4Q0BB

Crystal structure of hiv-1 reverse transcriptase in complex with gap-rna/dna and nevirapine
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
425
structure length
412
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of HIV-1 RT-RNA/DNA ternary complexes with dATP and nevirapine reveal conformational flexibility of RNA/DNA: insights into requirements for RNase H cleavage.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase, hydrolase/rna/dna/inhibitor
molecule keywords HIV-1 reverse transcriptase, p66 subunit
total genus 112
structure length 412
sequence length 425
chains with identical sequence D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4q0bB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4q0bB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4q0bB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4q0bB03
2OPPB 1S1UA 2IM0A 1LWFA 2RF2A 3MFHA 5HLFA 5C24B 1K1QA 1JLCA 3KLFA 4KFBB 3ISNC 3TAMB 3V81B 2VG5B 4KB7A 3I0RA 1JLGB 1S1XB 1J5OA 2UUTA 3UR0A 3HKWA 2IM3A 1LWEB 4MIBA 5EWGA 4J9NA 3FRZA 4MFBB 2AQ4A 3I0RB 3MEGA 4U6PA 3MR2A 5L1JA 4IDKA 4RW9A 2F8EX 4WXWA 3V6DB 1S1UB 3IG1B 1S49A 4IG3B 1HQUA 1HYSB 3H2LA 1SH3A 2BRKA 3G6YA 4DG1A 4ED6A 1JLQA 2VG5A 2BQ3A 3HHKA 4ECZA 4PQUA 3H5UA 4NLXA 3M9MB 2WOMB 3IRXB 2VA2A 2C2EA 1S6QB 1RDRA 4YR3A 1IKYA 4H4MB 5KFXA 2BANA 3I5AA 4QWDA 4EBCA 5J2PA 3G86A 1DLOB 4ECTA 3KLHB 3PW2A 2BANB 5F9NA 4NCGA 3ITHB 3KJVA 1T03A 4NZ0A 4Q0BB 4ZVFA 4PQUB 3NGDA 1TQLA 3GV5B 3C6UB 5DLFA 2ILZA 3HVTB 1REVA 5KFEA 3KOAA 1RT3A 1IKXB 2WONB 3QIPB 5KFZA 5KFPA 1RT4B 5KFQA 3G6XA 3T5HA 1T05B 2FLLA 1I6JA 2C22A 1TVRA 2OPSA 3KLIA 4XPCA 4MK8A 2QE5A 4RNNA 3E01A 2W9AA 5CYMA 3KJVB 4RNMA 5HP1B 4O3RA 5KFDA 1WNEA 3LAKA 4ID5A 5J1EA 2AGPA 1S0MA 4IH5A 4ZHRB 4O3SA 4HKQA 2IA6A 1HNVA 2FJXA 2ILYA 4ZPAA 1JXLA 1LW0B 1TKTB 2ASDA 1S10A 2ASLA 3OL8A 3QLHB 2D7SA 4Y2AA 4J9LA 2DPIA 4K4SA 3I0SB 5HP1A 5KFCA 4ICLB 5KG2A 4ECVA 3KK2B 1S1VA 2FVRA 1FK9B 1S1WB 1QAIA 1KLMA 4K4YA 3DRPA 4RW6B 1RTDA 4MKAA 4O3NA 3KHLA 4QWBA 5F8NA 1HNIB 1N6QA 2J6TA 3DYAB 4XO0A 4IKAA 3M8QA 1HPZB 1S6PA 4XPEA 2FVPA 1XR6A 4KO0B 3DRRA 3MEEA 3CJ2A 3T1AA 2D41A 2FLNA 1W25A 5HLFB 4ZP8A 2BRLA 4RW7A 4ECXA 1N5YB 3OHAA 2ASJA 4MK9A 3MR3A 2CKWA 2IJFA 1TV6B 4WFXA 4Y34A 3KHGA 1RT2B 3G6VA 3QYYA 4NCGB 2AX0A 5KT4A 3V6JA 5KG0A 2UUWA 4LSNA 4URSA 4TQSA 4IOBA 5KG6A 3H4BA 3DLKA 4NLTA 4Q45A 5C25B 2E9RX 5KFGA 4J9OA 3OL6A 3HVWA 3IGNA 2UVWA 5C42B 3CJ3A 3GILA 3MTKA 4J9RA 4K4TA 4ED0A 3CJ5A 4IRDA 1JIHA 3CVKA 3RB4A 3CDUA 2D3UA 4DEZA 2HNDB 4R0EA 1D0EA 1JLGA 1SUQA 3N6NA 2GC8A 5KFTA 3OHBA 5KFYA 5KFVA 2V4QA 4IDKB 1JKHA 2HWHA 4PWDA 3DMJA 4O3OA 2BQRA 2JEIA 4M95A 2AX1A 1RYRA 3QGIA 3GIIA 4IR9A 5F8IA 2V0NA 3TVKA 4JV0A 4GC6A 4NRUA 4NLYA 5KFSA 3GIJA 3KLFB 3CIZA 2RKIA 4I2PA 3GYNA 4KHMA 5C24A 4MK7A 1YVFA 3KK2A 1RT6A 5J2NA 3LAMA 3NAIA 4O3PA 3DLGA 1JLBB 3CJ4A 1S9GA 2ZD1A 5EDWA 1BQNB 3DLKB 4TY8B 1RT1A 1C1CA 4J9QA 4ID5B 2JC1A 5I42A 1C0UB 3HVAA 1C1BA 3EZUA 3H5SA 3I5BA 4RW8B 2XI2A 3H40A 1VRTA 2W7PA 1IKWA 2RDJA 4F50A 5F8LA 2IC3A 1DTTA 1QE1A 4WE1B 2D3ZA 3T5JA 2W9CA 4JUZA 4DL4A 1N5YA 5J1EB 2ZKUA 3UQSA 3V6HA 1U09A 1FKPA 1JLFA 3FQLA 5KFFA 4B3OA 4IH7A 4RW4A 2FVQA 5KFKA 3T5KA 1MU2A 1TVRB 3KLIB 2AGQA 3QO9B 5F8GA 2V4RA 1MMLA 4YP3A 5L1IA 4FS1A 3DOKA 4IFVA 1RTHA 2W9CB 2OPQA 3GIKA 2W8LA 4F4XA 1DTTB 1QE1B 2UVRA 1TKXB 3KNAA 1T03B 1JLEB 4IFYB 2YNHA 4ED7A 2DPJA 2VA3A 1C0TB 5KT7A 4OL8A 3OLAA 4ZP6A 1S9EB 4PUOA 4TY9A 1BQNA 4TY8A 3PVXA 4K4XA 4F4YA 2YKNB 4TYAA 1IKYB 3IG1A 3RB0A 4DL6A 1HQEB 5DQIA 4WZMA 3MF5A 5DQHA 2YKMA 2HWIA 3GV8B 1RA7A 2I5JB 4QPXA 3FSIA 4DL2A 2YNFA 4NRTA 4WFZA 5J2MA 2R2RA 3FDSA 1ZETA 4NLWA 3LP0B 4ECRA 4LSLB 4H4OB 3E01B 1LWCB 3MEDB 4Q8FA 4RW9B 3JYTB 4KSEB 4I7FA 1FKOA 1SV5A 4R5PB 3H5YA 5KG4A 5HBMB 5HROA 5KG7A 5KFHA 5J2MB 4K50A 2WONA 3QIPA 4Y3CA 4LQ9A 4TQRA 2HNDA 2I5JA 3IS9B 4O3QA 2WB4A 5JXSA 3BQ0A 4RU9A 4O4RA 4KFBA 2CJQA 2JLEA 4ED3A 5D3GA 3JSMA 3IGVA 5C42A 3PJXA 4G1QB 4O4GA 3OSNA 1JLAA 2I1RA 3V6KA 4J9SA 3UPFA 2JEJA 3BGRA 5KT2A 4DL5A 1BQMB 4MIAA 5L9XA 4EEYA 4ED1A 1S1TA 3OSPA 4H4MA 2ZE2A 3BREA 5KFAA 3H5XA 4ECSA 3SFUA 1EETA 4EO6A 4IQXA 2JC0A 3BSNA 1S1TB 3IS9A 1N4LA 3KMQA 3CO9A 4RNOA 2AU0A 1RTJB 1TV6A 2W8KA 1RTHB 1TL3A 4URGA 1JLAB 2FVSA 4IG3A 2V9WA 3KLGB 2IAJB 4KE5A 3DRRB 3MEEB 3T19A 3FQKA 5KG3A 3I5CA 5KFLA 4R8UB 3H4DA 4QWEA 3PJWA 1EP4A 2HNZA 4LSLA 4B3OB 3Q8RB 4J9KA 3OL9A 4MFBA 1HNIA 3DYAA 2B6AB 4ED8A 4EYHB 4IG0A 3KLEB 4Q44A 4G3IA 3V4IB 4LQ3A 3GQCA 3FFIA 5KFIA 1Z4UA 2VG6B 1LWFB 5FDLB 1RT5B 5CYQB 2W9BB 2OPPA 1QUVA 4RUCA 4KHRA 3I0SA 2YNIB 4KV8B 4ECWA 4ZPCA 1S9GB 2ZD1B 1RT5A 2R2TA 1LW0A 2HMIA 4K4UA 4HYKA 4NLRA 2R2SA 5FDLA 1HMVA 2YNGA 2BQUA 3Q8SB 4IG0B 4QWCA 2ATLA 5I3UB 3H98A 1TL1B 4Q43A 3MECA 3RBEA 3LP1B 5J2QA 3PW7A 1K1SA 3PZPA 4YR0A 1R0AA 1JX4A 2HAIA 2VG7B 3C6TB 5K14A 2OH2A 4TXSA 1TKXA 3BR9A 3MR5A 3KLGA 4URQU 3PW4A 4I2QA 5KFWA 3KLEA 1T05A 3H59A 3NL0A 3UDLA 3QZ7A 5KT5A 4QW9A 4WYLA 4F4WA 4YMEA 5DLGA 3C6UA 4MH8A 4K4ZA 4RW8A 4ZP9A 3CJ0A 2BE2A 2VG7A 2OPRB 3C6TA 3KK1A 5F9LA 4NLGA 1GX5A 1DLOA 1RTIA 5EWEA 2JEGA 1TL3B 5DGBA 1KHVA 1GX6A 3DI6B 1RTIB 4RNFA 2R8JA 4LSNB 1RT6B 3T5LA 1VRTB 4DL7A 2JEFA 2GIRA 5KFRA 3NBPA 2R8HA 1RT1B 4WYWA 3MFIA 3KHHA 1UWBA 1D1UA 2ALZA 1HQUB 1HYSA 4GC7A 1S0NA 4J9PA 3DOLB 1TP7A 4RUAA 5DGAA 3FFIB 3TQ1A 3JYTA 1OS5A 3V4IA 5KG5A 1LWCA 3QGHA 4RNHA 4ZPDA 4FS2A 3MEGB 2BR0A 1TKZB 1N6QB 1RT7B 3KK3A 1LWEA 5F8HA 4X2BA 1S1XA 1J5OB 3NBPB 1TL1A 4YR2A 2J6SA 3DRPB 4RW6A 2FJWA 5KT3A 3RAQA 4IR1A 4FBTA 3RB6A 2AGOA 2RF2B 2YNGB 2IAJA 5T14A 2FVCA 3PR4A 5KFNA 4ICLA 3DI6A 3DOLA 1SUQB 5L1KA 2GIQA 1S9EA 3LP2B 4EO8A 1RTJA 4ECYA 3CDWA 4O44B 1DTQB 3BQ2A 1S48A 2XGPA 4DL3A 2IBKA 1NNDA 3EPIA 2YNHB 1EETB 1JLEA 2ZE2B 5DG7A 5C5JA 5F8JA 1RYSA 4IRKA 5KFBA 3OL7A 1QAJA 1HNVB 2OPQB 5C25A 5KT6A 4KKOA 4PUOB 2IM2A 4ZMMA 1RAJA 4RW7B 2R8IA 3BSOA 2HNYA 3EPGA 2O5DA 4RW4B 2BE2B 4Q8EA 4FBUA 4KBIA 3M8QB 2EC0A 4EBEA 5DG8A 3DOKB 4IFVB 5L1LA 2XGQA 4I7FB 4YQWA 1VRUA 2IC3B 3DM2B 1SH0A 3NMAA 1S4FA 5K14B 1IKWB 1S1VB 4K4VA 1HMVB 1R0AB 3NAHA 1ZTTA 4QW8A 2YNFB 2B43A 5KG1A 3N6LA 2YNIA 3ICLA 1RTDB 2XCPA 3MECB 2E9TA 1TKTA 3LP2A 2XI3A 1LW2B 3DLGB 4G1QA 4O4GB 4ZP7A 3M9OB 5J2NB 4K4WA 5D3GB 1HQEA 1IM4A 3KLVA 4Y2CA 1LW2A 2WCXA 4NLUA 5I42B 1C1CB 3QLHA 3LANA 2B6AA 4EBDA 1RT7A 3KK3B 3GIMA 4IH6A 5DG9A 3DDKA 4IFYA 1RA6A 3D5MA 4RZRA 2OPSB 3MEDA 3VQSA 1JKHB 3QIDA 3PHEA 3IN5A 4WZQA 3BSCA 3D28A 1N56A 5KFUA 1REVB 4NLQA 3SI8A 4TLRA 2IMWP 3QO9A 1EP4B 2HNZB 2UVVA 1MU2B 4MKBA 4R8UA 1NHVA 1SH2A 4NYZA 4TN2A 5KFJA 1S9FA 3ITHA 3KMSA 3QGGA 2HNYB 1HARA 2C2DA 3DRSA 1BQMA 3SFGA 1RT3B 3BGRB 3HVTA 4KKOB 3CDEA 3M8PA 1S6QA 3N6MA 1C1BB 1C0UA 3PW5A 4WXOA 3PW0A 3M9NB 3DRSB 3Q8QB 3V6DA 1NHUA 2OPRA 4U7CA 1HPZA 1S6PB 3JSMB 5DQGA 2FLPA 4KO0A 5EWFA 1RT2A 1JLFB 1FKPB 3MR6A 3DLEA 4JV1A 4DG1B 5KFMA 3LP1A 5J2QB 4JV2A 1TKZA 4NLDA 4ZVHA 3Q8PB 4F4ZA 1FKOB 1SV5B 4R5PA 4WE1A 2AWZA 3ISND 5HBMA 4I2QB 5HROB 2R2UA 1FK9A 1S1WA 3DMJB 2XCAA 1JLCB 1KLMB 3LP0A 3GV7B 3BQ1A 4J9MA 2YKNA 4H4OA 2QV6A 4ZVEA 4ECUA 2B5JA 3OLBA 3PR5B 1UWBB 5F8MA 4KV8A 2XC9A 2J6UA 1JLBA 3TAMA 3V81A 2WK4A 3BSAA 2R8GA 5CYQA 2W9BA 2YKMB 1C2PA 2IJNA 2FJVA 2WRMA 2WTFA 4IRCA 4I2PB 5EUHA 3RBDA 2HMIB 4ZHRA 2XWYA 4ECQA 2RDIA 2B5JB 5CYMB 1C0TA 3KK1B 2VG6A 3KHRA 4M94A 2E9ZA 1VRUB 3DM2A 4PWDB 3QZ8A 1IKVB 3E51A 2C28A 2R8KA 1XR7A 1RT4A 1N48A 4KAIA 4EYIB 3DLEB 3NKYA 4H54A 4QWAA 1IKVA 2WHOA 4Q0BA 2C2RA 3LALA 4NLOA 1S97A 2IM1A 1KHWA 4NLPA 4TYBA 3KLHA 1XR5A 4WFYA 3RAXA 3BJYA 5JUMA 2W7OA 1IKXA 4NLSA 5I3UA 1T94A 3RB3A 4ED2A 2WOMA 3IRXA 3CWJA 2RKIB 1S0OA 4NLVA 3M8PB 1JLQB 1T3NA 2UVUA 1DTQA 4O44A 5KFOA 5J2PB 1ZTWA 4ZVGA 1CSJA 4ZPBA
chains in the Genus database with same CATH superfamily
4LF9F 2IYIA 2BJ3A 2H5EA 2L9WA 1MN7A 3T41A 4YUDA 1TAQA 3IAS9 1GMWD 2EKNA 4AXIA 1XJWB 1F9HA 3ISNC 1H74A 2FZKB 2XNRA 1H7XA 1JLGB 2X3GA 5EWGA 1GTEA 4J9NA 3HKWA 2AYBA 2YWHA 5DZ7A 2CPFA 2X51A 5CYJA 3FRZA 1HNZJ 2AQ4A 3ZZZA 2PMZD 3MR2A 4JI4J 3O6QA 4M63A 3K89A 1CJKA 1S49A 3W1YC 1HYSB 2LEPA 5IZHA 3HX9A 3CJTA 3PRBA 3G4SS 4B3MJ 2AYMA 2KKHA 2ZNZA 2BQ3A 5T41A 4NE9C 4OX9F 5LSRA 3T1YF 4MYTA 3LGMA 5GADI 1IKYA 2BANA 2QEXS 3VWSA 5G0RA 4EBCA 2QA4S 1FRHA 1IBCB 4ECTA 4K7QA 2BANB 2OO4A 3LPYA 5IC6B 1URRA 3FMBA 4UUWA 2R7WA 1OSCA 2WVCA 4TVAB 2F4VF 3NLCA 1HKAA 2ZBCA 2DITA 4LF2A 1MN9A 1TQLA 2HBYB 2XMTA 3MMBB 2MMYA 5GAGI 1EZZB 5KFZA 1HD1A 3S01A 1RT4B 5KFQA 1CJKB 1VCTA 3D4JA 2C22A 4C0OC 2HHHJ 3KTQA 1GNKA 5D6GA 2QE5A 5KOWA 2W9AA 4RPFA 5CYMA 3CMES 1UJ4A 4UOGA 2R7TA 5HP1B 3BB5A 3CT9A 3UD5A 4ID5A 4DV5F 5J1EA 2AGPA 1WNEA 4IH5A 4ZHRB 4O3SA 2W4PA 1Q95G 2D1CA 2QLWA 2E5LJ 3TUPA 1HNVA 1FFSB 2FJXA 4ZVSB 1JXLA 4YDXA 4USHA 3L95X 3IAM9 5ETTA 2EFPA 1Q7YT 4AQYF 2FGCA 2I9SA 1NPRA 2ASDA 2ASLA 4ZLLA 3QLHB 3MM7A 2D7SA 4I68A 1DJ0A 5A8RA 5A8KA 1TTHB 2Q79A 5KFCA 1L3UA 1AA1B 2ZOFA 3F73A 3D68A 3FSYA 1NJXA 1FK9B 1S1WB 2BYCA 4JI2F 3M30A 3B78A 1K9MT 4K4YA 1U1KA 1X4DA 5HVHA 2CQ0A 4MKAA 4DPYA 2Q66A 2IA0A 4QWBA 2VB6A 3W5ZA 1TAUA 1N6QA 5F8NA 3DYAB 3D6MB 3OTEA 2JRSA 2W24A 2IVMA 2GW8A 4XPEA 1JQGA 1SC6A 2NS1B 1NPPA 2HFUA 3MEEA 3SQOP 3VZIA 3T1AA 4RBVA 4UQGA 4JI4F 3NNHA 3VAMA 4QIVA 4ECXA 5DDPC 3OHAA 3OJUA 5MAOA 1FDAA 2OAUA 3L3CA 2D3OR 1V3RA 2KJVA 4B9SA 1KVIA 1NUEA 2H48B 4QU7A 2HLTA 4F67A 2DGVA 2F8MA 4NCGB 2MKSA 4DUYJ 2HVIA 3QWPA 5KG0A 2UUWA 5FJ4A 2QTWA 3CCUS 2LP4A 4IOBA 3H4BA 3DLKA 5BYSA 1OWXA 3TO8A 3POTA 1QUPA 3PY8A 2DRAA 3VGUA 2EEYA 4KGXB 4J9OA 1NK9A 3HVWA 3R9LA 1IWAA 3IGNA 3AA9A 3MTKA 2NYHA 1VS3A 2XZDB 3AA8A 3AXKA 3ET6B 4ZPWR 3CVKA 3TOQA 3GP9A 3W64A 9ATCB 3RB4A 2HNDB 3TA1A 4LF5J 3RTVA 3NCQA 2GC8A 3H42A 3ZTOA 1EIYB 3D67A 2BM1A 8ATCB 1AROP 1HNZF 4PWDA 3BGLA 2D69A 1N36J 2AX1A 3EZ5A 2DR6A 2GGPA 1TL4A 1VOMA 2RQKA 1WELA 5F8IA 2XO7A 4RU2A 3TVKA 4IR9A 4HT5A 4ENOA 4NRUA 3GJRB 3GIJA 4KGMA 2MY7A 4OLOA 1B0VA 1KONA 4RBTA 2E5LF 3HM9A 3KLFB 4Y2MA 3JSBA 2NSBA 1K44A 1YVFA 4JI3J 3QJJA 3DLGA 5EDWA 2NZ4A 3DLKB 4NL5A 1C1CA 2VL1A 4DZDA 5I42A 4CM2A 1M1KT 2G4BA 3HVAA 4DR6F 1C1BA 2VBXA 3EZUA 3H5SA 2GHWA 3I5BA 4F0KA 2L41A 3VAFA 1UA1A 2NREA 1IKWA 1D09B 2PMWA 1XMQJ 2ZJQQ 2KVQE 2XLIA 1W7WA 2AJFE 1NO8A 2GQQA 4HTIA 4LRAA 3T5JA 4I67A 1YDLA 2Z2LA 4DU8A 5GAEU 5J1EB 3M8SA 1FTCA 2DCUB 3UQSA 3VVUA 4DL4A 3KXDA 1U09A 1FKPA 3FQLA 3TVZA 3JTNA 2G9OA 1RWKB 2VASA 8AT1B 1VQ5S 2DNKA 2V4RA 5IV3A 4FS1A 4DF4A 1SL0A 3I31A 2P9GA 3TW0A 2QJ3A 4F0HA 4IO1A 2XMMA 4WP3A 1U1LA 3BM7A 4X62F 3VGSA 2HURA 2YX7A 1NZ8A 4FZVA 1TKXB 4PEOA 3KNAA 4HDGA 5U47A 5A8WB 4DF8A 4QIWD 1WUUA 2BM0A 2YNHA 1SCJB 1SVDA 3TAPA 1C0TB 3EWGA 4X64F 3DXBA 3OLAA 3RBZA 1Q82T 1WEXA 4ZP6A 1X31C 4ALZA 1FVQA 5EGYA 3ZFVA 3FCVA 1R0CB 2WAQD 1FXRA 3CEDA 1IKYB 2E7VA 2F63A 5DQIA 4CWBA 2HWIA 1KOHA 4DV7F 2ADCA 3WZ0A 4C4WA 2YWFA 2W2OP 3W63A 1XK8A 2Z2MA 2XY7A 1YBUA 2MGZB 1FF2A 5L39A 3FDSA 3W2WA 4Y0FA 1SXLA 4LSLB 4OJHA 5E41A 1LWCB 2IRYA 3Q24A 4C3KA 4B9NA 4KSEB 3KFWX 4AE5A 2MHNA 1FKOA 4X65F 4GVLA 2ZDOA 5KG4A 4DDFA 4ES2A 3TUIC 2HW3A 1RAGB 4JI1J 1DARA 2F8HA 5LJ3Y 4TQRA 3G8QA 1CJUA 1U4BA 4PYDA 4KIAA 4O3QA 1R8AA 5JXSA 3BQ0A 4KPCA 4NXNJ 4CI0B 4IQMA 4ED3A 2JLEA 3UNGC 1XNQJ 1KTVA 3R6LB 1E6VA 4G1QB 1JNRB 3M7VA 2I1RA 2AF6A 3MCMA 4KT0C 4CH0S 2VFUA 2WBRA 2XSJB 1PYSB 3DLHA 1FDBA 2AJ0A 1QVFR 1U1QA 1RAAB 1WSRA 3DRXA 1NDLA 2F9DA 1E6VB 2G2ZA 3PFOA 1QSLA 1UP1A 2M4MA 4D3GA 2LA4A 2KXNB 3H25A 1VMBA 3CJ8A 3CCVS 3BSNA 3KMQA 2BE7D 2KL8A 3HXMA 4A8WA 3IBWA 2OEMA 2FC9A 1WHYA 2DJWA 1P6TA 2WVEA 5AE3A 3LTOA 2HVEA 4URGA 4CLPA 1YG0A 2MDAA 2D3O1 1D9FA 5HVFA 4GMKA 3FQKA 1EJ7L 2YBVA 4Z2XA 3I9ZA 3MD1A 5AE2A 3IWXA 4LSLA 5ETVA 3IWLA 3WC0A 4QWEA 3M6XA 3Q8RB 2MSSA 3CD6S 4RBUA 1Q1KA 1S76D 2B6AB 2UXDF 2X1BA 4OQJA 4FF1A 2M3DA 3HSZA 4WJBA 1SQGA 4ZVRB 3K5LA 5IT4A 4LQ3A 3VF0B 3THTA 3GQCA 2K3IA 3B4MA 3KKFA 3RAMA 2LEBA 2V5HG 5GAEI 1N33J 4A8OA 2QGFB 2J8SA 2EBGA 3UN3A 4C2MA 5HL7Q 1CEZA 3SZ2A 1WWHA 3I0SA 1NAQA 1KKHA 2JSXA 1SI9A 4MKYA 2IBOA 3A8EA 4NCBA 3I32A 2R2SA 5FDLA 1HMVA 5E33A 2BQUA 2PA3A 4DPTA 4CO5A 1H2UX 5HQ8A 4DR6J 4IG0B 2CJXB 2XM3A 2OUGA 4WWSA 1T02A 1OY6A 3CE8A 4I4BA 1RKIA 3SCIE 5B09A 4M5JA 5BXIA 5D0HA 4BWJA 2KI2A 4Q43A 4DR5F 2EBEA 3MURP 1JX4A 2VG7B 3UO0A 5K14A 1Q86T 5FLXU 2MQLA 2QRRA 4EGLA 4DR3F 3PW4A 1Y0HA 3J7ZT 5KFWA 3MZIA 3KLEA 1WG5A 4RO0A 2VIHA 2P2CB 4OZ2A 4P2SA 3UD4P 3CULA 3D1OA 4CO0A 3QZ7A 1XBWA 1WC4A 2KT5A 4OI3A 4WYLA 4QW9A 1VC6A 4YMEA 4PKDB 3C16B 3U1NA 3ET6A 4EI2A 1IR2A 3CJ0A 4UZCA 2HQ3A 4NLGA 2VHGA 3NCRA 3OBIA 1GX5A 4OYAA 1RTIA 5EWEA 2ZHOA 2ZKTA 4JI0J 1HQ2A 4KTQA 2X1FA 2OTJS 4FPIA 2CQGA 1OJ4A 1Y7PA 4PRFA 2KG0A 1RTIB 1FI4A 2R8JA 2LU1A 2ABYA 2C2NA 3HSJA 3ISZA 1Z2ZA 2OMOA 1AUSL 3GJTB 2CQBA 3DGPB 2R8HA 3JB9k 3MCNA 1S0VA 3N28A 3KHHA 1D1UA 2HSEB 3OFGA 3RU0A 2ALZA 2XYPB 1KTQA 4RKUC 3Q86A 1XTZA 1RBLA 3N5BA 1CQMA 4GC7A 1S0NA 1P27B 1TP7A 5L8RC 2OJ3A 4N76A 3FFIB 1Q8KA 3HDSA 1OS5A 2WW8A 2YX4A 3V4IA 3CCTA 4JBCA 3QGHA 3MMJA 2H54B 4ZPDA 3CJKA 3CSKA 3D0HE 2XZTB 5HQMA 2BR0A 3K58A 1WG4A 1N6QB 3W60A 2DBBA 1LWEA 1J5OB 3J81j 4B9MA 4LVOP 2QFIA 2E5JA 5E2QA 4IR1A 3R3TA 5GAHI 3DHWC 2IAJA 1RAIB 3ILIA 5CABA 3PR4A 4JV5J 2VD3A 1FRXA 1SUQB 3FCHA 1S9EA 4LFCF 1ZA2B 4FXVA 3B82A 2C2MB 1NK8A 3OTDA 4O44B 1DTQB 1S48A 3NCPA 3DKDA 3DGPA 3H2VE 4DL3A 2HQIA 2CPZA 1HBMA 2DHGA 1EETB 2V69A 2VFSA 3PNIA 1GMWA 4TKTA 2HGLA 3W65A 3MM8A 2MLYA 4DFPA 2V63A 1JJ2R 4IRKA 2EW9A 4ED5A 1HNVB 4O23A 2F4VJ 5C25A 4KKOA 1L3VA 1HNXF 2X3DA 1BQXA 1ULRA 1N32J 2ZHBA 2F5GA 2J76E 2SXLA 5D77A 5ETMA 4RW4B 1NSQA 2WSCC 2HHTA 3GFYA 4AXJA 1F9EB 1WDTA 4KBIA 2DO0A 4NA1A 5I3PA 3WQPA 3VQTA 2B8QA 3BKUA 5DG8A 3CCRS 4WF9Q 1U8SA 2QZ8A 2UXCJ 1FEEA 2QN6B 2DXEA 1YJWS 3I82A 2FZGB 2MQ8A 2M8HA 2OD4A 2V8PA 2MZ1A 3ZZYA 4YOEA 2QL5B 1WC5A 3DM2B 3PACA 2D9OA 3HK2A 1HMVB 5BYQA 3NGSA 3NAHA 4PR6A 3MR7A 3QFWA 1HW8A 2YNFB 3LF0A 4HVZA 5E0OA 1KQFB 4K5SA 4B3RJ 2B4PA 2EK1A 2WSFC 4HH1A 3P3DA 2XCPA 4KHPJ 2CYYA 3LP2A 3G2XA 2XI3A 1LW2B 3JXOA 4KQZA 3M2UB 3S8SA 4G1QA 5DDRC 2O67A 4JI5J 5J2NB 5LSOA 3GFHA 3R7SB 1S12A 1KQKA 5ETNA 2X1AA 2MQNA 4LF9J 5M2UA 2B6AA 2BA9A 3EM1A 1L3SA 1VIOA 3P6YC 1HL6A 4IH6A 4GO5X 4YB1P 1RA6A 2LDYA 3D5MA 3GG1A 3L7UA 4L75A 2HHQA 1T11A 1ZM9A 1FRMA 2PC6A 3QIDA 3QT8A 5T7LA 2XLJA 3QRRA 1D8ZA 3PHEA 4G6VB 5L38A 4WZQA 1TUGB 1N56A 4DMZA 1M5HA 1XERA 2HVZA 3ULHA 2R42A 1UJ5A 2HAFA 3EGVA 4DFKA 4DQSA 1MU2B 2H9ZA 2APOA 2YWEA 2UXDJ 2RE1A 5E3PA 2QLJB 3QGGA 2RD5C 5DETA 3F0NA 1YX2A 3TNVA 3IR7B 2W01A 1EARA 1ZAXA 5AXLA 1FKAF 1S77D 4OX9J 2RUSA 3N01A 2HS3A 5ETOA 2U1AA 4ILMA 2MKKA 3CCMS 1TUWA 1HA1A 3U1LA 1C0UA 4B9TA 4X4TA 1UW9A 1HI8A 3NMRA 4KGVB 4Y6IA 3M2RA 3PG9A 3SDEA 3N4WA 2F40A 4WXOA 2HZAA 3M9NB 1Z2LA 1W26A 4P73A 3Q8QB 1NHUA 2CG8A 3CD0A 4KO0A 4R0JA 4DCJB 1NKCA 5J1PA 1FKPB 3MR6A 2VFVA 1N36F 2BJ9A 3OPKA 2AHOB 3FRYA 2C3OA 4OIXA 3AQPA 3LP1A 5J2QB 2DHXA 2C3UA 5F3TA 4JV2A 4P2FA 1XNRJ 1NKEA 4F4ZA 1SV5B 2AWZA 5LOQA 4I2QB 2AV5A 4PWWA 2H3EB 3Q0AA 1KLMB 2B9EA 1JNZB 1IQZA 3LP0A 3OTOJ 4CDIA 4LFCJ 3BO4A 2HFNA 2QV6A 1NSPA 2B5JA 3W2WB 4JV5F 3PX4A 3CC4S 5IQ6A 3ELHA 1O8BA 5D4LA 2QA4G 2J9DA 4C8YA 3LUYA 3CCLS 3BSAA 1C2PA 1F3FA 2P8IA 4J91A 4DSEA 1F0XA 1BXNA 5AJ3J 4WTOB 2PN6A 1NK4A 2B9YA 1FX4A 1TMJA 3TRGA 1FNXH 3KWMA 5CQGA 5A2QU 2NUHA 5H9EK 2VICA 1N34F 1C0TA 1P1LA 9RUBA 4X4PA 1N32F 2M0GB 2ERRA 4FVMA 2CIMA 2E9ZA 1E6YA 4PWDB 2OP5A 5A8WA 2BJ8A 3QZ8A 5BR8J 4DWIA 4ZKAA 2MSTA 1YLXA 2R8KA 2Q6CA 2JWNA 3GR0A 1N48A 1PILA 2PD1A 2AJQA 4EYIB 1IJEB 3P5BP 6FD1A 3NKYA 2NPFA 1GXUA 1FFWB 3PIPQ 2ZBRA 2OHDA 4X66J 4QZVB 2C42A 5FD1A 1KHWA 4TYBA 3E3XA 3KLHA 1UEKA 4WFYA 3U1MA 3UR3C 4LRCA 4WK3A 1IKXA 3FBFA 4UZBA 1QSSA 3LOUA 4M5IA 2V50A 3R7BB 3QRQA 1HHTP 5E3AA 3IRXA 5GVQA 1WOOA 3MHYA 1UVNA 4C9DA 1NKBA 1JLQB 4QPTA 2Q6BA 3GR1A 2HQFA 2K2PA 1DTQA 4O44A 3GFXA 2GA7A 5J2PB 4PG5A 4DSFA 2WB1D 1CSJA 3S6EA 3AQOA 2ZH2A 5ETSA 4G65A 5C2GA 5C24B 1HHQA 1JLCA 1MMNA 1FWLA 3J7Z5 2DHSA 4C0HA 2FGOA 3W9JA 1EQMA 4DPWA 2VG5B 2G1DA 2CA9A 4KB7A 1J5OA 2GIFA 1Q8LA 2FY8A 2KRBA 1LWEB 2KVIA 3GJQB 3R5AA 4OFZA 1DQAA 2DT9A 4MFBB 3TX8A 2XQCA 1U2CA 3GPAA 2DRBA 4U6PA 2PI5A 4U8VA 3M30B 4FYWB 4RW9A 2AIRB 2F8EX 2K1RA 4WXWA 3IG1B 1TKDA 4IG3B 2V8GA 4FNHA 4ZOSA 1HD0A 1REGX 1SH3A 2BRKA 1NEEA 4BBYA 1T9XA 1LFPA 1S5ZA 3BDEA 4M5NA 3S7RA 4PQUA 1U2RA 3M9MB 2HLUA 2WOMB 1OO0B 2HFSA 3IXQA 2C2EA 2QIFA 2Z56B 4ITSA 3M1VA 4JOUA 1KC8T 5IOLA 2MZTA 3KUHA 3CPWR 1C4CA 3AHPA 1DLOB 1RSCA 2IPOB 2DKOB 4LFBF 2CJYB 5F9NA 4DSLA 2IHR1 2GJIA 3NNCA 2EXUA 1T03A 3AAWB 3OXLA 4NZ0A 5CA5A 2JZ5A 5JJBA 1Q5YA 4DQPA 3AXMA 3C16A 3BO3A 3UCGA 3HVTB 1KN6A 3KOAA 5F0UA 4P7TA 1RT3A 2WONB 1ZAWA 2ZH7A 2KYXA 3G6XA 4Q7AA 1OYDA 4L76A 3T5HA 2F65A 1TVRA 3KLIA 3OTOF 4V19X 1NBEB 5DZ6A 2CPYA 2XG8A 4ZK7M 2COLA 2VDIA 2PDAA 1M5PC 3K8WA 4QYRA 1NSAA 5A8RB 3ZXWA 5THWA 1RCOB 2GNKA 3HT3A 3I96A 1Q53A 2BW2A 3GWCA 4CO4A 2IA6A 2CNNB 3RGIA 2C3MA 2N7YA 4NXMF 3PYGA 3UN5A 2ZOMA 1FXDA 1PG5B 1YWXA 3FZBA 1LW0B 1R43A 1S10A 2BV3A 2MZSA 4O0IA 4K4SA 3QNWB 5H9EJ 2DPIA 1HI1A 4QYZJ 3I0SB 3M8RA 1R8PA 5HP1A 2LKZA 4DV2F 1GFWB 4NYOA 4OI6A 1WORA 3KK2B 2FVRA 2ZC4A 3DNCA 2O3DA 2M88A 3PYEA 1KLMA 1A7GE 3QSYB 2AJ2A 4CO2A 3WX8A 1VQNS 4QIFA 3OFFA 4M5KA 1FCAA 1RTDA 3CC7S 1RWXB 7FDRA 1HNIB 1G6BA 2A2CA 3QRPA 4XO0A 1NZAA 4HACA 3W9HA 1LK7A 2CJAA 3MCOA 1VDHA 2BOAA 2FTRA 1HPZB 1S6PA 2DNOA 2LVWA 2WSEC 4KO0B 1WF2A 3HT0A 4HI1A 5DO2A 4ZLNA 4ZP8A 3KDOA 3RBXA 2BBEA 3H20A 1KRPA 4CYUA 4MK9A 2RJZA 1JJHA 2JX2A 3R8YA 2GVDA 4B3MF 2KXFA 1VBZA 1CVJA 2B9WA 3NEKA 4Y34A 3KHGA 2AT1B 4F4KA 1Q8IA 2ACYA 3G6VA 1U6ZA 2CQ2A 2AX0A 1CQNA 1FNOA 1WOSA 1XNQF 4EZ9A 2K7JA 2BOPA 1WF0A 2CPDA 4EMDA 4NLTA 4PXCA 3CCWA 3KJNB 4WK1A 4YS2A 4CYUB 4ZN1A 5E3CA 4L6V3 3GG0A 3PO4A 1H7WA 1H0HB 3CJ3A 4K4TA 4OZLA 4IOCQ 2UXBF 1NK0A 3T9ZA 4ZVGA 4B02A 4LF7J 4OLPA 1P8GA 2LXIA 1YJ9S 4MIWA 2CPIA 4WU3A 1JLGA 2KDOA 1UJ6A 4WCEQ 3R7NB 4Y2KA 3VGVA 2FHKA 4IDKB 1FEHA 4P2MA 2ZJRQ 3W8GA 4DV6J 1IR0A 4M95A 5DM7Q 1L3TA 2NCKL 3JSRA 4OYWA 3QGIA 5IS2A 1D9AA 1DAXA 3AD7C 1VHFA 1D8YA 3WC2A 2MGZA 5CHCB 4JV0A 5LXRA 3HLUA 2DR7A 3NWRA 1NXIA 2Z2ZA 2HZCA 5CCMA 3DU6A 3EXYA 2ZBQA 4RJVA 4I2PA 3BH7B 2FQQB 3EVMA 4DPOA 2BX6A 2FHMA 5J2NA 3AD9C 3NAIA 4HDHA 1R27B 3M2UA 3QT6A 1N5TA 3SYZA 1HNWJ 2QA1A 1U6FA 1S9GA 2ZD1A 5A0YB 5F0WA 4QU6A 1YKWA 2PSZA 2GO9A 4RWXA 4J9QA 1M5KC 3J80U 1V5VA 1UW4A 4WP8A 2DR9A 3PRVA 3H40A 1PO6A 1VRTA 2C3YA 3ENQA 5F8LA 1QE1A 3I56S 2YH0A 2FY1A 2W9CA 1I1GA 5D4NA 1YGYA 1RAHB 5D0EA 3UD3P 4USWA 4C6AA 1JLFA 3V6HA 1SKSA 3CCJS 5BR8F 1ZH5A 2FVQA 2M52A 4XTTA 3G6ES 2CQDA 4DR3J 2ZZMA 2J0WA 3BS9A 3FEXB 3DOKA 4IFVA 3QPIA 4ES3A 3GIKA 1KBRA 2B4UA 1DTTB 2RMLA 2V8VA 1H72C 2CUYA 4I64A 4WTYA 5G4DA 5JVGQ 4DQQA 1MLAA 1F2HA 4IO9Q 4GO7X 2QMXA 4TU7A 4IFYB 2DNPA 4J37A 3Q23A 2DPJA 3NNAA 5FIIA 2GFFA 3CD7A 2DGQA 3B4DA 4PUOA 5E5NA 2ZWOA 2DH7A 2CNLB 3MEKA 2YKNB 2GAGC 4TYAA 2RQ4A 2NQPA 3IG1A 1EX8A 4I6AA 1HQEB 4K2XA 4DHVA 2GV1A 1FFGB 2YKMA 1RBAA 1PBAA 2O01C 1Y11A 3VR1A 2Z8QA 1N52B 3CJSA 2VPZB 3L7PA 5J2MA 4NRTA 4UW2A 4WFZA 4NLWA 1T9UA 1RKJA 1X9MA 2JEGA 1H2VZ 4H4OB 5LM7E 3X1LB 4WP9A 1ZPVA 2XTJP 1ZYQA 4I7FA 1FWKA 2UVRA 2AZ3A 3AOCA 3H5YA 3B6BA 5HROA 2KTQA 4H4KC 5MLCV 1MWZA 1WHVA 3QIPA 1HBOB 4LQ9A 2GVZA 1NJZA 4HHHA 4ZA1A 2HNDA 2E44A 2I5JA 4ZLPA 3IM9A 4QOTA 4A47A 1I94J 3TVYA 2C2KB 5D3GA 3JSMA 3IGVA 3HCXA 2VPYB 3PJXA 2BKNA 4PG8A 1JLAA 4C11A 4FYDA 4DX6A 3B54A 4X4SA 1C4AA 1KQGB 3L7OA 3A12A 3NGTA 3POTB 1AUDA 2CVIA 3TJAA 4DL5A 2MLXA 3MAHA 1CBKA 1VC5A 1S1TA 3PO5A 1HBNB 4LREA 2MZJA 4WU2A 2YVSA 2ZE2A 2YPZA 3BREA 3Q8VA 5KFAA 3SFUA 3BBFA 2OKQA 5B0CA 2JC0A 4IQXA 3M8YA 1S1TB 1IBLF 3IS9A 1N4LA 3EE3A 3W61A 3CIMA 1Q4RA 2CFXA 5B0AA 4RNOA 2QYCA 2W8KA 1NDKA 1RTHB 4C8ZA 4PXDA 2UXBJ 2FLOA 1JLAB 4C11B 4CP5A 2V9WA 3KLGB 2HIQA 2HHPA 2I38A 3DRRB 3RJMB 3T19A 3DOMA 5KG3A 3I5CA 2JFDA 2L3MA 3BEGB 5KFLA 5D78A 3PJWA 1EP4A 4R8UB 2KM8C 4B3OB 1FT8A 4J9VA 4A8YA 3MXHP 1IWGA 1K47A 2CPXA 3DYAA 1ACMB 2ACMA 5BYRA 1DRZA 5CCLA 2C3PA 4I6YA 1XC9A 1LXNA 4EYHB 4F02A 4USJC 4X4QA 4DR1J 1KDNA 2A3JA 4WFBQ 5EX0A 2HVDA 2B7BB 5KFIA 4DV5J 1X4BA 1R89A 2R3VA 5FDLB 1RT5B 2NYIA 3V2UC 5C2CA 4ZCLA 1U0HA 4KHRA 1X4HA 2YNIB 1RHJB 2Z2YB 3CW2C 3GYXB 1CS4A 2QYGA 2CJKA 1MWYA 4XIUA 4NLRA 5GMEA 5HI7A 2QL9B 3L4BC 1AW0A 3HZEA 3Q8SB 1EKSA 2ATLA 5I3UB 4FKYA 2B4OA 1TL1B 3H98A 4M5MA 4P74A 2OD6A 3V4MA 3WDOA 4YB7A 4FPRA 3NS5A 2VPWB 3C46A 3LP1B 5J2QA 2MTLA 3E2EA 1K1SA 1NSKL 3PZPA 3C6TB 4F2RA 2AEMA 4TXSA 2KT2A 3BR9A 2VFRA 4URQU 1RE1B 1ZM2A 3CCSS 4X4NA 2JJ4D 2U2FA 1AT1B 3MM5B 5IXUA 2N3LA 1PAUB 3PRDA 3Q2SC 1B3TA 3TUZC 4ZVOB 3R2DJ 3FUYA 4F4WA 2GQCA 2XSFA 3BO2A 1MNEA 3IFEA 5B08A 2UUBJ 4M5DA 5LMUF 4K4ZA 4RW8A 1Y5NB 1B0TA 4K59A 3KK1A 3O2IA 3A8KA 2FHOB 1FJGJ 2FDNA 3J7YU 4KGKA 1TL7B 1HLWA 2LDIA 4ZIVA 1TL3B 1GAOA 2N4DA 4M5HA 3TQEA 5DGBA 1YI2S 3AOBA 1U45A 2MZQA 2RUGA 4LF4F 3T5LA 1VRTB 4LF6J 3CTRA 2EPIA 5D4OA 4DL7A 2JEFA 1WDDA 1T0TV 4U8YA 1FRIA 2E5IA 3OR1A 3B8HA 2LLZA 1U1MA 1SJQA 3MFIA 3L09A 4LF1A 5A0YA 5K8NA 3J7A1 2CQ3A 3EDRB 4C8MA 1HQUB 2BJ7A 5M2RA 4DX5A 4DV6F 4J9PA 5B0FA 3TEGA 4RUAA 1ITPA 3AT1B 2V4JA 1S57A 3W7BA 3TQ1A 1WTBA 2DGWA 1LWCA 4RNHA 1T95A 3HZGA 4Z37A 1IBMF 4JI1F 3MI7X 2G0IA 3NRBA 1NJYA 1RAEB 2W4DA 2JLFA 2M5YA 4FN5A 1P1TA 3NBPB 1RWVB 1I3OB 3D0IE 4K5RA 4RW6A 1W2IA 3TZZA 1AB8A 5KT3A 4DR4F 3RB6A 2BABA 3QSIA 3HSDA 2RF2B 2YNGB 3OUYB 1LKZA 3HF5A 4ICLA 3DI6A 2XMJA 5KFNA 5CAAA 2EFNA 1VK3A 1X4AA 3LP2B 4UQTA 4ES1A 5A2QY 4F36A 1WKKA 2BMBA 3Q8YA 4UY85 1RTJA 2ALYB 4F04B 1KNZA 1UZDA 1S59A 1X5TA 3BQ2A 3OR1B 1NNDA 4KC5A 2YNHB 2WZ1A 4OHWA 4UUXA 3ZZPA 2ZH9A 3PX0A 4QJVA 5DG7A 2J6SA 3H0PA 5F8JA 5KFBA 3MWBA 2BXJA 3MAAA 4EWTA 2OPQB 1OPZA 1NPKA 4OZ0A 1KS2A 2JL9A 2IM2A 3GB0A 4YY3F 5HJXA 2R8IA 2HNYA 2MZRA 3G82B 1FD8A 2FPHX 1NCLA 2HPUA 2BE2B 4LJMA 4Q8EA 1S99A 2J7KA 4ZVUB 3VAGA 2EC0A 4EBEA 1KP6A 1SQEA 3OT9A 1M1HA 3L9ZA 2VPXB 3DXSX 2V6AA 3MM5A 1GQEA 3ETMA 5B0DA 1GT8A 2RU3A 2XGQA 4WPAA 1VRUA 5HAOA 2H4YB 1B7YB 2ZOGA 4W4MA 1IKWB 3CGIA 4B17A 5HANA 4NXMJ 1YITS 1G4CA 1N8RT 3KJQB 3LW5C 1K0TA 1ZTTA 1M5VC 2WVBA 4CT8A 3EGZA 1RTDB 4A8KA 3NOGA 1RAFB 2HK2A 2E9TA 1VQ7S 1ZOTA 1S6UA 1SPBP 3CO0P 4DR7F 3DLGB 5L1KA 3JSYA 1M5SA 3DN9A 4LT6A 3GLJA 3KG1A 1IM4A 1X9WA 1RWUA 3RW7A 4U67Q 4CCHA 3JTOA 5IFMA 3HPOA 2VQFJ 2PIIA 1FRLA 4FNIA 3US5A 2VJUA 3MPDA 1J2VA 1NDCA 3GE9A 1IQTA 2GGPB 3PXGa 2MHEA 3DDKA 2CZ9A 4KY3A 3TAQA 2OPSB 3MEDA 3PM9A 4NI2B 3G96A 1OQ6A 2YH1A 3SQGA 3CXCR 1TL5A 2RS2A 4F3OA 4U7UD 3FEZA 2ASYA 1IBMJ 3BSCA 4OMFG 1XMBA 4C48A 4WBFA 4NLQA 2ZH1A 1LWXA 4FF3A 2V67A 4TLRA 2JH3A 3QO9A 2IMWP 1EP4B 2EFGA 1KSPA 2UVVA 3BYPA 2BJEA 4R8UA 1CJVA 1YJVA 4MTPA 3M6VA 3IO1A 2AP6A 1H38A 3FBCA 2N4CA 2PGCA 2C2DA 3IWNC 4YN3B 1RT3B 4C3MA 2AW0A 4NEZA 3HVTA 2FZCB 3MM6A 4ZVQB 2VF3A 4OX8A 2OSQA 1S6QA 3ILOA 1VQMS 3N0VA 2E1RA 3EDQB 3K17A 5GAHU 4C8LA 3P8BB 2IY5B 3PW5A 1U2FA 3D9BA 2KHCA 3HHEA 2OELA 4OZJA 3OXGA 5IM0B 1PIEA 3DRSB 1RTZA 3V6DA 2L48A 3NGRA 2GX8A 2OPRA 4P75A 4K8RA 5DQGA 4QYZK 1RT2A 1U0SA 1U47A 4P71A 2RILA 3BH6B 2DR8A 3DLEA 2ZZNA 1DQ8A 2E1PA 1UFKA 5KFMA 3DDIA 1QD1A 1TKZA 1A0OB 4ZVHA 3Q8PB 3QT7A 4QR0A 2A2DA 1X60A 5IWAJ 1BC6A 1YBTA 3DMJB 4N8NA 2XCAA 2HS4A 3ENVA 4MKVA 4ELTA 3HHNB 3BQ1A 3OVBA 2VC0A 1ROFA 2GAHC 3D1QA 1VBKA 3PR5B 1UWBB 2ZBPA 1UPPA 5F8MA 5DM6Q 2XC9A 2IJRA 3UCZP 1RAOA 5LSLA 1JLBA 2R8GA 3DDNA 1AXQA 4NWBA 4B08A 4DPXA 2FJVA 1P9YA 1WHXA 2WRMA 3FVYA 3DGVA 3R5GA 3HULA 3VCDA 4M8LA 1WC1A 1R6YA 3R27A 2IVFB 5CD4H 2J8AA 3RBDA 2HMIB 4ER8A 2VQFF 4B3SF 1FESA 3H2UB 4B9UA 4OV6A 4P6QA 4AT1B 2VKZG 2VG6A 4LRDA 2BKOA 4J90A 1MROA 4CLLA 4M94A 1GMVA 5L9NA 1VRUB 1IKVB 3E51A 4OI1A 3UDVA 2C28A 3D6FB 2PE8A 1RT4A 2XEXA 2VFTA 2KRRA 1KQSR 3M4XA 2B7CB 3VZHA 2HHHF 2BDPA 4Q0BA 4DV3F 3CDAA 3BKTA 3H4DA 1S97A 4NZ7A 2Q43A 1RHRB 2W4CA 4NLPA 3RAXA 5GAGU 3BJYA 5CZVA 2RHQB 1M1GA 4CTAB 4PZVA 4X64J 4NLSA 1T9TA 1T94A 2RRNA 1Q16B 2YQ0A 3JTPA 2RKIB 1YRXA 1S0OA 3M8PB 1ICEB 4OV1A 2ZH5A 2WVDA 4LBPA 1T3NA 2BEFA 2R7XA 3BGFA 4N56A 4KJIA 1WTFA 2HAIA 4JB8B 4WFAQ 2OPPB 2H1YA 3NWGA 1S1UA 2IM0A 1LWFA 1HBUB 2RF2A 1SJ1A 2DNGA 4BHQA 1FO1A 5KOXA 4L3KA 1UKUA 4KFBB 4DN0A 5F3ZA 3UWTA 2XS2A 2J0XA 3KG0A 4B3TJ 3I6PA 4AD6A 2UUTA 3UR0A 4ZLJA 4MIBA 2G2YA 4BWMA 2HHXA 3C8YA 3Q8UA 1Y00A 4XDDA 4F8RA 5L1JA 4IDKA 1Y9OA 4UOFA 5DDOC 1CG2A 2GHPA 3DLJA 4E98A 1S1UB 2HZVA 1X5OA 4A8FA 1HQUA 2LXFA 3H2LA 3G6YA 2KYZA 1IUJA 4ED6A 2DISA 4ZCIA 4JI8J 4BLGA 2XB2D 3HHKA 2LA6A 4LVNP 1UA0A 3H5UA 1NH8A 1YTYA 3TYTA 4YR3A 4H4MB 1ELOA 5KFXA 2N82B 1FD2A 2CNOB 2QLXA 3I5AA 2CADA 1GXLA 1FA0A 1X4EA 2RSQA 4LR9A 1JXEA 3AB2B 3ITHB 1RB0A 4ZVFA 4Q0BB 4YEAA 1PJ5A 1LNQA 2EVZA 2IYGA 3NGDA 1ZZFA 1FWPA 2GVDB 3C6UB 4DX7A 3GV5B 4OJGA 2ZM6J 1IBKF 5D8HB 1REVA 5KFEA 1V6HA 1T7PA 1JMTA 1F5CA 2CWXA 4OJ3A 3BKFA 2DNRA 4MK8A 3E01A 4X66F 3KJVB 1V3SA 1V5IB 4HACB 4GKJF 1G1XA 4Q5VA 4LBHA 2RRBA 3LAKA 4K0KF 1JJCB 2DTJA 3T3FA 3IP0A 4DV0J 1RWWB 2EFQA 2HHWA 4I6WA 1EB0A 1WKJA 1QVGR 5JVHQ 5LMNJ 4DR2J 1MROB 2LU2A 2YPYA 1TZ0A 3W2VB 2FYXA 2VJVA 4OHVA 1TKTB 5HMZA 1X9SA 1AFIA 3RR7A 3TJ9A 3BDPA 1N5VA 3G8TA 1VBYA 2H65B 1KEKA 2XHCA 1R8HA 1KFDA 4J9LA 1R8CA 1WOPA 3EJMA 1X7VA 3A3PB 4RX6A 5KG2A 4M5GA 2ZH3A 2CPJA 1S1VA 4DR5J 4LF8F 3HFKA 1UAWA 4EUVA 2W1BA 3ZZ0A 3DRPA 2KO1A 2P6TA 1UTAA 4O3NA 3KHLA 2B51A 2XWXA 2MQQA 2J7WA 4TU8A 3PKMA 1O5JA 4OHXA 1U24A 5HK4A 2J6TA 2AJ4A 3QMQA 3M8QA 4IKAA 4DSIA 3UE2A 3P45B 2FB0A 6FDRA 3CJ2A 3DRRA 5ETQA 4N77A 2CDRB 3CMAS 3TANA 1W25A 5HLFB 2FLNA 4RW7A 2NXJA 2GJFA 1N5YB 3K5PA 1VFJA 3R5DA 5A6WA 2CKWA 2IJFA 2ZH4A 1TV6B 4N7TA 5AXKA 3U7JA 1P9QC 1V3ZA 2MKCA 1RT2B 2DEJA 1HWJA 2DNZA 2RU9A 3QYYA 3UDEA 5KT4A 1BE4A 3V6JA 3T1YJ 4LSNA 3JS9A 4URSA 4CZCA 2DNQA 2ZVIA 1RHQB 1FNMA 1S4EA 5C25B 3JQKA 3MPUB 4JI7J 2R7VA 3CD5A 3OL6A 3LWLA 1QSYA 4EZ6A 4W90B 4LFBJ 1CJVB 3T1HJ 5B0EA 1MW7A 3GILA 4ED0A 3R5JB 5A6PA 1NJWA 1DFDA 4IRDA 1B4SA 1JIHA 2DNHA 3SV3A 2GVZB 3CDUA 2D3UA 4RUBA 1DZ5A 2G13A 1RABB 3MM6B 1D0EA 1QJHA 3D3BJ 1SUQA 1EQ0A 5IQQA 1N54B 2JOQA 2PMHA 3JAMY 3OHBA 4RR5A 1FDDA 2BQRA 2HWHA 4DXLA 3DMJA 3TP2A 5M2PA 4DV4J 4LF5F 3IM8A 1BHNA 4OZ3A 3KNGA 2PA8D 3AOAA 3P49B 2CQ1A 1BGXT 2UUCF 4CNZA 2PFDA 4GC6A 2PO4A 2VH7A 3CIZA 3GYNA 4YDDB 4USKA 5C24A 4MK7A 4QIEA 4Y28C 4A8QA 1RT6A 3G87A 3MPYA 4O3PA 3EGNA 1X5PA 3J80Y 1T8EA 3CJ4A 1VLOA 3T9NA 2RS8A 4TY8B 3J81Y 2CQHA 4ID5B 2JC1A 1UL3A 4L72B 4OX6A 4OYOA 4Y65A 3HKZD 2KJWA 2GMJA 5FLXY 4U96A 2KFNA 2RDJA 2ZM6F 3PEHA 2IC3A 1DTTA 4WE1B 1NDPA 2D3ZA 4N8OA 1DBDA 2GMHA 3LA0A 2FHJD 4JI6F 3THPA 3BV8A 1PKUA 3HHLC 1WG1A 4C0BA 1M0SA 1N5YA 2I0XA 1JK9B 2ZKUA 5C7PA 1VISA 1PCAA 3A8JA 4ZCMA 3R6GB 5KFFA 4IH7A 4J5OA 4USVA 4NZ6A 3G82A 4AYBD 5KFKA 3T5KA 2UU9J 3OTBA 3QO9B 2R7OA 4DUTA 1FX2A 1Y3KA 4FXWA 5F8GA 5L1IA 2XMAA 1XMOF 2IDEA 2XYGB 2XYHB 3CCZA 3P96A 4ZIWA 2W9CB 1A9NB 2OPQA 2W8LA 1QE1B 4NMXA 3SQGB 1FJ7A 3PFEA 1YQHA 2DNLA 3W66A 2JFKA 2A0FB 1JLEB 2OSRA 2QMUB 3QAEA 3EX7B 1TK5A 3N5FA 2CJBA 4ANCA 2VA3A 2ZEJA 4OL8A 3NGUA 2BZ2A 2JHEA 2E5GA 2LMIA 1BQNA 4CIOA 3CF5Q 4J7CA 3ILLA 4USTA 4MAKA 3PVXA 4F4YA 2HQCA 4LF8J 1CLFA 3UW1A 2ROPA 3GU0A 1HR0J 5DJBA 4DL6A 3ETOA 1U26A 2C2OB 3AY0A 7AT1B 2QFJA 1RA7A 2VV5A 3FSIA 3UVJB 4LBIA 2JVOA 3RYLA 2CG4A 3AB4B 2R2RA 1VK8A 3PV8A 1ZETA 3LP0B 4ECRA 3OXFA 3UFCX 3E01B 1NB2A 1Y5LB 3OFHA 4E2FB 2DGTA 3K57A 4Q8FA 5LJ5Y 3JYTB 4C3LA 1SV5A 1HWLA 3R5BA 5HBMB 4K50A 1FVSA 4ZCKA 4OYXA 4AL7A 4Y3CA 4NX9A 4K2JA 3UVJA 2PFFB 3A13A 2WB4A 5GMKa 4CRJA 1ZPWX 1W2BR 3U02A 1B64A 4KFBA 4DR4J 1CULA 3V6KA 5C42A 2OTLS 4O4GA 1FJGF 3OV7A 1HBUA 1R3NA 2CXEA 4PG7A 4J9SA 3UPFA 1O0PA 2A10A 2JEJA 4IOAQ 3BGRA 2JVRA 4HT7A 5KT2A 3CB4A 2MKIA 1BQMB 4MIAA 5L9XA 4EEYA 4X84A 4ED1A 3OSPA 4H4MA 2DIUA 3WHIA 4M5DB 3M2VA 4ECSA 4EO6A 2PI4A 2HK3A 1WHWA 1URNA 4L3NA 3BF4A 2Y1LB 3K8VA 1M90T 1RTJB 1J5EF 1TR0A 1TL3A 2XSJA 3HD1A 1NM2A 4EFAC 2FVSA 2HFZA 4DFMA 4KE5A 3DLLQ 1WSVA 2VDHA 1G7CB 2UUAJ 1RHKB 1SQFA 2K3KA 1CJUB 2HRTA 1TFYA 1HNIA 2UZAA 3PTWA 3EVWA 4JP8A 2ZUAA 4BC7A 3OVAA 2KH9A 3ZNUA 4ED8A 4G1PA 2HBQB 4FDFA 3PDNA 3QWUA 2I6WA 1WC6A 1F6TA 4Q44A 3VALA 3MM9B 3W5YA 5EN1A 3SSRA 1D9DA 3KDNA 2C2ZB 2DK2A 2VG6B 1LWFB 4L73A 5CYQB 2W9BB 2OPPA 1QUVA 1XEZA 2DXDA 3VGTA 4C98A 4RUCA 5AJ3F 2YTCA 2ADBA 4KV8B 5HATA 2ZH8A 1SL2A 1VGYA 2QC3A 1RT5A 3C19A 5J1NA 2HMIA 1LW0A 4K4UA 1FHTA 4HYKA 4DR7J 1Q78A 1L5UA 4JI5F 1GEHA 2CQPA 4FXDA 4QWCA 4KYZA 4DCPB 2F1FA 4Q2LA 2RNEA 5CXTA 3BBBA 1BD6A 3MECA 1A6LA 1PAEX 5K5MA 4CLKA 4YY3J 4LRFA 3PW7A 4QCLA 1EHWA 3R5CA 5IT0A 1YJ7A 4P72A 3C66A 4YR0A 2OH2A 3DOMB 1TKXA 1QDUB 3KLGA 1K8AT 4QIGA 3NS7B 1T05A 4EK2A 3H59A 3LWMA 2ATCB 1D3WA 1PC4A 3C14A 3I4HX 4CQ1A 2JLGA 1MMDA 2VQEJ 4ZVPB 4ZITA 5DLGA 1S72S 1WKLA 3NS6A 1ZA1B 4ZP9A 5F9LA 3C15A 3C6TA 2OPRB 3U27A 1I94F 1DLOA 1S6OA 4OI4A 1PC5A 2E1AA 3HSGA 4E8UA 4OZ5A 1R8BA 1WC0A 3M1VB 4A4JA 4ERDA 3PYDA 2HS0A 1UVMA 5K9FA 3MM8B 4LSNB 1RT6B 1F3VA 4QR2A 1SC3B 1YJUA 2EG2A 1EAYC 3GJSB 1RU2A 3FBBA 2XY5A 2GIRA 4OYMA 5KFRA 2NXCA 1N0UA 3EGWB 4JI7F 4WYWA 1MWQA 4ZJLA 1UWBA 4NASA 1R0BG 2RQCA 2RB7A 4HHUA 4AL6A 1RGVA 4C8OA 4F26A 5L46A 1M5OC 3DOLB 5DGAA 1NHKL 2E1MC 3OFEA 1RU1A 5KG5A 1FERA 3MDFA 2CQ4A 3MPVA 3MEGB 2V2KA 5LXYA 4FS2A 1TKZB 2RRAA 1RT7B 2B9XA 3MUMP 5F8HA 3AODA 5D15A 1S1XA 2KXHA 3KG4A 2AKWB 1OY9A 1VJQA 3BYRA 1ZZNA 3DRPB 3K7RA 1SJ3P 1UZHA 2MB0B 3HFZB 2EFOA 2XMKA 3D6HB 3FGVA 2AGOA 2VZ9A 2UUCJ 3LH2S 3DOLA 2NLWA 3FMWA 3ILJA 4CO3A 3NXZA 1KVJA 2XGPA 3Q83A 2VBWA 3EPIA 4XDCA 3CDBA 3EVOA 1NK7A 1IBLJ 2ZE2B 2B4VA 4KGZB 4V19J 4KH0B 3MM9A 1RYSA 1QAJA 5KT6A 1ZS6A 3QQCD 4PUOB 2B0GA 2EC2A 1N34J 3M05A 1VQ8S 1RAJA 4A8XA 4RW7B 1RWOB 3CJQA 4XK8C 4NA3A 2QMWA 4DI6A 3EPGA 1L3KA 2YWWA 2KG1A 2MKYA 3C15B 3QAUA 1VI7A 4KR0B 4MMOA 3QFHA 3M8QB 1H98A 4B9LA 3K59A 3BZQA 3EYZA 2Z57B 1HBOA 4JYAJ 1ZBTA 1PJ6A 3D6TB 3J7YI 3DOKB 4IFVB 3CMQA 4WIIA 5JMNA 5L1LA 2RDDA 1UMJA 2DXFA 3SSQA 1LXJA 4I7FB 1E6YB 2DGOA 1N5SA 1S4FA 5K14B 5RUBA 1S1VB 3M2VB 2E1CA 4LUBA 3VAKA 1QTMA 4CH1A 3CCQS 3I55S 1VC0A 3QT5A 5KG1A 3RG6A 1B99A 4JI0F 3MECB 4F4AA 1TKTA 3N79A 3SCLE 1OMSA 4LIRA 4O4GB 3M9OB 1S79A 1HQEA 4X4VA 4LF6F 2M70A 2WCXA 1LV5A 3QLHA 1U7LA 4CLYA 2J0SD 1HR0F 2MLZA 3KK3B 1Y10A 3HHLB 1U6BA 1N5QA 2MKHA 1X4FA 5DG9A 4RZRA 4IFYA 2L08A 4YHHJ 2YKOA 3BPDA 4OHZA 3VQSA 1IJFB 1JKHB 1SB6A 5HMYA 1N88A 3W9IA 2BKPA 1WACA 3J81U 5KFUA 2Y1IA 1REVB 2DNNA 2GQ2A 4W98A 2EKYA 3SI8A 3GMGA 4G1IA 5B7WA 4FF2A 4DLGA 4MKBA 1NHVA 1SH2A 2NZCA 1RLDA 4NYZA 4TN2A 2V4JB 3ITHA 1WJ9A 2ZUGA 4ETZA 4F0MA 4GKKF 2HNYB 2OEKA 1HARA 3EICA 2XS7A 2AEFA 1BQMA 4DUYF 2HGMA 3BGRB 3MMBA 1WD6A 2LQ5A 1VLYA 4JI8F 4BC9A 1NB7A 3M8PA 2WW4A 3N6MA 3G8SA 2R7QA 2FUG9 3IR6B 1LQ9A 1TK8A 3HJFA 1APSA 4LFAJ 2AZ1A 2Y1RI 4CTAA 4N41A 4RWWA 4LF7F 4CLTA 4ATNA 2R9LA 1HPZA 1S6PB 1CULB 2G1HA 4M1KA 3O5TB 4PWUA 4TLQA 5EWFA 2FLPA 4BCAA 1YZ7A 4CLZA 3UDCA 3ZTSA 2KT3A 1FKOB 2UUAF 3UI3A 4WE1A 3W5XA 3ISND 5HBMA 3FJ2A 3A4TA 3OQ2A 4YFUA 1WI8A 1PYOB 1DY3A 3IBFB 4PPDA 3GV7B 4J9MA 3DC2A 2BW7A 3K5OA 2X7IA 3NG8A 4ZVEA 3T6BA 1I5OB 3M8ZA 2VODA 4WKRA 1QM9A 4Z7YA 2XS5A 2WK4A 4KHPF 2OIHA 2CAJA 2GCFA 2WTFA 4IRCA 4I56A 4C8NA 2BJ1A 1XWLA 2YQ1A 2CZ4A 4FKXA 2XWYA 1B0PA 3JQMA 2OLWA 2O1PA 3MPWA 4JI6J 2MQMA 1Q7LB 2H5IB 3A3NB 3KK1B 2QA2A 3DM2A 5DRKA 3ZZRA 4DOZA 5ITHA 2EI5A 1XR7A 2V94A 1SC4B 3GONA 4Q2MA 3X3UA 4KAIA 3PIOQ 3DLEB 1SKWA 3D7SB 4PCQA 4QWAA 1IKVA 1ZM4A 2FJBB 2C2RA 4C7QA 3HD2A 4FYVB 2HRUA 4ZN3A 2FHJA 2PEBA 1RUSA 4PAAA 4B3RF 1XR5A 1R7IA 2H5JB 5JUMA 2HFOA 3OR2B 2W7OA 3MAQA 3GSDA 2I2YA 4OYIA 2KN4A 2FJEB 2QLFB 3BBCA 1R31A 2HHSA 2Y0SD 5I3UA 1I51B 2CWKA 4Z7CA 2KFYA 4S0MA 3IMQJ 1PBUA 4DR2F 3RB3A 2WOMA 1RWMB 4HI2A 4CNYA 1X0FA 4MYUA 3N9UC 4PG4A 1SKRA 2DGSA 1HBNA 3O44A 2RAQA 3WIVA 5K8MA 2UVUA 3W3SA 2E5HA 4DUZF 4ID8A 3C3LA 3AD8C 4LFAF 1VQ4S 1CJTB 4ZPBA 3FKBA 3K5MA 4L74A 1KLNA 3LQVA 3MFHA 2K1RB 5HLFA 1VQPS 1K73T 2CRLA 2B8PA 1H6KX 1K1QA 2EK6A 2IFXA 3KLFA 1F1BB 2L9NA 4MJKA 4P9SA 4U9RA 3TAMB 3V81B 4TU9A 4LMZA 1JWWA 1AZSA 3I9V9 2RQMA 3PJ9A 3I0RA 2XZWA 3TEHB 2ZH6A 1KOOA 1Q81T 1S1XB 2IM3A 1OPIA 4ILLA 4N47A 4CLUA 2QX0A 3M6WA 3I0RB 2VUGA 3WX4A 1UVIA 3MEGA 4GKKJ 3CJRA 1SL1A 1IM6A 4WIQA 3V6DB 5HN0A 1UWAA 2YWKA 3PYFA 2ROGA 2ZDPA 4DG1A 2MEWA 1VQOS 1JLQA 2VG5A 2CQCA 5HQLA 4DSKA 4ECZA 3WBZA 4F25A 4NLXA 3F56A 1T9WA 5HMXA 2CPHA 3IRXB 2FJAB 2ZITA 4DU7A 1S6QB 1RDRA 2VA2A 3ZTQA 1RZMA 2OEJA 2QLBB 2XULA 3DU5A 3P4UB 3T6JA 2H51B 4QWDA 1HNWF 5J2PA 1UVLA 3G86A 1HW9A 3KLHB 2EG1A 3HFVA 3PW2A 3T1HF 1KR4A 1Q79A 4NCGA 2LYVA 4RL1A 3KJVA 1SBRA 1BY9A 1F60B 1UFLA 1VYAA 1RP5A 2G0CA 1QAXA 4PQUB 1RK8A 1HNXJ 1UVJA 1OQ3A 2J7UA 5DLFA 4UY8T 4CH7A 2ILZA 2I8EA 2NXUA 1IKXB 3QIPB 1QY7A 4GVBB 4P10A 1MSWD 5KFPA 1NU4A 2E7XA 1T05B 4DV4F 2FLLA 4BS2A 1I6JA 2MJUA 2PEHA 3AJ1A 2OPSA 4XPCA 4RNNA 2IRXA 2P6SA 5IC4B 4QQBA 4OYBA 4RNMA 1YIJS 3TZWA 3TJ8A 3M32A 4P52A 4LR8A 5KFDA 4O3RA 1O51A 1GTHA 5SUHA 1S0MA 2PT0A 5I3QA 1RHUB 2AEJA 3RUBL 4HKQA 3TWZA 3TZYA 5HO4A 4OYZA 3W2VA 1F5BA 2ILYA 4ZPAA 1RADB 1Z1ZA 4LR7A 1NLKL 3BN7A 1YK9A 3HHLD 5H9FJ 3G71S 5KTQA 2FIUA 3IRWP 3ADAC 2VBYA 2BACA 4DSJA 2HHVA 3OL8A 1VR6A 2HWTA 4Y2AA 2HKEA 4ICLB 4ECVA 1LOUA 1WF1A 7FD1A 1QAIA 1U1NA 1PGZA 3A1YG 1B70B 4RW6B 2D74B 2J5AA 4ZPTR 1TMMA 1UEUA 1RJJA 2J9CA 4ZDNA 3TI0A 3P5TL 1WI6A 4AUKA 2R7UA 3IC1A 2FVPA 1XR6A 3DHXA 4O0NA 3RR8A 2X1GA 3VAJA 2D41A 2V68A 2RHSB 2BRLA 2GJ2A 2MY8A 3OVSA 1X8DA 5IT9U 2ASJA 3MR3A 1HWUA 2DRDA 5BJRA 4PQAA 3QATA 3MAAB 4WFXA 1F9FA 2DEIA 2E66A 4OHYA 1RCXB 1WEYA 3I87A 2ZBIA 1TK0A 1DURA 2ZJPQ 3ZC4A 2DGXA 5CD4A 2J9DE 4TQSA 2IIHA 2AYEA 5KG6A 4F3MA 2VONA 3R1HA 4Q45A 3M2RB 3SDEB 2E9RX 2NR0A 1TL7A 2MKJA 5KFGA 3EXCX 2RIJA 3IBCB 3MGJA 5ETPA 3LGNA 2EWHA 2CDQA 2CZVC 3FZ2A 1KD1T 5C42B 5E3QA 3GIRA 4J9RA 1VQKS 1OSDA 3CJ5A 2HQDA 2OFHX 2BJDA 4H4KA 4DEZA 3O1LA 5ADZA 4R0EA 1VQLS 3N6NA 2Y9HA 4GRSA 5KFTA 2CQIA 2DD8S 5KFYA 4ZVTB 1RHMB 5KFVA 2KM8B 2V4QA 1JKHA 1EKRA 2HQGA 3IR5B 4O3OA 5HVGA 2JEIA 2ZC3A 2DNMA 2OFGX 3JQJA 2Z4PA 1KVKA 1XIQA 2IMOA 3HHDA 5EX3A 2V8DA 3GIIA 4U7UK 2V0NA 5IWAF 4NLYA 2W7AA 5KFSA 4DV0F 4NXNF 3J7AN 4UOCA 5D0GA 3Q2TC 5AE1A 2RKIA 4KHMA 2ZZTA 1J27A 3KK2A 3LAMA 2KHDA 3F44A 4DQRA 5CH7B 1JLBB 4PXEA 4ELUA 4Y2IA 4AQYJ 1BQNB 5IT9Y 2DVIA 1RT1A 1JXVA 3VAHA 1C0UB 1NJIT 4DV2J 3RZAA 3RRHA 4RW8B 2V34A 2XI2A 4I1TA 1YJNS 2W25A 2W7PA 2XLKA 4F50A 4CT9A 4BDPA 1J5EJ 2Z30B 3OJSA 1WEZA 3OW2R 3FCWA 4GVBA 4JUZA 4NPOA 5ETRA 3TUJC 3FSXA 2YWGA 4FP9A 1G3OA 3H7HB 4B3OA 1T3OA 1FTRA 4RW4A 1NRKA 2BE9B 2IVYA 2UV8G 3NGKA 4OYPA 3ZNJ1 1MU2A 1TVRB 3KLIB 4D3HA 3TARA 2AGQA 1F2GA 1MMLA 4YP3A 1X0PA 4OJ1A 1RTHA 1TU0B 4CO1A 3I4PA 4F4XA 5LMUJ 4ILRA 2DYAA 4EU0A 5T7LB 1YHQS 1N33F 1S7HA 3PKYA 1HWKA 1HBMB 3EMTA 2ZWPA 1T03B 3FC9A 4NA2A 2N7CA 3EUNA 3MMAB 3JAMU 4ED7A 1U1RA 3TZXA 3QBCA 4U95A 1CS4B 5KT7A 2EFVA 1S9EB 4TY9A 1VQYA 4FYXB 4TY8A 5D0RA 3CUNA 1CC7A 4NEYA 1XN9A 4K4XA 1G2EA 2L9DA 3O3LA 4UOHA 3SCJE 6AT1B 3RB0A 1B7FA 4WZMA 3AJDA 1UETA 3MF5A 4DX8H 4DUZJ 5DQHA 2Y3YA 2R7SA 3GV8B 1VJWA 2I5JB 2BUNA 1Y5IB 1RQ0A 3TA2A 4QPXA 1OIAA 4DL2A 3QJLA 3AFGA 2YNFA 2UVWA 2J9EA 4F7VA 5DS7A 1VQSA 5AXNA 1AZSB 1ZM3A 2QL7B 3MEDB 2GO8A 4RW9B 1U02A 2B3TB 1YBAA 4HEA9 3UCUP 2HBZB 4R5PB 2G0JA 5CZXA 3LPEA 4CLWA 5KFHA 5KG7A 4UF4A 5J2MB 4ETXA 4ZJQA 1KFSA 2WONA 2VQEF 4GKJJ 2C1EB 3FEYB 2NUUG 1JJ4A 3M6UA 2KZZA 2IRUA 3IS9B 3KYLA 4RU9A 4O4RA 2A6MA 2CJQA 1NK6A 4A48A 3OSNA 2RH3A 2Z0GA 4AL5A 2LFVA 3MOZA 4OI2A 4ED4A 2CVEA 4PG6A 1RXOB 4LF4J 3OR2A 1NH7A 3H5XA 1RLCL 1EETA 3SIPB 2A18A 2UV8A 1BWVA 4PABA 2R7RA 1QAYA 3CO9A 2MYFA 2AU0A 1TV6A 3MUVP 2YQ3A 1VHIA 4Y00A 4IG3A 1IXKA 3EZOA 2IAJB 3O8WA 3MEEB 2MXYA 3TR5A 2OI2A 3SEOA 3GZ7A 2ZFHA 2HNZA 4J9KA 2UXCF 1FRKA 4MFBA 1RWNB 1XQIA 2FC8A 3ZO7A 3VTIA 1XMOJ 3KJFB 2B56A 5H9FK 4IG0A 3KLEB 3NP5A 4KH1B 3OTCA 4AFFA 3Q22A 4G3IA 3V4IB 2NXNA 3CJKB 3FFIA 4NI2A 3ZTPA 1SC1B 1Z4UA 4C8KA 1SKUB 2P9EA 2DHHA 4DV1F 2KFZA 3PEJA 1FJEB 4ECWA 2Y8WA 4ZPCA 1S9GB 2ZD1B 1Q5VA 1Y3JA 1QTNB 2V2QA 2R2TA 4HHJA 5H1SV 3RRGA 3K0JA 2MQPA 2YNGA 3DCAA 3OUYA 1SIWB 4C97A 1HI0P 1BLUA 1T9YA 5HJYA 2XMWA 1SJFA 4NOHA 1R6VA 1FXLA 4DV7J 2DY9A 1DQ9A 1UPMB 2E7WA 2VU5A 4YB5A 2N3OA 3RBEA 3MUTP 1R0AA 1LK5A 3PHTA 2YKQA 3GFZA 2DGUA 2E29A 4LSZB 4DN9A 4USMA 5I4MA 1OYEA 3BPSP 4YHHF 3MR5A 4I2QA 3D0GE 3AJ2A 2BVZA 3NL0A 3UDLA 3OL9A 1U8WA 5KT5A 2XNQA 1UEVA 5E3RA 1K0VA 4LIWA 3C6UA 2MQOA 2YX1A 4MH8A 3W62A 1YRUA 4X62J 2BE2A 2VG7A 4USIA 2HFVA 4HL9A 4UT4A 2Y1JA 3HP6A 2MPUA 3D66A 2GS8A 3SXLA 3D54A 3H90A 2HRYA 5G0RB 1KHVA 1GX6A 4PPZA 3R97A 3DI6B 3RRKA 4RNFA 1NK5A 1RWPB 3SSSA 4R25A 4OI0A 5IV4A 4X4RA 4W92B 2XO6A 2LQBA 4QR1A 2W2PP 3LO3A 2ZHAA 2V2ZA 3NBPA 3AH6A 1RT1B 5E7OB 3HI9A 3NY0A 4ZJOA 1HFEL 1HHSA 3S1TA 2DR5A 8RUCA 3PCOB 4X4OA 1HYSA 3DRYA 3WIUA 2JNJA 5AT1B 4B3TF 1FJCA 2KU7A 5D4PA 1SJ4P 2AYGA 1U48A 1YSJA 3JYTA 2LQJA 4J9UE 2NPIA 2HBRB 1CC8A 2DCLA 2H4WB 2M9KA 5F41A 3KK3A 1UFWA 3HHLA 2Q1LA 4HH0A 5K8PA 2Q3PA 1VBXA 2OGUA 3MTJA 2Y8YA 4X2BA 1PSDA 5AXMA 1TL1A 4YR2A 2HYIB 3BGUA 2FJWA 1YRTA 5HMWA 5SZTA 3RAQA 4FBTA 1XNRF 4PYAA 2DH9A 1YZ6A 2V8HA 3SMZA 4A8MP 2VOOA 4RUHA 5T14A 2FVCA 4PXBA 2DIVA 5KAKA 2GIQA 4EO8A 1UCNA 4ECYA 3CDWA 4CLFA 1FRJA 2O66A 2IBKA 3K2YA 2HGNA 3BR8A 1JLEA 2D9PA 4DJBA 3BGOP 5C5JA 4DCOB 4DS4A 1Q8BA 1H2TZ 4USUA 3OL7A 4OZNA 3W8PA 2YY3A 2CPEA 3PX6A 4OZ1A 3HMJG 4P7VA 3GCXP 1H73A 2DH8A 4ZMMA 2F3JA 3D3CJ 3BSOA 5ETLA 4B3SJ 1BUXA 1XMQF 2O5DA 2F7VA 4F2SA 1H3DA 3GYGA 1OY8A 4FBUA 4X4UA 4MT1A 1X4GA 4NYPA 4YB6A 3H8YA 4DV3J 3SV4A 4DBQA 1YJTA 2IC3B 2IDLA 1SH0A 3GCWP 4YQWA 3NMAA 3HJVA 4K4VA 4XAKA 4WKYA 1U1PA 1R0AB 3F41A 5K8OA 2UUBF 2QSFA 4QW8A 4F3QA 5LMNF 2LEAA 1X4CA 2B43A 2GHVC 2P9CA 2YNIA 3ICLA 2ZNYA 3N6LA 3OD2A 3VV2B 1U0HB 3THVA 3ONQA 5LT5A 2WBMA 3A8IA 2QG9B 1IN0A 1FDNA 1VRQC 2F9JA 4KRWA 4ZP7A 2NSCA 4CM0A 4K4WA 4DFJA 5D3GB 2MJNA 4OX7A 4DZ6A 2FD2A 3FNNA 3KLVA 3RW6A 4Y2CA 1LW2A 4NLUA 5I42B 4KPYA 1WC3A 1C1CB 3LANA 4I69A 5B0BA 2M8DB 4EBDA 2K7KA 2RT3A 1RT7A 3ENAA 3ZZUA 3GIMA 3ZZOA 4TNOA 2LCWA 3HVRA 2QO3A 1RISA 2R4FA 3E8OA 4ZS6A 4DR1F 2HG4A 2A6OA 1ZAVA 2LECA 1VQ6S 3NOCA 3IN5A 3D28A 3QGPA 3QJPA 1HWIA 4RLEA 1PYTA 2A1BA 2VC1A 3M32B 1YJRA 4WFNQ 1Y4ZB 2K06A 3K5NA 4B9VA 4FF4A 2HNZB 1TUVA 3GSIA 4X65J 5KFJA 3KUGA 4HLBA 3CCES 2XY6A 1S9FA 2CNKB 3TX0A 3KMSA 1BWEA 2Z58B 3UNYA 2HVHA 3DRSA 3MMCA 4A46A 3SFGA 5HSPA 5IM0A 2KZMA 1HIYA 2ROEA 4KKOB 2DHAA 3TA0A 4FVCA 4V1Ak 3CDEA 2POKA 1IR1A 1Q0NA 2V9KA 2DO4A 5B0GA 2M2BA 5DDQC 1C1BB 4DL0C 1AYEA 2LQ8A 1LEOA 1SIZA 3D1HA 1F5AA 4NMLA 3VHQA 4ANDA 4CLSA 1UVKA 2HEKA 3A3OB 3CNQP 2XBPA 3C14B 3MMCB 4M5LA 4DS5A 2NXEA 3PW0A 1IVZA 1U25A 1PJ7A 1FE4A 1GXTA 3GTYX 4QBUA 4U7CA 3JSMB 4HR2A 3C2PA 2HIYA 4LRBA 5LL6d 2VBZA 1CPZA 1JLFB 1BMQB 3V5RA 5A76A 4JV1A 4DG1B 1IBKJ 3Q89A 3FK4A 4A8SA 1V9OA 4JYAF 2LQ9A 1O6XA 4NLDA 3SBMA 4R5PA 1RYRA 5HROB 1GMUA 2R2UA 2V2VA 2VKRA 1FK9A 1S1WA 5GMDA 3UN2A 1JLCB 3ZTRA 2LXUA 2OMLA 2DB1A 3SCKE 4IUFA 3R2CJ 4DV1J 2YKNA 4H4OA 4ECUA 2GMLA 4ZPVR 4K0KJ 3OLBA 4JI3F 2QSWA 1TFWA 4KV8A 2J6UA 2QT7A 2W2NP 3TAMA 3V81A 4E0DA 5CYQA 2W9BA 2YKMB 1VIXA 1AFJA 2IJNA 2K8GA 2M7SA 2VOPA 3ZZTA 4I2PB 2AJ1A 3MOJB 2AMCB 5EUHA 2J0QD 4NCAA 3HO1A 1CJTA 1SJRA 4ZHRA 1LFWA 1T9VA 2XHWA 1NMEB 2ZVSA 4HTJA 4ECQA 2AD9A 3MD3A 3MM7B 2RDIA 2YKAA 3M8WA 3MMAA 2B5JB 4IYQA 1U1OA 5CYMB 3R1LA 1X5SA 4JI2J 1GH8A 3KHRA 4DPUA 5GADU 4I0WA 1TELA 1RI7A 1N0VC 5EHHA 3LGHA 2UU9F 3MCSA 1MG7A 2DY1A 2KB2A 2GZOA 3DFEA 4ELVA 2DNYA 1QLNA 4H54A 2HHUA 2WHOA 3LALA 3IA0A 1RBOB 2JDJA 3KUEA 2CJ9A 4NLOA 2XMUA 1JB0C 2FJDB 2G2OA 2IM1A 2YKPA 3FBEA 1GK8A 4P2XA 3VVTA 3DLBA 1FE0A 3BN4A 4ANEA 1VQ9S 4FYYB 1RACB 3ENWA 3D2WA 3CC2S 2W2QP 5ETKA 4ED2A 2XMVA 4N5SA 2UP1A 3CWJA 2Y0BB 2F4FA 2WVFA 5K20B 1DHMA 4NLVA 4DLEA 4UTGA 2P5VA 2W2MP 5A8KB 3VAIA 5KFOA 1U49A 2RVJA 3G9CA 1ZTWA 2YXLA 1KWMA 1S7IA 4DQIA
chains in the Genus database with same CATH topology
4LF9F 2IYIA 2H5EA 2L9WA 4YUDA 1TAQA 3IAS9 4AXIA 3ISNC 2XNRA 1H7XA 1JLGB 2X3GA 5EWGA 1GTEA 4J9NA 3HKWA 2AYBA 2YWHA 2CPFA 2X51A 5CYJA 3FRZA 2AQ4A 3ZZZA 2PMZD 3MR2A 3O6QA 4M63A 1S49A 1HYSB 2LEPA 5IZHA 3HX9A 3PRBA 3G4SS 2AYMA 2KKHA 2ZNZA 2BQ3A 5T41A 4OX9F 5LSRA 3T1YF 4MYTA 3LGMA 1IKYA 2BANA 2QEXS 3VWSA 5G0RA 4EBCA 2QA4S 1FRHA 4ECTA 2BANB 2OO4A 3LPYA 1URRA 3FMBA 4UUWA 2R7WA 1OSCA 2F4VF 3NLCA 2ZBCA 2DITA 1TQLA 2XMTA 3MMBB 2MMYA 5GAGI 5KFZA 1HD1A 3S01A 1RT4B 5KFQA 2C22A 4C0OC 3KTQA 1GNKA 5D6GA 2QE5A 5KOWA 2W9AA 5CYMA 3CMES 1UJ4A 2R7TA 5HP1B 3BB5A 1WNEA 4DV5F 4ID5A 5J1EA 2AGPA 4IH5A 4ZHRB 4O3SA 2W4PA 2QLWA 2D1CA 1HNVA 2FJXA 1JXLA 4YDXA 4USHA 3L95X 3IAM9 2EFPA 1Q7YT 4AQYF 2FGCA 2I9SA 2ASDA 2ASLA 3QLHB 3MM7A 2D7SA 4I68A 1DJ0A 5A8RA 5A8KA 2Q79A 5KFCA 1L3UA 2ZOFA 3F73A 3FSYA 1NJXA 1FK9B 1S1WB 2BYCA 4JI2F 3M30A 3B78A 1K9MT 4K4YA 1U1KA 1X4DA 2CQ0A 4MKAA 2Q66A 2IA0A 4QWBA 2VB6A 1TAUA 5F8NA 1N6QA 3DYAB 3OTEA 2JRSA 2W24A 2IVMA 2GW8A 4XPEA 1SC6A 2NS1B 3VZIA 3MEEA 4UQGA 3T1AA 4RBVA 4JI4F 3NNHA 3VAMA 4QIVA 4ECXA 5DDPC 3OHAA 3OJUA 5MAOA 1FDAA 2OAUA 3L3CA 2D3OR 1V3RA 2KJVA 4B9SA 1KVIA 4QU7A 2HLTA 4F67A 2DGVA 2F8MA 4NCGB 2MKSA 2HVIA 3QWPA 5KG0A 2UUWA 5FJ4A 3CCUS 4IOBA 3H4BA 3DLKA 5BYSA 1OWXA 3TO8A 3POTA 1QUPA 3PY8A 2DRAA 1NK9A 4J9OA 3HVWA 3IGNA 3AA9A 3MTKA 1VS3A 3AA8A 3TOQA 4ZPWR 3CVKA 3RB4A 2HNDB 3TA1A 3RTVA 3NCQA 2GC8A 2BM1A 1AROP 1HNZF 4PWDA 3BGLA 2AX1A 3EZ5A 2GGPA 1TL4A 1VOMA 2RQKA 1WELA 5F8IA 2XO7A 4IR9A 3TVKA 4HT5A 4NRUA 3GIJA 4KGMA 2MY7A 4OLOA 1B0VA 1KONA 4RBTA 2E5LF 3HM9A 3KLFB 4Y2MA 3JSBA 2NSBA 1YVFA 3QJJA 3DLGA 5EDWA 2NZ4A 3DLKB 4NL5A 1C1CA 2VL1A 5I42A 1M1KT 2G4BA 3HVAA 4DR6F 1C1BA 2VBXA 3EZUA 3H5SA 2GHWA 3I5BA 2L41A 1UA1A 3VAFA 2NREA 1IKWA 2ZJQQ 2XLIA 2AJFE 2GQQA 1NO8A 4HTIA 3T5JA 4I67A 2Z2LA 4DL4A 5GAEU 5J1EB 3M8SA 1FTCA 2DCUB 3UQSA 1U09A </