1HYSB

Crystal structure of hiv-1 reverse transcriptase in complex with a polypurine tract rna:dna
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
425
structure length
425
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of HIV-1 reverse transcriptase in complex with a polypurine tract RNA:DNA.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/dna-rna hybrid
molecule keywords 5'-R(*UP*CP*AP*GP*CP*CP*AP*CP*UP*UP*UP*UP*UP*AP*AP*AP*AP*GP*
total genus 90
structure length 425
sequence length 425
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hysB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hysB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hysB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hysB02
2OPSA 4EYHB 3FQKA 1N56A 4NLSA 4KKOA 5KFVA 4WFXA 4IH6A 5DQIA 3TQ1A 1IKWA 2I5JA 3MEGB 5D3GA 3H5SA 1JLBB 1JLAB 4ZP6A 1LWCB 1HQEB 5KFTA 1J5OB 3E01A 4DL2A 1RT2B 2VG5B 4I2QA 4XO0A 2I5JB 3MEGA 4URSA 4QPXA 2OPPA 4ZP7A 3OSPA 5J2PA 4ED7A 3MEDA 4IDKB 3NAIA 3SFGA 5KT6A 1RT1A 3KLGA 1RTJA 3KLIA 3LP2A 1D0EA 3BQ1A 3G6YA 1FKOA 1VRTA 4RW4B 1C1CB 5F8IA 3G86A 4NLQA 2ASLA 1WNEA 3RAXA 1RT1B 3KLGB 4IRCA 3QYYA 3JYTB 3M9OB 5HBMB 1IKXA 1BQNB 1RT4B 3BSAA 4ZP8A 1JLQB 4LSLB 4LQ9A 4DL7A 2UVWA 2YNHB 2AGOA 4R0EA 3NGDA 2C22A 1TKZA 3V81B 1OS5A 3V6HA 4O44B 2W7PA 5KFDA 4ZPDA 5KG6A 3DLEA 2XCPA 3HKWA 3LANA 4IFVB 3QZ8A 4IRKA 1RAJA 3QGIA 5J2NB 4TY9A 3E51A 1T94A 3LP1B 4IFVA 4WE1A 2ILYA 2WRMA 2FLLA 1EP4A 5J2NA 3DM2A 2ASJA 1RT6A 2O5DA 4QW8A 1VRUB 4RNNA 4EYIB 4ECQA 1IKWB 1RDRA 3KHRA 4TN2A 2RDIA 4KFBA 1S4FA 1S1TA 3IGVA 3CJ4A 3GIJA 3BSNA 2OPSB 4YR0A 1SV5B 1DTQB 3OLBA 5KT4A 3QZ7A 1HPZB 5KFAA 3ISND 2WOMA 1MU2A 1TL1B 1S1UB 2W9AA 1C1BA 3QO9A 4NLGA 2FVSA 1QAIA 2VG7A 5KFHA 3QO9B 4RNFA 5KFQA 1XR6A 4ED8A 3RBDA 2UVVA 1S9GB 2AQ4A 1N5YA 1RTJB 1HNIB 2W9BA 3I0RA 1QUVA 4EBCA 1VRTB 4F4ZA 3QLHB 2JLEA 3IS9B 4EBDA 2B6AB 3DOLB 4H4MA 4PQUB 5KFIA 4EO6A 5KFKA 3H4BA 3MF5A 5J2QB 4KHMA 3PR4A 5DGAA 4O3SA 4DG1B 4B3OB 3DI6A 1LWEB 2YNIA 3QGGA 2IM3A 4OL8A 4NLRA 4ZVHA 3I0SA 4DL6A 1T3NA 2XCAA 4YP3A 3EPIA 2C2DA 1T03A 4O44A 1QAJA 1HQUA 2YNIB 4ECSA 4J9LA 1S1WB 1ZETA 1XR5A 2AWZA 4KO0B 5DGBA 3MFIA 4NYZA 3C6UB 5HP1A 4HKQA 3PW7A 1CSJA 5EUHA 4Q8FA 3UR0A 4YQWA 1S9EA 4MKAA 4O3NA 2FJWA 3DLGB 3LP0A 4ECWA 4QWBA 1HPZA 3QIPA 2JEIA 1JLEA 5KG1A 1S1XB 3EZUA 3MR3A 4RW8B 1NHUA 4R5PB 3PW2A 4Q8EA 1C1BB 1LWFB 1S6QA 1GX6A 3GQCA 4H4OA 1RT2A 2VG5A 4I2QB 4QWAA 1FKOB 4RW4A 3QGHA 2R8IA 4MFBA 1JLBA 3IG1B 3ITHB 3M9MB 4PUOA 3BSCA 5J2PB 2IM1A 3MECA 4G1QB 4NLTA 1UWBA 2D41A 4IOBA 4NRTA 2V4RA 3DOLA 4PQUA 2FVQA 4ZMMA 1HQEA 3ICLA 1LWEA 3OHBA 4DL4A 3I0RB 4TQSA 5K14B 2V0NA 3I0SB 5F9LA 3MEEB 3D5MA 2JC0A 4LQ3A 1JLQA 2R2SA 4HYKA 1TV6B 4JUZA 1R0AB 4IH7A 3PJWA 4RW6A 3FSIA 3PZPA 2IAJA 3BR9A 5KG4A 3CVKA 3IGNA 4YR3A 2E9RX 3KLEA 3OHAA 4ECRA 4NLVA 1RT3B 3V6DB 1I6JA 4ZHRB 2OH2A 4WYLA 2YKMB 1MMLA 1RA7A 2V9WA 4ECZA 3M8PA 4ZVGA 4IH5A 5KFCA 2YKNB 3KMQA 4R8UB 1HMVB 5KFLA 3BJYA 1DTQA 2FVRA 3NL0A 4KFBB 5C42A 4I7FB 2WONA 4EBEA 4QW9A 2IA6A 4KBIA 1LWCA 3DDKA 3CDWA 2IBKA 2ASDA 4KB7A 5F8JA 4MK9A 4DEZA 3KK2A 2UUTA 2JEGA 5EWEA 1S9GA 2DPIA 2VG6A 3PW5A 1RTIA 2RKIA 3KK1A 5F8MA 3CJ5A 5C25B 3JSMB 4IKAA 4TLRA 1C2PA 4F4WA 4IRDA 3BQ0A 2R8GA 4M94A 3RAQA 2C2RA 4ICLA 3MR6A 2R2TA 2YNGA 3KK3A 1K1SA 5L1KA 4ECYA 3NBPA 1HNVB 3UPFA 1TVRB 4U7CA 3DOKB 4DL5A 3DRRA 4URQU 5KFXA 5HP1B 3OSNA 1JKHB 3PR5B 5EWFA 4NCGB 1S1WA 4WFYA 4WXWA 2FJVA 4I2PB 2D3UA 5C5JA 5DQHA 3KHGA 3DLEB 4I7FA 1RT5B 3PW4A 3DRSB 1JLAA 3RB3A 1JLFB 5KFNA 3GV5B 2YKNA 2HWHA 3PHEA 3T5LA 1Z4UA 1DLOA 1FKPA 2VA3A 4J9KA 4XPCA 2JC1A 5KT2A 3OL7A 2HWIA 4IG0B 4H54A 2ZE2A 5EWGA 3GIKA 2HAIA 4F4XA 3DLGA 3LP0B 2AU0A 3OL9A 1S1VA 1NNDA 3MEDB 1NHVA 1HYSA 3TAMB 2IC3A 4WXOA 5C25A 4R5PA 1DTTB 3FFIB 3JYTA 1JIHA 4URGA 2FVPA 3DRPB 1YVFA 2OPPB 2WK4A 5KFJA 4J9RA 1TP7A 4X2BA 1RTIB 4ID5B 3FFIA 2QE5A 4M95A 3CJ3A 4RNOA 2W7OA 2ILZA 3CIZA 4QWDA 4KSEB 4Y3CA 5DQGA 3BGRA 3FQLA 3BSOA 1S48A 3VQSA 1RT7A 4Q0BB 2YNFA 5J2QA 2RDJA 1T03B 1QE1B 2OPQA 1LW2A 2OPRA 4KV8B 3RB4A 3KLFA 2HMIB 1TV6A 4YMEA 4GC6A 1S0MA 3DM2B 2R8KA 1LW2B 2OPRB 5KFPA 4IG3B 5I42B 5DG9A 2AGQA 1HMVA 3DRSA 2XI2A 3BREA 3KMSA 1TVRA 1RYSA 4F4YA 3MFHA 3DRRB 4QWCA 2W8KA 2E9ZA 2IJFA 3LAKA 3IRXA 3Q8RB 3LALA 4PUOB 3CJ2A 4IR1A 5HROB 1S6QB 5KG3A 3OL8A 1S1UA 3HVWA 3M8QB 2AGPA 1LW0B 5KG2A 5F8NA 1IKVA 1S49A 1S9EB 4K4UA 4Q44A 5J2MA 4NLWA 1MU2B 1DTTA 1TKXA 3D28A 2WHOA 3MTKA 3QIDA 1SV5A 5KT7A 4IDKA 4TQRA 1S1VB 2I1RA 4J9OA 3H59A 4ED0A 4MH8A 4J9MA 2ZE2B 1S97A 5DLFA 5FDLA 3KK1B 3Q8QB 2BQRA 4G3IA 3DLKA 2AX0A 4DG1A 4B3OA 3NAHA 4H4MB 1RTDB 4G1QA 2BANA 1HQUB 2W9CB 2J6UA 5KFZA 3C6TA 3Q8PB 1IKXB 1BQNA 1RT4A 4ZPAA 4RW9A 1HNVA 4KV8A 2YNHA 1JLGA 4KHRA 4O3QA 5I3UA 5KG7A 1ZTWA 2YNFB 1GX5A 4NRUA 5KFOA 4J9NA 2HNDA 1REVB 2RF2A 3PW0A 2YKMA 3JSMA 3KLEB 4Y34A 3KHLA 4ED6A 1JLEB 3CDEA 3H4DA 4FBTA 3DMJA 2HNDB 2RF2B 4LSNA 4PWDB 5KFYA 5J1EB 1IKVB 1JX4A 1SUQB 4JV0A 4FS1A 4RZRA 3H5UA 1S10A 3HVTA 5DLGA 5KFBA 1D1UA 3Q8SB 3IRXB 1W25A 5KFRA 2RKIB 4EEYA 3KLHA 5F8HA 4IG0A 4O4GB 5L1IA 1C0UA 4RUCA 5KFFA 3RBEA 4Q43A 5KG0A 4TXSA 5D3GB 1C0TB 4K4XA 5EDWA 3BGRB 4K4YA 4O4RA 5K14A 4RU9A 3UQSA 4O3RA 5C24A 1HARA 3NBPB 3GYNA 5FDLB 1TL3A 3FDSA 4DL3A 3DLKB 2IM2A 3NMAA 3GV7B 2JEFA 3V81A 4MK8A 4WFZA 1JKHA 2BRKA 1FK9A 4Y2CA 5JXSA 4IQXA 3T1AA 2R2UA 3V4IB 3TVKA 3UDLA 5F8GA 4IFYB 5CYQA 4FS2A 2IAJB 3HVAA 1RTHA 4RW9B 2XWYA 2E9TA 3V4IA 1IKYA 2ZD1A 3PVXA 4RW7A 2DPJA 3H5YA 5HROA 1SH0A 3M9NB 2W8LA 3CJ0A 1TQLA 3KOAA 1S1TB 3GIIA 4ZP9A 1S0NA 4ED3A 2IMWP 4ECXA 1BQMA 4I2PA 1RT6B 1J5OA 4TY8B 3CO9A 4J9QA 5DG8A 2HNYB 3N6MA 3MR2A 4WZQA 1N4LA 4TY8A 4YR2A 2GC8A 3M8PB 1SH3A 4NLUA 1KHWA 2D7SA 1KLMA 2FLNA 2IC3B 1S0OA 5T14A 2J6TA 2CKWA 4EO8A 4K50A 5HBMA 4MFBB 3IS9A 5KFSA 4ID5A 4K4TA 3RB6A 1TKTA 4MIBA 4RUAA 3KHHA 5J2MB 2GIQA 3HHKA 4IFYA 5CYQB 3KK2B 4WYWA 5L9XA 2XGPA 2VA2A 2IM0A 3TAMA 4K4VA 1N6QB 3DYAA 3MEEA 2B5JA 3GILA 4F50A 3KLFB 2HMIA 4GC7A 2BE2A 1XR7A 3N6LA 4Y2AA 3DI6B 4ED1A 5HLFA 1KHVA 2XGQA 1RT7B 4NCGA 2AX1A 4MKBA 5KFEA 2R2RA 4O3PA 4TYBA 4ECVA 3PJXA 4RW7B 3DOKA 1TKXB 4JV1A 1RT5A 3KLHB 1TKZB 2B43A 1SUQA 1ZTTA 1EP4B 1BQMB 2BR0A 3SI8A 2XC9A 1U09A 5C42B 1LW0A 2R8HA 3SFUA 1JLCB 1S1XA 4NLOA 3HVTB 2ATLA 5KFUA 1C1CA 5KFGA 2HNZA 2WOMB 5KT3A 4K4ZA 2FVCA 1TL3B 1TKTB 3DRPA 1LWFA 2HNZB 5L1LA 2BQ3A 2J6SA 3I5BA 1HYSB 1S9FA 1TL1A 3FRZA 1FK9B 1JXLA 3MR5A 5C24B 2UVRA 3T5KA 3KLIB 3LP2B 3T19A 1IM4A 3RB0A 4Q45A 2C2EA 1C0UB 1SH2A 3ISNC 4JV2A 2VG6B 1UWBB 3H2LA 3C6TB 4KE5A 3LP1A 4WE1B 4ZVEA 2WB4A 5L1JA 3V6JA 2BE2B 3CWJA 2BANB 1S6PA 2W9CA 4FBUA 1N6QA 1K1QA 2ZKUA 5HLFB 3T5HA 4NLYA 2FLPA 4NLDA 1S6PB 3OL6A 1N5YB 2ALZA 3DYAB 5KFMA 3GIMA 4Q0BA 2FJXA 4NLXA 3DMJB 2B5JB 2QV6A 2B6AA 4XPEA 4R8UA 4RNMA 1EETB 5KFWA 4LSNB 1T05A 4J9SA 1JLGB 5F9NA 2JEJA 3H5XA 5J1EA 4NZ0A 4ZHRA 4ECUA 1REVA 2BQUA 4ZVFA 4RW8A 2VG7B 2GIRA 3M8QA 4KO0A 2V4QA 1JLCA 5F8LA 1JLFA 5JUMA 3N6NA 1RYRA 3I5CA 4ZPCA 2HNYA 3EPGA 5KG5A 2BRLA 2CJQA 4U6PA 3G6XA 2R8JA 3I5AA 2F8EX 4J9PA 1FKPB 4MK7A 2WTFA 4KKOB 2UUWA 3T5JA 4MIAA 2WONB 3V6KA 3MECB 2IJNA 4O3OA 3OLAA 1C0TA 4K4SA 3E01B 1RTDA 3QLHA 3GV8B 4WZMA 4H4OB 1IKYB 2ZD1B 2YNGB 3KK3B 3H98A 1QE1A 2OPQB 4LSLA 3IG1A 3ITHA 5KT5A 2UVUA 1RT3A 4NLPA 4K4WA 5CYMA 2EC0A 2XI3A 3H40A 4ECTA 1HNIA 2W9BB 3LAMA 4TYAA 4ED2A 1N48A 5CYMB 1EETA 3KNAA 1RTHB 3KJVA 4PWDA 1R0AA 4ICLB 1T05B 3BQ2A 4RNHA 3IN5A 3V6DA 4KAIA 5DG7A 4ZPBA 3KJVB 3CDUA 3C6UA 3G6VA 3NKYA 4IG3A 5I42A 1RA6A 5I3UB 2D3ZA 3QIPB 2WCXA 1VRUA 4QWEA 3KLVA 4IR9A 1KLMB 4RW6B 1DLOB 2C28A 4O4GA
chains in the Genus database with same CATH superfamily
2OPSA 3R2CJ 3OTDA 1W26A 3VAMA 2CXEA 4DCJB 4NLSA 4DUTA 3K5LA 1RCXB 4IH6A 3GYGA 1FRLA 3H5SA 2I5JA 3HULA 1Q7YT 1NZ8A 1JK9B 2FHJA 3OTBA 1SKUB 1HQEB 2DY9A 3W61A 4E98A 1J5OB 4DR7J 3E01A 4IO1A 2VG5B 4I2QA 4XO0A 2ROGA 4URSA 4WJBA 4DL2A 1XNQF 2HVEA 5L38A 1KWMA 4DJBA 3OSPA 2ZJRQ 4FYDA 4DR2J 5J2PA 2IVYA 4ED7A 2ATCB 4CLUA 1F1BB 3W9HA 1RT1A 1HBNA 1WUUA 1RTJA 1VQSA 3TP2A 4X2BA 4RW4B 1UWAA 4CI0B 1H38A 3G86A 2VFUA 3KG4A 2XG8A 2NSBA 3NNCA 2B4PA 1BQNB 1RT4B 1FXRA 4NPOA 1ZPVA 4ZP8A 2HBRB 3QT6A 4DL7A 2UVWA 1VQ7S 4MKVA 1LWXA 1RHUB 4KHPF 2E7WA 4CDIA 4DUZJ 3IWXA 3V81B 2C22A 1A0OB 3W5ZA 4O44B 1X4DA 2F65A 1QSYA 4X4PA 2OO4A 5AXLA 2NPIA 3DLEA 5KFDA 1FKAF 2LVWA 3LANA 4IFVB 4IRKA 1HBMA 3O44A 1I94J 3R8YA 2FGCA 2XEXA 5T7LB 3MUVP 1UZDA 1T11A 2RU9A 2E66A 3HKZD 5HJXA 2ZUAA 3CIMA 3TRGA 4BCAA 2O5DA 1QM9A 3C3LA 3AXMA 5E7OB 1RDRA 3JSBA 3Q22A 5ITHA 2RDIA 2Y1IA 3G4SS 3IGVA 4V1Ak 1Q5VA 3PM9A 1ZZNA 5LSRA 4DR4F 3W7BA 5KT4A 3W62A 4F3MA 3GE9A 2PEBA 3MCOA 4QIEA 4RKUC 2WOMA 2KXHA 1RWVB 2J9EA 1H2UX 2EBGA 2Q43A 3IAS9 3OFGA 4FVMA 1TELA 1X4AA 4DX8H 7AT1B 4BDPA 2W4PA 2DGQA 4LMZA 5A8KA 2VG7A 3GCWP 1I1GA 1TAUA 2LQ8A 3CW2C 4RNFA 2UVVA 4ZVSB 5HATA 4WFAQ 2AQ4A 1J5EJ 1HNIB 5A6WA 2PI5A 1S99A 1RU1A 4F4ZA 4LRDA 1SIWB 2NR0A 5DDQC 3DOLB 2D1CA 3BS9A 2VFTA 3H4BA 4OYAA 3J7YI 4O3SA 1H7WA 5HMZA 2HFSA 1E6VB 4PG8A 3LO3A 4ZVHA 5LXYA 3QGGA 3CCMS 4DL6A 2VC1A 2BJ7A 3B4MA 1T03A 2CNKB 2X51A 3KUHA 1KOHA 4CO4A 2HPUA 1XR5A 1RAAB 4DQSA 3NP5A 1UETA 1WC4A 2C3MA 3FUYA 4PG4A 1G7CB 2Y8YA 1MWQA 4Q8FA 5D0RA 3VGVA 4YQWA 1S9EA 4P75A 1UFKA 4XDCA 4O3NA 2YX4A 3A4TA 4HI1A 3I56S 3L4BC 4ECWA 3QIPA 2JEIA 3EWGA 1VFJA 1TK8A 3TUPA 3D66A 2PGCA 4RW8B 2MMYA 1X31C 3HDSA 1S0VA 3A13A 4CRJA 4Q8EA 4RWXA 2EPIA 1S6QA 1GX6A 3MCMA 3M4XA 2C2KB 2QYGA 4RW4A 4YY3J 3OV7A 2OEMA 3AQPA 4JV1A 1RWKB 3ITHB 4LF4F 4PUOA 5J2PB 3IWLA 3MECA 3Q86A 4G1QB 4OYBA 4DCOB 5SZTA 1VC0A 2RRBA 5M2RA 3NGRA 1R8PA 1D09B 4NRTA 1Z2ZA 5IV3A 2FTRA 2NPFA 1R7IA 4OV1A 5AJ3J 4JI1F 1HQEA 3CJRA 3ICLA 1MG7A 5FD1A 3I0RB 4TQSA 4USMA 4DL4A 1VBXA 4J90A 4Y2IA 3MEEB 3D5MA 4KGKA 4DX5A 4AQYJ 2R2SA 2GQ2A 4A4JA 5LSOA 2QA2A 4HYKA 1LOUA 1FRXA 4ES3A 4MKYA 1PYSB 1WHVA 2C42A 4QU6A 1X5TA 4RW6A 3FSIA 3PZPA 2IAJA 5D4PA 2AT1B 5KG4A 4NCBA 3LOUA 3H7HB 4G1PA 3ZZRA 4KJIA 3RUBL 2RQKA 3HHLB 3OJSA 1AFIA 1FJ7A 2CVEA 1M1HA 2CWKA 5HK4A 2R7VA 4BWJA 3RYLA 1NB7A 3THTA 4DQIA 3JTOA 3R5AA 1S4EA 3M8PA 4K5RA 5KFCA 2W2PP 1RAHB 2O1PA 3P5BP 1NDCA 3W8GA 5CD4H 1DTQA 1FWKA 3FRYA 2WONA 1NUEA 4EBEA 3BGUA 2HS4A 2IVFB 4CT9A 3HM9A 3Q83A 3MGJA 4Z37A 1NRKA 4MMOA 1WF1A 1M5SA 1VQ5S 3D0HE 4EZ6A 1FNMA 3RRKA 4X84A 2UUCF 3Q8UA 2P9CA 3US5A 2HHUA 3AH6A 2DEIA 1R27B 1Q5YA 4DR6J 1S9GA 4DSFA 1IR1A 1G4CA 4P10A 5CXTA 1U0HA 3KK1A 5LT5A 3EZOA 4WKYA 4OQJA 1WG5A 2XHCA 4CLFA 3CJ5A 4OLPA 1WKKA 3MEKA 2NZ4A 3D6MB 2R8GA 4M94A 3PRBA 3RAQA 4ICLA 1M0SA 3RJMB 2YNGA 3KK3A 1K1SA 1RU2A 2FC8A 1FE4A 1SVDA 2QC3A 5AE2A 2VQEF 5L1KA 1ICEB 3NBPA 4DV1J 3ET6A 1GXUA 4U7CA 4M8LA 3E2EA 3DOKB 2IFXA 3K5MA 3R6GB 5CA5A 1SJ4P 3MPYA 4DR7F 4NCGB 3ILLA 1AUSL 4WFYA 4N7TA 2CDRB 4WXWA 2FJVA 3M2RA 2BW2A 2I8EA 3D6TB 4L3KA 4PXCA 1JLAA 5HN0A 3RB3A 4TVAB 2N4DA 2DH8A 4OZJA 3GV5B 3HCXA 2UUAJ 1F2HA 4NEZA 4KH0B 1FFSB 4CLWA 4Q5VA 5B0GA 2NXCA 3R1HA 1FWLA 2JC1A 4B3TJ 4IG0B 1SQEA 3D3BJ 2XY6A 3CGIA 1NBEB 4W4MA 4LF6J 4ITSA 1J27A 1PG5B 4M1KA 1WI6A 4K7QA 2AJ1A 2YKOA 2OD6A 3QNWB 2B3TB 3FFIB 3JYTA 4WXOA 3A8IA 4FPIA 1TP7A 1RTIB 3IMQJ 2BXJA 4N77A 4CLKA 2QE5A 2W7OA 2Z8QA 3FZBA 9RUBA 4QWDA 3P6YC 2ZC4A 3OFHA 3J7ZT 2G0JA 3BSOA 4CZCA 1RHRB 2MZRA 4EFAC 4Z2XA 2VBZA 1QVFR 2Z30B 4Q0BB 3TZXA 5FLXY 4IOCQ 4CLZA 3RR8A 4KV8B 2R7XA 3KLFA 1LFPA 2MTLA 4YMEA 2AZ1A 3VWSA 2M2BA 5ETLA 4RL1A 3BREA 3NGTA 3T1HJ 2ZH6A 3G96A 2KJVA 4LIWA 3DDNA 3MFHA 3DRRB 2RDDA 4QWCA 2HQFA 2E9ZA 3PX0A 3VAGA 3LAKA 3Q8RB 4PEOA 3LALA 4WP9A 1G6BA 2QL9B 3QJJA 4PUOB 3CJ2A 3G2XA 1B0VA 1NM2A 1VLOA 1VLYA 1HIYA 4DV2F 2E5JA 4J9VA 1S1UA 3HVWA 3M8QB 1UKUA 2V4JA 5AXMA 1YLXA 3W5YA 4JI4F 5F8NA 2ZDPA 4NLWA 4U7UD 1MU2B 1DTTA 2WHOA 2AW0A 4N8NA 4TQRA 2HQ3A 1S1VB 1PIEA 2W1BA 1VI7A 3Q8SB 4ED0A 2IY5B 3A3PB 2EFVA 1S97A 2POKA 5G0RA 2UXBJ 1IVZA 3DLKA 3CPWR 3AD8C 1MNEA 2MB0B 1Q79A 1HHSA 3NWGA 3ENQA 1WD6A 4F7VA 3M32B 2BANA 3M6XA 2ROPA 1QY7A 2RNEA 2L41A 3MURP 2W9CB 1KRPA 2V2KA 3Q8PB 3OTEA 1OPZA 1BQNA 1RT4A 1SIZA 1U2CA 2EXUA 2QMWA 1O51A 4RW9A 1QAYA 3FNNA 1SI9A 2YNHA 3NGKA 5I3UA 2DBBA 3R7BB 2RU3A 4NRUA 1GX5A 4B3MJ 3PKMA 1X4EA 1NJIT 2YKMA 3JSMA 2K2PA 2GVDA 2G2ZA 2O67A 3C15B 3C14B 3PG9A 4Y34A 2VB6A 3SIPB 3CDEA 3H4DA 2EBEA 2HNDB 2RF2B 4A47A 3RAMA 5KFYA 4FF4A 1U1QA 4RO0A 2BE9B 1JX4A 1X7VA 4RZRA 3H5UA 4OJ3A 3DFEA 5K8OA 3HVTA 3RRHA 4JI2J 2YXLA 4PKDB 4JOUA 2VPYB 2B4VA 1W25A 1L3VA 3BDPA 3OFFA 4JI8J 3ETOA 1HBUB 4P2SA 1C0UA 3UVJB 2H51B 1SXLA 4FPRA 4ANDA 4CLYA 2AYBA 1DAXA 4DWIA 4EZ9A 1T3OA 3AB2B 1TL7A 3RU0A 5EDWA 3IRWP 1U1NA 2RSQA 5K14A 1GXTA 1BWVA 2MSSA 2OLWA 1T3NA 3MAAA 3G6ES 1SL1A 1X5PA 5C24A 1HARA 3NBPB 2FIUA 2JSXA 3CEDA 1TL3A 3GYNA 4P2MA 3WC0A 2DNYA 4DL3A 1V5VA 2JEFA 4MK8A 3DGVA 1QAXA 1P6TA 4ID8A 2BRKA 4Y2CA 2UXCF 4X4TA 1KQGB 1PBUA 4PZVA 5F8GA 4DFPA 2HHXA 2WSEC 3K5OA 3TEHB 2IAJB 3HVAA 2XWYA 2APOA 2E9TA 2EFQA 3BYPA 4RW7A 1XERA 2GAHC 2DHSA 2XMWA 3H5YA 1SH0A 1XMOF 1WG1A 3TZWA 3BO2A 5GMEA 3TOQA 3V4MA 2HBZB 3A3NB 4ZP9A 1S0NA 3PY8A 2GVZA 1J5EF 1NMEB 2XSJA 4ECXA 5H9FK 3QT7A 2MDAA 2XZDB 4ELVA 2PMWA 4TY8B 1RABB 3CD0A 2LKZA 1FRKA 4ZKAA 3CMES 1H2VZ 4I56A 3CC4S 5FIIA 5BR8J 1CJVA 4OX9F 4WZQA 1N4LA 2H9ZA 4YR2A 4TLQA 4OYPA 4GKJF 3M8PB 1J2VA 1WI8A 4KQZA 4CH1A 3QATA 1KHWA 2D7SA 4CO3A 3ILOA 2FLNA 1SJQA 2CKWA 2EI5A 1XNQJ 1KQSR 3UCGA 5GAEU 2ZM6J 3BGFA 4MFBB 3IS9A 1PYTA 3D1QA 4NI2B 4Y2MA 5KFSA 3TO8A 2J7KA 4K4TA 4DUYF 3RB6A 1XWLA 1ZAXA 2C2MB 4IRDA 2GV1A 2F1FA 2RT3A 5J2MB 1RADB 2CRLA 3A8KA 2B9EA 2CWXA 4LJMA 2QRRA 4P71A 4WYWA 2QO3A 3VV2B 1TUVA 3MUTP 4K4VA 3DYAA 5IZHA 2LEBA 4DV0J 3MEEA 1NCLA 2BA9A 2D9PA 2X1GA 2HQGA 3GILA 1R8HA 3EXYA 3KDNA 1F5AA 3ZTSA 4DV4J 2FQQB 2ZZNA 2D69A 3LPYA 2Y0BB 1B3TA 1T0TV 5I3QA 2XGQA 5L46A 2DNMA 2PIIA 5KFEA 2VC0A 1IJEB 4O3PA 4DV4F 2YKQA 4C8ZA 5FJ4A 1HI1A 3JXOA 2H65B 2ZHBA 2P8IA 1RT5A 3KLHB 2MQNA 2PD1A 1ZTTA 2OSRA 4DV6J 2XSJB 3IBWA 1PC4A 2BR0A 2V8DA 2XC9A 2CQHA 5C42B 1WG4A 5BYQA 2V8VA 1LW0A 5ETKA 4U7UK 4DV2J 2KFZA 3TYTA 4OHWA 4X62J 3HVTB 2MQLA 4K59A 4OI6A 3R9LA 4BLGA 2ATLA 3BB5A 2HNZA 4C8OA 2B4OA 2WOMB 2BBEA 4LBIA 3HT0A 2FVCA 4HHJA 1PSDA 1N36F 4JV5F 1LWFA 3QMQA 3AODA 5L1LA 1HYSB 2YH1A 2J9DE 2J7WA 3QAEA 4BHQA 2ZITA 2CPHA 3TUJC 4S0MA 3UD4P 1Q81T 4J7CA 4C9DA 5C24B 4OZ5A 2UVRA 3KLIB 3LP2B 1QD1A 1X5OA 3ZZZA 8RUCA 3BO4A 5HANA 3OVAA 1U2RA 3GSIA 4F0KA 5H1SV 4OHYA 2HEKA 2DH7A 2HVDA 2RAQA 3N0VA 1S7HA 5L1JA 1HI0P 4FBUA 4UY8T 1TMMA 2BANB 1S6PA 2W9CA 1XC9A 4C8MA 1K1QA 1F9FA 2WSFC 2BJ3A 2CPEA 3CJQA 4C97A 3UDCA 5CYJA 2ALZA 2NYHA 5IQQA 5KFMA 3GIMA 3MMCB 1RAFB 2HZAA 3AOCA 2I6WA 3T6BA 1S57A 1CC7A 4R8UA 1OY6A 5E3PA 2NUHA 3WZ0A 2AYEA 2EFOA 1SKWA 1YZ7A 5IWAF 3ZZYA 4ECUA 1H74A 4DI6A 2DNRA 3JAMU 3SZ2A 3KTQA 3M8QA 4LF9J 1D9DA 2UUBF 1RYRA 1S6UA 1K0TA 3EPGA 5GVQA 2E1RA 4D3HA 3I5AA 4KHPJ 2UUBJ 1KNZA 2WTFA 4MK7A 2LQBA 3BPSP 3MECB 4YFUA 4K8RA 3NWRA 1TL7B 3TVZA 1AXQA 3GMGA 1IQTA 4MYTA 1VK3A 2GGPA 2ZJQQ 4HL9A 2YPYA 5F0WA 4X64J 4QCLA 2XLIA 1U1OA 3SBMA 1VCTA 2GAGC 2WSCC 5A76A 5B08A 2ADBA 2H4WB 5AE1A 2RRAA 1NPKA 4RPFA 1RT3A 4NLPA 1XQIA 5CYMA 2W7AA 3GB0A 2CJAA 2DNPA 2XI3A 2IIHA 4QIVA 1MROB 3VHQA 2W9BB 3DN9A 2W25A 3L7UA 4ED2A 1X4FA 3MD1A 3T6JA 3KJVA 4FYYB 1R0AA 2OFGX 2CPYA 4DCPB 3N5BA 1T05B 3BQ2A 2DGUA 1HNZJ 1Y5NB 3C15A 3E8OA 3I32A 1AUDA 4ZPBA 3KJVB 1F0XA 4WP8A 3C6UA 2LU2A 4CQ1A 4DFKA 2DRBA 4UUXA 2HYIB 5I42A 1RA6A 5I3UB 4IQMA 4YUDA 5JVHQ 2QSFA 2J9DA 1DLOB 1GMUA 2EC2A 2QA1A 4ZVPB 3TA2A 3GG0A 4FP9A 3TW0A 5MAOA 3PIOQ 4O4GA 2AD9A 5A8RB 4KKOA 5KFVA 1N5VA 4WFXA 1IKWA 3MEGB 4ZP6A 4C3LA 1JLAB 1F3FA 2MLZA 2DR7A 2Y9HA 3UN2A 3EGZA 3UFCX 2OPPA 1RACB 1N88A 5A8KB 4A8WA 2DR8A 2LMIA 2VPXB 2ZZTA 3MEDA 4U8YA 5CCLA 2VQEJ 3SFGA 3PHTA 1MN9A 2YQ1A 3THVA 1RKJA 3KLIA 3LP2A 1D0EA 1Y9OA 1IM6A 1OYDA 1RI7A 1FI4A 3NGSA 4OZ0A 4JI8F 3WIUA 3A12A 1GMWA 2AKWB 5HVHA 1RT1B 1HBNB 3RAXA 1WNEA 4K0KJ 2J76E 3QYYA 3JYTB 3MPVA 4PYAA 3ZNJ1 5HBMB 4B08A 1JJCB 4C48A 1PAUB 2VQFF 2E5LJ 2B51A 1KVIA 2NYIA 4C4WA 1EX8A 5J1NA 2QLBB 2Z57B 1UCNA 1GFWB 2Z2LA 4C8NA 4ZPTR 1X4CA 4LFAJ 3V6HA 4ZPDA 5HQ8A 4C0OC 4KYZA 2XCPA 1NJZA 1NZAA 1RAJA 4TY9A 5J2NB 2AIRB 4AFFA 2FHKA 1T94A 3E51A 3AD7C 3NGUA 3LP1B 4IFVA 1W2BR 2XNRA 5J2NA 1M90T 4KY3A 1RHJB 3T9NA 4DHVA 1VRUB 3W3SA 3GSDA 4ECQA 1N33J 6FDRA 5CZXA 1YJWS 3CJ4A 2HK2A 4LBPA 3MM9A 3GIJA 3G82B 4YR0A 3BSNA 1SV5B 1YZ6A 1DTQB 3HFZB 3OLBA 1WTBA 3R2DJ 2XULA 1HPZB 2A2DA 2MHNA 4LF4J 5KFAA 2M8HA 4OHZA 3ISND 2CDQA 2E7XA 3ILIA 2UV8G 2DJWA 3GR1A 7FDRA 4N5SA 2FVSA 1WWHA 3DRYA 3HJFA 1U0SA 4ZJLA 2J0SD 3U1MA 3QO9B 2IVMA 3GG1A 1XR6A 3KXDA 3IA0A 2WB1D 2JNJA 4EMDA 2X1FA 1S9GB 2DIUA 1RK8A 3GU0A 1L3UA 2NXNA 4NYPA 1QUVA 4DOZA 3G8SA 4ILLA 1AT1B 4OJGA 3IS9B 1IBKF 2B6AB 4WWSA 4H4MA 1IBCB 4EO6A 1Q0NA 4ETXA 2FZKB 3MF5A 4UQGA 2GHVC 3PR4A 4B3OB 4HTJA 2YPZA 3G8QA 1LWEB 5IC6B 1UVMA 4ZVTB 1UEVA 2QTWA 5CD4A 3U7JA 3EXCX 3FC9A 2YNIB 3OVSA 1I5OB 1QUPA 1LV5A 1ZETA 4KO0B 1WTFA 3MFIA 1QVGR 4NYZA 1P1LA 3C6UB 3JQMA 3WQPA 4LF2A 1NJYA 2R7UA 2M70A 1NKCA 5EUHA 4JP8A 2CQCA 2CZVC 3IM8A 3UR0A 1Q7LB 4W90B 2FJWA 3DLGB 3BGOP 2DTJA 3PRVA 1HPZA 4NXNJ 1JLEA 5KG1A 4DMZA 1KSPA 4KGMA 1Q78A 2GFFA 4RLEA 4I4BA 2H5IB 2P6SA 3CJKA 3W2VB 4ETZA 2NSCA 3R7NB 1C1BB 5D0EA 5HSPA 2UP1A 2FD2A 2AJ4A 2MQOA 3KG0A 4DUYJ 2F63A 4NXMJ 1C4AA 4J5OA 2VL1A 2KU7A 4YDDB 2VOPA 4MFBA 4DSLA 2PE8A 3OXGA 3NRBA 3IG1B 4CH7A 3M9MB 2RVJA 2IM1A 1YJRA 2KYZA 4YOEA 2KB2A 2D41A 1N5TA 4IOBA 1F60B 4PQUA 2FVQA 1Z2LA 4ZMMA 2JFKA 4DF8A 4OJHA 3RTVA 3EDQB 5CHCB 2QX0A 3MM7B 2F9JA 3F44A 5K14B 2DR6A 2KT2A 3GONA 4HACA 3SXLA 1UVNA 3PX4A 4X65J 3HF5A 1CJKA 2M9KA 2V8HA 3VVTA 5KOWA 3EVOA 1TV6B 5GAHU 2J0QD 1MW7A 2GZOA 2Z2MA 2E5HA 5IV4A 3D2WA 2G0IA 1R0AB 4IH7A 3M8RA 2YKAA 1Z1ZA 4K5SA 4UTGA 3L7PA 3BR9A 3CVKA 2YWKA 3S6EA 2XS5A 3J7A1 3EUNA 2LDYA 2E9RX 3KLEA 1SC4B 1YK9A 4NLVA 1RT3B 1FRMA 3V6DB 1Q8BA 4ZHRB 4UUWA 2ZH3A 3SV3A 4DQQA 2CPDA 2V50A 1MMLA 1JQGA 5HJYA 4LF5J 2V9WA 4B9TA 4X62F 1HQ2A 3FZ2A 5CH7B 2DNOA 2FGOA 2YX1A 1YJTA 4ENOA 1SJ1A 2BZ2A 1FNXH 1WSRA 3KFWX 4K2XA 1HMVB 4EUVA 3CCUS 2R9LA 3BJYA 3LGNA 5A8RA 1UVLA 4CH0S 4KFBB 1DQAA 2A2CA 3M6UA 1AFJA 1FFWB 2IA6A 1PC5A 1M5VC 4IOAQ 4OI3A 2NXEA 3DDKA 4NZ6A 3CDWA 5M2UA 1EAYC 1U2FA 1W7WA 2DGSA 3W66A 4EGLA 3O8WA 3I96A 4DR3F 4WBFA 2FLOA 4X4NA 4JI7J 4DEZA 1KR4A 3SYZA 1TFYA 1MMDA 2UUTA 2CZ4A 1U45A 2JEGA 2KXFA 3RZAA 4LVNP 4L73A 1TUWA 2RH3A 1IWGA 2DCLA 4MJKA 3BQ1A 3WHIA 1NXIA 2DGWA 3SSRA 3UDVA 2XMAA 3TARA 4BS2A 3OVBA 4F4WA 2YH0A 1ZA1B 2W2MP 3MMBB 2YWFA 2C2RA 2HW3A 2KZMA 4OHXA 3SQOP 2HIQA 3ELHA 3LGHA 1U26A 2IRXA 4RUBA 4ANCA 4I6AA 3OUYA 2HLTA 4QR1A 1S6OA 2VIHA 4PG6A 2OI2A 4DL5A 3EYZA 2ZNYA 4URQU 3OSNA 1FVQA 1JKHB 4ES1A 5U47A 1NK5A 1L3SA 2D3UA 2W2NP 4P74A 5DQHA 1LQ9A 1P8GA 2Y0SD 1WOSA 4OZ1A 1LXJA 4ZIWA 2HWHA 2O66A 3PHEA 2I9SA 4HT5A 1KBRA 3KG1A 2ZOFA 2ZNZA 1W2IA 3EGNA 3C66A 3ZFVA 5KAKA 1FKPA 2VKRA 1U48A 3U02A 2VA3A 4J9KA 3I9V9 1HNWJ 3P3DA 5KT2A 4DPOA 2HWIA 3OL7A 4FYXB 4H54A 2X3DA 5EWGA 3GIKA 4NI2A 1VRQC 2HAIA 4F4XA 3OL9A 2AU0A 5BXIA 1S1VA 1A9NB 3QJPA 1TK5A 4CO1A 2H1YA 1SKRA 3GJTB 2DVIA 2CQBA 2FC9A 4YB5A 3ENAA 5C25A 3CJKB 2B9XA 1DTTB 2F4VF 3OQ2A 1YVFA 3DRPB 3NS5A 1HBOB 5KFJA 1R0CB 3TZYA 4JYAF 4CLTA 2CA9A 4ID5B 3FFIA 2BJ1A 5K8NA 4M95A 2ILZA 2EFNA 2WBMA 4KSEB 3LTOA 2VODA 2H48B 1NKBA 2LEPA 2MYFA 1HWIA 2ZH7A 5HVGA 3N9UC 2YNFA 5J2QA 1EHWA 4NL5A 2PI4A 2OPQA 4M5DA 3BBCA 5K20B 1LW2A 3EM1A 3CD5A 2J0XA 3RB4A 3CMQA 1S0MA 3HHNB 4X4VA 2IYGA 4Z7YA 4DZDA 3DKDA 4DR6F 1ZM2A 4WTOB 5I4MA 4L3NA 1IR0A 3GPAA 3HMJG 1TVRA 2H4YB 3BR8A 4ZLNA 1WEYA 1FDNA 2BJEA 2HIYA 2IJFA 1BLUA 2UU9F 3K57A 1VQKS 4IR1A 5HROB 1Y00A 3QQCD 1UA1A 5KG3A 1H3DA 3K59A 1OPIA 2DIVA 3Q2TC 3IC1A 1LW0B 2WVEA 4ANEA 5KG2A 1TU0B 2I2YA 4DU7A 4K4UA 4Q44A 1RAGB 4OFZA 2KG1A 4K4ZA 3GLJA 1SV5A 2KXNB 2K8GA 1F9HA 1NEEA 2V6AA 3MM5B 2I1RA 3H59A 3QGPA 4MH8A 4NE9C 1UL3A 4J9MA 5HMXA 4CIOA 5H9EJ 4LRAA 1ZM9A 1NH8A 3KK1B 2JH3A 5E33A 4C6AA 3Q8QB 4USJC 2L48A 3AQOA 4B3OA 3VCDA 3SQGA 4U96A 5F3ZA 2MKKA 3W8PA 4H4MB 1L3TA 4B3SF 2EKNA 3BH7B 2XYPB 4C11A 3FEXB 4P52A 4FXVA 2R3VA 4P2FA 2MQPA 1VC6A 3C6TA 1IKXB 4ZPAA 2VBYA 1TAQA 2E7VA 3GJSB 3IXQA 2YWWA 2DRAA 2AJQA 2LCWA 3CXCR 3IR5B 4O3QA 4DZ6A 1Q86T 4B9MA 3OXLA 4C8LA 1ZTWA 2YNFB 4J9NA 3PW0A 2HNDA 2RF2A 4I68A 3D54A 2L9NA 5E5NA 4LF7F 2LFVA 2QLJB 1FF2A 2E5IA 1IR2A 5C7PA 1B7YB 4MAKA 1D9AA 5ETQA 5HAOA 4ZDNA 2DKOB 4JI6F 5J1EB 2F3JA 1T02A 2XMVA 4FVCA 1VBKA 5B0AA 5HQMA 1YKWA 4JV0A 5J1PA 2KT5A 2V8GA 3D67A 3M1VA 5LJ5Y 4FS1A 1VQ8S 4JI6J 1CJVB 4UOHA 2GW8A 2VV5A 2QFIA 1WHWA 2L9WA 4P2XA 3HZGA 1PJ7A 2G1DA 1D1UA 1YQHA 2E1AA 3M2UB 3O2IA 1U0HB 4OX8A 5KFRA 4EEYA 2PT0A 4C3KA 2G9OA 2FJEB 4C3MA 2BEFA 2K3KA 5IT9Y 5KFFA 2ZBQA 2VZ9A 4ZVUB 2NLWA 1XTZA 2FJBB 4ZVQB 2ZWPA 2XTJP 4OYMA 1X0PA 1C0TB 3IO1A 5KG0A 4E8UA 3BGRB 5E2QA 3ZZOA 4RU9A 1N8RT 4FZVA 3W5XA 1KC8T 4O3RA 3HFVA 5CQGA 1O0PA 2VFSA 5BYSA 4ZCIA 3MAQA 5JVGQ 3OR1A 1U49A 2MQMA 4HI2A 4DX7A 2VICA 4OYIA 1IQZA 3OFEA 4QU7A 1JKHA 2RMLA 3R1LA 1N52B 1Y0HA 2C2ZB 2ERRA 1PCAA 4K2JA 4PRFA 1HBOA 1GTHA 2VDHA 1KP6A 3O1LA 4RW9B 3V4IA 1YJVA 2DPJA 1K8AT 2RUGA 5HROA 3FEYB 2W8LA 1CQMA 1S1TB 1TZ0A 2MKSA 4N76A 2R7SA 5ETNA 4ED3A 4P72A 5ETSA 2IMWP 4I2PA 1RT6B 4M5MA 1VQOS 2ZFHA 3EICA 1T9TA 4J9QA 5DG8A 2R4FA 1T95A 4J9UE 3S7RA 1HWJA 3R97A 5B09A 4GKKJ 1HD1A 3T41A 1LK7A 2DHGA 2LQ9A 5F3TA 3TVYA 2CG8A 2GC8A 2VJVA 3ENVA 5B0DA 2M5YA 1KEKA 1IBLF 1CQNA 3WX4A 4TU8A 4B3MF 1BE4A 2VFVA 3VR1A 3GYXB 1S0OA 1BD6A 2ABYA 2GHWA 2AEMA 2HVZA 3NS6A 2RHSB 3J7Z5 4TKTA 4ID5A 2BW7A 4UW2A 1N5SA 3J81Y 2DEJA 4MIBA 2CYYA 3QPIA 2GIQA 3HHKA 4IFYA 5CYQB 3KK2B 4N8OA 5ETPA 2W24A 2OTJS 3TA0A 2IM0A 3LF0A 3TAMA 2MZQA 1RHMB 2D74B 1N6QB 2KL8A 3JQKA 4OMFG 2CIMA 2V2QA 1D9FA 1NK8A 2N82B 5ETVA 3UWTA 4B17A 1ZZFA 1YSJA 3MZIA 2AEFA 3KLFB 4GC7A 2BOPA 2OMLA 4FXDA 1XR7A 3N6LA 3HHLD 4ED1A 1HHTP 3CCRS 1NSPA 4MKBA 4NCGA 3NXZA 2R2RA 2DY1A 3CE8A 3K7RA 3H90A 4OYWA 1IWAA 4TYBA 2ZBPA 3L3CA 3DOKA 3A8EA 4ECVA 2B43A 1TKZB 1UFWA 2QLFB 5DRKA 3VVUA 3EJMA 1OIAA 2EKYA 3QBCA 3W9IA 1U09A 3K58A 3RW6A 3OUYB 3K8WA 2V4JB 1XMQF 2V8PA 2A3JA 3QAUA 1UA0A 2R8HA 1UZHA 2HBYB 2CQ1A 2HRUA 3VAHA 4LF8J 2LXFA 4MIWA 1BY9A 1GXLA 4NOHA 5GMDA 4UF4A 1C1CA 4LVOP 1UW9A 1JXEA 4CLLA 2HS0A 1IBKJ 3TA1A 2GJFA 1U7LA 3N28A 3OR1B 1U8SA 2FZCB 1U25A 4HR2A 3A1YG 5D77A 5A2QY 2HNZB 2FY1A 1Q8LA 4LR9A 1Y3KA 1XMBA 3FRZA 3VAFA 2QSWA 2F40A 3QJLA 1JXLA 1RQ0A 1DBDA 3GIRA 1VHFA 1A7GE 1SJRA 3T5KA 1FX2A 1Y11A 2K1RB 4G6VB 1PILA 4MYUA 5F41A 3MHYA 4JI3J 2VG6B 1UWBB 1K0VA 3H2LA 4DF4A 1N32J 2MZTA 4WE1B 1TKDA 4NMXA 3V6JA 3CWJA 4YHHJ 2YWHA 1B4SA 3EZ5A 3CSKA 2Z2YB 4NLYA 4CLSA 1NJWA 4ZLPA 3TJAA 4ZJQA 4ZVRB 3DYAB 3JS9A 2FHMA 4HTIA 2FJXA 1YHQS 1BQXA 1HBMB 1SQFA 3ZTOA 1BMQB 2QV6A 2B6AA 5DJBA 2DHAA 3CCTA 4F4KA 4KPYA 2MKJA 2VONA 5KFWA 1HWKA 4YB7A 1AROP 1SB6A 4ZHRA 1REVA 3OTOJ 1UMJA 2QMXA 3AB4B 2GIRA 4ZVFA 2BQUA 4K0KF 4DPTA 5EGYA 5THWA 1M1GA 4GO5X 3SCKE 1VC5A 2H5EA 3QWUA 1TTHB 5F8LA 3H8YA 1KOOA 3N6NA 4ZPCA 2VQFJ 2HNYA 3TI0A 4B9LA 1GAOA 2IRUA 1VDHA 2BKOA 2XMUA 3Q23A 2F8EX 4J9PA 3F73A 3T5JA 2GCFA 3OTCA 2VUGA 3DLJA 2WONB 3G82A 1ZH5A 1F3VA 9ATCB 1EIYB 2Z56B 4HLBA 2DT9A 3E01B 1NB2A 2XHWA 3K8VA 1TK0A 3QLHA 4X4OA 4MTPA 3GV8B 3H2VE 2VPWB 4H4OB 1IKYB 2ZD1B 1S59A 5IT4A 1KN6A 1P27B 2YNGB 3KK3B 2QMUB 2CQPA 3TJ9A 3NG8A 4LSLA 4CO2A 3IG1A 2FJDB 1UEUA 2HZCA 2UVUA 2BMBA 4F8RA 1OYEA 1WC3A 4YEAA 1WKLA 2GMLA 2EC0A 1XEZA 4ECTA 1HNWF 1B70B 8ATCB 1DQ9A 4LFCJ 2K7JA 3SSQA 3J7YU 2J8SA 1FA0A 3I6PA 4PWDA 2Y8WA 1I51B 2AF6A 2R7TA 1NKEA 3W2VA 2COLA 4I0WA 4KAIA 1VIOA 2DB1A 5AT1B 3RRGA 3CDUA 3G6VA 5LMUF 3D68A 2WCXA 1NHKL 3KLVA 4QWEA 2UXCJ 4PQAA 2C28A 1R8BA 2FJAB 1Q95G 3BF4A 4A8MP 2J7UA 2NXUA 3GIIA 2BKNA 4QYZK 1N56A 2XNQA 5A6PA 2B56A 3WIVA 3TQ1A 1HLWA 3MD3A 2IMOA 3UVJA 5GAEI 1LWCB 3OW2R 4N47A 1RAEB 2NUUG 3GCXP 2E1PA 4LFBF 1P1TA 3MEGA 2OEJA 5K5MA 2AYMA 3DRXA 3OPKA 4A46A 4QPXA 4ZP7A 5GAGI 3HSJA 3GWCA 5DDRC 1NK7A 1GMVA 2IDLA 3HSGA 3MMBA 4AUKA 2A10A 3NAIA 2XBPA 4U95A 1L5UA 4NWBA 2CPFA 2UUAF 1H72C 1FKOA 1VRTA 2OKQA 1C1CB 5KTQA 1FNOA 5F8IA 1RWMB 3D0GE 4JI0F 2RQCA 3KLGB 4LF1A 3HP6A 4C7QA 4IRCA 3HHLC 3M9OB 1EARA 2D3OR 3BSAA 3JTPA 4LQ9A 3IBCB 1R31A 2YNHB 3QFWA 4R0EA 1VIXA 3NGDA 3JSRA 1TKZA 2R42A 1VQPS 1AZSB 1OS5A 1MROA 2XY7A 5KG6A 3ULHA 2GX8A 1RLCL 3HKWA 4A8YA 1SQGA 3QZ8A 3R5JB 4JBCA 2YQ3A 4DV5J 1CULB 4WP3A 2YKPA 4OZ2A 4U9RA 4OI1A 2GNKA 5HVFA 2N3OA 3CCLS 4A8QA 1NU4A 2VU5A 2FLLA 1EP4A 3TNVA 2CADA 4PYDA 1RT6A 1CBKA 1T9VA 2ASJA 3AY0A 2KYXA 4RNNA 4EYIB 1IKWB 3KHRA 3EX7B 3AJDA 3UD3P 1S1TA 2MXYA 1G3OA 1TR0A 2VF3A 3I82A 2WAQD 1K44A 1S79A 5K9FA 2EG1A 4A8SA 3MM8B 1HHQA 2F8HA 1G1XA 1X8DA 1Y10A 4PXEA 1NPPA 4PXBA 1HL6A 2HQDA 3JTNA 3LPEA 5C2CA 4X4RA 2KH9A 1LXNA 1U6BA 1MU2A 1TL1B 1S1UB 1BGXT 4ZIVA 4NLGA 2EW9A 2F9DA 1QAIA 3DXBA 3IFEA 4DFJA 5A8WA 1RHQB 4UY85 4OV6A 3NY0A 3RBDA 5DM7Q 1E6YA 1N5YA 2FPHX 2RUSA 2W9BA 4JI3F 4ED5A 1FERA 2Y3YA 1VRTB 2O3DA 2JJ4D 3ONQA 2WW4A 3CCSS 2JLEA 4EBDA 1KVKA 3A3OB 2KJWA 1NO8A 4PQUB 2BOAA 1T9WA 2GO9A 4KHMA 3UW1A 1FHTA 2B9WA 4RWWA 2ZOMA 1JWWA 3DI6A 4PPDA 2IM3A 2L08A 2DGVA 4HEA9 3I0SA 4NLRA 2JWNA 3VGTA 2R7QA 3K89A 3N4WA 2ROEA 2I38A 4YP3A 1KFDA 4O44A 5IC4B 1HQUA 4ECSA 3D1OA 1S1WB 1LFWA 3DGPB 5DGBA 2LEAA 2XMJA 2FZGB 3NNHA 1KVJA 2QL5B 1CULA 4DSIA 1XN9A 4F2SA 2XM3A 4DR3J 3ZZUA 1CSJA 2MKHA 2ZUGA 3AA8A 4V19X 2AZ3A 4MKAA 5LJ3Y 2ZH8A 3EGWB 3LP0A 1S77D 3QSIA 3T1YJ 3HSDA 4USTA 5IT0A 2MKYA 4OI0A 4LFBJ 5E0OA 3DHXA 4F25A 4Y0FA 1S1XB 3MR3A 1NHUA 4R25A 3PW2A 1VQ9S 1VQMS 1R8AA 3UR3C 2DO4A 1LWFB 2Y1RI 4KGXB 4DV0F 3GQCA 1RWWB 1YX2A 2BX6A 2QIFA 3SCJE 2VG5A 4I2QB 2ZWOA 4QWAA 1FKOB 2CVIA 3QGHA 4I1TA 3TANA 4M5JA 4OZ3A 1VISA 5E3QA 1DURA 1U1KA 2U2FA 4OIXA 1BHNA 2AV5A 3BSCA 3SCIE 2BUNA 1RKIA 1NK0A 2MEWA 4NLTA 1RJJA 4C0BA 2M88A 3CDBA 2V4RA 4M5HA 2LA4A 2MGZB 2N3LA 1GTEA 2AP6A 2GGPB 2GHPA 2RILA 4DV6F 3PV8A 3OHBA 4TU7A 1UFLA 3TAPA 2Q66A 2JLGA 2V0NA 3ZO7A 3EMTA 1FJGJ 2JC0A 4PR6A 2QJ3A 4OX7A 4PXDA 1UVJA 3MM5A 3HX9A 3BBBA 3MAHA 5DDOC 3M6WA 3H2UB 4UT4A 1SJ3P 1K47A 3PJWA 2OTLS 1WC6A 4R0JA 3X3UA 3W1YC 2YVSA 4YR3A 2HHVA 2ZBIA 2HBQB 2ZBCA 1UEKA 1V9OA 1N0VC 2MKCA 1I6JA 1MLAA 5GADU 3GP9A 3UO0A 2OH2A 4CO5A 4WYLA 2GIFA 2MZJA 4ECZA 3IAM9 3R6LB 4F2RA 4ZVGA 4IH5A 4KC5A 4ZPVR 2BJ8A 1CPZA 2FVRA 2J8AA 3BN7A 3SSSA 4QZVB 5C42A 1HNZF 2JRSA 3KWMA 4PCQA 3JAMY 4QW9A 5F0UA 4E0DA 2VJUA 4DPUA 3M2VA 1LWCA 4M5GA 8AT1B 3QT5A 2MLXA 3AT1B 3IR6B 2IBKA 2ASDA 4KB7A 4QR0A 2YQ0A 3QSYB 3WDOA 3PIPQ 4NYOA 4A8KA 1H2TZ 1S12A 2FB0A 3E3XA 3RG6A 4B3RF 3V5RA 3HT3A 1PGZA 4AL5A 3Q24A 2VG6A 3HD1A 3PW5A 2RKIA 2A6MA 3TZZA 3POTB 4WF9Q 1M5KC 1LEOA 5F8MA 2LU1A 2M8DB 1ACMB 5C25B 1UPMB 3D7SB 1RWXB 5JMNA 3MPWA 2YBVA 3SMZA 1RUSA 2HFUA 2A1BA 3BQ0A 3ZZTA 2MQQA 3MR6A 1A6LA 2LDIA 4Q2LA 3F41A 3VTIA 2JOQA 4EU0A 4DV7F 4ECYA 3FSYA 3I4HX 4QIFA 1HNVB 2E1MC 1TVRB 3Q89A 2HWTA 4DV5F 1YJNS 1CS4B 1N0UA 2KDOA 4GKKF 4JB8B 5KFXA 5HP1B 4XAKA 5IXUA 1DQ8A 4AE5A 6AT1B 5EWFA 3PR5B 3LUYA 1ZM4A 1VOMA 5HQLA 2PDAA 2CAJA 3THPA 5C5JA 1B7FA 5IS2A 5D15A 4ATNA 2EK6A 3MWBA 2LP4A 1WF2A 2AYGA 1T9UA 1MSWD 3DRSB 2CJYB 1JLFB 3W2WA 2KHCA 1QTMA 3T5LA 1Z4UA 3H42A 3PYFA 1FE0A 2BACA 1H6KX 7FD1A 4DS5A 4DSEA 4XPCA 1O8BA 1SCJB 2G2YA 4NA2A 2ZE2A 2ZH1A 3LP0B 2QT7A 4LF9F 4M5NA 4LR8A 4DUZF 3WC2A 3H25A 1NNDA 3MEDB 1NHVA 2B0GA 2LXIA 3TAMB 2IC3A 3DU5A 2IJRA 3OT9A 4EO8A 4DS4A 4URGA 3FGVA 2FVPA 1M5HA 2DO0A 4LF7J 2OPPB 2DNGA 2Q6CA 2VPZB 2CQGA 3C16A 4L74A 5D4NA 2AJ0A 4USIA 4J9RA 1SJFA 1JJ4A 5L39A 2XWXA 3JB9k 5DQGA 5MLCV 3FQLA 1VQLS 4DR1F 1CJUA 3QFHA 2PFDA 1T03B 1BC6A 1QE1B 3C8YA 3M30A 3IWNC 2OPRA 2XYGB 4ELTA 3CCVS 4DDFA 4GC6A 4WU2A 3DM2B 2HGLA 2OPRB 3FJ2A 2ZH4A 2R8KA 2F5GA 5I42B 5DG9A 2RS8A 4UZBA 2KFYA 2AGQA 3PEJA 4IO9Q 1HMVA 2PSZA 3CB4A 2PMHA 2XI2A 2JFDA 5KOXA 2G13A 3KMSA 2XZTB 2YWEA 1RYSA 3L9ZA 4F4YA 4RBVA 1VBYA 2XS7A 2PN6A 4ZA1A 5IQ6A 2MJNA 3FBEA 4ZK7M 2UXDF 4OYXA 1WEZA 4UOGA 1L3KA 5B0CA 1S6QB 3OL8A 4W98A 3MXHP 3K5NA 1OO0B 3M8WA 1YG0A 2AGPA 4DSJA 1WDTA 2KRBA 1S49A 1S9EB 2HKEA 4PWWA 3TEGA 4LRFA 4TU9A 2PA3A 1TKXA 3W63A 1DFDA 3CCES 4IDKA 1CJKB 4J9OA 5A0YB 1WC0A 2HHTA 1R89A 2MQ8A 5SUHA 1CVJA 3MM7A 2BJDA 5B0BA 2BQRA 4BC9A 1H0HB 5GAHI 3VGSA 3NEKA 1E6VA 4F67A 4NZ7A 1TUGB 1KQFB 1YIJS 2Y1LB 3NAHA 2QYCA 1RTDB 2DGOA 3BKTA 1FXDA 4F04B 5HMWA 2DGXA 1UJ5A 5LXRA 2JL9A 1HQUB 2KKHA 4FF1A 3PCOB 3J80U 2J6UA 1Y3JA 3CCWA 1WEXA 2DGTA 4WU3A 1RB0A 1WOOA 1FRIA 2KVQE 1F5CA 2RE1A 3FCVA 4RJVA 3Q0AA 3ZXWA 1HNVA 4KGZB 4KV8A 3KJQB 1NLKL 4KHRA 5KG7A 1SL0A 3B4DA 2CFXA 5LOQA 2G1HA 3P4UB 3R5DA 2QA4G 2KM8C 1NDPA 1S9FA 3SEOA 3KLEB 1HW8A 3WX8A 3O5TB 5EHHA 1U1LA 4LFAF 1JLEB 4UZCA 5T41A 4FBTA 4LSNA 2RHQB 4PG5A 5B0FA 1NDKA 4DR4J 5C2GA 4P7VA 1EKSA 3R5BA 4F4AA 2F4FA 3IP0A 3CC7S 1S10A 2Q3PA 1P9QC 1KDNA 2PEHA 1K9MT 2ACYA 2LA6A 4HHHA 4ZPWR 1SPBP 3DXSX 3FKBA 4GO7X 4QPTA 4IG0A 2HSEB 1JJ2R 3MCNA 1DJ0A 4RUCA 3M2VB 3PFEA 4DN9A 1U24A 3UNGC 1F9EB 4Q43A 4TXSA 3PEHA 4USUA 1RWNB 4YB1P 2W2QP 2GO8A 1SC1B 2K06A 2Y1JA 3P49B 2DNQA 2GMHA 4LFCF 2HHWA 4RBUA 1FJEB 4AL6A 1RTZA 1FD8A 5I3PA 2CJXB 3V81A 3TJ8A 1U1PA 2NREA 2H5JB 2RB7A 3EDRB 1FK9A 1UP1A 5JXSA 4IQXA 3PO5A 3T1AA 5D8HB 1YRXA 2R2UA 3V4IB 5D0GA 3TVKA 2KTQA 4FS2A 4AYBD 4X66F 3IBFB 3AFGA 1RTHA 1DHMA 2JVOA 3WBZA 2E5GA 1IKYA 2ZD1A 2JX2A 3PVXA 2HVHA 1CJTA 2AJFE 3CJ0A 1TQLA 4CTAA 1WHXA 4C8KA 1BQMA 2VBWA 4WIQA 3VZIA 2Q79A 2QA4S 1J5OA 4I6WA 1UVIA 1WC5A 5EX3A 3CO9A 4YS2A 1YI2S 1URNA 2SXLA 2VDIA 4QYRA 2HNYB 1VYAA 2ACMA 3N6MA 1ZYQA 2P2CB 2HQIA 3W9JA 1O6XA 1VMBA 1PYOB 5ETRA 1SH3A 1FJGF 1WOPA 4X4UA 1REGX 1SC6A 3KNGA 5HI7A 4FXWA 1FO1A 1QTNB 3RW7A 2EFGA 1FEEA 1PKUA 5BR8F 4RX6A 2IC3B 3GFZA 3M2UA 5AJ3F 2Q1LA 4CT8A 2J6TA 4JI1J 2L3MA 4DX6A 1RZMA 5HBMA 3GJQB 3HHDA 2ZC3A 1NSAA 2N4CA 5HO4A 4DV1F 2IPOB 2GJ2A 1TKTA 3CCZA 5B0EA 5AE3A 1OQ3A 2VH7A 3FBBA 5GMKa 2WZ1A 1N34J 4LUBA 4ZCKA 3LA0A 4Q7AA 4X66J 3L95X 3T1YF 5L9XA 2OELA 2XGPA 2VA2A 4X4QA 1NSKL 3VZHA 4USKA 4LR7A 4CNZA 1PBAA 2PO4A 3PYDA 1HR0F 2HHSA 3DGPA 4NEYA 2V5HG 2F4VJ 4CYUB 3CTRA 2KT3A 2DNZA 4QYZJ 1F2GA 2HMIA 3CJSA 1ZAWA 4YY3F 2BE2A 2GVZB 2DNNA 4Y2AA 3DI6B 2W01A 4L75A 4QQBA 2R7WA 1RT7B 4X4SA 5DZ7A 1R8CA 2XMTA 3G9CA 1KS2A 4AXJA 1RP5A 4RW7B 1HW9A 4WFBQ 1NK9A 4ZN1A 1Q1KA 3D6HB 3UD5A 2F7VA 1BQMB 1JXVA 4J91A 4I69A 2UV8A 1N33F 1FD2A 1JLCB 2VFRA 1S1XA 3M1VB 4U67Q 4NLOA 3VAJA 3H20A 1Q16B 2A18A 4C0HA 1YJUA 5KFUA 1RLDA 1U02A 5D4LA 2BV3A 3BPDA 4OX6A 4XTTA 4GVLA 4DLEA 2ZKTA 1TL3B 1TKTB 3DRPA 1VHIA 1ZA2B 2CQIA 4F0HA 4P73A 3DLBA 2J6SA 3KYLA 3DLLQ 1IXKA 3UCZP 1FK9B 2N7CA 4GRSA 1BUXA 2NZCA 3LW5C 2UXBF 4DQRA 5G4DA 4DXLA 1ZS6A 1ZBTA 1AA1B 4ZN3A 2B8PA 1IM4A 1X9WA 3T19A 1GQEA 3RB0A 4Q45A 1C0UB 1SH2A 3ISNC 4F26A 4DV7J 4KRWA 2HFVA 3OR2B 4KE5A 4ZVEA 1OMSA 2N7YA 2WB4A 2X1BA 1EQ0A 3BBFA 1N6QA 2FLPA 3T5HA 5HLFB 2LECA 2QZ8A 3HJVA 3MR7A 3CNQP 3NCQA 4DSKA 1PAEX 4NLDA 1FT8A 1N5YB 5A2QU 2VHGA 3W60A 4F3OA 3PO4A 5L8RC 2CJBA 2B5JB 2IBOA 1YJ7A 2GVDB 2HRYA 1RXOB 2GJIA 2V68A 2ALYB 4YN3B 4DPXA 4DPYA 4RNMA 1VBZA 4B3RJ 1JB0C 4DR2F 4LSNB 1RBLA 3QT8A 1T05A 4X65F 3VQTA 1TL5A 4J9SA 2W4DA 1M5PC 2JEJA 4NZ0A 1AB8A 3H5XA 3GFHA 1FDAA 2CQ4A 2FHJD 3CDAA 2BE7D 1SC3B 4FNHA 4RW8A 2VG7B 3UN3A 2KFNA 3ADAC 3S8SA 4LF6F 2V4QA 5JUMA 3HFKA 1UPPA 2J0WA 2L9DA 3QRRA 5KG5A 2CJQA 2MGZA 2VBXA 2LXUA 1FKPB 4AQYF 4KKOB 2CQDA 2UUWA 1JJHA 1WELA 3BZQA 4LRCA 5G0RB 2IJNA 4LF5F 4O3OA 1FCAA 3OLAA 3TX8A 3MUMP 4WIIA 2OJ3A 2H3EB 1HR0J 1RTDA 3GTYX 1Q4RA 4CP5A 4K4SA 2BKPA 5ETMA 3AHPA 4WZMA 1GMWD 1WSVA 1E6YB 1WC1A 2C3UA 1EZZB 5A0YA 4JYAJ 1ITPA 3AA9A 3ZNUA 1RBOB 1QSLA 3H98A 1HI8A 1QE1A 2XS2A 2V94A 3ITHA 1VQ6S 2W2OP 4M5KA 3D0IE 4K4WA 5LMNF 4BC7A 3H40A 1FJCA 3MOJB 1HNIA 1H98A 3IM9A 3NS7B 2NS1B 4UQTA 4TYAA 3KNAA 4KPCA 5CYMB 5L9NA 1IBMF 2HG4A 3BV8A 2LLZA 4Q2MA 3V6DA 5DG7A 1FFGB 2ASYA 2EG2A 2XLKA 1LKZA 3D4JA 2PFFB 3NKYA 2D3ZA 4IR9A 1X4HA 1KLMB 3PDNA 3OBIA 2DXFA 1FDBA 2OUGA 1M1KT 5LL6d 1WF0A 1HA1A 3ZTRA 3FMWA 4EYHB 3B6BA 3FQKA 1XJWB 3ISZA 1KQKA 4O0NA 1UJ6A 2I0XA 2W4CA 3QWPA 4FKXA 4ES2A 5DQIA 1NAQA 3G8TA 5D3GA 2FDNA 2HK3A 1JLBB 3KKFA 5EX0A 3RGIA 5KFTA 1N5QA 4N56A 1RT2B 3W65A 2ZOGA 2I5JB 2QL7B 4GMKA 1ZPWX 3M05A 4IYQA 2C3PA 4I67A 2YTCA 1FX4A 4IDKB 4M5LA 5KT6A 3KLGA 2C3YA 2ZDOA 1N34F 3MOZA 3G6YA 5BJRA 2V9KA 2ASLA 2JLFA 4NLQA 1JNRB 3C16B 3EVMA 3HI9A 1NSQA 1KONA 2WW8A 2CUYA 1C4CA 3TQEA 2QFJA 1KLNA 2XMKA 3B82A 1RSCA 1V3SA 3EGVA 1IKXA 4XDDA 4UOFA 4C98A 1HD0A 1JLQB 4LSLB 4OYOA 2FHOB 4QIWD 3TUIC 1U1RA 1T7PA 2AGOA 4HT7A 2K3IA 2MZSA 2DHHA 4YDXA 2ZHAA 5E3RA 1ZAVA 3R5GA 3M6VA 2PMZD 2W7PA 4A8OA 3POTA 1PJ6A 4UOCA 3QGIA 2OAUA 4V19J 1F5BA 2WVFA 2DXDA 4WE1A 2ILYA 2WRMA 2XQCA 2JDJA 1OJ4A 2HFOA 3DM2A 1Y7PA 2CNNB 3BN4A 2Z0GA 4JI2F 1YBUA 4QW8A 2F8MA 1CLFA 2XO7A 1FTRA 4ED4A 4TN2A 4KFBA 1S4FA 2Z58B 3LWLA 2HGMA 2KN4A 2OPSB 3DC2A 5ADZA 1SL2A 4LSZB 1GEHA 4J37A 3QZ7A 4ERDA 4F3QA 4A48A 5H9EK 2HHHJ 1VQ4S 4QJVA 4JV5J 2RRNA 4HHUA 4F36A 2W9AA 1C1BA 3QO9A 2HHPA 2OGUA 2HHHF 1AW0A 4P7TA 1H73A 3O6QA 5KFHA 5KFQA 1YWXA 2EVZA 4HVZA 4ED8A 2XY5A 2RD5C 2V2ZA 4OYZA 1RTJB 4EBCA 3I0RA 3FBCA 4CLPA 3NNAA 3QLHB 4H4KA 4P9SA 2R7RA 2WVBA 3KUEA 5KFKA 5KFIA 4DBQA 5DGAA 5J2QB 5B7WA 2DNKA 2V2VA 4DG1B 4B9VA 3RBEA 3HHEA 2YNIA 1WJ9A 1IBLJ 4OL8A 2AEJA 4FYWB 4ZVOB 3R7SB 2XCAA 3H0PA 2OSQA 2QG9B 3ZTQA 3EPIA 1QAJA 3BM7A 2C2DA 3C2PA 1N54B 4USVA 4J9LA 5DO2A 2AWZA 3GZ7A 4DV3F 4P6QA 5HP1A 4HKQA 2WBRA 2MJUA 3L09A 1UTAA 3PW7A 4JI5F 4WTYA 2G4BA 4NCAA 4ZS6A 3UNYA 4OX9J 1Q8KA 1T9XA 2PC6A 3FMBA 3OJUA 1APSA 3I9ZA 4WCEQ 2MZ1A 2DYAA 4QWBA 3HO1A 1PO6A 3EZUA 5D0HA 4GVBA 4R5PB 3IR7B 2DR5A 2ZEJA 2HLUA 1QLNA 2CQ2A 1NK4A 5GAGU 2ZM6F 4H4OA 3I55S 3J80Y 3M7VA 1RT2A 3CD7A 2R8IA 1VQNS 2CPIA 2QN6B 3MAAB 1YITS 3GFYA 2BDPA 1JLBA 3K17A 3KJFB 4DR5J 4NXMF 3JQJA 2OMOA 2MY8A 4N41A 1KTVA 2CG4A 1UWBA 4ZLLA 2HRTA 4X64F 2VKZG 3DOLA 4NA3A 4O0IA 2CQ3A 2H54B 4PPZA 3O3LA 4LREA 5DM6Q 1LWEA 2MKIA 1JMTA 3I0SB 3AAWB 5F9LA 4W92B 3CCJS 1MN7A 2K7KA 4LQ3A 1JLQA 2EK1A 4B3SJ 1R0BG 5IM0A 3U1NA 4NMLA 1KD1T 2HGNA 4Y65A 4JUZA 1X9SA 3HZEA 1NH7A 1IBMJ 1R6YA 1NPRA 1HWUA 3IGNA 3J81j 1FRHA 1FXLA 2NQPA 2HFNA 4WFNQ 3OHAA 4ECRA 4FNIA 2MHEA 3G71S 1DRZA 3D6FB 3K2YA 5CAAA 2YKMB 3MMAB 1S72S 1RA7A 1U6FA 2VD3A 2IA0A 3S1TA 2BABA 1OSCA 2XLJA 3DOMB 1RAIB 2P6TA 4XIUA 2YKNB 1FWPA 4WPAA 4R8UB 3MM9B 2KM8B 5KFLA 3KMQA 1HWLA 1N36J 3NL0A 3FSXA 4RR5A 4I7FB 2CPXA 1OSDA 1XNRF 1HBUA 1RCOB 2GQCA 5CCMA 3TUZC 4KBIA 1Q82T 3X1LB 1YJ9S 5EN1A 1VS3A 5LMNJ 1FESA 1S7IA 2V67A 1X9MA 4QIGA 3VAIA 4MK9A 4WKRA 5F8JA 1UVKA 4ZCLA 3KK2A 1TL4A 5EWEA 2DPIA 2DNHA 5DETA 1RTIA 1U8WA 4PAAA 1YDLA 4ER8A 2UZAA 2E29A 1I3OB 1ROFA 1U6ZA 2MLYA 3PJ9A 3K0JA 2G0CA 3JSMB 3C14A 3SDEA 4CO0A 4IKAA 4TLRA 1C2PA 2RQMA 1MWZA 2JVRA 2ZHOA 3N5FA 2XSFA 3NLCA 4Y28C 4BBYA 4DV3J 2R2TA 3FBFA 3U27A 3UI3A 4KR0B 3PX6A 3FCWA 2JHEA 3HVRA 1OY8A 2XZWA 3UPFA 5DS7A 3W64A 2HQCA 3TWZA 4JI0J 3DRRA 2QEXS 1WHYA 1YBAA 4OZNA 1UW4A 1T9YA 2AJ2A 3I87A 3MM8A 1S1WA 2AMCB 4NASA 4PABA 4I2PB 1H7XA 1U1MA 3LGMA 3KHGA 3DLEB 3UE2A 4I7FA 3BGLA 1NJXA 1RT5B 1YRTA 3AJ1A 4ILRA 4PG7A 3PW4A 1RWPB 5KFNA 4DR5F 2YKNA 2KZZA 1D8ZA 4Y2KA 1IN0A 2CQ0A 1ZM3A 3BDEA 3SDEB 1R6VA 3QRPA 1DLOA 5FLXU 4CWBA 2E5LF 4D3GA 4F02A 2MPUA 1S76D 4AXIA 1NK6A 3DLGA 2B9YA 3PNIA 2ZH5A 1M5OC 2ADCA 1KFSA 3HSZA 2KRRA 1HYSA 4R5PA 2B8QA 1JIHA 4USWA 4FF3A 2A0FB 4NA1A 1BXNA 2WK4A 3KJNB 3AOBA 3CJ3A 1CG2A 4RNOA 3CIZA 4Y3CA 2QGFB 5D78A 3BGRA 3D3CJ 3ZC4A 2RIJA 1QDUB 1S48A 4DPWA 4OHVA 1RBAA 1RT7A 3C19A 3OR2A 3MMCA 3VQSA 5IM0B 3PRDA 2RDJA 2LQJA 4HH1A 1FVSA 5IOLA 1DZ5A 4I64A 2HMIB 4ILMA 1TV6A 2DXEA 1F6TA 3DU6A 3D9BA 4IUFA 1LW2B 1TMJA 3JSYA 5KFPA 4IG3B 1X5SA 4CTAB 2DR9A 2KO1A 3BKFA 3DRSA 2IHR1 3ET6B 3V2UC 2NXJA 3OXFA 2P9GA 2LYVA 4C8YA 1QJHA 3MPDA 2W8KA 4LRBA 3IRXA 4ZLJA 3B78A 3LWMA 2XB2D 3J7AN 4ZOSA 3CT9A 1XMQJ 4NX9A 2OHDA 3PXGa 4B9SA 1IKVA 1EB0A 1V5IB 5J2MA 4OLOA 1MMNA 3CJ8A 3D28A 3MTKA 3QIDA 3PKYA 4TNOA 4Y00A 5KT7A 5ETTA 4LIRA 5HL7Q 4ZITA 3RBZA 2HS3A 2FY8A 2Z4PA 5D4OA 4OI4A 3G87A 3CC2S 3J81U 2ZE2B 3CJTA 4ED6A 5DLFA 3BH6B 4KT0C 5FDLA 1XMOJ 4G3IA 2OP5A 4EK2A 5K8PA 2AX0A 4DG1A 4HDGA 1ULRA 2DK2A 4Y6IA 1OQ6A 2FYXA 2P9EA 3QRQA 3MPUB 4G1QA 2GS8A 2ZVSA 4C2MA 1XBWA 2VASA 2ZBRA 5KFZA 1P9YA 4YHHF 3MCSA 4AT1B 2HHQA 2EFPA 4M5IA 5IWAJ 1JLGA 4DU8A 2B4UA 4ELUA 4GKJJ 5RUBA 1OWXA 1URRA 5KFOA 4B9UA 1REVB 1Q53A 4OI2A 2KG0A 5CZVA 1VK8A 3SCLE 3KHLA 1X0FA 3RR7A 1Y4ZB 3DMJA 1MWYA 3ETMA 4PWDB 2M7SA 2M0GB 3I4PA 3TR5A 3VF0B 1VJQA 3M8SA 1SBRA 3DDIA 1B64A 1IKVB 1OY9A 1SUQB 3MMJA 5K8MA 1CC8A 4PWUA 1K73T 1Y5IB 5LSLA 2DH9A 5DLGA 1GH8A 4LBHA 5KFBA 3UCUP 1XNRJ 4WK1A 1YRUA 3IRXB 3B54A 3KDOA 2RKIB 1FRJA 3F0NA 3PFOA 3KLHA 4HDHA 5F8HA 4O4GB 5L1IA 3GFXA 2O01C 4HH0A 1FTCA 1O5JA 1FDDA 2DITA 2KI2A 3CMAS 2BM0A 3NCRA 2AHOB 5D3GB 2JZ5A 2DCUB 1LNQA 4K4XA 4K4YA 4DQPA 2E44A 1VR6A 4O4RA 3UQSA 2K1RA 1BWEA 3AD9C 1B99A 5FDLB 2J5AA 2WVCA 4CCHA 3FDSA 3DLKB 2GMJA 2IM2A 2M3DA 2V69A 5M2PA 3FK4A 5DZ6A 2B7BB 2XYHB 3GV7B 3NMAA 1WDDA 4WFZA 3MM6B 2HZVA 4OZLA 3VGUA 2C2OB 3A8JA 2C3OA 4G65A 1UJ4A 3UDLA 3B8HA 4L72B 4IFYB 5CYQA 3HD2A 3L7OA 3N01A 4AD6A 3CF5Q 4DLGA 1KKHA 3DHWC 5HMYA 2EWHA 3DLHA 1EKRA 2XMMA 3M9NB 4NXNF 3PYEA 3NOGA 2RS2A 3R27A 2KHDA 3KOAA 4KGVB 4FDFA 5LMUJ 2P5VA 4QBUA 1V3RA 1NDLA 2CJKA 1G2EA 2BYCA 2D9OA 4Z7CA 2DRDA 5IFMA 2EEYA 3MR2A 4TY8A 3T3FA 1IJFB 1B0PA 4E2FB 1VQYA 1SKSA 1I94F 4YB6A 2C1EB 4ZCMA 2G2OA 4NLUA 1KLMA 3DNCA 4U8VA 5T14A 4A8XA 1D8YA 2UU9J 2CZ9A 1WKJA 4K50A 3BO3A 1RHKB 1EJ7L 5AXKA 1DY3A 3MM6A 3PYGA 1S5ZA 4KH1B 2FUG9 3S01A 1XIQA 3LQVA 1B0TA 5AXNA 5DDPC 1LK5A 4RUAA 2IDEA 3KHHA 3CUNA 1RWUA 2OEKA 5A8WB 2MSTA 2X3GA 2VOOA 3MI7X 2BJ9A 1HNXF 2B5JA 3BKUA 4DN0A 5LM7E 3VAKA 1VGYA 2YWGA 1KTQA 2DISA 3MTJA 3TX0A 4F50A 1GNKA 3CO0P 3ZZ0A 1HNXJ 3U1LA 1RISA 3CD6S 1X4BA 5D6GA 5HLFA 1KHVA 3R5CA 2AX1A 2GA7A 2RQ4A 2ZVIA 3KUGA 3M32A 3NOCA 4KIAA 4MT1A 1AYEA 4RUHA 1RGVA 2ZH9A 4DR1J 3FEZA 1CEZA 3MDFA 3PJXA 5T7LA 4BWMA 1CS4A 4L6V3 1TKXB 3M2RB 2HAFA 1SUQA 1EP4B 1JNZB 2DNLA 2CPZA 3UDEA 3SI8A 1YTYA 1U4BA 3I31A 3BEGB 4EI2A 1FEHA 1ELOA 2PA8D 3SFUA 3RBXA 3GR0A 1HKAA 1RE1B 1UAWA 2X7IA 5KFGA 1Q8IA 2RJZA 3NCPA 3CULA 3NMRA 1EQMA 1V6HA 5KT3A 4RBTA 4LF8F 2V34A 3Q8VA 4CNYA 2WVDA 3P5TL 1X4GA 3ZTPA 2BQ3A 3HLUA 1X60A 3I5BA 5ETOA 1TL1A 2DHXA 4I6YA 2CNOB 4EWTA 3Q2SC 4HACB 5BYRA 3MR5A 3HK2A 1RWOB 2CPJA 2C2EA 2UUCJ 5GADI 3M30B 4JV2A 3ENWA 2IYIA 2CJ9A 4RU2A 2C2NA 3C6TB 3Q8YA 1CJUB 3TAQA 3LP1A 4B3TF 2QLXA 4B9NA 3PTWA 4OJ1A 2BE2B 4JI5J 3K5PA 3BYRA 3M8ZA 4C11B 2ZKUA 2M4MA 1GT8A 2E1CA 4CYUA 3ILJA 1S6PB 3OL6A 4JI4J 1YBTA 5E41A 1DARA 4Q0BA 2YX7A 4NLXA 4QR2A 3ZZPA 3DMJB 6FD1A 4A8FA 3SV4A 1ZOTA 3DOMA 4FYVB 4XPEA 1N32F 4DFMA 4JI7F 2OFHX 1EETB 2BVZA 3AJ2A 1AZSA 1PJ5A 3R3TA 3HPOA 4QOTA 3MMAA 2J9CA 1JLGB 4ZJOA 4G1IA 4B02A 5J1EA 5F9NA 2ZH2A 4FF2A 2OD4A 3CCQS 2HURA 4GVBB 2CNLB 4FN5A 1WACA 1U47A 4KO0A 2QLWA 1JLCA 1JLFA 3D1HA 4H4KC 3W2WB 3EVWA 3I5CA 3OTOF 3C46A 4USHA 2NCKL 1V3ZA 3G6XA 2BRLA 4U6PA 2R8JA 5JJBA 2V63A 2MY7A 2X1AA 4MIAA 3V6KA 3P96A 4M63A 1C0TA 1T8EA 1QSSA 2HVIA 3T1HF 2GQQA 2KVIA 4CM0A 2Z2ZA 2XO6A 4KTQA 1R43A 2M52A 4XK8C 2B7CB 3F56A 1GK8A 3AOAA 1R3NA 3SQGB 2U1AA 2LQ5A 1TFWA 3M8YA 3LH2S 1CJTB 2OPQB 4M5DB 2Q6BA 3OD2A 4F0MA 5KT5A 4LT6A 3UN5A 3PACA 4WK3A 5IT9U 2R7OA 3AXKA 4L76A 4ALZA 4AL7A 5CABA 3LAMA 4O23A 1N48A 1RAOA 3GJRB 1EETA 2ZZMA 1RTHB 3T9ZA 2BM1A 1Y5LB 2HFZA 4ICLB 3EE3A 3P8BB 2ZJPQ 1XK8A 3FCHA 3P45B 4RNHA 3IN5A 2D3O1 1YGYA 2A6OA 2DD8S 1HFEL 1D3WA 1WORA 3HHLA 4DL0C 4IG3A 3VALA 1VJWA 4FKYA 3N79A 3QIPB 2OIHA 1VRUA 2UXDJ 5E3CA 3DCAA 3FVYA 4CM2A 3HXMA 1IUJA 4RW6B 2YY3A 5E3AA 5H9FJ 2IRYA
chains in the Genus database with same CATH topology
2OPSA 3OTDA 3VAMA 4NLSA 3K5LA 4IH6A 1FRLA 3H5SA 2I5JA 1Q7YT 1QSSA 3NNHA 1JK9B 2FHJA 3OTBA 4E98A 1HQEB 1J5OB 3E01A 4IO1A 2VG5B 4I2QA 4XO0A 2ROGA 4URSA 4WJBA 4DL2A 1XNQF 5L38A 4DJBA 3OSPA 2ZJRQ 4FYDA 5J2PA 2IVYA 4ED7A 1RT1A 1HBNA 3TP2A 1RTJA 1VQSA 4X2BA 4RW4B 4CI0B 1H38A 3G86A 2VFUA 3KG4A 2XG8A 2NSBA 3NNCA 2B4PA 1BQNB 1RT4B 1FXRA 4NPOA 1ZPVA 4ZP8A 4DL7A 2UVWA 4KHPF 2E7WA 2C22A 3IWXA 3V81B 4O44B 1X4DA 1QSYA 4X4PA 2OO4A 5AXLA 2NPIA 3DLEA 5KFDA 1FKAF 2LVWA 3LANA 4IFVB 4IRKA 1HBMA 3O44A 2FGCA 2XEXA 5T7LB 3MUVP 2RU9A 2E66A 3HKZD 4BCAA 3CIMA 3TRGA 2O5DA 1QM9A 3C3LA 5E7OB 1RDRA 3JSBA 3Q22A 5ITHA 2RDIA 2Y1IA 3G4SS 3IGVA 3PM9A 1ZZNA 5LSRA 4DR4F 3W7BA 5KT4A 4F3MA 3GE9A 4QIEA 4RKUC 2WOMA 2KXHA 3OFGA 2J9EA 1H2UX 2EBGA 2Q43A 3IAS9 4FVMA 4DX8H 1X4AA 3LWLA 4BDPA 2W4PA 2DGQA 4LMZA 5A8KA 2VG7A 1I1GA 1TAUA 4RNFA 2UVVA 4WFAQ 2AQ4A 1HNIB 5A6WA 2PI5A 1S99A 4F4ZA 1SIWB 2NR0A 5DDQC 3DOLB 2D1CA 3BS9A 2VFTA 3H4BA 3J7YI 4O3SA 1H7WA 5HMZA 4PG8A 1E6VB 5LXYA 3LO3A 4ZVHA 3CCMS 3QGGA 4DL6A 2VC1A 3B4MA 1T03A 2X51A 1KOHA 4CO4A 2HPUA 1XR5A 4DQSA 3NP5A 1UETA 2C3MA 4PG4A 1G7CB 4Q8FA 4YQWA 1S9EA 4O3NA 4XDCA 2YX4A 4HI1A 4ECWA 3I56S 3QIPA 2JEIA 1VFJA 1TK8A 1S0VA 2PGCA 4RW8B 2MMYA 3HDSA 4Q8EA 4RWXA 2EPIA 1S6QA 1GX6A 3M4XA 4RW4A 3OV7A 3AQPA 3ITHB 4PUOA 5J2PB 3IWLA 3MECA 5SZTA 4G1QB 1VC0A 2RRBA 5M2RA 1R8PA 4NRTA 1Z2ZA 2FTRA 2NPFA 1R7IA 4OV1A 4JI1F 1HQEA 3ICLA 5FD1A 4DL4A 1VBXA 3I0RB 4TQSA 4Y2IA 3MEEB 3D5MA 4KGKA 2R2SA 2GQ2A 4A4JA 5LSOA 2QA2A 4HYKA 1LOUA 1FRXA 4ES3A 4MKYA 1WHVA 2C42A 4QU6A 1X5TA 4RW6A 3FSIA 3PZPA 2IAJA 5D4PA 5KG4A 4NCBA 3LOUA 4G1PA 3ZZRA 4KJIA 2RQKA 3HHLB 3OJSA 1FJ7A 2CVEA 2R7VA 4BWJA 3RYLA 1NB7A 3THTA 4DQIA 3JTOA 3R5AA 3M8PA 4K5RA 5KFCA 2O1PA 5CD4H 1DTQA 3FRYA 2WONA 4EBEA 3BGUA 2HS4A 2IVFB 4CT9A 3HM9A 3MGJA 4Z37A 1NRKA 4MMOA 1WF1A 1M5SA 1VQ5S 3D0HE 4EZ6A 1FNMA 3RRKA 4X84A