JA 2OPQB 5DZ6A 1TKDA 1TL7B 1HBNA 3M6XA 1DQAA 2VPXB 4ANEA 2G2ZA 1JNZB 2BR0A 3BKFA 2YTCA 4J9KA 3WDOA 4QR0A 1WEYA 2NS1B 1PYOB 1NJIT 3BEGB 4DV4F 4YN3B 1JJCB 1KSPA 3DRPB 5CZVA 1YZ7A 2ZUAA 2BKPA 4J9RA 3U27A 2YQ1A 2QFIA 4LF9J 1WUUA 3VAFA 4P73A 2DHXA 1MN9A 3HVTB 2E1PA 4KR0B 2YNFA 4NMXA 4DCOB 2CRLA 1RQ0A 1VI7A 1SB6A 2RQMA 5IT9U 4LF6F 2IPOB 3QLHB 1WKKA 2IM0A 3UNGC 4CT9A 2PC6A 1UVMA 4X4OA 1FD2A 3FCVA 5FJ4A 2X1GA 1IWAA 2PSZA 5LSRA 3QWPA 5E5NA 2V4JB 1Y10A 2OLWA 4ALZA 2HMIB 1JLEA 1YK9A 3OVBA 5KG0A 4HH0A 3IWLA 3TAMB 3BBFA 4MYTA 3OUYB 4B3RJ 4D3HA 4AL5A 1NSKL 2G2OA 1EARA 3ENVA 1V6HA 4CYUB 3E3XA 1Q0NA 3CEDA 4A8KA 2QT7A 1DY3A 4WFNQ 4JI8J 2CJAA 4GMKA 3CGIA 1XR7A 3ZC4A 1MWQA 4ZS6A 3IC1A 2CFXA 2C2ZB 2HNDB 4FYWB 4WP8A 3HSDA 3W9IA 3GONA 2DCUB 2GCFA 2YNHB 3BS9A 4EZ9A 1IQTA 1B7FA 3NS6A 1S6OA 4HDGA 2YKQA 3CDWA 3AY0A 3PTWA 1UVNA 2M5YA 1VIXA 3GFYA 5LMUF 2DJWA 3NNAA 3J81Y 4NA1A 4DX6A 4Q0BA 3UQSA 1U1RA 4KT0C 3AJ2A 1UJ5A 3AFGA 5G0RA 1I94J 1NHKL 3QRPA 3IS9A 2UXDJ 4C8YA 3B6BA 3JS9A 3GG0A 1N5QA 5IWAJ 1JLQB 4QZVB 1H73A 2HQCA 3W65A 2GVZA 2XCAA 1FK9B 1NXIA 1VQYA 4NLGA 1J5OB 5A2QU 4XDCA 2OSRA 1WC0A 2A2DA 5IT9Y 2O3DA 1FFWB 2B4UA 1MWYA 7FDRA 2ALYB 5B0BA 3W64A 3NNCA 2FLOA 1HBMB 2HSEB 3OFGA 1FX2A 4PQUA 2Z2MA 1SL1A 4PG6A 1U47A 1RAJA 1WDTA 2OPQA 4QIFA 4LRCA 3G96A 1TL7A 2V4QA 1YJTA 1VQ8S 3IR6B 2VPYB 2JC1A 2MGZA 4PG5A 1SI9A 4CNYA 2F8EX 4DBQA 1FRHA 1SL0A 2ZH8A 3CJ5A 4MKBA 2NREA 1RHQB 1IBLF 2OELA 4KHRA 1S48A 1FD8A 5KFPA 3KMQA 2A10A 1KHVA 1PAEX 3GMGA 2LU2A 1XNRF 2HZVA 5K5MA 4CO5A 4XPCA 3HVTA 2BACA 1YSJA 4JI3F 4BDPA 1JK9B 4O0NA 2QYCA 2FQQB 2ZH5A 3FDSA 5KOWA 2DYAA 3AD7C 4O4RA 5AJ3F 3QLHA 3U1MA 1RAFB 4J90A 5F9NA 4RNNA 2MYFA 1KKHA 3BDPA 1NH8A 4IH5A 1T94A 3ISNC 4IOAQ 4M5LA 1P8GA 1CLFA 4DU7A 2V4JA 2XCPA 1EAYC 1GMVA 3AT1B 2HMIA 1JLAA 1L5UA 1BQXA 2R7SA 4W90B 1SC4B 3FKBA 4X4VA 3TAMA 3OLBA 2AP6A 3SFUA 2ZC4A 2IA6A 1WTBA 2HVHA 2C2OB 4CYUA 3PACA 4L75A 3PYDA 2BQUA 4DSJA 1K0VA 4ZPAA 1TL5A 2NSCA 3RAXA 1ZM2A 3GFXA 3Q0AA 3QT8A 5A2QY 3LANA 4K7QA 5L39A 2XNQA 4ZLJA 1FVQA 2HNDA 3HT0A 2VQFF 4KRWA 1TFYA 2X51A 2V8HA 4DPXA 1SKWA 2R8JA 4YB7A 2YNHA 2KH9A 1LOUA 1RLDA 5DDPC 4CM2A 3VGUA 6FDRA 5HMXA 3TZXA 3TEHB 4MAKA 4JI7J 2LQ9A 3I0SB 2DY9A 3EDQB 5KG4A 1QSSA 1KOHA 1HWKA 3UI3A 3QRQA 4P10A 5BXIA 2XGQA 1DARA 5L9XA 1MG7A 3WX8A 1NK9A 1T05A 2HKEA 1ZPVA 1RWPB 2MKYA 1X0FA 5J2QB 2GHVC 3QSYB 1WSVA 2WW8A 2PEBA 1FK9A 5D4PA 3I4PA 1FJCA 1WOPA 2K1RB 2UXBJ 1J5OA 5KT5A 3QMQA 4EGLA 2CQGA 1S9EB 2VA2A 2YX4A 3LPYA 5SUHA 3ICLA 1NCLA 2ZZTA 2ILYA 1HBMA 1WC1A 2HFNA 3GG1A 3R1HA 2XNRA 3LGNA 4WP9A 5KFAA 3P8BB 5DDRC 1ZM9A 2W01A 1N32J 4W4MA 4DR5J 1G6BA 4E98A 4JV0A 5E0OA 2ZD1B 1HWIA 2QGFB 4HH1A 2R4FA 4RW9B 1M1KT 3D3BJ 5ETVA 3DOLB 2F9DA 3H5UA 2B43A 5J2PA 1RUSA 4DS5A 1A0OB 5KFOA 3CWJA 1QY7A 2OMLA 4DN0A 4A8XA 4KSEB 3H5YA 5D0RA 1N6QA 2QA2A 3UDCA 4CO2A 4JI5J 2A2CA 5FDLB 4OHYA 1JJ4A 1T11A 2VG5B 2WOMB 4RO0A 1NSPA 1I51B 3PVXA 1RT4A 3UDVA 2C2KB 1LXJA 3HZGA 2MKHA 2JHEA 2YWFA 1MWZA 1VRTB 4PXEA 4ECUA 1Y5NB 2BBEA 3N6LA 4A47A 1ZAWA 4OLPA 2VA3A 4YQWA 3ILIA 1FRXA 3KTQA 3MPYA 1S0NA 2XO7A 4QW8A 4GO7X 2N7YA 3DC2A 4LF7F 1U8SA 3SCLE 4N77A 2EK1A 4FXWA 1R0CB 2OIHA 1S79A 4LBIA 1FRMA 4UY85 3CD7A 3PCOB 2IVFB 1KOOA 3CB4A 2JJ4D 1GQEA 5B0FA 3EPIA 2RKIA 3LO3A 3GIJA 5I3UB 3OR2B 4ED2A 5KFZA 1CC7A 4CLLA 1X9SA 2DEIA 3CCLS 1DQ8A 4A8MP 5T41A 4OYAA 2KXNB 2UXCF 4F0KA 3MAAB 3MFHA 2Q6CA 4F4WA 2CPJA 4DR7J 2HFOA 2HHTA 2NSBA 4WPAA 3DLEB 3I0SA 2BJ9A 2F65A 1D8YA 4OYMA 3C14B 4CLZA 2WONB 2X3GA 5M2PA 2DR8A 2ATLA 3U1NA 3W2WB 3B54A 3PW7A 4DSFA 4LF2A 4OI3A 4JI1F 3VCDA 1FRKA 2LXIA 1RA7A 5J2QA 2VF3A 4ZLPA 1IKXB 2HG4A 2B5JA 2CQCA 2KXHA 5DLFA 3D6HB 1EP4B 2ZBQA 2W7AA 4PR6A 2K1RA 2NUUG 2QRRA 1BMQB 1YWXA 1S9EA 5M2UA 2MZRA 4I0WA 4QQBA 4Q44A 4G1PA 4ZVSB 1VQOS 4ZITA 1X9WA 4KHPJ 1LWFB 1U8WA 2QMUB 3V6JA 4A8OA 2DO0A 1Y11A 2VFRA 1SKSA 3W8PA 3MFIA 2IVYA 2EFQA 5K8NA 4DV7J 4J9LA 4DV1J 2GX8A 1N0UA 3MTKA 4CLPA 4RW9A 1XWLA 2JLFA 4ETZA 3T1HJ 3DOLA 1R3NA 2CQ4A 2MMYA 1SC1B 2R7QA 2OTLS 1Q53A 2RQ4A 3OVSA 4KIAA 3JYTB 2HEKA 3K57A 4RUHA 1QUVA 1RAAB 3AQOA 2H51B 2DT9A 1NKEA 2NXNA 2HIYA 5KTQA 5FDLA 1CS4B 3GJSB 3PG9A 1UZDA 1HQEB 4RNHA 1YLXA 2LDYA 2VG5A 2B7CB 1UVJA 2WOMA 4CQ1A 5F8IA 4DR4F 3IR5B 5C2CA 4WIIA 3K2YA 1GXTA 3Q24A 1R31A 1LW2B 1XMQF 2WW4A 3CCES 4LQ9A 3SV3A 4WCEQ 1VRTA 5BJRA 4OHVA 1HWJA 1NKBA 1RTJB 4MH8A 1KBRA 2K3IA 1WEZA 1X4GA 3L4BC 1FF2A 4L74A 1SBRA 3HI9A 6FD1A 2G0CA 4Q43A 2ALZA 4WZQA 3KOAA 3PEJA 4RR5A 4ZVGA 4K5RA 1K0TA 4A8WA 3Q8RB 1R8AA 2AEJA 4OYIA 4YDDB 3EUNA 1U1MA 2XMMA 2IFXA 1WJ9A 2WVFA 1CJVB 3JSRA 1BE4A 3K5OA 3NGUA 5I3UA 3OR2A 5DG8A 1IJFB 2QG9B 3THTA 4OZLA 5KFIA 2ZBPA 5LXYA 3DDKA 2HWTA 5DGBA 2ZKTA 3L7PA 5DDQC 4IH6A 4U95A 3VAIA 1R0AA 2W4DA 4NLSA 4CLKA 1P9QC 5LMNJ 4M5DB 2XI3A 2CWKA 3DLGA 3WC2A 4DUYJ 3R6LB 3M30B 5KT6A 3C14A 3PX0A 3DLBA 4C8NA 1RXOB 2IRUA 2WONA 1REVB 4QYZK 3W2WA 3A3OB 2EEYA 4OYBA 4QYZJ 1U09A 1WD6A 4DL0C 4OJ1A 7FD1A 4LR9A 1NDLA 3W7BA 3S01A 4OL8A 4FF2A 1IKXA 2UVWA 3M9MB 1FT8A 4H4MB 3I55S 5KG2A 1EP4A 3PY8A 2XY6A 4QR2A 4QIEA 2BRLA 4PQAA 3LA0A 2HS0A 4X4SA 1XMOF 2QN6B 4ED1A 3R2DJ 1X4AA 2OUGA 3Q23A 1LWFA 4R0JA 3GLJA 3VQSA 4IRDA 3GU0A 2RDIA 3B78A 3GCWP 4JI0J 2G9OA 3ENAA 3PJWA 3JQMA 4DV0F 3MEGB 1VMBA 3SQOP 4OI0A 5F8HA 3G8TA 3JYTA 1WG4A 2QLFB 3HFKA 5CYQB 4JI2F 5SZTA 1NJZA 4NLVA 4O3QA 1CS4A 2ZJPQ 1HQEA 3LTOA 3IM8A 4DL4A 1LW0B 3DGPB 5LSOA 3MM6B 1BY9A 5GAEI 2Z56B 2MQQA 4ZVOB 5IC4B 3H2VE 3H20A 5KFKA 3JTPA 3G71S 1LW2A 4OX7A 2EFGA 3DGVA 1VK8A 4EK2A 1H2UX 1LK7A 3BGRB 3BO3A 4X64F 2HGMA 4CH1A 1T02A 2PMZD 1WNEA 5KG7A 4PG8A 3SCJE 4P7VA 3QT7A 1C1BB 5C24B 1S77D 3QSIA 4B9MA 4F67A 3J7AN 1RTIA 3IG1B 1UWAA 1YJWS 4DV3F 1X31C 1S6QA 2F3JA 2H1YA 1VR6A 4DG1B 2GQ2A 2HGNA 2YWEA 1EB0A 1CJVA 1OJ4A 1KEKA 3OL7A 2BJ3A 4ED4A 2RMLA 1HBUA 2E7VA 2BJEA 4CLYA 3MHYA 2K06A 4K4ZA 3DU6A 2KU7A 2XZDB 3EGWB 4N41A 1FJEB 1KFDA 2F5GA 1WF0A 2PMHA 2V2VA 1YJ7A 3OXGA 1RJJA 2HHPA 3CC7S 1U6FA 3KK3B 4RW6B 2IMWP 3M30A 1X0PA 1HKAA 3OJUA 2YH1A 3CCMS 2V2KA 2RF2B 5KFSA 2C3PA 4X4PA 1L3UA 3QJPA 1REVA 1RAEB 3BPSP 4N8OA 4C8MA 3JB9k 2Y9HA 2RIJA 1AFJA 1XMBA 3DLHA 2HFUA 4P71A 3QATA 3UDEA 1B70B 2UUTA 2B4PA 4OI6A 2XTJP 4RNOA 5EGYA 3RAQA 1SJQA 2CPDA 2IRXA 3H4BA 5K14A 2OH2A 2GGPB 3THVA 2BKOA 2UVVA 2R7OA 4DXLA 4RW4B 4IQMA 3SBMA 1RAOA 1UJ4A 1UTAA 2AKWB 2CZ9A 4QWCA 3W61A 4C4WA 1VRQC 5EWGA 4O3RA 5E2QA 4I2QA 1UP1A 3ADAC 1CQNA 2RHSB 2ZUGA 3MR6A 1UEUA 2UUWA 4URSA 2AEFA 2GNKA 3OT9A 2W25A 1ACMB 3MEGA 2YX1A 2IIHA
chains in the Genus database with same CATH topology
4LIRA 1E6YA 4I2PB 3TVYA 2JEFA 3PJXA 5E3CA 3QPIA 1Q79A 1R89A 4N56A 3KMSA 3KG0A 3T3FA 3T6BA 4FVMA 3FCHA 2AX1A 4G1IA 4LF9F 1TV6A 1JWWA 1U25A 1IUJA 2FVCA 4H4KC 3K5LA 1FCAA 3M8PB 5AXLA 5HLFB 4ZK7M 3UR0A 4H54A 4TY8B 3GFHA 2C2RA 3CO9A 3NS5A 3SQGB 4YEAA 1D3WA 3PKMA 4FBTA 2RRNA 1VQPS 4C98A 2MB0B 3M9OB 3GYNA 5B0CA 2VV5A 1N56A 1NJXA 3LWMA 4OIXA 1U1OA 2QSWA 3MUVP 3PFOA 1M5SA 2RE1A 1UVLA 3EXCX 3FEXB 2LYVA 4HDHA 3GV5B 1MMDA 5HQ8A 5L1JA 3D0HE 3NGKA 4DQSA 1QTMA 1D9AA 4F4YA 5LL6d 2J0SD 4N5SA 4DFKA 1AFIA 4W92B 4D3GA 5KFJA 2CPHA 3IWXA 4NYPA 1I6JA 1RTDA 1FXLA 4U9RA 1SXLA 3MD3A 1KQFB 2OAUA 3POTA 2EFVA 1LW0A 4X4QA 2VG7A 2ACYA 5J2PB 3DGPA 4HTJA 3AH6A 1Y00A 3MM6A 3JSMA 4PRFA 4ZPVR 2CQ0A 3PNIA 4J9SA 4DQRA 4QWBA 1LV5A 1JLGB 2M0GB 5EX0A 3PHEA 3M05A 2I5JA 4PPZA 3MM7A 2FHOB 4FPRA 4X66F 1N6QB 3FJ2A 1J2VA 1OO0B 4WTYA 3PO4A 4C97A 3P5TL 2ABYA 2E29A 3MMJA 1FE0A 2ZOMA 1FERA 4M8LA 5B0AA 1DQ9A 4O3OA 3LH2S 3UDLA 3BGRA 3ZZ0A 4WFZA 3CUNA 2AGQA 4DL5A 1NK5A 2HNZA 2C3MA 2HFZA 2WSFC 5JJBA 1JXEA 3OTBA 5IZHA 4U7CA 1FKOA 1TKXA 4Y2KA 4C8OA 2OJ3A 1FHTA 2FDNA 5LJ5Y 1IN0A 4ZPWR 1B64A 5KFEA 3NP5A 5EDWA 3TW0A 5KG3A 3R27A 2L48A 4C3LA 2J9CA 3R5DA 2JEGA 4B3RF 4C9DA 2V8VA 3MM9A 1NU4A 2DH8A 2B9XA 2VFUA 5T7LB 1C1BA 5C24A 1N0VC 5U47A 5F8GA 2YNFB 3MOZA 2COLA 1VFJA 2R8IA 1RT4B 2J6UA 2J9DA 2M8DB 4R5PB 1S1WA 1X5OA 2RH3A 1QSLA 4PWDB 5K9FA 5L1KA 1VQ4S 3O6QA 2NZ4A 3RR7A 1FRIA 2JEIA 4I6YA 4IUFA 1S9FA 1VIOA 4TYBA 2DNQA 5CD4H 3MAQA 2E5HA 3LWLA 3DCAA 4JI8F 4AE5A 1Y9OA 1TL1A 3GWCA 4UQGA 2VOPA 3C6UB 4EEYA 1R27B 4IFVA 3M32A 4H4OB 3RB3A 4PXCA 4NCGB 3B82A 3V6HA 3P6YC 2CJ9A 5E3RA 4ITSA 5A6WA 2D1CA 2X1AA 4OJGA 3MUTP 3IRWP 2ZH1A 1AW0A 5A8KA 1SJ1A 4R8UB 3MMCB 4NCAA 3M8QA 4GKKF 2FJDB 4RW7B 2E9TA 4QYRA 4HT7A 1IM4A 1TL3A 3DXBA 4LVNP 4GO5X 4PCQA 4B3OB 2KZMA 3O1LA 5MAOA 5DQHA 2UUAF 1HFEL 2POKA 2EG2A 4USJC 2WK4A 4NA2A 1FKAF 2RRBA 2VD3A 1HR0F 5K8OA 2QEXS 2YH0A 4ED0A 2E7WA 2AX0A 1U6BA 1HD1A 4TXSA 2ZDOA 1JLEB 1KTQA 3UCZP 1S1VA 4RX6A 5KFNA 1E6VB 3RU0A 2L9NA 2CYYA 3CJ3A 4Y2CA 3NCRA 3WBZA 1UETA 1RT5A 2XSJB 3CIMA 4OZ0A 3P96A 2VL1A 2BOPA 1HHSA 3I31A 1FJ7A 2DNHA 2XWYA 4V19J 4DS4A 2B4VA 2HHXA 3D1QA 2V94A 4NLQA 2JWNA 1V3RA 1FJGF 4A8SA 1VRUA 2DTJA 2W4CA 2EI5A 4B3MF 2R7WA 1N4LA 1SJRA 5L1IA 4NLTA 4M95A 3C66A 5CA5A 1N54B 4ZVFA 3TR5A 4CZCA 1N5YA 4F2RA 1LKZA 1RT7A 5CYMB 3M9NB 5FD1A 5G4DA 2RKIB 1WF1A 2FGOA 2LEAA 4F50A 4ZCIA 3I9V9 2ASLA 3SDEB 1I94F 1FEHA 4EWTA 2E44A 3HHKA 1YGYA 3M6UA 1JKHA 4ZP6A 2HQ3A 2UXDF 3TQ1A 4B17A 1K73T 3DLEA 1RTHB 2QSFA 4HI2A 3OHAA 2KN4A 4RW6A 3KK3A 5IWAF 1JIHA 1Q81T 4QIVA 4CO0A 1RT3A 1QUPA 1HNVA 2XG8A 3V4MA 1IKWB 4F3MA 3MMAB 2RF2A 2RQKA 3OTOF 3C6TB 2FHJD 2M88A 3P3DA 4I6WA 2O66A 2GHPA 1V9OA 4ELUA 4FYDA 2IHR1 2GIQA 2QO3A 4J5OA 4OMFG 4ES2A 3KHLA 1BQMA 2ZHAA 3PW0A 3V6DB 1VJWA 1X7VA 1XEZA 1VLYA 3I6PA 5D78A 5ADZA 4Y0FA 2XC9A 3FNNA 2V9WA 2FY1A 1X4HA 2VOOA 5F8NA 1DBDA 1R7IA 2HVZA 2Q1LA 3T1AA 5HL7Q 2VONA 3SSSA 3RRHA 1SV5A 1F2GA 4Q8EA 1RGVA 2EKYA 4O4GB 4N47A 4EUVA 2XY7A 1NEEA 4A4JA 1NB7A 2IJFA 2V0NA 3K5MA 4O23A 1N8RT 3MM5A 1Y5IB 3M2VA 5HO4A 1RYSA 3JSBA 2DGTA 4URGA 1PC5A 2ZE2B 1SC6A 1F0XA 3FSXA 5B0EA 4Z2XA 1MU2A 4HLBA 2LA4A 4C11A 2W8LA 1NJWA 1WELA 4MIWA 4JYAF 3CCJS 4CIOA 2JX2A 4F3QA 1S1TB 1RKJA 2KDOA 3NAIA 1WI8A 3MPVA 4G1QB 3X3UA 4CNZA 1CC8A 1W25A 2FLLA 4Q0BB 1KR4A 2K8GA 4O3SA 2GGPA 2GIRA 2B51A 1L3KA 3GZ7A 3OSPA 3IWNC 2CZ4A 2ZNYA 2V8DA 3UD4P 4DQIA 4EBCA 2J0WA 3IS9B 3PR5B 4Y2MA 4RW4A 5F3TA 5KFMA 4HKQA 1KFSA 4P7TA 4IRCA 3JAMY 1VGYA 2DGSA 5D77A 3Q8QB 1S10A 1V3ZA 2PI4A 1IKYB 2CJQA 1VQLS 1WI6A 2B5JB 2JVOA 4FZVA 4WYLA 1HWUA 1U24A 4C0OC 1RT6A 4ID5A 4F4XA 2IM1A 2AW0A 2OPPB 2DPJA 5KFVA 1MROB 3MPWA 3QGHA 1GT8A 4JBCA 5MLCV 2HHWA 2FB0A 2ZDPA 5F0WA 4B9UA 5AE3A 4ECYA 4NLYA 1O5JA 1R6YA 3BGLA 3W2VB 3BZQA 2J7KA 1XBWA 3PIOQ 5KFHA 1ZAXA 2L9DA 2XB2D 3HO1A 1V3SA 4TU8A 2KFYA 3NBPA 1IKVA 1YJUA 3EGNA 3TVZA 3M1VB 1TP7A 5DO2A 3VWSA 2VG6A 3QJJA 3CCRS 3VR1A 2UUBF 2VBYA 5J2NA 1KONA 5E7OB 1UA1A 2VFVA 2VBWA 2J6SA 2B9YA 2D74B 3PM9A 2KRBA 4MIBA 3DU5A 2HNYB 3JTNA 1HNIB 3Q8SB 4I2PA 4LUBA 4X62F 3BREA 3HDSA 1M0SA 4WKYA 1VC6A 4YB1P 2Q6BA 3GSDA 3UWTA 2Q66A 3M8PA 3MURP 5HLFA 1NHVA 5DS7A 2NPFA 1T8EA 4TY8A 5DRKA 3GFZA 3KFWX 3KNGA 4DSKA 3SQGA 4LFAF 4ZHRA 1KS2A 2XLJA 1CQMA 1R8HA 2CQDA 4TKTA 4PQUB 2BQRA 3NGDA 3J7ZT 3EZ5A 4RUAA 4P2SA 5I3QA 4Q5VA 2QLXA 3ITHB 2FTRA 1P1TA 3TA1A 1FDDA 1S6PB 5KFQA 1FDAA 2CVIA 4AXIA 2KFNA 5F8JA 1BD6A 2OPQB 3DHXA 3MWBA 1TKDA 5C25A 3K7RA 1HBNA 4ECTA 3M6XA 1DQAA 2VPXB 5KFDA 4K50A 4GC7A 3T1YF 4Y2IA 1JNZB 2BR0A 3S8SA 3KHGA 3KHHA 3VAJA 3HKWA 2YTCA 1U1KA 2O01C 2BM1A 3VZIA 2DNYA 4E8UA 4J9KA 3WDOA 4UQTA 1JLGA 2MQLA 4QR0A 3WC0A 1WEYA 2DGOA 2GJIA 5IQQA 5KG6A 4AXJA 2NS1B 3OJSA 2WBMA 1Y0HA 3IGNA 3MAHA 1NJIT 3RZAA 4EU0A 3K59A 3BEGB 1UJ6A 2AJ0A 2JSXA 3MXHP 4DV4F 1XC9A 1KSPA 2E5GA 2KKHA 3DHW