3CO0P

Substrate complex of fluoride-sensitive engineered subtilisin subt_bacam
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
71
structure length
71
Chain Sequence
EKKYIVGFKQGFKSCAKKEDVISEKGGKLQKCFKYVDAASATLNEKAVEELKKDPSVAYVEEDKLYRALSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Subtilisin BPN'
publication title Structure of a switchable subtilisin complexed with a substrate and with the activator azide.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 15
structure length 71
sequence length 71
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2008-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF05922 Inhibitor_I9 Peptidase inhibitor I9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3co0P00
1R6VA 2Z30B 3A3OB 3P5BP 2Z58B 2PMWA 2W2PP 2ZWPA 3WIVA 2E1PA 3BPSP 4NMXA 4OV6A 2W2QP 2ZWOA 2XTJP 1ITPA 2W2MP 4JP8A 3T41A 2Z57B 3BGOP 2Z2YB 3WHIA 1SCJB 3GCXP 3WIUA 3CO0P 2Z56B 2W2NP 3VHQA 4K8RA 3SQOP 3VV2B 2W2OP 3CNQP 3H42A 4YN3B 3QFHA 1V5IB 3AFGA 1SPBP 2QTWA 4NE9C 3A3NB 3GCWP 2Z2ZA 3A3PB
chains in the Genus database with same CATH superfamily
3SSSA 3TAMA 2LKZA 4FF2A 2ASJA 3GJRB 2MKYA 3BEGB 5KT4A 2HNZB 2CWKA 4PQUA 2Z56B 3KLEA 3MM9A 4NWBA 2M2BA 4UY8T 2IBOA 3LP0B 4DR1F 3CD7A 1AA1B 1UAWA 3QNWB 1SKRA 2HHHJ 4USTA 1U6FA 2RNEA 4F4KA 2EW9A 2AD9A 1TAQA 3NGUA 3W3SA 4HDHA 2PI5A 2DGUA 1RWOB 2JVRA 3PW5A 3BSAA 4OI6A 3OVBA 1WEZA 4F4AA 2X1AA 1AFJA 2PDAA 3UD5A 1GNKA 2V9WA 4WKRA 4L6V3 1NDLA 3JXOA 2CPDA 2FGCA 1H0HB 2OI2A 1KHWA 2E1RA 1T9TA 1GH8A 3QT7A 3PX0A 5A6PA 1RAOA 4EYHB 3D28A 3KG0A 3OVSA 3J7ZT 1E6VB 3KJVB 1C1CA 3S8SA 2HRUA 2W8KA 1X4FA 3TRGA 4Y0FA 2Q1LA 1FX4A 2CNOB 2HZVA 2FVSA 1WEXA 1RZMA 4LF5J 3BDEA 3K89A 3T3FA 1FNOA 4DQSA 2D41A 4PPZA 4M5NA 1RT4B 3MM8A 4PWUA 3H8YA 1U0SA 4ALZA 4EZ9A 2W9CA 3H5UA 3UFCX 4Z7CA 3RB6A 3SFGA 1O51A 3F44A 2B9YA 4F67A 4XAKA 2QX0A 1RLDA 3A12A 4Y2CA 2HVEA 5I3QA 1UZHA 3ET6A 2E9RX 4WKYA 2HQDA 4ER8A 9ATCB 5A2QY 4A4JA 1FHTA 2LQBA 1OWXA 2LQJA 2CQPA 1NU4A 3LUYA 5EWEA 1RB0A 2OH2A 5D77A 2CNNB 4WP9A 4HACA 3D1QA 1T3OA 2NYIA 3QYYA 1NKBA 1H6KX 3M32B 2DVIA 1WOPA 2IM0A 1JWWA 3VF0B 4ECYA 4DUYJ 3HPOA 1N52B 3EYZA 2M7SA 1N33J 1WACA 4NLYA 4XDCA 3V81A 1HNWF 4K50A 5E33A 3FNNA 2VBXA 2LQ5A 4IKAA 1RWPB 3M1VB 4I68A 1AXQA 1CJUB 2ZBPA 1IM4A 1VGYA 2P9GA 3G82B 5HP1B 3Q8SB 3VAFA 3LGMA 4WIQA 1LV5A 1KSPA 4GVLA 1SV5A 2XLJA 2V2VA 4DBQA 5HAOA 2OEMA 1RHQB 1YZ7A 3A1YG 2UUTA 2VG7A 2X3DA 1B70B 3PO4A 4FF3A 2MQLA 3BGLA 1HHQA 3TUPA 3VAKA 1FD8A 3D4JA 1UL3A 3SIPB 2HBYB 4WU2A 2FHKA 3JAMU 1YITS 4I64A 1LXJA 5DGBA 1NK4A 1LWXA 2VZ9A 2DXEA 3ZZZA 4ZCKA 4CLFA 2DBBA 1TUWA 4U7UK 5HVFA 4DPYA 3QBCA 2IAJA 1LKZA 1RHKB 4MK8A 3CCSS 5C24A 1X4GA 1U49A 1Q8BA 4QYZJ 3CJ8A 1FKOB 5D0EA 4GO7X 1I94F 1UVLA 2IA6A 1F9EB 2E9ZA 1SKUB 3IGVA 2CDQA 1T9YA 2J9EA 3GV8B 2AV5A 4WTYA 2EBEA 4AUKA 3PKYA 4P2FA 3KHGA 1J2VA 2B9XA 3DRRA 5ETSA 4J9RA 4HI2A 4NCAA 4UUXA 3NP5A 3GFZA 1NSAA 2Z58B 2EG2A 1RT5A 2VFSA 3M6VA 1ZAXA 2EFQA 2YNIB 3CCJS 5A8WB 3UCGA 3OR2A 3TX0A 3P8BB 1SIZA 3MAAB 1N8RT 1WG1A 3M30A 1I6JA 2XZWA 4O23A 4ID5B 2DHSA 4H4MB 3EGWB 4DV1J 4DSJA 2I5JB 5KFOA 2AIRB 3THVA 4F2RA 3N4WA 3GG0A 3I0RB 2PN6A 2DNYA 4KV8A 4J9OA 1HD0A 5I3UA 1HWUA 2FTRA 2EFOA 2KJWA 5LXYA 3ZZTA 3NMRA 5C5JA 2ZVIA 2R7TA 1JNRB 1F9HA 2NYHA 4B02A 2HRTA 3CF5Q 2RDIA 5D8HB 1S57A 2QLBB 2FC8A 3AAWB 4LRBA 1T05A 1S7IA 3R27A 3PJ9A 5F8IA 3HJFA 4NLVA 1JJ4A 2X1BA 4FBUA 3O5TB 3I4PA 1N88A 1UJ4A 3R5DA 5IT9Y 4WK1A 4EBDA 2Z2MA 4PCQA 3CUNA 1B99A 3HO1A 3GR1A 5IOLA 3MR6A 2RS2A 2FZKB 2M70A 4KHMA 1WORA 3HMJG 4C8KA 4DPWA 3G4SS 1DQ9A 1VQYA 1OYDA 4IDKA 4UW2A 2XMJA 3LF0A 4OIXA 3DM2A 1SUQA 2YKOA 4ED8A 3DMJA 4JI8F 4IO9Q 1SJ3P 4N7TA 2OP5A 1CPZA 1GXLA 2XY6A 3IP0A 2EFPA 2FGOA 1KLNA 2AT1B 2OSRA 1RT7A 2IPOB 2MDAA 1LNQA 2HNDA 4IG0B 4OYWA 1JIHA 4C11A 2CJ9A 5DDRC 3UVJB 1GXUA 3OFHA 3TEHB 2X7IA 3HCXA 1GT8A 3NCPA 5B0EA 3AJDA 2J76E 3UDVA 2DIVA 2YX7A 4DUZJ 4NRUA 3TYTA 1H2UX 3QIPA 2HYIB 4DX5A 1Y5IB 3VAMA 3CJQA 1GX5A 2V4RA 2J6UA 1DTQB 4Y34A 3IG1A 1DRZA 2BM1A 4F36A 1CC7A 2VG6B 4TY8A 1U47A 4R5PB 3ULHA 1UWBB 5EX0A 1KRPA 2BM0A 2JWNA 1KQGB 2MKHA 3AY0A 3DYAB 2YWEA 1NCLA 2OEJA 2W7PA 2HBRB 2OPPA 2DR9A 3SQOP 3FEYB 3VR1A 3KUHA 4BC9A 1ZZFA 3IBCB 2O5DA 5M2PA 1U6BA 4QWCA 4M5MA 2WK4A 2GW8A 3B4DA 2XZTB 4DQPA 4USKA 2GQQA 1IKYB 5JVHQ 3CJ4A 4EO6A 2JL9A 1HWKA 2W25A 4TVAB 1JJHA 4KHRA 3JSYA 2DY1A 1N32J 2ALYB 3VQTA 3H5SA 4ZOSA 2WVBA 4WBFA 2YTCA 3J7YI 5H9EK 1KVKA 4G1IA 4DPUA 2KZMA 4RLEA 1BC6A 5KFSA 4E2FB 2ILYA 1KNZA 1EHWA 1U8SA 1GK8A 3MEEB 2B9EA 3LTOA 4DCOB 2PGCA 5HQ8A 5ETQA 1E6YA 4IO1A 2E7XA 4LSZB 3N5BA 1QVGR 3DLLQ 3KK2B 2RUGA 4WCEQ 2ZKTA 3OL7A 3PR4A 3JSBA 1M5OC 2V4JB 1HW8A 2BUNA 4RWXA 1KTQA 2ZVSA 2HWHA 1FNXH 2VODA 1S6PB 4ED2A 2HAFA 3MOJB 3R2CJ 4OX6A 4JI7F 1EQ0A 4LMZA 4X4RA 2DGSA 2DR8A 4R8UB 4B3OA 3W2WB 1FDDA 3TUJC 1ELOA 5BR8J 2YPZA 3NS5A 4I7FA 3JS9A 3QT5A 2VG5A 1YGYA 4LREA 2P9EA 1HPZA 5IT4A 1XBWA 2ADCA 4OZ5A 4FF4A 1RXOB 1V3SA 1RT3A 1GFWB 3TOQA 4FDFA 2B4PA 1RTDA 2VONA 5LMUF 2GQCA 1S97A 2MTLA 1MWZA 4KYZA 1P8GA 2BJ3A 3IM9A 4JI6F 4JV5J 4GC7A 2R8JA 1ZETA 2DNZA 2VPZB 4KFBA 2B56A 5F41A 2XS7A 1RLCL 5D4NA 1NSKL 3TZXA 2RS8A 1N56A 4I1TA 1R6VA 4C9DA 4HDGA 1N0VC 2RRBA 1YQHA 3VALA 1S9FA 4K4UA 3EVMA 1FDAA 3AOCA 4LF2A 3CE8A 5KG3A 1PJ6A 3QSIA 1FEEA 1QUVA 1DBDA 2V0NA 2Z0GA 1RHJB 3DRYA 5IQQA 2DR6A 3Q86A 3HJVA 2GIFA 1FKPB 2VQEJ 2G0CA 2MQNA 1D09B 4NLSA 3NNAA 1ACMB 1X31C 1X5OA 3R1LA 3J81Y 5I42A 1BWVA 1TZ0A 4EEYA 3IR5B 4K4YA 6AT1B 5K14A 1ZM4A 2MGZA 2VA2A 1WC3A 2W7AA 2NXCA 2ZWOA 3T1YF 1DZ5A 1RAGB 1NLKL 3MM6B 4DPOA 2B4VA 1HI1A 4FZVA 1UVMA 3HVAA 4NA1A 1YBUA 4NE9C 2ZD1B 2C2NA 1XERA 3MECB 1YBAA 3WIVA 1Q95G 4TKTA 2LCWA 4OI1A 1I5OB 1U2CA 4V19X 3GYNA 4IOCQ 4FXVA 1S0OA 3BO2A 1PBAA 4DF8A 3N6NA 2KXFA 4QIVA 2WB1D 2CDRB 3SBMA 2QJ3A 4RBUA 3L7OA 4KR0B 3KLFA 1WC1A 2DHGA 3F73A 3Q22A 1K44A 1IR2A 5CZVA 3QIDA 1JKHA 5AXKA 2HHXA 3OL6A 3B8HA 1S4FA 4DQIA 3BGOP 2IYIA 2G0JA 2PIIA 4O3PA 3P5BP 4K4XA 3POTA 4CM2A 3O3LA 3NBPA 2DHXA 1AYEA 2AGPA 1U1QA 1HLWA 1VQNS 4LRCA 5K8OA 1FRIA 2ROEA 3CGIA 4WJBA 2BOAA 3R3TA 2GHPA 4KGKA 2XLIA 3MPVA 5AE2A 4K0KF 1VJWA 1JLFA 1WI6A 1RACB 1NPKA 5A6WA 1A0OB 4DL0C 3A3OB 2QLJB 4ERDA 4I2QA 4ZVFA 3T5LA 3UCZP 1HNIA 2MKIA 4FYYB 2IBKA 3GFYA 2NLWA 2FJEB 5HROB 1YWXA 3HZGA 1HQ2A 4TYAA 2QRRA 4LFCJ 2KVQE 5AJ3F 4PRFA 1I51B 1TKDA 4DR7F 4DV3F 1EQMA 3RRHA 1NPPA 2AYBA 3UWTA 1WD6A 3EZUA 2DXFA 1F3FA 1HNVB 1N34F 2YKNB 2RH3A 3BYPA 4NZ7A 2XMUA 3BKUA 2E44A 2XGQA 1L3KA 3CJKA 4OZ2A 3AA9A 2ZHBA 3HK2A 4DX8H 1KLMA 5HVHA 4RW7A 4OHYA 3EGVA 3KJNB 5DQHA 3FBEA 3MEGB 5HMWA 1UVNA 1Q8LA 4LF4F 4USWA 2UU9F 1LFPA 3FMWA 2WVDA 3P3DA 3E2EA 2CQ2A 1XNQF 3KKFA 4QU7A 3U02A 4ES1A 2FYXA 5IFMA 1NH8A 1YLXA 4B9VA 1HBUB 4NXMJ 3EUNA 4USHA 5B7WA 3X3UA 5M2UA 2ZM6F 3WC2A 5K8NA 3S1TA 3SQGB 3Q8QB 4AL6A 3LP0A 4ED4A 4ZCIA 1PGZA 2NSCA 3MR2A 4GMKA 5GAEI 1S5ZA 1SH0A 3IBWA 5FJ4A 1WOOA 1R31A 4I67A 5B09A 3Q8UA 3DLEA 4MFBA 4JI1F 4PKDB 1X4AA 4UF4A 4KO0A 2FQQB 3DXBA 3D6HB 3IAS9 4N47A 2OPRA 2RHQB 1S0VA 3NXZA 2CZ9A 2KKHA 1HA1A 3P96A 2JHEA 3L95X 3EPIA 2VOPA 4EYIB 3GG1A 3PO5A 2L3MA 4A48A 3B78A 1RWVB 2FC9A 2LA4A 4NLRA 1QAIA 2U2FA 3KNAA 5RUBA 5C25A 4J9KA 5F3ZA 5B0AA 3JSRA 1R8BA 2W2QP 1U2RA 3DDKA 3IAM9 1GXTA 1J5OA 1RT2A 2CFXA 2D3OR 1E6VA 2YNHB 3T5KA 1CJVB 2VQFJ 4X4OA 3RBDA 2QEXS 4B9LA 3KK1B 3CJ2A 4F26A 1VQ5S 1RWNB 4LFAJ 1HR0J 3A4TA 2HBZB 1GTHA 2C2ZB 2AEJA 2R8IA 1RCOB 4KGXB 4KHPF 2UV8A 5LJ3Y 1RUSA 2B5JB 3UR0A 5L1IA 2WSFC 2E5HA 2AJQA 3X1LB 4Y2IA 2JFKA 5KFWA 4NLQA 2DB1A 3C6TA 1F5AA 4RUCA 3QATA 1NBEB 3QFWA 4JV2A 1VISA 3UDEA 3FJ2A 1JLGA 4CO3A 5L1LA 2H65B 4NEYA 2YQ3A 4FPIA 3KLGA 2DNGA 4ZVHA 3ZTRA 3DI6B 2HIQA 1ZA2B 5B0BA 2V8GA 2JEFA 3LA0A 1N36J 4G1PA 5KFIA 1APSA 1YKWA 2DO0A 2VU5A 5AXLA 1D0EA 2R2TA 2CNKB 3MCNA 2JFDA 2O3DA 8ATCB 2FJWA 2HGNA 3K5LA 1HNXF 5DS7A 4BBYA 4KY3A 1T03A 4NI2A 4ELTA 1R89A 4AFFA 1Q78A 2MHNA 2B8PA 3DLGB 4J9LA 2V8HA 4ZVPB 5KFNA 2F7VA 3FFIB 4DV4J 4RW4B 1CJTA 3L09A 4K5RA 2MQMA 4Y2MA 1EKSA 2OKQA 3EXYA 4DV5J 2B0GA 5L38A 3M32A 1YBTA 1R3NA 5DO2A 1FCAA 2HQCA 3P4UB 5LMNF 3NCQA 2C2OB 1Q7YT 3EDQB 1DY3A 2XMTA 4NCGB 3SSQA 1DTTB 3R6GB 2VPYB 4FN5A 3QMQA 1VDHA 1WWHA 4DUYF 3G82A 1PG5B 3CCRS 2XI2A 5HP1A 5E7OB 3HFZB 5KFGA 3NAHA 4DG1A 1Y0HA 1C0UB 1UA1A 1IBLJ 1Q1KA 3W2VA 3LP2B 4P7VA 1L5UA 2AQ4A 4P52A 1NZ8A 3IBFB 2BANB 3NWRA 1KEKA 2E29A 2DNMA 3R2DJ 2ZH6A 2B9WA 1MN7A 5ITHA 4QCLA 2AJ1A 2XO7A 3MZIA 4EBEA 1R0AA 1MU2B 3SCJE 4KGVB 4O44B 3ITHB 3P5TL 3FQKA 4P75A 2CPIA 5MLCV 1UFWA 4ZMMA 4LVNP 1WHYA 1FFSB 2FVCA 5F8GA 4K5SA 2XY5A 2IRXA 4CH7A 1EP4B 4N8OA 1WKKA 5D6GA 2KDOA 3BBBA 4DSIA 3UI3A 4MKBA 4YMEA 1M0SA 2P6TA 2PO4A 1HL6A 4LQ9A 2XHCA 2XB2D 4HKQA 3O44A 4P74A 5ETNA 2Q6BA 4MIWA 3TJ8A 1OPIA 5C7PA 3H20A 3HVTB 4XPEA 3UDLA 2UUCJ 5D4LA 1RGVA 3FK4A 2ZOMA 1HQEB 2F1FA 4N5SA 4MH8A 2HS0A 4U8VA 3GE9A 4OMFG 1KDNA 1OSDA 1KQFB 3T41A 2RJZA 1N5YB 1RHRB 1C1BA 3TAMB 1RTZA 5DDQC 4OZ3A 2DPJA 5K8PA 1T7PA 1WJ9A 3QT6A 2YNIA 1XC9A 4PQUB 2F8EX 3KLEB 2BX6A 3MM9B 1P27B 2I1RA 1GMVA 1EIYB 2V2QA 4P71A 3BB5A 4H4MA 3H5XA 4FKYA 3K58A 5KG6A 2CJBA 3I0RA 3T1HJ 3FUYA 4QIFA 4ZVUB 4PEOA 4B9MA 2MJNA 1RAHB 4JOUA 2DRBA 4ED0A 7FDRA 4ZPVR 1YHQS 3CC2S 3JYTB 2OLWA 5FLXY 3DXSX 2LQ8A 4LF1A 4QR1A 1QSSA 4HTJA 5B0FA 3N6MA 5HI7A 3BO3A 5JJBA 2CZ4A 4I2PA 1KP6A 1MN9A 4Y28C 2M5YA 4DR5F 3E8OA 3S6EA 3HHLA 3PEJA 4OX9J 3QO9A 4C3MA 1JLCA 2J5AA 4EU0A 3BGRB 5IQ6A 1U09A 4ECRA 2KT5A 4K2JA 3IRWP 1BQMA 1C1CB 4H4OA 3KG4A 2RRNA 3VWSA 2VPWB 5KFLA 3J7A1 3QJJA 2V2KA 1KONA 2CPHA 4J37A 2UXBF 5F8LA 3MM8B 1W7WA 3GPAA 2GGPA 2RU9A 3ZZRA 2AJFE 2R42A 2W9AA 5HL7Q 2MQOA 2W9CB 6FDRA 3ISZA 1WG4A 4EUVA 2QFJA 2HHPA 1PKUA 3UVJA 3CDEA 4A47A 1PILA 2MSSA 3UNYA 1RT1B 3UR3C 1PO6A 3W62A 2VASA 1SQFA 1VYAA 1AUDA 2HHQA 3G6YA 2IVMA 3PX4A 1GEHA 2A2CA 2ZDOA 3TVZA 3UN3A 3TVKA 1S1XB 1DTQA 5EN1A 2GHWA 3G8QA 3GFXA 3QFHA 4J9PA 3KJQB 1X4HA 2VG6A 1WKJA 3W9IA 3CCWA 2RQCA 4HACB 4LRDA 3GJQB 4Z7YA 3W66A 2AMCB 1TKXB 2AZ3A 3RAMA 1U1KA 1TFYA 1RWXB 4NXNF 2FLLA 1BMQB 3TI0A 1FE0A 2HQIA 4JYAF 3DNCA 2KO1A 3V81B 4NZ6A 4HLBA 4IRDA 2E5LF 4U96A 3HHEA 4CT9A 2KXHA 2DRDA 3RBZA 2A3JA 4DN0A 3R7BB 4V1Ak 3FEXB 1HQUA 1SQGA 1HWLA 1SV5B 2ZBCA 4W4MA 5H9FJ 1DQAA 1QTMA 1FRHA 4WU3A 3ZTQA 4HI1A 2VG7B 2VIHA 2DRAA 5D4OA 3VGUA 5KFPA 3P49B 2HIYA 1TU0B 8RUCA 1UVKA 2IM1A 4PYDA 2JZ5A 2KFZA 2KB2A 4J9SA 2HK3A 4C0HA 2ZH2A 2XS2A 5IV4A 1NEEA 3ILLA 5A0YB 2P8IA 2BJ9A 3IWLA 2AGOA 3TQ1A 4Y2KA 2KH9A 3LP1B 5ETPA 3NL0A 2UXCJ 2MZSA 3FEZA 5AE3A 2IAJB 4EBCA 5AT1B 1ZM3A 1WHWA 3I87A 2W4DA 1FTCA 2XLKA 5C24B 4NYZA 3GIKA 1S10A 4C6AA 1PIEA 1X9SA 3MEDA 4AYBD 1HHTP 4AQYF 2GVZA 2L9WA 1HARA 3R6LB 3VVUA 3DRRB 2JLGA 4OV1A 2FB0A 1ZPVA 2WONB 1VR6A 3FKBA 1U1RA 2OFHX 5U47A 2F4FA 4RNMA 1RT5B 1CULA 2EK6A 5DM6Q 4A8YA 1YJTA 1NUEA 4ZJQA 4OL8A 1JX4A 2RF2A 3SZ2A 2BJ7A 2XSJA 4CM0A 3MR7A 4Q7AA 5T7LA 2QSFA 1TK8A 4DMZA 4ZPCA 4B3TJ 3LGHA 1GX6A 2GIQA 3V6JA 1HBMA 2N4CA 4LF7F 1SPBP 2V5HG 4ZN1A 4UOGA 3OT9A 4DU8A 2ZNYA 1WTFA 4KV8B 5G0RA 1S4EA 3NGKA 4KGZB 2IYGA 2YKMA 1TVRA 4JB8B 2QO3A 2IRYA 4B3RF 2RDDA 2MXYA 2FZCB 4AD6A 3OL8A 4PPDA 4G65A 2CVEA 2QGFB 1RTIB 1FKPA 4KPYA 3RB3A 3OUYA 3GCXP 3JTNA 3MAHA 2U1AA 1U1MA 3KJFB 2NUHA 1T05B 4UQTA 5E5NA 3W8GA 2LEAA 2HHUA 5B0CA 2YKQA 2Y1IA 2GJIA 2CQDA 5EUHA 1FTRA 3BN4A 3I96A 1FE4A 1BGXT 1Y7PA 3FBCA 2J7UA 3G9CA 1U1OA 4YDDB 2NPIA 4PWWA 1L3VA 2WZ1A 1NK7A 1FXDA 3KLIA 5KG1A 5L9NA 1YDLA 3C16A 1AFIA 1UKUA 1RTJA 1ITPA 4BC7A 3LPEA 2ZD1A 1H2VZ 4IDKB 4LF6J 5KFUA 1UJ5A 5K20B 1ZS6A 3M05A 4F3MA 3DM2B 1SUQB 1J5EF 3DMJB 3K8VA 3A8JA 3MPUB 1WUUA 4LR8A 1M5VC 3PYGA 4CNYA 4MKVA 3H25A 3RZAA 2KM8B 2WBMA 4WYLA 1AROP 3FZ2A 4QWDA 2HNDB 4CNZA 1HI8A 4OZ0A 4C11B 3NY0A 2VF3A 4C7QA 1LWEA 2KTQA 1MMDA 4RBTA 1HW9A 3I56S 5CYQA 2QYGA 1S6OA 1C0TA 3ENQA 5K8MA 1VCTA 2L08A 3GV7B 2ZH8A 5LSOA 4DJBA 1UVIA 3D66A 3AFGA 1Q16B 2ZBQA 4RPFA 1OIAA 4EWTA 3KG1A 2G4BA 1EJ7L 1A7GE 1MMNA 1P9QC 4ECVA 4WFAQ 2XHWA 3BSOA 2F63A 5C42B 3H42A 4KH1B 1IUJA 1YTYA 3V4MA 2DISA 1UW4A 3M8QB 4P2XA 4ZVEA 3OTOF 1LW2B 1UP1A 3HVWA 2K3IA 3H59A 4X66J 2J9CA 2BQRA 4IH7A 4LF8F 3MPYA 1R7IA 1EKRA 4G1QB 5E3QA 2OPPB 1FD2A 3HFVA 1IKWA 4ZP8A 3C19A 3VCDA 1UA0A 2I8EA 3Q2TC 2MZQA 4JI2F 4Q8FA 2CYYA 4M5LA 3VAHA 2CQ1A 2EFVA 4DV0F 5IT0A 5HN0A 1G3OA 5HROA 3DLBA 3MR3A 3NGSA 3OR1A 4Y3CA 4CO2A 3EMTA 4XPCA 1YJUA 2DGVA 2C3MA 5HLFB 3SDEB 1CJKA 5GAHI 1TKTA 3H0PA 3R9LA 2HKEA 3FSYA 2YQ0A 1M5KC 2YKNA 2MQPA 2ASLA 5BYSA 1OQ6A 5CQGA 4M5DA 3SMZA 1P1TA 4R0JA 3I0SA 3OSPA 2GO8A 3TA0A 1E6YB 2KL8A 1H72C 3CDUA 2BE9B 1U24A 3DCAA 2XS5A 3HHLD 3MEGA 2N82B 1JXVA 1O8BA 1Q4RA 4JI0J 3RBXA 2COLA 4ICLB 1I3OB 4DX7A 4BS2A 5KG4A 4PG6A 3M8PA 2BJ1A 2HBQB 1S0MA 1BWEA 1Q5YA 2RSQA 5F8HA 4H4KA 1K8AT 5CXTA 4F4WA 5EWFA 1KVJA 4RNHA 1TK0A 3TZWA 2VFVA 4B3OB 3ILOA 1W2IA 2H48B 4UY85 1CBKA 3OLAA 2C3PA 3PW4A 2XMWA 2VG5B 3QGPA 3FGVA 2LVWA 3PACA 2MQQA 1VMBA 1RT3B 3TZYA 3R1HA 1BHNA 1Q7LB 4IFYA 4DHVA 1RTDB 3MHYA 1VQ4S 2NUUG 1T9UA 4L74A 3BPDA 1XMOJ 2WW8A 1FJEB 2M88A 2PEBA 3W61A 4K4WA 2HVZA 1CC8A 1EZZB 2GMLA 2WBRA 2LU2A 1U4BA 1U02A 3W9JA 3HXMA 3KMSA 4KFBB 1HWJA 4FF1A 2P5VA 2D74B 2J8SA 4ED7A 3CJRA 1RWWB 4K4VA 4WTOB 2V8DA 2NCKL 3T9NA 3OTEA 4MK9A 3VAIA 4RNFA 1MSWD 2KJVA 4X4NA 2YVSA 3R5GA 3AHPA 3HLUA 1G4CA 3CD6S 4OZNA 2AYMA 2VH7A 3MGJA 1XNRJ 4OHXA 5IS2A 2YNHA 1CJVA 3Q8PB 3HFKA 3MTKA 2ZKUA 3QGHA 4M5IA 4WPAA 3M8RA 3J7Z5 1JK9B 3RB0A 2RU3A 4USVA 2DKOB 3RJMB 3W8PA 3BR8A 1RADB 3EWGA 1KC8T 1RAIB 2V8PA 3CMES 2W2NP 5I42B 3ISNC 5K14B 4QPTA 1U1NA 1F6TA 3C14B 3DI6A 1HMVA 2LXUA 2H9ZA 3MUVP 4YP3A 1SKWA 4RW9B 2KRBA 3R5CA 4U67Q 1RT6A 2V4QA 1KN6A 3IXQA 4FNIA 2R7OA 2WVFA 2GQ2A 2YH1A 3D1HA 1FWLA 2EKNA 1WHXA 3ENAA 4L72B 1JXLA 2O67A 1QSYA 3HX9A 4Q5VA 1XN9A 3EZ5A 2I6WA 4IR9A 3C2PA 4RW8A 2B8QA 2B7BB 2C3OA 1OMSA 4KJIA 1K9MT 1SL1A 2OIHA 1Q8IA 2Q3PA 2VL1A 4TNOA 4DL2A 5KTQA 2AEFA 2AZ1A 3HI9A 3FVYA 3U1LA 3GCWP 1X7VA 1VC0A 5SZTA 5J2NA 4M94A 2C3UA 2OELA 3OQ2A 1JKHB 3MFIA 4PXCA 4X64F 4TU8A 3VGTA 1IN0A 1FJCA 1DHMA 2GJ2A 2RQMA 4K4TA 4X4TA 2HS3A 4W92B 1UZDA 2UZAA 4P6QA 5JXSA 3Q23A 3T19A 4NA2A 4F3QA 3MR5A 4C2MA 4DSEA 3POTB 2ROPA 2XBPA 4PXEA 2JDJA 2ERRA 3CCUS 1F5CA 3DGPA 3F0NA 7AT1B 1F5BA 1FXLA 4ITSA 1Q79A 1U7LA 1CSJA 1SJQA 2VD3A 4DR1J 1NKCA 2CQBA 1MWYA 4DSKA 3LOUA 4I2QB 4O44A 3ITHA 1PSDA 1HNIB 2MZJA 3J7YU 4JI4J 4I56A 2J0XA 2NPFA 2V34A 3M2UA 1N5VA 5HMZA 4PWDA 4ZP7A 4USJC 2ACYA 3DGVA 1S72S 3CIZA 5H1SV 3CJKB 1O0PA 1VQSA 4CLZA 5KFJA 1O5JA 4RW7B 3HVTA 3ZNJ1 3PY8A 4W90B 3R7SB 2UUAF 1B4SA 3TA2A 2ZUAA 2HQFA 3FC9A 2XYPB 3VZHA 3QZ8A 3HP6A 1UCNA 3MPDA 4DU7A 1S48A 4URQU 2ZH7A 2I0XA 3GU0A 1N5YA 3QJLA 5KT6A 1D9FA 4BDPA 4UZCA 1S1VB 3PX6A 1Y9OA 2GIRA 2FJDB 3EXCX 1RJJA 3DU5A 2UV8G 4B17A 3PKMA 1TMMA 2F9DA 4PXDA 3R8YA 2Y1RI 4MMOA 2VB6A 4M5GA 2RMLA 2WRMA 4CZCA 1WKLA 2KZZA 3M8WA 2R7UA 3CMQA 1PC4A 4O0NA 2HVIA 5L46A 2JLFA 3DFEA 4DLGA 2MLXA 3CO0P 3DLEB 2HVDA 4B9SA 4EK2A 3BR9A 1S1UB 4MFBB 4KO0B 4K4SA 4NMXA 5J2PB 2AX1A 4ZVRB 2DNOA 2OPRB 2AU0A 3JYTA 1REGX 2IDEA 1U26A 5F3TA 2QV6A 3GONA 2E1MC 2C42A 2R7QA 3NCRA 2DNPA 5E0OA 4TU7A 4O3RA 1YJWS 3IWNC 2HG4A 2QL5B 5DG7A 3C6UA 2KT2A 1FFGB 1L3TA 3DU6A 2H5JB 3OTDA 5C25B 3IRXA 5HBMA 1MW7A 4QR2A 4ZCLA 1J5OB 3BGRA 1ZM9A 1RT2B 2AYEA 2J6SA 3TAQA 4CRJA 2DO4A 3O6QA 1HNZF 1KFDA 1HBOA 4RBVA 3PDNA 3ZZ0A 3RUBL 3R5JB 2IVYA 1HNWJ 3MXHP 2BKPA 4DV2F 1IR1A 1IXKA 2M8HA 2FJVA 4OX9F 3BQ2A 3F41A 2YWKA 3C6TB 4ETZA 5T41A 4NZ0A 3L9ZA 1RWMB 3GP9A 1JLGB 2VKRA 1Y00A 3G6ES 3EZOA 3KLGB 4F02A 1VLOA 2E1CA 2WW4A 1IJEB 2ZH4A 4HT7A 4OYPA 1T11A 1B7YB 3MOZA 4RR5A 4Z2XA 2AP6A 2W9BA 4JUZA 4AT1B 2KXNB 1RDRA 1RT1A 5E3CA 3CDWA 3NLCA 3TA1A 3BBFA 2UXDF 1T03B 4NI2B 2FVPA 3GIMA 3I9V9 2KHCA 2BKNA 1QAYA 1VQOS 1QE1B 1S1XA 1MROA 3BPSP 1ZTTA 1CJTB 2DD8S 1DAXA 2FLPA 4CH0S 4Y00A 2XMKA 5A2QU 4DL4A 3P6YC 1TKXA 2YWFA 1B3TA 3OLBA 1K1SA 2Z4PA 2HHVA 2VPXB 3THPA 3QGIA 1NHKL 2RRAA 4ANDA 1I94J 4K7QA 1XMQJ 3PTWA 5J2QA 1W25A 4Q43A 2E66A 2L41A 1VC6A 4C8NA 5D0RA 5KFDA 2UUWA 1X5TA 3RW7A 5F0WA 3G8TA 1FA0A 4DG1B 3KNGA 2XGPA 2OTJS 2BACA 2OPQB 3W2VB 4B9TA 3M7VA 2H4WB 4WE1A 3O8WA 4NASA 5KFCA 3O2IA 1WSVA 4U7CA 2BVZA 2DEIA 5KFQA 4CLUA 4HVZA 2NQPA 4ZVGA 4F25A 1R0AB 1PYSB 4BCAA 5A0YA 5JMNA 2BQ3A 2I9SA 1CS4A 4ECXA 1Q5VA 2X3GA 3LP1A 4JI5J 1JB0C 2OHDA 2NXJA 1YK9A 3CCQS 3NOGA 2PEHA 3G6XA 2VJVA 2HNYA 3FRYA 1X5PA 2YNFA 2AHOB 4OI0A 1VBZA 1TAUA 3FZBA 4NYPA 3QT8A 1U25A 3NNHA 3PHTA 2UXCF 3HSZA 2DH7A 3T6BA 2OMLA 4MJKA 2HFVA 4DV7F 2HEKA 2J0QD 3A3NB 3L7PA 2ZC3A 2GVDA 2A18A 2IJFA 3FCHA 3AQOA 1NK5A 3PM9A 5HJYA 2FLNA 5C2CA 1KQSR 3CJ5A 4USIA 4WYWA 1RU1A 4GO5X 2MHEA 2ZZMA 4FNHA 1JJ2R 2WONA 1FJGF 1C1BB 3QAEA 4NMLA 3M2VB 2PA8D 3AJ2A 3OHAA 5GAEU 1PYOB 1LWFB 4JI8J 4IRCA 2QT7A 5EX3A 3RB4A 5DZ6A 2IC3A 5HQMA 3GYGA 2DNRA 3CD5A 2MKCA 4L75A 3HSDA 1HBNA 4YEAA 4YY3F 3GFHA 3T6JA 5D78A 2VBYA 3N6LA 3NEKA 4LBHA 4EO8A 1Y11A 2JVOA 2LDIA 1RAAB 1DQ8A 1NH7A 4AL7A 4OYIA 2ZUGA 4TLQA 4USUA 1RTIA 2NR0A 3GV5B 4FPRA 1CLFA 1JLAA 1VRTA 4MIBA 3OPKA 2UVVA 4I2PB 3L7UA 2XYGB 1XR5A 3RG6A 3D67A 1D8ZA 1A6LA 3HHLB 1T0TV 5A8KA 3ZXWA 3QO9B 3EGNA 1JLCB 1U1PA 4O3SA 3BM7A 1BQMB 4X4UA 4H4OB 3LQVA 5CZXA 1XIQA 1LOUA 1LK7A 2CPJA 4ED1A 2LU1A 4R25A 2OGUA 3BBCA 1NM2A 4H4KC 4AL5A 4CYUA 2R7XA 1U1LA 1VQ7S 4ZIVA 1IKVB 2GGPB 1NK8A 1FXRA 3FBBA 1CQNA 1OYEA 4HHHA 4M63A 1UWAA 4GKKF 4G6VB 2HQGA 3ADAC 5IV3A 4W98A 4ZHRB 4NPOA 1UEUA 2Y1LB 2J8AA 1FWKA 1TL7A 3G8SA 4KKOB 2FD2A 2EC2A 2N4DA 4GKJF 5B0DA 3M8YA 2E9TA 2E7WA 2XG8A 3J80U 3DRPA 4F0KA 4ZPBA 2P6SA 1RAJA 1LWCA 3RAXA 1RU2A 2DH9A 4ZJLA 1JXEA 1NAQA 3JSMA 2E1PA 3NKYA 4OHZA 4OZLA 5C42A 2Z57B 2KG1A 3S7RA 1P9YA 2V69A 1TL1A 1KBRA 1U0HA 1OY8A 1AZSB 1MWQA 3M8QA 4QW9A 5EHHA 4DL5A 2ZJQQ 1LW2A 3V5RA 3C8YA 1V5VA 5FIIA 4ZDNA 1K0VA 1AT1B 2BW7A 4G1QA 3HKZD 1ICEB 1ZH5A 2ZNZA 4JI7J 2V6AA 4ZP9A 1VQPS 1SXLA 2DTJA 3U7JA 1M1KT 3ZC4A 5KG5A 4IH5A 3CC7S 1F1BB 3H90A 1KFSA 1KQKA 1F60B 2BKOA 2XCAA 1HQUB 3CJSA 3T5HA 1Q81T 5HLFA 3SDEA 3MCSA 3H7HB 3LH2S 2JC1A 5CYMA 1MMLA 2ZH1A 4DPXA 1R43A 5KT2A 3CWJA 1S1WA 3IA0A 5DDPC 4LSNA 3KTQA 1XK8A 2AGQA 1NDCA 1LFWA 5C2GA 1SJFA 4NX9A 3KXDA 4X65F 1NNDA 2QL7B 4RO0A 3D6MB 2IJRA 1LW0A 2UVWA 1NB2A 4N8NA 3GB0A 3WIUA 5KFXA 2BYCA 2XWXA 1W26A 4O4GA 3RR8A 3BO4A 3GMGA 1RCXB 2YQ1A 4ICLA 4OV6A 1S6QA 3Q8VA 1RI7A 4DV6J 4ES3A 4DR2F 1NDKA 2RILA 3OFFA 4CLTA 4ZJOA 1OSCA 2GCFA 1B0PA 4G3IA 2M9KA 3Q8YA 2HSEB 1KD1T 2AJ2A 2VICA 4QW8A 1U6ZA 1IKXA 3RTVA 5HMYA 1IBMF 2Z2YB 1ZAWA 3C66A 3OTCA 3R5BA 1YRXA 3MEDB 1NB7A 2F5GA 3N28A 3Q0AA 2GVZB 2IDLA 2XC9A 4OYAA 4LIWA 3ZTSA 2QMXA 2JRSA 2K3KA 3T1YJ 5J1NA 2CNLB 1QM9A 2LFVA 4KBIA 1JQGA 3PXGa 2UUBF 1KTVA 3OTBA 3C46A 2H5IB 1WI8A 3PRVA 1J27A 1ZBTA 2GX8A 3HVRA 5KG2A 1CULB 4ELVA 4RUAA 2IVFB 2F8HA 3DC2A 4ILMA 5D0HA 5KT3A 2BABA 2RF2B 2XSJB 2DNQA 5T7LB 2CJQA 3DRXA 1TELA 4YS2A 2YWGA 5GMEA 5GADI 4C8OA 2G9OA 2MEWA 4NLDA 2JSXA 4KH0B 3MMAA 3WX8A 1T3NA 1UFLA 1HBMB 5KFBA 5F0UA 3PW0A 2N3LA 1AUSL 1YJRA 4HYKA 3OD2A 5G0RB 2QC3A 1TV6A 1Y4ZB 3IO1A 2YKMB 1TVRB 1ZM2A 3DOLA 2CJXB 3W7BA 4CO5A 3IR6B 3DLHA 1S76D 2B7CB 4DL3A 4F2SA 1FNMA 4B3SF 1YZ6A 4NOHA 2Y8WA 1FFWB 3OUYB 4ZLNA 3HULA 2JJ4D 2CQ0A 2ZITA 4LIRA 3CT9A 5J1EA 2OEKA 3K5PA 3PEHA 3QRPA 4LVOP 4LSLA 1BE4A 4N77A 1EAYC 4C8MA 2CA9A 3C14A 4BWMA 4DR3F 3DKDA 2JEJA 4ANCA 4RW9A 4WK3A 3DDNA 3J81U 1R0CB 4Z37A 1U48A 2K1RA 4H54A 1WELA 4DDFA 3TWZA 3KLIB 4CLLA 4ATNA 3C16B 2CADA 4K0KJ 4OYOA 3ILJA 3BS9A 1RTJB 2V68A 1W2BR 2A6MA 2RQKA 2RUSA 5DGAA 3LWMA 3TJ9A 4UUWA 4LFBF 2IA0A 1JLQB 5CHCB 4M5JA 4CIOA 2QTWA 1NJIT 2EFNA 5AJ3J 2GC8A 4P9SA 4DR7J 3MUTP 4DV3J 5D3GA 1LWEB 2XEXA 5CYQB 1N34J 5HJXA 1C0TB 3HDSA 3ZNUA 4OYXA 1D1UA 3K59A 1SL2A 3HSJA 2K06A 1R0BG 3MCOA 4LF9F 1FF2A 2R2RA 4DZ6A 2CUYA 4YHHJ 2WOMA 3F56A 1S9EA 3VGSA 1S1TB 1T9XA 4LF4J 4E98A 2A1BA 2UU9J 1U8WA 1WOSA 2CPXA 4J7CA 4OHVA 2LEPA 4NRTA 4NA3A 1S99A 3CJTA 5IWAF 1XNQJ 3NNCA 4I6WA 4RNNA 4ANEA 2DXDA 3DOKB 1Y5LB 2OJ3A 3MMBA 2L9NA 4X62F 2FJBB 5LM7E 3L3CA 4E0DA 4LRFA 4PQAA 1QAJA 5D0GA 2CPYA 6FD1A 1IKWB 2ZM6J 3M6WA 3HD1A 2QLXA 1BXNA 2W4CA 1HYSB 3VGVA 2W7OA 3CCZA 4YFUA 2KYXA 2ALZA 3H40A 3KUGA 3GIIA 3HT0A 2E7VA 2OO4A 2FY8A 1QDUB 5SUHA 2G1HA 4C0BA 4F4ZA 4JI1J 3OR1B 4DOZA 2OAUA 3D2WA 4X2BA 5IXUA 4LR9A 1FI4A 1ZTWA 5HANA 1CJKB 4YB7A 3OFGA 1TKTB 3N9UC 2DITA 4FBTA 2C1EB 2BDPA 1R8AA 3H4BA 7FD1A 3OJSA 2YX1A 4M5DB 4JI4F 4FYVB 1SQEA 1OY6A 2QZ8A 2WAQD 5F8NA 3I0SB 3TR5A 1IBKF 2M8DB 2M0GB 5FDLA 4UTGA 4F04B 1B7FA 2G13A 2ZH9A 3U27A 3RRGA 2ROGA 4JI3F 2FHJD 3I32A 4KPCA 2ZHOA 3OXLA 5E3RA 4IYQA 1VOMA 5DZ7A 4IG3A 3EE3A 4WFZA 3M8PB 1S1VA 2MSTA 2QA4G 4KHPJ 3W5YA 3D0HE 2DCLA 2CRLA 2H51B 2VJUA 1U45A 2EPIA 5F9NA 4O4RA 3C3LA 3GWCA 3I5BA 2Y0SD 3SCIE 1Q53A 3IN5A 2GJFA 1WDTA 3SXLA 5CCLA 4YN3B 4ZPTR 2MZRA 2XULA 4LR7A 1SJ1A 3SYZA 2OD6A 3VAGA 1SL0A 3TP2A 1PYTA 1S1UA 4UOFA 4HT5A 3G2XA 5CD4H 1NDPA 3QRRA 4IFYB 3UN2A 2NSBA 4DSLA 5J2PA 4X4SA 4M95A 2HHTA 4ECWA 2K8GA 2UVRA 1ZZNA 1HNXJ 1UPMB 2HHHF 4DI6A 3GTYX 3H2LA 3W9HA 5DDOC 1K1QA 1K47A 4A8XA 4RUBA 1QSLA 1ZAVA 4MYTA 3UO0A 3IS9A 2HPUA 4J9VA 4DN9A 4WZMA 1TK5A 1VFJA 4C97A 2LQ9A 5M2RA 1SC1B 1SCJB 4DFMA 1AW0A 2DNNA 3IC1A 4OFZA 5ETOA 4E8UA 4FYXB 1DURA 5LMNJ 4V19J 3EICA 5HK4A 2HFZA 2CPFA 4O3QA 5CH7B 3PYFA 2R7SA 2D3ZA 1DARA 3G71S 4YR0A 4HL9A 2BE2A 1Z4UA 5E3PA 3M9MB 1TUVA 4UZBA 2QYCA 5I3PA 2GV1A 3EM1A 2DH8A 3LO3A 5KT7A 1GTEA 4PR6A 2H4YB 3TNVA 3LALA 1HMVB 2I38A 4LF5F 3FCVA 1G7CB 1UEVA 1RT6B 3IMQJ 2HMIB 2V9KA 4NLOA 2SXLA 3AA8A 2F3JA 4IFVB 1WNEA 2PFFB 3PRDA 1OJ4A 2R2SA 4ZPAA 3RGIA 2KFYA 1H7WA 2HFSA 1GAOA 2ZC4A 4OJ3A 4OI2A 4QPXA 4C8YA 1QE1A 3JAMY 4RW8B 2QMUB 3Q83A 5CA5A 4ECQA 1SVDA 2F4VJ 3LAMA 2QSWA 3OBIA 1GMWA 5J2NB 5J1PA 3D1OA 4Y6IA 1TL5A 4WP8A 4S0MA 3FRZA 1WHVA 3KUEA 2J7KA 3SCLE 1Z2LA 2OSQA 4UOCA 1F3VA 4RUHA 3MM7A 4LBIA 1PJ7A 3QJPA 4TXSA 2JNJA 1Z1ZA 1N33F 3RRKA 3V6KA 3PCOB 4KT0C 3DHXA 2XWYA 3OXGA 3HHNB 3DGPB 5CABA 4IH6A 4ELUA 3JTOA 5KFVA 3ZZUA 2OPQA 1N6QA 1RISA 1XMQF 3AH6A 1RA6A 1RP5A 3OW2R 2DY9A 2W01A 4DFJA 5DETA 4KSEB 2J0SD 4FKXA 3A13A 1RABB 1NKEA 3UN5A 2KG0A 4IQXA 1FDNA 3V6HA 4DR4J 4CDIA 5F8JA 2DHAA 4CLYA 5GAHU 4L3KA 2BEFA 1VRUA 2KM8C 1FERA 1SB6A 3MURP 1WEYA 4YUDA 5EDWA 3GLJA 3M2UB 3PFOA 3I4HX 4PWDB 4TLRA 3RR7A 3NGRA 4DL7A 2QA2A 4X4QA 1XQIA 5KFKA 5DG8A 2FHOB 4JI5F 2FVQA 2QLFB 2D69A 4ZIWA 4UQGA 4KRWA 3S01A 1RBLA 2F40A 4DR5J 3LWLA 4KE5A 1FESA 1SBRA 2R7WA 4XTTA 2XMAA 3QAUA 4CP5A 2BRLA 4DSFA 1XMBA 5AXNA 4ECUA 4DFPA 2RKIA 2ZEJA 3OFEA 3QLHA 1WTBA 5ETRA 1EETA 5A8RB 1CQMA 2J7WA 2HZAA 2E5GA 2R8GA 4O3NA 3TEGA 3M2VA 1X4CA 2N3OA 3AD8C 2HHWA 3CTRA 1RYRA 2HFUA 2B4OA 3EPGA 4M5KA 3BSNA 1VQLS 3NWGA 1LWFA 2C2RA 2YKAA 2UXBJ 4YB5A 1QJHA 4Q0BB 3C15B 1FJ7A 4L73A 2B3TB 5K5MA 4PABA 1VK8A 2ZDPA 3TVYA 1FK9B 2AWZA 1YJ7A 1X60A 4CLPA 2CAJA 4OYMA 2ATCB 4FS1A 4DPTA 1M1GA 2CIMA 1VK3A 3ETOA 4RL1A 2D9OA 1WC4A 3RAQA 2ZE2A 1NJWA 2D9PA 2KFNA 3OHBA 3TW0A 1URNA 4DV1F 2DPIA 3ZO7A 3D0GE 5LSLA 2BZ2A 2IMWP 2W1BA 4J9QA 1OQ3A 2J0WA 3J80Y 3H2VE 1IJFB 3C6UB 3Q89A 2LMIA 3LW5C 3D0IE 2GA7A 1IBCB 3IRXB 5HBMB 4OZ1A 2V8VA 5FLXU 3NG8A 2VKZG 3MD3A 3DN9A 2DGXA 1UFKA 2HHSA 2F65A 4NXNJ 1HBOB 4WP3A 2VBZA 1S49A 2BMBA 2ASDA 4I6YA 3EGZA 4R0EA 4JYAJ 4QZVB 4YB6A 1DJ0A 3M6UA 2E5LJ 4OJGA 1X0FA 4ZVTB 1KOOA 1K73T 3PG9A 2ATLA 3CB4A 4OI4A 2R2UA 1IKVA 4CQ1A 4HR2A 2W24A 3UCUP 2QFIA 4CH1A 1H98A 3NAIA 1KOHA 1FT8A 4GC6A 4ZHRA 1UMJA 4QYZK 4FYWB 2W9BB 4USMA 4KKOA 4RU9A 4JBCA 1I1GA 3K7RA 1D9DA 2HWTA 3VZIA 3OSNA 4DX6A 4PZVA 2Y8YA 4ZPDA 4HTIA 5D4PA 4EMDA 1SC3B 3BV8A 1MROB 4ZA1A 2HFNA 1RAFB 2M3DA 4PG7A 3M8SA 4ZLLA 4P2SA 4WFNQ 3A8KA 2NREA 3KLHA 1AZSA 3GR0A 4NLUA 4DUZF 2PE8A 2FUG9 3V4IA 1YIJS 2R7RA 1MNEA 2VBWA 2QL9B 3TO8A 4JV0A 1TTHB 2H54B 3W63A 1NMEB 5J2QB 3WHIA 4N76A 3BJYA 4AQYJ 4HHUA 2YKPA 2CQ3A 1UPPA 3DOMA 2CQCA 2OPSB 5D15A 1UVJA 3ZFVA 3P45B 3CEDA 4FXWA 3U1NA 4CT8A 1B0TA 4U6PA 3HHKA 3SSRA 1VS3A 4YB1P 1RTHB 1UJ6A 5KFFA 4WE1B 1LK5A 2B4UA 3VQSA 1IQTA 3I55S 3ONQA 2LXIA 4FS2A 2FVRA 3NS7B 1MG7A 2Z8QA 5ADZA 4MYUA 3CCES 2CZVC 3GILA 3GIJA 2P9CA 5DLFA 4LF7J 4DQQA 3D6TB 1N32F 3DRSA 1N0UA 1CS4B 2LP4A 4C0OC 1T8EA 3AXMA 4ZCMA 3H5YA 3BN7A 1D8YA 3UD4P 4Y65A 4QYRA 3BDPA 2BOPA 2QG9B 3CNQP 4IOBA 4YDXA 4B3RJ 3M2RA 3AB2B 5FD1A 1AB8A 2HNYB 3ZTPA 2R3VA 4PG8A 2ZJRQ 2YNFB 1T9WA 2YH0A 1TL4A 1YRTA 1LEOA 3NGTA 3ZZOA 2IM2A 4NL5A 2MPUA 1QTNB 1Y3KA 1X8DA 4ZVOB 4F0MA 2X1GA 3HF5A 3CVKA 4L3NA 2AKWB 4XO0A 2R4FA 1REVB 4DR6J 5LJ5Y 4YR2A 4DV6F 1N5SA 4OYZA 1S59A 2GVDB 3A8IA 4TQSA 2HFOA 2B6AB 4I6AA 2M4MA 3W5ZA 3ENVA 4OLOA 3MFHA 1FKAF 5BYRA 2Z2LA 2EFGA 5LXRA 1T9VA 1FDBA 3RU0A 3BH7B 1WDDA 5BR8F 2RD5C 1J5EJ 4LJMA 5AXMA 5LOQA 2YNGA 2IC3B 2OD4A 4IOAQ 1KHVA 3N0VA 4GVBA 3V6DB 3CIMA 5CYJA 1EARA 1KS2A 2ZOFA 2EEYA 1HBNB 1Z2ZA 4QU6A 2K2PA 1VLYA 3B82A 3SFUA 1RHUB 4WXOA 1EB0A 1RHMB 4JV5F 2YX4A 3H98A 1GMWD 1HIYA 1HI0P 1G6BA 2CG4A 5KT5A 3AT1B 2XI3A 2GFFA 2J9DE 2BBEA 3K5OA 5AE1A 1JLAB 1TMJA 5BYQA 1VRTB 2PT0A 1TL3B 1N54B 5J2MA 1R8PA 1S12A 4RWWA 5IM0B 3FBFA 3OJUA 5A8KB 3OTOJ 1Q0NA 1BQNA 1DLOB 2VQEF 2MYFA 4LF8J 1FEHA 2E5IA 2VC1A 3E3XA 1HD1A 1N5QA 4RJVA 4TY9A 4KTQA 4B08A 2POKA 1QLNA 1N5TA 5E3AA 4DF4A 4JI2J 3KFWX 3NRBA 2GAHC 2YXLA 4CYUB 2UVUA 3GJSB 1VHFA 2MY8A 1JLQA 1IWAA 3TUZC 4DV0J 3MM5A 1VQ9S 2C2KB 4DS4A 2A6OA 2EBGA 2KYZA 2G2ZA 4WWSA 3NMAA 2BV3A 1WC0A 2MKKA 2N7YA 3MMCA 4IUFA 1JLBA 2DCUB 2DJWA 3FSIA 3TQEA 1V9OA 1HFEL 3D68A 1H74A 4LQ3A 2K7KA 1TL7B 3MMJA 1WG5A 1V3RA 3MPWA 4KAIA 2MLYA 3OV7A 5JUMA 2XY7A 4PUOA 3VVTA 2CG8A 3DRPB 4LBPA 2ACMA 3MCMA 1ZA1B 1XJWB 5KFRA 3G96A 1S1TA 1LWCB 2WSCC 1S7HA 2HZCA 3JSMB 1R8HA 3NS6A 4B9NA 1DFDA 2BW2A 1VQMS 4DLEA 3TZZA 5ETTA 3NOCA 1Y5NB 3AODA 3CJ3A 1TL1B 2W2PP 1U0HB 2DNKA 3DOKA 4YHHF 2MLZA 4F50A 3HHDA 2DGWA 4ETXA 5IC6B 2MB0B 1A9NB 4QR0A 1FRJA 3E01A 1S9GB 2BA9A 3QPIA 1RWUA 4HH1A 1UETA 2CJKA 1HYSA 1R8CA 3IR7B 2PC6A 3DLKA 1ULRA 1PBUA 5CCMA 2W4PA 4L76A 3MI7X 2O01C 2HNZA 5K9FA 2PMWA 4B3MJ 2APOA 4A8FA 1QAXA 4N41A 4OI3A 2DGTA 2PA3A 2PMZD 2MZ1A 4TU9A 5CYMB 1U2FA 4HHJA 1S1WB 1VJQA 4LSNB 3D3BJ 3TARA 2XMMA 1BUXA 2H3EB 1XR7A 3VTIA 4CLWA 4J91A 4M8LA 2E1AA 4LFCF 1NSQA 1LW0B 1NJZA 2WVCA 5GVQA 5B08A 1NZAA 2V2ZA 3K5NA 4O4GB 3R7NB 2W8LA 2B51A 3EVOA 2QA1A 2EK1A 1NO8A 1S6QB 3W65A 5KOXA 2V50A 1SH2A 3G6VA 1SC6A 2NS1B 1WSRA 4U9RA 2Q79A 2FIUA 1Q8KA 1IKXB 1VC5A 4FP9A 2CXEA 3KJVA 3T9ZA 1YJVA 4ECTA 4X4VA 2Z30B 1KR4A 2Y9HA 2PFDA 1XWLA 3CCLS 3D3CJ 4RKUC 3LPYA 3AOAA 4OQJA 2MQ8A 4ZP6A 2O66A 4NXMF 3PV8A 2NXUA 2VOOA 2YY3A 4OLPA 5DLGA 1MLAA 5HO4A 3I5CA 2RQ4A 1RT4A 5T14A 4FYDA 3VAJA 4CWBA 4DQRA 2VFUA 1JLEB 2C22A 1RWKB 1VQKS 3KHRA 4URGA 4NLWA 1V5IB 1K0TA 2VV5A 3M6XA 2WSEC 4MK7A 2ZWPA 2XQCA 1BY9A 3MMAB 4Q8EA 3TX8A 2JC0A 2CJAA 3BQ0A 4QWAA 1X4EA 1HKAA 2ZFHA 4ZVSB 1TQLA 1TV6B 3I9ZA 5LT5A 3DOLB 4X64J 5KFHA 1V6HA 2BXJA 1G1XA 1H3DA 2EVZA 2QA4S 2XTJP 2VDIA 5KAKA 1FRXA 1X5SA 5L39A 3M8ZA 3KYLA 1FRMA 2OMOA 2VQFF 5J1EB 1SJRA 3W5XA 4LSLB 3UW1A 5A76A 5L8RC 1NHVA 1HR0F 4LFAF 2HVHA 3KK3B 4CTAB 4WFXA 3FMBA 5F9LA 3AD7C 4U7UD 3M1VA 1RK8A 2HMIA 2K1RB 4RZRA 1CJUA 1IWGA 2C2EA 1RBOB 4ZLJA 3HSGA 2J9DA 4IFVA 4RX6A 1YI2S 4F7VA 3MF5A 2XNRA 8AT1B 1TKZB 3JB9k 2GMHA 3FSXA 3GZ7A 3KDNA 3KWMA 4PG5A 1N36F 2A10A 2HGLA 3CCTA 4KIAA 1X9MA 2G2OA 4MAKA 2MKSA 2C3YA 4QWBA 4HEA9 2A0FB 4DEZA 4DFKA 5D3GB 4YOEA 3R97A 1QUPA 5IC4B 1JMTA 3CCMS 5DRKA 3O1LA 5DM7Q 4OJ1A 4RW6B 5BXIA 4DV4F 4QJVA 4NEZA 1VIXA 3I5AA 3QWUA 2UUAJ 2WOMB 1OY9A 4DV5F 4WZQA 4AXJA 1PAUB 1S9EB 2ILZA 3V2UC 1R27B 2M52A 2F4VF 3BYRA 3ZTOA 4CLKA 3HHLC 4WFYA 1V3ZA 2RB7A 2KVIA 1OPZA 3DHWC 1FKOA 2UP1A 1RBAA 3EDRB 4YQWA 3MMBB 3WX4A 2KN4A 2PMHA 1PCAA 5THWA 5ETLA 3PW7A 5E2QA 4DZDA 3CJ0A 2L48A 3CO9A 2CPEA 3QRQA 3KDOA 2IFXA 1T94A 1JJCB 2MY7A 4PG4A 5LL6d 2EKYA 2HLTA 1PJ5A 4AE5A 2GAGC 1IBLF 3THTA 4BHQA 1VHIA 2R8HA 4ZLPA 3RYLA 4D3GA 2OUGA 1B64A 3HZEA 3FQLA 3MTJA 3CXCR 5A8WA 1QD1A 1SJ4P 4XDDA 4ID8A 1X4DA 3MAAA 2PSZA 3PR5B 5KG7A 2VC0A 1URRA 1CEZA 3FCWA 4DS5A 4ID5A 4DR4F 3GJTB 2I5JA 2LYVA 4OX7A 1TR0A 2HRYA 5KFZA 3UNGC 2HS4A 4FVCA 4ZITA 2D3UA 2GS8A 4QWEA 3GQCA 4B9UA 2WB4A 3VHQA 3T1AA 1SI9A 1WF1A 1H2TZ 5FDLB 2X51A 1RSCA 2VFRA 4KC5A 2QMWA 4ES2A 1FWPA 1VQ6S 5HSPA 2BRKA 2V67A 3I82A 1HNZJ 1L3UA 3BGUA 3K8WA 5A8RA 2EG1A 3IGNA 4CO4A 4IG3B 2LEBA 4DV2J 3K2YA 1CG2A 2UUCF 2NZ4A 2HURA 2DT9A 2IJNA 3Q8RB 4Q0BA 3C15A 1H7XA 3U1MA 1FK9A 3RBEA 2KT3A 3CDAA 2ZH5A 3SV4A 1WF0A 2QN6B 3QGGA 1EX8A 4ED6A 9RUBA 1NSPA 2HLUA 1QVFR 5HVGA 2J6TA 5EGYA 4F4XA 2JX2A 5GADU 2DR7A 3N79A 3PVXA 2WVEA 2H1YA 2UXDJ 1H73A 2DNLA 4URSA 4IG0A 3T1HF 3WZ0A 1NHUA 2IRUA 3IS9B 4IRKA 2BJ8A 4J9MA 3WDOA 5KFAA 2BR0A 3OL9A 2CQ4A 3UDCA 5BJRA 2IY5B 2JEIA 4DUTA 1SH3A 3ET6B 5IZHA 3AB4B 3JQKA 2WTFA 2O1PA 5KFYA 3B4MA 3PNIA 1SC4B 2XO6A 3D54A 5L1JA 1NJYA 3HM9A 4KB7A 3GYXB 4R5PA 4GRSA 1UWBA 4MIAA 2BE2B 2XYHB 2GMJA 4J9UE 3CPWR 3EX7B 3DYAA 4IQMA 3KHLA 4EZ6A 4QIGA 1ZYQA 1UW9A 3LGNA 5KG0A 1FVSA 3AXKA 4LRAA 2QE5A 4PYAA 4YR3A 2GNKA 2RT3A 5GAGU 2E5JA 4DCJB 1TP7A 2C2DA 5I4MA 2HWIA 3Q2SC 1BLUA 3GSDA 4U8YA 1IKYA 3E51A 2DR5A 1G2EA 3QQCD 2CQHA 3WQPA 1VI7A 4ZPWR 2XNQA 4F4YA 4CI0B 1YJ9S 1O6XA 2BE7D 2CQGA 3WC0A 3PHEA 1L3SA 4RU2A 1N4LA 5CD4A 3QZ7A 3SV3A 2NZCA 3IM8A 1IR0A 3BSCA 2ZJPQ 4MTPA 4C48A 4K4ZA 3MEEA 1FRKA 3J81j 1IM6A 2AJ4A 4RNOA 2XSFA 3KK2A 2LA6A 4ILLA 3J7AN 1S79A 5LSRA 3MM7B 4WFBQ 1F0XA 1NPRA 2D3O1 1FO1A 3BQ1A 3NGDA 4DV7J 2ZZTA 1Q86T 1D9AA 2V4JA 2BJDA 2EWHA 3CMAS 2OPSA 1IVZA 4WXWA 2R9LA 1FRLA 4Q2MA 3MD1A 1TFWA 1S6PA 2OTLS 3M9NB 4A46A 1T02A 1OO0B 5HATA 1RTHA 1VBYA 3GSIA 4A8KA 1VRQC 1FJGJ 2Q43A 4R8UA 1N6QB 3D7SB 4F0HA 3W2WA 2HW3A 1RYSA 1XR6A 5KFMA 3TAPA 4QIWD 5KFEA 2DGQA 2Y0BB 3TUIC 4BLGA 3M4XA 3JQMA 1YRUA 1M5HA 4XIUA 4C4WA 4A8MP 2N7CA 4J9NA 1FX2A 4Q45A 2Q6CA 3UE2A 1M90T 2CJYB 2VA3A 1WF2A 1P1LA 2HQ3A 4YY3J 1VRUB 4OJHA 4IR1A 3D5MA 4DCPB 3MEKA 4Y2AA 3OR2B 2FZGB 3M30B 1RE1B 2CKWA 1VBKA 1Y10A 1GQEA 2B43A 4ZVQB 2DYAA 2GO9A 3UD3P 4QQBA 5I3UB 5DQIA 4ED3A 3BKTA 2FY1A 3D9BA 1REVA 1NK0A 2AEMA 2MKJA 3A3PB 3ZZYA 5DQGA 4KQZA 2B6AA 5H9EJ 2PD1A 3D6FB 3MAQA 2LECA 2RKIB 4UOHA 4QBUA 3QLHB 1EETB 2K7JA 2C2MB 5B0GA 3DLJA 4WF9Q 4ZKAA 4DR6F 3PW2A 1S6UA 3PIOQ 4EFAC 3T5JA 4WIIA 4I4BA 1GMUA 2FHMA 2JH3A 1XTZA 2AW0A 2FJXA 3MM6A 3BREA 1IQZA 1SKSA 2XMVA 2VFTA 3V6DA 1X9WA 1M5SA 5MAOA 4GKKJ 2G2YA 3EVWA 3MECA 3MUMP 1BQXA 1YSJA 2R8KA 3HD2A 2ZE2B 2FDNA 1OS5A 2D7SA 4HH0A 4B3TF 4GKJJ 4DWIA 1F9FA 1RT7B 4FVMA 3ICLA 4CO1A 1NK6A 2D1CA 2GHVC 1Q82T 1TL3A 1N48A 3QWPA 5L9XA 2CPZA 1M1HA 1NK9A 2KRRA 1Y3JA 5IM0A 2G0IA 5H9FK 3CULA 3VV2B 1YVFA 1NXIA 2FHJA 3BKFA 4P10A 3QSYB 1S0NA 2YPYA 3G87A 3QIPB 3HT3A 1DLOA 1LQ9A 4D3HA 3ISND 3IG1B 5G4DA 2PI4A 4UT4A 3W1YC 2XM3A 1D3WA 1FVQA 4TY8B 5IT9U 4A8SA 4ENOA 4NLPA 2R7VA 3R5AA 3K17A 4OYBA 1WC6A 4NCBA 1RAEB 4X84A 5ETVA 4OZJA 5KFTA 5DG9A 4LF6F 1VIOA 2RVJA 2BQUA 1LXNA 2WHOA 3TJAA 1ZPWX 4P72A 3I31A 2RDJA 1C2PA 4X65J 1RKIA 3PIPQ 3KMQA 3K57A 2EXUA 3JTPA 1C4AA 5L1KA 4NLTA 1H38A 2CQIA 2OFGX 3ELHA 1HNVA 3OXFA 1XEZA 1R6YA 2NXNA 1YX2A 4M1KA 4TYBA 4DR2J 4O3OA 2H5EA 3EJMA 3KLHB 4ZN3A 5HQLA 1HHSA 3V4IB 2Y3YA 1RKJA 4K59A 5DJBA 1S9GA 4Q2LA 4M5HA 4DL6A 2F9JA 1IBMJ 4J90A 4AXIA 4I69A 4QIEA 2L9DA 3CC4S 2C28A 5ETMA 4OX8A 3DOMB 4X66F 1VBXA 1KVIA 2QIFA 1HBUA 2V63A 1P6TA 4FXDA 5JVGQ 3AD9C 4ZK7M 2UUBJ 5LMUJ 1TUGB 3A8EA 3SQGA 4F8RA 4P73A 1UEKA 2VDHA 2W2MP 4JI6J 1ZOTA 2BJEA 4I7FB 2LXFA 3CDBA 1HPZB 2RHSB 1BD6A 2FLOA 3Q24A 2X1FA 1NJXA 4B3MF 5KOWA 1SIWB 3ZZPA 2IHR1 1WC5A 5ETKA 1PC5A 3DRSB 1YG0A 3MDFA 4C3KA 2ABYA 4TQRA 3KLVA 2FPHX 2ASYA 3M2RB 1KKHA 2ZH3A 3FDSA 2HAIA 3G86A 4EGLA 3K0JA 4B3SJ 4O0IA 4KGMA 2Y1JA 1C4CA 2YBVA 4MT1A 3LAKA 2DHHA 4JI0F 2AF6A 3KK1A 3M9OB 3LANA 3H4DA 2AX0A 1VQ8S 4NYOA 5CAAA 4DR3J 3AQPA 2DNHA 3BGFA 2LLZA 2DIUA 4QOTA 3W64A 1X4BA 2XZDB 2B5JA 2NXEA 4ECSA 4F3OA 2KU7A 4N56A 2RAQA 4LT6A 4XK8C 4PAAA 4ECZA 4CCHA 5F8MA 1JLEA 2ZBRA 2HK2A 4CO0A 2MGZB 4OHWA 2MJUA 4C98A 3IWXA 4LFBJ 3CSKA 1NRKA 1CVJA 3UPFA 1RQ0A 1S77D 2YNGB 4DXLA 4I0WA 5EWGA 3BZQA 1PAEX 2XCPA 2ZOGA 3PRBA 4P2MA 3IFEA 4GVBB 3N5FA 2G1DA 4ZS6A 2FJAB 3GIRA 1ROFA 2GZOA 4C8ZA 1XMOF 3AJ1A 1YJNS 4Q44A 2HGMA 4ILRA 3TANA 3N01A 4MKAA 5E41A 4P7TA 3DLGA 2JLEA 3ILIA 3H2UB 3PYDA 3FFIA 3JQJA 4JV1A 4RW4A 2VHGA 4JP8A 4LF9J 2AYGA 2RE1A 2JEGA 1F2HA 2RIJA 2QLWA 2YWWA 3KLFB 3BH6B 1XNRF 2YWHA 3ETMA 5J2MB 4J5OA 2DEJA 4A8OA 3L4BC 4C3LA 3B54A 4K2XA 2CVIA 3CW2C 3HKWA 5IWAJ 3KK3A 1RA7A 4CTAA 3KOAA 1BQNB 4PXBA 4NCGA 5HMXA 1DTTA 4X62J 3ENWA 2ZZNA 4ED5A 2W2OP 3NBPB 4BWJA 1B0VA 1F2GA 1C0UA 5GAGI 4A8WA 1TKZA 4LUBA 3OVAA 2ADBA 4C8LA 1X0PA 3B6BA 3LP2A 4EI2A 2DGOA 2CWXA 3SCKE 3RW6A 2F8MA 2BANA 3MM5B 2KHDA 2A2DA 2IMOA 2EI5A 1HWIA 2KI2A 5GMKa 2Z2ZA 2DK2A 1JLFB 3MMCB 1JLBB 4U95A 3PJXA 1MU2A 3W60A 3SI8A 2ZHAA 4RW6A 3BF4A 2EC0A 3AOBA 3KHHA 4NLGA 1IBKJ 4PUOB 3PZPA 1EP4A 2I2YA 2MMYA 1T95A 3WBZA 4JI3J 3SEOA 1UTAA 2WCXA 1QY7A 2ZBIA 2IM3A 4CLSA 5GMDA 4K8RA 3DDIA 2IIHA 1KLMB 2P2CB 4A8QA 2MZTA 3I6PA 4X4PA 3E01B 4MKYA 2V94A 1HQEA 1KWMA 3MWBA 1M5PC 2AJ0A 2LDYA 3CD0A 3UQSA 1JNZB 4TN2A 3PYEA 3US5A 3PJWA 2JOQA 4NLXA 3CCVS 3K5MA 3PFEA 3DLKB 2VUGA 2Q66A
chains in the Genus database with same CATH topology
1R6VA 2Z30B 3A3OB 3P5BP 2Z58B 2PMWA 2W2PP 2ZWPA 3WIVA 2E1PA 3BPSP 4NMXA 4OV6A 2W2QP 2ZWOA 2XTJP 1ITPA 2W2MP 4JP8A 3T41A 2Z57B 3BGOP 2Z2YB 3WHIA 1SCJB 3GCXP 3WIUA 3CO0P 2Z56B 2W2NP 3VHQA 4K8RA 3SQOP 3VV2B 2W2OP 3CNQP 3H42A 4YN3B 3QFHA 1V5IB 3AFGA 1SPBP 2QTWA 4NE9C 3A3NB 3GCWP 2Z2ZA 3A3PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R6V A;  2Z30 B;  3A3O B;  3P5B P;  2Z58 B;  2PMW A;  2W2P P;  2ZWP A;  3WIV A;  2E1P A;  3BPS P;  4NMX A;  4OV6 A;  2W2Q P;  2ZWO A;  2XTJ P;  1ITP A;  2W2M P;  4JP8 A;  3T41 A;  2Z57 B;  3BGO P;  2Z2Y B;  3WHI A;  1SCJ B;  3GCX P;  3WIU A;  3CO0 P;  2Z56 B;  2W2N P;  3VHQ A;  4K8R A;  3SQO P;  3VV2 B;  2W2O P;  3CNQ P;  3H42 A;  4YN3 B;  3QFH A;  1V5I B;  3AFG A;  1SPB P;  2QTW A;  4NE9 C;  3A3N B;  3GCW P;  2Z2Z A;  3A3P B; 
#chains in the Genus database with same CATH topology
 3SSS A;  3TAM A;  2LKZ A;  4FF2 A;  2ASJ A;  3GJR B;  2MKY A;  3BEG B;  5KT4 A;  2HNZ B;  2CWK A;  4PQU A;  2Z56 B;  3KLE A;  3MM9 A;  4NWB A;  2M2B A;  4UY8 T;  2IBO A;  3LP0 B;  4DR1 F;  3CD7 A;  1AA1 B;  1UAW A;  3QNW B;  1SKR A;  2HHH J;  4UST A;  1U6F A;  2RNE A;  4F4K A;  2EW9 A;  2AD9 A;  1TAQ A;  3NGU A;  3W3S A;  4HDH A;  2PI5 A;  2DGU A;  1RWO B;  2JVR A;  3PW5 A;  3BSA A;  4OI6 A;  3OVB A;  1WEZ A;  4F4A A;  2X1A A;  1AFJ A;  2PDA A;  3UD5 A;  1GNK A;  2V9W A;  4WKR A;  4L6V 3;  1NDL A;  3JXO A;  2CPD A;  2FGC A;  1H0H B;  2OI2 A;  1KHW A;  2E1R A;  1T9T A;  1GH8 A;  3QT7 A;  3PX0 A;  5A6P A;  1RAO A;  4EYH B;  3D28 A;  3KG0 A;  3OVS A;  3J7Z T;  1E6V B;  3KJV B;  1C1C A;  3S8S A;  2HRU A;  2W8K A;  1X4F A;  3TRG A;  4Y0F A;  2Q1L A;  1FX4 A;  2CNO B;  2HZV A;  2FVS A;  1WEX A;  1RZM A;  4LF5 J;  3BDE A;  3K89 A;  3T3F A;  1FNO A;  4DQS A;  2D41 A;  4PPZ A;  4M5N A;  1RT4 B;  3MM8 A;  4PWU A;  3H8Y A;  1U0S A;  4ALZ A;  4EZ9 A;  2W9C A;  3H5U A;  3UFC X;  4Z7C A;  3RB6 A;  3SFG A;  1O51 A;  3F44 A;  2B9Y A;  4F67 A;  4XAK A;  2QX0 A;  1RLD A;  3A12 A;  4Y2C A;  2HVE A;  5I3Q A;  1UZH A;  3ET6 A;  2E9R X;  4WKY A;  2HQD A;  4ER8 A;  9ATC B;  5A2Q Y;  4A4J A;  1FHT A;  2LQB A;  1OWX A;  2LQJ A;  2CQP A;  1NU4 A;  3LUY A;  5EWE A;  1RB0 A;  2OH2 A;  5D77 A;  2CNN B;  4WP9 A;  4HAC A;  3D1Q A;  1T3O A;  2NYI A;  3QYY A;  1NKB A;  1H6K X;  3M32 B;  2DVI A;  1WOP A;  2IM0 A;  1JWW A;  3VF0 B;  4ECY A;  4DUY J;  3HPO A;  1N52 B;  3EYZ A;  2M7S A;  1N33 J;  1WAC A;  4NLY A;  4XDC A;  3V81 A;  1HNW F;  4K50 A;  5E33 A;  3FNN A;  2VBX A;  2LQ5 A;  4IKA A;  1RWP B;  3M1V B;  4I68 A;  1AXQ A;  1CJU B;  2ZBP A;  1IM4 A;  1VGY A;  2P9G A;  3G82 B;  5HP1 B;  3Q8S B;  3VAF A;  3LGM A;  4WIQ A;  1LV5 A;  1KSP A;  4GVL A;  1SV5 A;  2XLJ A;  2V2V A;  4DBQ A;  5HAO A;  2OEM A;  1RHQ B;  1YZ7 A;  3A1Y G;  2UUT A;  2VG7 A;  2X3D A;  1B70 B;  3PO4 A;  4FF3 A;  2MQL A;  3BGL A;  1HHQ A;  3TUP A;  3VAK A;  1FD8 A;  3D4J A;  1UL3 A;  3SIP B;  2HBY B;  4WU2 A;  2FHK A;  3JAM U;  1YIT S;  4I64 A;  1LXJ A;  5DGB A;  1NK4 A;  1LWX A;  2VZ9 A;  2DXE A;  3ZZZ A;  4ZCK A;  4CLF A;  2DBB A;  1TUW A;  4U7U K;  5HVF A;  4DPY A;  3QBC A;  2IAJ A;  1LKZ A;  1RHK B;  4MK8 A;  3CCS S;  5C24 A;  1X4G A;  1U49 A;  1Q8B A;  4QYZ J;  3CJ8 A;  1FKO B;  5D0E A;  4GO7 X;  1I94 F;  1UVL A;  2IA6 A;  1F9E B;  2E9Z A;  1SKU B;  3IGV A;  2CDQ A;  1T9Y A;  2J9E A;  3GV8 B;  2AV5 A;  4WTY A;  2EBE A;  4AUK A;  3PKY A;  4P2F A;  3KHG A;  1J2V A;  2B9X A;  3DRR A;  5ETS A;  4J9R A;  4HI2 A;  4NCA A;  4UUX A;  3NP5 A;  3GFZ A;  1NSA A;  2Z58 B;  2EG2 A;  1RT5 A;  2VFS A;  3M6V A;  1ZAX A;  2EFQ A;  2YNI B;  3CCJ S;  5A8W B;  3UCG A;  3OR2 A;  3TX0 A;  3P8B B;  1SIZ A;  3MAA B;  1N8R T;  1WG1 A;  3M30 A;  1I6J A;  2XZW A;  4O23 A;  4ID5 B;  2DHS A;  4H4M B;  3EGW B;  4DV1 J;  4DSJ A;  2I5J B;  5KFO A;  2AIR B;  3THV A;  4F2R A;  3N4W A;  3GG0 A;  3I0R B;  2PN6 A;  2DNY A;  4KV8 A;  4J9O A;  1HD0 A;  5I3U A;  1HWU A;  2FTR A;  2EFO A;  2KJW A;  5LXY A;  3ZZT A;  3NMR A;  5C5J A;  2ZVI A;  2R7T A;  1JNR B;  1F9H A;  2NYH A;  4B02 A;  2HRT A;  3CF5 Q;  2RDI A;  5D8H B;  1S57 A;  2QLB B;  2FC8 A;  3AAW B;  4LRB A;  1T05 A;  1S7I A;  3R27 A;  3PJ9 A;  5F8I A;  3HJF A;  4NLV A;  1JJ4 A;  2X1B A;  4FBU A;  3O5T B;  3I4P A;  1N88 A;  1UJ4 A;  3R5D A;  5IT9 Y;  4WK1 A;  4EBD A;  2Z2M A;  4PCQ A;  3CUN A;  1B99 A;  3HO1 A;  3GR1 A;  5IOL A;  3MR6 A;  2RS2 A;  2FZK B;  2M70 A;  4KHM A;  1WOR A;  3HMJ G;  4C8K A;  4DPW A;  3G4S S;  1DQ9 A;  1VQY A;  1OYD A;  4IDK A;  4UW2 A;  2XMJ A;  3LF0 A;  4OIX A;  3DM2 A;  1SUQ A;  2YKO A;  4ED8 A;  3DMJ A;  4JI8 F;  4IO9 Q;  1SJ3 P;  4N7T A;  2OP5 A;  1CPZ A;  1GXL A;  2XY6 A;  3IP0 A;  2EFP A;  2FGO A;  1KLN A;  2AT1 B;  2OSR A;  1RT7 A;  2IPO B;  2MDA A;  1LNQ A;  2HND A;  4IG0 B;  4OYW A;  1JIH A;  4C11 A;  2CJ9 A;  5DDR C;  3UVJ B;  1GXU A;  3OFH A;  3TEH B;  2X7I A;  3HCX A;  1GT8 A;  3NCP A;  5B0E A;  3AJD A;  2J76 E;  3UDV A;  2DIV A;  2YX7 A;  4DUZ J;  4NRU A;  3TYT A;  1H2U X;  3QIP A;  2HYI B;  4DX5 A;  1Y5I B;  3VAM A;  3CJQ A;  1GX5 A;  2V4R A;  2J6U A;  1DTQ B;  4Y34 A;  3IG1 A;  1DRZ A;  2BM1 A;  4F36 A;  1CC7 A;  2VG6 B;  4TY8 A;  1U47 A;  4R5P B;  3ULH A;  1UWB B;  5EX0 A;  1KRP A;  2BM0 A;  2JWN A;  1KQG B;  2MKH A;  3AY0 A;  3DYA B;  2YWE A;  1NCL A;  2OEJ A;  2W7P A;  2HBR B;  2OPP A;  2DR9 A;  3SQO P;  3FEY B;  3VR1 A;  3KUH A;  4BC9 A;  1ZZF A;  3IBC B;  2O5D A;  5M2P A;  1U6B A;  4QWC A;  4M5M A;  2WK4 A;  2GW8 A;  3B4D A;  2XZT B;  4DQP A;  4USK A;  2GQQ A;  1IKY B;  5JVH Q;  3CJ4 A;  4EO6 A;  2JL9 A;  1HWK A;  2W25 A;  4TVA B;  1JJH A;  4KHR A;  3JSY A;  2DY1 A;  1N32 J;  2ALY B;  3VQT A;  3H5S A;  4ZOS A;  2WVB A;  4WBF A;  2YTC A;  3J7Y I;  5H9E K;  1KVK A;  4G1I A;  4DPU A;  2KZM A;  4RLE A;  1BC6 A;  5KFS A;  4E2F B;  2ILY A;  1KNZ A;  1EHW A;  1U8S A;  1GK8 A;  3MEE B;  2B9E A;  3LTO A;  4DCO B;  2PGC A;  5HQ8 A;  5ETQ A;  1E6Y A;  4IO1 A;  2E7X A;  4LSZ B;  3N5B A;  1QVG R;  3DLL Q;  3KK2 B;  2RUG A;  4WCE Q;  2ZKT A;  3OL7 A;  3PR4 A;  3JSB A;  1M5O C;  2V4J B;  1HW8 A;  2BUN A;  4RWX A;  1KTQ A;  2ZVS A;  2HWH A;  1FNX H;  2VOD A;  1S6P B;  4ED2 A;  2HAF A;  3MOJ B;  3R2C J;  4OX6 A;  4JI7 F;  1EQ0 A;  4LMZ A;  4X4R A;  2DGS A;  2DR8 A;  4R8U B;  4B3O A;  3W2W B;  1FDD A;  3TUJ C;  1ELO A;  5BR8 J;  2YPZ A;  3NS5 A;  4I7F A;  3JS9 A;  3QT5 A;  2VG5 A;  1YGY A;  4LRE A;  2P9E A;  1HPZ A;  5IT4 A;  1XBW A;  2ADC A;  4OZ5 A;  4FF4 A;  1RXO B;  1V3S A;  1RT3 A;  1GFW B;  3TOQ A;  4FDF A;  2B4P A;  1RTD A;  2VON A;  5LMU F;  2GQC A;  1S97 A;  2MTL A;  1MWZ A;  4KYZ A;  1P8G A;  2BJ3 A;  3IM9 A;  4JI6 F;  4JV5 J;  4GC7 A;  2R8J A;  1ZET A;  2DNZ A;  2VPZ B;  4KFB A;  2B56 A;  5F41 A;  2XS7 A;  1RLC L;  5D4N A;  1NSK L;  3TZX A;  2RS8 A;  1N56 A;  4I1T A;  1R6V A;  4C9D A;  4HDG A;  1N0V C;  2RRB A;  1YQH A;  3VAL A;  1S9F A;  4K4U A;  3EVM A;  1FDA A;  3AOC A;  4LF2 A;  3CE8 A;  5KG3 A;  1PJ6 A;  3QSI A;  1FEE A;  1QUV A;  1DBD A;  2V0N A;  2Z0G A;  1RHJ B;  3DRY A;  5IQQ A;  2DR6 A;  3Q86 A;  3HJV A;  2GIF A;  1FKP B;  2VQE J;  2G0C A;  2MQN A;  1D09 B;  4NLS A;  3NNA A;  1ACM B;  1X31 C;  1X5O A;  3R1L A;  3J81 Y;  5I42 A;  1BWV A;  1TZ0 A;  4EEY A;  3IR5 B;  4K4Y A;  6AT1 B;  5K14 A;  1ZM4 A;  2MGZ A;  2VA2 A;  1WC3 A;  2W7A A;  2NXC A;  2ZWO A;  3T1Y F;  1DZ5 A;  1RAG B;  1NLK L;  3MM6 B;  4DPO A;  2B4V A;  1HI1 A;  4FZV A;  1UVM A;  3HVA A;  4NA1 A;  1YBU A;  4NE9 C;  2ZD1 B;  2C2N A;  1XER A;  3MEC B;  1YBA A;  3WIV A;  1Q95 G;  4TKT A;  2LCW A;  4OI1 A;  1I5O B;  1U2C A;  4V19 X;  3GYN A;  4IOC Q;  4FXV A;  1S0O A;  3BO2 A;  1PBA A;  4DF8 A;  3N6N A;  2KXF A;  4QIV A;  2WB1 D;  2CDR B;  3SBM A;  2QJ3 A;  4RBU A;  3L7O A;  4KR0 B;  3KLF A;  1WC1 A;  2DHG A;  3F73 A;  3Q22 A;  1K44 A;  1IR2 A;  5CZV A;  3QID A;  1JKH A;  5AXK A;  2HHX A;  3OL6 A;  3B8H A;  1S4F A;  4DQI A;  3BGO P;  2IYI A;  2G0J A;  2PII A;  4O3P A;  3P5B P;  4K4X A;  3POT A;  4CM2 A;  3O3L A;  3NBP A;  2DHX A;  1AYE A;  2AGP A;  1U1Q A;  1HLW A;  1VQN S;  4LRC A;  5K8O A;  1FRI A;  2ROE A;  3CGI A;  4WJB A;  2BOA A;  3R3T A;  2GHP A;  4KGK A;  2XLI A;  3MPV A;  5AE2 A;  4K0K F;  1VJW A;  1JLF A;  1WI6 A;  1RAC B;  1NPK A;  5A6W A;  1A0O B;  4DL0 C;  3A3O B;  2QLJ B;  4ERD A;  4I2Q A;  4ZVF A;  3T5L A;  3UCZ P;  1HNI A;  2MKI A;  4FYY B;  2IBK A;  3GFY A;  2NLW A;  2FJE B;  5HRO B;  1YWX A;  3HZG A;  1HQ2 A;  4TYA A;  2QRR A;  4LFC J;  2KVQ E;  5AJ3 F;  4PRF A;  1I51 B;  1TKD A;  4DR7 F;  4DV3 F;  1EQM A;  3RRH A;  1NPP A;  2AYB A;  3UWT A;  1WD6 A;  3EZU A;  2DXF A;  1F3F A;  1HNV B;  1N34 F;  2YKN B;  2RH3 A;  3BYP A;  4NZ7 A;  2XMU A;  3BKU A;  2E44 A;  2XGQ A;  1L3K A;  3CJK A;  4OZ2 A;  3AA9 A;  2ZHB A;  3HK2 A;  4DX8 H;  1KLM A;  5HVH A;  4RW7 A;  4OHY A;  3EGV A;  3KJN B;  5DQH A;  3FBE A;  3MEG B;  5HMW A;  1UVN A;  1Q8L A;  4LF4 F;  4USW A;  2UU9 F;  1LFP A;  3FMW A;  2WVD A;  3P3D A;  3E2E A;  2CQ2 A;  1XNQ F;  3KKF A;  4QU7 A;  3U02 A;  4ES1 A;  2FYX A;  5IFM A;  1NH8 A;  1YLX A;  4B9V A;  1HBU B;  4NXM J;  3EUN A;  4USH A;  5B7W A;  3X3U A;  5M2U A;  2ZM6 F;  3WC2 A;  5K8N A;  3S1T A;  3SQG B;  3Q8Q B;  4AL6 A;  3LP0 A;  4ED4 A;  4ZCI A;  1PGZ A;  2NSC A;  3MR2 A;  4GMK A;  5GAE I;  1S5Z A;  1SH0 A;  3IBW A;  5FJ4 A;  1WOO A;  1R31 A;  4I67 A;  5B09 A;  3Q8U A;  3DLE A;  4MFB A;  4JI1 F;  4PKD B;  1X4A A;  4UF4 A;  4KO0 A;  2FQQ B;  3DXB A;  3D6H B;  3IAS 9;  4N47 A;  2OPR A;  2RHQ B;  1S0V A;  3NXZ A;  2CZ9 A;  2KKH A;  1HA1 A;  3P96 A;  2JHE A;  3L95 X;  3EPI A;  2VOP A;  4EYI B;  3GG1 A;  3PO5 A;  2L3M A;  4A48 A;  3B78 A;  1RWV B;  2FC9 A;  2LA4 A;  4NLR A;  1QAI A;  2U2F A;  3KNA A;  5RUB A;  5C25 A;  4J9K A;  5F3Z A;  5B0A A;  3JSR A;  1R8B A;  2W2Q P;  1U2R A;  3DDK A;  3IAM 9;  1GXT A;  1J5O A;  1RT2 A;  2CFX A;  2D3O R;  1E6V A;  2YNH B;  3T5K A;  1CJV B;  2VQF J;  4X4O A;  3RBD A;  2QEX S;  4B9L A;  3KK1 B;  3CJ2 A;  4F26 A;  1VQ5 S;  1RWN B;  4LFA J;  1HR0 J;  3A4T A;  2HBZ B;  1GTH A;  2C2Z B;  2AEJ A;  2R8I A;  1RCO B;  4KGX B;  4KHP F;  2UV8 A;  5LJ3 Y;  1RUS A;  2B5J B;  3UR0 A;  5L1I A;  2WSF C;  2E5H A;  2AJQ A;  3X1L B;  4Y2I A;  2JFK A;  5KFW A;  4NLQ A;  2DB1 A;  3C6T A;  1F5A A;  4RUC A;  3QAT A;  1NBE B;  3QFW A;  4JV2 A;  1VIS A;  3UDE A;  3FJ2 A;  1JLG A;  4CO3 A;  5L1L A;  2H65 B;  4NEY A;  2YQ3 A;  4FPI A;  3KLG A;  2DNG A;  4ZVH A;  3ZTR A;  3DI6 B;  2HIQ A;  1ZA2 B;  5B0B A;  2V8G A;  2JEF A;  3LA0 A;  1N36 J;  4G1P A;  5KFI A;  1APS A;  1YKW A;  2DO0 A;  2VU5 A;  5AXL A;  1D0E A;  2R2T A;  2CNK B;  3MCN A;  2JFD A;  2O3D A;  8ATC B;  2FJW A;  2HGN A;  3K5L A;  1HNX F;  5DS7 A;  4BBY A;  4KY3 A;  1T03 A;  4NI2 A;  4ELT A;  1R89 A;  4AFF A;  1Q78 A;  2MHN A;  2B8P A;  3DLG B;  4J9L A;  2V8H A;  4ZVP B;  5KFN A;  2F7V A;  3FFI B;  4DV4 J;  4RW4 B;  1CJT A;  3L09 A;  4K5R A;  2MQM A;  4Y2M A;  1EKS A;  2OKQ A;  3EXY A;  4DV5 J;  2B0G A;  5L38 A;  3M32 A;  1YBT A;  1R3N A;  5DO2 A;  1FCA A;  2HQC A;  3P4U B;  5LMN F;  3NCQ A;  2C2O B;  1Q7Y T;  3EDQ B;  1DY3 A;  2XMT A;  4NCG B;  3SSQ A;  1DTT B;  3R6G B;  2VPY B;  4FN5 A;  3QMQ A;  1VDH A;  1WWH A;  4DUY F;  3G82 A;  1PG5 B;  3CCR S;  2XI2 A;  5HP1 A;  5E7O B;  3HFZ B;  5KFG A;  3NAH A;  4DG1 A;  1Y0H A;  1C0U B;  1UA1 A;  1IBL J;  1Q1K A;  3W2V A;  3LP2 B;  4P7V A;  1L5U A;  2AQ4 A;  4P52 A;  1NZ8 A;  3IBF B;  2BAN B;  3NWR A;  1KEK A;  2E29 A;  2DNM A;  3R2D J;  2ZH6 A;  2B9W A;  1MN7 A;  5ITH A;  4QCL A;  2AJ1 A;  2XO7 A;  3MZI A;  4EBE A;  1R0A A;  1MU2 B;  3SCJ E;  4KGV B;  4O44 B;  3ITH B;  3P5T L;  3FQK A;  4P75 A;  2CPI A;  5MLC V;  1UFW A;  4ZMM A;  4LVN P;  1WHY A;  1FFS B;  2FVC A;  5F8G A;  4K5S A;  2XY5 A;  2IRX A;  4CH7 A;  1EP4 B;  4N8O A;  1WKK A;  5D6G A;  2KDO A;  3BBB A;  4DSI A;  3UI3 A;  4MKB A;  4YME A;  1M0S A;  2P6T A;  2PO4 A;  1HL6 A;  4LQ9 A;  2XHC A;  2XB2 D;  4HKQ A;  3O44 A;  4P74 A;  5ETN A;  2Q6B A;  4MIW A;  3TJ8 A;  1OPI A;  5C7P A;  3H20 A;  3HVT B;  4XPE A;  3UDL A;  2UUC J;  5D4L A;  1RGV A;  3FK4 A;  2ZOM A;  1HQE B;  2F1F A;  4N5S A;  4MH8 A;  2HS0 A;  4U8V A;  3GE9 A;  4OMF G;  1KDN A;  1OSD A;  1KQF B;  3T41 A;  2RJZ A;  1N5Y B;  1RHR B;  1C1B A;  3TAM B;  1RTZ A;  5DDQ C;  4OZ3 A;  2DPJ A;  5K8P A;  1T7P A;  1WJ9 A;  3QT6 A;  2YNI A;  1XC9 A;  4PQU B;  2F8E X;  3KLE B;  2BX6 A;  3MM9 B;  1P27 B;  2I1R A;  1GMV A;  1EIY B;  2V2Q A;  4P71 A;  3BB5 A;  4H4M A;  3H5X A;  4FKY A;  3K58 A;  5KG6 A;  2CJB A;  3I0R A;  3T1H J;  3FUY A;  4QIF A;  4ZVU B;  4PEO A;  4B9M A;  2MJN A;  1RAH B;  4JOU A;  2DRB A;  4ED0 A;  7FDR A;  4ZPV R;  1YHQ S;  3CC2 S;  3JYT B;  2OLW A;  5FLX Y;  3DXS X;  2LQ8 A;  4LF1 A;  4QR1 A;  1QSS A;  4HTJ A;  5B0F A;  3N6M A;  5HI7 A;  3BO3 A;  5JJB A;  2CZ4 A;  4I2P A;  1KP6 A;  1MN9 A;  4Y28 C;  2M5Y A;  4DR5 F;  3E8O A;  3S6E A;  3HHL A;  3PEJ A;  4OX9 J;  3QO9 A;  4C3M A;  1JLC A;  2J5A A;  4EU0 A;  3BGR B;  5IQ6 A;  1U09 A;  4ECR A;  2KT5 A;  4K2J A;  3IRW P;  1BQM A;  1C1C B;  4H4O A;  3KG4 A;  2RRN A;  3VWS A;  2VPW B;  5KFL A;  3J7A 1;  3QJJ A;  2V2K A;  1KON A;  2CPH A;  4J37 A;  2UXB F;  5F8L A;  3MM8 B;  1W7W A;  3GPA A;  2GGP A;  2RU9 A;  3ZZR A;  2AJF E;  2R42 A;  2W9A A;  5HL7 Q;  2MQO A;  2W9C B;  6FDR A;  3ISZ A;  1WG4 A;  4EUV A;  2QFJ A;  2HHP A;  1PKU A;  3UVJ A;  3CDE A;  4A47 A;  1PIL A;  2MSS A;  3UNY A;  1RT1 B;  3UR3 C;  1PO6 A;  3W62 A;  2VAS A;  1SQF A;  1VYA A;  1AUD A;  2HHQ A;  3G6Y A;  2IVM A;  3PX4 A;  1GEH A;  2A2C A;  2ZDO A;  3TVZ A;  3UN3 A;  3TVK A;  1S1X B;  1DTQ A;  5EN1 A;  2GHW A;  3G8Q A;  3GFX A;  3QFH A;  4J9P A;  3KJQ B;  1X4H A;  2VG6 A;  1WKJ A;  3W9I A;  3CCW A;  2RQC A;  4HAC B;  4LRD A;  3GJQ B;  4Z7Y A;  3W66 A;  2AMC B;  1TKX B;  2AZ3 A;  3RAM A;  1U1K A;  1TFY A;  1RWX B;  4NXN F;  2FLL A;  1BMQ B;  3TI0 A;  1FE0 A;  2HQI A;  4JYA F;  3DNC A;  2KO1 A;  3V81 B;  4NZ6 A;  4HLB A;  4IRD A;  2E5L F;  4U96 A;  3HHE A;  4CT9 A;  2KXH A;  2DRD A;  3RBZ A;  2A3J A;  4DN0 A;  3R7B B;  4V1A k;  3FEX B;  1HQU A;  1SQG A;  1HWL A;  1SV5 B;  2ZBC A;  4W4M A;  5H9F J;  1DQA A;  1QTM A;  1FRH A;  4WU3 A;  3ZTQ A;  4HI1 A;  2VG7 B;  2VIH A;  2DRA A;  5D4O A;  3VGU A;  5KFP A;  3P49 B;  2HIY A;  1TU0 B;  8RUC A;  1UVK A;  2IM1 A;  4PYD A;  2JZ5 A;  2KFZ A;  2KB2 A;  4J9S A;  2HK3 A;  4C0H A;  2ZH2 A;  2XS2 A;  5IV4 A;  1NEE A;  3ILL A;  5A0Y B;  2P8I A;  2BJ9 A;  3IWL A;  2AGO A;  3TQ1 A;  4Y2K A;  2KH9 A;  3LP1 B;  5ETP A;  3NL0 A;  2UXC J;  2MZS A;  3FEZ A;  5AE3 A;  2IAJ B;  4EBC A;  5AT1 B;  1ZM3 A;  1WHW A;  3I87 A;  2W4D A;  1FTC A;  2XLK A;  5C24 B;  4NYZ A;  3GIK A;  1S10 A;  4C6A A;  1PIE A;  1X9S A;  3MED A;  4AYB D;  1HHT P;  4AQY F;  2GVZ A;  2L9W A;  1HAR A;  3R6L B;  3VVU A;  3DRR B;  2JLG A;  4OV1 A;  2FB0 A;  1ZPV A;  2WON B;  1VR6 A;  3FKB A;  1U1R A;  2OFH X;  5U47 A;  2F4F A;  4RNM A;  1RT5 B;  1CUL A;  2EK6 A;  5DM6 Q;  4A8Y A;  1YJT A;  1NUE A;  4ZJQ A;  4OL8 A;  1JX4 A;  2RF2 A;  3SZ2 A;  2BJ7 A;  2XSJ A;  4CM0 A;  3MR7 A;  4Q7A A;  5T7L A;  2QSF A;  1TK8 A;  4DMZ A;  4ZPC A;  4B3T J;  3LGH A;  1GX6 A;  2GIQ A;  3V6J A;  1HBM A;  2N4C A;  4LF7 F;  1SPB P;  2V5H G;  4ZN1 A;  4UOG A;  3OT9 A;  4DU8 A;  2ZNY A;  1WTF A;  4KV8 B;  5G0R A;  1S4E A;  3NGK A;  4KGZ B;  2IYG A;  2YKM A;  1TVR A;  4JB8 B;  2QO3 A;  2IRY A;  4B3R F;  2RDD A;  2MXY A;  2FZC B;  4AD6 A;  3OL8 A;  4PPD A;  4G65 A;  2CVE A;  2QGF B;  1RTI B;  1FKP A;  4KPY A;  3RB3 A;  3OUY A;  3GCX P;  3JTN A;  3MAH A;  2U1A A;  1U1M A;  3KJF B;  2NUH A;  1T05 B;  4UQT A;  5E5N A;  3W8G A;  2LEA A;  2HHU A;  5B0C A;  2YKQ A;  2Y1I A;  2GJI A;  2CQD A;  5EUH A;  1FTR A;  3BN4 A;  3I96 A;  1FE4 A;  1BGX T;  1Y7P A;  3FBC A;  2J7U A;  3G9C A;  1U1O A;  4YDD B;  2NPI A;  4PWW A;  1L3V A;  2WZ1 A;  1NK7 A;  1FXD A;  3KLI A;  5KG1 A;  5L9N A;  1YDL A;  3C16 A;  1AFI A;  1UKU A;  1RTJ A;  1ITP A;  4BC7 A;  3LPE A;  2ZD1 A;  1H2V Z;  4IDK B;  4LF6 J;  5KFU A;  1UJ5 A;  5K20 B;  1ZS6 A;  3M05 A;  4F3M A;  3DM2 B;  1SUQ B;  1J5E F;  3DMJ B;  3K8V A;  3A8J A;  3MPU B;  1WUU A;  4LR8 A;  1M5V C;  3PYG A;  4CNY A;  4MKV A;  3H25 A;  3RZA A;  2KM8 B;  2WBM A;  4WYL A;  1ARO P;  3FZ2 A;  4QWD A;  2HND B;  4CNZ A;  1HI8 A;  4OZ0 A;  4C11 B;  3NY0 A;  2VF3 A;  4C7Q A;  1LWE A;  2KTQ A;  1MMD A;  4RBT A;  1HW9 A;  3I56 S;  5CYQ A;  2QYG A;  1S6O A;  1C0T A;  3ENQ A;  5K8M A;  1VCT A;  2L08 A;  3GV7 B;  2ZH8 A;  5LSO A;  4DJB A;  1UVI A;  3D66 A;  3AFG A;  1Q16 B;  2ZBQ A;  4RPF A;  1OIA A;  4EWT A;  3KG1 A;  2G4B A;  1EJ7 L;  1A7G E;  1MMN A;  1P9Q C;  4ECV A;  4WFA Q;  2XHW A;  3BSO A;  2F63 A;  5C42 B;  3H42 A;  4KH1 B;  1IUJ A;  1YTY A;  3V4M A;  2DIS A;  1UW4 A;  3M8Q B;  4P2X A;  4ZVE A;  3OTO F;  1LW2 B;  1UP1 A;  3HVW A;  2K3I A;  3H59 A;  4X66 J;  2J9C A;  2BQR A;  4IH7 A;  4LF8 F;  3MPY A;  1R7I A;  1EKR A;  4G1Q B;  5E3Q A;  2OPP B;  1FD2 A;  3HFV A;  1IKW A;  4ZP8 A;  3C19 A;  3VCD A;  1UA0 A;  2I8E A;  3Q2T C;  2MZQ A;  4JI2 F;  4Q8F A;  2CYY A;  4M5L A;  3VAH A;  2CQ1 A;  2EFV A;  4DV0 F;  5IT0 A;  5HN0 A;  1G3O A;  5HRO A;  3DLB A;  3MR3 A;  3NGS A;  3OR1 A;  4Y3C A;  4CO2 A;  3EMT A;  4XPC A;  1YJU A;  2DGV A;  2C3M A;  5HLF B;  3SDE B;  1CJK A;  5GAH I;  1TKT A;  3H0P A;  3R9L A;  2HKE A;  3FSY A;  2YQ0 A;  1M5K C;  2YKN A;  2MQP A;  2ASL A;  5BYS A;  1OQ6 A;  5CQG A;  4M5D A;  3SMZ A;  1P1T A;  4R0J A;  3I0S A;  3OSP A;  2GO8 A;  3TA0 A;  1E6Y B;  2KL8 A;  1H72 C;  3CDU A;  2BE9 B;  1U24 A;  3DCA A;  2XS5 A;  3HHL D;  3MEG A;  2N82 B;  1JXV A;  1O8B A;  1Q4R A;  4JI0 J;  3RBX A;  2COL A;  4ICL B;  1I3O B;  4DX7 A;  4BS2 A;  5KG4 A;  4PG6 A;  3M8P A;  2BJ1 A;  2HBQ B;  1S0M A;  1BWE A;  1Q5Y A;  2RSQ A;  5F8H A;  4H4K A;  1K8A T;  5CXT A;  4F4W A;  5EWF A;  1KVJ A;  4RNH A;  1TK0 A;  3TZW A;  2VFV A;  4B3O B;  3ILO A;  1W2I A;  2H48 B;  4UY8 5;  1CBK A;  3OLA A;  2C3P A;  3PW4 A;  2XMW A;  2VG5 B;  3QGP A;  3FGV A;  2LVW A;  3PAC A;  2MQQ A;  1VMB A;  1RT3 B;  3TZY A;  3R1H A;  1BHN A;  1Q7L B;  4IFY A;  4DHV A;  1RTD B;  3MHY A;  1VQ4 S;  2NUU G;  1T9U A;  4L74 A;  3BPD A;  1XMO J;  2WW8 A;  1FJE B;  2M88 A;  2PEB A;  3W61 A;  4K4W A;  2HVZ A;  1CC8 A;  1EZZ B;  2GML A;  2WBR A;  2LU2 A;  1U4B A;  1U02 A;  3W9J A;  3HXM A;  3KMS A;  4KFB B;  1HWJ A;  4FF1 A;  2P5V A;  2D74 B;  2J8S A;  4ED7 A;  3CJR A;  1RWW B;  4K4V A;  4WTO B;  2V8D A;  2NCK L;  3T9N A;  3OTE A;  4MK9 A;  3VAI A;  4RNF A;  1MSW D;  2KJV A;  4X4N A;  2YVS A;  3R5G A;  3AHP A;  3HLU A;  1G4C A;  3CD6 S;  4OZN A;  2AYM A;  2VH7 A;  3MGJ A;  1XNR J;  4OHX A;  5IS2 A;  2YNH A;  1CJV A;  3Q8P B;  3HFK A;  3MTK A;  2ZKU A;  3QGH A;  4M5I A;  4WPA A;  3M8R A;  3J7Z 5;  1JK9 B;  3RB0 A;  2RU3 A;  4USV A;  2DKO B;  3RJM B;  3W8P A;  3BR8 A;  1RAD B;  3EWG A;  1KC8 T;  1RAI B;  2V8P A;  3CME S;  2W2N P;  5I42 B;  3ISN C;  5K14 B;  4QPT A;  1U1N A;  1F6T A;  3C14 B;  3DI6 A;  1HMV A;  2LXU A;  2H9Z A;  3MUV P;  4YP3 A;  1SKW A;  4RW9 B;  2KRB A;  3R5C A;  4U67 Q;  1RT6 A;  2V4Q A;  1KN6 A;  3IXQ A;  4FNI A;  2R7O A;  2WVF A;  2GQ2 A;  2YH1 A;  3D1H A;  1FWL A;  2EKN A;  1WHX A;  3ENA A;  4L72 B;  1JXL A;  2O67 A;  1QSY A;  3HX9 A;  4Q5V A;  1XN9 A;  3EZ5 A;  2I6W A;  4IR9 A;  3C2P A;  4RW8 A;  2B8Q A;  2B7B B;  2C3O A;  1OMS A;  4KJI A;  1K9M T;  1SL1 A;  2OIH A;  1Q8I A;  2Q3P A;  2VL1 A;  4TNO A;  4DL2 A;  5KTQ A;  2AEF A;  2AZ1 A;  3HI9 A;  3FVY A;  3U1L A;  3GCW P;  1X7V A;  1VC0 A;  5SZT A;  5J2N A;  4M94 A;  2C3U A;  2OEL A;  3OQ2 A;  1JKH B;  3MFI A;  4PXC A;  4X64 F;  4TU8 A;  3VGT A;  1IN0 A;  1FJC A;  1DHM A;  2GJ2 A;  2RQM A;  4K4T A;  4X4T A;  2HS3 A;  4W92 B;  1UZD A;  2UZA A;  4P6Q A;  5JXS A;  3Q23 A;  3T19 A;  4NA2 A;  4F3Q A;  3MR5 A;  4C2M A;  4DSE A;  3POT B;  2ROP A;  2XBP A;  4PXE A;  2JDJ A;  2ERR A;  3CCU S;  1F5C A;  3DGP A;  3F0N A;  7AT1 B;  1F5B A;  1FXL A;  4ITS A;  1Q79 A;  1U7L A;  1CSJ A;  1SJQ A;  2VD3 A;  4DR1 J;  1NKC A;  2CQB A;  1MWY A;  4DSK A;  3LOU A;  4I2Q B;  4O44 A;  3ITH A;  1PSD A;  1HNI B;  2MZJ A;  3J7Y U;  4JI4 J;  4I56 A;  2J0X A;  2NPF A;  2V34 A;  3M2U A;  1N5V A;  5HMZ A;  4PWD A;  4ZP7 A;  4USJ C;  2ACY A;  3DGV A;  1S72 S;  3CIZ A;  5H1S V;  3CJK B;  1O0P A;  1VQS A;  4CLZ A;  5KFJ A;  1O5J A;  4RW7 B;  3HVT A;  3ZNJ 1;  3PY8 A;  4W90 B;  3R7S B;  2UUA F;  1B4S A;  3TA2 A;  2ZUA A;  2HQF A;  3FC9 A;  2XYP B;  3VZH A;  3QZ8 A;  3HP6 A;  1UCN A;  3MPD A;  4DU7 A;  1S48 A;  4URQ U;  2ZH7 A;  2I0X A;  3GU0 A;  1N5Y A;  3QJL A;  5KT6 A;  1D9F A;  4BDP A;  4UZC A;  1S1V B;  3PX6 A;  1Y9O A;  2GIR A;  2FJD B;  3EXC X;  1RJJ A;  3DU5 A;  2UV8 G;  4B17 A;  3PKM A;  1TMM A;  2F9D A;  4PXD A;  3R8Y A;  2Y1R I;  4MMO A;  2VB6 A;  4M5G A;  2RML A;  2WRM A;  4CZC A;  1WKL A;  2KZZ A;  3M8W A;  2R7U A;  3CMQ A;  1PC4 A;  4O0N A;  2HVI A;  5L46 A;  2JLF A;  3DFE A;  4DLG A;  2MLX A;  3CO0 P;  3DLE B;  2HVD A;  4B9S A;  4EK2 A;  3BR9 A;  1S1U B;  4MFB B;  4KO0 B;  4K4S A;  4NMX A;  5J2P B;  2AX1 A;  4ZVR B;  2DNO A;  2OPR B;  2AU0 A;  3JYT A;  1REG X;  2IDE A;  1U26 A;  5F3T A;  2QV6 A;  3GON A;  2E1M C;  2C42 A;  2R7Q A;  3NCR A;  2DNP A;  5E0O A;  4TU7 A;  4O3R A;  1YJW S;  3IWN C;  2HG4 A;  2QL5 B;  5DG7 A;  3C6U A;  2KT2 A;  1FFG B;  1L3T A;  3DU6 A;  2H5J B;  3OTD A;  5C25 B;  3IRX A;  5HBM A;  1MW7 A;  4QR2 A;  4ZCL A;  1J5O B;  3BGR A;  1ZM9 A;  1RT2 B;  2AYE A;  2J6S A;  3TAQ A;  4CRJ A;  2DO4 A;  3O6Q A;  1HNZ F;  1KFD A;  1HBO A;  4RBV A;  3PDN A;  3ZZ0 A;  3RUB L;  3R5J B;  2IVY A;  1HNW J;  3MXH P;  2BKP A;  4DV2 F;  1IR1 A;  1IXK A;  2M8H A;  2FJV A;  4OX9 F;  3BQ2 A;  3F41 A;  2YWK A;  3C6T B;  4ETZ A;  5T41 A;  4NZ0 A;  3L9Z A;  1RWM B;  3GP9 A;  1JLG B;  2VKR A;  1Y00 A;  3G6E S;  3EZO A;  3KLG B;  4F02 A;  1VLO A;  2E1C A;  2WW4 A;  1IJE B;  2ZH4 A;  4HT7 A;  4OYP A;  1T11 A;  1B7Y B;  3MOZ A;  4RR5 A;  4Z2X A;  2AP6 A;  2W9B A;  4JUZ A;  4AT1 B;  2KXN B;  1RDR A;  1RT1 A;  5E3C A;  3CDW A;  3NLC A;  3TA1 A;  3BBF A;  2UXD F;  1T03 B;  4NI2 B;  2FVP A;  3GIM A;  3I9V 9;  2KHC A;  2BKN A;  1QAY A;  1VQO S;  1QE1 B;  1S1X A;  1MRO A;  3BPS P;  1ZTT A;  1CJT B;  2DD8 S;  1DAX A;  2FLP A;  4CH0 S;  4Y00 A;  2XMK A;  5A2Q U;  4DL4 A;  3P6Y C;  1TKX A;  2YWF A;  1B3T A;  3OLB A;  1K1S A;  2Z4P A;  2HHV A;  2VPX B;  3THP A;  3QGI A;  1NHK L;  2RRA A;  4AND A;  1I94 J;  4K7Q A;  1XMQ J;  3PTW A;  5J2Q A;  1W25 A;  4Q43 A;  2E66 A;  2L41 A;  1VC6 A;  4C8N A;  5D0R A;  5KFD A;  2UUW A;  1X5T A;  3RW7 A;  5F0W A;  3G8T A;  1FA0 A;  4DG1 B;  3KNG A;  2XGP A;  2OTJ S;  2BAC A;  2OPQ B;  3W2V B;  4B9T A;  3M7V A;  2H4W B;  4WE1 A;  3O8W A;  4NAS A;  5KFC A;  3O2I A;  1WSV A;  4U7C A;  2BVZ A;  2DEI A;  5KFQ A;  4CLU A;  4HVZ A;  2NQP A;  4ZVG A;  4F25 A;  1R0A B;  1PYS B;  4BCA A;  5A0Y A;  5JMN A;  2BQ3 A;  2I9S A;  1CS4 A;  4ECX A;  1Q5V A;  2X3G A;  3LP1 A;  4JI5 J;  1JB0 C;  2OHD A;  2NXJ A;  1YK9 A;  3CCQ S;  3NOG A;  2PEH A;  3G6X A;  2VJV A;  2HNY A;  3FRY A;  1X5P A;  2YNF A;  2AHO B;  4OI0 A;  1VBZ A;  1TAU A;  3FZB A;  4NYP A;  3QT8 A;  1U25 A;  3NNH A;  3PHT A;  2UXC F;  3HSZ A;  2DH7 A;  3T6B A;  2OML A;  4MJK A;  2HFV A;  4DV7 F;  2HEK A;  2J0Q D;  3A3N B;  3L7P A;  2ZC3 A;  2GVD A;  2A18 A;  2IJF A;  3FCH A;  3AQO A;  1NK5 A;  3PM9 A;  5HJY A;  2FLN A;  5C2C A;  1KQS R;  3CJ5 A;  4USI A;  4WYW A;  1RU1 A;  4GO5 X;  2MHE A;  2ZZM A;  4FNH A;  1JJ2 R;  2WON A;  1FJG F;  1C1B B;  3QAE A;  4NML A;  3M2V B;  2PA8 D;  3AJ2 A;  3OHA A;  5GAE U;  1PYO B;  1LWF B;  4JI8 J;  4IRC A;  2QT7 A;  5EX3 A;  3RB4 A;  5DZ6 A;  2IC3 A;  5HQM A;  3GYG A;  2DNR A;  3CD5 A;  2MKC A;  4L75 A;  3HSD A;  1HBN A;  4YEA A;  4YY3 F;  3GFH A;  3T6J A;  5D78 A;  2VBY A;  3N6L A;  3NEK A;  4LBH A;  4EO8 A;  1Y11 A;  2JVO A;  2LDI A;  1RAA B;  1DQ8 A;  1NH7 A;  4AL7 A;  4OYI A;  2ZUG A;  4TLQ A;  4USU A;  1RTI A;  2NR0 A;  3GV5 B;  4FPR A;  1CLF A;  1JLA A;  1VRT A;  4MIB A;  3OPK A;  2UVV A;  4I2P B;  3L7U A;  2XYG B;  1XR5 A;  3RG6 A;  3D67 A;  1D8Z A;  1A6L A;  3HHL B;  1T0T V;  5A8K A;  3ZXW A;  3QO9 B;  3EGN A;  1JLC B;  1U1P A;  4O3S A;  3BM7 A;  1BQM B;  4X4U A;  4H4O B;  3LQV A;  5CZX A;  1XIQ A;  1LOU A;  1LK7 A;  2CPJ A;  4ED1 A;  2LU1 A;  4R25 A;  2OGU A;  3BBC A;  1NM2 A;  4H4K C;  4AL5 A;  4CYU A;  2R7X A;  1U1L A;  1VQ7 S;  4ZIV A;  1IKV B;  2GGP B;  1NK8 A;  1FXR A;  3FBB A;  1CQN A;  1OYE A;  4HHH A;  4M63 A;  1UWA A;  4GKK F;  4G6V B;  2HQG A;  3ADA C;  5IV3 A;  4W98 A;  4ZHR B;  4NPO A;  1UEU A;  2Y1L B;  2J8A A;  1FWK A;  1TL7 A;  3G8S A;  4KKO B;  2FD2 A;  2EC2 A;  2N4D A;  4GKJ F;  5B0D A;  3M8Y A;  2E9T A;  2E7W A;  2XG8 A;  3J80 U;  3DRP A;  4F0K A;  4ZPB A;  2P6S A;  1RAJ A;  1LWC A;  3RAX A;  1RU2 A;  2DH9 A;  4ZJL A;  1JXE A;  1NAQ A;  3JSM A;  2E1P A;  3NKY A;  4OHZ A;  4OZL A;  5C42 A;  2Z57 B;  2KG1 A;  3S7R A;  1P9Y A;  2V69 A;  1TL1 A;  1KBR A;  1U0H A;  1OY8 A;  1AZS B;  1MWQ A;  3M8Q A;  4QW9 A;  5EHH A;  4DL5 A;  2ZJQ Q;  1LW2 A;  3V5R A;  3C8Y A;  1V5V A;  5FII A;  4ZDN A;  1K0V A;  1AT1 B;  2BW7 A;  4G1Q A;  3HKZ D;  1ICE B;  1ZH5 A;  2ZNZ A;  4JI7 J;  2V6A A;  4ZP9 A;  1VQP S;  1SXL A;  2DTJ A;  3U7J A;  1M1K T;  3ZC4 A;  5KG5 A;  4IH5 A;  3CC7 S;  1F1B B;  3H90 A;  1KFS A;  1KQK A;  1F60 B;  2BKO A;  2XCA A;  1HQU B;  3CJS A;  3T5H A;  1Q81 T;  5HLF A;  3SDE A;  3MCS A;  3H7H B;  3LH2 S;  2JC1 A;  5CYM A;  1MML A;  2ZH1 A;  4DPX A;  1R43 A;  5KT2 A;  3CWJ A;  1S1W A;  3IA0 A;  5DDP C;  4LSN A;  3KTQ A;  1XK8 A;  2AGQ A;  1NDC A;  1LFW A;  5C2G A;  1SJF A;  4NX9 A;  3KXD A;  4X65 F;  1NND A;  2QL7 B;  4RO0 A;  3D6M B;  2IJR A;  1LW0 A;  2UVW A;  1NB2 A;  4N8N A;  3GB0 A;  3WIU A;  5KFX A;  2BYC A;  2XWX A;  1W26 A;  4O4G A;  3RR8 A;  3BO4 A;  3GMG A;  1RCX B;  2YQ1 A;  4ICL A;  4OV6 A;  1S6Q A;  3Q8V A;  1RI7 A;  4DV6 J;  4ES3 A;  4DR2 F;  1NDK A;  2RIL A;  3OFF A;  4CLT A;  4ZJO A;  1OSC A;  2GCF A;  1B0P A;  4G3I A;  2M9K A;  3Q8Y A;  2HSE B;  1KD1 T;  2AJ2 A;  2VIC A;  4QW8 A;  1U6Z A;  1IKX A;  3RTV A;  5HMY A;  1IBM F;  2Z2Y B;  1ZAW A;  3C66 A;  3OTC A;  3R5B A;  1YRX A;  3MED B;  1NB7 A;  2F5G A;  3N28 A;  3Q0A A;  2GVZ B;  2IDL A;  2XC9 A;  4OYA A;  4LIW A;  3ZTS A;  2QMX A;  2JRS A;  2K3K A;  3T1Y J;  5J1N A;  2CNL B;  1QM9 A;  2LFV A;  4KBI A;  1JQG A;  3PXG a;  2UUB F;  1KTV A;  3OTB A;  3C46 A;  2H5I B;  1WI8 A;  3PRV A;  1J27 A;  1ZBT A;  2GX8 A;  3HVR A;  5KG2 A;  1CUL B;  4ELV A;  4RUA A;  2IVF B;  2F8H A;  3DC2 A;  4ILM A;  5D0H A;  5KT3 A;  2BAB A;  2RF2 B;  2XSJ B;  2DNQ A;  5T7L B;  2CJQ A;  3DRX A;  1TEL A;  4YS2 A;  2YWG A;  5GME A;  5GAD I;  4C8O A;  2G9O A;  2MEW A;  4NLD A;  2JSX A;  4KH0 B;  3MMA A;  3WX8 A;  1T3N A;  1UFL A;  1HBM B;  5KFB A;  5F0U A;  3PW0 A;  2N3L A;  1AUS L;  1YJR A;  4HYK A;  3OD2 A;  5G0R B;  2QC3 A;  1TV6 A;  1Y4Z B;  3IO1 A;  2YKM B;  1TVR B;  1ZM2 A;  3DOL A;  2CJX B;  3W7B A;  4CO5 A;  3IR6 B;  3DLH A;  1S76 D;  2B7C B;  4DL3 A;  4F2S A;  1FNM A;  4B3S F;  1YZ6 A;  4NOH A;  2Y8W A;  1FFW B;  3OUY B;  4ZLN A;  3HUL A;  2JJ4 D;  2CQ0 A;  2ZIT A;  4LIR A;  3CT9 A;  5J1E A;  2OEK A;  3K5P A;  3PEH A;  3QRP A;  4LVO P;  4LSL A;  1BE4 A;  4N77 A;  1EAY C;  4C8M A;  2CA9 A;  3C14 A;  4BWM A;  4DR3 F;  3DKD A;  2JEJ A;  4ANC A;  4RW9 A;  4WK3 A;  3DDN A;  3J81 U;  1R0C B;  4Z37 A;  1U48 A;  2K1R A;  4H54 A;  1WEL A;  4DDF A;  3TWZ A;  3KLI B;  4CLL A;  4ATN A;  3C16 B;  2CAD A;  4K0K J;  4OYO A;  3ILJ A;  3BS9 A;  1RTJ B;  2V68 A;  1W2B R;  2A6M A;  2RQK A;  2RUS A;  5DGA A;  3LWM A;  3TJ9 A;  4UUW A;  4LFB F;  2IA0 A;  1JLQ B;  5CHC B;  4M5J A;  4CIO A;  2QTW A;  1NJI T;  2EFN A;  5AJ3 J;  2GC8 A;  4P9S A;  4DR7 J;  3MUT P;  4DV3 J;  5D3G A;  1LWE B;  2XEX A;  5CYQ B;  1N34 J;  5HJX A;  1C0T B;  3HDS A;  3ZNU A;  4OYX A;  1D1U A;  3K59 A;  1SL2 A;  3HSJ A;  2K06 A;  1R0B G;  3MCO A;  4LF9 F;  1FF2 A;  2R2R A;  4DZ6 A;  2CUY A;  4YHH J;  2WOM A;  3F56 A;  1S9E A;  3VGS A;  1S1T B;  1T9X A;  4LF4 J;  4E98 A;  2A1B A;  2UU9 J;  1U8W A;  1WOS A;  2CPX A;  4J7C A;  4OHV A;  2LEP A;  4NRT A;  4NA3 A;  1S99 A;  3CJT A;  5IWA F;  1XNQ J;  3NNC A;  4I6W A;  4RNN A;  4ANE A;  2DXD A;  3DOK B;  1Y5L B;  2OJ3 A;  3MMB A;  2L9N A;  4X62 F;  2FJB B;  5LM7 E;  3L3C A;  4E0D A;  4LRF A;  4PQA A;  1QAJ A;  5D0G A;  2CPY A;  6FD1 A;  1IKW B;  2ZM6 J;  3M6W A;  3HD1 A;  2QLX A;  1BXN A;  2W4C A;  1HYS B;  3VGV A;  2W7O A;  3CCZ A;  4YFU A;  2KYX A;  2ALZ A;  3H40 A;  3KUG A;  3GII A;  3HT0 A;  2E7V A;  2OO4 A;  2FY8 A;  1QDU B;  5SUH A;  2G1H A;  4C0B A;  4F4Z A;  4JI1 J;  3OR1 B;  4DOZ A;  2OAU A;  3D2W A;  4X2B A;  5IXU A;  4LR9 A;  1FI4 A;  1ZTW A;  5HAN A;  1CJK B;  4YB7 A;  3OFG A;  1TKT B;  3N9U C;  2DIT A;  4FBT A;  2C1E B;  2BDP A;  1R8A A;  3H4B A;  7FD1 A;  3OJS A;  2YX1 A;  4M5D B;  4JI4 F;  4FYV B;  1SQE A;  1OY6 A;  2QZ8 A;  2WAQ D;  5F8N A;  3I0S B;  3TR5 A;  1IBK F;  2M8D B;  2M0G B;  5FDL A;  4UTG A;  4F04 B;  1B7F A;  2G13 A;  2ZH9 A;  3U27 A;  3RRG A;  2ROG A;  4JI3 F;  2FHJ D;  3I32 A;  4KPC A;  2ZHO A;  3OXL A;  5E3R A;  4IYQ A;  1VOM A;  5DZ7 A;  4IG3 A;  3EE3 A;  4WFZ A;  3M8P B;  1S1V A;  2MST A;  2QA4 G;  4KHP J;  3W5Y A;  3D0H E;  2DCL A;  2CRL A;  2H51 B;  2VJU A;  1U45 A;  2EPI A;  5F9N A;  4O4R A;  3C3L A;  3GWC A;  3I5B A;  2Y0S D;  3SCI E;  1Q53 A;  3IN5 A;  2GJF A;  1WDT A;  3SXL A;  5CCL A;  4YN3 B;  4ZPT R;  2MZR A;  2XUL A;  4LR7 A;  1SJ1 A;  3SYZ A;  2OD6 A;  3VAG A;  1SL0 A;  3TP2 A;  1PYT A;  1S1U A;  4UOF A;  4HT5 A;  3G2X A;  5CD4 H;  1NDP A;  3QRR A;  4IFY B;  3UN2 A;  2NSB A;  4DSL A;  5J2P A;  4X4S A;  4M95 A;  2HHT A;  4ECW A;  2K8G A;  2UVR A;  1ZZN A;  1HNX J;  1UPM B;  2HHH F;  4DI6 A;  3GTY X;  3H2L A;  3W9H A;  5DDO C;  1K1Q A;  1K47 A;  4A8X A;  4RUB A;  1QSL A;  1ZAV A;  4MYT A;  3UO0 A;  3IS9 A;  2HPU A;  4J9V A;  4DN9 A;  4WZM A;  1TK5 A;  1VFJ A;  4C97 A;  2LQ9 A;  5M2R A;  1SC1 B;  1SCJ B;  4DFM A;  1AW0 A;  2DNN A;  3IC1 A;  4OFZ A;  5ETO A;  4E8U A;  4FYX B;  1DUR A;  5LMN J;  4V19 J;  3EIC A;  5HK4 A;  2HFZ A;  2CPF A;  4O3Q A;  5CH7 B;  3PYF A;  2R7S A;  2D3Z A;  1DAR A;  3G71 S;  4YR0 A;  4HL9 A;  2BE2 A;  1Z4U A;  5E3P A;  3M9M B;  1TUV A;  4UZB A;  2QYC A;  5I3P A;  2GV1 A;  3EM1 A;  2DH8 A;  3LO3 A;  5KT7 A;  1GTE A;  4PR6 A;  2H4Y B;  3TNV A;  3LAL A;  1HMV B;  2I38 A;  4LF5 F;  3FCV A;  1G7C B;  1UEV A;  1RT6 B;  3IMQ J;  2HMI B;  2V9K A;  4NLO A;  2SXL A;  3AA8 A;  2F3J A;  4IFV B;  1WNE A;  2PFF B;  3PRD A;  1OJ4 A;  2R2S A;  4ZPA A;  3RGI A;  2KFY A;  1H7W A;  2HFS A;  1GAO A;  2ZC4 A;  4OJ3 A;  4OI2 A;  4QPX A;  4C8Y A;  1QE1 A;  3JAM Y;  4RW8 B;  2QMU B;  3Q83 A;  5CA5 A;  4ECQ A;  1SVD A;  2F4V J;  3LAM A;  2QSW A;  3OBI A;  1GMW A;  5J2N B;  5J1P A;  3D1O A;  4Y6I A;  1TL5 A;  4WP8 A;  4S0M A;  3FRZ A;  1WHV A;  3KUE A;  2J7K A;  3SCL E;  1Z2L A;  2OSQ A;  4UOC A;  1F3V A;  4RUH A;  3MM7 A;  4LBI A;  1PJ7 A;  3QJP A;  4TXS A;  2JNJ A;  1Z1Z A;  1N33 F;  3RRK A;  3V6K A;  3PCO B;  4KT0 C;  3DHX A;  2XWY A;  3OXG A;  3HHN B;  3DGP B;  5CAB A;  4IH6 A;  4ELU A;  3JTO A;  5KFV A;  3ZZU A;  2OPQ A;  1N6Q A;  1RIS A;  1XMQ F;  3AH6 A;  1RA6 A;  1RP5 A;  3OW2 R;  2DY9 A;  2W01 A;  4DFJ A;  5DET A;  4KSE B;  2J0S D;  4FKX A;  3A13 A;  1RAB B;  1NKE A;  3UN5 A;  2KG0 A;  4IQX A;  1FDN A;  3V6H A;  4DR4 J;  4CDI A;  5F8J A;  2DHA A;  4CLY A;  5GAH U;  4L3K A;  2BEF A;  1VRU A;  2KM8 C;  1FER A;  1SB6 A;  3MUR P;  1WEY A;  4YUD A;  5EDW A;  3GLJ A;  3M2U B;  3PFO A;  3I4H X;  4PWD B;  4TLR A;  3RR7 A;  3NGR A;  4DL7 A;  2QA2 A;  4X4Q A;  1XQI A;  5KFK A;  5DG8 A;  2FHO B;  4JI5 F;  2FVQ A;  2QLF B;  2D69 A;  4ZIW A;  4UQG A;  4KRW A;  3S01 A;  1RBL A;  2F40 A;  4DR5 J;  3LWL A;  4KE5 A;  1FES A;  1SBR A;  2R7W A;  4XTT A;  2XMA A;  3QAU A;  4CP5 A;  2BRL A;  4DSF A;  1XMB A;  5AXN A;  4ECU A;  4DFP A;  2RKI A;  2ZEJ A;  3OFE A;  3QLH A;  1WTB A;  5ETR A;  1EET A;  5A8R B;  1CQM A;  2J7W A;  2HZA A;  2E5G A;  2R8G A;  4O3N A;  3TEG A;  3M2V A;  1X4C A;  2N3O A;  3AD8 C;  2HHW A;  3CTR A;  1RYR A;  2HFU A;  2B4O A;  3EPG A;  4M5K A;  3BSN A;  1VQL S;  3NWG A;  1LWF A;  2C2R A;  2YKA A;  2UXB J;  4YB5 A;  1QJH A;  4Q0B B;  3C15 B;  1FJ7 A;  4L73 A;  2B3T B;  5K5M A;  4PAB A;  1VK8 A;  2ZDP A;  3TVY A;  1FK9 B;  2AWZ A;  1YJ7 A;  1X60 A;  4CLP A;  2CAJ A;  4OYM A;  2ATC B;  4FS1 A;  4DPT A;  1M1G A;  2CIM A;  1VK3 A;  3ETO A;  4RL1 A;  2D9O A;  1WC4 A;  3RAQ A;  2ZE2 A;  1NJW A;  2D9P A;  2KFN A;  3OHB A;  3TW0 A;  1URN A;  4DV1 F;  2DPI A;  3ZO7 A;  3D0G E;  5LSL A;  2BZ2 A;  2IMW P;  2W1B A;  4J9Q A;  1OQ3 A;  2J0W A;  3J80 Y;  3H2V E;  1IJF B;  3C6U B;  3Q89 A;  2LMI A;  3LW5 C;  3D0I E;  2GA7 A;  1IBC B;  3IRX B;  5HBM B;  4OZ1 A;  2V8V A;  5FLX U;  3NG8 A;  2VKZ G;  3MD3 A;  3DN9 A;  2DGX A;  1UFK A;  2HHS A;  2F65 A;  4NXN J;  1HBO B;  4WP3 A;  2VBZ A;  1S49 A;  2BMB A;  2ASD A;  4I6Y A;  3EGZ A;  4R0E A;  4JYA J;  4QZV B;  4YB6 A;  1DJ0 A;  3M6U A;  2E5L J;  4OJG A;  1X0F A;  4ZVT B;  1KOO A;  1K73 T;  3PG9 A;  2ATL A;  3CB4 A;  4OI4 A;  2R2U A;  1IKV A;  4CQ1 A;  4HR2 A;  2W24 A;  3UCU P;  2QFI A;  4CH1 A;  1H98 A;  3NAI A;  1KOH A;  1FT8 A;  4GC6 A;  4ZHR A;  1UMJ A;  4QYZ K;  4FYW B;  2W9B B;  4USM A;  4KKO A;  4RU9 A;  4JBC A;  1I1G A;  3K7R A;  1D9D A;  2HWT A;  3VZI A;  3OSN A;  4DX6 A;  4PZV A;  2Y8Y A;  4ZPD A;  4HTI A;  5D4P A;  4EMD A;  1SC3 B;  3BV8 A;  1MRO B;  4ZA1 A;  2HFN A;  1RAF B;  2M3D A;  4PG7 A;  3M8S A;  4ZLL A;  4P2S A;  4WFN Q;  3A8K A;  2NRE A;  3KLH A;  1AZS A;  3GR0 A;  4NLU A;  4DUZ F;  2PE8 A;  2FUG 9;  3V4I A;  1YIJ S;  2R7R A;  1MNE A;  2VBW A;  2QL9 B;  3TO8 A;  4JV0 A;  1TTH B;  2H54 B;  3W63 A;  1NME B;  5J2Q B;  3WHI A;  4N76 A;  3BJY A;  4AQY J;  4HHU A;  2YKP A;  2CQ3 A;  1UPP A;  3DOM A;  2CQC A;  2OPS B;  5D15 A;  1UVJ A;  3ZFV A;  3P45 B;  3CED A;  4FXW A;  3U1N A;  4CT8 A;  1B0T A;  4U6P A;  3HHK A;  3SSR A;  1VS3 A;  4YB1 P;  1RTH B;  1UJ6 A;  5KFF A;  4WE1 B;  1LK5 A;  2B4U A;  3VQS A;  1IQT A;  3I55 S;  3ONQ A;  2LXI A;  4FS2 A;  2FVR A;  3NS7 B;  1MG7 A;  2Z8Q A;  5ADZ A;  4MYU A;  3CCE S;  2CZV C;  3GIL A;  3GIJ A;  2P9C A;  5DLF A;  4LF7 J;  4DQQ A;  3D6T B;  1N32 F;  3DRS A;  1N0U A;  1CS4 B;  2LP4 A;  4C0O C;  1T8E A;  3AXM A;  4ZCM A;  3H5Y A;  3BN7 A;  1D8Y A;  3UD4 P;  4Y65 A;  4QYR A;  3BDP A;  2BOP A;  2QG9 B;  3CNQ P;  4IOB A;  4YDX A;  4B3R J;  3M2R A;  3AB2 B;  5FD1 A;  1AB8 A;  2HNY B;  3ZTP A;  2R3V A;  4PG8 A;  2ZJR Q;  2YNF B;  1T9W A;  2YH0 A;  1TL4 A;  1YRT A;  1LEO A;  3NGT A;  3ZZO A;  2IM2 A;  4NL5 A;  2MPU A;  1QTN B;  1Y3K A;  1X8D A;  4ZVO B;  4F0M A;  2X1G A;  3HF5 A;  3CVK A;  4L3N A;  2AKW B;  4XO0 A;  2R4F A;  1REV B;  4DR6 J;  5LJ5 Y;  4YR2 A;  4DV6 F;  1N5S A;  4OYZ A;  1S59 A;  2GVD B;  3A8I A;  4TQS A;  2HFO A;  2B6A B;  4I6A A;  2M4M A;  3W5Z A;  3ENV A;  4OLO A;  3MFH A;  1FKA F;  5BYR A;  2Z2L A;  2EFG A;  5LXR A;  1T9V A;  1FDB A;  3RU0 A;  3BH7 B;  1WDD A;  5BR8 F;  2RD5 C;  1J5E J;  4LJM A;  5AXM A;  5LOQ A;  2YNG A;  2IC3 B;  2OD4 A;  4IOA Q;  1KHV A;  3N0V A;  4GVB A;  3V6D B;  3CIM A;  5CYJ A;  1EAR A;  1KS2 A;  2ZOF A;  2EEY A;  1HBN B;  1Z2Z A;  4QU6 A;  2K2P A;  1VLY A;  3B82 A;  3SFU A;  1RHU B;  4WXO A;  1EB0 A;  1RHM B;  4JV5 F;  2YX4 A;  3H98 A;  1GMW D;  1HIY A;  1HI0 P;  1G6B A;  2CG4 A;  5KT5 A;  3AT1 B;  2XI3 A;  2GFF A;  2J9D E;  2BBE A;  3K5O A;  5AE1 A;  1JLA B;  1TMJ A;  5BYQ A;  1VRT B;  2PT0 A;  1TL3 B;  1N54 B;  5J2M A;  1R8P A;  1S12 A;  4RWW A;  5IM0 B;  3FBF A;  3OJU A;  5A8K B;  3OTO J;  1Q0N A;  1BQN A;  1DLO B;  2VQE F;  2MYF A;  4LF8 J;  1FEH A;  2E5I A;  2VC1 A;  3E3X A;  1HD1 A;  1N5Q A;  4RJV A;  4TY9 A;  4KTQ A;  4B08 A;  2POK A;  1QLN A;  1N5T A;  5E3A A;  4DF4 A;  4JI2 J;  3KFW X;  3NRB A;  2GAH C;  2YXL A;  4CYU B;  2UVU A;  3GJS B;  1VHF A;  2MY8 A;  1JLQ A;  1IWA A;  3TUZ C;  4DV0 J;  3MM5 A;  1VQ9 S;  2C2K B;  4DS4 A;  2A6O A;  2EBG A;  2KYZ A;  2G2Z A;  4WWS A;  3NMA A;  2BV3 A;  1WC0 A;  2MKK A;  2N7Y A;  3MMC A;  4IUF A;  1JLB A;  2DCU B;  2DJW A;  3FSI A;  3TQE A;  1V9O A;  1HFE L;  3D68 A;  1H74 A;  4LQ3 A;  2K7K A;  1TL7 B;  3MMJ A;  1WG5 A;  1V3R A;  3MPW A;  4KAI A;  2MLY A;  3OV7 A;  5JUM A;  2XY7 A;  4PUO A;  3VVT A;  2CG8 A;  3DRP B;  4LBP A;  2ACM A;  3MCM A;  1ZA1 B;  1XJW B;  5KFR A;  3G96 A;  1S1T A;  1LWC B;  2WSC C;  1S7H A;  2HZC A;  3JSM B;  1R8H A;  3NS6 A;  4B9N A;  1DFD A;  2BW2 A;  1VQM S;  4DLE A;  3TZZ A;  5ETT A;  3NOC A;  1Y5N B;  3AOD A;  3CJ3 A;  1TL1 B;  2W2P P;  1U0H B;  2DNK A;  3DOK A;  4YHH F;  2MLZ A;  4F50 A;  3HHD A;  2DGW A;  4ETX A;  5IC6 B;  2MB0 B;  1A9N B;  4QR0 A;  1FRJ A;  3E01 A;  1S9G B;  2BA9 A;  3QPI A;  1RWU A;  4HH1 A;  1UET A;  2CJK A;  1HYS A;  1R8C A;  3IR7 B;  2PC6 A;  3DLK A;  1ULR A;  1PBU A;  5CCM A;  2W4P A;  4L76 A;  3MI7 X;  2O01 C;  2HNZ A;  5K9F A;  2PMW A;  4B3M J;  2APO A;  4A8F A;  1QAX A;  4N41 A;  4OI3 A;  2DGT A;  2PA3 A;  2PMZ D;  2MZ1 A;  4TU9 A;  5CYM B;  1U2F A;  4HHJ A;  1S1W B;  1VJQ A;  4LSN B;  3D3B J;  3TAR A;  2XMM A;  1BUX A;  2H3E B;  1XR7 A;  3VTI A;  4CLW A;  4J91 A;  4M8L A;  2E1A A;  4LFC F;  1NSQ A;  1LW0 B;  1NJZ A;  2WVC A;  5GVQ A;  5B08 A;  1NZA A;  2V2Z A;  3K5N A;  4O4G B;  3R7N B;  2W8L A;  2B51 A;  3EVO A;  2QA1 A;  2EK1 A;  1NO8 A;  1S6Q B;  3W65 A;  5KOX A;  2V50 A;  1SH2 A;  3G6V A;  1SC6 A;  2NS1 B;  1WSR A;  4U9R A;  2Q79 A;  2FIU A;  1Q8K A;  1IKX B;  1VC5 A;  4FP9 A;  2CXE A;  3KJV A;  3T9Z A;  1YJV A;  4ECT A;  4X4V A;  2Z30 B;  1KR4 A;  2Y9H A;  2PFD A;  1XWL A;  3CCL S;  3D3C J;  4RKU C;  3LPY A;  3AOA A;  4OQJ A;  2MQ8 A;  4ZP6 A;  2O66 A;  4NXM F;  3PV8 A;  2NXU A;  2VOO A;  2YY3 A;  4OLP A;  5DLG A;  1MLA A;  5HO4 A;  3I5C A;  2RQ4 A;  1RT4 A;  5T14 A;  4FYD A;  3VAJ A;  4CWB A;  4DQR A;  2VFU A;  1JLE B;  2C22 A;  1RWK B;  1VQK S;  3KHR A;  4URG A;  4NLW A;  1V5I B;  1K0T A;  2VV5 A;  3M6X A;  2WSE C;  4MK7 A;  2ZWP A;  2XQC A;  1BY9 A;  3MMA B;  4Q8E A;  3TX8 A;  2JC0 A;  2CJA A;  3BQ0 A;  4QWA A;  1X4E A;  1HKA A;  2ZFH A;  4ZVS B;  1TQL A;  1TV6 B;  3I9Z A;  5LT5 A;  3DOL B;  4X64 J;  5KFH A;  1V6H A;  2BXJ A;  1G1X A;  1H3D A;  2EVZ A;  2QA4 S;  2XTJ P;  2VDI A;  5KAK A;  1FRX A;  1X5S A;  5L39 A;  3M8Z A;  3KYL A;  1FRM A;  2OMO A;  2VQF F;  5J1E B;  1SJR A;  3W5X A;  4LSL B;  3UW1 A;  5A76 A;  5L8R C;  1NHV A;  1HR0 F;  4LFA F;  2HVH A;  3KK3 B;  4CTA B;  4WFX A;  3FMB A;  5F9L A;  3AD7 C;  4U7U D;  3M1V A;  1RK8 A;  2HMI A;  2K1R B;  4RZR A;  1CJU A;  1IWG A;  2C2E A;  1RBO B;  4ZLJ A;  3HSG A;  2J9D A;  4IFV A;  4RX6 A;  1YI2 S;  4F7V A;  3MF5 A;  2XNR A;  8AT1 B;  1TKZ B;  3JB9 k;  2GMH A;  3FSX A;  3GZ7 A;  3KDN A;  3KWM A;  4PG5 A;  1N36 F;  2A10 A;  2HGL A;  3CCT A;  4KIA A;  1X9M A;  2G2O A;  4MAK A;  2MKS A;  2C3Y A;  4QWB A;  4HEA 9;  2A0F B;  4DEZ A;  4DFK A;  5D3G B;  4YOE A;  3R97 A;  1QUP A;  5IC4 B;  1JMT A;  3CCM S;  5DRK A;  3O1L A;  5DM7 Q;  4OJ1 A;  4RW6 B;  5BXI A;  4DV4 F;  4QJV A;  4NEZ A;  1VIX A;  3I5A A;  3QWU A;  2UUA J;  2WOM B;  1OY9 A;  4DV5 F;  4WZQ A;  4AXJ A;  1PAU B;  1S9E B;  2ILZ A;  3V2U C;  1R27 B;  2M52 A;  2F4V F;  3BYR A;  3ZTO A;  4CLK A;  3HHL C;  4WFY A;  1V3Z A;  2RB7 A;  2KVI A;  1OPZ A;  3DHW C;  1FKO A;  2UP1 A;  1RBA A;  3EDR B;  4YQW A;  3MMB B;  3WX4 A;  2KN4 A;  2PMH A;  1PCA A;  5THW A;  5ETL A;  3PW7 A;  5E2Q A;  4DZD A;  3CJ0 A;  2L48 A;  3CO9 A;  2CPE A;  3QRQ A;  3KDO A;  2IFX A;  1T94 A;  1JJC B;  2MY7 A;  4PG4 A;  5LL6 d;  2EKY A;  2HLT A;  1PJ5 A;  4AE5 A;  2GAG C;  1IBL F;  3THT A;  4BHQ A;  1VHI A;  2R8H A;  4ZLP A;  3RYL A;  4D3G A;  2OUG A;  1B64 A;  3HZE A;  3FQL A;  3MTJ A;  3CXC R;  5A8W A;  1QD1 A;  1SJ4 P;  4XDD A;  4ID8 A;  1X4D A;  3MAA A;  2PSZ A;  3PR5 B;  5KG7 A;  2VC0 A;  1URR A;  1CEZ A;  3FCW A;  4DS5 A;  4ID5 A;  4DR4 F;  3GJT B;  2I5J A;  2LYV A;  4OX7 A;  1TR0 A;  2HRY A;  5KFZ A;  3UNG C;  2HS4 A;  4FVC A;  4ZIT A;  2D3U A;  2GS8 A;  4QWE A;  3GQC A;  4B9U A;  2WB4 A;  3VHQ A;  3T1A A;  1SI9 A;  1WF1 A;  1H2T Z;  5FDL B;  2X51 A;  1RSC A;  2VFR A;  4KC5 A;  2QMW A;  4ES2 A;  1FWP A;  1VQ6 S;  5HSP A;  2BRK A;  2V67 A;  3I82 A;  1HNZ J;  1L3U A;  3BGU A;  3K8W A;  5A8R A;  2EG1 A;  3IGN A;  4CO4 A;  4IG3 B;  2LEB A;  4DV2 J;  3K2Y A;  1CG2 A;  2UUC F;  2NZ4 A;  2HUR A;  2DT9 A;  2IJN A;  3Q8R B;  4Q0B A;  3C15 A;  1H7X A;  3U1M A;  1FK9 A;  3RBE A;  2KT3 A;  3CDA A;  2ZH5 A;  3SV4 A;  1WF0 A;  2QN6 B;  3QGG A;  1EX8 A;  4ED6 A;  9RUB A;  1NSP A;  2HLU A;  1QVF R;  5HVG A;  2J6T A;  5EGY A;  4F4X A;  2JX2 A;  5GAD U;  2DR7 A;  3N79 A;  3PVX A;  2WVE A;  2H1Y A;  2UXD J;  1H73 A;  2DNL A;  4URS A;  4IG0 A;  3T1H F;  3WZ0 A;  1NHU A;  2IRU A;  3IS9 B;  4IRK A;  2BJ8 A;  4J9M A;  3WDO A;  5KFA A;  2BR0 A;  3OL9 A;  2CQ4 A;  3UDC A;  5BJR A;  2IY5 B;  2JEI A;  4DUT A;  1SH3 A;  3ET6 B;  5IZH A;  3AB4 B;  3JQK A;  2WTF A;  2O1P A;  5KFY A;  3B4M A;  3PNI A;  1SC4 B;  2XO6 A;  3D54 A;  5L1J A;  1NJY A;  3HM9 A;  4KB7 A;  3GYX B;  4R5P A;  4GRS A;  1UWB A;  4MIA A;  2BE2 B;  2XYH B;  2GMJ A;  4J9U E;  3CPW R;  3EX7 B;  3DYA A;  4IQM A;  3KHL A;  4EZ6 A;  4QIG A;  1ZYQ A;  1UW9 A;  3LGN A;  5KG0 A;  1FVS A;  3AXK A;  4LRA A;  2QE5 A;  4PYA A;  4YR3 A;  2GNK A;  2RT3 A;  5GAG U;  2E5J A;  4DCJ B;  1TP7 A;  2C2D A;  5I4M A;  2HWI A;  3Q2S C;  1BLU A;  3GSD A;  4U8Y A;  1IKY A;  3E51 A;  2DR5 A;  1G2E A;  3QQC D;  2CQH A;  3WQP A;  1VI7 A;  4ZPW R;  2XNQ A;  4F4Y A;  4CI0 B;  1YJ9 S;  1O6X A;  2BE7 D;  2CQG A;  3WC0 A;  3PHE A;  1L3S A;  4RU2 A;  1N4L A;  5CD4 A;  3QZ7 A;  3SV3 A;  2NZC A;  3IM8 A;  1IR0 A;  3BSC A;  2ZJP Q;  4MTP A;  4C48 A;  4K4Z A;  3MEE A;  1FRK A;  3J81 j;  1IM6 A;  2AJ4 A;  4RNO A;  2XSF A;  3KK2 A;  2LA6 A;  4ILL A;  3J7A N;  1S79 A;  5LSR A;  3MM7 B;  4WFB Q;  1F0X A;  1NPR A;  2D3O 1;  1FO1 A;  3BQ1 A;  3NGD A;  4DV7 J;  2ZZT A;  1Q86 T;  1D9A A;  2V4J A;  2BJD A;  2EWH A;  3CMA S;  2OPS A;  1IVZ A;  4WXW A;  2R9L A;  1FRL A;  4Q2M A;  3MD1 A;  1TFW A;  1S6P A;  2OTL S;  3M9N B;  4A46 A;  1T02 A;  1OO0 B;  5HAT A;  1RTH A;  1VBY A;  3GSI A;  4A8K A;  1VRQ C;  1FJG J;  2Q43 A;  4R8U A;  1N6Q B;  3D7S B;  4F0H A;  3W2W A;  2HW3 A;  1RYS A;  1XR6 A;  5KFM A;  3TAP A;  4QIW D;  5KFE A;  2DGQ A;  2Y0B B;  3TUI C;  4BLG A;  3M4X A;  3JQM A;  1YRU A;  1M5H A;  4XIU A;  4C4W A;  4A8M P;  2N7C A;  4J9N A;  1FX2 A;  4Q45 A;  2Q6C A;  3UE2 A;  1M90 T;  2CJY B;  2VA3 A;  1WF2 A;  1P1L A;  2HQ3 A;  4YY3 J;  1VRU B;  4OJH A;  4IR1 A;  3D5M A;  4DCP B;  3MEK A;  4Y2A A;  3OR2 B;  2FZG B;  3M30 B;  1RE1 B;  2CKW A;  1VBK A;  1Y10 A;  1GQE A;  2B43 A;  4ZVQ B;  2DYA A;  2GO9 A;  3UD3 P;  4QQB A;  5I3U B;  5DQI A;  4ED3 A;  3BKT A;  2FY1 A;  3D9B A;  1REV A;  1NK0 A;  2AEM A;  2MKJ A;  3A3P B;  3ZZY A;  5DQG A;  4KQZ A;  2B6A A;  5H9E J;  2PD1 A;  3D6F B;  3MAQ A;  2LEC A;  2RKI B;  4UOH A;  4QBU A;  3QLH B;  1EET B;  2K7J A;  2C2M B;  5B0G A;  3DLJ A;  4WF9 Q;  4ZKA A;  4DR6 F;  3PW2 A;  1S6U A;  3PIO Q;  4EFA C;  3T5J A;  4WII A;  4I4B A;  1GMU A;  2FHM A;  2JH3 A;  1XTZ A;  2AW0 A;  2FJX A;  3MM6 A;  3BRE A;  1IQZ A;  1SKS A;  2XMV A;  2VFT A;  3V6D A;  1X9W A;  1M5S A;  5MAO A;  4GKK J;  2G2Y A;  3EVW A;  3MEC A;  3MUM P;  1BQX A;  1YSJ A;  2R8K A;  3HD2 A;  2ZE2 B;  2FDN A;  1OS5 A;  2D7S A;  4HH0 A;  4B3T F;  4GKJ J;  4DWI A;  1F9F A;  1RT7 B;  4FVM A;  3ICL A;  4CO1 A;  1NK6 A;  2D1C A;  2GHV C;  1Q82 T;  1TL3 A;  1N48 A;  3QWP A;  5L9X A;  2CPZ A;  1M1H A;  1NK9 A;  2KRR A;  1Y3J A;  5IM0 A;  2G0I A;  5H9F K;  3CUL A;  3VV2 B;  1YVF A;  1NXI A;  2FHJ A;  3BKF A;  4P10 A;  3QSY B;  1S0N A;  2YPY A;  3G87 A;  3QIP B;  3HT3 A;  1DLO A;  1LQ9 A;  4D3H A;  3ISN D;  3IG1 B;  5G4D A;  2PI4 A;  4UT4 A;  3W1Y C;  2XM3 A;  1D3W A;  1FVQ A;  4TY8 B;  5IT9 U;  4A8S A;  4ENO A;  4NLP A;  2R7V A;  3R5A A;  3K17 A;  4OYB A;  1WC6 A;  4NCB A;  1RAE B;  4X84 A;  5ETV A;  4OZJ A;  5KFT A;  5DG9 A;  4LF6 F;  1VIO A;  2RVJ A;  2BQU A;  1LXN A;  2WHO A;  3TJA A;  1ZPW X;  4P72 A;  3I31 A;  2RDJ A;  1C2P A;  4X65 J;  1RKI A;  3PIP Q;  3KMQ A;  3K57 A;  2EXU A;  3JTP A;  1C4A A;  5L1K A;  4NLT A;  1H38 A;  2CQI A;  2OFG X;  3ELH A;  1HNV A;  3OXF A;  1XEZ A;  1R6Y A;  2NXN A;  1YX2 A;  4M1K A;  4TYB A;  4DR2 J;  4O3O A;  2H5E A;  3EJM A;  3KLH B;  4ZN3 A;  5HQL A;  1HHS A;  3V4I B;  2Y3Y A;  1RKJ A;  4K59 A;  5DJB A;  1S9G A;  4Q2L A;  4M5H A;  4DL6 A;  2F9J A;  1IBM J;  4J90 A;  4AXI A;  4I69 A;  4QIE A;  2L9D A;  3CC4 S;  2C28 A;  5ETM A;  4OX8 A;  3DOM B;  4X66 F;  1VBX A;  1KVI A;  2QIF A;  1HBU A;  2V63 A;  1P6T A;  4FXD A;  5JVG Q;  3AD9 C;  4ZK7 M;  2UUB J;  5LMU J;  1TUG B;  3A8E A;  3SQG A;  4F8R A;  4P73 A;  1UEK A;  2VDH A;  2W2M P;  4JI6 J;  1ZOT A;  2BJE A;  4I7F B;  2LXF A;  3CDB A;  1HPZ B;  2RHS B;  1BD6 A;  2FLO A;  3Q24 A;  2X1F A;  1NJX A;  4B3M F;  5KOW A;  1SIW B;  3ZZP A;  2IHR 1;  1WC5 A;  5ETK A;  1PC5 A;  3DRS B;  1YG0 A;  3MDF A;  4C3K A;  2ABY A;  4TQR A;  3KLV A;  2FPH X;  2ASY A;  3M2R B;  1KKH A;  2ZH3 A;  3FDS A;  2HAI A;  3G86 A;  4EGL A;  3K0J A;  4B3S J;  4O0I A;  4KGM A;  2Y1J A;  1C4C A;  2YBV A;  4MT1 A;  3LAK A;  2DHH A;  4JI0 F;  2AF6 A;  3KK1 A;  3M9O B;  3LAN A;  3H4D A;  2AX0 A;  1VQ8 S;  4NYO A;  5CAA A;  4DR3 J;  3AQP A;  2DNH A;  3BGF A;  2LLZ A;  2DIU A;  4QOT A;  3W64 A;  1X4B A;  2XZD B;  2B5J A;  2NXE A;  4ECS A;  4F3O A;  2KU7 A;  4N56 A;  2RAQ A;  4LT6 A;  4XK8 C;  4PAA A;  4ECZ A;  4CCH A;  5F8M A;  1JLE A;  2ZBR A;  2HK2 A;  4CO0 A;  2MGZ B;  4OHW A;  2MJU A;  4C98 A;  3IWX A;  4LFB J;  3CSK A;  1NRK A;  1CVJ A;  3UPF A;  1RQ0 A;  1S77 D;  2YNG B;  4DXL A;  4I0W A;  5EWG A;  3BZQ A;  1PAE X;  2XCP A;  2ZOG A;  3PRB A;  4P2M A;  3IFE A;  4GVB B;  3N5F A;  2G1D A;  4ZS6 A;  2FJA B;  3GIR A;  1ROF A;  2GZO A;  4C8Z A;  1XMO F;  3AJ1 A;  1YJN S;  4Q44 A;  2HGM A;  4ILR A;  3TAN A;  3N01 A;  4MKA A;  5E41 A;  4P7T A;  3DLG A;  2JLE A;  3ILI A;  3H2U B;  3PYD A;  3FFI A;  3JQJ A;  4JV1 A;  4RW4 A;  2VHG A;  4JP8 A;  4LF9 J;  2AYG A;  2RE1 A;  2JEG A;  1F2H A;  2RIJ A;  2QLW A;  2YWW A;  3KLF B;  3BH6 B;  1XNR F;  2YWH A;  3ETM A;  5J2M B;  4J5O A;  2DEJ A;  4A8O A;  3L4B C;  4C3L A;  3B54 A;  4K2X A;  2CVI A;  3CW2 C;  3HKW A;  5IWA J;  3KK3 A;  1RA7 A;  4CTA A;  3KOA A;  1BQN B;  4PXB A;  4NCG A;  5HMX A;  1DTT A;  4X62 J;  3ENW A;  2ZZN A;  4ED5 A;  2W2O P;  3NBP B;  4BWJ A;  1B0V A;  1F2G A;  1C0U A;  5GAG I;  4A8W A;  1TKZ A;  4LUB A;  3OVA A;  2ADB A;  4C8L A;  1X0P A;  3B6B A;  3LP2 A;  4EI2 A;  2DGO A;  2CWX A;  3SCK E;  3RW6 A;  2F8M A;  2BAN A;  3MM5 B;  2KHD A;  2A2D A;  2IMO A;  2EI5 A;  1HWI A;  2KI2 A;  5GMK a;  2Z2Z A;  2DK2 A;  1JLF B;  3MMC B;  1JLB B;  4U95 A;  3PJX A;  1MU2 A;  3W60 A;  3SI8 A;  2ZHA A;  4RW6 A;  3BF4 A;  2EC0 A;  3AOB A;  3KHH A;  4NLG A;  1IBK J;  4PUO B;  3PZP A;  1EP4 A;  2I2Y A;  2MMY A;  1T95 A;  3WBZ A;  4JI3 J;  3SEO A;  1UTA A;  2WCX A;  1QY7 A;  2ZBI A;  2IM3 A;  4CLS A;  5GMD A;  4K8R A;  3DDI A;  2IIH A;  1KLM B;  2P2C B;  4A8Q A;  2MZT A;  3I6P A;  4X4P A;  3E01 B;  4MKY A;  2V94 A;  1HQE A;  1KWM A;  3MWB A;  1M5P C;  2AJ0 A;  2LDY A;  3CD0 A;  3UQS A;  1JNZ B;  4TN2 A;  3PYE A;  3US5 A;  3PJW A;  2JOQ A;  4NLX A;  3CCV S;  3K5M A;  3PFE A;  3DLK B;  2VUG A;  2Q66 A; 
#chains in the Genus database with same CATH homology
 1R6V A;  2Z30 B;  3A3O B;  3P5B P;  2Z58 B;  2PMW A;  2W2P P;  2ZWP A;  3WIV A;  2E1P A;  3BPS P;  4NMX A;  4OV6 A;  2W2Q P;  2ZWO A;  2XTJ P;  1ITP A;  2W2M P;  4JP8 A;  3T41 A;  2Z57 B;  3BGO P;  2Z2Y B;  3WHI A;  1SCJ B;  3GCX P;  3WIU A;  3CO0 P;  2Z56 B;  2W2N P;  3VHQ A;  4K8R A;  3SQO P;  3VV2 B;  2W2O P;  3CNQ P;  3H42 A;  4YN3 B;  3QFH A;  1V5I B;  3AFG A;  1SPB P;  2QTW A;  4NE9 C;  3A3N B;  3GCW P;  2Z2Z A;  3A3P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...