4IOAQ

Crystal structure of compound 4e bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
93
structure length
93
Chain Sequence
SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
molecule keywords 23S ribosomal RNA
total genus 15
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ioaQ00
3OW2R 2M2BA 2DNNA 1VQNS 2CPYA 1SJRA 1Q81T 4WFAQ 1X4FA 3US5A 4WFNQ 5GADU 5CXTA 2VODA 3S8SA 3MUTP 2MSTA 2DO4A 4P6QA 3CMAS 1WEZA 5LXRA 3J7ZT 1VQPS 2JWNA 2JVRA 1SJ4P 5HL7Q 1N54B 3L3CA 2LA6A 2FC8A 3PIOQ 5GAEU 3DLLQ 3LQVA 2X1AA 2LEAA 2M4MA 4YUDA 3JB9k 1XN9A 3B4MA 1JMTA 1OIAA 2J76E 4C7QA 3CC7S 2CQ1A 2YH0A 2BZ2A 2X1GA 4F02A 3NNCA 4LJMA 1H2UX 2MZQA 2KI2A 4F26A 2X1BA 4W90B 2MQQA 1P27B 3CCSS 1X4CA 2HZCA 1DHMA 2YWKA 2LXIA 2Q79A 2RRAA 2M8HA 3Q2SC 5ITHA 1WI6A 1PO6A 5DDRC 3RW6A 2HVZA 2I38A 3B4DA 1N52B 2GHPA 3S7RA 5BJRA 2E5HA 3CPWR 1VC5A 5DETA 2DIUA 2AYMA 1A7GE 1X4EA 2RUGA 3UWTA 2PE8A 1WHVA 2CQGA 2CPXA 1WHWA 3CCMS 3BO2A 1X5OA 5GAGU 1U6BA 3UE2A 2F3JA 3CCRS 5H1SV 2FY1A 4WF9Q 1WHXA 1FO1A 1WG5A 4CQ1A 1N88A 1K9MT 2XS7A 2CPDA 1VQ7S 2DNQA 2XNRA 2XNQA 3VAJA 1X5PA 2KXNB 2DGQA 3EGZA 3CUNA 3R27A 4ERDA 3CULA 2YH1A 2G4BA 2MPUA 3UCUP 1NU4A 3TP2A 5DDQC 2EK1A 2DISA 2MKSA 2MY8A 2DGWA 2MHNA 2RS8A 3LPYA 1A9NB 1FJCA 4M5DB 3J7YU 1M1KT 1WF2A 2FHOB 4CH1A 1VQKS 3FEYB 4A8XA 1FXLA 2JX2A 3CCQS 2RRBA 2EVZA 2ADCA 4C0OC 3G6ES 2MZRA 2MQPA 3ULHA 1X5TA 2CPIA 3DXBA 2WBRA 5LSOA 3CMES 2K3KA 2MKHA 4YOEA 1BY9A 1OO0B 3U1LA 5CA5A 3TO8A 2FPHX 3SDEA 4QU7A 4FXWA 1SJ3P 1JJHA 3VAKA 4ZKAA 3CCLS 4QU6A 2MKKA 2MQLA 2J0SD 2MJUA 3UD4P 1K73T 2M8DB 3ZZYA 4TLQA 2M0GB 4C4WA 3EGNA 2KXFA 3VAFA 4Y0FA 2M52A 1VBYA 2MYFA 3VAMA 3CCUS 4CH0S 2F9DA 3I55S 1YWXA 2EK6A 1VBXA 2YTCA 2JRSA 5JVHQ 2CQIA 2DHXA 3R1LA 1F9FA 3MURP 2CQ0A 3H2UB 2CQPA 2LYVA 1WWHA 3UCZP 3THPA 2ZJQQ 2BOPA 3NNHA 1URNA 1M5VC 2KT5A 3MOJB 2MY7A 2L41A 2MKCA 5GMKa 2CPHA 2DNYA 2XS5A 2RT3A 2U1AA 2G1DA 2OIHA 1KC8T 3MD3A 3G71S 2KG0A 5D78A 2SXLA 1X5SA 2MKJA 3G4SS 1WHYA 3D2WA 3NS6A 2L9WA 2FC9A 2QA4S 5LJ3Y 1YJWS 1Q7YT 4UQTA 2OTJS 4FXVA 2CQDA 3S6EA 4IOCQ 2N3OA 2KU7A 1FJEB 4QQBA 2MZSA 4IOAQ 1VQ9S 2AYGA 2DNKA 1HD1A 1YITS 1M5PC 3BS9A 1WTBA 2RNEA 4Y00A 2DB1A 2KG1A 2OSQA 4PRFA 2RQCA 2DNOA 1ZH5A 2E5JA 2MGZA 1FHTA 2CPEA 1VC0A 1R8HA 2RU3A 2ZJPQ 5MLCV 3G8SA 2OSRA 1Q86T 5EN1A 1UFWA 5DDOC 1NO8A 4WFBQ 1X4AA 2NZ4A 2ADBA 1VC6A 1NJIT 2MJNA 3VAIA 3UCGA 4LMZA 2KM8C 2RS2A 2LECA 3CXCR 4QPTA 2ERRA 2LKZA 1K8AT 2DNRA 5LXYA 1OWXA 2LA4A 2KFYA 2E5IA 2N82B 2MZJA 1YIJS 3CTRA 1U1OA 2DH8A 2DNLA 2QFJA 3PIPQ 3G96A 1HD0A 1YJNS 2KN4A 5LJ5Y 2YKAA 3MI7X 4UY8T 3MXHP 3SDEB 1Q82T 1DBDA 3R1HA 3CC2S 1AUDA 2NLWA 1VQLS 2CQ2A 2KRBA 3BO3A 4YB1P 3FEXB 1U1NA 2M88A 4V19X 3P6YC 2VONA 5DM7Q 1O0PA 3EX7B 1X4HA 4WIIA 5GAHU 1UP1A 2CQBA 1H2TZ 2M70A 2DHSA 1ZZNA 4ED5A 3HI9A 2L08A 1DZ5A 4U67Q 3VAGA 3BO4A 2MSSA 1WI8A 2JVOA 3G8TA 3CF5Q 1JJ2R 4F25A 2G0CA 3ZZZA 2B0GA 2CPFA 1U1LA 1SJFA 2OTLS 1ZZFA 2XB2D 3K0JA 2HYIB 2MKIA 3H2VE 2VOPA 3V4MA 3P5TL 5LSLA 1WG1A 1VQ5S 2U2FA 3IWNC 2CQ3A 1U1KA 2DGOA 1R8PA 2V94A 5JVGQ 1SXLA 2MMYA 4IO9Q 4CIOA 2KYXA 3RW7A 1YJ9S 3MDFA 3P49B 2K8GA 2KVIA 4J5OA 2DNHA 4TU7A 2KM8B 2MGZB 5IM0A 3NNAA 2HGMA 3BEGB 2I2YA 2DITA 1YHQS 1OPIA 1WEYA 2OJ3A 2CPZA 2LQ5A 4BS2A 2MQOA 1X0FA 3SXLA 5CYJA 2MXYA 2CQCA 3G9CA 1M5OC 1DRZA 1KOOA 3VAHA 1VQ6S 2LEBA 2DNPA 2VOOA 2KH9A 1YTYA 2LMIA 3CCVS 4IUFA 1WF1A 1RK8A 1D8ZA 3I56S 3P3DA 1FNXH 3S01A 2CPJA 1UW4A 2MQMA 1M5KC 2DHAA 3VF0B 3CC4S 1WEXA 1WF0A 5IFMA 1P1TA 3SMZA 2RQ4A 5HO4A 2XSFA 1U1QA 1VBZA 2QEXS 2KXHA 1KOHA 1X4DA 1B7FA 1D9AA 4EGLA 3VALA 2DIVA 1U1MA 3TYTA 3NMRA 3IRWP 2DK2A 3THTA 2X1FA 5DM6Q 2E44A 5IQQA 5FJ4A 2MZTA 1FJ7A 3CD6S 1S72S 3U1MA 2AD9A 3CCES 2DH9A 1U2FA 1X4GA 1WG4A 1FT8A 1JJ4A 1S79A 2DGTA 1W2BR 2O3DA 1H6KX 2DGUA 1WELA 1VQOS 2XS2A 1PGZA 2AYEA 2DNZA 3NS5A 1KD1T 2KHCA 2MZ1A 2LCWA 2LXUA 2DHGA 1M90T 3MUVP 4LIRA 4Z2XA 2A3JA 2DGSA 1HL6A 1QVGR 1U6FA 3UD3P 1HA1A 3Q2TC 2HGNA 2DO0A 1YI2S 4PR6A 1X4BA 1KQSR 2DH7A 1L3KA 2J8AA 2M7SA 1U1RA 2RVJA 2D9PA 2J0QD 2MB0B 2DGVA 2F9JA 1H2VZ 1SJQA 2HGLA 3N9UC 4TU8A 1QM9A 2N3LA 2D3OR 1CVJA 1IQTA 1N8RT 2CQHA 2MQNA 4RU2A 5IM0B 3MD1A 4WKRA 2N7CA 2AYBA 3CCJS 1VQ4S 1G2EA 2E5GA 1UAWA 2UP1A 2PEHA 2DNMA 3HHNB 2GO9A 1U1PA 4W92B 1RKJA 2CJKA 4OZ1A 4PKDB 2ZJRQ 1QVFR 5GVQA 2CQ4A 4WCEQ 3MUMP 2DNGA 2D9OA 1VQ8S 2DGXA 2KRRA 2M9KA 5D77A 5DDPC 4TU9A 4OZ0A 1VQMS
chains in the Genus database with same CATH superfamily
1NDPA 3ZTQA 3OW2R 3SV4A 1HYSB 2HHHJ 1ZTTA 4M5MA 3OVBA 3A3PB 1GMUA 2ZE2A 1Q81T 4B3SF 3D3BJ 4ECZA 4DS4A 4JI6J 4ANEA 5CXTA 9RUBA 2FB0A 5MAOA 4WP3A 4M1KA 2R2UA 2MSTA 4ZVQB 4P6QA 3CMAS 2H4WB 4AYBD 4ILMA 1PILA 2H5JB 1RLCL 2YXLA 3BBBA 2NZCA 4P75A 5L1LA 1N48A 1IBKF 2VHGA 2ROPA 2FZCB 2JWNA 3R6GB 1LXJA 2OFHX 3MR6A 3CDUA 2PFDA 2EKYA 4CWBA 3G8QA 1RZMA 4H54A 4NMXA 5RUBA 2DXDA 2OPPB 1I5OB 2VPZB 2CKWA 3KLFB 1UJ5A 1I6JA 3PIOQ 4OX9F 4PXBA 5F8GA 3DLLQ 1YZ6A 5AJ3J 3LW5C 2X1AA 2LEAA 4WIQA 5C42B 4PPZA 4YUDA 4J9LA 3MPVA 3JB9k 2G13A 1REGX 1T9XA 3GLJA 4OLPA 2DVIA 1JMTA 2G2OA 4WE1B 1OIAA 1FXDA 2WB4A 4ZVEA 4X4UA 4KO0B 2ZBPA 3O8WA 2JOQA 1C0UB 1HW9A 3KTQA 1VHIA 3ZZUA 1RHRB 2IHR1 3I96A 2K7JA 2X3DA 1T0TV 2GMLA 3NWGA 4K59A 4KSEB 4LJMA 4AE5A 4F3MA 2W9BA 2MZQA 1IKXA 3W3SA 2X1BA 1NRKA 2OKQA 2GX8A 1X9WA 1N33J 3UNGC 3F73A 1UZHA 1XERA 2F4FA 3BDEA 3ET6B 2MQQA 5GAGI 3CCSS 2ZHOA 2GQCA 2HZCA 2RRAA 2WW4A 3CW2C 3IM9A 2HFZA 1AYEA 2E1MC 1JLFA 1U8SA 2O66A 4D3HA 3K89A 1RCXB 4B3TF 2AGOA 1ZS6A 1Q4RA 2GVDB 3DLKB 3KLFA 4IH7A 3EUNA 3CPWR 4RLEA 2IFXA 2DR7A 4GKKJ 3Q89A 3OTDA 1VIOA 5DETA 4EO6A 2AYMA 4P2SA 4WYWA 4ES3A 3EDRB 4U8YA 1IBLF 4B3OB 3GCWP 2AEMA 2RUGA 1PIEA 2I9SA 3AJDA 3AQPA 4DSLA 2GMHA 2XZTB 2CQGA 1DTTB 4KT0C 5KOWA 2HBQB 4ZLPA 2KZMA 4WF9Q 2DD8S 2ZH1A 5HLFA 2DT9A 4DLGA 3BF4A 4WU2A 5GAGU 2F3JA 2C2RA 1JXVA 4R0JA 3HPOA 1U25A 2Z2YB 3C46A 3H8YA 4IH6A 2RDDA 1NXIA 3SSSA 2YPYA 2FVPA 2VA3A 1FJGF 1WHXA 4NLRA 4UQGA 2HQIA 1Y5IB 3KYLA 4PXEA 1I94J 4CQ1A 1N88A 4UW2A 3WIUA 2CPDA 4JUZA 3RRHA 4USVA 1B7YB 2ASYA 2DNQA 2ZH2A 4KFBB 4IRKA 3BQ0A 2R42A 1F9EB 4F3QA 2V34A 3P5BP 3FGVA 2DGQA 3ILIA 2YBVA 3C66A 2OFGX 1JB0C 1HIYA 3CUNA 3R27A 3GQCA 4GC6A 3K5MA 1FTCA 2E1RA 2HNZA 2P9GA 1KQFB 4ECUA 4N56A 3RAQA 1M5SA 3UCUP 2G4BA 3CULA 3D6MB 2GIQA 2B6AA 3RBXA 2BOAA 2Y0SD 3CJ5A 3TP2A 1LW2A 5DDQC 3RAXA 4J9UE 1WC6A 2MKSA 2MY8A 1R8CA 3NAIA 2Y1RI 5DG9A 3O6QA 2YQ3A 1NSPA 4FKYA 3MPYA 1DTTA 4A8FA 4ZVOB 3GG1A 2R7UA 4M5DB 3BGUA 2G2ZA 1NJZA 1H72C 1ZETA 1M1KT 2FHOB 5B0BA 2HQDA 1HFEL 3DOKA 4HHUA 4QOTA 2DPJA 1VQKS 1TVRB 1XMBA 3W65A 4FZVA 1D8YA 2EVZA 3QJLA 1NEEA 3HZEA 3N6LA 3G6ES 4OHZA 4PG8A 2ZHAA 4EMDA 3ZZTA 5F8HA 3MEDA 2F63A 4LREA 3NGDA 5A8KA 3D1QA 2AKWB 3MM5A 3FBBA 3G6XA 4QJVA 1R0BG 2PIIA 4WTOB 4PXDA 2PGCA 1AB8A 4DV5F 1YG0A 2B4UA 2NXCA 3W5XA 1BY9A 3M30A 2O5DA 1MWZA 1C2PA 4L76A 1SC3B 2HNZB 2XHCA 2BJDA 4CCHA 3Q83A 1RTIA 4ECVA 3ADAC 1U49A 4FXWA 5EWEA 3CCLS 4QU6A 3WHIA 5B09A 3HP6A 2EFGA 2BW7A 4KGMA 2J0SD 4RUHA 4PUOA 4WE1A 3EVMA 3UN3A 4DSEA 2YX4A 2AGPA 2M8DB 2POKA 3CJKB 3SCKE 4L6V3 2B4OA 2Y1IA 1O8BA 3HHLC 3D67A 3SFGA 4DV3F 1IR1A 3H42A 4OHYA 1YLXA 2BKPA 4C4WA 2BDPA 5IZHA 3KLVA 4MMOA 1R0AB 1S9GA 3C15B 3M6WA 1T05B 2KXFA 3W63A 5ETKA 3BGLA 4E0DA 1CJKB 4C97A 1N5QA 3VAFA 2HK3A 3DI6A 5HMXA 4Y0FA 4QIEA 1VBYA 1G6BA 2MYFA 2W2QP 4J7CA 4LRCA 3GWCA 5KFVA 5B08A 1TK5A 2UVWA 1WC3A 2AF6A 4CTAA 1YWXA 4TQRA 5F8NA 1RBOB 4DV1J 2YTCA 5C2CA 3IS9A 4CNZA 2AX0A 3OBIA 4F4ZA 2VA2A 2HBYB 1S1TA 2VFSA 3T19A 4B3RF 1IKXB 3MURP 3F41A 1OMSA 1VJWA 3DHWC 5AXLA 3OFEA 1RHMB 3UCZP 2V67A 3KLGA 3UN2A 3EPGA 5J2NA 3W5YA 1RWOB 2DY1A 2KT5A 3HFZB 4ECQA 3MOJB 2L41A 2MEWA 3QRPA 1TKXB 2MKCA 3RAMA 4AT1B 5FLXU 6FD1A 4KPCA 3I32A 5K20B 2RT3A 1K44A 4RR5A 2R7SA 3PJWA 4ZIWA 2A6OA 2UXBJ 5D0GA 1MSWD 2WONB 1HMVA 4J37A 4DHVA 1VLYA 1FESA 2BRLA 3LA0A 4NOHA 3W1YC 5C2GA 3VGUA 3EZ5A 3I9ZA 4U9RA 1XC9A 3JTPA 2CXEA 2GMJA 3V6DA 1BWEA 2NCKL 5I3QA 1V9OA 5THWA 3G4SS 4B02A 4LF9F 2XGQA 1KN6A 1OQ3A 2Y9HA 4YDXA 2DR9A 1GXLA 1DURA 3KUHA 2GIRA 3GSIA 2XHWA 3VAHA 4YEAA 4FXVA 4WZQA 1NMEB 2DCLA 2K1RA 6AT1B 4IOCQ 1IBKJ 1HWUA 2V69A 4DPYA 1W26A 5F0WA 2UUWA 5B0AA 4NPOA 1AZSB 1IUJA 3EVOA 3IBCB 4QIGA 4QQBA 4IOAQ 1SH0A 2ZC3A 1E6YB 1M5PC 3RGIA 2KYZA 3KDNA 2HAFA 4B3RJ 2DB1A 3GR1A 3L95X 1IWAA 3PHEA 4OX8A 2F4VJ 2RQCA 1ZH5A 2MGZA 1RT5B 4PWDB 2CPEA 5A0YA 4CO4A 5A6PA 3PX6A 3OTEA 2HFOA 2KFNA 1YDLA 2ZJPQ 5CQGA 5MLCV 2PC6A 1FEHA 3GFYA 5B0DA 2CJAA 3TZYA 1UFWA 4K0KJ 1NO8A 1YBTA 2NUHA 3BBFA 1N0VC 4WFBQ 1X4AA 1MG7A 5BYQA 3M4XA 4C6AA 2D7SA 2LU2A 1NSAA 2MJNA 4WP9A 3WC0A 5DQHA 3HMJG 2ZH4A 1N4LA 2UUCF 4QWAA 3DLEB 4WWSA 3A8IA 2WTFA 3BH7B 3HXMA 4DV5J 1DQAA 3KWMA 1FRMA 2VZ9A 4QPTA 3QAEA 1N6QB 2UV8A 1V3ZA 1LQ9A 1T9WA 4MKVA 2FHKA 1JKHB 1R3NA 3FSYA 1NK5A 1XR6A 3GE9A 3TAMB 5DLGA 2XMAA 3MM5B 1YIJS 4IDKA 1VRTB 3D0HE 2QYCA 1B70B 3KXDA 5SUHA 5KG0A 4AXIA 4JI2J 1JLQA 3VQSA 4PUOB 3IR5B 3FJ2A 1DLOA 4ID5A 3PIPQ 1Q8BA 3D6FB 5JXSA 4HTIA 4EBEA 1YJNS 4Q0BB 3IBFB 4LBHA 4UY8T 4PCQA 2VBZA 1DBDA 3KLHA 3R1HA 1AUDA 5F8LA 4B9TA 1HBMA 2ZH3A 2IJNA 3FEXB 3N79A 1U1NA 4AQYJ 3D68A 4FYDA 1HLWA 2M88A 4R5PB 3G6VA 4IQXA 2J0WA 3PYEA 1GH8A 1XMQF 2BABA 1ZAVA 4JI1F 1C1CB 2VONA 2GJFA 5DM7Q 4LF6J 1JLEB 4E2FB 1VRUA 1WC1A 4X66F 4MFBB 4RWWA 5ETLA 3Q23A 2JEGA 5GAHU 5D0EA 1S1TB 2VB6A 4PG4A 3AFGA 4P7VA 1C0TA 1H2TZ 2CZ9A 2FZKB 3DRRB 2VPXB 5J2PB 1U2RA 4LF1A 3FQKA 3JSMA 1W25A 2VDHA 2EPIA 3N5FA 3V4IB 1D3WA 4DWIA 1DZ5A 2L48A 1VRTA 4HVZA 2VQEJ 3H2LA 3I4HX 1A0OB 3PDNA 4USUA 4JI4F 2ACMA 3JQMA 1L3VA 1UEKA 1NBEB 1YVFA 3JXOA 1SPBP 1S59A 3HVWA 3TEGA 3ZZRA 2HMIB 4CLKA 1U0HB 5DZ6A 3CF5Q 1HNWF 2C2NA 3SEOA 4Q0BA 2EXUA 2GHVC 1S1XB 2G0CA 4RBVA 1PSDA 3CT9A 3MMBA 2V5HG 4FYXB 3RTVA 1U1LA 1SJFA 4IG0A 2ASJA 2AU0A 1KFSA 3RR7A 5U47A 4ANCA 3PXGa 4FF1A 2HYIB 3PW7A 4PYAA 4CLTA 2BYCA 3V4MA 1W2IA 2QLJB 2OD6A 3P5TL 2R9LA 2XY6A 2KTQA 4KGZB 1D1UA 5KOXA 1VQ5S 2V4QA 2OGUA 3QQCD 3IWNC 4BDPA 4ECXA 3D0IE 4AL6A 4HYKA 2B7BB 5EWFA 5DGBA 3C2PA 2DGOA 3R7NB 1FNMA 1TTHB 2V94A 4X4NA 4A8KA 5JVGQ 3NCQA 1N32J 3T1YJ 1XMOJ 4F7VA 2BMBA 3PACA 3TR5A 4JI5J 4NA3A 2BACA 3CB4A 3OFHA 2IPOB 1ZTWA 2QC3A 2BM0A 1BLUA 2KYXA 3K5NA 4WXOA 1N5TA 2QMUB 3UR0A 2FYXA 1LOUA 3H7HB 1VJQA 2F8MA 4Y2CA 5CD4A 4J5OA 4USMA 3OR2A 2KM8B 1DTQB 1HQEA 1SKSA 2MGZB 1KVIA 4TYBA 1NHVA 4NLTA 5B0FA 1S48A 3C6UA 1WEYA 4LFCF 1TAUA 3BQ2A 3FRYA 4BS2A 1X0FA 2HHTA 3SXLA 2W1BA 2MXYA 2CQCA 4WFZA 4DSFA 3G9CA 4YB7A 4HI1A 2DKOB 1DRZA 4EZ6A 3AOAA 1HARA 1B0VA 2APOA 1W7WA 2HSEB 5E5NA 5JJBA 1RHUB 4PG5A 1YJ7A 2RB7A 1TP7A 2I8EA 3GFHA 3T6JA 5F9LA 1WTFA 4ID8A 1R43A 2Z57B 2KH9A 1YTYA 2VQFF 1V5VA 4XDDA 4WKYA 1SQFA 3PHTA 4M5GA 3S01A 5I3UA 2CPJA 1UW4A 3DM2B 3DGVA 4LF9J 2DHAA 4QU7A 1FE4A 1M1HA 1TL7A 4U96A 3VF0B 4AXJA 4DL2A 1WEXA 2RF2B 4Q45A 5IFMA 1XNRJ 3ETMA 4B9UA 3QZ8A 1FWKA 3SMZA 4DQQA 1FK9B 1RWVB 3DOMB 1S99A 3PM9A 3JQKA 4N41A 1CJVB 2DEJA 3DYAA 3I6PA 4MYTA 4IR9A 3I0SA 4C0HA 2E9TA 3I5BA 5KG1A 3NOGA 2PDAA 4DZ6A 4EGLA 1T94A 3CJRA 3KHHA 3VALA 2MDAA 2IRXA 3BSCA 3PTWA 3TYTA 3CO0P 3MCMA 5D0HA 2DK2A 2W4CA 3IC1A 2VD3A 3TW0A 1RHJB 1LWEA 2W4PA 2EFOA 3Q8PB 2K2PA 5K8PA 4JI6F 1EETB 3GSDA 2FJXA 1JLEA 2QIFA 2RDJA 2EC2A 5DM6Q 4EU0A 1S10A 2GA7A 4LF6F 3AOBA 3RBDA 1NKBA 2F1FA 2RKIB 3CDAA 1AT1B 1QAIA 2QO3A 3A12A 3KLHB 4DR3J 4FP9A 4KKOA 3CCES 1L3SA 4F0KA 4DSIA 3FSIA 1NM2A 1U2FA 4JB8B 2HQ3A 2IY5B 1UMJA 2AHOB 4V19J 3BYRA 1FT8A 2IVYA 4ECTA 1RDRA 3RB3A 1JJ4A 2ATCB 3NCRA 4EI2A 3PY8A 2O3DA 1QVFR 1WELA 5KFEA 4RKUC 5F3TA 3DGPB 3DCAA 5CYMB 1PGZA 1NZAA 1T9VA 1U6ZA 2IM0A 2QE5A 4CLLA 1RTIB 1QTNB 4WK3A 1EAYC 3CVKA 2FHJD 2JH3A 3QZ7A 2KKHA 4NI2B 1HL6A 1QVGR 2ZDOA 3CEDA 4RW9B 1TMMA 1RBAA 1EJ7L 3AJ2A 3T1AA 4XIUA 3TUPA 1KLMB 5T14A 3OPKA 2LEPA 4ER8A 4WFXA 5E7OB 3UW1A 5BXIA 2KHDA 2FTRA 4L73A 4M94A 3PO5A 2WW8A 1X4BA 1RWKB 1KQSR 1PAEX 1L3KA 4MIWA 4L72B 1FFWB 2UXCJ 4Q5VA 4EYIB 1FXRA 2H5EA 2AIRB 2WCXA 3FNNA 4KKOB 2IDEA 4A46A 1UVLA 1RT6A 2B8PA 3TA1A 4U8VA 4LIWA 1KFDA 2H54B 2G1HA 3MM7B 3PYFA 2HFNA 3Q8VA 4CM0A 4E98A 3P4UB 1H2VZ 1TVRA 2PA8D 4OYWA 4UF4A 4HHHA 1UFLA 4JI0F 2HGLA 4BWJA 5CAAA 2HZVA 3KMQA 4TU8A 1QM9A 5M2RA 5JUMA 2QYGA 4GVBB 5J1EB 5H9EJ 4ZPBA 1DQ8A 4PQUA 4LVOP 1IQTA 2V4JA 4FYWB 3AXMA 4OQJA 4ZVUB 4EBDA 5J2QA 2GC8A 2X51A 3JTOA 5EDWA 4X2BA 4AD6A 1U0SA 3C19A 4URSA 2AYBA 1Q95G 4OI0A 2WAQD 4JOUA 4WBFA 2M3DA 4LSNA 1RAGB 1UAWA 5CZXA 3DDKA 4RO0A 4DCPB 1I51B 4M5JA 2WVFA 2ZWOA 4OV6A 1NK7A 2DNMA 1FFGB 1HBNB 1S6UA 1HQUA 3IP0A 3HHNB 3ZZOA 4NLGA 1T9UA 5CABA 1Q78A 4NLDA 2BJ1A 2NPIA 2BANB 1H74A 2BE9B 1JLGB 3HVTB 1J27A 1DAXA 1KONA 2A2DA 1U47A 1HNZF 3Q8SB 3AAWB 2OEMA 2RRNA 3C14A 4Q2LA 5GVQA 5T7LB 4QWDA 5HVGA 2DNGA 2QLWA 4KIAA 4MK7A 2WK4A 5IQ6A 3T3FA 2LU1A 3HHKA 4DPXA 4ECSA 1X0PA 1VQ8S 2UU9J 4NCAA 3G6YA 3OFFA 2XMWA 4LRBA 4TU9A 1SKWA 4C8YA 2BJEA 3J81U 5L9NA 1F2GA 2ZBRA 2ZNYA 5HK4A 1WD6A 2DNNA 2FHMA 1VQNS 1REVA 3MCSA 1SJRA 3M6XA 1FERA 1RKIA 3ENVA 2UVUA 4K4SA 1X4FA 1FCAA 4L75A 2QSWA 1G3OA 1S1UA 3KNGA 5K14B 5KT6A 4K0KF 2L9DA 4O3PA 3PZPA 2IDLA 3CD5A 2V2QA 5IC4B 5D0RA 2Y8WA 2AJ1A 2IRYA 2RF2A 3GFZA 2YNIB 4LRDA 1UPPA 3V2UC 5C5JA 4DF4A 5ETRA 3FQLA 2HVHA 2BJ7A 1IM4A 3I87A 4UOCA 4DL5A 2ZH9A 1S1VB 3CMQA 4ZVPB 4CLFA 5B0CA 3W61A 4ZVSB 1FDDA 2HFUA 3MR3A 2W9CA 1TELA 1DJ0A 3HX9A 3PX0A 1UWAA 4JI0J 4ELVA 2UUAF 4PPDA 1NPKA 1WC0A 3B78A 4DR4F 2W9BB 2UV8G 1H0HB 4LR8A 4MK9A 4PG6A 2QA4G 5F41A 3DDIA 1QUVA 1QLNA 2CQ1A 2YH0A 3DOLB 5BYSA 1VR6A 3MM8A 3PJXA 4WU3A 2D41A 3IMQJ 3FCWA 4K2XA 4X84A 4JI4J 1EQMA 3SI8A 3T6BA 4RW8B 5AE1A 1XK8A 2XYGB 1NK8A 2BJ9A 4Y28C 4DCJB 2HWTA 3M8WA 5KFCA 2ZNZA 3CJ3A 3C8YA 1P6TA 2YWKA 1AFJA 3MMCA 1HBOA 4RWXA 1TZ0A 4X62J 3B4DA 4MJKA 4DZDA 2LVWA 2NYHA 2YNGA 2LP4A 4FVCA 3W9JA 1FFSB 1P8GA 1Y5LB 3S7RA 4ZLNA 2V8VA 2NQPA 3N4WA 2V8HA 3GV8B 1VC5A 2X7IA 2HVDA 2C3YA 5IOLA 4QYZK 5F3ZA 4L74A 1A7GE 1BHNA 6FDRA 4I1TA 4OYPA 2YWHA 3TANA 1X4EA 2A6MA 5AE3A 1T11A 2PE8A 2LQBA 8AT1B 1WHVA 4KYZA 4ZPTR 2R4FA 4X4SA 2M5YA 3BO2A 3CGIA 4RW6B 3BZQA 3G86A 4MKYA 4X4RA 1U6BA 1H3DA 2WSEC 1C0TB 1DQ9A 3CCRS 2ZKTA 3M9MB 3ENWA 5H1SV 2FY1A 1HYSA 3QYYA 4NYPA 3IS9B 4CLWA 1N34J 4CDIA 1WG5A 5KFPA 1V5IB 1JIHA 2XS7A 3UO0A 4CI0B 2VFUA 2WVBA 1VQ7S 2HZAA 1M5HA 2F7VA 1H7XA 4K4YA 3K5LA 3VAJA 1S5ZA 1X5PA 1RXOB 3HKWA 3POTA 1S0MA 2XM3A 4UUWA 3EE3A 3QLHA 1U4BA 3BSOA 4DFMA 1B3TA 2HPUA 2YWWA 2OD4A 3QGIA 4DV7J 1WJ9A 3O2IA 3H5SA 4UZBA 1NU4A 2VG6B 1J5OB 4ZVTB 2EK1A 4YQWA 2FVRA 1JLBA 4LFAF 2DHHA 3PNIA 1NAQA 1RT1A 1R8AA 2DGWA 3FBFA 2MHNA 4ILLA 2N4DA 1A9NB 3RRGA 1FJCA 1PKUA 2PD1A 3R3TA 2OH2A 2J7WA 2OI2A 2PI5A 1WF2A 4A8XA 2QLBB 1ELOA 2HLUA 2GCFA 1SC1B 2JX2A 2CJQA 3SV3A 2AGQA 2RRBA 2XSJA 1XNQJ 1CPZA 4F4YA 4NLXA 5C25A 2BR0A 1R6VA 3PFEA 3WX8A 1AUSL 5EUHA 3H5YA 2HHPA 2L3MA 3LP0A 1BXNA 2MZRA 1C1BA 4RNFA 5KFHA 2MQPA 1S12A 2EBEA 4W4MA 4CM2A 4PAAA 2XCAA 2ZH5A 2B8QA 5KG3A 3DXBA 2ZDPA 4BWMA 3VV2B 2R7TA 2B56A 2UUTA 3C6TA 3LAMA 3QT7A 3KUGA 1JNZB 2K3KA 4C0BA 3WBZA 3CMES 4M95A 4G65A 4G3IA 2HHSA 2ACYA 3MEDB 3ET6A 3R7BB 4B3MF 1KSPA 1Z2ZA 5E3RA 2YWFA 4Y2MA 1IVZA 1B4SA 4JI3J 1XNRF 3C6UB 3KK2A 5IC6B 3A13A 4ZKAA 4LR7A 3UN5A 1FEEA 2CIMA 2ILYA 2W01A 3LGNA 4A4JA 4PWDA 2FGCA 3A8KA 3DHXA 4NYOA 3VGTA 5IT9U 1O6XA 2MJUA 3NG8A 1S9EA 4RNOA 3UQSA 3FMBA 3ZZYA 2B9WA 3TVZA 2V8GA 1D0EA 2CRLA 4O3SA 4DR6J 1NNDA 2XSJB 2W9CB 2CVIA 7AT1B 4I6WA 2QG9B 4I2PB 3EGNA 3L7PA 4PWUA 4OHVA 3LGMA 1SKRA 3FCVA 1CBKA 2M52A 1TUVA 3KLIB 4Q44A 3LP1A 4N8NA 1KQKA 3CCUS 4CH0S 2F9DA 3DRSA 3I55S 4WPAA 1IKVB 3RU0A 2EK6A 4ZVHA 4JV0A 3MAAA 2VH7A 3GIMA 3A4TA 5JVHQ 3D3CJ 4C11A 1Q16B 3SSQA 1F9FA 2QL5B 2D3O1 1S76D 4QWBA 4OJ1A 4KFBA 1SIZA 5ADZA 5KG7A 1TL4A 2CQPA 5B0GA 3CJTA 1WWHA 2D74B 1TKZA 3F0NA 3THPA 2A0FB 5HROA 2NREA 2Z2MA 3NNHA 1URNA 3QIPB 5DO2A 2HHVA 3FDSA 2BQUA 1MN7A 4DUZF 1YJVA 4B3MJ 4ED2A 5GMKa 4YP3A 3PR5B 3EJMA 1IJEB 5ETQA 1QSLA 1GAOA 1H73A 2EFNA 2RDIA 3W8GA 2HK2A 3KLGB 4IFYA 2VQEF 3LP2A 1C4AA 2NS1B 2G1DA 2LDIA 3R5DA 1MLAA 2WSCC 1C0UA 2ALYB 1RWWB 4AFFA 2ASDA 4PABA 4XK8C 1CC8A 4BBYA 2HFVA 1BUXA 1XR5A 5I4MA 3BDPA 4I67A 1UJ4A 1RAJA 1SL2A 2ZC4A 4FNIA 3DDNA 3OT9A 1HMVB 3NS6A 3KLEA 2L9WA 2FC9A 4Y2KA 2ZUGA 4NLVA 1Q7YT 2FJEB 3PEHA 2OTJS 4B9SA 3P45B 9ATCB 4CP5A 3OV7A 1XNQF 3IAS9 1FRIA 2CQDA 3HD1A 2B43A 3PCOB 1Q79A 1NJWA 2HHWA 4ZJQA 5AE2A 2N3OA 3X1LB 2DBBA 3M30B 1HQ2A 2BKNA 3EMTA 1RT5A 3D54A 4URGA 4ZITA 2ZEJA 1WC4A 1BQMA 4DR5J 2KG1A 4LSNB 1Y3JA 2K06A 4WXWA 1FE0A 1HNVA 1K1QA 2ILZA 2V4RA 2W24A 5E41A 4GO7X 4C9DA 1XR7A 1YSJA 4NA2A 1RT6B 2XI2A 2YKOA 3TOQA 1CSJA 5DLFA 2AZ3A 1Q86T 3A3OB 2B3TB 5IV4A 2YKMA 3Q22A 1RT1B 4P2FA 1NPRA 2ADBA 5ETOA 1JQGA 1NJIT 3EPIA 1Y10A 3LWLA 3MECB 1UEVA 3UCGA 5GADI 4NLSA 3BR8A 3QSIA 2RS2A 5HMZA 2LECA 3BKUA 2ERRA 4ZHRA 1QSSA 3E01B 3ZNJ1 4LF4J 4HDHA 2G9OA 2OPRB 4MH8A 2E7XA 1ROFA 1VOMA 5LL6d 3M1VA 1FKAF 1HBUA 2VFTA 1OWXA 2GVZB 5LXYA 4ED1A 2E5IA 3HHLB 2VV5A 5J1NA 3RW6A 2MZJA 1F5BA 1Y4ZB 4OYAA 2VBYA 3EICA 4L3NA 3VR1A 1U1OA 2DH8A 1PJ5A 2DNLA 3ZZ0A 1X31C 4M5IA 3F56A 3HSZA 4I6YA 2QFJA 5G0RB 4J91A 2KN4A 5LJ5Y 1RA7A 5KFTA 3MXHP 1HNIB 2FD2A 2RMLA 2B5JB 4D3GA 2EW9A 2Y0BB 2CDRB 3KMSA 4A8WA 1IXKA 2KRBA 5BR8J 5FLXY 2Z4PA 3AXKA 3VQTA 1CJUB 3PYGA 2OAUA 4TYAA 2CJBA 2XCPA 2E1AA 3M8PA 1S57A 4YB5A 1Q0NA 3GZ7A 5HP1B 2F8EX 3UR3C 1IKVA 3EX7B 3Q24A 1RYSA 3MM6B 2ATLA 2XMKA 4P74A 1UKUA 2CQBA 3K8VA 5ETPA 1FDAA 4HH0A 4BCAA 4O4GA 4BHQA 3D0GE 2GNKA 2MLYA 1GX5A 1VYAA 3CD0A 4ZS6A 2W8LA 2EWHA 3GYGA 2PN6A 3SCJE 5KT4A 4Q43A 4ED5A 3MPDA 3EM1A 3T1HF 1TKZB 5HROB 4OZNA 4NZ0A 2CG8A 1TKDA 4LQ3A 3J80Y 1U48A 5CYQA 2XWXA 2G0IA 3FKBA 2MSSA 1WI8A 4C8LA 2YKQA 4IQMA 4NLQA 5KFOA 3G8TA 1T8EA 4H4MB 1Y00A 4ZN1A 1MWYA 2R7WA 3H5XA 1XTZA 2CUYA 1HNXJ 3GFXA 2YWGA 3KJQB 1UWBB 2CPFA 4ZK7M 2OTLS 2J7KA 2UXDF 3IR7B 1ZZFA 2C3UA 4DQPA 1XBWA 1VHFA 1N36F 2XB2D 3N01A 1JLGA 2BANA 4ZP9A 3D7SB 3H2VE 4OX7A 3ZXWA 4A48A 3QIPA 3K0JA 3PKMA 1RP5A 2QLXA 4RJVA 1KTVA 1CQNA 4ED3A 1RAAB 4ZN3A 1U7LA 2BJ8A 2HEKA 4XTTA 1UVMA 1S97A 3BKFA 2C2DA 2ZH8A 2MMYA 3DKDA 2JJ4D 3ZZPA 5IXUA 3T1HJ 3OHBA 3M32A 4NCGB 1RTJA 2O67A 3P96A 4CIOA 3K17A 3OSNA 3MTKA 3QRQA 3EZUA 4NX9A 4U7UD 3IR6B 3M8YA 3RW7A 1Z1ZA 1Z4UA 1ZOTA 2RAQA 2PSZA 3MDFA 3NOCA 3Q8YA 3PYDA 1YJ9S 4X4TA 2EEYA 5CHCB 5K14A 3MCOA 4TU7A 2I5JA 1UCNA 4NXMF 2QSFA 4OHXA 5IM0A 1L3UA 3HO1A 1C4CA 1NDKA 1RU2A 3NBPA 2HBRB 4GC7A 1LW0B 1IKYA 3G82B 4R8UA 3TI0A 2OJ3A 1RYRA 2LQ5A 2OMOA 4DCOB 3VHQA 5DQGA 1F60B 1TK8A 2FIUA 3T5HA 3KUEA 1LK7A 5CYJA 3NXZA 2XULA 2BA9A 1T9YA 4FYYB 4BC9A 4LSZB 1KOOA 2CJXB 2HQGA 1NH7A 5EWGA 2RE1A 2UZAA 3OXGA 4DV3J 2DNPA 4DL7A 3W66A 3QO9B 3NS7B 2HRTA 1URRA 3CCVS 1MN9A 1RK8A 1D8ZA 1CJTB 4YHHJ 4Y6IA 1L3TA 1PCAA 2R7RA 4I2QA 2V4JB 4ALZA 1VK8A 3U27A 3TZWA 4DBQA 3DYAB 4R25A 2GJIA 3D5MA 3OSPA 3AHPA 5C25B 1P1TA 4LF8J 4OI3A 1AW0A 4LRFA 1GMWD 2R7OA 3DRRA 5HO4A 3PV8A 2HWHA 2BJ3A 1NB2A 2XYHB 2IRUA 4DQIA 2LDYA 2IIHA 3K2YA 2ZZTA 2KXHA 3QWUA 5ETMA 2B7CB 3TJ8A 1T3OA 2QEXS 2FGOA 4IKAA 1IKYB 2AMCB 2Q1LA 4R8UB 5L46A 4A8SA 4ITSA 1LWFA 2HIYA 3CJKA 2WVEA 3JAMY 1T3NA 1ZYQA 1I94F 4DG1A 2Q6CA 3DN9A 1K1SA 3FK4A 4JYAF 1LK5A 4IH5A 4QIVA 3M8PB 2XC9A 4DSJA 2AX1A 2C2ZB 3RBZA 4B08A 3GIJA 5T7LA 3L7OA 1QD1A 1FKPB 2VG5B 1RTHA 2E44A 4J9OA 1UA1A 1CJKA 2KB2A 3R5GA 4MYUA 2NYIA 3BN7A 3MPUB 4ZA1A 3CD6S 1S72S 2BRKA 3U1MA 2J9DA 4ZPDA 4CTAB 2MTLA 2W2PP 3FC9A 1TV6B 7FD1A 1N5VA 2O1PA 1WG4A 5CYMA 3ZO7A 1IBLJ 4A8OA 4PQAA 4MT1A 3P49B 2AV5A 2DGTA 3OL8A 1B64A 3HVAA 3I0RB 2RQKA 4QR1A 4NI2A 3E8OA 5L38A 2DNZA 3TAPA 4ED8A 4DMZA 1E6VA 4F3OA 3L09A 2H4YB 1M90T 3MUVP 2DGSA 4RW4A 2BBEA 3LAKA 2CADA 4ED0A 4OJ3A 2JZ5A 2HAIA 2A2CA 4FNHA 2IYGA 4Z7YA 3KK3B 3BSNA 2UVRA 2HGNA 2C3PA 1FKOA 2RH3A 3KFWX 4B3TJ 3O5TB 4Y65A 1N33F 2MLXA 2PMWA 2KJVA 3CNQP 1ACMB 2HURA 1MMDA 3V6JA 1GFWB 1VK3A 1WDTA 2OHDA 1SIWB 1CLFA 1VCTA 4DFJA 2RVJA 1U1RA 2D9PA 1LWXA 5AXMA 3HHDA 2MB0B 1HWLA 3AJ1A 2BX6A 1HWJA 2H1YA 5KT7A 1XMOF 5AJ3F 1AFIA 4RW8A 3DU6A 4OJGA 2JC1A 2D3OR 4F2RA 3CD7A 1CVJA 3LO3A 3OXFA 4DUYJ 5KFKA 5K5MA 5I3UB 2IM1A 1N8RT 2JSXA 5IM0B 3MD1A 3R5CA 2N7CA 4DUZJ 4DL4A 3CCJS 2Z2LA 3H0PA 1NH8A 2C28A 3KKFA 2YQ1A 1G2EA 2BEFA 3DMJB 4LFCJ 3UFCX 3L4BC 2W8KA 4ZIVA 1YK9A 1FKOB 5EHHA 5KTQA 2PEHA 1HI0P 2IVFB 1YJRA 3CO9A 3CCWA 5HQMA 2R3VA 4DR2J 4DV1F 5CH7B 4FF3A 2XLKA 4A8QA 2GV1A 1KTQA 1H98A 5KG5A 1U1PA 4W92B 1RKJA 2CJKA 1S1WA 3HM9A 3ISNC 4OZ1A 4PYDA 3NKYA 4PKDB 4DI6A 1FVQA 4OZ2A 2CQ4A 4LFAJ 5KFJA 4WCEQ 3MUMP 5LMNF 3ITHA 2KJWA 2DGXA 2VQFJ 2EC0A 4J90A 5D4LA 1EHWA 1NK0A 1N32F 2EG2A 2OPQB 4QZVB 2XBPA 1VQMS 5KT3A 4USIA 2M2BA 1FRKA 3R5AA 4NZ6A 2V63A 2PI4A 3Q8QB 5D3GA 4QPXA 2CPYA 1FX2A 2XMMA 1MU2A 3TAMA 2WOMB 1CC7A 1TL3A 4FDFA 4KAIA 5FIIA 4F67A 4J9KA 1B99A 3DLBA 4JBCA 2RQMA 3US5A 4WFNQ 3M2VB 4IR1A 2VODA 3MECA 3S8SA 3E3XA 3R5JB 2GW8A 2HBZB 3FSXA 3QLHB 5JMNA 3MUTP 2DO4A 2OO4A 4MKAA 1WEZA 3JYTB 1KLNA 4C8NA 3CCTA 5K9FA 2QL7B 5LXRA 4YN3B 3J7ZT 3TUIC 8ATCB 1OSDA 3QPIA 3BGRA 2YKPA 1TQLA 3IG1A 3HHLA 5HL7Q 3AODA 4HACA 1D9FA 1BD6A 1R89A 2LA6A 2FC8A 2IJFA 3M2UB 5K8OA 2HG4A 3K7RA 1S9GB 1VLOA 3C15A 2F8HA 5GMEA 3DU5A 2YKMB 5G0RA 4NRUA 1I1GA 4P2MA 1XN9A 4P72A 2MKYA 4QR0A 4DV7F 3EGWB 3VZIA 4LR9A 4N7TA 4KPYA 4EWTA 5KFIA 2X1GA 4UT4A 3MAHA 2G2YA 3K8WA 3EXCX 2VBXA 2BXJA 4C8KA 1H2UX 3N0VA 3J7AN 2KI2A 3DLGB 3VZHA 4F26A 2OPRA 3M2VA 5D6GA 1XMQJ 1NK9A 3M8SA 3DOLA 4ZP7A 5KG6A 3J7Z5 4ENOA 3OJUA 2ZWPA 4LF4F 3BGFA 2Q79A 3BQ1A 1KVKA 3KK3A 2HS3A 2M8HA 3Q2SC 5LT5A 4O3RA 3KK2B 5ITHA 1RAHB 3I0RA 1WI6A 4ZPWR 3OFGA 3RUBL 5DDRC 2HVZA 2I38A 4RU9A 4ETZA 4N5SA 1PO6A 2AJ4A 1N52B 3JTNA 2IC3B 3M05A 2DPIA 5BJRA 5KFYA 2XI3A 4I4BA 4USTA 3QJPA 4QW9A 4DR7J 1D09B 3KG1A 2VKZG 2WONA 4K5RA 4J9NA 4DR4J 2DIUA 4NCBA 1P1LA 4HEA9 4C98A 3ENQA 1HNVB 3UWTA 4HT7A 1QAJA 1FWLA 1NUEA 3V6DB 4WTYA 2XZWA 1YRXA 3CCMS 3FZ2A 4NEZA 1X5OA 1SCJB 1CS4A 1SH3A 4QW8A 4ETXA 5KFQA 4JI1J 1VGYA 2J6SA 1BQNB 5AXNA 1JXLA 1KR4A 4RNNA 2XMUA 3J81Y 3V6KA 2IYIA 1NJYA 3OVSA 1IJFB 2ZBIA 3HF5A 3I82A 2OEKA 2JL9A 4JI7F 1WTBA 4U6PA 1FO1A 5GAEI 1IBMF 4U7UK 1DARA 3KJFB 2RUSA 1AZSA 1K9MT 1JLFB 3W2WB 1HW8A 3EGVA 3V81B 1SVDA 5KFGA 2XNRA 2XNQA 4NWBA 2V2ZA 4NCGA 1TKTB 3BV8A 1HBUB 2ZFHA 2KXNB 2GVDA 3DLKA 1CJVA 5HJYA 2XMTA 2C3OA 4F50A 2Z2ZA 1YBUA 4C3MA 4DU8A 2YH1A 1PG5B 1KDNA 1GMVA 4MKBA 5HVHA 2WBMA 4IRCA 2ZD1B 3NL0A 2DISA 1EB0A 3BSAA 4IFVA 2C2EA 1O51A 2FUG9 3HD2A 5KFDA 2C22A 2H5IB 3LPYA 1E6YA 5KFZA 1NLKL 1LW0A 1UVNA 3HSJA 4OYMA 1OS5A 5E3QA 3HT3A 4LF7J 2R7XA 2GO8A 2IMOA 4CLYA 1OSCA 3FCHA 2HVEA 3MM7A 4LBPA 3DM2A 4UTGA 5AT1B 5KFFA 5G4DA 3EVWA 4NLUA 5HQLA 3CCQS 5KFSA 2ZZNA 1N6QA 4ES1A 5KFUA 1HHQA 4I7FA 4GVBA 3W60A 5J1EA 1FK9A 1RWXB 2R8JA 4OI4A 4EZ9A 1X5TA 1GX6A 3KG0A 4OV1A 4X64J 3W2WA 3H25A 3QFWA 2X3GA 1KQGB 4CO0A 1VFJA 3GB0A 5LSOA 2MKHA 3QT6A 4HTJA 4DX7A 4YOEA 1OO0B 1EKRA 3MEEA 3J7A1 5SZTA 5CCMA 3NGTA 2VPWB 3DC2A 3M2UA 2YNHB 3IRXB 4ZP6A 1LFPA 3SDEA 3W9HA 1S49A 4DR1J 4DFKA 3IWLA 4RUBA 3UI3A 4P71A 5ETNA 4M5LA 5FDLB 4CO1A 3VAKA 1PYSB 3TX8A 3SZ2A 3CWJA 3D6TB 4DSKA 2MKKA 4ZP8A 5HVFA 1JK9B 1SC6A 4O3OA 1N56A 1KLMA 4M8LA 5C7PA 1U09A 3UD4P 1K73T 3MWBA 4TLQA 4CLZA 4EBCA 4JP8A 4LUBA 2IA6A 3L7UA 5D4PA 2BQRA 4LRAA 1NK4A 1S0OA 4RUAA 4DV6F 4CLUA 1D9DA 5BR8F 1RADB 1SC4B 1PJ7A 3IGVA 3TJAA 3TRGA 4OYOA 2R8KA 1V3RA 2RU9A 1NHUA 5GMDA 3SQGB 2KT2A 4K50A 4KBIA 4KE5A 3CSKA 1VRUB 2VC1A 3E2EA 5M2UA 1NCLA 3DFEA 1EQ0A 1Q5YA 2JRSA 2QJ3A 1QE1A 3ZTPA 2Y8YA 1PAUB 1OQ6A 4M5HA 1GT8A 2CQIA 3R1LA 1Q8IA 1HPZA 3HFVA 2EFVA 4CNYA 1RACB 1OYEA 3MEGA 2RSQA 2CQ0A 4F4AA 5HATA 1G7CB 1GNKA 3H2UB 3MAAB 1F5CA 1YRUA 1WKLA 2ROEA 3KDOA 4USJC 3ELHA 4G1QA 4H4OB 2ZJQQ 3TQ1A 3G87A 4FYVB 4B9NA 3HLUA 2HHQA 1U2CA 5DZ7A 4DV4F 3HJFA 3UDVA 2C3MA 3Q8UA 1HQUB 1HNWJ 5HQ8A 3OL6A 2DNYA 2EFPA 2JDJA 1U0HA 1KS2A 1CS4B 1Y7PA 1YZ7A 2NXUA 4ECYA 1S77D 3HT0A 2H65B 2K3IA 3QSYB 1NPPA 2Y1JA 3KOAA 1WOOA 4U95A 4DLEA 4ZJLA 4WK1A 4V1Ak 1KC8T 3MD3A 1WACA 2OIHA 2V9WA 3AD7C 2HNDA 4F4KA 2PMZD 4LFBJ 5D78A 3B8HA 4ZOSA 3TNVA 2SXLA 4KH1B 1X5SA 3SFUA 1Y9OA 4KY3A 4FBUA 3RB0A 2NPFA 2JEJA 2XYPB 4J9SA 4HLBA 1CJTA 3U7JA 5LJ3Y 1YJWS 2R8GA 4I2QB 2E9RX 4DV0F 4UQTA 1SJ3P 2IBKA 4KHPF 1CEZA 3OTBA 4O3NA 1F3FA 2ZVSA 4LF5F 5IV3A 1HBNA 3S6EA 3QT8A 4TQSA 2FVSA 3S1TA 2XEXA 3I31A 1NJXA 4LT6A 2R8HA 1V3SA 2ZKUA 1RU1A 4OZ5A 5F0UA 4A8MP 3ILLA 4X4PA 2MZSA 3PO4A 3ISZA 4ECRA 1VQ9S 2AYGA 1HD1A 3TARA 1HHTP 1YITS 1ZPVA 3BS9A 3OQ2A 3FRZA 4RW7B 3UVJB 2RNEA 3IXQA 2NXJA 4PRFA 3MM9A 3RYLA 2R8IA 1RISA 1X7VA 2DYAA 4OLOA 4HR2A 3MTJA 3GIIA 3H4BA 2R2TA 1VC0A 5IT9Y 2RU3A 1KKHA 4U7CA 1BQMB 3CIMA 3HJVA 4ZLJA 4OZLA 1HI1A 5E3PA 2OSRA 3LF0A 3N5BA 1IKWA 1RWUA 2WB1D 3O3LA 4HL9A 5HI7A 2FZGB 4ZJOA 5DDOC 1REVB 5EN1A 2PFFB 3DRXA 1VC6A 3E01A 4OZJA 2EFQA 4RBTA 4RX6A 1LV5A 3ITHB 1S1UB 4TY8A 2H51B 4P52A 2JHEA 4LMZA 4C48A 2KM8C 3OUYB 4K4TA 4ICLB 2P6TA 1AROP 2QV6A 4ZDNA 4RNMA 4ED7A 1HHSA 1JLAB 3IRXA 3PX4A 1FDBA 1MW7A 2HRYA 2DRDA 2VUGA 2WHOA 4KRWA 4I7FB 4LBIA 3GJQB 5A6WA 4CH7A 5LMNJ 1RJJA 1K8AT 2DRAA 2LA4A 2AJFE 2I5JB 4XO0A 4C8OA 3T1YF 1S0NA 4DXLA 2N82B 4O0IA 4Y3CA 1MROB 2HWIA 4ZVFA 3CDBA 3W5ZA 1RBLA 1S6PB 1JLBB 3G96A 1HD0A 4ZMMA 4A47A 1UJ6A 3K59A 3EWGA 4UZCA 3SDEB 1SL0A 3ZNUA 1Y5NB 3CC2S 4FBTA 2HS0A 2NLWA 3MMJA 4OJHA 2CQ2A 4CO3A 3BO3A 2P8IA 1R0CB 3ENAA 2XTJP 3C16A 4ZCLA 4YB1P 5D15A 1FJGJ 3M8RA 3GV5B 2Z58B 3TX0A 4V19X 2EI5A 3P6YC 1QTMA 4O4GB 4HDGA 1FRXA 2W2OP 2BKOA 1X4HA 5IT0A 4WIIA 5FD1A 4N8OA 3KJVA 3MF5A 5L9XA 1CJUA 2RHQB 1TL3B 1UP1A 5DJBA 3MCNA 1TUGB 5EGYA 4GKJJ 2M70A 1ZZNA 4OX6A 3B6BA 1NDLA 3MM6A 2L08A 4QWEA 1Q8KA 4DL6A 2JEIA 1MROA 1SL1A 2CNNB 3QRRA 1WKKA 3BO4A 4LF7F 2Y3YA 4EFAC 2C42A 4G6VB 4EUVA 3PW4A 4DR6F 2VPYB 4EYHB 3DMJA 1RE1B 2DEIA 3TUZC 4DUTA 1FWPA 3ZZZA 1FTRA 4G1IA 4NXNJ 1HKAA 1RTZA 4JI8J 1VQYA 3QAUA 4Q7AA 2KVQE 3U1NA 2HS4A 2IAJA 2IC3A 1JLCA 1RAFB 4JI7J 1SQGA 2MKIA 1JX4A 3FFIB 2VOPA 3IN5A 4P7TA 1TFWA 3D1HA 1X60A 3M32B 2QZ8A 4JV5J 4ZPAA 1U1KA 1VDHA 3PW0A 1S6QA 3HZGA 3UPFA 5J2QB 1GK8A 3GILA 4GMKA 1G1XA 3W9IA 4N77A 2KT3A 3HFKA 4I68A 4IO9Q 2HIQA 4RPFA 4OYIA 3GYXB 4IOBA 2ZH6A 1C1BB 3H5UA 4E8UA 3Q86A 2VASA 3ZFVA 1BC6A 1QAYA 1KNZA 1XQIA 3AA9A 5ETSA 3AY0A 2AEFA 2C1EB 4DL0C 3BJYA 2ALZA 4RW7A 3UVJA 4YY3J 4OZ3A 2GVZA 2QX0A 4J9RA 1VRQC 3NNAA 1FF2A 1S1XA 4O4RA 5A0YB 5KFBA 3NP5A 2PT0A 1S7IA 2VG7B 2K1RB 2EBGA 2WSFC 1OPIA 4QIWD 4TVAB 5LM7E 2XY7A 1HWIA 2D69A 2J0XA 2VFVA 3IG1B 3OL9A 2GS8A 4HACB 2FLOA 2V9KA 1LWEB 3CCZA 2HNYA 4F4XA 1KHVA 4ZCMA 2LEBA 1R7IA 2FJDB 4GO5X 3M9NB 2WRMA 3AB2B 4IRDA 5C24A 1RLDA 3GIRA 5B0EA 2ZBCA 4M5DA 1KP6A 3J7YI 5DG7A 2YNFA 3I56S 1N0UA 3SCLE 1FNXH 2UUAJ 1WDDA 2ZITA 2AW0A 2MQMA 3QO9A 2LXFA 3ISND 4FS1A 2V2KA 3CC4S 2OEJA 1VI7A 1FRHA 1WF0A 4CRJA 4C8MA 3SIPB 2YQ0A 3DRSB 4K4ZA 1S4FA 8RUCA 5LOQA 1SI9A 3JAMU 1RTDB 1UETA 4KHRA 3HSGA 4PWWA 2F65A 4DG1B 5A2QY 3PVXA 1T03B 2P9CA 1U1QA 2QFIA 2ZOMA 4O0NA 1KOHA 4C11B 2LFVA 1NZ8A 3GTYX 2D1CA 4P73A 1LWCB 4ERDA 1RT2A 3M7VA 1YX2A 1WOPA 2L9NA 4OFZA 4ZVRB 3NMRA 2YNIA 1SKUB 3THTA 2X1FA 1KBRA 1LWFB 5FJ4A 5IQQA 4HKQA 2MZTA 3CJ2A 4WJBA 4N76A 4B3OA 1GEHA 1ICEB 1RABB 5C24B 3KLIA 2FHJA 4KQZA 3T5KA 4I0WA 3JSYA 5KAKA 2J9DE 4NLOA 2UU9F 5KFMA 1T02A 1VQSA 2JLEA 5HLFB 2FLNA 3BPSP 4OL8A 1MNEA 1RUSA 1HR0F 3MMCB 1NSQA 1FVSA 1P9QC 3UDEA 1S79A 5F9NA 2YX1A 2DY9A 1H6KX 4NXMJ 1UTAA 3X3UA 2Q43A 4DN0A 1VQOS 2YY3A 3Q8RB 2AYEA 2VJVA 2J9EA 3NS5A 1KRPA 3E51A 1WUUA 3RJMB 4DX6A 1U26A 1S6OA 2KDOA 2KHCA 4LSLB 3RRKA 3VGVA 2CNKB 2Q3PA 2H48B 3LALA 3LGHA 3MMBB 1SH2A 4LIRA 3W2VA 4Z2XA 2QL9B 2JFDA 4IG3A 1U8WA 2KZZA 1U6FA 1F2HA 4XPEA 3UD3P 1YQHA 1HA1A 2O01C 2OPPA 3HHLD 1B0TA 4JI8F 1HBOB 4KGKA 4ANDA 4QR2A 2B9YA 2COLA 3ICLA 2DO0A 3PRDA 4RW4B 1ZM9A 3LTOA 3G82A 1YI2S 2FDNA 4DX5A 2CVEA 2QTWA 4KGVB 2DH7A 2M7SA 3HCXA 4IO1A 4W98A 1S6QB 2FLPA 1R8BA 1R0AA 2MQ8A 4KO0A 1SQEA 3KHGA 4LVNP 4DJBA 2VIHA 4DEZA 2V50A 3DLJA 5E3AA 2DGVA 1KVJA 2V6AA 3DOKB 3FFIA 4Y2AA 4OHWA 3ETOA 3A3NB 1SJQA 2W2NP 2BVZA 4OIXA 2LLZA 1UZDA 1UEUA 3CJSA 2N3LA 1MWQA 2H9ZA 1UVKA 1RT7A 5HANA 3CJ4A 2DRBA 5H9EK 3HHEA 2F4VF 1SUQB 2CQHA 2MQNA 4YR3A 3WX4A 4RU2A 4LSLA 4WKRA 3LANA 1B0PA 5CYQB 3SYZA 2CAJA 2GIFA 4DFPA 5DGAA 1VQ4S 4GRSA 3RG6A 3QGPA 1J5OA 1RI7A 1UVJA 1PC5A 2JNJA 2BE2B 3M2RA 2HLTA 2FLLA 3TVKA 3VVUA 3R2DJ 1LEOA 3BREA 3T5JA 3RB4A 3TZXA 3POTB 1QY7A 2Q6BA 3HK2A 1OY8A 2HQFA 3IO1A 3NGUA 2GO9A 5CZVA 1DY3A 2K7KA 2CDQA 4KHMA 2AJ0A 4UUXA 2YX7A 3GV7B 4KR0B 2D9OA 1RTHB 4ZPCA 2KRRA 3DRPA 3OL7A 1HWKA 1BQNA 1KHWA 1RAEB 2VL1A 4OZ0A 5DDPC 3EYZA 4Z7CA 1GQEA 5L1JA 3OJSA 4B3SJ 4YY3F 3BPDA 4J9PA 4NLWA 4LF2A 1T03A 1G4CA 1Q8LA 1YGYA 2QMXA 3R9LA 1TMJA 4WFAQ 3GONA 2XO7A 4OYXA 3EXYA 1RGVA 2DTJA 3AD8C 4NA1A 5GADU 3PKYA 2YNFB 2Z0GA 3ONQA 2GHWA 4FPRA 2ZM6F 3QT5A 5I3PA 5F8MA 4LFBF 1IQZA 3B54A 5DS7A 4NYZA 1TL7B 2XY5A 3NGRA 1IR0A 3ZTOA 4PXCA 2YKNA 3KK1B 1VQPS 5L1KA 2JVRA 2IVMA 1CULB 1SJ4P 3GP9A 3NGSA 4X66J 5ETVA 3N28A 4JV5F 2YNGB 2A10A 2DR8A 4KJIA 1N54B 3L3CA 1PBAA 5E33A 3Q0AA 2AEJA 4MAKA 3BR9A 4KH0B 1PBUA 4DPOA 5GAEU 3M8QA 1SV5A 3LQVA 2QA1A 4CYUB 4DDFA 3BM7A 3NEKA 1LXNA 2XQCA 1VMBA 2M4MA 4PG7A 1NKEA 1AXQA 2KL8A 2CWXA 4OYBA 2C2OB 2IJRA 3M6VA 3O44A 3V81A 2B9EA 4I56A 3B4MA 4YHHF 5LMUF 1LNQA 1R6YA 3CE8A 2J76E 3OD2A 4C7QA 2ZHBA 3CC7S 2BZ2A 3C3LA 4F0MA 3NGKA 4DU7A 5A8KB 3NNCA 2ZBQA 4A8YA 3MR5A 1JLAA 3EZOA 4M5KA 4HI2A 3RR8A 4K4WA 4W90B 4JV2A 2JLFA 4WP8A 3LOUA 3NAHA 3MFIA 1XEZA 3GJRB 2R7VA 1P27B 1X4CA 4H4MA 2CJYB 3THVA 1DHMA 2LXIA 2V0NA 4IDKB 1TK0A 3TVYA 2YKNB 3HSDA 1NDCA 1P9YA 1IM6A 2XLIA 4FVMA 2Z56B 5KFNA 3KHLA 4F2SA 1TU0B 2GHPA 3D9BA 3P8BB 2E5HA 3OTOF 5KT5A 4X64F 4ZLLA 3NBPB 3W2VB 2WVCA 2EG1A 2ZVIA 3D6HB 1FKPA 2VG5A 5HMYA 4RW9A 3T41A 2FY8A 1KD1T 1BGXT 5J2MA 2GZOA 3D28A 1HNXF 2W9AA 1EARA 4DR1F 4Y2IA 2PO4A 2CPXA 3GU0A 3GR0A 2LQ8A 2QA2A 1WHWA 5KFRA 4IG0B 3MAQA 4Q8FA 5F8JA 5DG8A 2IAJB 4DUYF 1RTJB 4DL3A 4CZCA 5J1PA 4NLYA 1N5YB 3W7BA 3UE2A 4F36A 1UL3A 1VIXA 1FRJA 2CZVC 2OPQA 3BGOP 3NCPA 4KV8B 5DRKA 4B17A 4MK8A 2FVCA 4I6AA 4MTPA 3HKZD 7FDRA 3QJJA 2F5GA 4M63A 1QE1B 3FZBA 5D3GB 5DQIA 4DV6J 2GGPB 2PEBA 1GTHA 2KO1A 4IYQA 4GKKF 2W7OA 2ZD1A 1JKHA 3EGZA 1XIQA 2LQJA 1TL5A 3IM8A 3MMAB 2BQ3A 1TL1B 2GQQA 1F6TA 4CO5A 4USWA 4KTQA 2MPUA 1F0XA 3MPWA 4K4VA 3MOZA 2CFXA 3PFOA 1TKTA 3K5PA 4JI3F 2PMHA 2IM2A 3OR1A 5J2MB 2IMWP 3R5BA 1VS3A 2RIJA 1NK6A 2RS8A 3TA2A 2QMWA 4Q8EA 3KJNB 4FXDA 2VBWA 3J7YU 4UOHA 3C16B 3JS9A 2J8SA 4QBUA 1OY9A 3FEYB 4ED4A 4CH1A 3T5LA 1FXLA 4DV2J 4F04B 1M1GA 4X4VA 2IBOA 2H3EB 4X65J 2ADCA 4C0OC 4NZ7A 1U45A 1BE4A 1EKSA 4CT9A 1F5AA 4ATNA 3SCIE 3ULHA 2UUBF 2Q66A 2Z30B 2CPIA 2E7VA 1GXTA 2WBRA 1APSA 1ZM2A 2CZ4A 4OX9J 1T95A 1FD8A 2QGFB 3LUYA 4C3KA 1CULA 2XLJA 3DRYA 4DV0J 3V6HA 5H9FK 3JSMB 4NL5A 5H9FJ 3U1LA 3A8EA 3TO8A 5CA5A 1JXEA 1BMQB 2FPHX 2V8DA 3TEHB 1S1VA 4ZHRB 4DPTA 1E6VB 2D3ZA 4JYAJ 2VG6A 4TNOA 2XMJA 3QGHA 3HVRA 1GTEA 1JJHA 1QJHA 2ROGA 2Z8QA 2B4VA 3MM9B 4USHA 4EO8A 1MMLA 5E3CA 1K0TA 1ZPWX 4DOZA 2KFZA 5L39A 4DS5A 2CNOB 2MQLA 1H7WA 3KK1A 1LWCA 2EKNA 3CDWA 1T05A 2AJQA 1OY6A 1TV6A 4DQSA 2M0GB 2E7WA 3IAM9 4S0MA 1S4EA 1X9MA 1HNIA 5D8HB 5HJXA 4AQYF 1KWMA 3T9NA 4CYUA 1I3OB 3SSRA 1K0VA 2C2MB 5BYRA 4K4XA 3QGGA 2ZE2B 1QAXA 5KG4A 4PZVA 4C8ZA 1YJUA 3IGNA 2MLZA 5KG2A 4URQU 2OPSB 3VAMA 4TN2A 4DV2F 4ES2A 3PW2A 1VBXA 3WC2A 2JFKA 3JYTA 4ELUA 3U02A 3VCDA 2A18A 1UA0A 3I0SB 1Q7LB 2DHXA 4DR5F 1NB7A 3NMAA 3QIDA 1R27B 4X4OA 3GJSB 4B9MA 1DLOB 4ID5B 3FUYA 1RWPB 1PYTA 2LYVA 2GAGC 3GPAA 3GYNA 3HDSA 3PJ9A 4NRTA 1ZM3A 4DPUA 2BOPA 3DXSX 1NHKL 4LQ9A 1EETA 3IFEA 1M5VC 4USKA 1WNEA 1FRLA 2BM1A 4RNHA 2N7YA 1PJ6A 1RT3A 2MY7A 1ZA2B 3MEGB 2B6AB 2CPHA 2D3UA 4K8RA 3KLEB 4TKTA 4R5PA 4ELTA 2E9ZA 2RKIA 4AL5A 2J7UA 1EX8A 2E29A 4NE9C 3I5AA 3ZC4A 2XS5A 2GJ2A 3M8ZA 4JI2F 1R31A 2U1AA 1S1WB 4I2PA 1S9FA 4MFBA 3SBMA 1RHKB 2QT7A 2YVSA 2E5LJ 4ZCKA 2QLFB 4I64A 1FNOA 3ZTSA 3G71S 2KG0A 4DR3F 2JLGA 5A8WA 2CWKA 3DNCA 1Y0HA 2MKJA 2YWEA 3D4JA 2XG8A 3O1LA 1WHYA 4WFYA 2GGPA 1FI4A 4C2MA 3D2WA 4F4WA 2QA4S 2HHXA 1ULRA 4DR2F 1JWWA 1O5JA 2Y1LB 4O44B 4K2JA 5IS2A 3PRBA 1TL1A 3H40A 3GMGA 2V8PA 1BWVA 2W4DA 3QMQA 1RT7B 2VFRA 3CDEA 5KFWA 4QCLA 2KU7A 2FJAB 4DPWA 3B82A 3MEEB 3RB6A 1SUQA 3L9ZA 4RZRA 2VF3A 4AUKA 1FD2A 1V6HA 1FJEB 4GKJF 2DNKA 5GAHI 1RWNB 1OPZA 3FMWA 3TA0A 2OP5A 2CJ9A 3VVTA 4NMLA 5FDLA 5HAOA 4Y00A 4CLPA 5I42B 2J5AA 2OSQA 4DQRA 3TQEA 1Q5VA 2DNOA 2E5JA 2DJWA 3PR4A 3PW5A 1FHTA 5ETTA 3MR2A 1R8HA 3OXLA 3QATA 4K5SA 2P2CB 3A1YG 1FDNA 4ILRA 1RHQB 2ZOGA 4BC7A 2V68A 3GG0A 4EK2A 3G8SA 1EIYB 4B9VA 4TY8B 2OLWA 4X65F 4NXNF 2HHUA 2E66A 2BV3A 3OUYA 3NLCA 2FVQA 4WZMA 2NSCA 2PA3A 5CD4H 2NZ4A 1OJ4A 1SBRA 5IT4A 1EZZB 4NEYA 3AD9C 3WZ0A 3JSRA 5KFAA 3VAIA 5E2QA 2C2KB 4O44A 3AB4B 3T9ZA 3CXCR 1UFKA 1ZAXA 1HI8A 2LKZA 1AA1B 2VICA 5LMUJ 1U02A 1NKCA 1NSKL 2E1CA 3R2CJ 3BGRB 1DFDA 2DNRA 1F3VA 3AT1B 3J81j 1DTQA 1HQEB 2KFYA 3DGPA 3OLBA 3H59A 5HBMB 1HNZJ 1EP4B 3CTRA 1VBKA 4ECWA 2W7PA 4ED6A 2BUNA 2UXBF 5I42A 3OTOJ 3MZIA 2F40A 1SJ1A 2YPZA 2GQ2A 2R7QA 4H4KC 4KC5A 3RZAA 4UOGA 4Z37A 2ZZMA 4KHPJ 1X8DA 1XJWB 3GCXP 3H90A 4I69A 5C42A 5IWAF 3IA0A 3RBEA 1J5EF 2YKAA 4G1QB 2R2RA 3MI7X 5A8RB 4TLRA 3EDQB 2IA0A 3C14B 3M9OB 1Q82T 1TAQA 3QWPA 1VQLS 3ILOA 1TKXA 3QBCA 4JV1A 4YMEA 2OPSA 2BW2A 1O0PA 3KNAA 1YRTA 1HBMB 5AXKA 5J2PA 4YB6A 1J2VA 4YR2A 3MFHA 4CLSA 2BE7D 3JSBA 1C1CA 1QDUB 4DV4J 4H4KA 3I9V9 4F02A 2DHSA 1RTDA 3HI9A 4FPIA 5KFXA 2HMIA 4O23A 3AH6A 1ZA1B 3LP1B 1F9HA 2I6WA 4U67Q 1Y3KA 2A1BA 3FBEA 3VAGA 2FJVA 3OLAA 3BB5A 2JVOA 3AOCA 4QYRA 3R97A 4FN5A 3TUJC 2B9XA 4LF8F 3D1OA 1JJ2R 4F0HA 4F25A 2JEFA 1IN0A 1N5SA 1RA6A 1A6LA 2B5JA 2B0GA 2AWZA 2W2MP 3R7SB 3K5OA 5A76A 2P6SA 2RD5C 3PEJA 4OI1A 3WDOA 1N34F 1MMNA 1JNRB 1JJCB 2P5VA 5LSLA 3TZZA 1WG1A 2G0JA 2U2FA 3I4PA 3QNWB 2UXCF 5HN0A 3TWZA 3NY0A 2CQ3A 1LFWA 2RHSB 1IKWB 2CG4A 3CJ8A 3LH2S 3PG9A 4P2XA 3SQGA 1R8PA 3TJ9A 5L1IA 1RAIB 3QFHA 2UUCJ 2GAHC 3VTIA 3TAQA 1CQMA 1SXLA 3KG4A 3R6LB 4QWCA 3MGJA 2XWYA 4ZVGA 3UNYA 3FBCA 3LPEA 2OUGA 5HMWA 4XAKA 3H98A 3K57A 3OR2B 3DLEA 4P9SA 4G1PA 4FF2A 1IBCB 2ABYA 4YFUA 3J80U 4KGXB 3N6MA 3WIVA 3G2XA 2VG7A 4EEYA 2NSBA 4X4QA 2K8GA 1UW9A 2DCUB 2KVIA 3UDLA 1X9SA 4FF4A 4UY85 1LW2B 2DNHA 2IM3A 1WSRA 2I1RA 2WVDA 2WZ1A 3BYPA 3MHYA 1YJTA 4M5NA 4UOFA 4IFVB 2HGMA 3BEGB 2QN6B 3IWXA 4HT5A 2I2YA 2YNHA 2DITA 3M6UA 1TUWA 2DR5A 1YHQS 4ZCIA 1BQXA 4OMFG 3H4DA 2ZH7A 2CPZA 1SB6A 2ZM6J 4NASA 2I0XA 1Y11A 2MQOA 2UVVA 1QUPA 3VWSA 1F1BB 4RBUA 3WQPA 4HHJA 1RT4A 3CIZA 4OI6A 4CT8A 1M5OC 2CNLB 4AL7A 2J6TA 3M8QB 1VQ6S 4X62F 2HRUA 4CO2A 2MHEA 5EX3A 3NRBA 3UD5A 2HNDB 2W7AA 2VDIA 1WSVA 3A8JA 3FEZA 3OR1B 2VOOA 2WOMA 5K8NA 2LMIA 4KV8A 5LSRA 3JQJA 4IUFA 1WF1A 2XMVA 1TR0A 3P3DA 2AT1B 3DOMA 4QYZJ 1RWMB 1RB0A 5EX0A 3KJVB 5A2QU 5K8MA 1IR2A 3BH6B 1T9TA 4QIFA 1M5KC 2ASLA 1Q1KA 4WYLA 2FJWA 1Z2LA 5KFLA 2RQ4A 1IWGA 2AP6A 4OI2A 2BE2A 2FQQB 3M2RB 2XSFA 5IWAJ 1J5EJ 3MMAA 1MU2B 5D4OA 1VBZA 2VC0A 1K47A 4FKXA 1X4DA 1B7FA 1D9AA 2XGPA 1HPZB 2FJBB 2J9CA 3F44A 4F8RA 3FVYA 3M1VB 4R0EA 2GFFA 2JC0A 2CA9A 2DIVA 3ILJA 2LQ9A 4O3QA 3HVTA 1U1MA 2HW3A 4XDCA 3IRWP 5HBMA 1FA0A 4H4OA 1EP4A 2AQ4A 3IBWA 4BLGA 5J2NB 4C3LA 1U24A 5F8IA 5HP1A 4J9MA 2N4CA 1YKWA 4OYZA 5HSPA 4HH1A 3CJQA 4K7QA 4J9QA 4P10A 3DI6B 1FJ7A 5A8RA 4JI5F 2AD9A 1HR0J 4GVLA 2DH9A 5T41A 2RILA 4ZPVR 1X4GA 4ICLA 3V5RA 1ITPA 3OHAA 4KB7A 4FS2A 4PEOA 1W2BR 3C6TB 3W64A 5KT2A 2AJ2A 1KEKA 2DGUA 2XO6A 1UVIA 2DXEA 3W62A 3KHRA 3OTCA 2XS2A 3K58A 4B9LA 2V2VA 2E1PA 5D4NA 3LWMA 3NWRA 2P9EA 3DLGA 2MZ1A 2LCWA 2LXUA 3BBCA 2DHGA 3I5CA 3UDCA 4DX8H 2A3JA 3N6NA 1S6PA 1WC5A 4NLPA 3BN4A 1N36J 2E5LF 4N47A 1WKJA 2NR0A 1RSCA 5L8RC 2UXDJ 1H38A 2HQCA 1RQ0A 3MR7A 5E0OA 3BKTA 1S9EB 2NUUG 4DF8A 4LF5J 3Q2TC 1SV5B 1PYOB 3PRVA 4YDDB 2OELA 4IG3B 4MIAA 4PR6A 3GIKA 1ZAWA 4RL1A 2J8AA 1ZBTA 2HKEA 2B51A 2OMLA 1M0SA 1FX4A 2HFSA 1UWBA 4YR0A 1Q53A 5CCLA 4DN9A 1L5UA 4L3KA 2HNYB 2J0QD 1TFYA 2B4PA 3D66A 3MM8B 2F9JA 4TY9A 1PC4A 3W8PA 2DR6A 3LP2B 3ZTRA 1GMWA 4DR7F 2CYYA 3R8YA 1UPMB 1WOSA 1WORA 3N9UC 4YS2A 3MEKA 4MIBA 1ZM4A 4RUCA 2VKRA 3V4IA 3LP0B 2DXFA 3CJ0A 5A8WB 1RCOB 2HHHF 1S7HA 1RAOA 5M2PA 1OYDA 1IBMJ 2UUBJ 3HULA 1T7PA 3DLHA 2E5GA 1CG2A 3AA8A 4PQUB 4TXSA 2J6UA 2XZDB 4Q2MA 2UP1A 1S0VA 4XPCA 2VU5A 4K4UA 3GJTB 2QRRA 4Y34A 1RT3B 3H20A 2NXNA 1JLQB 2NXEA 2VJUA 1LKZA 1RT2B 1JLCB 3OVAA 1GXUA 3DRPB 4IFYB 4J9VA 2AZ1A 1XWLA 5B7WA 2ZOFA 1YBAA 3SQOP 2ZJRQ 1QSYA 4RW6A 1VISA 1N5YA 3VGSA 2M9KA 5D77A 2R2SA 2W25A 2RJZA 2HVIA 1RT4B 3AQOA 2ZUAA
chains in the Genus database with same CATH topology
3SV4A 3OW2R 1HYSB 1ZTTA 3OVBA 2ZE2A 1Q81T 4B3SF 4ECZA 4DS4A 5CXTA 2FB0A 5MAOA 2R2UA 4M1KA 2MSTA 4ILMA 4P6QA 3CMAS 4AYBD 1PILA 5L1LA 1N48A 1IBKF 2ROPA 2JWNA 1LXJA 2OFHX 3MR6A 3CDUA 2EKYA 3G8QA 4H54A 2OPPB 2VPZB 1I6JA 2CKWA 3KLFB 1UJ5A 3PIOQ 4OX9F 4PXBA 5F8GA 3DLLQ 3LW5C 2X1AA 2LEAA 5C42B 4PPZA 4YUDA 4J9LA 3MPVA 3JB9k 2G13A 4OLPA 2DVIA 1JMTA 4WE1B 4ZVEA 1OIAA 1FXDA 2WB4A 4X4UA 4KO0B 3O8WA 2JOQA 1C0UB 1HW9A 3KTQA 3ZZUA 2IHR1 3I96A 2K7JA 3NWGA 4NX9A 2GMLA 4K59A 4KSEB 4LJMA 4AE5A 4F3MA 2W9BA 4F02A 2MZQA 1IKXA 3W3SA 2X1BA 1NRKA 2OKQA 2GX8A 3UNGC 3F73A 2MQQA 1XERA 3BDEA 5GAGI 3CCSS 2ZHOA 2GQCA 2HZCA 2RRAA 2HFZA 2E1MC 1JLFA 1U8SA 2O66A 4D3HA 4B3TF 2AGOA 1Q4RA 3DLKB 3KLFA 4IH7A 3EUNA 3CPWR 4RLEA 2IFXA 2DR7A 3OTDA 1VIOA 5DETA 4EO6A 2AYMA 4P2SA 4WYWA 4ES3A 1IBLF 4B3OB 2RUGA 2I9SA 3AQPA 2GMHA 2CQGA 1DTTB 4KT0C 5KOWA 4ZLPA 2KZMA 2DD8S 2ZH1A 5HLFA 2DT9A 4DLGA 3BF4A 4WU2A 5GAGU 2F3JA 2C2RA 4R0JA 3HPOA 1U25A 3C46A 3H8YA 4IH6A 1FJGF 3SSSA 2FVPA 2VA3A 4WF9Q 1WHXA 4NLRA 4UQGA 2HQIA 1Y5IB 3KYLA 4PXEA 4CQ1A 1N88A 4UW2A 2CPDA 4JUZA 3RRHA 2ZH2A 2ASYA 2DNQA 4KFBB 4IRKA 3BQ0A 4F3QA 3FGVA 2DGQA 3C66A 3CUNA 2OFGX 1JB0C 4GC6A 4Q8FA 3R27A 3GQCA 4ERDA 3K5MA 1FTCA 2E1RA 2HNZA 2P9GA 1KQFB 4ECUA 4N56A 3RAQA 1M5SA 3UCUP 2G4BA 3CULA 2GIQA 2B6AA 2Y0SD 3CJ5A 3TP2A 1LW2A 5DDQC 3RAXA 2MKSA 2MY8A 3NAIA 1R8CA 2Y1RI 5DG9A 3O6QA 2YQ3A 4A8FA 3MPYA 1DTTA 3GG1A 2R7UA 4M5DB 3BGUA 1NJZA 1ZETA 1M1KT 2FHOB 5B0BA 3DOKA 1HFEL 4QOTA 2DPJA 1VQKS 1TVRB 1XMBA 4FZVA 1D8YA 2EVZA 3QJLA 1NEEA 3HZEA 3N6LA 3G6ES 4OHZA 4PG8A 2ZHAA 3ZZTA 5F8HA 3MEDA 3NGDA 5A8KA 3D1QA 3MM5A 3G6XA 4QJVA 2PIIA 4DV5F 4PXDA 2PGCA 1YG0A 2B4UA 1BY9A 3M30A 2O5DA 1MWZA 1C2PA 2HNZB 4CCHA 2BJDA 1RTIA 4ECVA 1U49A 4FXWA 5EWEA 3CCLS 4QU6A 3HP6A 5B09A 2EFGA 4KGMA 2J0SD 4RUHA 4PUOA 4WE1A 4DSEA 2M8DB 2YX4A 2AGPA 2POKA 3CJKB 3SCKE 4L6V3 2B4OA 2Y1IA 1O8BA 3HHLC 3SFGA 4DV3F 4OHYA 4C4WA 2BDPA 5IZHA 3KLVA 4MMOA 1R0AB 1S9GA 3M6WA 1T05B 2KXFA 3BGLA 4E0DA 4C97A 1N5QA 3VAFA 5HMXA 3DI6A 4Y0FA 4QIEA 1VBYA 1G6BA 2MYFA 3GWCA 5KFVA 5B08A 1TK5A 2UVWA 2AF6A 4CTAA 1YWXA 4TQRA 5F8NA 2YTCA 3IS9A 4CNZA 2AX0A 3OBIA 4F4ZA 2VA2A 1S1TA 2VFSA 3T19A 4B3RF 1IKXB 3MURP 3F41A 5AXLA 1VJWA 3DHWC 3OFEA 3UCZP 3KLGA 3EPGA 5J2NA 2KT5A 3MOJB 2L41A 1TKXB 2MKCA 3RAMA 6FD1A 3I32A 2RT3A 2R7SA 3PJWA 1MSWD 2WONB 1HMVA 4J37A 4DHVA 1VLYA 1FESA 2BRLA 4NOHA 3EZ5A 3I9ZA 4U9RA 1XC9A 3JTPA 2GMJA 1BWEA 3V6DA 5I3QA 1V9OA 5THWA 3G4SS 4B02A 2XGQA 1KN6A 1OQ3A 4YDXA 2DR9A 1GXLA 1DURA 2GIRA 2XHWA 4YEAA 4FXVA 4WZQA 2DCLA 2K1RA 4IOCQ 1HWUA 5F0WA 2UUWA 5B0AA 4NPOA 4QQBA 1IUJA 4QIGA 4IOAQ 1SH0A 2ZC3A 1E6YB 1M5PC 2KYZA 2DB1A 3GR1A 3L95X 3PHEA 4OX8A 2RQCA 1ZH5A 2MGZA 1RT5B 4PWDB 2CPEA 5A0YA 4CO4A 5A6PA 3PX6A 3OTEA 2HFOA 2KFNA 2ZJPQ 5CQGA 5MLCV 2PC6A 1FEHA 3GFYA 5B0DA 2CJAA 1UFWA 1NO8A 2NUHA 4WFBQ 1N0VC 1X4AA 5BYQA 3M4XA 2D7SA 2LU2A 2MJNA 3WC0A 5DQHA 1N4LA 3HMJG 2ZH4A 2UUCF 4QWAA 3DLEB 3HXMA 2WTFA 1DQAA 3KWMA 1FRMA 2VZ9A 4QPTA 3QAEA 1N6QB 2UV8A 1V3ZA 1LQ9A 2FHKA 1JKHB 1R3NA 3FSYA 1NK5A 1XR6A 3GE9A 3TAMB 5DLGA 3MM5B 1YIJS 4IDKA 1VRTB 3D0HE 2QYCA 5SUHA 4PUOB 5KG0A 4AXIA 1JLQA 3VQSA 3IR5B 3FJ2A 1DLOA 4ID5A 3PIPQ 1Q8BA 4EBEA 5JXSA 4HTIA 1YJNS 4Q0BB 4UY8T 4PCQA 2VBZA 1DBDA 3KLHA 3R1HA 1AUDA 5F8LA 4B9TA 1HBMA 2ZH3A 2IJNA 3FEXB 3N79A 1U1NA 4FYDA 2M88A 4R5PB 3G6VA 4IQXA 1GH8A 2J0WA 1XMQF 2BABA 1ZAVA 4JI1F 1C1CB 2VONA 5DM7Q 1JLEB 1VRUA 4X66F 4MFBB 4RWWA 3Q23A 5GAHU 1S1TB 2VB6A 4PG4A 4P7VA 1C0TA 1H2TZ 3DRRB 2VPXB 5J2PB 1U2RA 3JSMA 3FQKA 1W25A 3N5FA 2EPIA 3V4IB 4JYAF 1D3WA 4DWIA 1DZ5A 2L48A 1VRTA 4HVZA 3H2LA 3I4HX 3PDNA 4JI4F 1L3VA 1YVFA 3HVWA 3ZZRA 2HMIB 3CF5Q 1HNWF 3SEOA 4Q0BA 2GHVC 1S1XB 2G0CA 4RBVA 1PSDA 3CT9A 3MMBA 2V5HG 3RTVA 1U1LA 1SJFA 1KFSA 4IG0A 2AU0A 3RR7A 5U47A 3PXGa 4FF1A 2HYIB 3PW7A 2BYCA 3V4MA 1W2IA 3P5TL 2OD6A 2R9LA 2XY6A 2KTQA 1D1UA 5KOXA 1VQ5S 2V4QA 3IWNC 4BDPA 4ECXA 3D0IE 4AL6A 4HYKA 2B7BB 5EWFA 5DGBA 3C2PA 2DGOA 1FNMA 2V94A 4X4NA 4A8KA 5JVGQ 3NCQA 3PACA 3TR5A 4NA3A 2BACA 3CB4A 3OFHA 1ZTWA 2BM0A 1BLUA 2KYXA 3K5NA 4WXOA 1N5TA 3UR0A 1LOUA 2F8MA 4Y2CA 4J5OA 3OR2A 2KM8B 1DTQB 1HQEA 1SKSA 2MGZB 4TYBA 1NHVA 4NLTA 5B0FA 3C6UA 1S48A 1WEYA 4LFCF 1TAUA 3BQ2A 3FRYA 4BS2A 1X0FA 2HHTA 3SXLA 2MXYA 2CQCA 4WFZA 4DSFA 3G9CA 4YB7A 4HI1A 1DRZA 4EZ6A 5JJBA 1HARA 1B0VA 2APOA 5E5NA 3VAHA 4PG5A 2RB7A 1TP7A 2I8EA 3GFHA 3T6JA 5F9LA 1WTFA 4ID8A 1R43A 2KH9A 1YTYA 2VQFF 4XDDA 4WKYA 3S01A 5I3UA 2CPJA 1UW4A 3DM2B 2DHAA 1FE4A 3VF0B 4AXJA 4DL2A 1WEXA 2RF2B 4Q45A 5IFMA 4B9UA 4DQQA 3SMZA 1FK9B 1S99A 3PM9A 4N41A 3DYAA 3I6PA 4MYTA 4IR9A 3I0SA 4C0HA 2E9TA 3I5BA 5KG1A 4EGLA 2PDAA 3KHHA 1T94A 3VALA 2MDAA 2IRXA 3BSCA 3TYTA 2DK2A 2W4CA 3IC1A 2VD3A 3TW0A 2W4PA 1LWEA 3Q8PB 2EFOA