4PQUB

Crystal structure of hiv-1 reverse transcriptase in complex with rna/dna and datp
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
425
structure length
412
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of HIV-1 RT-RNA/DNA ternary complexes with dATP and nevirapine reveal conformational flexibility of RNA/DNA: insights into requirements for RNase H cleavage.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase, hydrolase/dna/rna
molecule keywords HIV-1 Reverse Transcriptase, p66 subunit
total genus 120
structure length 412
sequence length 425
chains with identical sequence D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4pquB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pquB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pquB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pquB03
4G1QB 4TY8A 4ICLA 3BQ0A 1LW2A 2YKMA 4YR0A 1SUQA 3LP1A 3MEEA 4RNOA 3FSIA 5DQIA 3HVTA 2W8LA 1N48A 2OPPA 3E01A 5J2MB 2BQRA 4NLWA 4WFYA 1NHVA 3NAIA 3QIDA 3UR0A 2E9TA 1ZETA 4NLDA 3FFIA 4RNNA 1HYSA 1YVFA 1Z4UA 2OPQB 1IKWB 5HLFA 3MR2A 1N56A 4NLUA 5DG9A 3CVKA 4IRKA 5DQGA 5HBMA 4Q0BA 5F8NA 3KLEA 4KO0B 2YNHA 4TYAA 3OL9A 1RT5A 3KJVA 4PWDA 1FKOA 2XI2A 3G6VA 3OSPA 2ASLA 2WRMA 3D28A 3IGVA 4URGA 3PW0A 1TKXA 1HQEA 3MEGB 3M9NB 2ZKUA 1BQMB 2CKWA 2QE5A 1BQMA 3DLEB 4Y2AA 3GIJA 4K4TA 3KK1A 5KG0A 3JYTA 2HNYB 1MU2B 3DMJB 4KKOB 1ZTWA 3GV5B 4RUAA 4EO6A 4J9QA 3JSMA 3RB0A 3I5AA 4ZVHA 3DYAA 4R8UB 5HROB 4RNFA 3PR5B 1IM4A 2W7PA 1JLEA 5HP1B 3GQCA 3H4DA 3SI8A 4WE1A 4ZP9A 2ZE2A 2AX1A 1S10A 1QAIA 5L1KA 3IN5A 1T94A 3BSNA 4J9PA 2J6TA 3Q8RB 3DOKA 4NRUA 2AGOA 3DRRB 2WB4A 1RT4B 1RT3A 5DG8A 2JEFA 3TAMA 2VG7A 4EYIB 4K4UA 1CSJA 5KFTA 3MR3A 1RYRA 2V4QA 2WTFA 3DM2A 1QE1B 3G6XA 4J9MA 3RB6A 4J9SA 4URSA 4LSNB 3OHAA 2AGQA 1JX4A 2VG6B 3V6JA 3QGGA 3H98A 3M8PA 4EEYA 1W25A 3QGIA 4QW9A 2BE2B 2UUWA 3BQ1A 1S1WA 1RT7B 2C28A 1TL3B 4O44A 3MEGA 3KK3A 3CWJA 3M9MB 3ISNC 3IS9B 1RT6B 3H59A 3N6MA 3NBPB 4KHMA 4ECTA 5KFCA 4TYBA 3G86A 1RT2B 4DEZA 1LW2B 1C1BA 3CJ3A 3IRXA 1JXLA 4NLYA 4FS1A 3Q8PB 4J9LA 4O3RA 5CYQA 1IKYB 4O3PA 4JUZA 3H5YA 3RBDA 4H54A 1FKPA 1TKTB 3V81B 4PQUA 1U09A 4ECRA 4ECYA 3JSMB 5KG1A 4ZHRA 4F4ZA 5EUHA 2OPSB 3M9OB 2WONB 5I42A 3QYYA 4JV2A 1RT6A 3GYNA 4ID5A 4RNMA 5L1IA 2JEJA 2YNFA 2B5JA 1S4FA 2W9AA 2BQ3A 4LQ9A 1IKXB 3MF5A 4O4GA 2R8GA 2FLPA 2YKNB 5KFPA 1VRUB 4QW8A 3SFUA 2VG5B 5F8LA 4GC6A 3I5CA 2VG5A 4MK8A 4GC7A 1C0UB 1S6QA 4KO0A 4TXSA 3DM2B 3T5LA 2FLNA 2R8IA 3GIIA 1D1UA 4NRTA 3RAQA 4TN2A 2F8EX 4ZMMA 2RDIA 2C2EA 1S0MA 2FVQA 1HYSB 2D3UA 4YP3A 2RF2B 4Q44A 2JEIA 4PUOB 5J2PA 2D41A 2UVRA 4B3OA 2D7SA 2JC0A 3V81A 1N5YB 4PQUB 3HVTB 3H4BA 1QUVA 2ALZA 4MK9A 4RW4A 3CO9A 5L9XA 5HROA 4FBTA 5KT2A 3DYAB 4IFVA 3IRXB 2B43A 3H5SA 4G1QA 4R8UA 1C1BB 4ZVGA 1DTTB 3LAKA 1T05B 3BGRB 4I2PA 3BR9A 3DRPB 1MU2A 1XR7A 1LWCA 5F9LA 4ED3A 5C25A 3JYTB 4QPXA 2HWHA 1IKXA 1C2PA 1REVB 3NAHA 1C1CA 1S0OA 4NYZA 3EPGA 3IGNA 4K4XA 5F8GA 1JKHB 4QWBA 5KG6A 2AU0A 3I5BA 2HNZA 5KFYA 5KT6A 1S6PB 1K1SA 3LANA 5F8IA 4ECQA 4J9OA 1RTJB 4RW6A 3KLVA 1HNVA 1TV6B 4URQU 5KG3A 4Q0BB 4LSLA 3KLIA 5C5JA 5KFQA 4WYWA 1LWEB 4F4XA 1IKWA 5HLFB 2V9WA 4NLVA 1JLBB 1IKVB 3QGHA 3CDWA 5KFSA 1JLCB 4NLXA 3MECA 1RT4A 1MMLA 1WNEA 4ZPDA 5KFRA 1S1VB 3BREA 3IS9A 1S1XB 3DI6B 2GIQA 4YQWA 4R0EA 1FK9B 5JXSA 3KLHB 3BQ2A 2V0NA 3DLGA 3ICLA 3BGRA 4NLRA 3M8PB 4IQXA 3MEDA 3ITHA 4ICLB 3UPFA 2VG6A 2YKMB 4M94A 3E51A 3PHEA 5KFMA 4H4OA 2XGQA 5F9NA 4WYLA 2E9ZA 5KFOA 4IH7A 3BJYA 4ED7A 2BR0A 3I0SA 5J2QB 4RW4B 2BRKA 5F8JA 3PZPA 4QWDA 3EZUA 4NCGB 5J2NB 3I0RA 3PR4A 3N6NA 3FDSA 4IG3A 3KLGA 4ZVFA 4J9NA 2C2DA 4KV8B 5C24B 5KFFA 1C0TB 2W9CB 4RW7A 5C24A 4WFXA 4ZPAA 4ZVEA 3H2LA 3T5KA 4IG3B 3KLGB 3KMQA 1JLBA 2IAJB 3FRZA 1K1QA 3IG1B 2W7OA 4FS2A 3H5UA 3RBEA 3Q8SB 1SV5B 2BANB 3KLEB 4ZPBA 1S1UA 3KHHA 4F50A 4K4SA 5KFDA 3KHGA 3PW4A 1S6PA 2IMWP 4I2QA 3V6KA 1TL1A 3C6TB 3KNAA 3OL8A 3BSAA 2V4RA 3CDEA 1S9FA 3FFIB 3MR6A 3KLHA 4RW8B 4KKOA 1FK9A 5T14A 4DG1A 3NGDA 2OPPB 3MFHA 4NLQA 4DG1B 1RT7A 3SFGA 2HNDA 5DLFA 3PW2A 2OH2A 3MECB 4IFYB 5D3GA 1TL1B 3Q8QB 3DRSB 3OL6A 2EC0A 4I7FA 4MFBB 4MK7A 3DOLB 3OHBA 3T1AA 4O3NA 3RB4A 3IG1A 3HKWA 2IAJA 3CJ2A 3NKYA 4IRCA 3V6DB 4HYKA 1HQUB 4K4VA 4IOBA 2YNIB 4ZPCA 3QO9B 5KFVA 3PJWA 5J2NA 3T5JA 3KMSA 1HARA 2CJQA 1KHVA 1HNIB 1RT1A 3LP0A 3M8QB 4I2PB 2R2SA 4ED8A 1JLQB 4LSNA 3FQLA 4EBEA 3UDLA 3TQ1A 1UWBB 4O3SA 3BSOA 2YKNA 1HPZB 2IJNA 4IH5A 5KG4A 2WCXA 3GV7B 3KK2B 4H4MB 4NLOA 4IR9A 1J5OA 3TAMB 4KFBB 4WZQA 2ATLA 1D0EA 3CDUA 4DL6A 3DLEA 1S1VA 1S1XA 3DI6A 2ILYA 5KG7A 5KFKA 4RW8A 3DLKB 4MKAA 2O5DA 1HQEB 4IR1A 5I3UB 5F8HA 1RAJA 4Y34A 4ED2A 4Y3CA 1RTHA 1S1TB 3MFIA 3RAXA 4HKQA 3LP2B 4EYHB 3OLAA 3GILA 4JV0A 5DQHA 3C6UA 1QAJA 4Q8FA 3NMAA 2RKIA 4O4GB 1C0TA 5KT4A 2W9CA 3KHLA 2OPRA 3DLKA 4ZP8A 1S9GB 1TKZA 4ID5B 1DTQA 1C1CB 5J2MA 2OPRB 4RUCA 2YNIA 3QLHA 3CJ5A 3E01B 2BQUA 1LWCB 1HQUA 2JLEA 5C25B 4O3QA 3KLFA 4U6PA 2OPSA 4H4MA 4ZHRB 1ZTTA 4R5PB 2FVSA 4PWDB 4MIBA 1BQNB 3C6UB 2ZD1B 5KG5A 4JV1A 4TY9A 1JIHA 4NLSA 2XWYA 5HBMB 4KAIA 2GC8A 4DL4A 1HNIA 1RT1B 3LP0B 2OPQA 3M8QA 1XR5A 5KFWA 5KFBA 2W9BB 4Y2CA 1RYSA 3OL7A 1JLGA 2HMIB 3CJ0A 5I3UA 3V4IA 1N6QA 4K50A 5KFZA 5J2PB 2VA3A 3N6LA 1T3NA 4Q8EA 4ZP7A 3PW7A 4WZMA 4RU9A 1JLCA 5KT7A 1TL3A 4NLTA 2XC9A 2W8KA 3CJ4A 4XPCA 1LWFA 2AWZA 1RA6A 1SH2A 2XI3A 4TY8B 2XCAA 1EP4B 2ILZA 1LW0A 3QZ7A 4Q43A 5L1JA 1LW0B 5KFXA 1VRUA 4DL5A 4NLGA 3QZ8A 3DMJA 1EP4A 2FLLA 1SV5A 3MEDB 2ASDA 3LP2A 3H40A 1RTHB 1S1TA 3GIKA 2HNDB 2IM1A 4F4WA 5DG7A 5KT5A 4ECVA 2XGPA 3QO9A 4RZRA 4RW7B 2XCPA 2DPJA 5C42B 2WONA 4KV8A 5I42B 2IM0A 3PW5A 4DL2A 2AQ4A 1RTIA 3GV8B 1GX6A 2ZE2B 4O3OA 5KFJA 3OSNA 1RA7A 3V4IB 1N6QB 3DOLA 1KHWA 3GIMA 2C22A 1JLGB 2IM2A 4MFBA 2QV6A 1TVRA 2W9BA 1RDRA 1IKYA 2FVPA 1LWEA 4RW9A 2R8HA 3KK2A 1S48A 3KLIB 4RW9B 4J9KA 1HPZA 3DDKA 2ZD1A 4IFYA 1SH3A 3HHKA 2RDJA 1BQNA 4MH8A 1RT2A 4ED0A 4R5PA 2AGPA 4QWEA 1S9EA 3NBPA 4XPEA 1N4LA 4ECXA 2HNYA 5C42A 2IM3A 3KK1B 3G6YA 5K14A 4O44B 5KFIA 2BE2A 5K14B 1S1WB 4QWCA 4DL3A 3LP1B 1R0AB 3MTKA 4TQSA 2VA2A 1KLMA 4M95A 1JLAA 3I0SB 2J6UA 4DL7A 2C2RA 4RNHA 1DTTA 2JC1A 3VQSA 1JLFB 2AX0A 3BSCA 5KG2A 4ECSA 4ECWA 4IFVB 1XR6A 1RTDA 4NLPA 1HNVB 1TV6A 1LWFB 3DLGB 5EWFA 3DRSA 2YNFB 5D3GB 4K4WA 1SH0A 1TVRB 4IDKA 1S49A 1RT3B 1TP7A 5L1LA 3DOKB 4F4YA 3DRRA 4YR3A 4EO8A 4B3OB 2WK4A 2D3ZA 4ZP6A 3V6HA 1S0NA 2IA6A 1REVA 4NCGA 5KFGA 4KFBA 4ECUA 2R2RA 1T03B 1JLEB 5HP1A 3RB3A 4LSLB 5F8MA 2WOMB 1RTDB 4O4RA 5KFLA 3ISND 4EBCA 4TQRA 1UWBA 3ITHB 4KB7A 3OLBA 2WOMA 4WXWA 2FJXA 1JLQA 1JLAB 2BANA 3KLFB 1KLMB 1R0AA 3KK3B 1EETB 4IG0B 5J1EB 4ED6A 2HAIA 4U7CA 1DLOA 5EDWA 3UQSA 4YMEA 2IBKA 1TKXB 1GX5A 2R2TA 2FJVA 2GIRA 2JEGA 2RKIB 3DRPA 4IDKB 1S9EB 2UVWA 3NL0A 1HMVB 2I5JB 3TVKA 1T05A 4KBIA 4YR2A 3T5HA 3H5XA 2HMIA 1FKPB 1TKTA 3QIPA 3QIPB 5J2QA 3EPIA 3HVAA 3HVWA 4IH6A 5CYQB 5EWGA 2IC3B 2VG7B 4H4OB 4Q45A 2HNZB 1N5YA 2FJWA 2I1RA 5KFEA 2IJFA 4WFZA 4ECZA 4ED1A 3D5MA 1JKHA 3LALA 3PJXA 1DLOB 4MIAA 1OS5A 3FQKA 3T19A 1VRTB 2YNGB 3QLHB 3PVXA 1VRTA 2YNGA 1TQLA 1DTQB 4QWAA 4KSEB 4KE5A 4K4YA 4EBDA 1S9GA 1TKZB 2BRLA 3MEEB 5KT3A 3KHRA 1SUQB 1I6JA 1C0UA 1S6QB 1IKVA 2FVRA 3C6TA 4XO0A 4OL8A 2HWIA 2IC3A 4MKBA 1S97A 4I2QB 5KFAA 5FDLA 5JUMA 1T03A 1S1UB 1QE1A 1NHUA 4NZ0A 1RTJA 4RW6B 2B5JB 2J6SA 1HMVA 2I5JA 3KOAA 4TLRA 1RTIB 2DPIA 2R8JA 4LQ3A 5CYMA 2UVVA 4PUOA 2B6AB 2RF2A 2E9RX 4KHRA 2B6AA 3V6DA 5KFUA 5CYMB 2R2UA 1FKOB 2UUTA 3CIZA 5J1EA 4WXOA 1RT5B 3KJVB 1EETA 4IG0A 2YNHB 2ASJA 3I0RB 4J9RA 5KFNA 4G3IA 4IRDA 5DGBA 1NNDA 4WE1B 5DLGA 5EWEA 2UVUA 1J5OB 2WHOA 2R8KA 4I7FB 5FDLB 1JLFA 4IKAA 5KFHA 3MR5A 5DGAA 2FVCA 4X2BA 4FBUA 3LAMA 4K4ZA
chains in the Genus database with same CATH superfamily
1LOUA 5IWAF 4TY8A 4ICLA 3C46A 1LW2A 2YKMA 1TUVA 4NZ7A 4AQYJ 5CA5A 3T1YJ 4HLBA 3VWSA 1SUQA 1NXIA 2RU9A 4YR0A 1AROP 4RNOA 1QAXA 2JSXA 3LPYA 4PZVA 3BO4A 1M5OC 3GFZA 1SL1A 2DKOB 4P6QA 1X8DA 5J2MB 2E29A 1FA0A 5K5MA 4WFYA 3ILLA 4EI2A 3QIDA 4M5DB 1M90T 1MMNA 1X4EA 4NLDA 1R0CB 4ES2A 1C4CA 4F2SA 2GNKA 4CO4A 1YVFA 2VB6A 4DQIA 1Q16B 2GJFA 2W2OP 4DJBA 2IVFB 2OPQB 1N56A 1FWLA 2L9NA 4NLUA 2DNQA 3W5ZA 3CNQP 3PACA 2HFSA 3Q24A 1O8BA 2YPYA 1U1QA 1Y3JA 2M8HA 4K5RA 3IR7B 1PYTA 4TYAA 3OL9A 1NDLA 1OJ4A 1O5JA 1PJ5A 3IGVA 4F25A 2GVZA 3PW0A 2F1FA 1K73T 1FXLA 5DZ7A 2ZKUA 3CW2C 3LF0A 4I4BA 3I4HX 4QR1A 4KY3A 2ZH5A 1VQ9S 2HHWA 3TYTA 1BQMA 2HEKA 4K5SA 1F2GA 3KK1A 2W2NP 3JYTA 4PAAA 2DR6A 5KG0A 3ZZUA 4EGLA 1MU2B 1OO0B 1HFEL 4LF2A 4QIEA 1ZTWA 4KKOB 2BJ3A 2LKZA 2EEYA 4MYUA 4NMLA 3JSMA 4EO6A 3QPIA 2MKKA 3RB0A 4ZVHA 4OI6A 4JI2F 1CJVB 3D1OA 1DFDA 1JWWA 3VCDA 3PR5B 1HD0A 4F26A 2IY5B 2CQ0A 3SQOP 1H74A 4ZP9A 3QRQA 3OJUA 4JI1J 4L6V3 5D4NA 2KG0A 1JJCB 1QAIA 5IM0B 5L1KA 2CRLA 1YIJS 1T94A 1YRTA 3BSNA 2M0GB 3NGKA 4J9PA 3DOKA 2J6TA 2JEFA 3P49B 3G8QA 4UQTA 4B9UA 4EYIB 1WC6A 4QJVA 5CYJA 4LF5J 4PXDA 4K4UA 1BWVA 5LT5A 2HPUA 2ZDOA 3QBCA 1F9EB 3LH2S 2VJUA 2CNLB 1SI9A 3BM7A 2BJ9A 1IBMJ 4XTTA 5D77A 3M8WA 4XDDA 2VOPA 5LSOA 3RB6A 4J9SA 4B3SJ 4G65A 2C42A 4LSNB 2RDDA 2VF3A 2N7CA 4OI1A 2MKIA 2MJNA 4DPXA 3OHAA 3T1YF 3UD5A 4TKTA 1YZ6A 3V6JA 4L3NA 3H98A 3M8PA 4DS4A 1W25A 3KKFA 1UJ6A 3FZBA 3NS6A 1RT7B 3O44A 3SDEA 4RUCA 3D6FB 3PIPQ 2UP1A 4JI5F 4CO3A 1FRKA 5D4LA 1N33F 3VQTA 2QJ3A 3M9MB 3H59A 2PEHA 1Q7LB 3N6MA 3MMCA 2NUUG 4KHMA 2B4VA 4M5LA 4DV2J 1QLNA 3TOQA 3HT0A 4P71A 1RT2B 3DKDA 3PM9A 4QYZJ 1LW2B 3QMQA 4MKVA 3IRXA 4NLYA 1KONA 4J9LA 3PYEA 3NG8A 4FNHA 3AOBA 2AYGA 3NCRA 3UVJB 5LSLA 1X9WA 4O3PA 2B7CB 2B9YA 2WVFA 1U09A 2LXIA 3D9BA 1BXNA 4JI8J 4F4ZA 1H0HB 3K5MA 3M9OB 2WONB 5L39A 3AOAA 1GXTA 4ID5A 2GJIA 4M5HA 2BJ8A 2XY6A 2JDJA 1U49A 2YNFA 5E3CA 4DPTA 2LFVA 4LFAF 3CDAA 2EBGA 1URRA 3MF5A 2RS8A 4LQ9A 2DNRA 3IAS9 3TVYA 2LLZA 3CT9A 4OJGA 2FLPA 3OTBA 3N5FA 2VG5B 1EQMA 4ZDNA 2RQCA 3I5CA 4MK8A 1Y10A 4GC7A 1C0UB 2R8IA 1D1UA 4NRTA 2GHVC 1RB0A 4FYYB 4TU7A 1QSLA 3HX9A 2C2EA 2FVQA 3R27A 4YP3A 4Q44A 2L9WA 4X4UA 2X1GA 2RJZA 2D41A 3G6ES 1I94J 3KTQA 5CABA 1KOOA 2D69A 2C3MA 3JQKA 4CTAB 4LT6A 4PQUB 5HL7Q 3HVTB 2V8DA 2AKWB 4G6VB 5HROA 4AL6A 2ABYA 2Y0SD 1Q0NA 2VL1A 2B43A 3H5SA 4R8UA 8AT1B 3OXFA 4OV1A 2NXEA 1C1BB 3HULA 4KYZA 4ZK7M 3LAKA 3I56S 1XC9A 3UE2A 1CJUA 1WD6A 2VICA 1XR7A 1ZM4A 1RKIA 2KYXA 2DB1A 3W2WA 3G71S 3AD8C 1IKXA 1C2PA 1FT8A 1KQFB 3ENQA 4Z2XA 1S0OA 1GXLA 3C16A 3PO5A 1DBDA 2DGXA 1FD2A 1F3FA 2YWGA 1ZM9A 3IGNA 5E3QA 3RBXA 5BXIA 4K4XA 1B3TA 3A8EA 1CJTB 1WACA 3I5BA 3AJ1A 4LR8A 2AEFA 4ZVTB 1S6PB 4FNIA 5F8IA 3LANA 3MM7B 3OTOF 2MJUA 4RW6A 2W7AA 1ZOTA 5D0GA 2ZHBA 1HNVA 1TV6B 1WC5A 4OI2A 3NS5A 3HM9A 2CPHA 3UDVA 4LSLA 1WEYA 3KLIA 3B4MA 4A46A 5KFQA 3HHDA 2MEWA 2HK3A 2KJWA 4LF8F 2GCFA 5ADZA 4ZPTR 2RRNA 4DL0C 3D0GE 1I3OB 3M6VA 5KFSA 3D2WA 4U7UD 1RT4A 1MMLA 3QT5A 3F44A 5ETTA 3S6EA 2ZZMA 3TUZC 3QJPA 2Z56B 3CJRA 3MAHA 2G9OA 1QDUB 3J80Y 1VYAA 4O23A 5IS2A 1IBKJ 2YWFA 3V2UC 3MDFA 1VS3A 5B09A 1UVNA 1RWOB 2ZH2A 2DH7A 3R5JB 3DRYA 5GAEI 1VK3A 1LK5A 1PIEA 4IQXA 2XGQA 2OSQA 3MUVP 2ACYA 3M32A 2IBOA 2V8HA 3KUGA 4ENOA 4KJIA 1WDTA 4ED7A 3ZC4A 4USUA 1EX8A 2LEAA 4CI0B 1FD8A 1SC3B 3FDSA 4IG3A 2G2OA 3V5RA 1Q82T 4KV8B 2WSFC 4PR6A 1RWPB 2EFNA 5C24A 4ZPAA 1NZAA 2IPOB 4ZVEA 4DCJB 2M8DB 1XNRF 5D8HB 3FRZA 4CZCA 2XMMA 3IG1B 3L7PA 1PJ6A 2B9WA 2GGPB 3IA0A 2FY8A 3DLLQ 2KI2A 5FJ4A 4UZCA 3PFEA 4ZPBA 7FD1A 4B9SA 3GMGA 2E44A 2C2MB 4I2QA 1ZAWA 1TL1A 2FQQB 1CG2A 4LBIA 4Y28C 3V6KA 4IYQA 2V4RA 3CDEA 3T3FA 1WTBA 1TAQA 1EZZB 1RLDA 4P72A 1FFSB 3N0VA 3GJTB 2UUCJ 3RUBL 4DQPA 4ILMA 1RT7A 1V3SA 2L41A 5DLFA 3HDSA 1WC1A 4DSEA 4F02A 3A13A 2B8PA 1FJGJ 2GIFA 2KXFA 2CQDA 3UD4P 2XYHB 2ZVIA 4RLEA 1FNMA 2DISA 2DY9A 2R3VA 3Q8QB 3CMAS 2DVIA 2EC0A 1CLFA 2DO0A 1KN6A 1WC4A 3IC1A 4GRSA 5AJ3J 2LDIA 3OHBA 4F04B 4O3NA 3D1QA 4Z7CA 3EPGA 1S5ZA 1YJRA 3CJ2A 4AXJA 4IRCA 5ITHA 1RCXB 3AY0A 3DHWC 3D66A 1HQUB 4K4VA 3PRVA 4IOBA 3DLJA 1R6VA 4HI1A 2EK6A 1U1RA 2BXJA 3G87A 3TW0A 1HARA 2YKOA 4UTGA 4DFJA 4GVBA 3LO3A 1SB6A 1RT1A 4X84A 1OQ6A 1L3TA 2DRDA 3H7HB 3NXZA 2F63A 2QG9B 3FQLA 2BMBA 3NEKA 3UDLA 2HGNA 3DNCA 4DFPA 3TQ1A 1Q86T 1S79A 1WC0A 3M4XA 1U8WA 1S0VA 3UN2A 4IH5A 2WCXA 3K8VA 4OYPA 3KNGA 4NLOA 1J5OA 1VISA 1QVGR 4WZQA 1DARA 1RE1B 3PRBA 2ATLA 1D0EA 4HEA9 3DLEA 3GIRA 5AXLA 1S1XA 5KFKA 2V4JB 2O5DA 3GSIA 3PNIA 5IM0A 4IR1A 4LBPA 3RW6A 1HBOA 4V19X 1PGZA 3Q8YA 1HIYA 4P73A 3FCHA 5K8OA 4DR2J 3THTA 2RU3A 5ETKA 4KTQA 1RU2A 2XYPB 2BKPA 3LP2B 2Z8QA 2KFZA 3M2VB 3PDNA 3GILA 2BBEA 5KTQA 4E2FB 2RQ4A 4LVOP 2XQCA 3OFEA 1NKBA 5IOLA 3MM9A 2CDRB 3HFVA 2FIUA 4BDPA 1KDNA 1YG0A 1NLKL 2KFYA 3O6QA 1H3DA 2RKIA 2P2CB 4ELUA 1NJYA 4DR4J 4FYWB 1HWLA 1RHMB 3DLKA 4QYRA 4ZP8A 5J2MA 4C8ZA 1HQUA 4F3QA 4U6PA 5A6PA 1U0HB 4AT1B 2OPSA 4K59A 3SV3A 4LF4J 2HVZA 1UVMA 2YWWA 2XYGB 1NBEB 3TUIC 4R0JA 2H5EA 2BJEA 2HZVA 2UUAJ 5HQLA 1D3WA 4NL5A 4WK1A 3M8QA 1XR5A 5KFBA 1YDLA 5AXNA 4Y2CA 5H1SV 3DRXA 2GAHC 1VJWA 2H5JB 1R8HA 3QSIA 1UFLA 3KG4A 2NSBA 2EFVA 1VBYA 1JJ4A 5KFZA 3N6LA 1UP1A 4Q8EA 2BYCA 2P8IA 4TVAB 4CM0A 4RU9A 2HZCA 4NLTA 2GAGC 2GS8A 2ZBCA 1PC5A 3NNHA 1P9YA 3K59A 2AWZA 2MYFA 1RCOB 1RA6A 4DSKA 4DV5J 1ZM3A 2IRYA 2VDHA 3C19A 3QZ7A 4DR6F 2CQCA 4NLGA 3P96A 2AJQA 2QO3A 3HHLB 1V9OA 3DMJA 3R3TA 2AD9A 2P5VA 2ASDA 1S6OA 1NPKA 2V2VA 1RTHB 3D4JA 2HNDB 2HBQB 2MQ8A 2VFVA 3G2XA 5DG7A 1T11A 5KT5A 2XGPA 5GAGU 5KOWA 5M2RA 2XCPA 2DGUA 5C42B 5I42B 4KV8A 5LL6d 5F3TA 3AT1B 1L3VA 2CXEA 2ZE2B 5KFJA 3EICA 3GIMA 3DOLA 2PMWA 1J5EF 1JLGB 4JYAJ 4GVLA 5IXUA 1TVRA 1KLNA 2E5JA 5AXMA 2K2PA 3VHQA 1S72S 1UMJA 3KK2A 3KLIB 4RW9B 2E5GA 2ROEA 4J9KA 1DRZA 4IOAQ 4N8NA 1HD1A 3WBZA 5D0RA 1BQNA 4MH8A 4ED0A 4B3MF 4OZ1A 2LQ9A 4UZBA 4L74A 4XPEA 4LIRA 1N36J 2R42A 2YH0A 3FBCA 4HH0A 4OZ0A 4Q2LA 4MKYA 2OELA 4X4RA 2BE2A 2HGLA 5CQGA 3MTKA 2DCLA 2MPUA 1KLMA 1VQ7S 4PG8A 3I0SB 1RISA 3CSKA 4DL7A 4B17A 4CLZA 1Y5LB 4RNHA 2JC1A 3CD5A 5KG2A 4ECSA 5D0EA 4JI0F 2CFXA 2YWKA 2OAUA 4PG6A 1HNVB 1TV6A 1A7GE 1UA0A 3HXMA 1QVFR 1TMJA 3N79A 1RZMA 3EXCX 2YNFB 1R6YA 4P2SA 4C11A 4DCOB 1U4BA 1TVRB 1IJFB 1NUEA 1TP7A 5L1LA 2KZMA 3DRRA 3F0NA 1V5VA 3US5A 2D3ZA 3V6HA 1B0PA 3I9V9 1Z2LA 4QIGA 5IC6B 2B9EA 1T8EA 1BGXT 2VQEF 1REVA 4C3LA 3IBCB 3CC4S 3JAMY 3UN5A 1T03B 2VC1A 1NSAA 2F65A 2V8GA 3FNNA 3PFOA 4CYUA 8ATCB 3RB3A 1R27B 1IQTA 3Q8VA 1IVZA 2DNMA 4B9LA 4IUFA 4TQRA 4UOHA 3ITHB 4H4KA 5ETRA 4F2RA 2HIYA 2POKA 4CH1A 1Z2ZA 1KOHA 2E7WA 1N36F 2GO9A 1JLQA 4FVMA 1JMTA 1R0AA 3KK3B 3CE8A 4DQSA 4UUWA 2DNNA 1XQIA 2DXFA 3M6UA 5EDWA 3D67A 4U8YA 1TKXB 1GX5A 2DNKA 2JNJA 4QIVA 1MWYA 4Y2KA 2FZKB 2GX8A 2HQFA 1PYOB 3MURP 4EMDA 4KBIA 1GAOA 3GJQB 3QIPB 5J2QA 3VZIA 3GR0A 3M2VA 3S01A 3CJ8A 3HVAA 5CYQB 4F4KA 1VQNS 1KVIA 4DFKA 2IC3B 1N5SA 4Q45A 3M2UB 4KC5A 1N5YA 5JJBA 2UXCJ 2G2YA 2L9DA 2C2KB 3D54A 3LGMA 2XLJA 3LALA 5GAHU 3PJXA 2VIHA 4DOZA 2Z2MA 1GMWD 3SYZA 3AA9A 1VRTB 2X3GA 1JJ2R 4QPTA 2MMYA 4K4YA 4A8MP 4ERDA 2FGCA 1VK8A 3O8WA 4EZ9A 2DTJA 1I1GA 2FHJD 1I6JA 1F5AA 5CH7B 1D9FA 2BW7A 2FVRA 1MLAA 4HDHA 5BJRA 2HWIA 3ENWA 4CQ1A 5JMNA 1P6TA 2UXBF 1EAYC 1O6XA 5KAKA 5SUHA 5FDLA 2LXFA 1F9HA 1SKUB 1QE1A 2F40A 4DZ6A 1EARA 1RBLA 5J1NA 2DR8A 4NZ0A 1VCTA 2X1BA 4NCAA 1UETA 2N4CA 1HMVA 3DGPA 1J2VA 2V63A 1P8GA 5CYMA 1FE4A 3M2RA 5E0OA 1WI6A 4PWWA 2RHQB 2B6AA 4KHRA 2YQ1A 5KFUA 5CYMB 2R2UA 4OYWA 3TVZA 2XLIA 3CCVS 4WXOA 3TUPA 3R1HA 1TKDA 5H9FK 2NQPA 2KM8B 3Q2SC 5A0YB 5KFNA 4A8KA 5DGBA 1R8AA 1KRPA 3RBZA 2OSRA 1J5OB 2WHOA 3BN7A 4CLUA 3HMJG 4RKUC 5DGAA 2AV5A 2NPFA 2FVCA 3PXGa 2AYEA 1IXKA 4OHYA 4DN9A 5IFMA 4OV6A 1QY7A 3EDRB 2AW0A 3LQVA 3M8SA 1FVSA 4A8OA 1LKZA 4ILLA 1HWJA 2V8PA 1NO8A 2APOA 3EYZA 1RAOA 1WG1A 3HHEA 1N48A 2O67A 2HHXA 3E01A 4OHVA 2HHHF 4ZN3A 1HL6A 3FJ2A 3PV8A 1FDBA 1SIWB 4C0OC 1NHVA 1H6KX 4UQGA 1WF2A 4X64F 1ZETA 2R7XA 1YBTA 3AAWB 2B3TB 1T0TV 1E6VB 2J7KA 2W01A 4O0NA 4CH0S 2ZFHA 2MDAA 2FJDB 2JRSA 3CVKA 4J37A 2VKRA 5DO2A 3W9HA 1U1OA 3BGFA 4WFNQ 4DLEA 2LA6A 2QA4S 1AFJA 4PG7A 4LR9A 2XSFA 4LVNP 5H9EJ 2YNHA 3FBBA 4XDCA 1VQ5S 1RT5A 2JLFA 4PWDA 2XI2A 1CC7A 2KB2A 2CPJA 2MLZA 2QRRA 2YQ3A 4GO7X 4URGA 2MQLA 1TKXA 2W2QP 3WIVA 4M5DA 1SC1B 1T3OA 9ATCB 3M9NB 1BQMB 2COLA 2M3DA 3NGSA 4WJBA 3RGIA 4B3MJ 4Y2AA 5ETVA 3G82A 3ZNUA 3Q89A 1UJ4A 3NLCA 1WORA 4WFBQ 2PA8D 1JXVA 3MM8A 3DMJB 4BC7A 3GV5B 5L8RC 1HWKA 2KO1A 3G4SS 3RRHA 1HNWJ 3I5AA 4R25A 1Y5IB 5MAOA 2FJAB 1FJCA 1T95A 2LDYA 4PG5A 1Y11A 1VC5A 3DYAA 1T9TA 4P9SA 4RU2A 4CYUB 1IM4A 2XBPA 3GG0A 2OP5A 1JLEA 3H4DA 2RHSB 3SI8A 2HHTA 1OY6A 3A8IA 5GVQA 3I6PA 1YSJA 2ZE2A 1WUUA 2RB7A 3GCWP 3BO2A 2XWXA 3VAHA 1RKJA 3FZ2A 3IXQA 4X66J 3IN5A 2J9EA 2BM0A 4PXEA 3Q8RB 2QLJB 3PEHA 4ED4A 3DRRB 2WB4A 3RBDA 1RT3A 2VFUA 3UCGA 1NJXA 1NK6A 5B0GA 4C6AA 2E5LJ 3NNAA 2FZCB 3NNCA 2Y8WA 1CSJA 1FX2A 1WJ9A 4FYVB 1B0TA 3QAEA 4DR7J 4YDXA 3HSGA 1N5TA 5KFTA 2V4QA 1YZ7A 2CPDA 3F41A 1RYRA 1HNZF 3G6XA 2G13A 4ZLPA 1OWXA 1I51B 3C66A 2PI4A 2AGQA 5LMNF 4UOFA 3QGGA 3DXSX 3OFGA 2RD5C 4EEYA 3G82B 1U6FA 1ZZNA 2JX2A 4N77A 2UUWA 4ZVQB 1JQGA 3GTYX 4OMFG 2ZBIA 4Y2MA 5KOXA 3MEGA 4Z37A 2FDNA 4OX7A 3MOJB 5F0UA 2MQOA 1GK8A 1RT6B 3NBPB 3IWXA 1GEHA 1RHJB 4DEZA 1C1BA 1KS2A 1WI8A 3CJ3A 1ELOA 2DNZA 2DHHA 1W26A 2EG1A 2H3EB 5E2QA 1UFKA 4C0BA 1SQEA 3ADAC 5EGYA 1M5SA 4X62J 1IKYB 2WSEC 3I55S 1LNQA 3H5YA 4YOEA 4H54A 4PQUA 1WHYA 4X66F 1QD1A 4QU7A 1XTZA 1FNOA 3W8GA 4ITSA 5MLCV 3B8HA 4TNOA 1B64A 3GYNA 2P6TA 2VONA 2A18A 4TU8A 1YJNS 1HR0J 4RNMA 4P2FA 2HLTA 4TU9A 3EZOA 3WX8A 2BQ3A 1IKXB 2BJDA 4OYMA 1XMBA 2DNHA 1HBUA 3EUNA 1VGYA 4MT1A 1AUSL 3SCIE 3VGTA 4QW8A 5KFPA 4FF4A 3HHLA 3VVTA 5F0WA 1K47A 3DC2A 4GC6A 2GHPA 2CNKB 2NREA 1QJHA 3W60A 2FLNA 1IQZA 1Q4RA 4YHHF 1X9SA 4Q7AA 1GMUA 2F8EX 2NXUA 4ZMMA 2BE9B 1HYSB 3K5PA 4EUVA 4DR3F 3G9CA 4PKDB 2RS2A 1S7HA 2AJFE 1BUXA 2NZCA 4B3OA 1PAEX 1N54B 2AT1B 2CJBA 2XMTA 1X4BA 4RL1A 4RR5A 4ZIVA 3TZYA 3H4BA 3BO3A 3CD0A 4AD6A 1QUVA 1GTHA 4LSZB 2CPFA 2MZRA 2HS3A 3VGSA 4N41A 4G1QA 3NS7B 4DUTA 1SJ4P 1DTTB 1KP6A 1XJWB 3CC7S 4K0KF 3BR9A 4DR5J 2A0FB 1LWCA 3JYTB 3C2PA 1LEOA 2NPIA 4NYZA 4HH1A 5B0FA 3MCMA 5F8GA 1JKHB 2GVZB 4QWBA 5KG6A 3PX4A 2YKAA 5DJBA 3MGJA 2Y9HA 2BUNA 1JK9B 1K1SA 4UOCA 1S99A 2IHR1 1RTZA 3SSRA 3SV4A 3DN9A 1LV5A 2G4BA 2FB0A 1T9UA 1MN7A 4Q0BB 2EBEA 4DV3F 5C5JA 2EW9A 4RWWA 4DSFA 5ETNA 4F4XA 1JLBB 1IKVB 1BQXA 1F60B 2H65B 1X0FA 1JLCB 2LYVA 2VFSA 3FVYA 4NZ6A 4OX9J 1R8CA 1U1PA 4KPYA 4NXMJ 1WNEA 2KH9A 1UTAA 3O1LA 1B7FA 1RABB 5CCMA 2B4PA 1S1VB 1FXRA 1S1XB 1NH7A 1VLYA 2E66A 1NH8A 4YQWA 2IVYA 3R5DA 1AYEA 2KT3A 5JXSA 4B3RJ 2V0NA 3ICLA 4IO1A 1FRJA 3ITHA 4ICLB 3B82A 4X2BA 4V19J 1X7VA 1TUGB 1VLOA 4H4OA 3PHEA 1NSQA 2BOPA 5F9NA 3BS9A 4IO9Q 4WU3A 3KWMA 1RK8A 3LOUA 2MSTA 5G0RA 4CH7A 4RW4B 1J27A 4AQYF 1SKRA 1RADB 3W2VB 5A8KB 3PZPA 2K3KA 2YH1A 4ID8A 5J2NB 4ZCLA 3MCNA 2E1RA 4LRAA 4FKYA 4LRDA 4X4OA 3KLGA 4FP9A 1FO1A 1VIXA 1PBAA 2C2DA 5C24B 1YTYA 2EG2A 4UUXA 4RW7A 1U1LA 3H2LA 3M2RB 4IG3B 1CJKB 3WC0A 3KMQA 3EDQB 1G1XA 4OYIA 1KQGB 1RAGB 1XWLA 1V3RA 2B8QA 3CD7A 2JFKA 3CEDA 3H5UA 1S57A 4OLPA 2V50A 2DITA 5HVGA 5EN1A 3HVRA 2BANB 1XN9A 1VOMA 3KLEB 4KGMA 4E98A 4C8MA 3VVUA 2FY1A 4K4SA 3PW4A 4C48A 3C6TB 1KR4A 1B0VA 1Q8BA 2DHGA 2DXDA 3MPVA 1U45A 1SKSA 3O2IA 4DR5F 3M1VA 1GTEA 1P1LA 3KLHA 2QL7B 3VGUA 4RW8B 5B7WA 4Y6IA 4C98A 3K58A 2Y1LB 4N47A 4N5SA 2HLUA 2ZUGA 3N4WA 2K06A 2AJ1A 4LIWA 3NGDA 4DV0F 6AT1B 4M5GA 2J9DE 5HJXA 1H98A 2DNOA 4ZCIA 3CCLS 2ZEJA 4LFBJ 2FYXA 3EVWA 3MECB 4LF4F 5HAOA 3MR7A 4IFYB 3OR1B 2N4DA 4I6WA 2MHEA 4USTA 1TL1B 2FD2A 5AXKA 3DRSB 1FI4A 4LUBA 3UDCA 5EHHA 1TK5A 1XNQJ 2KTQA 4MK7A 4BS2A 3DOLB 3FUYA 2GGPA 1G7CB 4OX9F 1QAYA 4KQZA 5HN0A 2Z58B 2ADCA 3C15A 2L08A 4HHUA 1OYDA 2YNIB 2BDPA 4RO0A 2PMZD 5DDRC 4I68A 1NDKA 3PJWA 3T5JA 1NDPA 1VQSA 2V94A 2YBVA 3BGLA 4DPYA 3CJTA 3D3CJ 3G96A 4I2PB 1PCAA 4ED8A 2VODA 1JLQB 4USWA 3AHPA 3NOCA 2NXNA 3W1YC 1YBAA 3ZO7A 1N33J 2JFDA 3WC2A 1P27B 2KKHA 2HRUA 2YKNA 3AD9C 2ZDPA 3ZTPA 3GV7B 3CXCR 3OFHA 2VJVA 1NJWA 1VI7A 4PYDA 4DXLA 3H25A 4OFZA 4P7VA 2J7WA 2RQMA 4GO5X 3IAM9 2ZH7A 2ILYA 2ZOGA 3MUMP 4RW8A 4HACB 4WP8A 1HQEB 1FJEB 4LF8J 3D1HA 3GFXA 4CO1A 5F8HA 5E33A 3M8RA 3EXYA 1HHQA 1HWUA 4U9RA 4Y3CA 1RTHA 2PIIA 2Q6CA 4HKQA 1PBUA 4K2JA 3MFIA 3NY0A 4JV0A 4F0HA 1UVLA 2FHKA 3QSYB 4Q8FA 2M88A 1MN9A 3RU0A 2QA4G 1RP5A 3OFFA 2KHDA 1Q53A 2XMKA 3NMAA 4C3MA 4OQJA 3W7BA 4J90A 5KT4A 3KHLA 3NMRA 1WKKA 1ZA2B 4ZVUB 1S9GB 3FMWA 1IN0A 1DTQA 1C1CB 2GO8A 2ZVSA 4OYZA 2LEPA 3QLHA 1IR0A 2GFFA 2GMLA 3CB4A 2E5HA 2G0CA 4O3QA 5HJYA 2BQUA 4JI3J 2NR0A 4B3TJ 2UXDJ 2KN4A 4H4MA 5G0RB 4ZHRB 4PWDB 4R5PB 1PC4A 3A4TA 2XMWA 5FD1A 2UXBJ 2Y0BB 1G2EA 4NXNF 2XZTB 3EGWB 2ZD1B 5KG5A 1U02A 2HVEA 4KGVB 1EJ7L 1GQEA 2XWYA 5K8PA 3UCUP 4KAIA 3THVA 2D3OR 5K8MA 1ZYQA 1RT1B 3TZZA 5LJ5Y 4ZPVR 4PPZA 1RYSA 3OL7A 1JLGA 3K17A 3KDOA 2VASA 2RRBA 2W4PA 1N6QA 3HT3A 1TFWA 3SMZA 5HMXA 1FTCA 4K50A 4QU6A 3GSDA 3LWMA 3PW7A 1HNZJ 1D09B 1M5VC 3S8SA 5KT7A 2Y1JA 2AJ4A 4WTOB 4A8FA 1W7WA 4KHPJ 2DH8A 4XPCA 2GZOA 2QL5B 3QT8A 4JB8B 1LWFA 3L7OA 4QR2A 2MGZA 4J9UE 1SH2A 2XI3A 3TQEA 3X3UA 4YB1P 1LW0A 2CQBA 4DL5A 4MIWA 1CQMA 4J91A 3K5LA 3MEDB 3LP2A 2VU5A 2YWEA 4W4MA 4CLTA 3H40A 5A8RB 2OIHA 3GJSB 1MSWD 4TLQA 4LF7F 2IM1A 3FKBA 3OW2R 2CVEA 4RZRA 2CUYA 2BA9A 4RBVA 2EFQA 1L3UA 3VTIA 4X64J 3EWGA 1YQHA 1YJUA 2ZM6F 3WQPA 2AQ4A 2NYIA 1RTIA 1MMDA 1GX6A 1IUJA 2HFUA 2QFIA 3EVMA 4USJC 4C2MA 2MKYA 3I96A 5LOQA 2I2YA 2C22A 3SSQA 2V2KA 4B02A 4WPAA 4CLYA 4JI7F 1IKYA 1ULRA 1LWEA 4DX5A 2FTRA 1HPZA 1VBXA 4HTJA 3DDKA 3ZTRA 1XMQF 4F8RA 2RIJA 2ZD1A 2DGTA 2LVWA 5B0EA 4DU7A 2RDJA 4DFMA 1U47A 1U1KA 1VC0A 3B54A 4JI8F 2A6OA 2UV8A 1U26A 3GU0A 3N28A 4U67Q 1YJ9S 4DUZJ 4JI6J 3FSXA 4JI4F 4UT4A 2XHWA 1KBRA 2HQ3A 1UEKA 2B9XA 3AXKA 1RXOB 4X4VA 3CCRS 1I5OB 5KFIA 4K0KJ 1BLUA 5K14B 4DL3A 4DX7A 3LP1B 1R0AB 4DF4A 3KUEA 4TQSA 3JQJA 1JLAA 2J6UA 5E3PA 3CCSS 2XULA 3FEZA 1X4GA 3E2EA 3J7ZT 3MM9B 2HHQA 1OIAA 3ETMA 3VQSA 1OY9A 1T9XA 3IO1A 4QIWD 4ZA1A 1K8AT 1RTDA 4DSIA 2E1AA 3CTRA 4NLPA 3PG9A 4A4JA 4CLFA 4EWTA 5EWFA 4JI3F 2CQGA 4CO0A 2OEJA 1HHSA 4CWBA 4K4WA 1FX4A 1S49A 2CZVC 1RT3B 3W62A 4LJMA 5ETLA 1F0XA 4DR3J 2QLFB 2IA6A 4B3OB 4FYXB 3DHXA 1RQ0A 4OX6A 3CULA 5CD4A 3VAMA 1XNRJ 2JZ5A 2QEXS 4KFBA 5HMWA 4B9VA 2VKZG 4P52A 2G1HA 1GMVA 1DJ0A 2CJYB 4AUKA 4LSLB 1H2UX 2X51A 4K7QA 5F8MA 3VAIA 3A8JA 4O4RA 5KFLA 5LSRA 4QZVB 4EBCA 1FRXA 3R9LA 4USKA 3C14A 3IFEA 2VBZA 2R7RA 3GWCA 2U2FA 2YX4A 1Y4ZB 3CCMS 2ZITA 2WVDA 3CDBA 1X4AA 3FSYA 2ZHOA 3BDEA 3MMJA 1VQYA 3W5XA 5J1EB 4HTIA 2HAIA 4U7CA 1DLOA 2GMJA 2UUAF 4YMEA 2Q3PA 3NOGA 3QFHA 1APSA 3BN4A 3DRPA 4DV7F 1NB7A 3NL0A 1WSRA 3I4PA 2VPYB 2XSJB 3QWPA 4YR2A 2Y1RI 2F8MA 5AE2A 1YGYA 2LQ8A 3I32A 3ZTOA 4YB7A 1TFYA 3BEGB 2WSCC 3EPIA 1YRXA 1NKEA 1VR6A 2JJ4D 2V68A 2ZBQA 4HDGA 1VQLS 2HNZB 2FJWA 1X5SA 3A3OB 4ECZA 4ED1A 1SVDA 1OSDA 4XAKA 2MKSA 1OS5A 4OHXA 3EGVA 2J5AA 4LF9J 3T1HF 4NASA 2YNGA 1DAXA 4QWAA 1DTQB 4EBDA 1S77D 1OQ3A 3AXMA 2J0SD 1S9GA 2BRLA 3NCPA 2RQKA 4OYAA 2QFJA 1FRHA 4ZVSB 3ILJA 1B99A 3NGTA 4XO0A 2F8HA 1S97A 1DURA 2LQBA 4HR2A 3Q0AA 2X1FA 1A6LA 1H2VZ 5JUMA 2NLWA 4FF1A 3U7JA 2DEIA 3HPOA 2ZHAA 4ZOSA 4WIQA 1NJIT 1RTJA 2OUGA 1N88A 1WOSA 2I5JA 2QA2A 3IR5B 5D4PA 2DPIA 2R9LA 2NXCA 3QT7A 4FDFA 2CPYA 4PUOA 4DLGA 4LQ3A 5THWA 3F73A 3KJQB 2DYAA 2GQQA 2FHOB 2CIMA 1XERA 4RUBA 3HO1A 5J1EA 2IA0A 1RT5B 2VUGA 1EETA 4IG0A 4DF8A 4DR2F 2FLOA 3I0RB 1RWXB 5A8WA 5A8KA 2ASJA 2OLWA 4XK8C 3RJMB 2UVUA 4U96A 3I87A 5IQ6A 4I7FB 5FDLB 1JLFA 2P9CA 4IKAA 2Z4PA 3MR5A 1QTMA 4FYDA 2R7TA 1W2IA 2CQPA 2A6MA 3DU5A 2CADA 1IR2A 3OXGA 3BQ0A 2Y1IA 2DJWA 1NK0A 4FF2A 2HFNA 3EM1A 3QJJA 2GA7A 3LP1A 3MEEA 2R8KA 3IWNC 1XBWA 3FSIA 1RSCA 3HVTA 1RHRB 2BJ7A 1YLXA 2JOQA 4NA3A 4C7QA 5DQIA 5E3RA 2W8LA 3MAQA 1SC4B 1FDAA 4NLWA 4RWXA 4ZCKA 3RR8A 3NAIA 1Y7PA 4W98A 3UR0A 2IIHA 4X4SA 1WF1A 4Y0FA 3FFIA 1MROA 5CZVA 2DY1A 1N32J 5BYRA 2PC6A 1Z4UA 1H38A 1VQMS 3MWBA 1GFWB 2IRUA 3MR2A 3D6MB 3CCQS 5DG9A 1WOPA 1DHMA 5DQGA 5HBMA 4Q0BA 2B56A 4IRKA 5HK4A 3KLEA 4OI3A 5B0AA 4KO0B 1FRIA 2HHVA 1FFGB 4CT9A 4FPIA 3DXBA 3TJAA 1CULA 2MQQA 3CUNA 3KG0A 5E5NA 3OSPA 2ASLA 3D28A 3MPWA 4YB6A 4DUYF 2BOAA 1C4AA 3GG1A 3T6JA 4AE5A 2VQFF 3GCXP 4PCQA 2QE5A 4DV4F 5T7LA 4UY85 3DLEB 2HHPA 3A12A 4MJKA 2F7VA 2H48B 3K5NA 2HNYB 1G4CA 4M5IA 1MWQA 2ZH1A 2CYYA 3WZ0A 1RI7A 2H4WB 3R2DJ 1HNWF 4HL9A 5GMDA 4W92B 1VDHA 2Z2ZA 4R8UB 4DR1F 2HRTA 2RVJA 1WC3A 2GQCA 1FEHA 5L38A 2W7PA 5HP1B 2Z2LA 3NP5A 4B9MA 4JV5F 4WE1A 1H73A 1RACB 2CNNB 2W4DA 4P10A 5D4OA 3MD3A 3UR3C 4CRJA 7FDRA 2D1CA 2AX1A 3DFEA 4GMKA 2CPEA 2BVZA 1F5CA 2AGOA 1Q8IA 4NRUA 4YEAA 3O5TB 3W8PA 4E8UA 5DG8A 3PKMA 4NWBA 1UVIA 1BY9A 3Q22A 2VG7A 1J5EJ 4YY3J 3C3LA 3MUTP 3MMAB 1QE1B 3H20A 1QTNB 2DRBA 4C8NA 1V3ZA 5K20B 1NJZA 4KHPF 2N7YA 4URSA 4DUYJ 2BW2A 1U6BA 4EU0A 1JX4A 2VG6B 1X60A 2ZC3A 4O0IA 3FBFA 1ZBTA 3GB0A 3KXDA 1SPBP 2HQDA 2BE2B 2FZGB 2ZOMA 1S1WA 3FC9A 3N01A 4EFAC 2C28A 1TL3B 1KD1T 2X3DA 4NEYA 1DQAA 1R31A 3KK3A 1REGX 2EXUA 2F3JA 2M70A 2PD1A 3ISNC 3A8KA 1KQKA 1TU0B 1HA1A 5HMZA 2UU9F 1EKSA 2ZOFA 3ONQA 4TYBA 2RMLA 3SEOA 1BD6A 4LRFA 1OPIA 4A8WA 2D3O1 1FKAF 1ZA1B 1V6HA 1JXLA 1X5OA 4FS1A 3QQCD 5C2GA 1WELA 3UVJA 5CYQA 4O3RA 2RAQA 3HZGA 5AE3A 4JUZA 2HVHA 2QMUB 1S59A 2C3YA 3UI3A 1TKTB 3BYPA 4ECYA 1HI0P 4DR4F 5DM6Q 3KFWX 3JSMB 5KG1A 4ZHRA 3VGVA 1URNA 2KVIA 5I42A 2LQJA 2LA4A 2V6AA 3DGVA 4FVCA 3A3NB 3RW7A 4BC9A 1EHWA 4C3KA 2PSZA 4AFFA 1HHTP 1WOOA 3DOMA 3P5BP 3TO8A 2B5JA 1S4FA 4KGXB 5CCLA 1WEZA 4M1KA 4OZ2A 3AB4B 4B3RF 1CS4B 2YKNB 3LGNA 3CGIA 2HW3A 1KVKA 1NMEB 3SFUA 1CULB 2WBMA 3AODA 5HQMA 1NCLA 5D6GA 5F8LA 1U48A 2LU2A 1B4SA 2RUSA 4QIFA 1M1KT 2VC0A 4KO0A 1YRUA 3FCVA 3T5LA 4ANDA 1N0UA 1XMOF 2FJBB 3RAQA 3SQGA 1OMSA 1UL3A 1GMWA 4MYTA 3MM5A 4TN2A 1U1NA 2H1YA 2RDIA 3MM6B 2RF2B 4ZLLA 4QYZK 4PUOB 5J2PA 3TRGA 1TAUA 1NRKA 3IM9A 3T6BA 3JSRA 3OTDA 2XM3A 3BKTA 1N34F 1HBMB 2AZ1A 2F5GA 2QL9B 2XEXA 3DDIA 3V81A 4NA1A 2MQMA 3SCKE 1SJFA 4M5KA 1BC6A 3CO9A 2O1PA 2J9DA 4HHHA 3BKUA 5KT2A 2CQ3A 4IFVA 4JI4J 2NYHA 2D74B 2E5LF 4ZVGA 4QCLA 1T05B 1CBKA 2YTCA 4NYPA 5GAHI 4LF7J 2YVSA 3ENAA 4I2PA 3DRPB 2AYBA 1TELA 1YK9A 2B0GA 4QPXA 4YN3B 3RYLA 3VAKA 1REVB 3NAHA 1C1CA 3C16B 3EGZA 1N52B 4M5MA 1EIYB 4ELVA 3OPKA 5A6WA 1TL5A 3C15B 3HJVA 2R4FA 2OI2A 3THPA 2MQPA 2HNZA 5KFYA 2FPHX 3ZTQA 5CXTA 2WVCA 1P1TA 1RTJB 4YS2A 2DIUA 2IDEA 2FUG9 1QSSA 3ZZTA 1V5IB 1LFPA 4WYWA 2V9WA 1IKWA 5HLFB 2G0JA 4NLVA 2CQ4A 2C3PA 1M5HA 2DK2A 3CDWA 4NLXA 3MECA 3R97A 1HBMA 4Q2MA 4DR7F 1HI1A 1U2CA 4ZPDA 4C8KA 5KFRA 4FF3A 1FWPA 3BREA 3IS9A 3AFGA 2GIQA 4H4KC 3IRWP 2QT7A 2ZJPQ 3K0JA 4ETZA 4R0EA 1Q5VA 1RGVA 1VBKA 5T41A 3KLHB 2CJ9A 2Q43A 3BQ2A 3DLGA 4NLRA 4AL5A 2EK1A 3UPFA 3GPAA 2YKMB 4M94A 2EC2A 3AQPA 3H8YA 2QN6B 2E9ZA 4JOUA 5KFOA 4IH7A 3BJYA 3J7YU 3AOCA 2NCKL 4FXDA 1VQKS 2BRKA 3TA1A 2IJRA 5IQQA 1XNQF 4PXBA 3OVBA 4QWDA 3EZUA 4NCGB 3PR4A 3I0RA 2CZ9A 4P7TA 3N6NA 2K1RA 4JP8A 3M6WA 1H2TZ 5DZ6A 5U47A 5FLXY 4DQRA 3MXHP 5AT1B 2V67A 1H7XA 4ZVFA 2VPXB 1C0TB 1RBOB 3J7AN 3T5KA 3CCWA 1UVKA 3KLGB 1JLBA 3AB2B 2CPXA 3OUYB 5DDOC 1SJRA 2ZC4A 1HWIA 4M5NA 2GV1A 5H9EK 2Q1LA 1TK8A 1NK5A 1ZZFA 3MZIA 1S1UA 3KHHA 2PFFB 4F50A 5KFDA 2IMWP 5HATA 4GKJJ 2K7JA 2QTWA 2YXLA 2HQIA 3BH6B 3DDNA 2E1MC 1JJHA 3KNAA 2OFHX 3BSAA 2N3LA 3CJKA 3OL8A 1S9FA 4ZVRB 3MR6A 2CNOB 2DEJA 2DHXA 4LRCA 1FK9A 5T14A 1F9FA 4DG1A 3MM8B 3U27A 2ZKTA 3UNGC 2OPPB 1SQFA 3MFHA 3U1LA 3SFGA 3PW2A 2OH2A 1Y3KA 2A2DA 3H2VE 1T9WA 1ZAXA 4B3TF 2UXDF 3CC2S 3ZZZA 4A8SA 3SZ2A 1JNRB 3L3CA 3QWUA 2MZJA 1GH8A 1ZH5A 1YKWA 3ZZRA 4LBHA 2H9ZA 3UW1A 3Q86A 3OL6A 2ZH9A 4N76A 1AT1B 4MFBB 3BBCA 1SKWA 3J7A1 3S7RA 3B78A 1DY3A 2W24A 3RB4A 1CC8A 1HNXF 3HKWA 3RRKA 4LF6J 2IAJA 5IT9Y 3J7Z5 3V6DB 2KRBA 3DLBA 1O0PA 5IT9U 2HG4A 4E0DA 2XLKA 4I69A 2K1RB 2OD4A 5KFVA 1FRLA 2M5YA 2KT2A 2MSSA 4CO5A 1VFJA 1HNIB 3LP0A 3NRBA 3K5OA 4FN5A 4LSNA 4EBEA 4NYOA 4O3SA 2ZH8A 3C14B 1KC8T 5HANA 3TA2A 5IZHA 4DV0J 4OYBA 1HPZB 2IJNA 3BB5A 3A3PB 3EZ5A 1Q81T 4B9TA 4H4MB 3KYLA 3NGRA 4J9VA 3UO0A 4N56A 2CWXA 4IR9A 1AB8A 2VDIA 5A2QU 4ZPWR 1U6ZA 3CDUA 3M7VA 2VBYA 3DI6A 2KT5A 2QA1A 3PYGA 2V4JA 4ANCA 4ATNA 4ELTA 4JI0J 2L48A 4MKAA 2EPIA 4P2XA 5GAGI 1KVJA 2HURA 5JVHQ 3RAMA 2OD6A 2ROPA 3P5TL 4ZCMA 1Y9OA 4Y34A 5I4MA 3OD2A 3UDEA 2VFRA 3PYFA 5A8RA 2CJKA 4JI7J 3OLAA 4KPCA 1KQSR 1TL7A 5DQHA 1U24A 3C6UA 1U0SA 3Q23A 2HKEA 2XS7A 3M05A 4DV4J 2XMAA 2VHGA 5C2CA 3VALA 2QC3A 2MGZB 4GVBB 4O4GB 3PKYA 5FLXU 1C0TA 2HQCA 2J7UA 2JVOA 2OPRA 2OKQA 3AH6A 3HCXA 3OTCA 4HACA 2RUGA 4OLOA 4K8RA 1TKZA 3L9ZA 4M5JA 1UPPA 3TWZA 2CVIA 3PX0A 1FRMA 2JLEA 3W2WB 5C25B 2FGOA 2BX6A 4L72B 3TZXA 1AFIA 1ZTTA 2FVSA 4DV2F 2KZZA 4MIBA 1BQNB 3NCQA 3CJKB 4B08A 4CM2A 4TY9A 3GFYA 4X4TA 1FF2A 5HBMB 2FC9A 2GC8A 4DL4A 1Y0HA 4F0MA 4RBUA 1VC6A 2OPQA 5KFWA 1X4FA 5LMUJ 1B7YB 3PYDA 3CJ0A 5I3UA 3V4IA 2LXUA 4RX6A 2VFTA 1LXJA 5BYQA 2XO6A 2YX7A 3A1YG 5J2PB 3OR2B 4U95A 2FHMA 4A47A 1ZPVA 4P2MA 2ZNYA 4F0KA 3QJLA 4LF5F 3P4UB 1H7WA 2XC9A 2HK2A 4C11B 2QYCA 4KH0B 2ROGA 3MPYA 4F3MA 2QZ8A 4C8OA 3Q2TC 4TY8B 2XCAA 1EP4B 2ILZA 4NOHA 3VZHA 2I6WA 1ZPWX 2DGSA 2JVRA 4CLPA 5L1JA 3ENVA 1QSYA 2KL8A 3GONA 2QGFB 1VMBA 4I1TA 2FLLA 1AXQA 2CAJA 1LXNA 4D3GA 4Q5VA 1VQ8S 2UUCF 1S1TA 1QM9A 3GIKA 4F4WA 2J9CA 1KEKA 4ECVA 3QO9A 3U1NA 5ETPA 1UPMB 3NWRA 2GQ2A 2I8EA 2WONA 1Q1KA 4HHJA 4MAKA 2MB0B 3PW5A 3HD2A 4DL2A 1HI8A 3GV8B 1I94F 4O3OA 1RA7A 1N6QB 1KHWA 5B0DA 2CPIA 2W9BA 1Q79A 1RDRA 2FVPA 1RWVB 4RW9A 2R8HA 2N82B 1KTVA 3HFKA 1SL0A 4ZLNA 2BJ1A 3FBEA 5LMUF 2W2PP 4P74A 4IFYA 1SH3A 3HHKA 3OR1A 1RT2A 2HYIB 2R7OA 2Y3YA 2DNLA 5A76A 3MMCB 1KTQA 4DV6J 1N4LA 1RWNB 2W2MP 1NPPA 2Z0GA 5C42A 4F7VA 2VPZB 2IM3A 2OJ3A 3ZXWA 3CCTA 2Z57B 3MM6A 3G6YA 4O44B 2ALYB 3PEJA 3SDEB 4ZITA 2VZ9A 4QWCA 3HK2A 3X1LB 3OT9A 2XS5A 2KM8C 2ZJQQ 2BEFA 3PTWA 2DD8S 2CQ1A 2R7SA 2LQ5A 4A8XA 3SSSA 2C2RA 2R7VA 1DQ8A 1U25A 2QLWA 2ZBRA 4CLLA 3BSCA 5IC4B 2IFXA 1TL7B 5RUBA 4ECWA 4IFVB 1XR6A 3R5AA 5D15A 1ITPA 1UW4A 4OZLA 1RBAA 2WB1D 3DRSA 2QIFA 5D3GB 4Y65A 3J81j 4IDKA 1CEZA 1CJKA 3HSZA 3DOKB 3IM8A 2VD3A 4EO8A 2WK4A 4ZP6A 2DGVA 5A2QY 4NI2B 2F4VF 4GKJF 4BWJA 4DPUA 5B08A 3BYRA 2BKNA 2QMWA 2ATCB 5KFGA 2JHEA 3QT6A 3T1HJ 4QR0A 4ECUA 1RAHB 3BDPA 2ZZTA 1JLEB 3SQGB 5SZTA 2A3JA 3BR8A 1T02A 2WOMB 1RTDB 4N8OA 2ZJRQ 4PPDA 3SCJE 5EX0A 3TA0A 3AA8A 3G8SA 2CA9A 4WXWA 2HZAA 1LQ9A 1OYEA 1JLAB 2DGOA 2BANA 3TJ9A 3FGVA 3TEGA 2E1CA 3PY8A 3ETOA 1VHIA 3VF0B 5IWAJ 2RE1A 4WKRA 4OJ3A 4ED6A 4F36A 1FFWB 2M4MA 2LEBA 2PT0A 1RU1A 2D9OA 2IBKA 1RWKB 4IQMA 2R2TA 4OIXA 2GIRA 4ZLJA 1AUDA 2RKIB 1AZSB 2E7VA 1KSPA 1S9EB 2UVWA 4P75A 3MM5B 1HMVB 1TUWA 3MPUB 3TVKA 2AP6A 5BR8F 3T5HA 3TAQA 3U02A 3H5XA 3MEKA 1TKTA 2LCWA 1UW9A 3QIPA 4ANEA 4L75A 1SCJB 1YITS 2XB2D 3HVWA 3VAJA 3NWGA 3R5BA 3K7RA 4S0MA 5HQ8A 2VG7B 4H4OB 2OHDA 4PABA 1CVJA 2A2CA 4I67A 1MROB 3W9JA 2CG4A 2D9PA 1JKHA 2JWNA 2Z30B 1IJEB 4CP5A 4DCPB 4MIAA 3S1TA 3FQKA 1SIZA 4U8VA 4GKKF 3R2CJ 2DT9A 1MW7A 1KNZA 3K57A 4DR1J 1VRTA 2MY7A 3PVXA 1TQLA 2V5HG 4NA2A 4KSEB 3C8YA 4AYBD 4ILRA 1TKZB 4CLSA 2QMXA 3UD3P 3MEEB 3R7NB 3J81Y 5L46A 5KT3A 3KHRA 1TK0A 3HHLD 3LGHA 2CQIA 2PE8A 1T7PA 3RR7A 2H54B 1WHVA 3J81U 1S6QB 2J0WA 1IKVA 1BHNA 4DPWA 2HGMA 3R6LB 2V2ZA 2IC3A 4USMA 4X65J 1WKJA 3VR1A 3I31A 3EX7B 4B9NA 1ROFA 1T03A 2CQ2A 2ZM6J 1NHUA 1YI2S 1PILA 1Y5NB 3GJRB 3MMAA 3BBFA 3T41A 4USHA 2W1BA 4I64A 2HFZA 2YY3A 5GADI 2MKJA 1RTIB 2BACA 3EE3A 2EFPA 2R8JA 2UVVA 1HBOB 2B6AB 1RAFB 4BHQA 2KYZA 5DDQC 2PO4A 2X1AA 4DSLA 3V6DA 1FXDA 2MQNA 2E9RX 4C4WA 1B70B 2UUTA 3VAGA 3P6YC 2MZ1A 1KFDA 2YQ0A 4G3IA 5C7PA 4WE1B 2BZ2A 5EWEA 1X4CA 4DUZF 2DBBA 4JI6F 3LW5C 2HAFA 1R89A 2HBYB 3TJ8A 3LAMA 3UFCX 4G1QB 1RWWB 3FRYA 1HBUB 1M1HA 2P9EA 3HKZD 4MMOA 3D0HE 3PHTA 4C9DA 3TR5A 4GKKJ 5I3QA 1WG4A 3HJFA 1KFSA 1NKCA 2OPPA 1HQ2A 2IMOA 2VBWA 5ETOA 1WWHA 2BQRA 2JL9A 7AT1B 4NI2A 2BABA 1M0SA 3OTEA 3JAMU 2E9TA 2AF6A 4RNNA 1HYSA 2HFVA 3GZ7A 3UN3A 1IKWB 5HLFA 4NXNJ 4L76A 2K8GA 4OI0A 3R7SB 1UAWA 4WFAQ 3KDNA 2ZWOA 4YFUA 5F8NA 1EQ0A 3MAAA 1K0TA 2AIRB 3PIOQ 2GMHA 4XIUA 1YHQS 3KJVA 1FWKA 3SBMA 4CO2A 1GT8A 1FKOA 3G6VA 1F2HA 1HLWA 2WRMA 4DPOA 3TANA 1HQEA 3MEGB 2C3OA 4B3SF 5T7LB 2N3OA 1KKHA 2CKWA 1FE0A 3DU6A 2BKOA 3G8TA 1E6YB 5BYSA 3L7UA 3OJSA 3GIJA 4K4TA 4A8QA 2EWHA 2IRXA 2XY5A 1FHTA 5HSPA 1HBNA 2GVDA 2FC8A 4W90B 3AQOA 1UKUA 4J7CA 4RUAA 3BH7B 4ZJOA 4J9QA 1ZS6A 3K8WA 2Q66A 4KGZB 1VQOS 2AJ0A 1K9MT 3PRDA 2HHHJ 3CF5Q 3W64A 5HROB 1PG5B 3TP2A 2SXLA 3K89A 1FDNA 3Q83A 3W65A 4RNFA 3J7YI 1BWEA 3ZZPA 3GQCA 2DNPA 3FEXB 1R8BA 1UEVA 1XMOJ 1WEXA 2O66A 1IR1A 2QYGA 1W2BR 1S10A 2LU1A 2IYGA 3AJ2A 4ZS6A 5ETQA 2MZSA 4ZIWA 2QX0A 3OQ2A 1RT4B 1SL2A 4NMXA 4X4QA 3MOZA 3TAMA 3JXOA 2UV8G 3N5BA 5LM7E 2PEBA 4YY3F 5LJ3Y 3MCSA 2MTLA 2RILA 3O3LA 4WK3A 2C1EB 3VV2B 3GR1A 2MHNA 3MR3A 3DM2A 1XIQA 2WTFA 1VQPS 6FD1A 2E5IA 4J9MA 2VQFJ 3MCOA 2OGUA 2XSJA 3FEYB 2EKYA 3MM7A 5F41A 1FJ7A 2O01C 2U1AA 3JTOA 1VQ4S 2BE7D 1CS4A 4KH1B 2GW8A 4WP9A 2YX1A 2WW8A 3QGIA 3E3XA 5DETA 4QW9A 3OTOJ 3CCJS 2B4OA 3BPDA 2OTLS 4O44A 2IVMA 4D3HA 4X65F 3IP0A 3BGUA 3CWJA 3LA0A 2ASYA 3FCWA 3IS9B 1TZ0A 4IOCQ 2QSFA 4N7TA 4ECTA 4LFBF 2RT3A 5KFCA 1UZDA 3G86A 3HI9A 4NEZA 4PYAA 4Y00A 5D78A 3CJSA 3ISZA 4USIA 5CHCB 4BBYA 5DM7Q 1TMMA 2ADBA 3SIPB 1X5TA 2CDQA 2C2ZB 2MY8A 3Q8PB 3R1LA 1YBUA 4F67A 2P9GA 3SXLA 1HKAA 3V4MA 5IT4A 3P3DA 3TAPA 5E3AA 3W5YA 1RUSA 1FKPA 3V81B 2CQHA 2XMVA 3DCAA 3ILOA 4FZVA 1RWUA 2KDOA 4ES3A 4ECRA 3KJFB 3LUYA 2VPWB 2L3MA 5EUHA 1DZ5A 2OPSB 3QYYA 4DV3J 2QLXA 4JV2A 3B6BA 1RT6A 1VIOA 2O3DA 2HQGA 3W9IA 2XO7A 4KGKA 5L1IA 2KHCA 2HFOA 1KWMA 1WDDA 3LPEA 3QFWA 2JEJA 1FCAA 2HVDA 1Q8LA 5M2PA 2W9AA 2B4UA 2A10A 2R8GA 4O4GA 3CMES 2P6SA 5HI7A 2WVBA 3TX8A 1VRUB 1IBKF 1M5PC 3GYXB 5CZXA 3EVOA 2VG5A 1LFWA 2IYIA 1S6QA 3MAAB 4TXSA 4ER8A 3DM2B 2XZWA 5A0YA 2AJ2A 3ET6B 4PQAA 5ETSA 4ZJQA 2V69A 3GIIA 1T9VA 1PJ7A 4DN0A 4JI5J 2NSCA 1S0MA 2D3UA 2KVQE 3R8YA 2JEIA 1QUPA 4DDFA 1UFWA 3D68A 3OR2A 4I56A 3IBWA 3D6HB 3ILIA 4EK2A 2D7SA 4X62F 2UVRA 5CD4H 1IWAA 1S4EA 5DDPC 1X0PA 1UEUA 2DNYA 5GAEU 2JC0A 2XMJA 1LK7A 1N5YB 4OJHA 4JYAF 2J8AA 3W2VA 2ALZA 4MK9A 2ZBPA 4RW4A 1VRQC 5L9XA 2VH7A 3K2YA 3JB9k 1WSVA 2HRYA 4FBTA 2OTJS 2B51A 3DYAB 4LF9F 3IRXB 1CJVA 5B0CA 2KXHA 3RRGA 3M30B 3BGRB 1EB0A 1AZSA 4NE9C 4CLKA 1MU2A 5F9LA 2LP4A 2Q6BA 5C25A 4L3KA 4ED3A 2HWHA 3POTA 3RZAA 3BBBA 5GADU 2XZDB 4DR6J 3H0PA 4DSJA 1PAUB 3I9ZA 2KFNA 3BZQA 1N5QA 3BV8A 4YB5A 1OY8A 2ERRA 3JTPA 1TR0A 2MZTA 2AU0A 3ELHA 5IV4A 4NPOA 5KT6A 4WCEQ 4JI2J 4ES1A 4DV7J 3DGPB 4ZJLA 4ECQA 2ZH4A 4LRBA 4J9OA 3KLVA 4KT0C 1AW0A 1WG5A 1X4HA 1TL4A 4HVZA 4URQU 5KG3A 4KRWA 1WHWA 2DR5A 1LWEB 3OUYA 1VQ6S 1D9AA 8RUCA 3QGHA 3D7SB 4DZDA 1N5VA 3CD6S 2KRRA 4UOGA 3GLJA 1SJ3P 2C2NA 3ZZ0A 5D0HA 5ETMA 3SCLE 3JTNA 3DI6B 4CLWA 1P9QC 3OVAA 3MMBA 2RH3A 4J5OA 2OO4A 2Y8YA 1G6BA 1FK9B 1MG7A 3EMTA 3HFZB 2GHWA 2KXNB 1YWXA 1UWAA 3BGRA 3LWLA 3M8PB 3MEDA 1U7LA 2OEMA 2VG6A 3E51A 5KFMA 5K8NA 3TI0A 3M2UA 2OFGX 4WYLA 4F4AA 1PO6A 2W4CA 2BR0A 2AMCB 4HT5A 3I0SA 4CIOA 5J2QB 1NDCA 5F8JA 3TUJC 2MLXA 5B0BA 2DO4A 4AL7A 1A9NB 3F56A 1M1GA 2JLGA 1FVQA 2XNRA 4LF6F 4J9NA 5KFFA 2W9CB 2FJEB 2HWTA 4WFXA 1NPRA 2I9SA 3JS9A 3ZNJ1 5AJ3F 2IAJB 1RWMB 1K1QA 3L4BC 4WU2A 2DH9A 2A1BA 4FS2A 2VOOA 1R7IA 3RBEA 1ZAVA 3Q8SB 1SV5B 3IMQJ 4CCHA 2I0XA 3KG1A 2XS2A 3KHGA 3EJMA 1S6PA 2J76E 3P8BB 1IBCB 1HW8A 3ULHA 2YKPA 1CJTA 1RAEB 2MKHA 5LXYA 5IT0A 3FFIB 4RBTA 2MZQA 4KKOA 2HSEB 1N0VC 4WKYA 2V9KA 3HD1A 5E41A 4DV5F 2G0IA 3QAUA 1RHKB 2F9JA 2F4FA 2AZ3A 2CG8A 2C3UA 2M2BA 3R7BB 2DHAA 1ICEB 4NLQA 4DG1B 4ZVOB 2ZWPA 2HNDA 3M8ZA 3ZZYA 4K2XA 4BCAA 4DX6A 4ED5A 2XNQA 1R43A 4PXCA 4CT8A 3KJNB 3JQMA 3QNWB 2DHSA 5D3GA 1OPZA 1K44A 2E7XA 2GJ2A 1N8RT 4I7FA 2PI5A 2WAQD 2K7KA 1SJ1A 2DCUB 3T1AA 3H2UB 1Q8KA 2HVIA 2JH3A 3IG1A 4FKXA 1HNXJ 2R7UA 1SQGA 1X31C 3NKYA 1MWZA 1Q78A 2ZUAA 3L95X 2YWHA 4HYKA 4ZPCA 3HSDA 2DNGA 3QO9B 2J0XA 3IWLA 3QGPA 2YPZA 4OHZA 5H9FJ 1L3SA 3DLHA 3WIUA 4RUHA 5J2NA 2H51B 1HR0F 3MI7X 1YJTA 3KMSA 2CJQA 1KHVA 3M8QB 3Q8UA 1CJUB 3RTVA 3WHIA 2R2SA 3UCZP 2DR7A 1GXUA 2PMHA 1F5BA 2OEKA 1UWBB 3BKFA 3EGNA 4M8LA 3RG6A 2MXYA 3BSOA 1OSCA 3AD7C 2BM1A 5KG4A 3KK2B 1EKRA 2DIVA 1JNZB 1AA1B 2RNEA 3BGOP 4DU8A 1U0HA 1R3NA 3TAMB 4KFBB 1IWGA 1TTHB 2HBZB 4OX8A 1R0BG 4YHHJ 2UZAA 3N9UC 4DHVA 5A8WB 4DQQA 4DL6A 1FERA 1S1VA 4OZ5A 2AHOB 1D9DA 2VV5A 2M9KA 4QOTA 1NHKL 4BLGA 5KG7A 3DLKB 4LREA 3M1VB 5I3UB 2MLYA 2DGQA 4HI2A 4V1Ak 1PYSB 4OYOA 3TX0A 3ZFVA 1RAJA 2F9DA 4ED2A 4DBQA 1X5PA 2DXEA 2HBRB 1S1TB 3RAXA 2K3IA 4ZN1A 4EYHB 1FEEA 4RJVA 1JXEA 2NS1B 4KR0B 1QAJA 2OMOA 4WP3A 1UCNA 2V2QA 4OZ3A 1E6VA 2XHCA 4CNZA 5LMNJ 3GE9A 4LMZA 2W9CA 1XMQJ 1E6YA 2B7BB 3DOMB 2PFDA 2AYMA 4OHWA 4ID5B 1UVJA 4JI1F 1Y00A 2OPRB 3POTB 2YNIA 3CJ5A 2KU7A 3E01B 3CCES 1LWCB 3E8OA 3JSYA 1SXLA 4LR7A 3KLFA 1A0OB 4I6YA 4DMZA 1PKUA 5J1PA 1NEEA 1D8ZA 4I6AA 2AEJA 3C6UB 2G1DA 2WZ1A 1R8PA 3PX6A 4JV1A 1JIHA 1YJWS 4G1IA 1F6TA 4NLSA 3CCUS 3IBFB 4PWUA 4DS5A 2KG1A 4BWMA 1HNIA 3LP0B 3QATA 1NB2A 4WF9Q 2W9BB 2HMIB 3I82A 1RHQB 4CTAA 2HHSA 4U7UK 2XY7A 2G2ZA 3W3SA 3MHYA 2EI5A 3HLUA 5G4DA 1T9YA 1UA1A 2VA3A 1T3NA 5DRKA 4ZP7A 2HHUA 4WZMA 1JLCA 3W66A 1TL3A 3B4DA 2DGWA 2CPZA 1RLCL 3CJ4A 1Q5YA 2IDLA 5DS7A 3ET6A 2E1PA 2W8KA 1NK7A 1MNEA 3WX4A 1O51A 3HF5A 3D3BJ 1HW9A 2CJAA 2VQEJ 1YJVA 4DV1F 1IBLF 2CZ4A 1NK8A 4Q43A 1LW0B 1VHFA 1VRUA 1U2FA 2EFOA 3M6XA 1NZ8A 4LFAJ 5KFXA 1EP4A 2M7SA 4FXWA 3QZ8A 3QRPA 1SV5A 2UUBJ 1NU4A 4PEOA 2HIQA 2CWKA 2RSQA 3GFHA 1WKLA 1U8SA 2PN6A 4CNYA 1L3KA 1NAQA 1FTRA 2YKQA 3HHLC 4ALZA 4EZ6A 2V8VA 1Q7YT 4RW7B 2QLBB 3TZWA 4UF4A 2DPJA 4C8LA 1H72C 2IM0A 2UU9J 4C97A 5CAAA 3MD1A 4HT7A 1F3VA 3HZEA 3V4IB 3M30A 3OSNA 1VBZA 2IM2A 2QV6A 4MFBA 1BMQB 1LWXA 1RAIB 2Z2YB 3NGUA 4PG4A 4DI6A 3VAFA 3LTOA 1S48A 2ACMA 3D0IE 5AE1A 1BE4A 3L09A 2WVEA 1XEZA 2DR9A 1Q95G 1RJJA 1XK8A 4RPFA 5GMKa 2EFGA 4YUDA 2OMLA 4R5PA 5IV3A 2AGPA 1SBRA 2CJXB 4QWEA 1S9EA 2LECA 3NBPA 2LMIA 3D6TB 3PJ9A 3W63A 4FPRA 4ECXA 5EX3A 2HNYA 3TARA 3T9NA 3KK1B 1S7IA 3H42A 3MMBB 2R7WA 5K14A 1UJ5A 2EVZA 4MTPA 1NK9A 1S1WB 2MKCA 5I3PA 4ZVPB 1WF0A 3JSBA 4LF1A 2VA2A 2HS0A 3OXLA 3U1MA 4M95A 6FDRA 1X4DA 1G3OA 3M32B 4C0HA 1DTTA 3BPSP 4Z7YA 1JLFB 2AX0A 5BR8J 2XG8A 2UUBF 4UW2A 1SJQA 1LWFB 3DLGB 2KJVA 4ZKAA 3OVSA 2ZH6A 1WHXA 2AEMA 4WTYA 4JBCA 1SH0A 3FK4A 1FNXH 3GP9A 4WBFA 4NXMF 4F4YA 3TNVA 4YR3A 2PDAA 4DWIA 4WWSA 1S0NA 3QRRA 1FESA 3M8YA 2J8SA 1IBMF 3ZZOA 1CQNA 1Z1ZA 4NCGA 2J0QD 3BQ1A 1GNKA 4A8YA 2R2RA 5HP1A 2V34A 3H90A 4AXIA 2BV3A 5E7OB 3PCOB 1RHUB 1U1MA 4OI4A 3AJDA 2W7OA 3FMBA 3ISND 1JB0C 2FHJA 2H5IB 1UWBA 3CIMA 4KB7A 3OLBA 3CJQA 2WOMA 2I38A 1WTFA 1IM6A 2XTJP 2FJXA 1SC6A 1HBNB 2GVDB 1S6UA 4I0WA 9RUBA 1NK4A 2ZNZA 3KLFB 1KLMB 2W25A 4OZJA 3TEHB 5F3ZA 3CPWR 5GMEA 4JV5J 1EETB 4IG0B 2H4YB 5M2UA 2EKNA 3R5GA 4NX9A 4OZNA 4ETXA 3UQSA 1U2RA 3OV7A 2NUHA 3CCZA 1NSPA 2FJVA 1N34J 2Q79A 4FXVA 1FJGF 4IDKB 5HVFA 2I5JB 3IR6B 1T05A 4UY8T 1CPZA 2HMIA 1FKPB 1F1BB 5HO4A 4DV6F 3R5CA 4G1PA 3OBIA 3WDOA 5LXRA 4IH6A 3CO0P 1D8YA 1DQ9A 1N32F 1L5UA 5EWGA 2NZ4A 2M52A 4M63A 2XMUA 2I1RA 5KFEA 2IJFA 2UXCF 4WFZA 4X4PA 3D5MA 4OJ1A 1X9MA 4X4NA 1ACMB 1DLOB 3R6GB 3T19A 1FDDA 3BF4A 1NM2A 2YNGB 4DV1J 1IBLJ 3T9ZA 3QLHB 2NXJA 4YDDB 4F3OA 2JEGA 3KUHA 4KE5A 3J80U 5K9FA 1S12A 1SUQB 3P45B 2DRAA 2C2OB 1C0UA 5FIIA 3C6TA 4OL8A 1S76D 4MKBA 4I2QB 4KIAA 5KFAA 2ZH3A 4CDIA 1M5KC 1VJQA 4Y2IA 1S1UB 2X7IA 3UWTA 3MTJA 5HMYA 5JVGQ 1ZM2A 4RW6B 4QBUA 5L9NA 2B5JB 2J6SA 2QSWA 3KOAA 4TLRA 3PO4A 1NSKL 4LFCJ 4LFCF 2PA3A 3CMQA 2R7QA 4NCBA 2RF2A 2WBRA 1YJ7A 2WW4A 4OYXA 1YX2A 3CIZA 1FKOB 1PSDA 2VBXA 3GYGA 3HP6A 4A48A 3KJVB 1RAAB 2HS4A 2PGCA 3W61A 2YNHB 3ZTSA 5HVHA 4J9RA 2RRAA 2ZZNA 4IRDA 4WIIA 1NNDA 5DLGA 3HHNB 1K0VA 3HSJA 4USVA 4DX8H 3UNYA 5KFHA 4L73A 4C8YA 3MPDA 2F4VJ 4FBUA 4PRFA 1UZHA 4K4ZA 4QQBA
chains in the Genus database with same CATH topology
1LOUA 5IWAF 4TY8A 4ICLA 3C46A 1LW2A 2YKMA 1TUVA 4NZ7A 1PO6A 5CA5A 4HLBA 3VWSA 1SUQA 2RU9A 4YR0A 1AROP 4RNOA 1QAXA 2JSXA 3LPYA 3BO4A 1M5OC 3GFZA 1SL1A 4P6QA 1X8DA 5J2MB 2E29A 1FA0A 5K5MA 4WFYA 3QIDA 4M5DB 1M90T 1MMNA 1X4EA 4NLDA 4ES2A 1C4CA 4F2SA 2GNKA 4CO4A 1YVFA 2VB6A 4DQIA 1Q16B 4DJBA 2IVFB 2OPQB 1N56A 2L9NA 4NLUA 2DNQA 3PACA 3Q24A 1O8BA 1U1QA 1Y3JA 2M8HA 4K5RA 3IR7B 4TYAA 3OL9A 1O5JA 3IGVA 4F25A 3PW0A 1K73T 2F1FA 1FXLA 2ZKUA 2ZH5A 3LF0A 4I4BA 3I4HX 4QR1A 1VQ9S 3TYTA 1BQMA 4K5SA 1F2GA 3KK1A 5KG0A 3JYTA 3ZZUA 4EGLA 1MU2B 1OO0B 1HFEL 4QIEA 1ZTWA 4KKOB 3RB0A 2LKZA 4MYUA 4EO6A 4NMLA 3JSMA 1U4BA 3QPIA 2MKKA 4ZVHA 4OI6A 4JI2F 3D1OA 1DFDA 1JWWA 3VCDA 3PR5B 1HD0A 4F26A 2CQ0A 4ZP9A 3OJUA 4L6V3 5D4NA 2KG0A 5IM0B 1QAIA 5L1KA 1YIJS 2CRLA 1T94A 1YRTA 3BSNA 2M0GB 3NGKA 4J9PA 3DOKA 2J6TA 2JEFA 3P49B 3G8QA 4UQTA 4B9UA 4EYIB 4QJVA 5CYJA 4K4UA 4PXDA 5LT5A 2HPUA 2ZDOA 3LH2S 1SI9A 3BM7A 5D77A 2VOPA 4XDDA 5LSOA 3RB6A 4J9SA 2C42A 4LSNB 2N7CA 2MKIA 3OHAA 4OI1A 3T1YF 2MJNA 4TKTA 3V6JA 4L3NA 3H98A 3M8PA 4DS4A 1W25A 3KKFA 1UJ6A 3FZBA 3NS6A 1RT7B 3O44A 3SDEA 4RUCA 3PIPQ 3BQ1A 2UP1A 4JI5F 4CO3A 1FRKA 5D4LA 1N33F 3VQTA 3M9MB 3H59A 2PEHA 1Q7LB 3N6MA 3MMCA 2NUUG 4KHMA 2B4VA 1QLNA 3TOQA 1RT2B 3PM9A 4QYZJ 1LW2B 3QMQA 3IRXA 4NLYA 1KONA 4J9LA 4FNHA 3NG8A 2AYGA 3NCRA 5LSLA 1X9WA 4O3PA 2B7CB 2B9YA 1U09A 2LXIA 4F4ZA 1H0HB 3K5MA 3M9OB 2WONB 5L39A 1GXTA 4ID5A 2GJIA 1U49A 2XY6A 2JDJA 2YNFA 5E3CA 4LFAF 3CDAA 2EBGA 1URRA 3MF5A 2RS8A 4LQ9A 2DNRA 3IAS9 3TVYA 2LLZA 3CT9A 4OJGA 2FLPA 3OTBA 3N5FA 2VG5B 2RQCA 4ZDNA 3I5CA 4MK8A 4GC7A 1C0UB 2R8IA 1D1UA 4NRTA 2GHVC 1QSLA 4TU7A 3HX9A 2C2EA 2FVQA 3R27A 4YP3A 4Q44A 2L9WA 4X4UA 2X1GA 2RJZA 2D41A 3G6ES 3KTQA 1KOOA 2C3MA 5HL7Q 4CTAB 4LT6A 4PQUB 3HVTB 2V8DA 4G6VB 5HROA 4AL6A 2ABYA 2Y0SD 2VL1A 2B43A 3H5SA 4R8UA 3OXFA 4OV1A 1C1BB 4ZK7M