4LMZA

Structural insight into rna recognition by rrm1+2 domain of human etr-3 protein
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
176
structure length
176
Chain Sequence
b'DPDAIKMFVGQIPRSWSEKELKELFEPYGAVYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHPIQMKPADSEKSNAVEDRKLFIGMVSKKCNENDIRVMFSPFGQIEECRILRGPDGLSRGCAFVTFSTRAMAQNAIKAMHQSQTMEGCSSPIVVKFAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA (5'-R(*GP*CP*UP*GP*CP*GP*UP*AP*UP*UP*GP*UP*UP*UP*G)-3')
publication title sequence specific RNA recognition of ETR3 RRM 1-2 domains
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 40
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2013-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lmzA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lmzA02
1OIAA 2CPJA 2G0CA 1XN9A 2M88A 3ZZZA 2CQ3A 5DDRC 2N3LA 1WELA 2M0GB 3UCZP 1DBDA 2FC8A 1WHVA 2MQMA 3P6YC 2M8DB 2I2YA 3MUMP 2RT3A 3CCSS 2PEHA 3IRWP 2DNNA 2KYXA 3SMZA 2MZRA 3THPA 4Y0FA 4ZKAA 2MB0B 3DXBA 2HGMA 2OTJS 2UP1A 1M5PC 2KG0A 1DZ5A 1SJ4P 2RVJA 5D77A 3CC4S 2HZCA 3S7RA 3CCES 3CCUS 3CCMS 2M2BA 1WWHA 1YITS 2RUGA 2MPUA 2AYBA 2J8AA 3TYTA 3UCUP 1SXLA 1X4EA 4CIOA 3S01A 1VC0A 1VQNS 2LXUA 4FXWA 1U1RA 2GHPA 2JWNA 2LMIA 2DGSA 2DNMA 2FC9A 1X5PA 2VOOA 4PKDB 3G8TA 2KG1A 2E5IA 2N82B 5LXRA 2E5HA 1OPIA 3MXHP 5LXYA 4CQ1A 2M70A 3VF0B 2DNLA 2DH8A 3FEXB 2DNPA 2JRSA 2HGLA 3B4DA 2AYEA 1VQOS 3DLLQ 2KHCA 2DGVA 1KOOA 2AYMA 3G96A 1DHMA 3NS5A 2MQPA 2KFYA 2F9JA 1M5OC 5EN1A 4YB1P 2XS5A 4EGLA 2CPYA 2CQDA 2DHXA 3PIOQ 4ERDA 2OSQA 2RQ4A 5GVQA 3UCGA 2BZ2A 2A3JA 2RRBA 1OO0B 2AD9A 1HD1A 2DK2A 4LMZA 2WBRA 1KOHA 2L41A 2LECA 1U1PA 2D9PA 2G4BA 3CCRS 2MKSA 2N7CA 5LJ5Y 1K9MT 4IOCQ 3BEGB 4WIIA 3Q2TC 1HD0A 2MKCA 3HI9A 2MY8A 1X4GA 2CQ4A 1Q81T 4WFAQ 1AUDA 3MUVP 3CPWR 3UE2A 2K8GA 1H6KX 4PR6A 1NO8A 1VQMS 4PRFA 4WKRA 1HA1A 1QVFR 1RK8A 5DDPC 2D3OR 2CQCA 2DO0A 5IQQA 2DNYA 3U1LA 4A8XA 4U67Q 2OIHA 4QU6A 1HL6A 1M90T 1VBXA 2YKAA 3UD4P 3PIPQ 1M5KC 1WHYA 2BOPA 4QU7A 1WEZA 5IM0B 2DNKA 2M7SA 2HVZA 2CQ2A 3S8SA 3U1MA 1S79A 2JX2A 2KXFA 1M1KT 1WI6A 3LPYA 1X4HA 2NLWA 2E44A 1KD1T 2KI2A 3CCVS 1S72S 1NJIT 3BO4A 2LYVA 3ULHA 3RW6A 3VALA 2MHNA 1FT8A 2KN4A 1U1OA 2MZJA 3MDFA 1D9AA 1VQ8S 2GO9A 2MSSA 1YHQS 1UAWA 2KM8B 4ED5A 1X5TA 2CQHA 1H2TZ 3LQVA 2CQ1A 2EK6A 1VC6A 1UP1A 4LIRA 1Q86T 1CVJA 1YJWS 1WHWA 2JVOA 1W2BR 1R8PA 3B4MA 3MD3A 1N54B 2RU3A 2F9DA 3VAHA 1K8AT 5DDQC 5ITHA 1WG5A 4P6QA 2DGXA 2MXYA 4WCEQ 2YH0A 1P1TA 3D2WA 5JVGQ 3VAIA 2CQBA 4F26A 4QQBA 3BO2A 3R1HA 1VQ4S 3NMRA 2K3KA 1YTYA 2MKJA 3L3CA 3EX7B 2DISA 5CA5A 1VQ5S 2DITA 1WG1A 1U1NA 2J76E 4F25A 4WF9Q 5DDOC 2X1FA 3CTRA 2MQNA 1KC8T 1U1QA 2MQQA 4CH1A 2PE8A 1G2EA 1X4FA 1X4AA 2ZJQQ 1FJEB 2YH1A 2CPXA 4IUFA 1FJCA 2MGZA 4W90B 2U2FA 1DRZA 1PO6A 2QA4S 3VAJA 4W92B 5BJRA 4TU8A 2ERRA 4TLQA 2DGWA 3CCQS 4WFBQ 1SJFA 4OZ1A 1VBZA 2KXHA 3V4MA 3G9CA 3G71S 5GMKa 4FXVA 3MOJB 1JJHA 5IM0A 2G1DA 2O3DA 3G4SS 2MYFA 2KVIA 2KH9A 2CQ0A 5H1SV 2CJKA 2MSTA 4OZ0A 1Q7YT 3CULA 1WHXA 3P3DA 1VBYA 5LSOA 2QFJA 2M8HA 1IQTA 1X5SA 1FO1A 2Q79A 1VQPS 1M5VC 5D78A 2DHGA 2EVZA 5CYJA 3CMES 2OTLS 5FJ4A 5HL7Q 3NNAA 2E5GA 3TO8A 2F3JA 2XS2A 3BO3A 2MQOA 2LXIA 4CH0S 2RS8A 1X4DA 3H2VE 1JJ4A 1ZH5A 3S6EA 3SDEB 1U6FA 2DNRA 2ADBA 3JB9k 1U1MA 2I38A 3ZZYA 2XB2D 5LJ3Y 5GAHU 3MD1A 2KRRA 1JMTA 4UQTA 3VAKA 2X1AA 2LCWA 4RU2A 3FEYB 2CPHA 3N9UC 2CQIA 3CMAS 2LA4A 2DHAA 2FHOB 4M5DB 2SXLA 2B0GA 3CCJS 2MZTA 5MLCV 1OWXA 1R8HA 1X4CA 1NU4A 2KU7A 2OSRA 4WFNQ 2QEXS 1WF1A 5LSLA 2DGQA 5IFMA 4J5OA 1X5OA 1WTBA 2DIUA 1H2VZ 1N88A 1O0PA 1WEXA 3CC2S 2FY1A 1N8RT 1U6BA 2M52A 4TU7A 1VQ7S 1VQ6S 2DNOA 1ZZNA 2AYGA 1WF0A 5GAGU 4IOAQ 3CXCR 4YUDA 4LJMA 2LEAA 2CPFA 3I56S 1YWXA 2DIVA 2RQCA 4C7QA 1WG4A 4V19X 3K0JA 4UY8T 1YJ9S 1A7GE 1WF2A 1F9FA 4TU9A 3I55S 2HGNA 3H2UB 2M9KA 5DM6Q 2CQPA 1VQ9S 2MKKA 2V94A 2EK1A 4C0OC 4QPTA 2DGOA 3OW2R 4F02A 2DNZA 3G6ES 2DNHA 2CPIA 3MI7X 2VOPA 2MQLA 4Y00A 2XNRA 3SXLA 2CQGA 2MKHA 2U1AA 1PGZA 2DNQA 1X0FA 1YI2S 2MMYA 1QM9A 1D8ZA 3J7ZT 3VAGA 2MZ1A 1FHTA 2MJNA 3THTA 2M4MA 3EGNA 2KXNB 1VQLS 4YOEA 1ZZFA 2D9OA 4C4WA 2MJUA 2ZJPQ 2XNQA 2LKZA 1P27B 3SDEA 3MURP 3NNHA 1L3KA 1URNA 1YIJS 1K73T 1SJRA 1X4BA 4BS2A 3R1LA 1SJQA 3NNCA 1H2UX 2JVRA 3NS6A 2ZJRQ 3CCLS 1UFWA 1U2FA 1A9NB 2DGTA 1QVGR 1WEYA 3J7YU 2KM8C 3IWNC 2DNGA 2OJ3A 1RKJA 1Q82T 2X1BA 2J0QD 4Z2XA 2KT5A 3US5A 2KRBA 1VQKS 1WI8A 1U1KA 2LQ5A 2XSFA 3BS9A 3TP2A 1SJ3P 2VODA 2DH7A 3R27A 3UD3P 2DGUA 2MZQA 1U1LA 1B7FA 1KQSR 1UW4A 2MZSA 3UWTA 2DO4A 2RRAA 2DHSA 2CPDA 4IO9Q 5GAEU 1VC5A 5GADU 3HHNB 3VAFA 2J0SD 2CPZA 2CPEA 3CF5Q 3P49B 3Q2SC 3EGZA 3RW7A 2DB1A 1N52B 2L9WA 3MUTP 3VAMA 2YTCA 2X1GA 2L08A 2YWKA 3P5TL 5CXTA 1FXLA 5HO4A 5DM7Q 2RNEA 2FPHX 3CC7S 2MGZB 3G8SA 2NZ4A 2XS7A 2LEBA 1FJ7A 2ADCA 1FNXH 1YJNS 2E5JA 2MY7A 5DETA 1BY9A 5JVHQ 3CUNA 2RS2A 2MKIA 2VONA 1JJ2R 2N3OA 2HYIB 2LA6A 2DH9A 3CD6S
chains in the Genus database with same CATH superfamily
1YLXA 2HVDA 3UN2A 3CE8A 3H25A 1IKVA 2V2QA 1RKIA 4MKAA 2XLKA 3T9ZA 2FJVA 2M8DB 2I2YA 1T94A 2KYXA 4NL5A 4MKVA 4IDKB 4LIWA 1KVKA 2C2NA 2KG0A 3MCMA 2KTQA 2B5JB 3R97A 4CNZA 3GLJA 4XPCA 4M5HA 3D0HE 1SXLA 4J37A 3GJRB 1U0SA 3ZO7A 1Q0NA 4KHPJ 2HFSA 2RH3A 1RTDA 3HJVA 2WVCA 4ZLPA 1AT1B 4XK8C 2AIRB 2E9RX 2ROGA 1FNOA 4I2PB 3PYDA 5A6WA 4E0DA 2HHHF 2ZNZA 2V9WA 3LAMA 1FE0A 3PRBA 4F4XA 3JS9A 3P45B 4ECXA 2C3YA 4QOTA 4IG3A 3D5MA 3DMJB 3PO4A 1D3WA 4YR3A 4C3MA 2E66A 4HT7A 1N36F 1NK7A 2G1HA 4AYBD 2V8PA 2F40A 5F3ZA 4PRFA 1YX2A 3OTBA 3UR0A 1NH7A 1KLMB 4DR3F 1RLDA 2K1RB 4R8UA 4GC7A 4DSEA 2RMLA 1D9FA 2V34A 1N5TA 3PFOA 3CD7A 2VASA 1JIHA 3BO4A 1QAJA 4KE5A 1YJRA 2KN4A 3SI8A 2LVWA 3D9BA 1GMUA 3U1NA 1D0EA 5HANA 1MMNA 1SC6A 2CQHA 1LW2A 4OX7A 1CSJA 1UP1A 4C48A 4EWTA 1NDCA 1CVJA 1YJWS 4B9SA 3BGRA 3MD3A 1N54B 3VAHA 2YXLA 1Y7PA 3RRHA 3JAMU 3NLCA 4JYAF 3RBZA 3SCLE 4PQAA 1HLWA 4DL4A 2YKQA 1RAGB 1P9QC 4Y3CA 3H5SA 2W24A 1CJUA 4L72B 2GVDB 3GR0A 4NCAA 1QE1B 4BDPA 1KHWA 4X4PA 3JSMA 2OKQA 1IQZA 2ERRA 4DQIA 1SKWA 1SJFA 4A47A 4OZ1A 1UPPA 3MOJB 1GTEA 4OZJA 3VWSA 3V81B 4OL8A 3HHLB 5KFCA 3IS9A 2R7VA 1UVMA 2EVZA 3LP0B 9RUBA 1JK9B 1VMBA 1SQEA 2XYPB 1GMWA 1S6UA 3PYEA 3SSQA 1TL4A 2DNRA 3BPDA 3K5PA 1N34F 5DQIA 1QDUB 4O3PA 3VAKA 2OD4A 1EIYB 3FEYB 3IAM9 3N9UC 1R0BG 4R0EA 3C16A 4M5DB 4Q5VA 5D0EA 1S1WA 5MLCV 1LK5A 2ZFHA 5LSLA 1X5OA 4KC5A 1RWPB 4BWJA 4RWXA 3P4UB 5J2QA 2WSCC 5DGBA 5C42B 3D1QA 3C8YA 4PZVA 4IOAQ 2B9EA 5ETNA 4P74A 3I56S 1JXLA 1YWXA 1QSSA 4CNYA 4ID5A 4OYZA 3WHIA 4UOHA 1HBOB 4LQ3A 2J6SA 3RB0A 2V4JA 1IM6A 4WTYA 3TA1A 2W8KA 4UOGA 4TYAA 2F4FA 2DGOA 4A4JA 2IDEA 1HBUA 1S99A 4NYPA 1XMBA 2OAUA 2KDOA 3UDEA 2VPWB 1NHKL 1LWFA 1HMVA 2XBPA 2RQKA 1U25A 2J9DE 1FA0A 1K73T 3C46A 2C2EA 3HVAA 1SJQA 1F9HA 4TN2A 2WK4A 1BWVA 4A8FA 1BLUA 2EFNA 1RKJA 4ECRA 2QE5A 2AZ1A 1KQSR 3UWTA 1FK9A 2XI2A 3KK1B 5EDWA 1X9SA 1IBMF 4C8MA 3KK2A 2DTJA 2XYGB 1HHSA 3GJTB 2OO4A 4ECYA 4JI5F 2AGQA 2FPHX 1XERA 2A1BA 4CLZA 4M5IA 1YDLA 1AXQA 1JX4A 3QAUA 2VF3A 1KFDA 4ZP7A 4NLQA 4ZLNA 3PACA 1RT1A 2HZVA 2XZDB 3A4TA 2Y3YA 4DUZF 1SKSA 5HI7A 1UEUA 4OI1A 4DSLA 3CO0P 2PA8D 3CCSS 4HYKA 2DNNA 1KDNA 4AL7A 2DY1A 3OV7A 1FF2A 1NBEB 1HWLA 3T19A 1T8EA 3CCUS 2AF6A 3SBMA 1VQNS 1KEKA 1T9YA 3PO5A 2DNMA 2QIFA 4Q8EA 1JWWA 3BGLA 1RXOB 1WC6A 4PABA 3D54A 4DPWA 3W8GA 1S7HA 4DR2F 2DGVA 2AYMA 3CEDA 2XS5A 2RSQA 3QIDA 2A2CA 4ERDA 5E5NA 2RQ4A 4ZK7M 3BJYA 2H4YB 2GHVC 1NDLA 3OR2A 4KV8A 3BGOP 4WIIA 4NXMJ 2O66A 2CNKB 3CPWR 3UE2A 3ZNJ1 1SC3B 4LF9F 4CI0B 1R8BA 4R25A 1VBKA 3MEKA 1M5KC 2HBRB 1RTIA 2HMIB 2HVZA 4C0HA 2RUSA 2QRRA 1EZZB 4RW7B 3FCWA 4NI2B 2UZAA 4EO8A 1P6TA 2V8HA 3G6XA 2Q66A 3ZZUA 4TQRA 3CJKB 3MDFA 1VQ8S 3MPYA 3HVTB 2VH7A 1RCOB 2AGOA 2V2VA 1RJJA 3OL7A 1RT6A 4FZVA 3EGVA 5A2QU 3EDRB 3M7VA 2WZ1A 4CZCA 2QL9B 1K0TA 2JNJA 3BO2A 3EZ5A 4K2JA 2HHXA 1RE1B 3VGUA 1Y5LB 3R6LB 2R2SA 3H0PA 4WF9Q 1IKVB 1S1XA 3PW5A 1HQEA 4AUKA 2OH2A 5F9NA 1XMQF 5CCLA 3EE3A 1PIEA 2V4QA 4DPUA 3POTA 5I4MA 2HZAA 4LF8J 4ZVGA 3OT9A 1RTJB 2QMXA 1VBYA 3IR5B 4KSEB 5CYJA 1SH2A 3KLFA 3ETOA 2LEPA 4ZPTR 4LBHA 2W7PA 2XMUA 1RTDB 1GXTA 2AJ4A 1RHQB 1U1MA 4NLSA 4C98A 2B8PA 4IQXA 2NS1B 3KJQB 3I31A 2EEYA 2N4CA 3CD5A 1R8HA 3SQGB 3PFEA 5E33A 5BR8J 4CYUA 4DEZA 4MFBB 2BE7D 3LWMA 2B4VA 3QT6A 4GKKJ 4LF4F 2EC0A 2YX7A 3EPIA 2HRUA 4E8UA 1YJ7A 3OLBA 1H74A 4R8UB 3H5XA 3I55S 1N33F 3IC1A 1UFLA 3Q0AA 5A0YB 2BQ3A 2E1PA 3J7ZT 3ONQA 1R27B 1Y4ZB 1HI8A 3CJQA 2JH3A 1FRHA 2MJUA 3E01A 3Q8UA 2VHGA 1M0SA 2ASYA 5IT9U 2MLXA 3AD7C 1LW2B 1OPZA 3RAXA 4K4TA 1WORA 1M5HA 3I9V9 1FJGJ 3N4WA 4O0NA 5HMWA 4DFPA 4Q43A 4ECUA 2EFPA 1L5UA 4WFZA 1QAIA 2RRAA 4KGMA 3FRYA 1T05A 1U0HB 1S10A 3P49B 1Q8IA 2MKYA 1C0TA 5KG2A 1V3RA 4JBCA 3G8SA 2A2DA 4YDXA 2OMLA 3FQKA 1K0VA 3H4BA 5HLFA 5JVHQ 1HI1A 2MKIA 4DX5A 4ETXA 2NR0A 4MT1A 1NJZA 2RQMA 2ILYA 3M9MB 5GMDA 3DLBA 3MR6A 1E6VA 2HVHA 1WHVA 4RNHA 4WYWA 4JI7F 3KJFB 4DXLA 1ZAXA 1SC4B 2LU2A 5JMNA 2ATLA 3RG6A 2HGMA 4KPYA 3CNQP 3DOLA 2Y1LB 2HQGA 3GV7B 1XEZA 2UVVA 1HBMA 4OI2A 5HBMA 2WOMA 1TV6B 2OPSB 3TUPA 4AD6A 1UZDA 1VC0A 4XTTA 5L9XA 2GHPA 2YWEA 3JSBA 2XCAA 3PNIA 1S1WB 4N47A 2OHDA 2Y1IA 5ETPA 2N7YA 1VQSA 1OPIA 2GJFA 2IJNA 2DH8A 1WKKA 2OGUA 2WONA 5SUHA 3Q8QB 3B8HA 1NM2A 4YB1P 3VQTA 3W9HA 2W2QP 3K2YA 1HYSB 3GYXB 3OL6A 4B9MA 3G8QA 4ID5B 1HD1A 3DNCA 1UTAA 3DCAA 5J1NA 2F8MA 3CCRS 5LJ5Y 1K9MT 3CW2C 2V4JB 5E3QA 1S1VB 4O3RA 3PEJA 3T6JA 1HBUB 4DSJA 4EK2A 2ZWPA 4RBVA 4XDDA 2DEIA 4X62F 3GIKA 1LWFB 4WP8A 4CLPA 3H8YA 1Y3JA 3CD0A 3UD4P 2BDPA 2POKA 2HHWA 3DC2A 1WI6A 1LXNA 3M1VA 1F5BA 2C3MA 1CS4A 2NLWA 1UVLA 2IMWP 2G2ZA 1QUPA 2V4RA 3GYNA 2HK3A 1U7LA 3VALA 4H54A 2BQUA 3T1YJ 1FK9B 5GADI 1MN9A 3Q22A 1X5TA 4NXNF 5HVHA 4DN9A 1IBKJ 1VR6A 3BSCA 1WHWA 5KG1A 4QIFA 3PR5B 3CCZA 1Z4UA 1GXUA 3W2WA 1HWKA 3TUZC 1S0VA 3EX7B 2XLJA 4FVCA 2GS8A 4WK1A 2NXUA 3LP1A 1BXNA 3ICLA 3G2XA 5DDOC 1P1LA 3MEDB 2ZOGA 1FJEB 2YH1A 1RI7A 2FUG9 4W90B 2PI5A 1SQGA 3NGRA 4F50A 1B0PA 4IFVA 3ZZ0A 3PX0A 3DKDA 1FKAF 3IM9A 2KVIA 1SI9A 4DFMA 2NSBA 4ELVA 4B3MF 1I3OB 2M8HA 1IQTA 1JKHA 1VQPS 1M5VC 3K8WA 5L46A 4GKJF 4JI2F 3IM8A 4E98A 5HSPA 4GMKA 2D3ZA 2CJ9A 2I38A 3J81U 2KRRA 3TEGA 1Q5YA 3W7BA 5C7PA 4CM0A 2ZD1A 5ETTA 3OR2B 2ZH2A 3QFWA 3I0SB 2YPZA 1H2VZ 4ZN3A 3CC2S 1N8RT 1FRIA 3NL0A 3EDQB 3FSIA 4C3LA 5D15A 2EW9A 1H3DA 2JSXA 3A3OB 2LQ9A 4U8VA 3OLAA 1B4SA 1EP4A 1FFGB 4CO4A 4UY8T 1WD6A 1YJ9S 3MAHA 4YEAA 2WSFC 3MR3A 4DQQA 2IHR1 2FVSA 4B9NA 2QMWA 4ZCKA 2G2OA 2QLJB 1B70B 3MI7X 5IWAJ 4NX9A 3Q23A 1X0FA 1AFIA 1NZ8A 2JLGA 5DG9A 2ZUGA 3PY8A 1BQMA 2QT7A 5BYSA 4DCPB 3IFEA 5FDLB 2C2OB 2GGPA 3MURP 3ZTQA 2FLPA 2UXCJ 2FJXA 1H2UX 1RT6B 1RHUB 1QVGR 3IWNC 1Q82T 2C3PA 1GX6A 3H59A 4YY3F 3KHGA 1U1LA 3AJDA 4HT5A 2BR0A 5HROA 4WZMA 1S1XB 1HQEB 2V50A 1Z2LA 4RL1A 2ZH6A 2HQDA 3KG0A 4FS1A 1IKWB 3CUNA 1UVNA 4USVA 2B9WA 2DH9A 3LOUA 3BR9A 5DLFA 4KO0A 4P2SA 4JB8B 3CDEA 1S6QA 2R2TA 2QLWA 3EICA 2HFVA 1IKYB 3TVZA 1BGXT 1O8BA 4BC7A 3T9NA 3KLFB 2EPIA 4DR6J 3VV2B 1U8WA 4ZKAA 2BX6A 2NUUG 2OTJS 3P8BB 5ETQA 1S6PA 2RVJA 1HBNA 1VFJA 5F8LA 3S7RA 4C8KA 4CRJA 2D41A 5FLXY 4KQZA 3QIPB 3UCUP 4M8LA 3WDOA 1JJCB 3BBCA 1KHVA 1VQYA 2DGSA 3LUYA 2RIJA 2KJWA 2W9CB 2E5HA 3MCOA 4TXSA 3MXHP 5LXYA 3M8SA 4LF6F 1XQIA 4CYUB 5DQGA 1AROP 1TFWA 4TQSA 3SYZA 4JI1F 3KLIB 3UCGA 3PJWA 2RRBA 3RBXA 1RWKB 4ZVTB 2FLNA 4OI3A 3CDWA 1G7CB 5F8JA 1BQXA 2W25A 4DX6A 1AUDA 2R7SA 3Q8VA 3HX9A 1VQMS 3HFZB 4WKRA 3L4BC 4A8XA 4U67Q 2O67A 1N32F 4ED2A 4OZ2A 2AQ4A 2W2PP 2J5AA 3S8SA 3U1MA 1D8YA 5C2CA 5H9EJ 2EG1A 1DQ8A 2KI2A 3B6BA 1X9MA 4H4OA 5KFGA 1YRXA 2PDAA 5DO2A 2P9EA 2CJQA 1T3NA 2OUGA 1D9AA 1NJXA 1UVJA 2UUBF 3BH7B 2J9EA 1HNVA 1H73A 4USWA 4NRUA 4P9SA 1WUUA 2HPUA 3EVMA 4F26A 4LVOP 5HLFB 3ADAC 2VB6A 4EFAC 2BM0A 3GFXA 3I4PA 2B9YA 2H9ZA 2E1AA 1M5SA 1FD8A 2MQNA 1E6VB 2DR8A 4KGXB 2KFNA 4PYDA 4NMXA 4FYVB 3HHDA 3M2VB 4IUFA 1J5EJ 2RHSB 4O44A 3RB4A 4WXOA 3CCQS 1VBZA 2WW4A 3G9CA 5KFMA 4ZJLA 3KHRA 2O3DA 1J5OB 3DOLB 4LSLA 3KNAA 4L3KA 3QJPA 4QYRA 2WOMB 2DXDA 1HNZF 1WHXA 3FUYA 4EBCA 3TUIC 5CYQA 2OTLS 3HKZD 3KJNB 4PWWA 4B17A 3BO3A 4NWBA 4CH0S 4ED3A 3CT9A 1FD2A 1NPKA 2BKOA 4OV6A 2WONB 5LJ3Y 3OR1A 5G0RA 1ITPA 1JMTA 5B0AA 4MIWA 1CQNA 5A76A 3GV5B 2KZZA 1WC5A 4CH7A 3HCXA 1EQ0A 4N8OA 1FESA 1PJ7A 1RWMB 3PTWA 4X2BA 3AHPA 5I42A 1YZ7A 3PW7A 2AEJA 1XBWA 5E3AA 2B9XA 5K8PA 3O6QA 2DNOA 2YX4A 1WF0A 2H5JB 3C6TB 4AXJA 1LKZA 2LEAA 3O8WA 2F63A 1JLGB 2BMBA 1XC9A 3GONA 2XGQA 2HGNA 1VQ9S 2V94A 4H4MA 4QPTA 5KFJA 4X65F 3M1VB 2GV1A 4W98A 2XO6A 1KVIA 1FHTA 2M4MA 2AX0A 2DEJA 2RJZA 3CIZA 3RJMB 4KH0B 5J2PA 3WC0A 4RW4A 1P8GA 4NEYA 3FEZA 3BKFA 3DLHA 2JHEA 2BW7A 3R5GA 4C11B 4ZVQB 2MDAA 1JQGA 1HNWF 2JVRA 1S1TB 2H51B 3TOQA 4DR5J 1R31A 4ZN1A 4J9OA 1DTTA 3BGFA 2OJ3A 5B08A 2KT5A 3R3TA 3US5A 2FVCA 2C42A 3W2WB 2HHSA 3QWPA 2FJWA 2DHSA 3UNYA 2J7KA 4M5MA 2QA1A 3LP1B 5KFIA 2PFDA 4DUTA 4U7UK 2ASDA 2VBWA 3IWXA 1ZBTA 2D3O1 5LM7E 5DM7Q 3CC7S 5DZ6A 5F8IA 2LEBA 4DV1F 2ZM6F 2DKOB 4IFVB 3F73A 3CJ4A 2ACYA 3UN5A 2HIYA 5EWGA 1JJ2R 1Z1ZA 1YJTA 3ZZZA 3BSOA 1WELA 2M0GB 2C3UA 3ET6A 1U24A 2BE9B 5EX3A 1UWBB 3IRWP 3M8PA 2RILA 1FERA 2PMZD 3PM9A 2Y1RI 1EKRA 2DYAA 4V1Ak 2CDRB 2O01C 2ZDOA 3B54A 4AT1B 3HSDA 4Q2LA 1IWGA 2P2CB 4H4KA 1MN7A 5T14A 3DLEA 1X4EA 4RW8A 1BQNA 2FC9A 2QA4G 4PKDB 2ZD1B 5KFVA 1REGX 3O5TB 4IH5A 1Y5NB 4R5PA 2Z0GA 2CZ4A 3VF0B 1W2IA 1FE4A 1DQ9A 4KHMA 3FRZA 2RU9A 5EN1A 2XWYA 5GVQA 4OIXA 4I67A 4RW6A 2NXJA 1EP4B 3PKMA 4JI6J 4A8QA 2WBRA 3BEGB 2DPJA 4EEYA 3VQSA 2MKCA 4Y2IA 2CQ4A 3C2PA 2RHQB 5LMUJ 1AZSA 3MR7A 3OUYB 3FBCA 3M9OB 3MF5A 3WC2A 1TZ0A 2BQRA 4ED8A 3IGVA 1T7PA 3U1LA 3Q8RB 2GGPB 3GFHA 2ZKUA 4Q2MA 5EWEA 1RYRA 4F4AA 1RWXB 2KXFA 1F3FA 2VQFJ 3TA0A 4B02A 1KD1T 1DQAA 1S72S 3KTQA 4K4XA 1JLAA 2LYVA 3ULHA 2MHNA 4U8YA 1RACB 5HROB 3DYAB 4JI3F 2ZHOA 4JV5J 2FTRA 2VQEF 2W7AA 3B4MA 1APSA 2MEWA 2RU3A 2CA9A 1QAXA 2V8GA 2Q43A 3HSGA 1RT3A 1VRUA 2MXYA 4WCEQ 1OSDA 1VCTA 4QQBA 2R8JA 1EB0A 1HQUA 1U6ZA 2DISA 4YQWA 2NPFA 1ZTWA 1HWIA 1HQ2A 4G1PA 4NZ0A 1PJ5A 1KQGB 4ZLLA 2PIIA 2V69A 1S6QB 3C6UA 3RR8A 2XGPA 2MGZA 2QA4S 2VJVA 4LFBF 1IVZA 4K4WA 4PG8A 2PMHA 3OTOJ 2FJBB 1LWEA 1JJHA 2G9OA 1S6PB 1HBNB 2MLYA 3QT7A 5EGYA 1K1SA 5HP1A 1GFWB 1Q8BA 4C8OA 3P3DA 4FF2A 1JXEA 1XWLA 1JNZB 3ISND 2ZC4A 2HVEA 3TI0A 3TO8A 3V6DB 2FDNA 5LSRA 1G4CA 3GE9A 3M8RA 6AT1B 5KT2A 3R9LA 2ADBA 3MFHA 1IBLF 2RDDA 4YN3B 4IR9A 3Q86A 4LR7A 1LQ9A 1TMMA 3T1HF 3JQKA 2HQFA 4AFFA 2F5GA 1RAOA 2Q6CA 1SH0A 1U6BA 1S7IA 4OI6A 4K5SA 4ZITA 1R8AA 3MHYA 2H3EB 3NKYA 1F60B 3K0JA 4J9KA 4BLGA 4LF5F 4I4BA 2XM3A 4F67A 1I6JA 3R5BA 1FVQA 2M9KA 5DM6Q 4C0OC 3UR3C 3MZIA 3UD5A 1REVA 1DURA 2MKHA 3EZUA 2MJNA 1C2PA 4MK9A 2RDIA 2D9OA 4IH6A 3WX8A 2QV6A 4C4WA 3KDNA 2V63A 5A8KB 2HWTA 4FNIA 1N0VC 5F41A 1L3VA 2OLWA 2HHHJ 4BS2A 4G3IA 3QGPA 5D0GA 3NS6A 1U2FA 3M8YA 4FKXA 4P71A 5L9NA 1NK8A 1HNVB 4WKYA 3KUHA 3J7YU 3I0RA 4DV5F 2KB2A 2X1BA 4Z2XA 2DR6A 2QN6B 2LQ5A 1TP7A 3NOCA 4ILMA 2MZSA 5ETRA 3ETMA 2KO1A 1SIZA 5KOXA 2FVPA 4UT4A 2IY5B 1V9OA 2HNZA 3HHNB 5C24B 3RTVA 1VI7A 1MW7A 3GYGA 2IM0A 4DR3J 2W7OA 1U49A 2XS7A 4ZVRB 4O44B 3CCTA 1AW0A 2L9DA 4DX7A 5DZ7A 1ZA1B 5KT4A 3U27A 4OI4A 4WFYA 3U02A 4TYBA 4NLOA 2LA6A 4LSLB 3QRRA 1URRA 2HNDB 3HZEA 5C2GA 2YNGB 3KUGA 3ZZOA 2CQ3A 5CABA 3V6HA 1WKLA 2VA2A 4RO0A 5IZHA 1NAQA 4CO5A 4RUBA 4JYAJ 2E29A 3BSNA 4B3OB 2C3OA 2FIUA 3VR1A 3M8ZA 3IGNA 3S01A 1QAYA 4NA1A 2KG1A 2ZBQA 2GVZA 1C1BA 3HMJG 3MPVA 1VQOS 2HQ3A 3FDSA 2MQPA 1F1BB 5E3CA 4LSNA 4YR0A 3PIOQ 2Y8WA 3E3XA 1FRXA 4PXBA 4LFAF 2HEKA 1X8DA 3PW0A 2N7CA 4QIEA 3KUEA 2DR9A 4JI4F 4WP3A 4ED6A 4MAKA 2FHJD 2O1PA 4E2FB 1PSDA 1RT5A 2YWFA 3HFKA 4A8MP 1K44A 2BKPA 4ZPCA 3IRXA 4JI0F 2A0FB 1DARA 1U02A 3M30A 1N34J 2ZH1A 4QYZK 3CDAA 4IDKA 1T9VA 3D28A 4P2XA 5IM0B 2M7SA 1RWNB 2B5JA 1S79A 1FRMA 4LQ9A 3DOKB 3AFGA 2QTWA 3L7PA 4DDFA 3K5NA 2ZVSA 4LSZB 2V2ZA 1EAYC 1DTTB 1SVDA 5A8RA 4FS2A 2VC0A 1YZ6A 3JTPA 2CNNB 4LRFA 1FWKA 3DI6B 2ALYB 2I0XA 1NHUA 1S48A 1ZAWA 2I5JA 3PHEA 7FDRA 3ENQA 4EUVA 1LK7A 2JZ5A 1W2BR 2V67A 2LFVA 1RAFB 2ILZA 2XYHB 3CIMA 4KH1B 4IQMA 1RT7A 3SCKE 2AEMA 4X84A 2XY7A 3L3CA 5F8GA 4U7CA 5CA5A 4F4YA 4I69A 3NMAA 3H90A 1U1NA 2V8VA 3DMJA 4F25A 3KKFA 4KR0B 5M2RA 4NLWA 1G2EA 3N5FA 3DRXA 4F4WA 2GX8A 1S0NA 5BJRA 3GSIA 2B56A 2BXJA 4ZIVA 3MTKA 2IRUA 5ADZA 1HW9A 3I4HX 2K1RA 3D68A 3G4SS 4JP8A 1MU2A 4J9NA 1UA0A 4NZ6A 2ZH5A 2N4DA 2YKNA 2MSTA 4LRBA 1F2HA 4OZ0A 5FD1A 2R8GA 1AUSL 3KNGA 3ZNUA 2E1MC 2VFSA 4ZVPB 4F2SA 4RW8B 1BQNB 3AD9C 3C3LA 4CLWA 3QQCD 1IBMJ 2W4DA 5L39A 3I82A 2GQQA 4DV4F 3NRBA 4YB6A 2RS8A 3Q8SB 2PA3A 3SCJE 4JI5J 2XMAA 3SDEB 3CMQA 5E3RA 3JB9k 2XB2D 5GAHU 4G65A 1H72C 4QW8A 4ELTA 2X1AA 2WHOA 1NUEA 2FHOB 2JOQA 2YNIA 4A46A 5B0GA 4IG0A 1OWXA 2BV3A 1Y00A 2FGCA 2QO3A 1ROFA 3TVYA 3B78A 1K1QA 5T7LB 1QE1A 1B0VA 1AZSB 3M32A 1ZM2A 2UVUA 5GAGU 1FKOB 1KKHA 4YUDA 3QGGA 5L8RC 4QIWD 3HVWA 4ZVSB 2VFRA 3ISZA 4V19X 3EGWB 1Y3KA 4K4YA 1CQMA 1TL5A 5ETSA 3ILLA 2CWXA 2VZ9A 2C28A 5AXMA 1JLCB 1N56A 2FQQB 1NKEA 2M5YA 4KTQA 2EC2A 3ZZTA 3LALA 1U2RA 1JLAB 3LP0A 4PG5A 4DR2J 3I5BA 4ANDA 5E0OA 4ZVUB 1RTHA 2BE2A 2GW8A 4LFCF 3EVOA 1DAXA 3BZQA 3AQPA 4PQUA 4W4MA 3HK2A 2VV5A 2J0QD 4GVBB 1RT3B 1VRUB 3KLEB 4CLFA 3GB0A 1U1KA 4HTJA 4NXMF 2PO4A 1HPZA 2MZQA 1HQUB 2ZDPA 1UWAA 4LRAA 4LF9J 2CPZA 3VVTA 5GMEA 2B8QA 1WOSA 3C6UB 1ZS6A 5HQMA 2MGZB 5AT1B 3CJSA 3ISNC 5KFNA 1YK9A 1ZM4A 1LWEB 2Z8QA 1HBOA 4DF4A 1R0AB 2N3LA 1Q53A 3OL9A 1DBDA 1KTQA 1JLFB 4NA2A 2XMJA 4F7VA 3MUMP 3J81j 3AJ2A 4DWIA 3THPA 4Y0FA 1FEEA 2UP1A 2AJFE 1L3UA 3RAMA 3J81Y 2M2BA 1WWHA 3TYTA 4ED1A 2PI4A 1XR7A 3S1TA 1U1RA 3H5UA 4P7VA 4HHJA 1GT8A 4J9RA 3KK1A 3HT0A 1XMQJ 3CWJA 2GQ2A 2FZGB 1F6TA 2WB4A 3J80Y 2XY6A 2CPYA 5ETLA 2OSQA 4DR4F 2KVQE 1ZAVA 2A3JA 4N41A 2AD9A 2YKOA 4YMEA 4GVLA 4LMZA 2L41A 1ZA2B 3I32A 1TAUA 1N48A 1TUWA 3Q2TC 4N8NA 2KHDA 5JJBA 4JI8J 5G4DA 3BBBA 2OEMA 4WFAQ 3W62A 1REVB 2W8LA 5L38A 2HSEB 3VZIA 1KBRA 3GJSB 3OPKA 2FJDB 4EYHB 1RQ0A 1RABB 2Z58B 2YKAA 4MYTA 5ETVA 2BJ1A 4CLYA 2BANA 1M1KT 3MCNA 3MMBA 1W26A 4CO1A 4DSFA 2ZWOA 1TL3A 1TUVA 3ILIA 5K20B 4FKYA 2IIHA 4JV1A 4OX6A 2OEJA 2HNZB 1YHQS 2G0JA 1UAWA 4ED5A 1F5CA 5SZTA 4LBIA 1T03A 4LIRA 3K5LA 4QWBA 2HS0A 4DV0F 1V3ZA 3CJ2A 4M95A 5K8MA 1N33J 3VAIA 4FVMA 2GAHC 4Y2AA 2QX0A 2VKZG 4GRSA 1S0MA 1EJ7L 4MYUA 1QD1A 5KFFA 2HRTA 4EMDA 2PSZA 5IV4A 2WVEA 4HLBA 2KXHA 2G1DA 1FJGF 3GTYX 3W9JA 1WTFA 2FYXA 1U48A 1RADB 1G6BA 3BQ0A 2R7XA 3BR8A 2Q79A 4M5NA 2HFNA 4EZ6A 1LOUA 1ZH5A 3DRRB 1IJEB 2OMOA 2EFQA 4URGA 3R5JB 4NLRA 4LSNB 1HARA 2UVWA 4PUOA 3QT5A 2EKYA 1UJ5A 1IWAA 2MZTA 5CYMB 1PG5B 2F1FA 3K7RA 3MPWA 3OFHA 3EXCX 2OSRA 3TWZA 3K57A 1Y11A 1S9GA 1XIQA 4Y28C 4JI7J 1F9EB 1RT5B 3WQPA 1V3SA 2ZH7A 1YG0A 4Q44A 1UKUA 4CTAA 5T41A 3IRXB 1TU0B 3M30B 1JLQA 5C25A 4XO0A 3H20A 4NLTA 3Q89A 3V4IA 3JYTB 1S6OA 4ZS6A 1FX2A 4WWSA 1RTJA 2XNRA 5A8RB 2CQGA 2KZMA 1TL1A 2IYGA 3DDKA 4RW9A 4O3OA 1NKCA 1FKPB 5M2UA 4QCLA 3DRSB 1KN6A 1BMQB 2I5JB 5J2MB 4ZDNA 3V5RA 3DHXA 1N5YB 1UW9A 1UFWA 2YWGA 1Q4RA 1GX5A 3MEGB 3C14B 2GIFA 2ALZA 2WB1D 1WI8A 2EFOA 4ZCLA 2QGFB 1RT7B 1NZAA 3DLGA 3SQGA 3I5CA 2GIQA 1UFKA 3N6MA 2BRLA 1UW4A 3CJRA 5GAEU 1XNRF 4MFBA 4X62J 2IA6A 4K59A 3Q2SC 3RW7A 2L9WA 2J6TA 3NY0A 2J7UA 3U7JA 2NZ4A 1QTNB 1TK5A 1YJNS 1BY9A 1B0TA 2GMJA 2VONA 2IRXA 4I1TA 1MU2B 2VC1A 4ZHRA 5IQ6A 4FYWB 4CT9A 2YKNB 4LREA 5KG4A 3UCZP 5A0YA 3GIJA 4UQGA 3P6YC 4N7TA 2CADA 1RTZA 4UUXA 4NXNJ 1PYSB 8RUCA 4EBDA 4G1QA 3DXBA 4QIGA 3H5YA 3E8OA 4OHWA 5ETMA 3QPIA 1RBAA 4X64F 2AYBA 2HHUA 2LXUA 4Y2KA 2YNIB 4ETZA 4IG0B 1B7YB 4MMOA 3LGHA 1U0HA 2M70A 4HI1A 1RUSA 2ZEJA 2HHTA 3NS5A 3M32B 2KFYA 2FGOA 4C9DA 2PEBA 3MM5A 1RAHB 3PW2A 4XDCA 3M9NB 3MOZA 1KOHA 4J90A 2LECA 3CO9A 1S1UB 2XZWA 4MK8A 3LGNA 1OSCA 3GIRA 4GKJJ 1X4GA 1MSWD 3MUVP 2UUAF 5KTQA 2E1RA 1MROB 1VK3A 3TZZA 3QZ7A 2VA3A 2DO0A 1B3TA 1HL6A 5JUMA 3HD2A 1RTHB 2BE2B 3V2UC 2VPXB 5IOLA 3OVSA 2GMLA 2CKWA 2VU5A 4B9VA 1NPRA 2IVMA 1TV6A 2YQ3A 2OPSA 4PQUB 3WIUA 4YHHJ 1HW8A 3T6BA 2P9CA 1HPZB 1VHIA 2MHEA 3CDUA 2MZJA 2BJEA 3MWBA 2GO9A 2KL8A 1UMJA 2CQ1A 4TLRA 4F3MA 3MMAB 2BW2A 3PEHA 2NXEA 4RLEA 4KT0C 4P10A 1HYSA 4HI2A 3D66A 2H65B 2AV5A 1VQ4S 3MM6B 4U9RA 2COLA 3BDPA 5E41A 2J7WA 3C19A 2LDIA 1S1VA 1S59A 1JLEB 1ZM9A 3CJ3A 1NNDA 2XMMA 2VICA 2CPXA 3KXDA 2J0WA 4W92B 3D1OA 4PCQA 1SB6A 1UEKA 5B0BA 2MYFA 2IC3A 2C2DA 4WU2A 4B08A 1B64A 4F3OA 5H1SV 4KGVB 2BJDA 4YY3J 2L9NA 1FO1A 4YR2A 4Q0BA 5FJ4A 3VVUA 4CCHA 1WC4A 4DFKA 1Q8KA 1IKXA 2F4VF 4EYIB 3MMJA 2RB7A 1IN0A 4FYXB 5HN0A 3MD1A 1SV5A 2HRYA 1WDDA 2ZC3A 3JSYA 1NK6A 2BRKA 2QZ8A 3MTJA 2VPYB 3TRGA 1OQ3A 3SV4A 2DGQA 3QYYA 5IFMA 3UN3A 3MEDA 1H7XA 4QZVB 4C6AA 3V6JA 2H5EA 4LJMA 4WK3A 3QGHA 3GPAA 2Z57B 4OYWA 3N0VA 2BANB 2C2KB 2EK1A 1FI4A 3MMBB 5K8OA 4DX8H 1TUGB 2CPIA 2MQLA 2XEXA 1TL3B 1PGZA 3D7SB 1CJTB 4LF6J 1VQLS 2E7XA 3KWMA 4JI1J 4YDDB 2R42A 3R1LA 1T03B 1HHQA 1EARA 2IRYA 4DBQA 1SL1A 1J2VA 2UUCF 3DGPB 4C8NA 1TKTA 5EWFA 4P73A 2AJQA 1AYEA 3GP9A 1CLFA 4BBYA 2XSFA 4B9UA 3R27A 1SC1B 4NASA 2HHPA 4NLYA 3I0SA 3WZ0A 1FRJA 2CPEA 4I6YA 1T0TV 3OHBA 3ITHA 1HFEL 1N32J 2YWKA 3BN7A 4L76A 3M6WA 3QATA 2YQ0A 4ANCA 2Z56B 3PR4A 3E2EA 4A8YA 5B0FA 5A6PA 1H98A 2O5DA 4LF7F 4C97A 2QL5B 1T9TA 2FC8A 1JXVA 4ZVHA 4USHA 5KOWA 2PEHA 4H4KC 2EI5A 5FDLA 2IYIA 2UUBJ 4DG1B 4PWDA 3FJ2A 3TNVA 4NYOA 4FBUA 1FFWB 5ETOA 5KT5A 4DR1F 1OYDA 5KAKA 4P2MA 2ABYA 4PUOB 4X4TA 2W4PA 4DV6F 4DSKA 1NJWA 3QSYB 4RR5A 3MPUB 2CJXB 2I1RA 1UL3A 3L7UA 4MTPA 1GH8A 1HNIB 3WBZA 3FEXB 2B4OA 1S9GB 2JRSA 1J5EF 2AYEA 3DLLQ 3GSDA 1DHMA 3NGUA 1U2CA 2H1YA 3MFIA 5F0WA 4CTAB 4ANEA 2FJAB 3SFGA 3EVWA 4B9LA 4YB5A 1LNQA 3O3LA 1JLQB 5C25B 5DLGA 2YX1A 3DM2A 1IKWA 4FYYB 4QWAA 1HNZJ 3RYLA 2D9PA 4I68A 1RLCL 4CP5A 2G4BA 5D4LA 5B0EA 3V4IB 2VPZB 2B4UA 4MH8A 2J0XA 3PJ9A 3UW1A 4J9SA 1V6HA 3W61A 4UTGA 3UDVA 1TL1B 1IKYA 2ASLA 3QLHA 4RW9B 5IQQA 2OIHA 4K8RA 1M90T 1VBXA 4U7UD 2VG5A 4RUCA 1S4FA 2RDJA 3W65A 2Z2ZA 5A8WA 1KP6A 3OFGA 2EG2A 2CAJA 3QIPA 1GMVA 4PEOA 1RISA 4HDHA 5HJYA 2W9CA 3DLGB 4AE5A 1QSLA 3VZHA 1NPPA 2RAQA 3G82B 3EYZA 1RWVB 2KYZA 1EX8A 4RZRA 3W60A 2UXDF 2LU1A 1WDTA 2AU0A 1GK8A 3AB2B 2JVOA 2JEFA 1H0HB 4C2MA 3KLIA 1K8AT 1I94F 4WPAA 3D4JA 3CJ5A 1XNQF 1R8CA 2IM3A 1YBTA 4X65J 2D1CA 1BUXA 2JLFA 1VQ5S 4ZHRB 1WG1A 4B3SF 4NYZA 4K50A 2JEIA 1O6XA 2UXBF 3A8KA 4PG4A 3AXKA 3LWLA 4TU8A 2Z2YB 5DGAA 1SUQA 2K3IA 4NCGA 3G71S 3W66A 4FXVA 5GMKa 3AA8A 4G1QB 1GAOA 4QWCA 2KH9A 4DQRA 2BBEA 2OP5A 1RT4B 4JV0A 4I56A 1UETA 1X5SA 4EI2A 3X3UA 1WOOA 4CWBA 5HL7Q 2EFGA 1HIYA 1T95A 2OPQB 3ZZYA 3MMCA 4DV1J 3HF5A 2ZM6J 2LCWA 2CPHA 1PBUA 2HLTA 2XMTA 1S77D 1W25A 3MM5B 3L09A 2CQIA 2ZKTA 4OHVA 2B0GA 5HVFA 2R8HA 4F4KA 4WFNQ 3MM8B 1VHFA 1S76D 2AW0A 5IC4B 1ZZNA 1O51A 3M2VA 2AGPA 2HWIA 2DRBA 1RU1A 5BYQA 1CG2A 1J5OA 4B3RF 1F9FA 1ZPWX 4HTIA 4ZJQA 2OFGX 5KFPA 4RNOA 2IA0A 3TQ1A 3A13A 3M2RB 3HVRA 3BF4A 2ZE2A 1ZM3A 2QLFB 4DPOA 1N6QB 1QM9A 3LH2S 2XQCA 3RZAA 2V5HG 3ZC4A 2XNQA 3PJXA 2LKZA 4FF4A 3NGDA 4OLPA 1SJRA 3HULA 2R7QA 1KNZA 4QWEA 4XPEA 1NSQA 1Y9OA 5IT4A 2DNGA 5KFQA 3CSKA 3OTCA 3M2UB 3KYLA 3G86A 4C3KA 5KFXA 4F0MA 3PHTA 2DHHA 2FJEB 3VAFA 5FLXU 5CXTA 2RNEA 3C6TA 2WAQD 1FDNA 1SKRA 1JLGA 1NK4A 2HK2A 4RX6A 2XMVA 2YQ1A 4WE1A 2B7CB 2GAGC 2IC3B 2DR7A 1RA7A 2CPJA 5KFBA 5IV3A 2M88A 4KIAA 1YJVA 1U09A 2QLXA 3TARA 4Q0BB 1K47A 2X3GA 2QG9B 4OJ3A 3KOAA 4B3TF 1LEOA 1RAEB 1IKXB 4JI3J 4WTOB 5HMYA 5CAAA 2VQEJ 4C11A 1Q79A 2D69A 1S1TA 4DUYF 1SV5B 4DZ6A 2RRNA 3D0GE 1YVFA 2MPUA 1QTMA 4HVZA 5KFAA 1HR0F 3DLKB 4A8KA 4RUAA 4OX8A 4DZDA 3ZZRA 2A6MA 4QR1A 2EFVA 4LFBJ 5K14A 3OTOF 4PAAA 5CD4A 1S4EA 4O4GB 3K5OA 3CB4A 1CBKA 2W01A 3LF0A 2CYYA 3BB5A 4DF8A 1U1PA 3QWUA 1X31C 4IOCQ 2W9AA 2FD2A 3H40A 3L95X 1HD0A 4ILLA 4X4UA 1PBAA 3H2LA 2P6SA 3KJVA 4OYMA 1SL2A 5E3PA 1UWBA 1CJVA 3Q83A 1IBLJ 2X51A 3HHEA 4PXDA 5H9EK 4X4NA 3WIVA 3FNNA 1WEZA 2HQIA 2PGCA 3R7BB 5AE1A 3UNGC 3PKYA 2AHOB 3TVKA 1PILA 3T1HJ 3LPYA 1TKTB 4IRDA 1D09B 3FZ2A 2R7OA 4PPDA 4ZVFA 4N77A 3EJMA 2FHJA 2Q6BA 5I3UA 2MSSA 3RRGA 3LQVA 3D6MB 3ITHB 1WJ9A 3SZ2A 4OZ5A 3ZTPA 1VYAA 1FVSA 1R8PA 4LF5J 4OYAA 1NEEA 4MIAA 4F3QA 4OFZA 4K5RA 4ZP9A 2UU9F 1R0CB 5AXLA 4HDGA 3RU0A 2X3DA 2MTLA 4CO0A 4U6PA 4NLPA 4OHZA 3JQJA 3AODA 4J9VA 3OUYA 1X0PA 1X4AA 2ZJQQ 4LR8A 1FJCA 3BKTA 3L7OA 4ALZA 1EKSA 4WFBQ 1FDBA 4PWDB 5KFSA 4DV5J 1NB7A 3GCWP 6FDRA 3I5AA 2CQ0A 1NK9A 2VDHA 3M8QA 4AQYF 4N76A 2JFKA 5HATA 2NXNA 5D78A 4YP3A 2I9SA 2PMWA 2HHQA 4KKOB 2LXIA 3ZTOA 1JJ4A 3CJ0A 1SPBP 4TKTA 1LW0A 5K8NA 3DYAA 1RYSA 3DRPB 3GZ7A 2Z2MA 2W2MP 2SXLA 3ILOA 3DM2B 3QMQA 4V19J 2V68A 1WTBA 1QJHA 1Q1KA 2FY1A 2VBZA 4ED7A 3BQ2A 3PDNA 3D3BJ 3NBPA 1UVIA 2PT0A 3QLHB 4DPTA 4L75A 2DIVA 2AKWB 4C7QA 1NSKL 1Q8LA 3AB4B 2VG5B 2W9BA 5HVGA 2FB0A 2ASJA 1YRUA 6FD1A 4LT6A 5A8WB 3CJTA 3G6VA 2B7BB 2DNZA 1TVRA 2ROPA 2VOPA 3BPSP 1BE4A 2UUTA 4IYQA 2YNFA 2U1AA 5J1EA 7AT1B 3FGVA 3V6DA 3BBFA 2ZJPQ 5CQGA 1SCJB 2R2RA 4HKQA 2VFTA 3W64A 4P52A 4LFAJ 3GJQB 3DFEA 2BABA 4JI4J 2VD3A 3SIPB 1KVJA 4O4RA 3NCPA 3KFWX 2CPDA 5F8MA 4JI0J 5KFHA 4DL6A 4K4ZA 2X1GA 1PJ6A 2B6AA 2E5LJ 2HKEA 2F8EX 4CLTA 3AXMA 1SUQB 3HPOA 1PAEX 4NCGB 4EO6A 4NLGA 1VOMA 2IVYA 3A3NB 1F0XA 1NKBA 3GG1A 2MQMA 2P5VA 4HEA9 3TANA 3OVBA 3HD1A 1SKUB 4KJIA 4K2XA 5A8KA 3DLJA 2KT3A 4DU7A 3IBWA 1D9DA 1DZ5A 1T9XA 3MMCB 3GIIA 3CCES 2BUNA 4C0BA 1TKZA 2NQPA 2UVRA 2NCKL 3MAAB 3FKBA 2JLEA 3J7AN 3C66A 4ZVOB 1FWLA 2DD8S 3CCWA 5C24A 1WNEA 1DTQB 2OD6A 3M05A 1RHKB 5K9FA 1S97A 2ZBRA 2XSJB 4WZQA 2HNDA 3UVJB 2ZUAA 4KRWA 2YNGA 5D4PA 2MY8A 2ZE2B 1LWCA 4DV4J 2ZZTA 2Z30B 2ZH9A 2GJIA 2BA9A 3BH6B 4OX9F 4DV7F 5DDPC 4F4ZA 2QMUB 2QYCA 2L3MA 4QU7A 2HHVA 2CVIA 4CLSA 1NDPA 3W8PA 4ZVEA 4B3OA 5HJXA 3N6NA 2CXEA 4QBUA 4ZJOA 1NJIT 4DV3F 1NB2A 3AAWB 3AOCA 1U1OA 2XCPA 4HACB 2F7VA 3NWGA 3FMWA 4Z37A 3O1LA 1TKXA 5DDQC 3QSIA 1RHJB 2Y8YA 2A10A 1TR0A 3UPFA 4CO3A 4DR7J 4WE1B 5L1LA 2MLZA 2RF2A 2NYHA 1NCLA 2J76E 3TAMA 3QO9B 2J8SA 2CDQA 2QLBB 1RAAB 2B3TB 2PE8A 3FBEA 3KLGB 5HAOA 4LFCJ 4QR2A 3KG1A 4IR1A 2JJ4D 8AT1B 5IM0A 4O3NA 4DL0C 3DOKA 4J91A 1CULB 3AD8C 5KFZA 5EUHA 1FTCA 1WSVA 4WBFA 5CCMA 5B7WA 1U4BA 4YFUA 2WTFA 3CMES 3DI6A 3JAMY 2E5GA 2GQCA 4DN0A 1RBOB 2K2PA 4XIUA 4ITSA 1L3TA 2RKIA 4OJ1A 4OYOA 5E7OB 5K14B 4CLKA 1FDDA 3ELHA 2HG4A 4OJGA 4DV2F 2C1EB 1KLNA 2DHAA 4X66J 2Q3PA 3GR1A 3IWLA 3OXGA 5AJ3F 2E9ZA 4KHRA 1A6LA 3IP0A 1JLBB 3ENAA 4TU7A 3HZGA 4Y2CA 3KJVB 1B99A 4FN5A 3AY0A 1M1HA 4TY8B 1CJVB 2CPFA 4X4RA 4LF2A 1WG4A 4HH1A 3KG4A 5KFLA 1MWZA 2V6AA 2EBGA 2D7SA 2IBKA 1RWOB 4L74A 2J6UA 5KT6A 1ACMB 5F8NA 1DY3A 2QJ3A 2YKMA 4UUWA 4ER8A 3QNWB 4XAKA 3EGNA 1VLYA 3ZFVA 4BCAA 3SDEA 5I3UB 4DR4J 3NNCA 3IBCB 3QRQA 1WEYA 4M5KA 1ZOTA 2KRBA 4JI8F 4I2QA 3UD3P 1NDKA 2ATCB 5LMNF 4IO9Q 5T7LA 2QSWA 3J7A1 5GADU 2J0SD 4WJBA 4ECTA 1FNMA 5MAOA 4DFJA 3EGZA 3PCOB 2YTCA 1FKOA 2GZOA 4G1IA 1FXLA 5HO4A 1X9WA 5L1KA 4K0KF 3HHLD 3BREA 4DJBA 1HNXF 2QC3A 3J7Z5 3G87A 5DG8A 1NHVA 2R7WA 1JLCA 1RU2A 2WRMA 1OIAA 5KFEA 2G0CA 2LP4A 4IG3B 3M8QB 3I9ZA 3LPEA 2VFVA 5AE2A 3X1LB 2PD1A 2EKNA 1Z2ZA 2IJFA 4ATNA 1XR5A 4USKA 4OV1A 2IM1A 4FP9A 1LW0B 4DL2A 4K7QA 4DV0J 4J7CA 1WSRA 1ZYQA 2Z4PA 2C2MB 2NPIA 2WVDA 4GVBA 3KLEA 3D0IE 3PW4A 4UF4A 2LMIA 5BYRA 4P2FA 3VGSA 3EZOA 3ENVA 4J9QA 3G8TA 2E5IA 4MIBA 5H9FK 3LP2A 2DNPA 1N5SA 2C2RA 3G6YA 3TZXA 2F9JA 3ILJA 3GFZA 3NBPB 4EGLA 2DHXA 4BHQA 3BGRB 1RT2A 2R3VA 1IR0A 4DOZA 1F2GA 2C2ZB 2E7WA 4ZPAA 4OHXA 4FYDA 1JB0C 3W5YA 1PKUA 1ZPVA 2W9BB 1FCAA 4BWMA 1AFJA 1R0AA 1CJUB 1TVRB 4I7FA 2DXFA 2XI3A 1JLFA 1H6KX 2YNFB 4PR6A 5J1EB 3W5ZA 1LFWA 3JSMB 5AXKA 2B43A 2WVFA 1HA1A 3AA9A 3P96A 4ILRA 1OS5A 4N5SA 4QPXA 2ZH8A 1XMOF 2XHCA 2HQCA 4EBEA 4KAIA 3O44A 4DPYA 3CDBA 2VG6A 1A0OB 3CCVS 3GIMA 1D1UA 3IS9B 2AZ3A 4ZCMA 2KKHA 3GMGA 3TW0A 2H4WB 5D3GA 2BACA 2GNKA 2KJVA 2HLUA 3EWGA 4MKYA 2CG8A 5B0DA 5LL6d 4OZNA 3GFYA 2B6AB 2F9DA 4DL7A 4WP9A 3FSXA 4O0IA 3RBDA 2GFFA 3C16B 4Q45A 4RBUA 1V5IB 2CZVC 4USMA 3IMQJ 2R7UA 5BXIA 2OFHX 2HAIA 1H38A 4KHPF 1UA1A 4RKUC 5J2QB 9ATCB 3KHLA 1UPMB 3QT8A 2JFDA 1TMJA 1DFDA 3R2CJ 4PWUA 1DRZA 3UO0A 4F0HA 1IBCB 2NREA 2CG4A 1C4CA 3MAQA 4WU3A 4DHVA 3EMTA 3OVAA 1E6YA 2FHMA 5A2QY 5LSOA 2H5IB 1WC0A 1TKZB 2K06A 3VCDA 1XNRJ 4I0WA 2OPRA 1HMVB 4CO2A 2W2NP 2ZNYA 1N36J 1ICEB 3DU5A 2A6OA 5F9LA 4DMZA 3V6KA 4RU2A 1C1CA 1RAIB 1VLOA 3A8JA 1G1XA 2LA4A 3VTIA 3TZWA 2EWHA 3OJSA 1FXDA 3OBIA 4RPFA 2AT1B 5CD4H 4URSA 4IRKA 1NMEB 2OI2A 2ZOMA 3KK2B 4YB7A 3A8IA 1LWCB 5D4OA 1OYEA 3CXCR 1S9EA 1N0UA 5ETKA 4X64J 4U96A 2R8IA 2IM2A 2LQ8A 1RT1B 3G6ES 2DNHA 2AJ1A 2CRLA 2QFIA 3RB6A 3AT1B 4WIQA 2PC6A 3VAGA 3IG1A 1XTZA 4OHYA 3OFEA 3UQSA 3W3SA 4FXDA 3DRRA 3KLHA 3HO1A 4G6VB 2IAJA 3OJUA 5H9FJ 2HBYB 4DS5A 5KG6A 1TKXB 4O3QA 1VQKS 5CYMA 4OZ3A 2W2OP 4ES2A 2VODA 1OY8A 1B7FA 4K4SA 3OL8A 2UUAJ 4UY85 2RF2B 2HIQA 3SCIE 3TAMB 4ZPBA 3CF5Q 3CGIA 2L08A 3P5TL 4WFXA 1XK8A 2RD5C 5L1JA 3DN9A 4MK7A 2Z2LA 3F56A 4I6WA 4KV8B 3JYTA 3HP6A 4D3GA 1FEHA 4YHHF 5IT9Y 1SBRA 5DDRC 1C0UA 4FPIA 3J80U 2XWXA 3LGMA 1G3OA 5KFKA 4D3HA 3T5KA 2RT3A 1WC1A 2CJYB 1FKPA 2XZTB 2YY3A 3CVKA 3DRSA 2MB0B 1RGVA 2YBVA 1VRQC 2ZBCA 3D1HA 2RKIB 1M5PC 5J2MA 1RTIB 3SEOA 1N5YA 3MEGA 3C14A 3TJAA 1RB0A 2J8AA 4O23A 4CDIA 1T11A 3L9ZA 3GWCA 2HBZB 3FBBA 1RSCA 4P72A 3B4DA 4NLVA 3D6HB 4OJHA 4JUZA 4OYBA 1EETA 2CQDA 2YWHA 1OO0B 2DK2A 3DXSX 1N4LA 3QJJA 1ZETA 3MPDA 3HI9A 3OTEA 3K59A 1ULRA 2YKMB 4U95A 2F4VJ 2K8GA 1Q5VA 1NXIA 4RWWA 4F04B 3OXLA 4ES1A 2I8EA 4PXCA 4X4VA 4M5LA 4OYXA 4FNHA 3POTB 3N5BA 4DSIA 1YKWA 3FQLA 2HFZA 2XMKA 3J7YI 3RUBL 2HBQB 5J2NA 2E44A 4USTA 3KLVA 4ZMMA 4FBTA 3HHLC 4I2QB 3DU6A 1ZTTA 5HQLA 1FT8A 4DUZJ 5KT7A 1CJKA 2ACMA 2HFOA 2IFXA 5CZVA 2ZHAA 1VIOA 2NYIA 2KM8B 4ELUA 4YS2A 1R6VA 2ZZMA 3QRPA 3IO1A 4OYIA 2DCUB 3EUNA 3AOAA 4X4SA 4M5JA 2YH0A 5JVGQ 3SV3A 1S1UA 3D67A 1GTHA 1KRPA 3BKUA 1GMWD 2X1FA 3CTRA 1X7VA 3GCXP 4OMFG 1MROA 1S49A 3AH6A 4N56A 3NWRA 4Y65A 2U2FA 2B51A 1OJ4A 2DGWA 1IXKA 2ZH3A 2L48A 1YQHA 3V4MA 1DLOA 2UUCJ 2OEKA 2H48B 2E9TA 3CJ8A 2XG8A 3IBFB 5THWA 4M94A 4ECWA 3CULA 5K5MA 4QJVA 3N01A 4NEZA 2F3JA 1IJFB 4NMLA 3LP2B 4I6AA 1LXJA 4UOCA 5IT0A 3E01B 4QIVA 4OQJA 4ECQA 4IFYA 3MMAA 4JV2A 3R2DJ 3R5DA 4UQTA 2KT2A 3MM9A 4OYPA 1RT2B 3NCQA 3N28A 5B0CA 4LF7J 3RRKA 3MM6A 2W1BA 3BN4A 3RGIA 2KU7A 3DGVA 1Y10A 1JLEA 1N88A 1O0PA 4P75A 1WEXA 1T05B 1TK0A 4L3NA 4I7FB 1VQ7S 1VQ6S 1C0TB 4ZP6A 3VGTA 1BWEA 2RQCA 4DR1J 2XULA 3JTOA 4TU9A 2XO7A 4DV6J 3NOGA 4WYLA 3H2UB 5HMXA 4RU9A 2NZCA 2MKKA 1KWMA 1KR4A 3OW2R 2VG6B 1T9WA 4Y00A 3SXLA 4NCBA 2MMYA 1QUVA 3DOMA 2DVIA 3M6XA 4Y34A 5D3GB 1NRKA 1T02A 3TEHB 5KFUA 3TA2A 2FVQA 2LDYA 1YIJS 4LR9A 5D8HB 2Y0BB 4LBPA 1R7IA 2K7JA 4ZP8A 2ZJRQ 1YGYA 3R8YA 4B9TA 1HBMB 4KB7A 5HBMB 1QLNA 4LF8F 1AA1B 3I87A 1LV5A 3FFIA 2OELA 3DRYA 5IXUA 4ECZA 3BS9A 1XJWB 2DGUA 5KT3A 2DO4A 3I96A 1VC5A 3PVXA 2AMCB 2WVBA 4A48A 1N52B 3MUTP 2HNYA 1RCXB 4USUA 1KFSA 1VDHA 1OQ6A 2ADCA 3KK3A 3RB3A 3CD6S 4RNMA 1E6YB 4TNOA 8ATCB 2BYCA 2AEFA 5AXNA 1MG7A 4NZ7A 3IR7B 5EX0A 1YBAA 5BR8F 4C8ZA 1CJTA 5CHCB 2UXDJ 4LF1A 3D6TB 3AJ1A 3AOBA 2OPRB 4GKKF 4LF4J 1UEVA 4TY9A 1VS3A 1HHTP 2VL1A 5GAHI 3ZZPA 3CC4S 2CJAA 4A8WA 1FRKA 3QZ8A 1I94J 1XNQJ 3M4XA 3DGPA 1YITS 1C1CB 1CS4B 5CH7B 1TK8A 4CIOA 2GMHA 3K89A 4FXWA 4B3SJ 3TJ8A 3ZTSA 4UZCA 2UXBJ 3PRDA 4PXEA 2WBMA 4ID8A 3BM7A 4KYZA 2DNLA 4C8LA 4GO5X 4AL6A 4MJKA 3HSZA 2DBBA 1LWXA 3R6GB 2PN6A 1M5OC 5GAGI 2ZBIA 2IJRA 1R6YA 3T41A 1S9EB 1U47A 4CT8A 3IAS9 3LA0A 3PYGA 4ICLA 5HMZA 2CNLB 1MNEA 3C15A 2R2UA 3DDNA 2NUHA 1F5AA 1Q81T 3JQMA 4CM2A 3UDLA 4NRTA 3IG1B 2CQCA 3BQ1A 1MMLA 2DNYA 2UV8A 4DG1A 3KLHB 2BOPA 3W2VA 2UUWA 2IAJB 2LQJA 2IBOA 5F8HA 5DQHA 2ZBPA 3HM9A 3OFFA 3NP5A 3MR2A 1OMSA 4K4UA 3RAQA 1VK8A 1U26A 3HJFA 1JKHB 4F36A 3R7SB 1TFYA 1KQKA 1CC7A 3R7NB 2AWZA 1EHWA 1HNIA 2EBEA 5DJBA 1MLAA 3EPGA 3PX6A 3SQOP 2D3UA 1FX4A 4B3RJ 2FLLA 3DHWC 3GV8B 1RHMB 2G0IA 2DT9A 3JSRA 3D2WA 3LANA 3UFCX 2K3KA 4DLGA 2MKJA 4AXIA 1MMDA 3FMBA 1O5JA 2JL9A 3KMSA 1H7WA 4UW2A 2YNHA 1C0UB 1R43A 1U8SA 4PYAA 4OZLA 1PO6A 3VAJA 2Y1JA 1YSJA 2BJ9A 4TLQA 2VDIA 3P5BP 1ELOA 1TL7A 4F2RA 1WC3A 4Z7YA 1FXRA 4DPXA 1U45A 1Q7YT 1VISA 5J1PA 1TTHB 2P8IA 2DHGA 2HS4A 3MECA 1R3NA 2Q1LA 4DL3A 1BQMB 1KONA 4A8SA 3G82A 3Q8PB 1Q7LB 1X4DA 3OD2A 2E1CA 1YBUA 3LTOA 3MM7A 3NGSA 4USJC 2IVFB 2XHWA 3PX4A 1EETB 3HDSA 4C8YA 4RUHA 1BC6A 3HFVA 5DS7A 3HT3A 5D0RA 4ZPWR 3CCJS 3PRVA 3GU0A 3EM1A 1PYTA 4J5OA 3THVA 2R9LA 2M52A 1XR6A 3PXGa 4IOBA 3T1YF 4FPRA 2DPIA 3AQOA 4B3TJ 5CZXA 2EXUA 1IBKF 4DCOB 4DUYJ 3RR7A 4X4OA 2JEGA 1A7GE 5E2QA 1WF2A 4ZPDA 2H54B 5HQ8A 4FF1A 2P6TA 2CQPA 1HR0J 3K58A 1RT4A 4KO0B 4LUBA 3NGTA 5J2NB 4HHUA 3MEEA 2YKPA 2MZ1A 2KXNB 2NXCA 2R8KA 2VJUA 1CJKB 2ZZNA 1HI0P 4NPOA 1P27B 3TAPA 1TAQA 3F41A 2OPQA 1YJUA 1NJYA 4IRCA 2DGTA 1BHNA 3MGJA 1I1GA 2CIMA 1BD6A 5D0HA 1Y5IB 4LRDA 4Y2MA 4B3MJ 2FY8A 1OY6A 3MM8A 3K8VA 4JI2J 4KFBA 4DLEA 3NAIA 1GNKA 2DB1A 2Y9HA 3VAMA 1VGYA 2CWKA 5I3PA 3A3PB 4F8RA 3BYRA 4DCJB 1JNRB 2W4CA 3H4DA 4ED0A 1VJWA 1DLOB 4F0KA 4KPCA 1T9UA 4OLOA 1RHRB 4IKAA 3M2RA 2HVIA 4M1KA 1N6QA 1WOPA 4NA3A 2V2KA 4J9MA 2CFXA 1UZHA 4J9LA 1GQEA 3SMZA 2MZRA 2APOA 2DRAA 2PFFB 1CPZA 4LVNP 4I64A 5D77A 4IFYB 3B82A 4M63A 2AX1A 1X60A 2RE1A 3HSJA 3KMQA 2UU9J 3MM9B 1NK0A 5KG7A 2R7RA 3VHQA 4H4OB 2JEJA 2JWNA 2LXFA 2YPYA 3M2UA 1KQFB 5IWAF 2N82B 3N79A 2XY5A 2MQ8A 3TR5A 4CQ1A 4ZOSA 5KG3A 1N5VA 2HGLA 2GHWA 2KHCA 3G96A 3FSYA 2UXCF 5AE3A 4QW9A 4IO1A 5HK4A 4Z7CA 2BJ3A 4AQYJ 2VUGA 2OPPA 2FLOA 2DY9A 4UOFA 3OHAA 3MCSA 4USIA 2K7KA 5L1IA 1P9YA 2IPOB 1FFSB 3DOMB 3A8EA 4NLXA 2BVZA 3W5XA 2VG7A 4QU6A 5U47A 3QBCA 3HLUA 4M5GA 2HAFA 3UDCA 3NGKA 2DNKA 1VRTA 2CQ2A 2IMOA 3QGIA 4O3SA 3W63A 2R7TA 3H7HB 3T3FA 4AL5A 3FFIB 5DG7A 3DLKA 5F3TA 2NSCA 1RP5A 5CYQB 1SJ1A 2LQBA 4S0MA 5GAEI 5C5JA 1TQLA 4ECSA 2IDLA 4K4VA 1FWPA 1H2TZ 3A12A 3PV8A 4DR6F 2EK6A 3OR1B 1VC6A 5G0RB 2HNYB 1Q86T 2GJ2A 3JTNA 4O4GA 1IM4A 2VBYA 5ITHA 1NSPA 2DGXA 3BDEA 1P1TA 2VKRA 3KK3B 2M3DA 2JC1A 3NMRA 4FDFA 1YTYA 3E51A 3IXQA 2CZ9A 1MWQA 2DITA 1UCNA 1S5ZA 5I42B 3PG9A 1KC8T 1U1QA 2MQQA 4CH1A 3LO3A 3IN5A 3M6UA 3OTDA 4NLUA 1CC8A 1S0OA 3BV8A 2ZITA 3NAHA 2DJWA 1S9FA 1IR2A 4QWDA 1WKJA 3N6LA 4H4MB 4QR0A 3FCHA 3HKWA 4ES3A 3NNAA 1WACA 2MQOA 1IR1A 5J2PB 3H2VE 3M8WA 4RW4B 4J9PA 3PYFA 2E5LF 5LT5A 3IA0A 2V9KA 1LFPA 2FHKA 1SQFA 2UV8G 3FBFA 4ED4A 3FK4A 1UVKA 1RBLA 4ICLB 3C15B 1X4CA 2DIUA 2VFUA 3BYPA 4UZBA 2JC0A 1KSPA 1NK5A 3SSSA 4I2PA 4CLLA 1RAJA 4NLDA 3K5MA 2ZHBA 1M1GA 2QSFA 2BEFA 1V5VA 3LW5C 3W2VB 2BJ8A 4ZIWA 4P7TA 1FTRA 3T5LA 1RZMA 4F02A 4URQU 3QJLA 1FRLA 3EXYA 5I3QA 3ET6B 1R89A 5RUBA 1YI2S 4NE9C 4YOEA 4KKOA 1ZZFA 2FZCB 2HS3A 2XMWA 3M8PB 2ZOFA 1KLMA 4GO7X 2YVSA 4NOHA 3DRPA 4DI6A 4Y6IA 2GCFA 3SSRA 1RA6A 2LLZA 3CCLS 1CEZA 2KM8C 2QL7B 3DLEB 3F0NA 3FC9A 5KFTA 3MR5A 1SJ3P 2DH7A 4DQSA 3IR6B 3NG8A 7FD1A 4R5PB 3FVYA 4OX9J 5FIIA 4DV7J 3TAQA 2YNHB 2P9GA 1Q95G 4TVAB 3HXMA 4J9UE 1PAUB 2F8HA 2XTJP 2CUYA 2DXEA 4RW6B 2MY7A 3R5AA 4A8OA 2I6WA 2RS2A 1HKAA 2BM1A 1GXLA 1Q16B 1TL7B 4DQPA 3T5HA 2QA2A 4DV3J 2ROEA 4R0JA 2GVDA 1XN9A 2Y0SD 1I5OB 4ZPVR 1Q78A 3MECB 3H98A 4ZCIA 4DL5A 1KTVA 1RWUA 3MM7B 3W1YC 3V81A 1SJ4P 2HZCA 2FVRA 3HHLA 1MWYA 1Y0HA 3CCMS 2RUGA 4DR7F 1GEHA 3NXZA 1HWUA 1IUJA 1X5PA 4KY3A 5D6GA 2VOOA 1J27A 5LXRA 4DU8A 2DCLA 1SIWB 1S57A 3JXOA 1KOOA 3KDOA 3PZPA 3NS7B 2BZ2A 1HNWJ 4M5DA 1YRTA 4DR5F 2HWHA 1NSAA 2GC8A 1N5QA 2MKSA 3GG0A 1OY9A 2AJ2A 5C42A 4OI0A 1AB8A 3FZBA 2BOAA 1NO8A 2AJ0A 2C22A 1QSYA 3MEEB 1QVFR 1RK8A 2D3OR 2HURA 3PIPQ 1WHYA 1KS2A 2WSEC 2R4FA 4JOUA 2JX2A 3O2IA 4DV2J 4X66F 4QYZJ 4KGKA 2GA7A 1X4HA 3NCRA 5HP1B 5AJ3J 2WCXA 5KG0A 2VBXA 5LOQA 3MAAA 3Q24A 3RW6A 5M2PA 2HW3A 4HHHA 2CJBA 3D6FB 1PC5A 3T5JA 5IC6B 1DTQA 4KFBB 2J9CA 2DRDA 3RBEA 3I6PA 4PPZA 5D4NA 3VGVA 1WG5A 4P6QA 2WW8A 4DS4A 2XSJA 2CQBA 3R1HA 4FF3A 3UVJA 3KHHA 2GO8A 3HHKA 5KFWA 4IH7A 2JDJA 1C4AA 3M6VA 1X4FA 1RWWB 2V0NA 1SL0A 4WXWA 1UJ6A 5KG5A 4ECVA 4EZ9A 4L73A 5KFOA 1RDRA 3BSAA 2XLIA 2ZVIA 4EU0A 4CLUA 5JXSA 4JI6F 2CJKA 1F3VA 1VIXA 2QFJA 1W7WA 2J9DA 4RJVA 5LMNJ 4HL9A 2BKNA 1DJ0A 2DR5A 5LMUF 2XS2A 1EQMA 4L6V3 3TJ9A 3S6EA 1U6FA 2G2YA 2GIRA 4K0KJ 4HACA 4Q7AA 1HNXJ 2E7VA 3ZTRA 4GC6A 3TX0A 3D3CJ 4KBIA 2AP6A 2X7IA 4ZA1A 1QY7A 1TKDA 3I0RB 3DDIA 2XC9A 3TQEA 3CMAS 2VIHA 1I51B 2VQFF 4KGZB 2F65A 3OSPA 3UI3A 5KFDA 2OPPB 1PYOB 1L3SA 1NU4A 2KFZA 2QEXS 3T1AA 1WF1A 3ENWA 3QO9A 5B09A 3WX4A 3KLGA 3TUJC 2AYGA 1NLKL 1FDAA 3NEKA 5F0UA 4Q8FA 4JV5F 2VG7B 4RNFA 2D74B 1UJ4A 4X4QA 1S12A 4MKBA 1VRTB 5KFRA 3R5CA 5KFYA 4RNNA 1CULA 3GQCA 3ZXWA 2HFUA 2CVEA 4BC9A 1T3OA 3K17A 2CNOB 3GILA 1PCAA 2DNQA 3QAEA 3OSNA 1D8ZA 2BJ7A 3THTA 3F44A 1NH8A 3W9IA 2G13A 3Q8YA 3NNHA 1L3KA 1URNA 2QYGA 2HMIA 1X4BA 5EHHA 3TZYA 4HH0A 1A9NB 4PG6A 3TX8A 4RW7A 1PC4A 4HR2A 4NI2A 2V8DA 3SFUA 1HWJA 3OXFA 3OQ2A 3H42A 3TP2A 3QFHA 4ENOA 3CJKA 5IS2A 2GVZB 3LAKA 4RBTA 1JLBA 3FCVA 1C1BB 3HVTA 4LRCA 2B4PA 2ZH4A 3A1YG 1VJQA 2A18A 5DRKA 2FZKB 4TY8A 4ZLJA 1XMOJ 1SH3A 1FJ7A 1FNXH 2E5JA 4PG7A 5DETA 2N3OA 1TELA 2HYIB 2YWWA 3BGUA
chains in the Genus database with same CATH topology
2O5DA 4D3GA 1FEHA 4YHHF 4LF7F 1YJTA 5IT9Y 4C97A 3CE8A 3H25A 1SBRA 3ZZZA 3BSOA 1IKVA 5DDRC 1WELA 2M0GB 1C0UA 1RKIA 2C3UA 1U24A 2XWXA 3LGMA 4MKAA 1G3OA 2XLKA 2FC8A 4ZVHA 3T9ZA 4USHA 2FJVA 5KFKA 4D3HA 2M8DB 2I2YA 3T5KA 5KOWA 2RT3A 5EX3A 2PEHA 4H4KC 1T94A 1UWBB 3IRWP 2KYXA 1FKPA 2EI5A 4NL5A 5FDLA 2IYIA 3M8PA 2RILA 1FERA 2PMZD 2YY3A 3CVKA 3DRSA 3PM9A 4DG1B 1RGVA 4IDKB 2MB0B 4PWDA 4LIWA 2ZBCA 3FJ2A 3D1HA 2RKIB 2Y1RI 3TNVA 1M5PC 4NYOA 4FBUA 5J2MA 2KG0A 1RTIB 3SEOA 5KT5A 4DR1F 2KTQA 2B5JB 1N5YA 2O01C 2ZDOA 3MEGA 5KAKA 4Q2LA 4CNZA 2ABYA 4PUOB 4X4TA 4XPCA 4H4KA 2J8AA 2W4PA 3D0HE 4DV6F 4DSKA 5T14A 1SXLA 3DLEA 1NJWA 1X4EA 4RW8A 1BQNA 4O23A 4J37A 2FC9A 2QA4G 4PKDB 2ZD1B 5KFVA 2RH3A 2I1RA 3O5TB 4IH5A 1UL3A 1Y5NB 4R5PA 4MTPA 3GWCA 1RTDA 1GH8A 2Z0GA 2CZ4A 1HNIB 3VF0B 3WBZA 3FEXB 2B4OA 4ZLPA 1S9GB 2JRSA 1W2IA 3B4DA 1J5EF 2AYEA 4NLVA 3DLLQ 3GSDA 1FE4A 1DQ9A 4OJHA 4XK8C 1DHMA 4JUZA 2E9RX 2ROGA 4KHMA 3FRZA 2RU9A 1FNOA 4I2PB 5EN1A 1EETA 3MFIA 5F0WA 2CQDA 2XWYA 5A6WA 4CTAB 2FJAB 4E0DA 2HHHF 3SFGA 2ZNZA 5GVQA 2V9WA 4OIXA 4YB5A 2YWHA 4B9LA 3LAMA 4I67A 1FE0A 4RW6A 3PRBA 1EP4B 3O3LA 1OO0B 1JLQB 5C25B 5DLGA 2DK2A 4F4XA 3PKMA 2YX1A 3DM2A 1IKWA 4QWAA 4ECXA 4A8QA 2WBRA 3RYLA 2D9PA 4I68A 2G4BA 5D4LA 5B0EA 3DXSX 3V4IB 3BEGB 1N4LA 2DPJA 2C3YA 3QJJA 2VPZB 1ZETA 4EEYA 4QOTA 4IG3A 3VQSA 3D5MA 3DMJB 2B4UA 2MKCA 3HI9A 3OTEA 4MH8A 4Y2IA 2J0XA 3UW1A 1D3WA 2CQ4A 4YR3A 3PO4A 3C2PA 4C3MA 2E66A 4J9SA 1ULRA 1V6HA 2YKMB 4HT7A 3OUYB 2K8GA 4RWWA 1N36F 1TL1B 4AYBD 1NK7A 3OXLA 1IKYA 3MF5A 3M9OB 1TZ0A 2ASLA 2BQRA 3QLHA 4ES1A 2F40A 2I8EA 5F3ZA 3WC2A 4RW9B 4PRFA 4PXCA 4ED8A 3IGVA 1T7PA 3OTBA 5IQQA 4X4VA 3UR0A 3U1LA 1NH7A 2OIHA 1M90T 1VBXA 3Q8RB 1KLMB 2GGPB 4FNHA 3GFHA 4DR3F 2VG5A 2K1RB 3POTB 4RUCA 4R8UA 2ZKUA 4GC7A 4DSEA 2RMLA 1D9FA 4Q2MA 3N5BA 5EWEA 4DSIA 1RYRA 3FQLA 1S4FA 2RDJA 5A8WA 2HFZA 2KXFA 1N5TA 3OFGA 3TA0A 2EG2A 3PFOA 3CD7A 2XMKA 2VASA 3J7YI 1JIHA 5J2NA 3QIPA 4B02A 2E44A 1KD1T 1DQAA 3KLVA 1S72S 4ZMMA 1RISA 3KTQA 3BO4A 4K4XA 1JLAA 3HHLC 4FBTA 4HDHA 2LYVA 3ULHA 4I2QB 3DU6A 1QAJA 4KE5A 2W9CA 2MHNA 1ZTTA 1YJRA 1FT8A 2KN4A 3DLGB 4AE5A 5KT7A 3SI8A 1QSLA 2LVWA 3VZHA 3U1NA 2HFOA 2IFXA 5CZVA 1D0EA 2ZHAA 3EYZA 4RZRA 2KYZA 2UXDF 1VIOA 5HROB 2NYIA 1MMNA 2KM8B 1SC6A 2CQHA 3DYAB 2LU1A 2AU0A 1LW2A 4JI3F 4OX7A 4ELUA 1CSJA 2ZHOA 1UP1A 2FTRA 4EWTA 1CVJA 3AB2B 2VQEF 1YJWS 2JVOA 2ZZMA 4B9SA 2JEFA 1H0HB 2W7AA 3B4MA 3BGRA 1APSA 3MD3A 1N54B 2RU3A 1QAXA 4C2MA 3VAHA 3KLIA 2V8GA 1K8AT 2Q43A 1Y7PA 3IO1A 3RRHA 1RT3A 1VRUA 2DCUB 3EUNA 2MXYA 4WCEQ 1OSDA 4X4SA 1I94F 2YH0A 3NLCA 3CJ5A 1XNQF 5JVGQ 4JYAF 1R8CA 2IM3A 4QQBA 3SCLE 2R8JA 4PQAA 3SV3A 1HQUA 2D1CA 1S1UA 2YKQA 4DL4A 1U6ZA 1P9QC 2DISA 4Y3CA 3H5SA 2NPFA 2JLFA 4YQWA 1VQ5S 1ZTWA 4ZHRB 1HWIA 1WG1A 2W24A 4NYZA 4B3SF 4K50A 1GTHA 4G1PA 4L72B 1KRPA 2JEIA 3GR0A 4NZ0A 1KQGB 4NCAA 1QE1B 2X1FA 2PIIA 3CTRA 4BDPA 1X7VA 1S6QB 1KHWA 2UXBF 3C6UA 4X4PA 4OMFG 1MROA 1S49A 3JSMA 3AH6A 2OKQA 4PG4A 4N56A 2XGPA 3RR8A 4Y65A 2MGZA 2U2FA 2B51A 2QA4S 3LWLA 1IQZA 4TU8A 2ERRA 4LFBF 4K4WA 4DQIA 4PG8A 5DGAA 2DGWA 1IXKA 1SKWA 2PMHA 1SUQA 4A47A 1SJFA 4OZ1A 2ZH3A 2L48A 1YQHA 2FJBB 2K3IA 3V4MA 3MOJB 1DLOA 4NCGA 1LWEA 4FXVA 5GMKa 3G71S 3AA8A 1JJHA 4G1QB 1GTEA 1GAOA 2G9OA 4OZJA 4QWCA 1S6PB 3VWSA 3V81B 2E9TA 1HBNB 2KH9A 2XG8A 4OL8A 3HHLB 4DQRA 2BBEA 2OP5A 5THWA 1RT4B 4M94A 5EGYA 5KFCA 1K1SA 4ECWA 5HP1A 1Q8BA 5K5MA 3CULA 4JV0A 4QJVA 4C8OA 4I56A 3P3DA 4FF2A 3IS9A 2R7VA 1UETA 1X5SA 3X3UA 1UVMA 1JXEA 1XWLA 2EVZA 3LP0B 1JNZB 3ISND 2ZC4A 3N01A 3TI0A 1JK9B 5HL7Q 1VMBA 3TO8A 2F3JA 2EFGA 3V6DB 1T95A 1SQEA 1IJFB 4NMLA 2FDNA 3LP2B 4I6AA 1LXJA 5LSRA 1S6UA 3GE9A 3M8RA 4UOCA 3SSQA 1TL4A 5KT2A 2DNRA 5IT0A 3E01B 2ADBA 2OPQB 3MFHA 4QIVA 3ZZYA 3K5PA 4OQJA 1N34F 1IBLF 4ECQA 4IFYA 5DQIA 3MMAA 4JV2A 3MMCA 3R5DA 3HF5A 4O3PA 4UQTA 2KT2A 2OD4A 3VAKA 2LCWA 3FEYB 2CPHA 3MM9A 3IAM9 2HLTA 1RT2B 2XMTA 3N9UC 3NCQA 4IR9A 1S77D 1W25A 3MM5B 3L09A 2CQIA 4R0EA 2ZKTA 3N28A 1LQ9A 4OHVA 5B0CA 4M5DB 2B0GA 4Q5VA 3RRKA 3MM6A 1S1WA 3T1HF 5MLCV 1LK5A 2ZFHA 3BN4A 2R8HA 4F4KA 2KU7A 4WFNQ 5LSLA 4AFFA 1X5OA 4KC5A 1JLEA 2Q6CA 1N88A 1O0PA 4BWJA 4RWXA 1WEXA 1T05B 1TK0A 1SH0A 5J2QA 1U6BA 3MM8B 1VHFA 2WSCC 4L3NA 5DGBA 4I7FB 5C42B 1S76D 1VQ7S 4OI6A 2AW0A 1VQ6S 4K5SA 1C0TB 4ZP6A 1ZZNA 1O51A 3D1QA 1BWEA 3C8YA 3M2VA 2AGPA 1R8AA 2HWIA 4IOAQ 2DRBA 3I56S 1JXLA 1YWXA 5BYQA 2RQCA 1QSSA 3MHYA 4CNYA 4ID5A 3NKYA 1F60B 3K0JA 4J9KA 1CG2A 4LF5F 2XULA 3JTOA 4I4BA 4F67A 1J5OA 1I6JA 4B3RF 1F9FA 1ZPWX 4TU9A 2XO7A 4HTIA 1HBOB 3R5BA 1FVQA 4LQ3A 2OFGX 2J6SA 5KFPA 4RNOA 2IA0A 3TQ1A 4WYLA 3H2UB 5HMXA 2M9KA 2V4JA 5DM6Q 4RU9A 3M2RB 2MKKA 4WTYA 4C0OC 3TA1A 2W8KA 4TYAA 3UR3C 2DGOA 1KR4A 4A4JA 3MZIA