3HHNB

Crystal structure of class i ligase ribozyme self-ligation product, in complex with u1a rbd
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
92
structure length
92
Chain Sequence
RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/rna
molecule keywords U1 small nuclear ribonucleoprotein A
publication title Crystal structure of the catalytic core of an RNA-polymerase ribozyme.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hhnB00
2DB1A 2MHNA 2N3LA 3DLLQ 1UP1A 3BO2A 1FJEB 2VOPA 4WCEQ 3G8TA 3CCES 2DGSA 2DGTA 1VC0A 1FT8A 4CH1A 3CTRA 2MQLA 2DO4A 2M8HA 2MPUA 2KG1A 3S6EA 5CXTA 2LMIA 3THTA 2EK1A 1XN9A 4TU8A 2MB0B 4UQTA 2HGNA 1WF1A 1VQ7S 3MD1A 1PGZA 2KHCA 1WEZA 1VQPS 3ULHA 3VF0B 2F9DA 2RT3A 3I56S 3VAIA 3Q2SC 2G0CA 3VALA 3VAHA 1VC6A 2MQPA 2HYIB 2CQ0A 1BY9A 3N9UC 3CCLS 4PR6A 4IOAQ 5EN1A 2CPZA 2DITA 1Q86T 1X4FA 3SDEA 1K9MT 2YH0A 1OO0B 2XS5A 2E5GA 2MJNA 2DHXA 3CCRS 1FNXH 4W92B 2J0QD 3NNAA 1VQ6S 2KRRA 1VBXA 4P6QA 1JMTA 2M0GB 5IFMA 3MURP 2MKKA 1UAWA 1H2VZ 2XSFA 3R1HA 3IWNC 2ADBA 5GAGU 1DHMA 1X5SA 2MYFA 2KN4A 2L08A 3RW6A 4WF9Q 5GMKa 1R8HA 1JJ4A 2DNPA 2PEHA 1VQLS 1L3KA 5LXRA 1RK8A 2DNRA 3S01A 4IO9Q 1Q82T 3G8SA 3MXHP 5FJ4A 2DGWA 2KYXA 3BEGB 1QVFR 2ZJQQ 1N88A 2KRBA 3EGZA 2VOOA 4FXVA 5IM0A 2RUGA 1KD1T 1KOHA 5CA5A 2CPHA 4U67Q 2J8AA 1W2BR 2YKAA 2OTLS 5LSOA 3CCQS 4TLQA 2E5JA 2F9JA 2ZJPQ 1JJ2R 4LIRA 2DIUA 2VONA 5DETA 1FO1A 4IOCQ 1X0FA 3CCUS 1S72S 1SJFA 3NS6A 2D3OR 3CMAS 1IQTA 2B0GA 2MJUA 4QPTA 5JVHQ 3VAKA 2ERRA 3MI7X 1U1MA 1R8PA 2CPIA 2MY8A 2RQCA 4UY8T 1SXLA 2DH9A 2CQGA 1M5VC 2KM8C 4QU7A 1NU4A 1OPIA 2KH9A 2DGOA 1U1RA 2CQ4A 4CQ1A 2GO9A 3BO4A 1U1LA 1X5TA 2LEAA 3D2WA 1UFWA 1WG4A 1X4DA 2CQ3A 2KG0A 2XNRA 2X1FA 2XB2D 2MKJA 2MQNA 1H6KX 2CQBA 2K8GA 3VAMA 1YIJS 2NZ4A 1U1OA 1NO8A 4IUFA 2L41A 1U2FA 5DM7Q 1PO6A 2K3KA 1SJ4P 1M5PC 1ZZFA 2MY7A 2M4MA 1S79A 1VBYA 3V4MA 5D78A 2X1GA 2LCWA 2MZJA 1OWXA 2VODA 3OW2R 3MUVP 3UCZP 1X4CA 3UE2A 4F02A 4F26A 3I55S 4CIOA 2DNZA 2PE8A 2X1BA 1NJIT 1FXLA 1WWHA 2DGVA 2MGZA 2QEXS 2J0SD 2XS7A 1CVJA 2FC8A 4PRFA 1DBDA 3G9CA 2U1AA 4WKRA 1HD1A 4YOEA 5LSLA 2N3OA 3CMES 2DHSA 1N52B 2MZQA 4WFNQ 3EX7B 2Q79A 1N8RT 1Q7YT 4W90B 1H2TZ 2WBRA 2MZTA 2DHAA 4C7QA 5LJ5Y 4A8XA 2J76E 1X4HA 5GADU 3UD3P 1DRZA 1KQSR 2EK6A 3LPYA 2M7SA 3TYTA 2M52A 2MQOA 1KOOA 1YI2S 2LYVA 2M2BA 2MQQA 2CQDA 3UWTA 1RKJA 4BS2A 1VQNS 2OSQA 2DNKA 4CH0S 1WELA 5HO4A 3SMZA 2RS2A 2NLWA 2EVZA 2DGUA 3VAFA 2CPXA 2AD9A 2LA6A 3CXCR 1D9AA 3NNCA 2DGQA 1VQ4S 2RU3A 2DISA 3U1MA 3CULA 3TP2A 2AYMA 1JJHA 2LEBA 2RRAA 4M5DB 1H2UX 1X4BA 2CPYA 2RQ4A 1U1PA 1M90T 1YITS 1SJ3P 4LMZA 3MDFA 2CQIA 2YWKA 5BJRA 3G96A 3P5TL 1ZH5A 5DM6Q 2DH8A 2G1DA 1Q81T 4Z2XA 2CPJA 4ED5A 2KXNB 1D8ZA 4J5OA 1K8AT 5IQQA 2N7CA 1N54B 2CQ2A 3CF5Q 3UD4P 1M5KC 2DH7A 1VQKS 1VQOS 3S7RA 1U1KA 3DXBA 1X4GA 2O3DA 2HGLA 1X5PA 2DNYA 3CD6S 2JWNA 2LXUA 2YH1A 2M88A 3TO8A 1M1KT 2N82B 2HVZA 2OSRA 4F25A 1QM9A 1U1QA 5GVQA 3P3DA 1FJCA 2RNEA 2ZJRQ 3CUNA 5CYJA 4QQBA 3BO3A 3PIOQ 1KC8T 4YUDA 1G2EA 2MKHA 2RS8A 2I2YA 1O0PA 2HGMA 1K73T 1HD0A 3NMRA 2CQHA 3RW7A 3CCSS 1F9FA 4OZ1A 1URNA 5MLCV 1ZZNA 2FC9A 3G6ES 1U1NA 2CQ1A 3ZZYA 2XNQA 2M8DB 3P49B 2MSTA 4Y0FA 3K0JA 3NS5A 2D9OA 2LKZA 2V94A 1WI6A 2FHOB 1WF2A 2LQ5A 5GAEU 1HA1A 2CPFA 4WFAQ 2CPDA 4TU7A 1WHWA 1WEXA 3P6YC 2DGXA 1YJ9S 2MGZB 2OJ3A 4TU9A 1VBZA 4WIIA 5JVGQ 3H2UB 4Y00A 2DNLA 1AUDA 3FEYB 2KFYA 4QU6A 4C0OC 2M9KA 3FEXB 5HL7Q 3G4SS 1VQMS 2E5IA 4ZKAA 2SXLA 2KU7A 2CQPA 1UW4A 3SDEB 5DDRC 1WHVA 3R27A 1OIAA 4YB1P 2KXFA 1VQ5S 1FHTA 2ADCA 3R1LA 2G4BA 5GAHU 2UP1A 4EGLA 2KXHA 2MKSA 1QVGR 2MMYA 3SXLA 1WHXA 1SJQA 3VAGA 2I38A 2LXIA 1U6BA 3VAJA 2E5HA 3S8SA 4V19X 1FJ7A 4C4WA 2X1AA 3G71S 2MZRA 2MKCA 2FY1A 1A7GE 2GHPA 2MZ1A 4RU2A 4FXWA 1WTBA 3LQVA 2DNQA 4OZ0A 3EGNA 1VQ8S 1SJRA 2JVRA 2HZCA 1P1TA 1DZ5A 2A3JA 2D9PA 2RVJA 2DNMA 5IM0B 2LA4A 2FPHX 1X4EA 3J7YU 2CPEA 3ZZZA 3MD3A 2L9WA 5LJ3Y 1WI8A 2U2FA 3CC7S 3MUTP 3NNHA 3J7ZT 2CJKA 2KM8B 2MKIA 2KT5A 3CC4S 2MQMA 3L3CA 3MUMP 3IRWP 1YJNS 3CCJS 5H1SV 2M70A 2RRBA 1WF0A 2AYGA 2QA4S 1X5OA 3BS9A 2XS2A 2LECA 2DO0A 2MZSA 1M5OC 1B7FA 2BZ2A 1YJWS 1VC5A 3U1LA 1WG5A 1VQ9S 3THPA 3CCVS 2AYBA 2QFJA 3MOJB 2YTCA 2DHGA 2E44A 2DNHA 2DK2A 3JB9k 3H2VE 3US5A 2BOPA 1YHQS 2OTJS 5ITHA 2JRSA 2KI2A 2F3JA 5D77A 3UCGA 2DNOA 2JX2A 1HL6A 2DNGA 3PIPQ 2DNNA 2DIVA 2MSSA 1WG1A 4WFBQ 4PKDB 3HI9A 1WHYA 2OIHA 2MXYA 1U6FA 5LXYA 3CPWR 2JVOA 1X4AA 2CQCA 3B4MA 5DDPC 1YTYA 4ERDA 3Q2TC 1A9NB 5DDQC 2AYEA 4LJMA 3UCUP 3CCMS 1YWXA 1WEYA 3B4DA 3HHNB 2KVIA 1P27B 5DDOC 3CC2S
chains in the Genus database with same CATH superfamily
2MHNA 4ZLNA 1CJUB 3BDEA 1F5BA 4QJVA 3QNWB 4CO4A 2MPUA 1PKUA 4DU7A 4TQRA 3PYFA 5D6GA 2YNFA 4KGVB 2HGNA 2WTFA 2HHVA 3RGIA 5I4MA 1VHFA 3MTJA 1T7PA 4A47A 2PSZA 1NH7A 2CPZA 4GKJJ 3EE3A 2YH0A 4C8OA 2DRAA 4MIBA 3RJMB 4C8KA 1ROFA 1VQ6S 5HP1B 1H2VZ 3JS9A 3N6LA 3TUPA 2C2EA 3NAHA 4OZJA 1DHMA 4HHHA 1V3RA 4ZVPB 3D4JA 5KOWA 4DR4J 1IQZA 4PWWA 3S01A 4URGA 2FZGB 5IWAF 1SL0A 3JTNA 2BJEA 2IAJA 4AL6A 1EETA 1ELOA 1FE4A 2E5JA 2GZOA 2QX0A 3PW5A 2ASLA 4RR5A 2AEJA 1Y11A 3M2RA 2PGCA 2Y3YA 2Q66A 1N5TA 4KSEB 2CUYA 2C42A 5KG2A 2W9BB 3BSOA 4BWJA 1SXLA 2L9DA 3OR2B 3RR7A 1DFDA 2DGOA 2CQ4A 4EBDA 2GO9A 2HQCA 4L72B 3M2UB 2EWHA 2KG0A 2XB2D 5M2UA 1C4CA 4G6VB 3CJKA 5GMEA 2P6TA 3A8IA 2HQ3A 2ZBQA 3V4MA 2Z8QA 3PTWA 2ZM6J 1LW0A 1S49A 5K20B 1IBMF 1R8CA 2HVIA 3K8VA 2Y8YA 3EGVA 3MEKA 3J81U 3F0NA 2XHCA 3ZTPA 3KK2A 2MZQA 2Q79A 4W90B 3ZZ0A 4KKOB 1KQSR 2UUCF 2ZHBA 3K5NA 1YJTA 5DS7A 3ZZRA 1LWEB 2M2BA 2JSXA 3QGGA 3T9NA 2BE9B 5A2QY 2ZH5A 1U1PA 3FSYA 2E66A 3PR4A 5C42B 1OS5A 4UZCA 2ZUAA 3HXMA 4JI2F 3ILJA 3EXCX 2FGCA 1VQKS 4QWEA 1JQGA 3X1LB 2YX4A 4RNMA 2LXUA 4X65F 2GIFA 1RTJA 1IJEB 3DN9A 8RUCA 3KDNA 2FHJD 4Q43A 1EZZB 1SUQA 3PRBA 1PJ5A 3JTOA 3G6YA 4CP5A 3ZNJ1 3D67A 1JLAA 3CCSS 3RZAA 3R2DJ 3Q8YA 4V19J 2ZDPA 1D3WA 1WI6A 1WF2A 5GAEU 2HHUA 4YQWA 1IXKA 4DSJA 5J2NA 3M8RA 5IT0A 3WQPA 1MMDA 1J5OA 4FYXB 3I0SB 3I6PA 4NYOA 5KT7A 5K14B 4F4YA 2KXFA 4RL1A 2HFVA 1EB0A 2WVCA 3R1LA 2VA3A 2I5JB 3QFHA 1IKXB 5ETRA 3KJVB 3L95X 1FJ7A 2AX1A 2X1AA 2B5JA 4E8UA 4QYZJ 1SV5B 2ZWPA 2YKNA 4MKAA 3T1HF 3HKZD 3ZZOA 4KFBB 1VISA 1C1BA 2I0XA 4BHQA 5KFEA 3K8WA 5DLFA 1X4EA 4M5GA 4R5PA 4I67A 3LAMA 3SV3A 3NS7B 2A18A 4NL5A 4ZVEA 1YJNS 5U47A 4YDDB 2IMWP 3H25A 2QA4S 3GQCA 2R4FA 3L9ZA 4OYIA 2Y0SD 3CCZA 2WVFA 4GVLA 4CLZA 2BZ2A 2BQ3A 5HBMB 4CM0A 2N7YA 3MGJA 1N32J 3PZPA 4GO7X 4DV7F 4ED1A 4J9PA 1DLOB 4FXDA 4CWBA 3LWMA 2UUAF 2CADA 2AV5A 3V2UC 2GQ2A 5E3PA 2DNNA 5KFRA 4DCJB 1S0OA 2HIQA 3EGWB 3CCMS 4CO1A 3CJ2A 3B4DA 1P27B 3M8PA 4QR2A 2UVWA 4NX9A 2VOPA 4WCEQ 3G8TA 4ANDA 3FSIA 3J7Z5 3FEZA 4JV0A 4ZPVR 2EXUA 1GMUA 3S6EA 1SC1B 1N5VA 1Z2LA 3ULHA 5AE1A 1UVLA 2W9CB 3Q2SC 5HMWA 1QSSA 2UXCJ 1DAXA 1LOUA 4AE5A 3GJRB 4ELTA 4NMXA 3SDEA 2PT0A 1YVFA 2E5GA 4W92B 2G9OA 1FA0A 3BN4A 1QSLA 4P2MA 3B82A 1TL4A 2IDEA 1L5UA 3GYXB 1F60B 1HNVB 5D4OA 1KVKA 5F3ZA 2EFNA 2F8EX 3RAMA 2Z2YB 2MEWA 1Q82T 1C0UA 4I2PB 3RAXA 4LBPA 4Z37A 2I8EA 4XPEA 4DV0F 3PYEA 4DR2J 4J7CA 4NRUA 3G87A 5DETA 5A0YB 2RILA 1FO1A 2GVDA 3OFGA 3NGUA 5C7PA 1AA1B 2R7WA 3F44A 3GV8B 1TU0B 1S9GB 2CIMA 4ZPAA 4QBUA 2KJWA 4NPOA 1HKAA 1U8SA 2WK4A 5I3UB 4DQRA 2KM8C 4Y6IA 2H48B 1URRA 2BM0A 4CQ1A 4KGKA 3VZIA 1EKRA 3A13A 1UFWA 2GJFA 2HFSA 4ELUA 5CYQB 4LFCF 1NO8A 3IS9A 5DM7Q 4JOUA 4B9SA 2K3IA 2RDIA 3AD8C 4N41A 5D78A 1OWXA 3TQ1A 4K4UA 3OW2R 1ZA2B 3M30A 3AT1B 4E0DA 1ZPWX 4R8UA 4CDIA 4U6PA 4A8WA 1HYSA 4FNIA 2DT9A 4OI4A 3N4WA 4YB6A 2N3OA 3JSRA 2VPYB 4KYZA 2HNYA 3UD5A 3BDPA 5HVHA 2GGPA 3G6VA 3ELHA 4LF2A 4C7QA 4DX5A 2EK6A 2M7SA 4LSLB 1FEEA 4EYIB 1NB7A 1JKHA 4DSKA 5A76A 1LEOA 2DRBA 3G8QA 2MLZA 4NLPA 3CULA 2BXJA 2AJ2A 4OYOA 3K58A 3MCSA 2YKPA 3PFOA 1SB6A 2YWKA 2L3MA 5LSRA 1RT2A 2DR7A 5IC4B 2QYGA 3MAHA 5BYQA 4G65A 1CEZA 1M5KC 2J6UA 3BSCA 3I96A 3DXBA 1X4GA 4Q5VA 5HSPA 3JYTB 2IA6A 3C14B 1SH0A 1U25A 1QTNB 2YNIA 2BMBA 3CJ8A 3IXQA 4O4RA 4QQBA 4Y28C 3AODA 3RB6A 2BE2A 1ZBTA 3M8YA 1NSPA 4MAKA 4AT1B 3U1NA 3RW7A 3VVTA 3IA0A 4OYMA 5IV3A 3RYLA 4ES2A 2PFFB 2MSTA 3OLAA 1KRPA 1EX8A 1TUWA 2EBEA 4RUCA 2W25A 2OHDA 2OJ3A 4TU9A 4P7VA 3K89A 1BE4A 1AROP 1ZAWA 2GIRA 2CQPA 4MKBA 4EWTA 3DHXA 1UEKA 4FDFA 2DKOB 4IH5A 1JLFA 3M6UA 2KFZA 4DV3F 4ZIVA 2H5IB 2ZH1A 4DV4J 2GHPA 3D6FB 3GB0A 2B9WA 2V34A 1VQ8S 2JVRA 4K5SA 2D9PA 2C2MB 3O8WA 2IAJB 3RBEA 2DNMA 4WE1A 1KKHA 1R43A 3E8OA 3ZTOA 2VG6B 5LJ3Y 2Z0GA 5IXUA 3J7ZT 3TZXA 4JI4J 2QE5A 4K2JA 2OPPA 2ASDA 3L4BC 4P10A 1RU1A 3WIVA 1LW2B 2HFOA 4Q0BB 5AE3A 2JLGA 3W64A 3HVRA 1RCOB 4UOHA 3CDUA 2R7TA 3DRPA 1FRJA 1GT8A 5A8RA 1FK9A 3GFYA 4OZ3A 1YJ7A 3IM8A 2DNOA 2J5AA 4ZN3A 4WFBQ 3KLHA 4A8OA 3CPWR 1NK5A 5F8JA 1LW0B 1F9EB 1UVJA 1H38A 1RT4A 2IM3A 3IAS9 4AL7A 4B9VA 3V81A 4LF6J 2QLFB 4WYLA 4ZVQB 2MLXA 2DGTA 2MQLA 3IC1A 1U24A 2VQFF 4U96A 4DFPA 1EP4B 3KK2B 4K8RA 2KHCA 1MNEA 1IUJA 2VHGA 3SCLE 1NPPA 3ETMA 3QQCD 4PG4A 3FFIA 4WTYA 3HLUA 2CQ0A 2IYIA 1NPKA 3UW1A 2J0QD 2XGPA 3DDNA 5E3AA 4ILMA 1R0BG 2V69A 1EHWA 3MWBA 4DL4A 3OFFA 3J7AN 1HARA 3GR0A 2RKIA 2UVUA 2D7SA 2QV6A 3RW6A 2ZUGA 1WTFA 1XEZA 2RUSA 3SQOP 5HMXA 1OSDA 4J9SA 5KFHA 2DGWA 4F04B 2W8LA 3OTEA 3OVSA 4TVAB 2V2KA 4U67Q 1RTJB 2YY3A 1TAUA 2IBKA 5LT5A 3W7BA 4ED4A 4OHZA 3DYAB 2MHEA 1SUQB 1U1MA 3GFXA 4C3LA 2XI2A 2HKEA 1M5VC 2CVIA 2XWYA 1OPIA 2KH9A 5FD1A 2XQCA 1S1WA 4LSNB 2XLJA 2YKMB 1SQEA 2HHPA 1TV6A 3B6BA 4YY3J 1NK4A 1SKSA 2C2OB 2R8JA 2CRLA 2FDNA 2ZITA 3GIKA 2C22A 1RTZA 1XNQJ 3ISND 4K4YA 2R7UA 3UCZP 1X4CA 3TUIC 2PE8A 3CDBA 4DUYF 4I0WA 5DG7A 4U8YA 3G9CA 3ICLA 3KHRA 2B7BB 2BQRA 2YKNB 2D3UA 1Q53A 3OL6A 4L6V3 1WOSA 1Y0HA 4R5PB 5HJXA 1N5QA 1V5IB 1X4HA 5KFCA 1P6TA 4OHWA 2ZBPA 1FDDA 3V6KA 2YQ0A 4ZA1A 2XC9A 2E7XA 4XIUA 2RU3A 1X31C 2HZVA 3TP2A 2XM3A 1M90T 1WOPA 2CQIA 2AZ1A 3TVYA 4KB7A 3BN7A 3QJPA 2CQ2A 2V4JB 4LF8F 2HLTA 3SCJE 5KFTA 2Y1LB 1SIWB 2COLA 1RHUB 2HGLA 3Q8UA 4JI8F 1T8EA 3DLEA 2C28A 4LREA 1QM9A 1I94F 1QSYA 1FJCA 6FDRA 1RE1B 5J2MB 3M8PB 3MR5A 3L7UA 1BWEA 2ZD1B 1HBUA 4NLRA 4ECWA 1QJHA 4MK8A 4IFYA 2RH3A 3D7SB 3G6ES 4NZ7A 2VV5A 2DEJA 3UDCA 1WSRA 5J2QB 4ED8A 1RLDA 1RT6B 2D9OA 1HNXJ 1BQNA 2XCPA 3WC0A 3MMCA 4Q7AA 3W61A 1BQMA 1LWCB 4ER8A 1T03A 1NSAA 1HBNA 5IQ6A 2V2VA 4ZKAA 3CD5A 2IJFA 3SDEB 3FGVA 3M1VB 1JXLA 2PO4A 1AYEA 4DCPB 4RW8A 1F5CA 4RNFA 2MKCA 1A7GE 2QJ3A 4H4KA 1R8AA 1C0UB 3MM7A 1S1UA 3IG1A 2HS3A 4XDCA 3TAMA 1D1UA 3AD7C 2GVDB 3L3CA 1RBLA 1FKPB 4L73A 1J27A 3CCJS 1GMWA 2RRBA 1WF0A 2F5GA 4JV2A 1FKOA 2XS2A 4YEAA 1UW9A 1Y7PA 2FZCB 4LRFA 1UCNA 2W4PA 1HIYA 4LRAA 2VKRA 2W2NP 3GV7B 2V8GA 4DV1J 1PC5A 4JI7F 4JP8A 1RTDA 3THVA 3CO0P 3CT9A 4X64F 4FS1A 2HBZB 3UCGA 1CJTB 1H74A 3R5DA 2DIVA 3P45B 1R27B 4DPYA 4JI6F 2X3GA 1SJ1A 1A9NB 3UCUP 1YWXA 3M30B 2B56A 1RT3A 5DDOC 1ZM2A 1KFSA 4TYAA 4R8UB 2WB1D 1HYSB 1WORA 1VC0A 4HI2A 2Z57B 2GV1A 4F7VA 5C5JA 1U7LA 2LVWA 1XN9A 2GJ2A 2HNYB 2XSJA 2GGPB 2XG8A 4DPXA 3QZ8A 4CH7A 3J7YI 1RAIB 2NS1B 3PX4A 2XZWA 5CD4H 1GFWB 2EKYA 4X4RA 1WJ9A 3MM9B 2F4FA 3TNVA 3J80U 3UDEA 1VK3A 3OXGA 3HHLD 2MKKA 2MTLA 2UV8A 2RF2A 4DV2J 1RT2B 3A1YG 2PEHA 1Y5IB 4BLGA 1Y5LB 5DG9A 2UUBJ 3MXHP 1NEEA 4XDDA 4UT4A 2XI3A 3G86A 3FQLA 1IBLJ 4ENOA 2OTLS 5LSOA 1RLCL 2YNIB 2ZJPQ 4S0MA 4LIRA 2DIUA 4ZCMA 2YWFA 4X66J 3CMQA 4A8FA 2A10A 4GKKF 4QZVB 2H9ZA 3M9NB 3LGMA 3F41A 1HNZF 2HHWA 3OPKA 5HN0A 1UJ6A 1WNEA 4NXMF 5IZHA 2NXJA 3R5AA 2K1RA 1WSVA 2ZH4A 1GX5A 4HTJA 5FLXY 4ECZA 1F3FA 5JMNA 4C8YA 4IUFA 2IRYA 5B0CA 4PQAA 3N79A 3BGUA 1M5SA 1OY9A 1ZZFA 1DURA 1S6QB 4LF7J 3MPUB 5AJ3J 2PMZD 2Y8WA 4F26A 3NAIA 1WWHA 2GNKA 1B64A 1NSKL 2DRDA 3NY0A 2U1AA 1SL1A 5A8KB 2DHSA 3RR8A 2V63A 2ZKTA 2Y1RI 4CTAA 3JSMA 4F0KA 1H2TZ 4WE1B 3NRBA 2W2MP 4IQMA 3HSDA 4CO0A 4USUA 5KFIA 2ZEJA 3BR9A 2LYVA 2R7XA 1WKJA 3TJ9A 5DQIA 2DNKA 4DL0C 3I87A 3CXCR 5HQMA 3BGRB 2I1RA 5L1LA 1RWNB 4OJ3A 2Y1JA 4CYUB 1S6UA 2B8QA 4OYPA 1XIQA 2WHOA 3TVKA 5A8RB 1FK9B 2UV8G 2DH7A 2RE1A 4AQYJ 4CLWA 1RT7A 2I6WA 4B3MJ 4HKQA 4TY9A 1RT4B 4MYTA 3KG0A 2V6AA 3HVTB 2J9DE 4LR9A 1KWMA 2ZVSA 1KLMB 3H5SA 4WFAQ 3SSQA 1HA1A 4DI6A 1NDKA 2DGXA 1BWVA 1RWMB 5JVGQ 3BPDA 3GMGA 1AUDA 4DLGA 3FFIB 1VQSA 4ZVRB 4IRKA 3FQKA 4HDHA 3E01A 3O5TB 3NMAA 2C2ZB 1N34F 4LQ3A 2XTJP 2DXDA 2GX8A 3RRGA 2AGPA 3T1AA 1N6QA 4ZHRA 2I38A 5KFJA 4IOBA 2LXIA 2F8MA 4P7TA 2GVZA 2RKIB 4HH1A 1JB0C 3GIMA 2FY1A 3PCOB 1HQ2A 2XLKA 4WK1A 4IKAA 1SJRA 2DR9A 5KG6A 1UZHA 1TL5A 3W2WA 2CPEA 4DBQA 2H51B 2BVZA 4G1IA 2ZC4A 1RADB 1H72C 1FNMA 3MUMP 2H1YA 5K9FA 1XNRF 3EM1A 3BSNA 4USTA 1B7FA 1D9FA 3PEJA 3K5LA 3THPA 4J9MA 4DR5F 2NYIA 3EUNA 2DK2A 1S12A 2XYGB 4P9SA 1TV6B 3K5OA 5HQLA 3GLJA 4O0IA 4CLUA 5HJYA 3LOUA 3SIPB 4CRJA 2HEKA 3WX8A 3Q2TC 4OYXA 2AYEA 1D09B 2YPYA 5KG5A 2AKWB 1XMOF 4KH1B 4DR6F 4O3SA 1TMJA 3CCES 2XWXA 4CH1A 3CTRA 2GMJA 1REVA 5KT6A 3TARA 2EK1A 3KDOA 3DRSA 1WF1A 1VQ7S 3ITHA 4XTTA 4R0EA 4I2QA 2E9TA 2KZMA 1PC4A 4ILLA 2E1MC 2OPRA 3R6GB 1N36F 3IRXB 4KHRA 1VRUA 3N9UC 4F4KA 4A4JA 3BGLA 2XO6A 3CCRS 3DM2B 3QIDA 4OMFG 1VI7A 2HWTA 4WJBA 2IHR1 4TN2A 3V6DA 1FD8A 4FF1A 3MMJA 1KTVA 1L3UA 3HCXA 4QWDA 1R8HA 2XMTA 3T5KA 2HAIA 3PR5B 4TLRA 4RW6A 3VGTA 4HI1A 3D6HB 2XY7A 2RJZA 7FD1A 5IM0A 4USWA 3DLEB 5J1EA 1R7IA 2ZH3A 3LP2A 4DS4A 1XC9A 3JQJA 3AH6A 1HBUB 2ZDOA 2ATLA 2D3OR 4NASA 5ETKA 4IFYB 2RHSB 1R0AA 1Q1KA 4LF5J 2RDJA 4YS2A 3H20A 2JZ5A 1NRKA 3MMCB 4OLPA 5CZVA 3D3BJ 4ZLJA 5JXSA 2CQ3A 3PW7A 3BH6B 4HT5A 2MKJA 2CQBA 1PG5B 2K8GA 3VAMA 1U1OA 4JV5F 1HBNB 5BYRA 2R7VA 3FSXA 2M4MA 1RA6A 2NXUA 4RW8B 4LBHA 3KLIA 3PX6A 3Q89A 1SBRA 1OY8A 2DGVA 4DR7F 4URQU 1TKTA 1FFGB 3AFGA 3TEGA 3PACA 2WOMA 4DU8A 4I6AA 3MM7B 1HQUB 3IG1B 4CO2A 4CLLA 3A12A 5GADU 2X51A 5C25A 3TAMB 2POKA 3PW2A 1NZ8A 5B08A 4URSA 5IWAJ 5D3GA 1N5YB 3UWTA 3MMBA 1BD6A 1IKVB 2NSCA 5ETTA 1FKOB 2DGUA 2J9CA 5T7LB 1W26A 2HQIA 3JSYA 4JI3F 2IA0A 3POTA 2QSWA 5B0DA 2JLFA 4NWBA 3WZ0A 4Z2XA 4X4PA 2CPJA 2KXNB 1RTDB 1IWGA 1Z1ZA 3CF5Q 2FHJA 3LPEA 4F4XA 5KAKA 2QT7A 2QRRA 3QFWA 1E6VA 1U8WA 2VG5A 5KFZA 4C98A 4ZJOA 1RHJB 2BKPA 1X60A 2HRYA 3FBFA 1Z2ZA 2FHKA 1RT3B 3A3NB 3WC2A 3KHHA 4MKYA 5KFAA 4YUDA 4KPYA 2BBEA 2E9RX 3TUJC 5MLCV 3M2VA 4DV5F 3RBDA 1IBMJ 3LA0A 1RYSA 3KK1A 3C15A 5ETPA 1HWKA 4DSIA 3EVWA 1VBZA 4Y00A 1LK5A 4LRBA 4FBTA 3HFKA 4C0OC 1S4EA 4PPDA 3J7A1 2ADCA 4N7TA 4QIWD 4EGLA 4FKYA 2OMLA 1APSA 2MMYA 1WHXA 2UUCJ 4H4MB 3F56A 3H40A 2QA1A 3S8SA 1TL7A 4EEYA 4RW7A 1H73A 1R31A 3C6TA 1WKKA 3SBMA 1XR6A 1C0TB 3BQ2A 4ZLLA 4RPFA 4ES1A 2LA4A 1IKWA 4FYVB 4JI2J 4O3RA 3IO1A 4F3QA 3TAQA 2IJNA 2KM8B 2VKZG 4DXLA 5CHCB 2C1EB 1LQ9A 5ETLA 3NWRA 1CJKB 3UVJA 3SCKE 2DO0A 2QN6B 5DRKA 4KGMA 3MOJB 1MW7A 2BQUA 4ZLPA 3X3UA 2BRKA 3QYYA 3AQPA 3KLGB 1U4BA 3EDRB 1H7XA 4NLOA 3T19A 4OHVA 2ALZA 4CCHA 3IFEA 5HMYA 3DDIA 3R3TA 4AXJA 3MAAA 2CQCA 4EUVA 3I4HX 2GIQA 4C0HA 3N5FA 4DN0A 1T3OA 1B0TA 3W62A 4KIAA 3ZC4A 1OPZA 1VHIA 3FZ2A 3BO2A 1M1HA 1JLGA 4C8NA 3HK2A 5D8HB 1V9OA 1U0SA 1TL3A 3MM5B 3AB2B 1F2GA 3L7OA 1Q4RA 4CTAB 5F8HA 3MD1A 1PGZA 3OTCA 5L8RC 2PFDA 3KG1A 2ACMA 3T1HJ 1NBEB 3TZYA 2IFXA 4LRCA 2HQFA 2LQBA 1OO0B 1FNXH 2CNKB 3LF0A 1Q78A 3I32A 2J6SA 3I9V9 1PYSB 2GMHA 1KTQA 3SEOA 1VBXA 3MPDA 3AY0A 4ZPBA 2XO7A 2P2CB 3IWNC 1KBRA 1T05A 2W7PA 2DR5A 3NCQA 2BKNA 2J7WA 1MWZA 2VBZA 5C2GA 3AJ2A 4YP3A 4TY8B 1RAGB 1DY3A 4AFFA 1SQFA 5FJ4A 1LWXA 3PG9A 3ENAA 1N88A 2BUNA 4DV7J 1FF2A 4EZ6A 4O4GA 5CA5A 3HSZA 1RT7B 3KNAA 2FJDB 2UUAJ 2M5YA 4JI1F 4IOCQ 4QPXA 2F4VF 4CNYA 2UUTA 2H3EB 1TP7A 4RU9A 4MT1A 2Z56B 2CG4A 4KY3A 1FRXA 1G1XA 1NDCA 1R89A 1FE0A 2R8IA 1YX2A 5DLGA 4KGZB 3KLEA 1OYEA 1IWAA 3D28A 1E6YA 3E01B 3ILLA 5K5MA 2DPJA 4QYRA 5D4PA 2CA9A 3JTPA 1FJGF 4ZHRB 2ZC3A 9ATCB 5EUHA 2GVZB 3OR1A 1TK5A 3MF5A 4OX9F 3PW0A 2ZOGA 4HT7A 4A8QA 3QLHA 5LSLA 2ZWOA 3CMES 2CVEA 4DR3F 1RGVA 2YWEA 4FYDA 1N8RT 3W2WB 4USHA 1JXVA 1JNZB 2MZTA 1TKXA 2MKYA 4KT0C 3U27A 1YI2S 1RKJA 5B0AA 2W4DA 3VV2B 1N33F 2RS2A 1MLAA 3B54A 3VAFA 4DV0J 2G0JA 2JJ4D 4LSZB 3NNCA 2IM2A 4OX7A 4RBUA 1X4BA 4PG8A 1XR7A 2ALYB 2RU9A 3MM6B 3QIPA 4WP8A 4X4UA 3CCWA 4HACA 4BCAA 1M1GA 1BUXA 4GO5X 1S6PA 2DYAA 1FTRA 3RUBL 3O6QA 2W7OA 4KO0A 3NGRA 2CWKA 2AEFA 1PCAA 4O44A 1VIXA 3UI3A 3KOAA 3BM7A 3K7RA 1IBLF 2HVZA 4LFCJ 2VG7A 4GVBB 5CYJA 3BO3A 1K73T 3NLCA 1FDAA 4BBYA 3N5BA 3C6UA 3HP6A 4OX8A 1REVB 5CABA 2R3VA 1MU2A 1LWFB 2A2DA 1FNOA 4ICLA 1DARA 5F8MA 2MGZB 4F3MA 3HHEA 1QD1A 2KFYA 1TTHB 4RUAA 1VRUB 2SXLA 2FYXA 2QLJB 2CDRB 1VQ5S 1VS3A 4CNZA 4ZP9A 2VBYA 3OL9A 2CJQA 2R7OA 2EPIA 1JLCB 4V19X 2KVQE 3M32A 4FN5A 2OPQA 4RU2A 4EBEA 2ASYA 4HL9A 2HBYB 2BJ3A 2UUWA 5IM0B 3HM9A 1ZPVA 5EWFA 3MD3A 5J1EB 3MEGA 3NNHA 5KT5A 3LP2B 5BR8F 1FCAA 4U8VA 1X5OA 3VQSA 2MZSA 2BR0A 3WBZA 2HHXA 4ZVSB 1R0AB 1T11A 3OSNA 5KFXA 2BOAA 4USIA 2YTCA 2DNHA 3CD7A 5G0RA 2ZVIA 3FC9A 5D77A 4WP3A 1LXNA 2FLLA 4MMOA 1KEKA 2VA2A 2YQ1A 3VGSA 1LXJA 3EPIA 5HROA 2PA3A 4ANCA 5HANA 4ZP8A 2VBWA 2APOA 5B0BA 3PRDA 3IR7B 2G0IA 4UF4A 1TKTB 2CZ9A 4NCGA 1HWLA 2MQ8A 1VRQC 3NL0A 2XZTB 3JAMU 4MK7A 4P2XA 2BRLA 5CXTA 1LFPA 1GNKA 2XMKA 3I5BA 2QMUB 4DV3J 3BKFA 4G3IA 3GPAA 1IJFB 4DL7A 3VAIA 4M95A 4IH7A 3VAHA 5D0HA 3TX8A 4ED6A 2O66A 3MMBB 2HYIB 3AJDA 1Q86T 2CJXB 2FLOA 4WXWA 2QA4G 3TOQA 5K8NA 3DU6A 2H4WB 3SYZA 1IVZA 4DQQA 1AZSB 4KHPF 2D74B 3M8QA 2LP4A 1JLEA 4Y2CA 5SZTA 3HHKA 5J2PB 4DQIA 2CPHA 3VQTA 1JJ2R 2YNGB 5RUBA 4Y2KA 5E41A 1B0PA 5B7WA 4KAIA 2OAUA 5KG4A 2R9LA 2B4VA 3CJ3A 3MTKA 3VAKA 3R8YA 3CJ5A 3FRZA 3KK1B 1HWJA 1KQFB 4QU7A 4EO8A 1U1RA 8AT1B 1DTTA 2WZ1A 2QFIA 1YIJS 2VQFJ 3GSDA 2FVCA 1ZM4A 2H5JB 1SJ4P 2XMMA 4CO3A 2X1GA 1L3SA 3UNYA 3MUVP 2Q43A 2AP6A 2OI2A 5E0OA 2GC8A 2DNZA 4CIOA 1TL7B 4IDKB 4Q8FA 2Q3PA 3C6TB 3DNCA 3UQSA 1UA1A 3WHIA 2ZE2A 1N52B 1W25A 1SC6A 4DZ6A 1IKWB 2CKWA 3QT7A 4TKTA 1KVIA 5T41A 2OD4A 5LL6d 5DQGA 4W98A 3HULA 4LR8A 1U09A 3SFUA 5DGAA 1DTQA 3PFEA 1NH8A 1VQ4S 3DLKA 3DXSX 2AJ0A 4M5DB 2CPYA 4J91A 3MDFA 2G1DA 4DPTA 4B17A 2CJYB 1K8AT 3PYDA 2WAQD 3QSYB 3FKBA 3W65A 2R42A 2AJ1A 2IJRA 3SI8A 2KDOA 2HURA 3V6HA 1HNIB 3GCXP 3MEDB 3MAAB 4LFBF 2YVSA 3QRPA 1GTHA 1RWUA 1VR6A 4QIGA 1KC8T 2MKHA 1KFDA 2HGMA 2QL7B 1XMBA 3NBPA 1SI9A 1TL3B 2RD5C 4QW8A 3VWSA 4Y0FA 4LVOP 1SH3A 4DUYJ 1B70B 2CPDA 4ZP6A 2ASJA 1FXRA 4ZDNA 4PG6A 3I5CA 5CYMA 3KJQB 1CS4B 2A6MA 1UEVA 1WHVA 3R27A 4YB1P 1QAXA 1KONA 4F0MA 3DOLB 1QVGR 2JC0A 3UN5A 3NCPA 1V6HA 1T05B 4P73A 4K5RA 1UA0A 2MZRA 2G1HA 4AXIA 1Q0NA 1FRLA 4ZVFA 3MAQA 3RB4A 9RUBA 4EFAC 4ECTA 2KHDA 3NGKA 1FESA 4O4GB 2EC2A 4DL5A 2U2FA 5D0RA 2OLWA 4LF8J 2LEPA 2Z30B 3HJFA 2AIRB 2VF3A 3DOMA 3TEHB 3BQ1A 4K4VA 4UZBA 4JI8J 1S59A 5IT9U 1Y00A 2HVEA 3ZZTA 1VC5A 3MR7A 1I94J 4KC5A 3DOKA 4LRDA 1VQ9S 2HNDB 2GO8A 2E44A 5HQ8A 3Q24A 4MYUA 2VFSA 3KLEB 2JRSA 1S4FA 1Q5VA 4D3HA 4M5IA 1ZYQA 2QTWA 3MCNA 2VDHA 4JI0F 4MIWA 2BYCA 1X4AA 4RJVA 4G1QB 5DDQC 4WXOA 2N4DA 3GJTB 3OR1B 2CXEA 2GHVC 4C8LA 1UP1A 3D54A 1RTIA 1WC6A 1RDRA 2F63A 3OFEA 4OZ5A 3QLHB 2PC6A 4ZPTR 4O3OA 4NLGA 3QWUA 2HHHF 1PJ6A 4JBCA 3PKYA 1TKXB 2W8KA 2LDIA 1UVMA 3HHLA 4P74A 2B9XA 4DFKA 3FBBA 3BYRA 3CCLS 3G6XA 1HQEA 2DITA 4C9DA 4XPCA 1F9HA 1M0SA 3ZTRA 3AA9A 4RW4A 5SUHA 3D6TB 4PUOA 4HACB 4Q45A 2MYFA 2PIIA 1VQLS 4KO0B 1L3KA 1JXEA 4DG1B 1AT1B 5FIIA 5HLFA 4DFJA 3BEGB 4ECSA 3HJVA 4IR9A 3VGVA 1SPBP 2PMHA 1KD1T 1BC6A 4JI7J 1GXTA 2YPZA 3D1QA 2F9JA 2A2CA 4X64J 3SSRA 3HF5A 2VG7B 2VQEF 4E2FB 4MTPA 4ID5A 4JI6J 2G2ZA 1IQTA 4OYBA 1YBTA 4OI3A 4IFVA 4K4SA 1MU2B 4OV6A 4ICLB 1X5TA 4K7QA 2XNRA 1RZMA 2X1FA 3MZIA 4FBUA 1CJVA 1RBOB 1OQ3A 3HZGA 5E5NA 2ZNYA 4ZPCA 2W2PP 2LCWA 4HH0A 2B4PA 1VOMA 4HLBA 4C2MA 3JSBA 1NHVA 2LDYA 3M32B 4LF9J 4C11B 2OPQB 4OYZA 2QEXS 2P9GA 1CVJA 3H59A 1DBDA 3AAWB 2ZBIA 4B3SJ 4DPOA 5B0EA 1HD1A 4YB5A 3K57A 5L1KA 4USKA 5LM7E 4AYBD 3GSIA 4X4VA 3TVZA 2J76E 3D68A 3MEGB 4ZPWR 1S0MA 2MQQA 4NI2B 1JLQB 1VQNS 1NDLA 4ZS6A 5HI7A 4FNHA 4K4TA 5E33A 4FS2A 3BYPA 2FTRA 1YITS 3FCVA 5DZ7A 1U47A 1WC0A 5BJRA 2XYHB 1U2CA 4GKKJ 4Q2MA 3T41A 3VHQA 4H4KC 1EJ7L 4CM2A 2XGQA 1D8ZA 1HNZJ 2HLUA 1Q7LB 4DEZA 3DRRA 5C24A 2ROEA 2JDJA 2KB2A 4NXMJ 3CB4A 1SQGA 3CD6S 3QJLA 4DX8H 4LR7A 4DL2A 2YH1A 4X62F 5DJBA 2ROPA 4I64A 2OSRA 2FLPA 3UDVA 2VL1A 4P52A 1RTHA 2RS8A 4ECRA 4NCGB 3D0GE 2W7AA 3D3CJ 3QGPA 2NYHA 3K17A 3BH7B 2ZZNA 2XNQA 3TJAA 1HNWF 3EDQB 4NYZA 2LQ5A 2AHOB 3NGDA 4LT6A 1NSQA 1UKUA 3C8YA 2FGOA 1U48A 3G4SS 1RB0A 2KU7A 2ZZTA 1Y5NB 5KFUA 3O2IA 3DMJA 3NEKA 2VH7A 4OZNA 1SIZA 4J9OA 3KUGA 2FUG9 5E7OB 4I56A 2BA9A 1U45A 5K8OA 4RNHA 3BGFA 3KLFA 4F3OA 1ULRA 1SKUB 3M8QB 1HBOA 4EMDA 1JLEB 2HZAA 4NLYA 5HMZA 2VJUA 4N8OA 2KFNA 1VJQA 3K5MA 3J7YU 5KFOA 5HP1A 1K44A 3AJ1A 3CC7S 2CJKA 1KHVA 2Q6CA 3SZ2A 1NK8A 2ZH2A 3BS9A 1XK8A 3EVOA 3P8BB 1F6TA 4M5MA 5FDLA 3OXLA 2QFJA 2GCFA 1BQXA 2EG1A 1KSPA 2Z2LA 1KNZA 2AJ4A 1RWKB 3JB9k 3BREA 5KFGA 1DTTB 2VICA 3T3FA 4F2RA 2HBRB 4ECYA 2AGOA 2KI2A 4B02A 4GC6A 1ZTTA 2MXYA 2YNHA 1L3TA 3DC2A 3GYNA 4K59A 1JK9B 3F73A 4E98A 4YR3A 3HHNB 3IBFB 2DB1A 2N3LA 3M2UA 3TQEA 3MCMA 1N34J 3DDKA 2DO4A 1UFLA 2ZE2B 1S57A 4TU8A 3ET6B 5AXKA 4FF3A 1KP6A 3NOGA 1VQPS 4OHXA 3PW4A 3VF0B 5ETMA 1T9VA 3MHYA 3VALA 2ZBRA 1ZAXA 4NLVA 2FVPA 1KR4A 4IOAQ 4KE5A 2RQKA 4DLEA 4DMZA 1DTQB 2ATCB 2RRNA 3DLKB 3GCWP 3DI6A 2EBGA 2ZKUA 3MURP 2VFUA 5EHHA 4J9VA 2W1BA 4KKOA 3EZOA 1I1GA 1XNRJ 4O3QA 1FRKA 1RKIA 5B0FA 5E3QA 5KFMA 1O6XA 2C3OA 4DR5J 4RW9B 2CAJA 2UZAA 1YGYA 4ZCIA 1GMWD 4DL6A 4CLKA 4GMKA 1S72S 1SJFA 2BANA 1RAOA 2HVHA 2VASA 3NBPB 3LP0A 3M7VA 3W5ZA 1QE1A 4OFZA 2R2RA 1NU4A 1XMOJ 4CT9A 4LFAF 3M6XA 4DX6A 4DR6J 1X0PA 3ZZUA 1X4DA 1Q8IA 3PXGa 3RTVA 1H6KX 5CYMB 2FVSA 4ILRA 3CE8A 1P1LA 3TW0A 2K3KA 2W01A 3TA0A 3W9IA 2YNFB 2MY7A 1MN9A 1PAUB 1B3TA 4Z7CA 4PWUA 2RDDA 4DF4A 1HI1A 2N4CA 4Y65A 1SCJB 2C3UA 1MSWD 1O8BA 2JFKA 3I55S 1N36J 1TFYA 1IR0A 5F8GA 4YDXA 1CC8A 1S99A 3T5HA 4RWXA 5GAGI 1Z4UA 3UN2A 1FERA 3H5XA 3IMQJ 5C2CA 3DRXA 5K14A 2BW2A 1A6LA 2WBRA 4DF8A 2C2NA 3LPYA 3HZEA 3O44A 1MROA 2VFRA 2KL8A 1YQHA 1C1CA 2C2KB 3DOMB 4CH0S 1WELA 1SV5A 3MCOA 3U1MA 1EETB 2AW0A 1H2UX 3DOKB 4IO1A 1ZS6A 5D0GA 5DM6Q 3EZUA 1F5AA 2HQDA 3TWZA 2KYZA 1WC4A 1RP5A 3I82A 3M2RB 2ZFHA 1VQOS 4HYKA 2A0FB 2E5LJ 3I0RA 3PJ9A 1PJ7A 5ADZA 4ZVUB 4PYDA 4ES3A 4ZCKA 3HVAA 4MIAA 2R8KA 5I42A 4JV5J 1DLOA 5EWEA 3FZBA 3GG0A 1X9WA 3PKMA 3CJKB 3KJNB 3M8SA 2I2YA 3NMRA 5HAOA 1SVDA 4NEYA 1TK8A 3NS5A 1S77D 2WONA 4DR7J 4ZPDA 2VC1A 4OL8A 2LQ9A 2G13A 1ICEB 4QU6A 1HQEB 2C3PA 3JXOA 3Q8PB 4KRWA 2Z2MA 1SJQA 4FF4A 2AJFE 4OI1A 4PUOB 2E5HA 1MN7A 4BC7A 3OJSA 5DO2A 2ZH9A 2W9CA 5M2PA 3MMAA 1RAAB 1RWXB 4FXWA 1NB2A 5KFNA 4L74A 3AB4B 4C0BA 5HLFB 4JI3J 2OMOA 4B3RJ 3LUYA 2HZCA 2A3JA 2E1PA 3MOZA 4NCAA 1JJCB 3CJSA 3HHDA 2QO3A 2YKOA 4DZDA 1X9SA 4C8MA 3N0VA 2B51A 3QMQA 5A8WA 2VPZB 2EEYA 2J8SA 3JAMY 2Y9HA 4ID5B 3GIJA 4J9RA 1YZ6A 3L09A 1RHMB 4B9NA 2FVQA 3HSGA 5KG3A 1M5OC 4YMEA 4CLFA 1WC1A 4U95A 3IR5B 3K59A 3S1TA 2MLYA 4I1TA 3IWXA 4N77A 5ITHA 1U49A 4B3TF 2IYGA 4DV5J 1JLAB 1N56A 5H9EK 1WG1A 1JNRB 2OIHA 1YTYA 4DR1F 3FCWA 5GAHI 1KVJA 1RABB 4NLXA 5J2NB 4NOHA 4X4OA 2JEJA 1J5OB 4UQGA 2HHSA 2CJBA 3B78A 2DGSA 2LLZA 2FJEB 3BBFA 5LMNF 1MMLA 3D6MB 3E51A 2KT2A 4P2SA 3LANA 1WEZA 2B5JB 1VC6A 2AT1B 3FNNA 5EN1A 2MJNA 2O1PA 2OUGA 3NNAA 3EMTA 1C1BB 4JUZA 4C48A 3V4IA 2XSFA 1Y10A 3D5MA 4IG0A 3K5PA 2UXDF 1AFJA 3Q0AA 5LXRA 3ILIA 4IO9Q 2Q6BA 4RBTA 3CIZA 4OV1A 3ZTQA 2B4UA 2KRBA 5MAOA 4GC7A 2BDPA 1OQ6A 4DPWA 4NA1A 3PO4A 3AXMA 4NLDA 4NLTA 3DRYA 4F36A 4DHVA 1RTHB 3FRYA 5D0EA 2LQ8A 1GXLA 1FXDA 2H54B 1GTEA 3W66A 3NP5A 1OJ4A 4NA2A 5KFYA 3EXYA 2ZNZA 1IBKF 2GA7A 5E2QA 3HFZB 1S97A 5F8IA 4ZIWA 1J5EJ 2W9AA 2NSBA 3CGIA 2AWZA 3CVKA 4USVA 2L41A 1U2FA 4P72A 4KJIA 1H98A 3T6JA 4RBVA 4ZVGA 1A0OB 4ZVOB 1M5PC 5E3RA 3DMJB 3MEEA 4LF4F 3PVXA 2MZJA 3KUEA 4F02A 2HWIA 1FXLA 1I3OB 3TANA 4Y2MA 2BW7A 3KLFB 2GAGC 1D8YA 1HBOB 1R3NA 2VIHA 2RMLA 4EYHB 1XJWB 2HAFA 1FTCA 3E2EA 3W5YA 2XYPB 4DPUA 3KNGA 4IG3A 3W8PA 4ED0A 4M94A 1I51B 2LA6A 1KQKA 2DGQA 2DISA 2AJQA 3LGNA 3RBXA 3DFEA 5FDLB 2RQ4A 4JI1J 3A3PB 3D9BA 1GXUA 1SJ3P 2GQQA 2FD2A 2PI4A 2VG6A 4MK9A 2F4VJ 1RSCA 4IH6A 1C4AA 4DUTA 4YR0A 5IQQA 4U9RA 2NPFA 1QAIA 1D0EA 1VIOA 3EWGA 4DOZA 4B3OA 1LNQA 4V1Ak 5B09A 2YNHB 1SL2A 1LW2A 1M1KT 5CD4A 4Q0BA 1VRTA 4F25A 2CFXA 1O5JA 3CUNA 3MR6A 2JEIA 3IAM9 3IS9B 2QG9B 3M05A 5T14A 2YWHA 1F9FA 4NZ6A 4EBCA 2R7QA 4I68A 1FJGJ 3PNIA 3P49B 2R7SA 2FHOB 4TU7A 4OX9J 3A8EA 5THWA 4U7CA 3T5LA 1RHKB 3H2UB 4RNNA 3GFZA 4DR3J 3FEYB 3MPVA 5IT9Y 2M9KA 5HL7Q 5LMUF 1P8GA 1Q5YA 5DDRC 1PBUA 1EP4A 1Y9OA 5F3TA 3LGHA 3DI6B 1WACA 1S7HA 3Q8SB 1K47A 3RRHA 3M6VA 3QRQA 3VAJA 3O3LA 3G71S 3ZXWA 1N33J 1JKHB 4JB8B 3OTOF 4LF9F 1WTBA 1UJ5A 4B3SF 3Q8RB 5FLXU 4N8NA 3PJWA 4ED2A 2BM1A 1OYDA 3VVUA 1DQ9A 1Q8KA 3AXKA 2VJVA 3GTYX 2MQMA 1I5OB 5H1SV 2BANB 2M70A 2AYGA 2W24A 4ZJLA 3W5XA 1RT5A 2DR8A 3L7PA 3LP0B 2FQQB 2P6SA 1QE1B 1WG5A 2HSEB 4M5JA 1PAEX 4NA3A 1FFSB 2QGFB 2BE2B 3J81Y 2OTJS 4MKVA 2HG4A 3DYAA 3A3OB 2DNGA 3PIPQ 2NUHA 3UPFA 1WUUA 5IC6B 2J7KA 5AE2A 3N01A 1NXIA 5CCMA 1WEYA 1RWWB 2AQ4A 2ZZMA 3H42A 4N56A 4F0HA 3QWPA 4LSNA 2WRMA 2YKMA 7AT1B 3TAPA 3OHAA 3OXFA 1FDNA 1D9DA 2HFNA 2B3TB 4Y34A 3THTA 3CJQA 2RB7A 4X84A 1JLFB 3T1YF 2EI5A 3RAQA 2XY5A 4UOGA 5DGBA 1MROB 3BQ0A 3EJMA 3R7NB 1C1CB 4PQUA 4PR6A 4IRDA 2HRUA 5KG0A 1RT1A 3A8JA 2ROGA 4OYAA 1NAQA 5F0UA 5BR8J 3SSSA 1X5SA 3N6MA 3VTIA 2OPPB 4GRSA 3H5UA 4CZCA 3G8SA 1TKDA 3MPYA 1QVFR 3VZHA 3I0RB 2FJWA 4QWCA 1YKWA 3G82A 2HQGA 4DUZF 3TA2A 4BC9A 1TVRA 2UVRA 3DRPB 1K0VA 5I42B 4YN3B 2EFQA 2D3ZA 3DHWC 2V4JA 1GQEA 3KLHB 3MI7X 2HHQA 3FCHA 2UU9F 2CPIA 3CIMA 3BGOP 1XMQJ 5DG8A 4X2BA 1UWBA 1NHKL 4O3PA 1HI0P 3V81B 2WONB 4NXNF 1U1LA 3UR3C 5J2MA 1NKBA 1S7IA 2ZD1A 4WPAA 4WU2A 4UUWA 1PO6A 1RA7A 4A8YA 4HDGA 4KHMA 4DDFA 1IR1A 4J90A 2ILYA 5J2QA 2QA2A 1RT6A 1W7WA 2O67A 2P9CA 4NLQA 1YSJA 1LWCA 3MMAB 1TL1A 2K7JA 5HVFA 1XR5A 4M5NA 2MDAA 1FEHA 3M1VA 2XHWA 3C16A 5ETNA 4KHPJ 3TZWA 3TYTA 3BPSP 4ECXA 5EDWA 2V50A 1WOOA 5A8WB 2E7VA 1Q95G 4Q8EA 4L76A 2GJIA 1U26A 3I9ZA 4A48A 3KK3A 3EPGA 1JJHA 2VBXA 1AFIA 4LMZA 2IC3A 2N7CA 1YG0A 2NPIA 4DQPA 1FKPA 4U7UD 2R8GA 1U1KA 3CEDA 4QOTA 4Z7YA 1X5PA 4TYBA 1VLYA 4KV8A 2IRXA 2H5EA 4K4ZA 4A8MP 4MH8A 3MECA 5GVQA 1S1WB 3AA8A 4QW9A 4OI2A 1O0PA 5A6WA 2CQHA 1URNA 3EZ5A 1CJTA 2OEKA 3W2VA 2M8DB 1YLXA 1AW0A 5ETQA 1J2VA 3WIUA 1VQMS 4G1PA 3H4DA 4PCQA 3CDEA 2BJDA 2O5DA 1WEXA 3W9JA 3KTQA 2L9NA 3GE9A 1RWVB 3CJRA 3FEXB 4C6AA 3UR0A 1UW4A 1FKAF 4J9NA 3OHBA 2J7UA 1FRHA 2KXHA 3BKTA 4BDPA 3V4IB 2B43A 4XAKA 2DVIA 1QAYA 2D41A 3W9HA 4IG0B 3EICA 3KFWX 2WB4A 1VJWA 3DGVA 2DNQA 2F65A 5L9XA 1X9MA 5CQGA 3JQMA 3KMQA 4ECVA 3MM9A 2RSQA 2FJBB 1NZAA 4P71A 5H9EJ 4ZOSA 4PZVA 3Q83A 2XCAA 3KMSA 1S0VA 3TJ8A 1XERA 2PMWA 2QYCA 3HKWA 3JQKA 4LFBJ 1SC3B 1EARA 1YRTA 3U1LA 2YX1A 3I4PA 3CNQP 3CCTA 2ZBCA 3BKUA 1F1BB 3H2VE 1HWUA 1QAJA 1S0NA 4NLSA 1Q79A 3TX0A 2OH2A 1U6FA 2E5LF 3MEEB 4LF1A 3B4MA 3Q23A 1BQNB 4ZITA 1K1SA 4W4MA 4O0NA 1BQMB 3GILA 4CLPA 1T03B 3FVYA 2J9DA 1JLBA 1BMQB 4RZRA 4FKXA 4EI2A 3T5JA 1S6QA 1UETA 2QL9B 2J9EA 3ISNC 4DQSA 5JUMA 4DCOB 2RT3A 4LQ9A 1ZETA 1XWLA 2RAQA 4IG3B 2IDLA 2V67A 1S1UB 1K9MT 3OBIA 2XS5A 2W2QP 3ZNUA 5A8KA 4WWSA 1FX4A 2D69A 2OD6A 5KFWA 1UAWA 2VC0A 2GQCA 3I31A 3I5AA 3OT9A 1TMMA 2KKHA 4NCBA 3PHEA 2GW8A 1P9QC 2AEMA 3QAUA 4F67A 2ZJQQ 4B3OB 4B3RF 1U6ZA 2RUGA 3BGRA 4K0KJ 2M3DA 1VRTB 3R97A 4KQZA 2R2SA 3FDSA 5L1JA 2FIUA 4OYWA 4CYUA 1TZ0A 3BF4A 1C2PA 4JI0J 4N47A 3U02A 3RB0A 4K2XA 2QLXA 2YX7A 1NPRA 2ABYA 4YHHJ 4DFMA 2WSFC 3OL7A 2QZ8A 2O01C 3T9ZA 1JIHA 3HVTA 3H0PA 1S1TA 3W1YC 4HEA9 2HHHJ 3QBCA 1S79A 2XSJB 1KLMA 4I6YA 3R5BA 3UE2A 1NJIT 1FRIA 3FMWA 1YJRA 1HI8A 3SV4A 2F40A 2VFTA 2W2OP 1MG7A 1T02A 2DHHA 2WSCC 3BBBA 3V6JA 5JJBA 1T3NA 4ZVTB 4WFNQ 4J9KA 4M5KA 2RF2B 4CLSA 4YB7A 2WSEC 4UOFA 4Y2AA 2NQPA 1QUVA 5HO4A 1RCXB 3FJ2A 4LUBA 2EVZA 1RT5B 2KT3A 1PBAA 4M1KA 2AYMA 2JL9A 3E3XA 4HTIA 4ECUA 1NK7A 1SC4B 2VQEJ 1ZH5A 1Q81T 4ANEA 2J0WA 2XY6A 3KHLA 4H4OA 1BXNA 4JYAF 2WCXA 1CULA 4K4WA 1ZA1B 1W2IA 3TO8A 4OJ1A 2N82B 5KT4A 1NHUA 2K1RB 3P96A 1ZM9A 2GAHC 4PXEA 4DL3A 1RU2A 3N28A 4ZCLA 3IN5A 4PYAA 1IBCB 4OZ1A 2IIHA 4PXBA 2FC9A 2CQ1A 3ZZYA 3K2YA 1NK0A 1GEHA 2DPIA 1XBWA 2UXBF 2DNLA 1J5EF 2V4RA 4PQUB 3CJ4A 5F41A 4C3MA 2B8PA 3PJXA 2XBPA 1LV5A 1RT1B 1OIAA 4OZLA 3JSMB 1FHTA 2UP1A 2WW8A 2MKSA 3T6BA 3LWLA 4AUKA 3RBZA 1UJ4A 3M9MB 2DY1A 2XEXA 4ID8A 1KLNA 3IRXA 4BWMA 3TZZA 3EGNA 2V0NA 1P1TA 1T0TV 3DM2A 4GKJF 1HLWA 2FPHX 1KS2A 4QCLA 3G82B 3HHLC 3ZZZA 4JI5J 1YDLA 6FD1A 1TVRB 1N0UA 3LW5C 2EG2A 5HATA 4MFBA 6AT1B 2R2TA 4X62J 4DR4F 1UPPA 4ALZA 4HHJA 1G6BA 3M8ZA 1YJWS 4DN9A 2B7CB 4WK3A 3CCVS 2R8HA 4KH0B 2DHGA 1UWBB 2IVMA 4NYPA 1FD2A 1G3OA 4WYWA 3US5A 1YHQS 3D1HA 4F8RA 5GAEI 5KT3A 4IQXA 2C2DA 1B4SA 3QPIA 1NMEB 2JX2A 1HL6A 3ENVA 3HI9A 1HNWJ 2HHTA 1K0TA 2E1AA 3WX4A 1N48A 4ED3A 3CC2S 2VPXB 3DLLQ 1OMSA 4QIVA 1S5ZA 3CW2C 3HVWA 3PM9A 2M8HA 1TL1B 2V2QA 1MWQA 3H98A 2LMIA 2DD8S 5KFFA 1T9XA 1NLKL 2DCLA 1N6QB 4OJHA 3C16B 2XMWA 4P75A 2ZM6F 3BSAA 3D0HE 2G0CA 2VZ9A 1T95A 1AUSL 4HVZA 1R8BA 3G2XA 1V3ZA 4O23A 1PILA 1HQUA 3A8KA 3KK3B 1VBKA 1JMTA 4O3NA 4CO5A 1U02A 5L9NA 1UZDA 3NCRA 2ADBA 1T9TA 2IC3B 2GS8A 2G2OA 2L08A 1LFWA 4AD6A 4PEOA 1EQ0A 1N5YA 1HBMA 4HHUA 1IKVA 2KYXA 4L3NA 5KFVA 5T7LA 4N5SA 3FMBA 4AL5A 1U2RA 4KV8B 1W2BR 3HDSA 3MECB 3OQ2A 1U0HA 4ELVA 1XQIA 4CT8A 1KDNA 1MMNA 1QLNA 4OX6A 5H9FK 5JVHQ 4DV6J 2LXFA 3W2VB 4EU0A 5EWGA 3LP1A 2YKQA 2L48A 5L38A 1TELA 4WIQA 4I6WA 4ECQA 5IS2A 3HMJG 4QIEA 1IM6A 1JX4A 2VDIA 3DRSB 4WZQA 3ITHB 2WVBA 3QT5A 1MWYA 4I2QB 5KFPA 2X1BA 5DQHA 3KKFA 2OPRB 2J0SD 2FZKB 4PRFA 2FC8A 3GIIA 5CH7B 2YBVA 1FVSA 4WKRA 4Q2LA 1TUVA 2V8HA 3NGTA 5ETSA 3V6DB 1RISA 4A8XA 4H4MA 3UD3P 1DRZA 3QJJA 3FBCA 1VCTA 2MQOA 4PG5A 4WBFA 4BS2A 2FVRA 4RW6B 2AD9A 2WW4A 2F1FA 2LEBA 1C0TA 1HHTP 1V5VA 3C3LA 2VFVA 1ZM3A 4FZVA 4OI6A 3QT6A 3G96A 2HW3A 3P5TL 3CJ0A 2HK2A 2OELA 4ED5A 5IV4A 2PDAA 1N54B 3S7RA 4NZ0A 5K8MA 1CJKA 1UL3A 1WKLA 4LFAJ 2DCUB 3D0IE 3NOCA 3ENWA 2IM1A 2A6OA 3AHPA 4DSEA 2RNEA 1N32F 3KLGA 1NJYA 1G2EA 1F2HA 3J80Y 1GH8A 1RAFB 4C97A 2V4QA 1JLBB 1ZZNA 1S9EA 1U1NA 1NK9A 4F2SA 1S1XA 5CCLA 4USMA 1UMJA 2AGQA 4B9TA 4PABA 1XMQF 3KLIB 2WVEA 1JWWA 4TNOA 2JFDA 3ETOA 2B9YA 3UO0A 2WOMB 3VCDA 5D15A 3Q8VA 2AMCB 1HR0J 3MM5A 1ITPA 2G4BA 1K1QA 2AZ3A 1BHNA 3VAGA 4WKYA 5BYSA 5C25B 4C4WA 3UN3A 4OQJA 5D3GB 2OFGX 2UXCF 5G4DA 2CNNB 2V8VA 1RHRB 4PAAA 1Y3KA 3POTB 4FPIA 2IPOB 5ETOA 5AXNA 1UVNA 5F9NA 3RU0A 1G7CB 5J1PA 3GR1A 3AOBA 2MKIA 1HFEL 3LALA 1GMVA 1XTZA 3IRWP 4I7FA 3OD2A 4TY8A 1ACMB 4J9QA 1E6VB 5KG1A 2VG5B 3W60A 1UTAA 1FFWB 3GJQB 1UWAA 4OZ2A 4DR2F 1X8DA 3GWCA 2JHEA 2B6AA 2F3JA 5GMDA 3GONA 3M2VB 1NUEA 1WDDA 3QAEA 1S1TB 5KFQA 3C15B 2R7RA 2DTJA 1T9WA 2NXEA 1WDTA 1TUGB 2E1RA 2KVIA 2DY9A 5DZ6A 1QDUB 1FJEB 1DJ0A 4FVMA 1SKWA 4DSLA 1TKZA 2E29A 4UQTA 1SH2A 1RUSA 2IM0A 2NREA 5F8LA 4RW7B 3IWLA 4NEZA 2B9EA 4H54A 1BY9A 4A8SA 2DHXA 2KRRA 3OVBA 1NKEA 4RX6A 3M4XA 5GAGU 1M5HA 1YZ7A 4H4OB 4CLTA 1FDBA 4RWWA 4A8KA 3PV8A 2DNRA 3UVJB 1CULB 4WFZA 1S76D 2C3MA 3EGZA 2P8IA 2CJ9A 1PYTA 2Z58B 1AXQA 3MM6A 1R0CB 3N6NA 4B3TJ 2VONA 4DWIA 2G2YA 2VD3A 1LKZA 1X0FA 3CMAS 3KYLA 2B0GA 2MJUA 4QPTA 2ERRA 4EK2A 4CLYA 1RBAA 2HVDA 3ISZA 2MY8A 4DR1J 3H8YA 1WD6A 2DH9A 3FUYA 4PWDA 3TI0A 3BO4A 1YJVA 2LEAA 4X4QA 4GVBA 3MFHA 1JLGB 4FPRA 2MQNA 4HR2A 5LMNJ 4F4ZA 2PN6A 2XMVA 2OPSA 2I9SA 3RRKA 2HS0A 1VMBA 3TRGA 2XULA 1LWFA 2C3YA 4DJBA 3H2LA 1ZOTA 2HRTA 3R5JB 2H4YB 1QY7A 2H65B 2MGZA 2XS7A 2LQJA 4XO0A 4ZP7A 4KPCA 4ETZA 3ZFVA 2R2UA 4X4SA 2VU5A 3GP9A 3BR8A 2UXDJ 5LJ5Y 1NCLA 2K7KA 1JLCA 4MFBB 2C2RA 1REGX 5L1IA 4DV4F 1R6YA 2CG8A 3SMZA 2X3DA 2NLWA 2CPXA 3C66A 2FJXA 4ED7A 2RRAA 3DGPA 3CO9A 2HPUA 2K2PA 2V8PA 3AD9C 2BV3A 4OIXA 1PSDA 4Y2IA 4JI4F 2HNZA 3OUYA 2OFHX 4ZVHA 1IBKJ 3GIRA 2M88A 3W63A 1I6JA 4R25A 2OP5A 4K0KF 3P3DA 5E3CA 2EFGA 2NXNA 3PIOQ 3QZ7A 3CJTA 5EX3A 3ZZPA 1E6YB 4M63A 4L75A 4LF4J 3HX9A 3DKDA 3GV5B 2IVFB 4KR0B 2JOQA 3FK4A 2LKZA 3Q22A 2HWHA 5A2QU 2Y1IA 4YHHF 5L39A 3A4TA 2CDQA 3KWMA 3H7HB 4IYQA 1R6VA 4LF6F 4WFYA 3SQGA 1CSJA 2QMXA 5GAHU 1VLOA 3CWJA 1U6BA 2JEFA 2FJAB 1TQLA 1FWPA 3R5CA 2Z4PA 1RXOB 2IMOA 1HBMB 4IRCA 3C19A 1DZ5A 3CD0A 3B8HA 1DQ8A 3DLHA 2RVJA 1VYAA 1FVQA 3QIPB 4FYYB 2F7VA 1U0HB 1S6PB 2FLNA 2OEMA 2KT5A 3CC4S 2IRUA 1AZSA 4O44B 2DBBA 1YBAA 1KHWA 4ZMMA 5D4LA 2RHQB 3H90A 5F9LA 1AB8A 3OTDA 2J0XA 2YQ3A 4RNOA 5KFDA 5J2PA 3OV7A 1UPMB 2GHWA 3LP1B 3R7SB 5I3QA 3Q8QB 1UEUA 2YNGA 3C2PA 3UNGC 3VR1A 3GFHA 3C6UB 3SFGA 2MSSA 4PKDB 5EX0A 4C8ZA 2YWGA 4NLWA 3V5RA 1CBKA 1B99A 2UVVA 2HMIA 1YRXA 5LMUJ 2LU2A 1Q8BA 2IBOA 1FT8A 3MM8A 4NE9C 3R7BB 2OKQA 5IT4A 5HVGA 2GMLA 4YY3F 1RACB 3PYGA 1TAQA 3ONQA 3NG8A 4YFUA 3GJSB 4NLUA 1IN0A 3I56S 5KT2A 3OTOJ 5D4NA 1XNQF 1H7WA 1S1VA 2AX0A 5M2RA 2XMJA 2FB0A 3SCIE 1T9UA 4DX7A 2D3O1 4IDKA 4RKUC 2W4CA 1X4FA 1IKYA 2CWXA 3LO3A 2HBQB 3P4UB 4ETXA 5IFMA 2JC1A 3ENQA 4UTGA 5H9FJ 1G4CA 3D66A 4IR1A 5CAAA 4WF9Q 1JJ4A 2DNPA 1HPZA 2DJWA 2HK3A 2BJ1A 3DLGA 1VQYA 2V8DA 4X65J 2HS4A 2VOOA 1VGYA 4FXVA 2HIYA 1KOHA 1WC3A 3FBEA 2J8AA 4M5DA 3QO9A 3CCQS 1CQNA 2CJAA 4TQSA 4JI5F 2DXEA 5G0RB 2NZCA 1EKSA 3CCUS 2Z2ZA 2QL5B 2X7IA 2XLIA 3J81j 1HNIA 1CC7A 1RAHB 2E7WA 5HROB 3NGSA 1S9EB 2IVYA 3MEDA 3DLBA 2CQGA 1S1XB 3WDOA 3U7JA 1HMVA 2KZZA 4CI0B 4J37A 3CDAA 3D2WA 1WG4A 3MPWA 5ETVA 1RAEB 1GAOA 2CNLB 3OFHA 1EAYC 3T1YJ 1KQGB 4M5LA 4B9UA 2AF6A 2QC3A 1VBYA 2VODA 1BLUA 1YJUA 4QWAA 1HNXF 4FVCA 5F0WA 3NWGA 1CJUA 3BV8A 2QIFA 1CS4A 1RYRA 4YOEA 3BJYA 2XMUA 5AXLA 3BZQA 3AQOA 5KFKA 1LK7A 3DOLA 3QGHA 1NK6A 2DHAA 4J9LA 2V5HG 4UY85 2M52A 3KXDA 2PA8D 2OSQA 4I7FB 5LOQA 1FI4A 1N4LA 4UOCA 4EO6A 1D9AA 1PIEA 4DUZJ 1GX6A 1HHSA 2EKNA 5J1NA 1HHQA 3GG1A 5EGYA 2BABA 1UVKA 1BGXT 2B6AB 4QWBA 2UU9J 4TXSA 2O3DA 2PI5A 3KUHA 1S6OA 2D1CA 4NXNJ 3MR2A 1U1QA 2HNDA 2ZJRQ 4ZK7M 4DV1F 4M5HA 4RUHA 4I69A 5KOXA 1L3VA 2CNOB 2VB6A 4UUXA 1TKZB 4I4BA 4UW2A 3R9LA 2W9BA 2ILZA 1OY6A 2E9ZA 4DV6F 2CZ4A 3K0JA 3OR2A 3KJFB 2NUUG 4G1QA 1IR2A 4RLEA 1CLFA 3VGUA 1TFWA 1YJ9S 4NMLA 4WIIA 5F8NA 2V2ZA 5K8PA 3OVAA 1RI7A 2KTQA 2E5IA 1N5SA 5KG7A 2GFFA 2WBMA 2OEJA 2V9WA 4U7UK 3IBWA 3SXLA 3MR3A 3ZTSA 3HSJA 4ITSA 1CQMA 3HT0A 3LQVA 4KTQA 4KBIA 3TA1A 4F4WA 3M8WA 2NXCA 3OTBA 2NR0A 1VDHA 4XK8C 1NM2A 3MUTP 1F3VA 1H3DA 1KN6A 4ZN1A 4ZJQA 2JEGA 3OJUA 2PEBA 4DV2F 1LWEA 4WU3A 2V68A 3ADAC 4DG1A 1ZTWA 2YXLA 3PY8A 3QRRA 3GZ7A 4QIFA 2UUBF 2P5VA 3IR6B 4QYZK 1UFKA 4M8LA 2AYBA 4ATNA 4PWDB 5C42A 2EFOA 2BOPA 5AXMA 2ACYA 2FHMA 4X66F 2CYYA 5BXIA 2OPSB 1QTMA 4P2FA 4FP9A 5LXYA 3R5GA 4DSFA 2JVOA 5DDPC 4ERDA 4L3KA 2VPWB 2J6TA 2DXFA 3HPOA 2ZHOA 3BBCA 2AU0A 4USJC 3UDLA 1WC5A 2BJ8A 5B0GA 2KG1A 1O51A 2MB0B 3R6LB 1Q8LA 4LF7F 1HWIA 2BACA 2F9DA 3AOCA 3QSIA 5AJ3F 3GU0A 4EZ9A 1NDPA 3O1LA 4C11A 2MQPA 3I0SA 2KO1A 4J9UE 3PRVA 2ZH8A 1T9YA 2HFUA 5KFBA 4P6QA 1HR0F 2I5JA 1RHQB 2M0GB 2RQMA 5IOLA 2ZOMA 3W8GA 1IKXA 3OSPA 3DGPB 3R1HA 3KJVA 1RWPB 2JNJA 2Y0BB 2KN4A 5GMKa 3C46A 1RK8A 1B7YB 5HK4A 4NI2A 1JLQA 1V3SA 4YR2A 2HNZB 3OUYB 3CSKA 4QR1A 4KFBA 7FDRA 3IM9A 3KHGA 3PDNA 1VK8A 2YKAA 3ZO7A 4TLQA 3P5BP 3IP0A 1X7VA 4D3GA 1NJWA 1EIYB 4PXDA 1T94A 3NS6A 4LVNP 3M6WA 3HFVA 2QLWA 2DR6A 1R8PA 5HBMA 2RQCA 2NCKL 4UY8T 2ZHAA 3NKYA 1ZAVA 4AQYF 3HD2A 2BEFA 2FY8A 4B3MF 3QGIA 1YRUA 1RTIB 2NZ4A 2B4OA 3TUZC 3SQGB 1HW9A 1N0VC 2VUGA 2YWWA 1RWOB 2KJVA 2Q1LA 4F4AA 3EYZA 1FRMA 4PPZA 3PEHA 4C3KA 1YK9A 3HO1A 3HHLB 1Q16B 1B0VA 4PG7A 2ZH7A 4B9LA 2BJ7A 5L46A 3DU5A 2QLBB 3ILOA 3NXZA 3DLJA 1CG2A 4RW4B 3EX7B 1Q7YT 2F8HA 8ATCB 1NKCA 4R0JA 2E1CA 2ZH6A 3KG4A 3DCAA 1KOOA 2CQDA 4FYWB 3Q86A 1S48A 2EW9A 2JH3A 5A6PA 1HW8A 3QT8A 2K06A 1FWKA 3M9OB 3R2CJ 3OLBA 4B9MA 3RB3A 2DH8A 1HNVA 4WZMA 4J5OA 3UD4P 1GK8A 3H5YA 4WFXA 3TR5A 4I2PA 2BKOA 2QMWA 2CZVC 2DNYA 4IFVB 2JWNA 4N76A 1TK0A 4X4NA 2XZDB 2JLEA 2V9KA 2A1BA 2LU1A 3KLVA 1FX2A 2LFVA 4F50A 1P9YA 5A0YA 3IBCB 2OO4A 2HMIB 4X4TA 5KFSA 1CJVB 1HD0A 1Y4ZB 4MJKA 1S9GA 3MM8B 3AOAA 2PD1A 3PO5A 5AT1B 5I3UA 1CPZA 3HD1A 2V94A 2CPFA 4WTOB 1WHWA 3P6YC 3QATA 1S1VB 2HFZA 1QUPA 5GADI 5CYQA 3RG6A 1FWLA 2OGUA 1RAJA 1IKYB 4RO0A 4RUBA 3MFIA 1NJXA 2QSFA 4JV1A 3LTOA 3ET6A 3HT3A 4A46A 1F0XA 4K50A 1VFJA 2P9EA 3LAKA 4Q44A 2BE7D 1YBUA 4OLOA 1NJZA 4OI0A 1IM4A 2MZ1A 3OL8A 1HPZB 2RIJA 1PYOB 3EVMA 4OZ0A 3CDWA 2WVDA 3DLGB 5KFLA 4Y3CA 4K4XA 4NRTA 5I3PA 1S10A 3PX0A 2BJ9A 4FF2A 2L9WA 3IGNA 3QO9B 1RQ0A 1WI8A 2EFVA 4JYAJ 4KGXB 4LSLA 5KTQA 4LBIA 1RJJA 3W3SA 1Y3JA 3DRRB 2FJVA 5C24B 2BX6A 3D1OA 4OHYA 4QR0A 2LECA 5CZXA 4PXCA 3IGVA 2EFPA 4OJGA 2ZOFA 1NNDA 4RW9A 1H0HB 1HMVB 1EQMA 3GYGA 2XMAA 4B08A 1OSCA 3PHTA 2DEIA 2EC0A 1UVIA 3H4BA 3JYTA 1DQAA 1S9FA 4DS5A 1WHYA 3LH2S 3C14A 3UFCX 4LIWA 4LJMA 2UXBJ 3BB5A 1TR0A 1SKRA 2IY5B 4LF5F 4WP9A
chains in the Genus database with same CATH topology
2DB1A 2MHNA 2VPXB 2N3LA 3M2UA 3DLLQ 3BDEA 4DR6F 4O3SA 4QIVA 1F5BA 4QJVA 3CCES 2XWXA 3HVWA 4CH1A 3CTRA 3DDKA 3PM9A 2DO4A 2M8HA 1TL1B 2MPUA 4CO4A 2GMJA 1REVA 3H98A 2LMIA 1UFLA 5KT6A 2DD8S 2ZE2B 4TQRA 3TARA 2EK1A 5KFFA 5D6GA 4TU8A 3DRSA 5AXKA 4FF3A 2YNFA 2HGNA 1WF1A 1VQ7S 3ITHA 2DCLA 1N6QB 4OJHA 4R0EA 2WTFA 2XMWA 1VQPS 4OHXA 4I2QA 3VF0B 3PW4A 2E9TA 2KZMA 2ZM6F 2HHVA 1PC4A 3BSAA 4ILLA 3D0HE 3MHYA 5I4MA 2G0CA 2VZ9A 3VALA 1VHFA 3MTJA 2E1MC 2OPRA 1T95A 1T7PA 1ZAXA 4NLVA 2FVPA 1N36F 3IRXB 4KHRA 4A47A 1KR4A 1VRUA 4HVZA 3N9UC 4IOAQ 2PSZA 1NH7A 1R8BA 1V3ZA 2CPZA 2RQKA 4KE5A 3BGLA 4O23A 4A4JA 4DMZA 4DLEA 2YH0A 4C8OA 2DRAA 1DTQB 3CCRS 3DM2B 4MIBA 1PILA 3QIDA 4C8KA 2RRNA 1HQUA 1ROFA 3DLKB 3DI6A 4F4KA 4OMFG 1VI7A 1VQ6S 2HWTA 2EBGA 3KK3B 2ZKUA 1JMTA 4O3NA 3MURP 5HP1B 4WJBA 1H2VZ 2IHR1 2VFUA 4TN2A 4CO5A 3V6DA 1FD8A 3N6LA 4FF1A 5EHHA 3MMJA 5L9NA 2C2EA 1KTVA 3NAHA 3NCRA 2ADBA 4OZJA 1DHMA 2IC3B 1L3UA 4KKOA 1V3RA 2L08A 4QWDA 1R8HA 1I1GA 1LFWA 4O3QA 1FRKA 2XMTA 5KOWA 1RKIA 1N5YA 1IQZA 3T5KA 1HBMA 3S01A 4URGA 2HAIA 5IWAF 1IKVA 5B0FA 5E3QA 2KYXA 3PR5B 4TLRA 1SL0A 3JTNA 4L3NA 2BJEA 4RW6A 5KFVA 4HI1A 5KFMA 2C3OA 2XY7A 5T7LA 4N5SA 2IAJA 3FMBA 2RJZA 7FD1A 5IM0A 4AL5A 4RW9B 1U2RA 4KV8B 1EETA 4AL6A 3DLEB 1ELOA 1W2BR 5J1EA 1FE4A 2E5JA 2UZAA 3HDSA 3MECB 3OQ2A 4ELVA 1R7IA 3PW5A 2ZH3A 3LP2A 2ASLA 1YGYA 4DS4A 4CT8A 4ZCIA 1MMNA 4DL6A 1QLNA 1XC9A 4GMKA 1S72S 3AH6A 2BANA 1SJFA 4OX6A 2HVHA 1HBUB 2ZDOA 3M2RA 2ATLA 2VASA 2D3OR 2PGCA 3NBPB 5JVHQ 1N5TA 4KSEB 2Q66A 2C42A 4IFYB 5KG2A 3LP0A 2LXFA 1QE1A 2W9BB 3BSOA 1R0AA 3W2VB 4BWJA 1SXLA 4OFZA 2R2RA 2L9DA 1Q1KA 3OR2B 4EU0A 5EWGA 1NU4A 2RDJA 3RR7A 3LP1A 2YKQA 1DFDA 4CT9A 2L48A 3M6XA 4LFAF 5L38A 2DGOA 3H20A 2JZ5A 2CQ4A 4EBDA 1NRKA 2GO9A 1X0PA 3MMCB 4OLPA 4L72B 5CZVA 3M2UB 3ZZUA 4I6WA 5JXSA 4ECQA 1X4DA 1Q8IA 2CQ3A 2EWHA 5IS2A 2KG0A 3PW7A 2XB2D 4HT5A 4QIEA 2MKJA 3PXGa 5M2UA 3HMJG 3RTVA 1H6KX 2CQBA 2K8GA 1C4CA 4G6VB 3VAMA 1U1OA 5CYMB 1JX4A 4JV5F 3CJKA 1HBNB 2FVSA 4ILRA 3CE8A 5BYRA 1P1LA 3TW0A 2R7VA 3FSXA 2K3KA 3TA0A 2P6TA 3DRSB 2YNFB 2MY7A 2HQ3A 2M4MA 4WZQA 3ITHB 3V4MA 2Z8QA 4PWUA 4DF4A 1LW0A 1MWYA 1RA6A 1S49A 1HI1A 2N4CA 4I2QB 1IBMF 4Y65A 2NXUA 4RW8B 2C3UA 3KLIA 1MSWD 5KFPA 1O8BA 2JFKA 3PX6A 3I55S 1R8CA 2X1BA 1SBRA 5DQHA 2HVIA 3KKFA 1TFYA 1IR0A 2DGVA 2OPRB 2J0SD 5F8GA 4PRFA 2FC8A 4DR7F 3K8VA 4URQU 1CC8A 1S99A 1TKTA 4RWXA 4YDXA 3T5HA 3GIIA 5GAGI 1Z4UA 1FERA 5CH7B 3MEKA 3H5XA 1FVSA 3PACA 4Q2LA 4WKRA 2WOMA 4I6AA 1TUVA 2V8HA 3DRXA 3MM7B 5K14A 1HQUB 2BW2A 3KK2A 2MZQA 3IG1B 4CO2A 1A6LA 2Q79A 4W90B 2WBRA 3V6DB 1RISA 3ZZ0A 4A8XA 5GADU 4DF8A 4H4MA 3UD3P 1DRZA 2X51A 5C25A 4KKOB 1KQSR 3QJJA 3LPYA 3TAMB 2POKA 3HZEA 3O44A 3PW2A 2UUCF 1MROA 2VFRA 2ZHBA 2MQOA 5B08A 1YQHA 1YJTA 4PG5A 4URSA 3K5NA 1C1CA 5DS7A 3ZZRA 5D3GA 1N5YB 1LWEB 2M2BA 3UWTA 2JSXA 3MMBA 4BS2A 3QGGA 2FVRA 4CH0S 1BD6A 1IKVB 2NSCA 1WELA 1SV5A 1FKOB 4RW6B 2DGUA 2J9CA 2AD9A 5T7LB 2HQIA 3T9NA 2F1FA 3JSYA 3U1MA 4JI3F 1EETB 2IA0A 5A2QY 2LEBA 1C0TA 2AW0A 3POTA 1HHTP 1H2UX 3DOKB 3C3LA 2ZH5A 1U1PA 3FSYA 2E66A 2VFVA 4IO1A 1ZM3A 4FZVA 2QSWA 4OI6A 3PR4A 3G96A 2HW3A 3P5TL 5B0DA 3CJ0A 5DM6Q 3EZUA 2JLFA 4NWBA 3WZ0A 5C42B 4Z2XA 4X4PA 2CPJA 1OS5A 1F5AA 3HXMA 2KXNB 4JI2F 4ED5A 2KYZA 3EXCX 1RTDB 2PDAA 1N54B 1Z1ZA 2FGCA 3CF5Q 1RP5A 3I82A 3M2RB 2ZFHA 2FHJA 1VQKS 4QWEA 1VQOS 3S7RA 4HYKA 4F4XA 4NZ0A 3X1LB 2YX4A 5KAKA 5K8MA 1UL3A 2QT7A 3I0RA 4RNMA 2QRRA 5ADZA 1E6VA 2DCUB 2LXUA 2VG5A 4ES3A 4ZCKA 5KFZA 4C98A 4X65F 1RTJA 3HVAA 4MIAA 3D0IE 3ENWA 2IM1A 2HRYA 3AHPA 1IJEB 4DSEA 1Z2ZA 2FHKA 3DN9A 1RT3B 3WC2A 2RNEA 2FHJD 2R8KA 1N32F 4Q43A 5I42A 1DLOA 3KLGA 5EWEA 3FZBA 3GG0A 1NJYA 1X9WA 3KHHA 4MKYA 5KFAA 4YUDA 4KPYA 1G2EA 1SUQA 3PRBA 3PKMA 3J80Y 3CJKB 1GH8A 3JTOA 3M8SA 2I2YA 2BBEA 3G6YA 2E9RX 3NMRA 3TUJC 1JLAA 4C97A 3CCSS 2V4QA 3RZAA 5MLCV 1JLBB 3M2VA 1ZZNA 4DV5F 3RBDA 1S9EA 1RYSA 1U1NA 3KK1A 1NK9A 4V19J 1TK8A 2ZDPA 4F2SA 1S1XA 5CCLA 3NS5A 1UMJA 2AGQA 1HWKA 1D3WA 4B9TA 1S77D 1WI6A 1XMQF 1WF2A 3KLIB 5GAEU 2WONA 4ZPDA 2HHUA 4YQWA 1IXKA 4DSIA 2VC1A 4DSJA 1JWWA 1VBZA 4TNOA 5J2NA 4OL8A 2JFDA 4Y00A 2LQ9A 3M8RA 3ETOA 2G13A 1LK5A 5IT0A 1MMDA 1J5OA 4FBTA 3HFKA 2B9YA 4QU6A 3I0SB 4C0OC 3I6PA 2WOMB 4NYOA 3VCDA 1HQEB 5KT7A 5K14B 4PPDA 2C3PA 4F4YA 2KXFA 3Q8PB 3J7A1 2ADCA 3MM5A 3R1LA 2G4BA 4QIWD 2VA3A 4EGLA 1K1QA 2OMLA 1APSA 2MMYA 2I5JB 4KRWA 2Z2MA 1WHXA 1SJQA 3VAGA 4H4MB 4FF4A 1IKXB 3F56A 4WKYA 5BYSA 5C25B 2QA1A 3H40A 2AJFE 3KJVB 4OI1A 3L95X 2E5HA 3S8SA 4PUOB 4BC7A 3OJSA 1FJ7A 4C4WA 5DO2A 2AX1A 2X1AA 2ZH9A 2W9CA 4OQJA 2B5JA 4EEYA 4E8UA 4RW7A 5D3GB 2OFGX 5M2PA 3MMAA 4FXWA 2UXCF 5KFNA 5G4DA 3AB4B 4QYZJ 1SV5B 1R31A 2V8VA 3C6TA 2YKNA 4MKAA 4C0BA 3T1HF