4W90B

Crystal structure of bacillus subtilis cyclic-di-amp riboswitch ydao
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
90
structure length
90
Chain Sequence
b'RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U1 small nuclear ribonucleoprotein A
publication title Crystal structure of a c-di-AMP riboswitch reveals an internally pseudo-dimeric RNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 18
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4w90B00
1M5VC 1M5KC 4LMZA 2F9JA 1UAWA 1URNA 2DGWA 1X5TA 2FC8A 1JMTA 4PRFA 1WF0A 2M7SA 1VBZA 1SJ4P 1PGZA 5DM7Q 1U1MA 2YH1A 1O0PA 1HA1A 5LXRA 2LYVA 2J76E 2XNQA 1U6BA 1YJNS 1X4HA 2M70A 3G8TA 2DH7A 2DGUA 2KN4A 2MGZA 3J7ZT 2CPIA 1WHYA 1FJEB 4WKRA 3UCZP 2KFYA 2LECA 1X4AA 3UCUP 2MXYA 2MQQA 4M5DB 4WIIA 5CYJA 3MUVP 4IOAQ 1RK8A 2VONA 3CUNA 2MYFA 2CPFA 3TYTA 3CD6S 4QQBA 4U67Q 5DDOC 2DGVA 1RKJA 1VBXA 2OTLS 1OIAA 2A3JA 2JX2A 4W90B 1H2TZ 1H6KX 3DLLQ 1A9NB 4QU6A 1FO1A 2E5IA 1NO8A 2M9KA 1SJFA 1SJRA 1OO0B 2SXLA 3DXBA 2MPUA 4Y00A 1SJQA 1S72S 2RUGA 1VC5A 3NNHA 1YTYA 3VAKA 1WF1A 5FJ4A 5CA5A 2PE8A 2YH0A 2DISA 1S79A 2JVOA 2EK1A 1FT8A 4CIOA 3B4MA 5BJRA 1XN9A 3UE2A 2QFJA 1WEZA 2CPYA 2M4MA 2JVRA 2PEHA 5GAGU 2RU3A 5D77A 2KYXA 3G8SA 2KM8B 1VBYA 1VQNS 2CQPA 3K0JA 4P6QA 2DNKA 3THTA 4OZ1A 2LEAA 4WFBQ 1Q81T 1H2VZ 2CQDA 3CC2S 1JJHA 1P27B 2RRBA 1M1KT 1U2FA 2Q79A 2CQ1A 4IOCQ 3CCMS 4QPTA 2I38A 3UD3P 2MZ1A 2MQLA 3MOJB 4TU9A 1U1QA 5GAEU 3IWNC 2MSTA 1WEXA 1OPIA 2D9PA 3FEXB 4C7QA 2MJUA 2RQCA 2QA4S 1X4CA 1KC8T 2XS7A 4OZ0A 2I2YA 2BZ2A 2DNMA 2AD9A 2WBRA 3Q2TC 2DNHA 3VAMA 2RS8A 4TU8A 1QM9A 2K8GA 3IRWP 2MQMA 5LSOA 2MMYA 2U2FA 2QEXS 2DNNA 1VQKS 1W2BR 2ADBA 3CC4S 1VQPS 1X4FA 3MD1A 4V19X 2EK6A 3UWTA 4UQTA 1WEYA 2G4BA 5JVGQ 2LA6A 4LIRA 1X5OA 2KI2A 2J0SD 2KVIA 3CCES 5GVQA 2UP1A 2AYEA 1N88A 3MDFA 1VQ8S 1UP1A 1JJ2R 4BS2A 3NS6A 3ZZZA 2DGQA 1YJWS 5DM6Q 1U1RA 3BO3A 1VQ5S 2DNZA 5GAHU 4IO9Q 2HYIB 3R27A 2RVJA 2DO0A 5CXTA 3THPA 2MHNA 2OSRA 3NMRA 2M8DB 2OIHA 2FHOB 3L3CA 1QVGR 2D9OA 1WI6A 1KD1T 1HL6A 5LSLA 2ZJRQ 2MKJA 1N52B 4Z2XA 1IQTA 3CCSS 5HL7Q 2AYMA 3TP2A 2HGLA 2YWKA 1ZH5A 2DNQA 5MLCV 5DDRC 1WG4A 1R8PA 5DDPC 2HGNA 2N3LA 4WFAQ 2XS2A 1A7GE 3VAJA 3ZZYA 1PO6A 3RW6A 3CPWR 1SJ3P 3VF0B 5GMKa 3MUTP 1SXLA 2DO4A 4IUFA 4YOEA 1FXLA 3SXLA 2MQNA 2MZSA 2LA4A 2D3OR 1ZZFA 3P3DA 2CQHA 1R8HA 3CCVS 3U1MA 1NJIT 2KT5A 5DETA 2MKSA 3BEGB 4W92B 4F25A 4PKDB 2LMIA 1H2UX 1U1KA 1KOHA 3US5A 3G71S 1X0FA 3ULHA 2RRAA 2F3JA 5H1SV 2DGOA 2AYGA 2FC9A 3U1LA 2DNYA 2GHPA 3CMES 4FXVA 5HO4A 2OSQA 2DGXA 1YI2S 1Q82T 2FPHX 2RQ4A 4EGLA 1FNXH 1WG5A 4PR6A 3CXCR 4CH1A 2KXNB 3LPYA 2DH8A 2DHGA 2KRBA 4ED5A 2JRSA 1DBDA 1X4EA 2DHSA 5D78A 2KXHA 2MKIA 3NNAA 2KRRA 4J5OA 1K9MT 2X1GA 3SDEB 2J0QD 2M8HA 1VQMS 1VQ4S 2E5HA 3NNCA 2CJKA 3HI9A 1X4DA 4WF9Q 4F02A 2YKAA 1U6FA 2CQBA 2LXUA 3S8SA 1VC0A 3UCGA 1U1LA 2XS5A 1Q86T 2AYBA 3PIPQ 3BO4A 3VALA 5LJ3Y 2KH9A 2KHCA 3BS9A 1VQ9S 2DIUA 2DB1A 1DZ5A 2VODA 1HD1A 2MZRA 4TU7A 2XB2D 2X1FA 3SDEA 3D2WA 2HGMA 2L08A 2DNGA 2RNEA 4TLQA 2ZJPQ 2CQIA 4QU7A 4WFNQ 3G9CA 3MI7X 1F9FA 1WHWA 1YWXA 3S6EA 3EX7B 2N3OA 1QVFR 2NLWA 4CH0S 1G2EA 4YUDA 4ZKAA 2HVZA 2DNLA 2ZJQQ 2X1AA 3Q2SC 3RW7A 1FHTA 3G4SS 2NZ4A 3CC7S 1N54B 2KG1A 5IM0B 2BOPA 1D9AA 3EGZA 2L9WA 2KG0A 1YJ9S 2LXIA 2DNRA 3P5TL 1NU4A 1YITS 2MKKA 2N7CA 2DK2A 1KOOA 3CCJS 2JWNA 3MUMP 2CPEA 3VAFA 1VQ7S 3CULA 5EN1A 3H2UB 1D8ZA 4FXWA 2V94A 1WTBA 1K73T 2CQ2A 2FY1A 3V4MA 1N8RT 1FJ7A 3MURP 3HHNB 1JJ4A 3R1LA 2MZQA 2M88A 2M52A 5IM0A 3CCRS 5JVHQ 2DGSA 3VAGA 1WHVA 2DNOA 3FEYB 2CQ4A 5ITHA 2RS2A 1OWXA 2CPHA 4C0OC 3VAHA 3MD3A 2E5GA 2MZJA 5GADU 2LCWA 1U1PA 1K8AT 1CVJA 3MXHP 2VOPA 2DGTA 4RU2A 3BO2A 1WHXA 2MSSA 3B4DA 2X1BA 2LEBA 2J8AA 5IQQA 2E44A 1YHQS 4C4WA 1X4BA 1X5SA 3S7RA 5IFMA 3VAIA 1WG1A 2GO9A 1ZZNA 1U1OA 2DITA 1VQLS 2MQPA 3R1HA 2KXFA 3EGNA 2E5JA 1M90T 2OJ3A 3JB9k 2MY8A 4UY8T 1UW4A 2MB0B 2U1AA 2CPJA 1UFWA 2MQOA 2DIVA 1P1TA 1X5PA 3I55S 2G0CA 2CQGA 2KU7A 2XSFA 3N9UC 3S01A 1HD0A 2KM8C 2YTCA 4CQ1A 2OTJS 4A8XA 1X4GA 4LJMA 2G1DA 5LJ5Y 2MJNA 2O3DA 3LQVA 3TO8A 2M0GB 3CCLS 2DH9A 1YIJS 1VC6A 2L41A 5DDQC 1DRZA 1M5OC 4WCEQ 3G6ES 1WELA 1WF2A 1B7FA 1BY9A 2DHAA 4YB1P 3CMAS 2K3KA 2MKHA 1VQOS 1VQ6S 2CPZA 3P49B 2XNRA 2VOOA 2CQCA 2DNPA 2B0GA 2MY7A 4Y0FA 2N82B 2LQ5A 3G96A 2CQ0A 4ERDA 2F9DA 2LKZA 2DHXA 2HZCA 3UD4P 2CPXA 1WI8A 3OW2R 1FJCA 1L3KA 3PIOQ 2ADCA 2CQ3A 4F26A 3SMZA 5LXYA 2MKCA 1DHMA 2M2BA 1AUDA 3CCQS 1WWHA 2MZTA 3I56S 2RT3A 2ERRA 2CPDA 3H2VE 1U1NA 3NS5A 3J7YU 3CCUS 2MGZB 1KQSR 2EVZA 3CTRA 1Q7YT 1M5PC 3P6YC 3CF5Q
chains in the Genus database with same CATH superfamily
3PFEA 2XCPA 2FHJD 4PRFA 2QG9B 2GW8A 3C6UA 2IRXA 4EI2A 3SZ2A 1RHMB 2KFYA 2VL1A 3V5RA 3X1LB 2YKQA 3QT8A 3GPAA 3HHLB 4JI1F 2DBBA 3PO5A 3TYTA 2HZVA 4NEYA 3QRQA 3OPKA 3MFIA 1RT4B 2UVRA 1H6KX 4ZN3A 1RWOB 3A3OB 3FBCA 1AB8A 4DSFA 3BPDA 2CJQA 3NL0A 1RA7A 2ALYB 3QJPA 3LGMA 3MM6A 2EG2A 2HSEB 3M1VA 2BDPA 3MECA 2QFJA 5GMDA 4NZ7A 4XAKA 1EARA 3MMAA 3FZ2A 2C3MA 3GLJA 2GX8A 2I5JA 3LWLA 3FK4A 3E8OA 2RKIB 2UU9F 3FUYA 2ZKTA 3MEDB 4WKYA 3K8WA 2GVZA 3NWRA 2R7SA 4DFMA 3FRZA 5HQMA 1XNQJ 4ICLB 5IWAF 2DNMA 2XYPB 4NXMJ 1UJ4A 3Q2TC 2K8GA 2Z30B 2BKPA 4K0KF 2CZ4A 2JEJA 5FDLA 2ADBA 5DG7A 3DLKA 5BYQA 4X64F 1B64A 1YJRA 2BVZA 3CCES 1NHVA 2HBRB 3J80U 4Q0BA 1YJWS 4BWMA 3R7SB 1S1TB 1TL3A 3ILLA 1RT7A 2JFKA 2JNJA 2JLEA 3W62A 2ZH7A 2M8DB 4C8KA 4O4RA 3GYXB 4DWIA 4ZVHA 3LOUA 2QSWA 5HJYA 3D54A 2DPJA 1N5SA 1GFWB 1ROFA 5FIIA 1HNIB 1HBUB 4USWA 5KFOA 1KR4A 4ECXA 4IR1A 1AFIA 4HHJA 1RWMB 1ZZFA 1RT6B 3UW1A 4G65A 2MKSA 4W92B 4CLPA 4F25A 2VDIA 1IR0A 4B3RJ 2VPXB 3C19A 4KGZB 4RW4B 3SQGA 3IBCB 3ETMA 2H4WB 3H2LA 1QAIA 1M5HA 4ID5A 5L9XA 2VBZA 1S1VA 2HPUA 3HFVA 4OX6A 1KS2A 2JRSA 2KXHA 3W8GA 1NKCA 2V9KA 1RT2B 2ZD1A 4QR0A 3BR9A 5LJ3Y 1VQ9S 5ETNA 1NK9A 4TU7A 5F0UA 3VZIA 1WOPA 3ZZRA 2HFOA 3AXKA 3ZFVA 5ADZA 1R31A 2HKEA 4CLYA 4B3SF 3UN3A 4CLWA 4DFJA 3TUZC 3Q8YA 4ZP9A 4NYOA 1HWIA 3GSDA 2QFIA 3LUYA 3PZPA 3KDNA 2CQ2A 1D3WA 1BWEA 2DGSA 3M2UB 4MKBA 4J9NA 5RUBA 1TK8A 4B3TF 3QSYB 3ENQA 3AY0A 3OL9A 2FY8A 3NOGA 4Y2CA 2BJ8A 1NK8A 4RU2A 3BDPA 5LMNF 1O51A 1X9WA 4C4WA 1WG1A 2AX0A 2Z57B 1HI8A 4UY8T 2MB0B 3BGFA 3O6QA 4K4VA 1PSDA 1TVRB 4JI7F 2C2NA 1BD6A 1ZTTA 4NA2A 3BSCA 3PV8A 5LJ5Y 2J9DA 4M5JA 3GFYA 2A10A 1T11A 2C3UA 2V9WA 4X66J 5KFDA 1WORA 2W2MP 1WJ9A 1LW2B 2X7IA 1RWVB 2CQCA 3O44A 1KP6A 4DV4F 1I6JA 4FNHA 2RHQB 4H4OA 4OFZA 1N6QB 2XG8A 1HHTP 1WTFA 2NCKL 3GWCA 4ECQA 3O2IA 3I56S 2ZM6J 2R7RA 1UZDA 2OGUA 5BXIA 3BSNA 1H3DA 2OEJA 2GHWA 1S9GA 2EBEA 1AZSB 2W8LA 3J81Y 2HFVA 1YJTA 3Q8QB 3CDUA 2OD4A 1NHKL 2WOMA 2ZVSA 4CYUB 3ZNUA 3CCWA 4RPFA 5HQ8A 4WKRA 1VQSA 3EMTA 3VHQA 4XIUA 3DRPA 3HVAA 2CZ9A 1K47A 2XMAA 3NOCA 1PIEA 3IXQA 3TOQA 1T03B 4DI6A 1U09A 2GA7A 2OTLS 2JX2A 4PEOA 2RD5C 4ILMA 3BGRA 2MPUA 2RF2A 1CJTA 4M94A 1F1BB 4YR0A 2P6SA 4DV2F 1H38A 4FNIA 1DLOB 2B4UA 5GAGU 4P75A 2QA2A 2I1RA 3ZZ0A 2CQDA 1P27B 4OI1A 2B8QA 2MZ1A 2ZOFA 1TKXB 5HANA 2J9CA 3N79A 2N4CA 2AEMA 3BKTA 4LF2A 3MPDA 5J2PB 2FHJA 3PYEA 2R8IA 2E1MC 2CYYA 3KLIA 3MFHA 5DLFA 2LQ8A 3HP6A 4NLGA 3GIKA 3DRSA 5LSOA 2MMYA 1XTZA 3IM8A 2BE2A 3WC2A 1CG2A 3I31A 1S9EB 1GNKA 3I0RA 7AT1B 3J81j 4U7UK 3JSMA 1NUEA 3D6FB 4YR3A 2J0SD 1UP1A 2A2CA 4QWAA 3O3LA 2F7VA 3A13A 5EX3A 5CXTA 2BKNA 1SJ1A 4NMLA 3RR7A 3C2PA 4BHQA 2GHVC 3I4PA 3QT7A 3GG0A 2ZBPA 3I4HX 1FRIA 2VFRA 2DRDA 3L09A 1QAXA 3RRKA 2N3LA 5KFVA 1VDHA 5D3GA 3RW6A 5F8LA 2DJWA 3F0NA 8RUCA 2D3OR 5DZ6A 1JIHA 2G0IA 4DS5A 2KTQA 4JB8B 2HNZB 4X62F 1U1KA 3G71S 2W2OP 4OV6A 4MKAA 2LDIA 2NS1B 2ZZNA 2DNYA 2A6OA 3NLCA 4KSEB 2DGXA 3DLEB 3GIJA 2R8HA 1JJCB 5CABA 2KRBA 1L5UA 4Q2LA 5D78A 4CLUA 1S6OA 2MLYA 4LF9J 5LMUF 4Y2KA 3TR5A 2CADA 2YKAA 2OFGX 2YKMA 3BKFA 3BO4A 3ZZUA 5AE2A 3QFHA 3BPSP 4K4TA 5IZHA 4C48A 4GKJF 4B3OB 5K9FA 2OPSB 4ZMMA 3R97A 3FSXA 1F9FA 4DUZJ 5B09A 2YNIB 2NSBA 2B56A 1AXQA 1JKHA 3OTEA 3R7BB 4C8OA 2GNKA 1XERA 4MFBA 4EEYA 3P5TL 1YITS 3SQOP 2O5DA 1IR2A 1KVJA 1VQ7S 2V2ZA 1FD8A 5AXKA 5A0YA 3LP1B 4XPEA 4DBQA 2VC0A 3ICLA 3NAHA 4X4PA 4DU7A 3I9V9 5J1EB 4EZ6A 2VPWB 2YKOA 1HWUA 4IG3A 2NUUG 2C2KB 2CPHA 4XDCA 1CJKA 2K7KA 1NKEA 4KT0C 2MZJA 5GADU 1B3TA 1SCJB 4HDHA 1WHXA 2E9ZA 4B9MA 1ZOTA 2WONB 1FE0A 5I3PA 3OR2B 1T0TV 1S6PB 4OIXA 4ZLJA 1WKLA 5HVHA 4AQYJ 2Z2LA 3CMQA 4JYAJ 2BYCA 4FYWB 1NLKL 3DMJA 2VKRA 4KKOA 4HTIA 1QSLA 1LXJA 1N36F 2M0GB 4OX9J 2L41A 4USKA 2H1YA 4YB6A 5K14A 3JSRA 4AT1B 4P74A 4KV8B 1Q4RA 4ERDA 3DI6B 4YMEA 4DL7A 3CIMA 3V2UC 4OYXA 3PJXA 3PR4A 1M1HA 1RWNB 3D4JA 3AD7C 4E2FB 4C3KA 3T5HA 1Y7PA 1FX4A 3KJFB 2EW9A 2JJ4D 1Y4ZB 1CLFA 3POTB 3PY8A 2GJIA 4LMZA 1JMTA 1PGZA 4DL4A 2ILZA 1U02A 1WACA 3M8SA 3CO9A 2DGUA 2KN4A 3ELHA 3MAAB 2P6TA 4ED0A 2MQQA 4NL5A 3GILA 4OJHA 4CO0A 1EZZB 1MG7A 4EMDA 2HHVA 4A8KA 4QWEA 5DDOC 2HLTA 1CQMA 1QUPA 2FLOA 3MM7B 3ITHA 4L75A 1SJFA 3OD2A 2ZH3A 1WF1A 4HHHA 3HHLA 2HWHA 4CCHA 3EVWA 2VQEF 2UXDJ 3THTA 4OQJA 3FVYA 4HHUA 2IPOB 5BR8F 3DNCA 5EWGA 4LR8A 1RLDA 4NLPA 4CLSA 2MSTA 5FLXY 2AGPA 3MR5A 1V3RA 2MJUA 3GV8B 4ALZA 4M5NA 2H48B 2AD9A 2RKIA 4JI8F 2D3UA 1QM9A 3WIVA 3JS9A 3MEDA 2I0XA 3OHAA 3IC1A 4P72A 3UWTA 4UQTA 2OP5A 3D5MA 3TJAA 5KFAA 1FCAA 1NMEB 2DR9A 1LV5A 1YBTA 1N88A 3E3XA 5L8RC 3HT3A 2EEYA 2RVJA 4A48A 2BKOA 2QL7B 1GMUA 5KG1A 3T1HJ 4Q43A 1QUVA 4RR5A 3I82A 2ZJRQ 1EB0A 3CD7A 1S1TA 3C15A 5SUHA 2JHEA 3M9OB 3IR6B 3EYZA 2D1CA 4V1Ak 4DLGA 4FVCA 3QWUA 3W2VB 2QYGA 3CJQA 3K5NA 1FRLA 3U1MA 3KJNB 5D8HB 3HVRA 1HNIA 1HBUA 3VTIA 5KG2A 5KOXA 3ISZA 2IM1A 1V9OA 1RT6A 4C6AA 5KFIA 4LBHA 3W64A 3TQ1A 3RAQA 2CVIA 2B4OA 4J9UE 2DHGA 2QA4G 4EWTA 4TQRA 3NNAA 3NKYA 4RW4A 4DV6J 1VQ4S 4ZLPA 3BF4A 2YKNB 4U6PA 2HVHA 3NEKA 3KLVA 3KJVB 3RR8A 3NAIA 2LU1A 4RZRA 2IMWP 4NZ0A 1SH0A 4F67A 5HVFA 5HQLA 3PFOA 1Q1KA 1RT2A 2PN6A 4K2JA 2H54B 3R8YA 3QIPA 3QJJA 1E6YB 2L3MA 2KG1A 8AT1B 2L9WA 1SPBP 2N7CA 3HZGA 4GKKF 2MLZA 4QIWD 3FEYB 3HF5A 2A6MA 4RUCA 4IH6A 1HNZJ 3SV3A 1BQNB 2UV8G 3NG8A 4PXEA 2ZZTA 2MSSA 2NXCA 1XMBA 4DR5J 3U7JA 3M2UA 3T1YJ 1VQLS 2GO9A 5F0WA 2R4FA 1O8BA 2ZWOA 3SYZA 1I51B 3JB9k 4DPYA 3PO4A 1WKJA 2GVDB 1X5PA 3I55S 4U8VA 4LFBF 3S01A 1UPMB 5F9NA 3QAUA 1I94F 2OTJS 3T6BA 3UR3C 1JLEA 1FRKA 2E9RX 4JI0F 2XMJA 3CJ3A 4PYDA 1BY9A 1TVRA 3OJSA 2XNRA 1UEUA 4NLUA 2NPFA 4JI5F 2C2EA 3FDSA 2KZMA 2RB7A 2DHXA 2CPXA 3D3BJ 2KL8A 4DDFA 2R7QA 4KGKA 2J0XA 2XMTA 2W9CA 3TI0A 3BSAA 1JXVA 4IFVB 1J27A 2GFFA 5KFTA 1RT1B 1Q7YT 1N6QA 2FHMA 1Y3JA 4PWDB 1URNA 2DGWA 3QQCD 1DTQA 1GXUA 1NNDA 3JAMY 3LWMA 1QSYA 2XNQA 4I2QB 1U6BA 2JSXA 3GG1A 3PM9A 1N48A 4NWBA 3SSSA 1SKUB 2LFVA 1AZSA 3M32A 2FDNA 4ECZA 4UZBA 2CA9A 4IOAQ 3MUVP 3CUNA 3H0PA 2BM0A 1TL5A 4J9PA 2DEJA 4MYTA 4CYUA 1FXRA 5I42B 4KPYA 3L4BC 1RP5A 3OTCA 2KDOA 2GJFA 2LLZA 4UT4A 2VICA 4E8UA 1QTMA 5E3RA 2XWYA 4WTYA 1I5OB 2DISA 3HCXA 2EK1A 1REVB 1HNWF 2CPYA 2D69A 4H54A 3G8SA 1VBYA 1RAFB 1BWVA 5KFYA 4O0IA 4CTAA 1U2FA 3TEHB 5KFGA 2AHOB 4JI1J 2ASYA 2MQLA 2ZDPA 1DLOA 4TU9A 1U1QA 3H40A 3EZ5A 2EG1A 4RWWA 2UUBJ 3EXYA 1JXLA 5EWFA 3UO0A 5D0RA 2AKWB 1C4CA 2P9EA 1NSKL 2NQPA 3UI3A 1RJJA 1VQKS 3KNGA 4TYBA 1VQPS 1ZBTA 4NCGB 5J2PA 1LEOA 1RCOB 4OL8A 4YDXA 4Q44A 1VOMA 2ABYA 3GSIA 1EHWA 2DGQA 2YQ0A 3ZNJ1 4RKUC 2HYIB 2UU9J 1IXKA 2FHOB 3L3CA 5CYMB 4NOHA 3BV8A 1VGYA 5LSLA 2MKJA 5THWA 5IWAJ 1ZH5A 4MK9A 4O4GB 2VPYB 3T41A 2YPZA 1QLNA 1WG4A 1R8PA 3A8EA 2L9NA 2LDYA 4CO2A 2XS2A 8ATCB 4K0KJ 1XR7A 4P7VA 3VF0B 2QX0A 4ZVQB 4X64J 2JZ5A 1Q95G 4URQU 3RTVA 5E7OB 3ZZPA 1UWBB 2WRMA 1MMNA 3EDRB 3W9JA 2HK3A 4QJVA 2XLKA 4FDFA 4LF1A 3QWPA 2BBEA 1BQXA 4DOZA 1KFDA 2RDJA 1ZYQA 1T9TA 3QJLA 1YI2S 4LF5F 1T9UA 2QMXA 3L7OA 1UJ6A 2HNZA 3CXCR 2B51A 4OZLA 3FEZA 3Q8PB 5KG7A 2UUWA 4J5OA 3D28A 4KC5A 2CJXB 4PQAA 1WOSA 1S1XB 1DFDA 3DLEA 3HZEA 4DSJA 1MLAA 5F8IA 5D4LA 2AJ0A 1Q86T 4DQIA 2AYBA 3PIPQ 3OUYA 5G0RB 2XGPA 3A12A 5B08A 4H4KA 3W1YC 5KAKA 4I6WA 1OQ6A 4DCJB 1FI4A 1AFJA 4K4SA 4C8LA 3RW7A 3B8HA 2Q1LA 2IM3A 2IJNA 3GONA 3JSBA 2OPSA 4U7UD 2NUHA 1PYSB 3M30B 2QL5B 5D0HA 4NCAA 3MCOA 2J9EA 1NBEB 2W4DA 3VAGA 4ZVOB 3KHRA 4UUXA 1GTEA 5HMXA 3M2RB 2GAHC 5F8JA 2VZ9A 1LW0B 2R8GA 1CVJA 1I1GA 2WK4A 4B3SJ 2J8AA 2XI2A 1E6VB 3D0IE 3G8QA 2PMWA 4QR1A 2DITA 1R0BG 1ICEB 2ZUGA 3WDOA 3J80Y 1N33F 4I2PB 3A4TA 4UY85 4ES2A 4N41A 2KU7A 4S0MA 2YTCA 2WONA 3OR2A 2YWGA 4KIAA 5ETPA 1S6PA 3IS9A 5HMZA 1OQ3A 1FDNA 2Z0GA 2DH9A 3AAWB 5DDQC 4F0HA 3NXZA 2G9OA 6AT1B 4B3TJ 1HI1A 4RW7B 2FHKA 1CJVA 4CT9A 5B0FA 4P7TA 2LQ5A 3Q89A 5LMNJ 2IAJB 1BMQB 1URRA 1M1GA 3OTDA 2I6WA 4Y28C 2FVRA 2VUGA 2PI4A 3CD0A 1FJCA 3CNQP 3QIDA 1ZM9A 1Q79A 3FBFA 1DHMA 3HDSA 1V3SA 3GMGA 3KK1B 1KLMB 4DQQA 4URSA 4JI7J 3NS5A 2DRAA 3AH6A 4LVOP 1R0AB 2XMVA 1X5TA 1IBMF 2YH1A 2LYVA 1Z4UA 1OYEA 1PC5A 3POTA 4DV4J 2YPYA 4FYDA 3CVKA 1CEZA 1CQNA 1FTCA 3T19A 5J2MA 2WVBA 2P9GA 2VFSA 3W9IA 5C2CA 4FBTA 3LGNA 1S1UB 3MAAA 1X0PA 1H2TZ 1OJ4A 2GJ2A 3D1HA 1S6UA 2H5IB 3FKBA 2RUGA 2GO8A 1PCAA 2ZC4A 4BC7A 3HD1A 3HSJA 1YDLA 4KGVB 2M4MA 4OYIA 4C97A 2A18A 1H7XA 1T9VA 4C8MA 2DNKA 4ELVA 1U6ZA 3F44A 3N4WA 5ETRA 4EBCA 3OFEA 3D0HE 3ZTQA 4LF6F 2D9PA 4ZVRB 2XHCA 3HSZA 5EDWA 2HFUA 1DQ9A 1IR1A 1NH7A 1WNEA 2AJ1A 3RRHA 2WBRA 2MQMA 4DV2J 2V8VA 1GTHA 2DNNA 3SIPB 3HSGA 3WHIA 2PT0A 3MD1A 3ISNC 3MPUB 2YX7A 2NSCA 4WK3A 3KLFB 2VIHA 4IO9Q 2B9YA 1KDNA 3BH7B 4RW9B 5AJ3F 2OPPB 4CNZA 2Z8QA 4O3NA 2CVEA 5E3PA 4L6V3 1UVKA 2AEFA 2VU5A 1NDCA 2NXNA 2Q6BA 4I7FB 4HTJA 4LFCF 4NLSA 2DNQA 1LWCB 3KHHA 4RW8B 2ROPA 4WPAA 4L72B 1KFSA 4KGXB 4OJ3A 2X3DA 5HROB 2UXBF 4IRKA 2F63A 5DO2A 1SQGA 1NJIT 2KT5A 5DETA 4DR7F 1RKIA 2OFHX 2RRAA 2F3JA 1VMBA 3OXLA 1Y11A 2QZ8A 3W2VA 3KLHB 1KRPA 4FXVA 4P9SA 4FVMA 5KG3A 3P45B 2IIHA 3RB4A 2QC3A 4F36A 5KFHA 2KRRA 1DARA 1W26A 1GT8A 1YZ6A 1R6YA 4BWJA 3QT6A 2KT3A 3HFKA 4UZCA 2KH9A 2KHCA 1Q0NA 4HKQA 2NZCA 3AA9A 4X62J 3DOKB 3D2WA 3I87A 4LRBA 1LNQA 1Q8IA 3R5DA 4NE9C 2YKNA 3HHKA 1FX2A 1MROB 3KJVA 1FVQA 4PXCA 3UDLA 2AU0A 2CG4A 3FBEA 4QYZK 1B4SA 1F60B 4JV5F 3EVOA 3ENVA 3QAEA 2LXFA 5LMUJ 1FE4A 1VYAA 2HVIA 1D8ZA 1AUSL 2M52A 4ZLNA 2FJWA 4F50A 2OAUA 1ULRA 4GKJJ 4DSLA 3MR2A 2HQCA 3H90A 2V5HG 4X4TA 3MXHP 2C2DA 2I9SA 4DQPA 1NPPA 3T5LA 2BW2A 3B4DA 2LEBA 3RBEA 1X5SA 1N0UA 3NS7B 1C0TB 5B7WA 3M6WA 1VRUB 3OT9A 4WE1B 3V6JA 4GO7X 1BQNA 2HRTA 4LF4F 1UFWA 3JXOA 2VD3A 1AROP 4QYRA 4ED1A 2AJ4A 4DV1F 1D8YA 2V8HA 4LREA 4GC6A 3UNGC 1Q78A 1FDBA 5C25B 2C3OA 3G6ES 2JOQA 2GVDA 1WELA 1YQHA 2MKYA 2RILA 1VCTA 1RAJA 2DVIA 2K7JA 3HFZB 2Y0BB 5EHHA 1IKYA 1R0CB 4ITSA 3K58A 3RYLA 2HZCA 2V4JA 4GVBB 3SCIE 4NLTA 4TLRA 3QGHA 1CSJA 4F26A 3NWGA 3C14B 2QT7A 2HFZA 2ERRA 1RCXB 3WIUA 3P6YC 4HYKA 1N36J 1BLUA 2O66A 2YQ1A 2WW4A 3OVAA 3JQJA 3PW4A 4USMA 4IFYA 3D6HB 3H5YA 2WZ1A 1MN7A 1RT1A 5U47A 1U24A 4PWDA 3PHTA 2EFVA 3HHLC 2DPIA 2KB2A 1SQFA 2XYHB 4MAKA 4I2QA 2W7PA 1UCNA 4QR2A 3N0VA 4K4UA 4WXWA 1S6QB 3J7AN 2A3JA 2FVPA 3DLLQ 1QAJA 4NLDA 1NO8A 1VC5A 4A8YA 3H4DA 5M2UA 4DL5A 2ZNYA 5I4MA 3PDNA 2C2MB 5I42A 1CJUA 1S79A 1UL3A 4X2BA 1KQGB 3AOAA 3W7BA 2JVRA 3GR0A 3ONQA 3NRBA 1FRXA 2B5JB 3M8YA 5KFKA 4FF1A 2KVQE 4JI3F 1XR5A 1REVA 5CCLA 4LRCA 1M5SA 4RNNA 2C42A 3JQKA 4CLFA 5E3QA 4DCPB 1QY7A 2KT2A 1H0HB 3GQCA 4KJIA 2GIRA 4AFFA 4F4WA 2QO3A 3K7RA 2DNHA 3CE8A 2XCAA 2CNNB 4DV7F 2IRYA 2VQEJ 3W5YA 3OL8A 3PEJA 4V19X 3AQOA 2JLGA 2AJFE 3JTNA 4MMOA 2GGPB 2WSCC 2UP1A 3MDFA 3H4BA 1I3OB 5GAHU 5BR8J 1S9FA 3T3FA 2PO4A 2E1RA 3BBBA 2VH7A 2C3PA 4DF4A 1U25A 5KFEA 3NGTA 3B78A 4ZDNA 4HT5A 3OV7A 2XMWA 4CO3A 4MKYA 3CCSS 2UUAF 5KFZA 3L9ZA 3QLHB 4JI8J 2BJ3A 3L7UA 3JTOA 3KJQB 3GIIA 1B70B 2YNHB 1Z2LA 2HG4A 1SXLA 5CYMA 4YOEA 1C1BB 1FXLA 4I56A 3I5CA 5FLXU 2MQNA 2H4YB 4OI3A 3GYGA 2B7CB 2ZNZA 4OI4A 4O4GA 1LWFA 2CQHA 3CCVS 4LBPA 5M2PA 1OSDA 2HHUA 2Z2ZA 4YEAA 3RGIA 3MMBB 4B9UA 5B0CA 1SIZA 3IG1B 4RU9A 4UUWA 1VK8A 1UWBA 2UXCF 5A8WB 1RWWB 2KYZA 4CH1A 5L1LA 3ET6B 1SV5B 3K8VA 2HWTA 3BH6B 1Y5IB 2JC0A 1K1SA 1K9MT 2J0QD 1NCLA 2WVCA 3UCGA 1FWPA 1IUJA 4ZJQA 5H9EJ 2PEBA 1YZ7A 2OMLA 1IWAA 1QJHA 4F4YA 5J2QB 4NPOA 1LOUA 3KG0A 4UW2A 3RJMB 4DR3F 1Q8BA 3AXMA 4N47A 3OFHA 2DNGA 5CYQB 1Y10A 4JV0A 2HHHF 2Z2YB 1LXNA 1RBLA 1RXOB 4YUDA 1UW9A 3KFWX 3KWMA 3KLEB 4CLTA 2HHXA 4D3HA 3TVZA 3V6DB 3A1YG 1XQIA 3N6LA 5CHCB 3CSKA 2FY1A 4K2XA 1Q7LB 5B0EA 3KK3B 1UZHA 4WU2A 3HMJG 4KBIA 2DNOA 1YKWA 2OLWA 2CQ4A 2RS2A 4K5RA 1OY6A 2DCLA 3M30A 2E5GA 1BE4A 2DR5A 3OLBA 2EC0A 2VOPA 5F41A 4JV2A 2X1BA 3KXDA 2E44A 3WQPA 2B6AB 1U1OA 4NASA 2AEJA 6FDRA 3NCQA 4DV0F 1TELA 1KSPA 4K5SA 1LW0A 3OXFA 2XGQA 4USVA 2XSFA 1E6VA 3EICA 4CO4A 4GKKJ 1ZAVA 1S4FA 2ZH2A 4F4XA 2HVEA 4I2PA 1UWAA 3JYTB 1NB2A 1WF2A 1HBOB 4PXBA 1VQ6S 2DD8S 4DZ6A 3PYFA 3RBDA 2VG7B 3DLGB 4Y0FA 4DV5F 1HMVB 3ZZTA 4OV1A 1WI8A 3OW2R 5KFNA 2OO4A 3L7PA 1GH8A 1M0SA 4RW7A 3QGGA 4LFBJ 3T9ZA 4KE5A 2IAJA 1I94J 5LL6d 2W2QP 2XZWA 1MU2B 4JI0J 3PW0A 3PJWA 3KK1A 1KLMA 4K50A 4NLQA 3J7ZT 3KMSA 3W2WB 4JI5J 1X4AA 1R0AA 2FZCB 3PACA 2B9XA 2VONA 3MEEB 3Q83A 2E5LF 2XYGB 2YNGA 1RACB 2CPFA 3PNIA 1LK7A 1PYTA 3MM5B 4FS1A 2LQBA 4CM0A 4R5PB 2F65A 3EZOA 1SJRA 1OO0B 4ID8A 3HJFA 2WBMA 2YWHA 5D0GA 2JVOA 3AOCA 4ES3A 2P2CB 3KUGA 1RISA 5HLFB 2VG5B 5A8KB 2BRKA 1MWQA 1Q81T 1R8CA 1H2VZ 3UD5A 3CCTA 2HS3A 3CJKB 1VI7A 3PX4A 3MM9B 2ASDA 2R2RA 3EZUA 4X4RA 1CULB 2QA4S 4A46A 2BJ1A 4RW6B 1EJ7L 3MGJA 5K8OA 4C0HA 4P2XA 3VAMA 4Z37A 2ACYA 4IR9A 1HNWJ 1A6LA 1TV6B 4GC7A 3GFXA 2B8PA 4UF4A 3WBZA 3TARA 2ZH9A 2JLFA 2DNZA 2G1HA 4OYMA 4K4WA 1KQFB 2RE1A 3THPA 2Z58B 4PWUA 3H42A 5ETKA 3AD8C 1MNEA 3MWBA 1GMWD 3KLFA 1RAEB 2HQDA 3IAM9 3QO9B 1FVSA 4WK1A 2VC1A 2GMHA 3MEGB 3D1QA 6FD1A 2CUYA 3RB0A 4I7FA 2MZSA 1ZAWA 1RTIB 4A4JA 3BQ2A 4MIWA 2XMUA 3D6TB 2Y3YA 3IA0A 1LWCA 4RW8A 4NEZA 2HHQA 3OFFA 3OR1B 2OUGA 4DUYJ 4PQUB 4O3RA 1S48A 1R8AA 5E3AA 5HROA 3TWZA 2ZVIA 2CZVC 4CLZA 3DLJA 5AXMA 5HO4A 2IBKA 4DR6F 1GEHA 1JX4A 4AXJA 4H4KC 3W66A 2B3TB 2RSQA 3W61A 1IKWB 4X84A 3KLHA 4M5IA 4NXNF 4F8RA 3NNCA 2CJKA 1X4DA 4OJ1A 1RU1A 5LOQA 4ECWA 3QZ7A 2JEFA 2BX6A 3UNYA 4AL6A 1WC6A 2DIUA 5B0BA 2XB2D 4ILLA 1AYEA 2ZJPQ 5T7LB 1OYDA 1EETA 5F3TA 4KTQA 1RHQB 1T05B 1TUWA 1J2VA 3OQ2A 4LF5J 4NZ6A 3QGIA 5E3CA 3DOKA 2VBWA 4P73A 1RSCA 1WDDA 1KBRA 4RUAA 5A8RA 1KEKA 5KG6A 5EN1A 1MROA 4DEZA 3HSDA 4EYIB 2ZH8A 1HQEB 3H2UB 3VGTA 3D1OA 1HLWA 4ZPCA 4DR4F 1N8RT 2YWFA 3MURP 4TXSA 3CCRS 3AJDA 2R7XA 1RAHB 4CRJA 3DRRB 2XEXA 3MD3A 3PEHA 3TZWA 1U1PA 3NGUA 2GMJA 1TFYA 2KHDA 2N4DA 4MT1A 1ZZNA 2M3DA 2QL9B 5IFMA 2VKZG 2UUBF 5I3QA 4DS4A 3MPVA 2MY8A 3UDVA 4L74A 4UTGA 4YB5A 4RBTA 2R7TA 2B43A 3ZTRA 2WAQD 1OS5A 4CQ1A 2J9DE 5DG8A 4ZIWA 1VRUA 3FFIB 3LP2A 1Y00A 3MCSA 4WE1A 4USHA 5BYSA 1R6VA 3G6VA 3H5XA 1NEEA 1G7CB 3QMQA 4OZJA 2VOOA 1X31C 2W8KA 1S0OA 4ER8A 3OL6A 3RRGA 5C25A 4X4QA 2HFSA 3B6BA 1EX8A 3I0SB 1PJ6A 3QBCA 1N33J 2MKCA 3UN5A 2UVWA 3J7YU 5D6GA 2MGZB 1DURA 3M8RA 3GFHA 3IP0A 3GV7B 4GVBA 1JLGB 2F9JA 1F2GA 1FTRA 1IKVB 2W4CA 4NLVA 3C14A 2W9BA 5DM7Q 3CDEA 2K1RB 1U2RA 1N32F 1WHYA 2F8MA 3NCPA 3LP0A 1ZAXA 5IC4B 2LECA 4LR7A 3GCWP 4WJBA 2IVFB 4OLPA 2DXFA 3AA8A 1V5VA 3Q8SB 1BGXT 1RZMA 1S1WB 4B08A 1WC0A 1S10A 4EZ9A 1SJQA 2IC3B 2P9CA 1H72C 3C6TB 5KG0A 1IBMJ 1HNVB 1U7LA 3AB4B 1Z1ZA 2Q3PA 4CIOA 4ECVA 3DKDA 2F1FA 4K4XA 4ZVGA 4UOHA 2RU3A 2WTFA 2KYXA 1VS3A 3PKYA 1VQNS 1KHVA 1Q5VA 4CZCA 2M5YA 4C3LA 1F9HA 4IOCQ 3RBXA 3F56A 2HMIB 1S0VA 1SBRA 2VA2A 3IWNC 3SCLE 1T7PA 1IJEB 4PG8A 5KT3A 4OHWA 4M1KA 1UJ5A 5DRKA 3C6UB 2EWHA 3ZC4A 3HVTB 2VQFF 3NMAA 5IOLA 5T14A 4G1QB 1FJGF 1NJYA 2KJVA 4ZPTR 4OJGA 2EK6A 2W4PA 3CJ4A 4DPXA 5T41A 1BUXA 4ZLLA 1HWKA 2H9ZA 2K06A 4LF6J 4ZVSB 3H7HB 2IDEA 1KD1T 4RO0A 2BE7D 4L3KA 1TTHB 1YVFA 4MYUA 5CQGA 2ZITA 5KFXA 3TP2A 1K0VA 3DN9A 4DN0A 3M1VB 4FP9A 2V6AA 5KFMA 3RG6A 1UVLA 2FGCA 3TW0A 1W7WA 2ZFHA 3H98A 3MMAB 4W4MA 2HZAA 1HBMA 2GIQA 1RE1B 2BUNA 2Q66A 3QLHA 2VFTA 3BEGB 4WFYA 4PUOB 1H2UX 2Y1LB 1LFWA 4JI4F 5H1SV 5AT1B 1SC1B 1NPKA 1WKKA 4PZVA 5AJ3J 4NLYA 5J1PA 1BXNA 2OSQA 2WB1D 3RB6A 1DQ8A 3ZTOA 3D67A 2QV6A 3K2YA 4LFCJ 2HWIA 1T95A 3U02A 2DHSA 1HPZA 2EPIA 4LR9A 4N7TA 5FDLB 4RNMA 3DLKB 3TVYA 2UXBJ 1RQ0A 5A8WA 4TKTA 4C9DA 3ET6A 1SV5A 5IT0A 1A0OB 4ZCKA 5H9FK 1TQLA 2YY3A 4DR7J 1RTJA 1X9MA 4K7QA 3CEDA 3MI7X 3S6EA 4PAAA 2N3OA 3EWGA 4JV1A 5LSRA 2DNLA 3KTQA 4QZVB 3FJ2A 3CJRA 5CYQA 2WB4A 3W63A 1NU4A 2DK2A 4KHPF 4PXDA 3CCJS 3ILIA 4RBUA 2PA8D 1JJ4A 2M88A 4Q5VA 3T5JA 3MTJA 2XSJB 3LGHA 4HACB 3PCOB 2W1BA 4BCAA 3ETOA 3W5ZA 2A1BA 2VPZB 2RDIA 3N5BA 1F0XA 2BRLA 1S1VB 1HFEL 3A8IA 5H9FJ 2COLA 3EGNA 4HLBA 4JV5J 5I3UA 2DY9A 4PPDA 2MQOA 4C2MA 2J0WA 4X65F 4OLOA 2G2YA 2KM8C 3ENAA 4WYLA 3TUJC 4F2RA 1AT1B 3AFGA 2Z56B 1RWUA 2R8KA 1U2CA 2ZHOA 4DX7A 4BDPA 1RTHA 2R9LA 4CLKA 3BB5A 4QW9A 2UZAA 2DHAA 1SVDA 2K3KA 3P49B 4D3GA 3PYGA 4LRDA 3FMWA 3S1TA 1MWZA 4ZCMA 5C24B 2B0GA 2N82B 2HS0A 1SUQB 2VDHA 2EXUA 2EKYA 3JYTA 3MAHA 3PIOQ 1HBOA 2B9WA 4J9VA 3FQKA 4LF4J 1CS4B 2VG7A 4Q45A 3TZXA 1HMVA 1TU0B 4CH7A 4DV1J 3VGSA 1SI9A 2K2PA 2FC8A 3M6VA 3RAXA 3BYPA 1KVIA 1O0PA 1HA1A 5HJXA 4ED4A 1KWMA 2FQQB 1WC3A 1PAEX 3SV4A 5DQHA 1RDRA 2PI5A 4LSNB 1MU2A 4M5DB 1JLBA 5ETMA 1Y5LB 1UFLA 4B3MF 4MK7A 4C98A 2EFQA 1GX6A 3RAMA 3G6YA 2LU2A 3UR0A 4DZDA 2CFXA 2LQ9A 1QDUB 4QU6A 2HAIA 2VFUA 1O5JA 3MEEA 4DV3F 1FRJA 3NNHA 3UN2A 3HKZD 4P2FA 3MM5A 3TZZA 4CLLA 4OI6A 2NXEA 1KKHA 4R5PA 2PEHA 1F5BA 2RAQA 3NBPB 5E5NA 3SBMA 2V68A 2FD2A 2EC2A 7FDRA 4K4ZA 1HQ2A 1JJHA 4NI2A 2I38A 3R3TA 3MOJB 5KFLA 1RWXB 3VGVA 3DU5A 1UETA 5HLFA 1WEXA 3DGPB 1S9GB 1G6BA 3TVKA 3ZTSA 2RQCA 1X4CA 2NPIA 2Z2MA 3CJKA 4WWSA 4QIVA 3TA2A 3QZ8A 3MM8B 2RS8A 1RHKB 2Y9HA 1CULA 3MTKA 4RW6A 3HHEA 3DRPB 1WEYA 3R5AA 1YX2A 1X5OA 3LH2S 5GVQA 4QCLA 2C2OB 4EO6A 4BS2A 3ZZZA 1TFWA 4JI3J 3M8PB 3MR3A 1RTZA 3A8KA 2IBOA 3R27A 1TV6A 2OSRA 3NMRA 4HT7A 4MIBA 1IWGA 5EX0A 3MAQA 3QATA 2HGLA 2OMOA 3I32A 3C8YA 3VAJA 2QTWA 4DV7J 5GMKa 1WC4A 2LEPA 2H51B 2ZDOA 4RUHA 4M5MA 5HP1A 5C7PA 5HBMB 1TKTB 2AZ1A 2AJQA 3QO9A 3MF5A 1GK8A 1R43A 1T02A 3MEGA 2AYGA 4NLWA 3CIZA 1R89A 1RTIA 1B0VA 3MCNA 3A3NB 1APSA 5A2QU 3OR1A 2WVDA 1U47A 2UUAJ 4PQUA 4DR2F 1N5TA 1L3SA 2NXUA 2ZH5A 2BE2B 1F2HA 2XZDB 1U49A 2M8HA 4V19J 1FK9B 4ZHRA 2LXUA 4AD6A 3JSMB 1BQMB 4NLRA 3RB3A 5KFQA 1IKWA 1VIXA 2X1FA 4USJC 4LQ3A 1TL7A 2QE5A 3MMCB 4LRFA 2HVZA 4FBUA 2UXCJ 2YQ3A 1N54B 2BOPA 2AMCB 4KR0B 5T7LA 4ECSA 2HK2A 2MKKA 1B0TA 2JWNA 2CPEA 4R0EA 2OD6A 5AXNA 2H65B 4YHHJ 4IG0B 2G13A 4B9TA 4DR3J 1ZTWA 2VASA 2CNLB 1S77D 1HQEA 3NGDA 1KNZA 2DGTA 4HEA9 2HHHJ 4CT8A 5IQQA 2EFGA 2BANB 4XPCA 3DRRA 4J9QA 2O01C 1UEKA 4B02A 3G82B 3DOMB 1LFPA 1P1TA 1HD0A 3PHEA 2YKMB 1YG0A 1RT4A 4LJMA 3OVSA 4USIA 5K8PA 2CNKB 3OFGA 1YIJS 1FNOA 2ZOMA 2R2UA 2QA1A 3PX0A 3TAPA 1DQAA 4KB7A 5E33A 4I0WA 4RBVA 3FFIA 5C2GA 5CD4H 4R25A 4DV0J 4PABA 1L3KA 4FKXA 4ZCIA 3SMZA 2FGOA 4DXLA 2M2BA 4QIGA 2K3IA 2EVZA 3CT9A 5KFJA 4O44B 1RT5B 1M5KC 4KH0B 1PILA 3I0SA 3TA1A 1WF0A 1SJ4P 4ICLA 1H74A 1XBWA 1F3VA 2M70A 1FF2A 2MGZA 1ZM3A 3J7Z5 2VJUA 4DV5J 1SH3A 3UCZP 4I1TA 4WIIA 2XLJA 4QPXA 4H4MB 5D4PA 2XC9A 1T8EA 3CD6S 3L95X 3DMJB 2W25A 4HL9A 1K1QA 5IQ6A 3PG9A 4QBUA 4HI1A 2IMOA 3K57A 4TY9A 4FF3A 2B7BB 5CA5A 4M8LA 2AJ2A 3JQMA 3UE2A 2OPRB 3PJ9A 1NJXA 4IRDA 3CJ8A 3C6TA 3FQLA 1HNVA 2E5LJ 3H8YA 1M1KT 3EM1A 3N6MA 3DGVA 4OHVA 1NSAA 3HKWA 3W3SA 1NM2A 4PWWA 2PDAA 3SSRA 1IVZA 2ASJA 1TR0A 1KC8T 2AZ3A 2BMBA 1S4EA 2XZTB 2XMMA 1AA1B 2RIJA 2J6SA 2P8IA 2IJRA 5KFPA 3BYRA 3ENWA 1REGX 1KHWA 3AD9C 3HVTA 2FVQA 2A2DA 1T3NA 5IT9U 3NS6A 5G4DA 3M9MB 4I68A 4G1QA 2QN6B 2W2NP 1TUVA 3ITHB 3Q24A 2V4QA 2Y1JA 5DQGA 4RUBA 1XJWB 2YKPA 3SCKE 1NK5A 2AYMA 3T6JA 5DDRC 3DLHA 2JH3A 4WFAQ 1DY3A 2ROGA 3ZZYA 3ISND 2EKNA 3QGPA 5HAOA 2Y0SD 4ANDA 1B7YB 4A8SA 4LT6A 4OHZA 1J5OB 3V4IB 2FC9A 1OSCA 5C42B 1OPZA 1UTAA 2W7AA 4K59A 3VWSA 5IXUA 2FPHX 2RQ4A 4PUOA 4ED5A 1N5VA 1HHSA 2OEMA 2W24A 2MKIA 2HFNA 4A8QA 2YX1A 4TY8B 1VQMS 3SI8A 4O3QA 2KJWA 2ZH4A 4CO1A 2HURA 5F9LA 2MZRA 1TK5A 3HO1A 1UA1A 1LW2A 2HQGA 1NZ8A 4NYPA 4QU7A 2DYAA 1YWXA 2J7UA 4EUVA 2PMHA 1ZETA 1G2EA 3FSYA 2EBGA 2FLLA 4DR6J 1QAYA 3C15B 3BGLA 2E66A 3VV2B 3U1NA 2RRNA 3Q86A 2IFXA 4NXNJ 3MUMP 3EJMA 4FXWA 2DY1A 2NREA 4OX8A 1SL1A 1FJ7A 2BQUA 4DLEA 3HHNB 4M95A 3M8ZA 3IBFB 3CDWA 4FYXB 1WHVA 5ITHA 4YR2A 2QLFB 1S0MA 1QD1A 2JC1A 1FKOB 2OHDA 3K89A 1HBNB 2V0NA 2XSJA 4HACA 1PKUA 2MQPA 2XTJP 2BEFA 2OJ3A 1UW4A 2U1AA 1T03A 5LM7E 5CD4A 2DIVA 3N9UC 3M8WA 3CDAA 3KHGA 4DR4J 3M6XA 5KG4A 2B9EA 4E0DA 3GTYX 3C3LA 4TYAA 1ZPWX 1FWKA 3QIPB 4WXOA 4M5HA 1D0EA 3E01B 3Q8VA 4ED8A 1B0PA 2GCFA 1S76D 3DC2A 4I6AA 1WWHA 3CDBA 5C24A 1TKXA 4NA1A 4P10A 3J7YI 1SUQA 2MTLA 3CTRA 1M5PC 1H7WA 1EQ0A 1UAWA 1VBZA 1U1MA 1P9YA 1CS4A 1WUUA 2GQ2A 1YJNS 1GQEA 4DUYF 2G2ZA 4QIFA 1BC6A 9ATCB 1VHIA 4MTPA 2AGQA 2BE9B 3UCUP 1S9EA 1R8BA 1RK8A 4F0MA 5HSPA 2RQMA 3K5PA 2IVMA 5DJBA 4MJKA 4QQBA 1TMJA 1OIAA 1SL0A 4KH1B 4ZVFA 4LSNA 4M5DA 1RADB 4JI2F 1FO1A 1JLEB 3IMQJ 4LF8F 4OZ3A 4OYZA 4DR1F 3HM9A 3E51A 3MMJA 3UPFA 2NYHA 2ZE2B 1N32J 4IH5A 2ALZA 2E9TA 2CQPA 4P6QA 2LEAA 3DM2B 2A0FB 3HHLD 2Q79A 1XC9A 5HI7A 4QPTA 3U27A 4N56A 1NHUA 2W9CB 1FXDA 5GAEU 3P5BP 1CC7A 2BA9A 3NBPA 1YGYA 4GO5X 2V2KA 4C7QA 4J9SA 1VLYA 3QFWA 4G1PA 1DTQB 2AW0A 4PG7A 3JTPA 1LWEB 2X51A 4N8NA 2QEXS 2R2SA 5C5JA 1VISA 3DGPA 3OSPA 1NRKA 2Z4PA 3ADAC 3M32B 1X4FA 1JLCB 4FF4A 2G4BA 4X4OA 3MM8A 2O67A 3PW7A 3CO0P 4B3OA 4C8ZA 4HVZA 4ZK7M 1CC8A 1GXTA 4J9RA 2YNIA 5HL7Q 2GV1A 2CXEA 3M8PA 2VQFJ 2YWKA 4M63A 4C0BA 4LF7J 1FJGJ 3I5AA 2FZKB 1L3TA 2Q43A 3SXLA 3LP1A 3BZQA 2HS4A 2B4PA 4CTAB 1B99A 5J1EA 4ANCA 4ZP6A 2GZOA 4ETZA 3CJ2A 3ULHA 3U1LA 1S59A 4LQ9A 5HBMA 1TKTA 3DRXA 4NYZA 4J9OA 2ZH6A 2AX1A 2HBYB 1XMQF 2YVSA 1RB0A 2KXNB 4Y34A 1R7IA 1UPPA 4DPUA 3VCDA 4RX6A 4AXIA 1HYSB 2X1GA 2O1PA 3VR1A 2HRUA 4HR2A 4DF8A 1YK9A 4F02A 4YS2A 1NAQA 2H5EA 5B0DA 1RLCL 2AT1B 4IO1A 1FDDA 3JSYA 1RA6A 4JI4J 2L08A 5A76A 2E7XA 1FK9A 3W9HA 3WZ0A 2ZWPA 3V6KA 2QLXA 4KV8A 4DSIA 2NLWA 1BQMA 1U8SA 1C0UB 3DI6A 3G4SS 3FZBA 1IBKF 2LXIA 1NK7A 3UQSA 1KOOA 3FSIA 2WSFC 1S7HA 2JDJA 3DRYA 3MMCA 2MQ8A 2WCXA 3FCWA 1BHNA 2HHWA 4OI2A 2WVFA 1IM4A 3GE9A 4J9KA 1T9XA 1UEVA 5A6WA 2V8DA 2LVWA 4KY3A 4OYAA 3F41A 3MEKA 4RJVA 3HXMA 2ZKUA 5GMEA 1IBLF 4IG0A 1X4BA 3CJ0A 3S7RA 9RUBA 3TUPA 3HD2A 1UKUA 3R5CA 2BQRA 3OJUA 3D68A 5L1IA 2DR8A 4Y2IA 4KHPJ 4M5LA 1WC5A 1XWLA 1X4GA 3MM7A 5GAGI 2BANA 3FNNA 3OUYB 3R2CJ 5K5MA 3DDNA 1HI0P 3EGVA 3G82A 3I5BA 1XNRF 1F3FA 3GP9A 3DOMA 1B7FA 1XEZA 2W2PP 3IGNA 3TEGA 1R3NA 4WZMA 4WP8A 3GJTB 1NDLA 1LKZA 4TQSA 3RU0A 5L38A 3DU6A 5DZ7A 3R9LA 2XY7A 1AUDA 3CCQS 1KTVA 4X65J 2RT3A 1UVMA 1Y9OA 3RBZA 5ETSA 2CDQA 2RMLA 1HHQA 4KPCA 4B17A 1L3VA 2XM3A 3GFZA 5ETQA 1O6XA 1F9EB 5KT4A 4O44A 1RT5A 1XR6A 4IDKB 1JK9B 1Y0HA 2ZUAA 1ITPA 2HHSA 2Y1IA 3QRPA 4A8OA 1MN9A 4KRWA 1RKJA 1VBXA 1HARA 3CWJA 3R2DJ 4W90B 2QYCA 1A9NB 2NXJA 5M2RA 4Q8FA 1VRTB 3IS9B 2E5IA 3IR7B 1FWLA 1TL1B 4H4MA 3RUBL 4ECUA 2FJAB 1KONA 2PE8A 2F4FA 1PJ5A 4J91A 3R7NB 5K8MA 4ZPDA 1CJVB 1XMOF 4ZPVR 3DYAB 4OZ1A 3LALA 3M6UA 4WFBQ 5EGYA 5MAOA 1RAAB 4GRSA 5K8NA 2R7UA 4B3MJ 3H5SA 2RRBA 4XTTA 2POKA 4ED7A 3D66A 4X4UA 3PRDA 2OPRA 2CRLA 4M5GA 5KT5A 3LF0A 1OPIA 4CDIA 1SC3B 2GQQA 1S0NA 4DV3J 4J7CA 4OHYA 3OTBA 1NXIA 3M05A 3IWXA 3IRWP 4XDDA 2U2FA 2DKOB 4TNOA 4R8UB 4OZ5A 4W98A 3F73A 5JVGQ 2RDDA 3IO1A 4LIRA 5J2MB 2G0JA 1ZM2A 2PMZD 5DM6Q 4A8MP 5ETLA 1ZA1B 1FEHA 3OTOF 3AOBA 2D9OA 1TP7A 1OY8A 1E6YA 1IQTA 3K17A 3HX9A 1QTNB 3RZAA 1H98A 3OL7A 2C2RA 4CWBA 1A7GE 3CPWR 1VR6A 1YSJA 3I6PA 2CJ9A 5GADI 4YN3B 3EUNA 2AV5A 1RYRA 1HR0J 1LK5A 4IH7A 4C11B 4ZIVA 4I64A 3DDKA 4Q8EA 1R8HA 3OLAA 4EYHB 2IY5B 3MR7A 3R6GB 2R7WA 3O8WA 2DTJA 4M5KA 3PW5A 1RHUB 1U26A 4QOTA 2JEIA 2QLWA 1YJVA 4J37A 1Q82T 3IRXB 4DFKA 1HW9A 3LPYA 2DH8A 1W2IA 3BDEA 2XI3A 3SFGA 1J5OA 3V4IA 1VLOA 4QYZJ 1UVIA 5C42A 3B82A 4WU3A 1CBKA 4BC9A 4XK8C 2JEGA 4DX6A 3HI9A 2NR0A 1U6FA 2MEWA 1VC0A 3S8SA 4ANEA 1U1LA 4NLXA 4MIAA 3BGOP 1S12A 3VALA 3AB2B 3PXGa 1FEEA 2WVEA 1EKRA 2F4VF 4F3QA 3Q0AA 4TY8A 2RNEA 2GIFA 1N5YB 4AL5A 3GV5B 2E7WA 4YFUA 3AJ1A 1X60A 4CI0B 1N34F 2QRRA 1QE1B 2KKHA 2UV8A 2X1AA 3Q2SC 2B4VA 1KVKA 3UVJB 3HJVA 3CC7S 1QSSA 4DR2J 4ED3A 4WTOB 2W7OA 4FKYA 1Q53A 2DNRA 1PBAA 1RBOB 3G2XA 3CCZA 1U4BA 2XMKA 1P6TA 1PG5B 4IFVA 2VG6B 4OX7A 3A8JA 1Q16B 3EGWB 4FYYB 1RI7A 2EI5A 1C1CB 2ZBCA 3BBCA 3VAHA 1CPZA 4JOUA 1RWKB 3M8QB 1K8AT 4JI6F 3DOLB 1HNXF 1RBAA 2BOAA 2VB6A 3FCVA 3IBWA 3R1HA 2HHPA 1EKSA 2GAGC 4A8WA 1VHFA 3IWLA 4CO5A 2FJVA 3NCRA 2CPJA 4WFZA 5HMYA 4DQRA 2FYXA 1FKOA 1S49A 2CQGA 1HBNA 1FKPB 3CJTA 5KFBA 2D3O1 2EFPA 2G1DA 2KZZA 3IAS9 4B9SA 1VK3A 3BBFA 4WCEQ 1WD6A 4ZP8A 4YB1P 2MKHA 2CPZA 3H5UA 1J5EF 3R5BA 2UUTA 3BM7A 1WC1A 1L3UA 2VF3A 2FLPA 1HWLA 3UD4P 1X8DA 4WP9A 4AL7A 3EE3A 2AGOA 4Y65A 3HVWA 5IT4A 2QMWA 3PX6A 4Q7AA 4YQWA 4LFAF 4FYVB 3X3UA 1N56A 2ROEA 3CCUS 2ATCB 2XY5A 2UUCF 3E01A 2HBZB 4UOCA 3GJRB 5A2QY 2M7SA 4YB7A 3NP5A 1SIWB 1D9FA 1RAIB 2J76E 3LW5C 4DL3A 1X4HA 2EFNA 5K20B 2VA3A 4DPOA 2LP4A 4YY3F 1RAOA 2CPIA 1F6TA 2QLJB 4NCGA 4BLGA 5DLGA 5CYJA 3NY0A 1HWJA 3M9NB 5IV4A 2VV5A 5IC6B 4ZITA 2FZGB 4WYWA 4I4BA 2AF6A 2R2TA 2ATLA 2C3YA 2CJAA 1S72S 5FJ4A 1G1XA 1S99A 2FB0A 3MPYA 4CP5A 2ZH1A 5F8HA 5DGAA 1FRHA 1R27B 3Q23A 1WEZA 1JLQB 5D77A 2KM8B 1IKYB 3K0JA 1HKAA 2V4JB 1N5QA 3VZHA 1JNRB 4C8YA 2UVUA 2ZE2A 1T9WA 3MPWA 2P5VA 2HAFA 3KDOA 4CNYA 2E7VA 3FEXB 2HNYB 3DM2A 4UQGA 2YNFB 2I2YA 4Z7YA 4ZCLA 3VGUA 5E41A 4IFYB 2XO7A 2ZBRA 4YHHF 2RUSA 2GMLA 1RTDB 1PC4A 1S1XA 1S57A 2KI2A 3PTWA 1LWEA 2AWZA 3ILOA 1YRXA 5G0RA 2J6TA 1GAOA 1VQ5S 2CIMA 4HH1A 1JLCA 2MHNA 3KG1A 4Y6IA 4MK8A 4P2MA 1HL6A 2YXLA 2JFDA 4Z2XA 2KFZA 4F4KA 4F3MA 3KYLA 5MLCV 1CJUB 4NMXA 3BR8A 2X3GA 3PVXA 4IUFA 1RWPB 3TX8A 4YDDB 3CW2C 2LA4A 2RHSB 2BJ9A 1W25A 2C22A 3KK2B 2Y1RI 4PKDB 2HEKA 1YRTA 1T3OA 2BQ3A 2PFFB 3D9BA 1SL2A 3M2RA 4Z7CA 4ZVTB 4LVNP 3GJSB 4JBCA 2OEKA 4DU8A 4NRTA 3IGVA 2HRYA 1DBDA 1MMDA 1X4EA 4DL2A 2E5HA 3KG4A 4WF9Q 2XS5A 2MDAA 3LANA 3ZXWA 3VVTA 2XHWA 2Q6CA 2DB1A 1HD1A 3LO3A 1HYSA 3THVA 1UA0A 4KQZA 3TA0A 4A8FA 3ILJA 4TLQA 3M4XA 1NK4A 1FA0A 2R42A 2BJ7A 1QVFR 4OZNA 1FD2A 4KYZA 2FUG9 3OVBA 1V5IB 3GYNA 4ZS6A 1YRUA 5IM0B 4B9NA 3BJYA 4K4YA 1VFJA 3BN4A 3ZO7A 4ZPAA 3CD5A 1WTBA 4Y2AA 2C2ZB 1JLFB 1C0UA 3LPEA 1NSPA 2CWXA 1LWFB 2QMUB 3Q8RB 3MZIA 1SKSA 2ZBIA 4MH8A 1RAGB 4ECYA 3GB0A 4OHXA 4U96A 2F40A 5JXSA 2F8EX 1SC4B 1YHQS 3TAMB 2FVSA 2KXFA 1M90T 2E5JA 3MHYA 3CB4A 3R5JB 1C2PA 5IT9Y 1NJWA 4PPZA 2G0CA 1S1UA 3UDCA 5KFCA 4UOFA 3ZTPA 3PKMA 4B9LA 1WSVA 4N5SA 2F8HA 3N28A 2LQJA 1EP4B 2PIIA 5D4OA 2CQ0A 2F9DA 5J2NB 2ASLA 4OYWA 3BQ0A 2CQ3A 3IR5B 4NLOA 1ZS6A 2FIUA 3H2VE 2QSFA 3EPGA 1OMSA 4PG4A 1IKXB 1M5VC 2E1PA 1KLNA 3DDIA 3H59A 1FNMA 1RUSA 5LXRA 2H5JB 3C46A 3PRVA 1U0SA 2L48A 3G8TA 4PG6A 2OKQA 4ETXA 3K5OA 3GR1A 4OMFG 3IFEA 4L3NA 1VJWA 2DGVA 2L9DA 1DTTB 4KFBB 1P1LA 2YWWA 4RW9A 2OPPA 4IDKA 1KN6A 3C66A 4ZPWR 3DXBA 4Y00A 3EXCX 2DEIA 1XNQF 1YTYA 2N7YA 1Y3KA 3I96A 4NXMF 4BBYA 4FZVA 1FT8A 4RLEA 5BJRA 4DG1B 1TKDA 1XN9A 3LTOA 1VRTA 4LRAA 1TL1A 2CJBA 4DL6A 2UVVA 3SSQA 1YBUA 3CCMS 3TZYA 1X7VA 1TKZB 2R7OA 5GAEI 2DHHA 1N4LA 3DYAA 2J6UA 1K44A 4JI2J 2XQCA 4LF8J 1X9SA 5KG5A 5FD1A 2QJ3A 3OSNA 4DR1J 1TUGB 5IV3A 1VQYA 3A3PB 4ILRA 2V8GA 1FFWB 5CAAA 2IA6A 3CC4S 5AE3A 4E98A 2V50A 4ZVPB 2KVIA 4EU0A 2AYEA 2BV3A 2YNGB 2V67A 1VQ8S 1JJ2R 4B3RF 1U1RA 1SQEA 2CDRB 4R8UA 4IOBA 2DO0A 3FMBA 3EPIA 2OIHA 1OY9A 1JQGA 2HQ3A 3TJ9A 5F8MA 5KFWA 5L39A 4FN5A 1PO6A 2AIRB 2R7VA 3D0GE 5HVGA 3WX4A 5CZXA 5KOWA 1JXEA 3MCMA 2PFDA 4IQXA 2OPQB 4KGMA 5D15A 1XK8A 1EIYB 4FS2A 5HATA 1KOHA 3US5A 1X0FA 2DGOA 3QYYA 3SCJE 4URGA 2GHPA 4C11A 2BACA 4ATNA 3J81U 3E2EA 4RNHA 1RT3B 1FNXH 2IA0A 2V34A 1C0TA 2PD1A 1MWYA 4LSLB 3UFCX 3SDEB 1H73A 3M2VB 3FBBA 3KUEA 4X4SA 2YX4A 2CQBA 3TAQA 3IRXA 4Q2MA 2EFOA 5E0OA 3QRRA 3TRGA 3HLUA 1SKRA 5CCMA 1DAXA 4DPTA 2XO6A 4J9LA 2D3ZA 5JJBA 3B54A 4AYBD 3G9CA 1UVNA 1LQ9A 1U0HB 3T1AA 1P8GA 4EBDA 1Q5YA 5L46A 4O23A 4LIWA 4I67A 4ZKAA 1XMQJ 3DFEA 2NZ4A 2FJEB 4DX8H 3V81B 1VBKA 3DLBA 4TN2A 3EGZA 5DGBA 1N5YA 5DQIA 1NJZA 3CULA 1D09B 4F2SA 1QE1A 1D1UA 3UVJA 2ILYA 5IS2A 3O1LA 3GCXP 3GIMA 3DCAA 4RNFA 4X66F 1OWXA 4C0OC 5HK4A 3FC9A 1HQUB 4U9RA 2F5GA 3HHDA 3WC0A 1EAYC 3QSIA 2VG6A 2HQIA 2ZBQA 2ZOGA 2ZHAA 3BO2A 3IM9A 4P52A 4UOGA 3BGUA 5KFUA 2IRUA 3BSOA 3HPOA 1C1CA 1YJUA 4DX5A 2E29A 4OYPA 1IBKJ 1UFKA 3M8QA 2HNDB 3PR5B 2ZM6F 1VJQA 3DOLA 2VJVA 3C16B 1S6QA 1JLAB 4HI2A 3LA0A 1XIQA 3TO8A 2C1EB 3GU0A 2G2OA 3KMQA 3AJ2A 3VVUA 1DRZA 1EQMA 2ZHBA 4KO0B 3CMAS 2HLUA 1VQOS 4DMZA 3R6LB 3W65A 3W8PA 1FKPA 1EETB 2BM1A 4ED2A 4J9MA 3KLGB 2DNPA 3ZZOA 1SH2A 1Q8LA 1MSWD 3G96A 3P4UB 2LKZA 1IBLJ 3BQ1A 2B5JA 1FRMA 4ED6A 2ADCA 1MMLA 5A8RB 2I8EA 5JUMA 4LF7F 1T94A 5F3ZA 2PSZA 4GVLA 4USUA 1XNRJ 1HIYA 1RHJB 2HIYA 1C4AA 1WOOA 1FJEB 2MXYA 1LWXA 4N76A 3AODA 2MYFA 2ACMA 2GGPA 1IN0A 4WIQA 4U67Q 1VIOA 3MM6B 3Q22A 3CJ5A 1T9YA 1U45A 2OH2A 2RU9A 3MECB 3LP2B 2M9KA 3PYDA 2BJDA 1ZA2B 2FJXA 4N77A 5SZTA 2RQKA 3GIRA 2I5JB 1RYSA 1FFSB 2RH3A 2HQFA 4ECTA 2YNHA 4OYOA 4EBEA 2KFNA 4X4NA 2FLNA 1C1BA 4F4ZA 2GVZB 5A6PA 3CC2S 2V69A 3K5MA 5E2QA 5D4NA 1NPRA 2YBVA 1Z2ZA 2V2VA 5KT6A 4DFPA 1JLQA 2XY6A 3MMBA 4MKVA 5DS7A 4EO8A 1IJFB 4K8RA 2WSEC 3IG1A 4WZQA 3N6NA 2XS7A 4OZ0A 1FERA 2W9BB 4B9VA 2IM2A 4PG5A 3D7SB 4TU8A 4Q0BB 3VQTA 1TAUA 5F8GA 1TL3B 4OYBA 2PC6A 1XMOJ 2HNYA 2AQ4A 3NGSA 2OELA 3LP0B 5ETVA 1W2BR 1FDAA 1RT7B 1AW0A 2YNFA 5HN0A 3FCHA 4U7CA 2W01A 3OXGA 2J5AA 1GMWA 5J2QA 4CM2A 1RTDA 4DQSA 4GMKA 4QWBA 2ZC3A 1WI6A 4I69A 3N5FA 2BABA 4QIEA 1FESA 4LSZB 3FGVA 3KLEA 1FKAF 5DDPC 2HGNA 4ELUA 4L73A 4LF9F 1SJ3P 3TJ8A 3MUTP 3V6DA 3LAKA 3SQGB 3EVMA 5F8NA 4ID5B 3KK3A 3G86A 2FJDB 5KTQA 2GQCA 2BW7A 3OTOJ 3N01A 4DUZF 2CWKA 2IDLA 1WSRA 3AQPA 1IM6A 3KK2A 1IBCB 4IRCA 1WG5A 2ZD1B 4ZOSA 2B6AA 2DXEA 4I6YA 5KT7A 3OBIA 1NDPA 1JWWA 1ELOA 4O3OA 5L1KA 4ZVUB 4OZ2A 3NGRA 2J7WA 2AP6A 3KOAA 5EWEA 1NH8A 1DZ5A 2HHTA 1NK0A 1TK0A 2HGMA 2DR6A 4NCBA 1GXLA 1NKBA 2CQIA 1WHWA 2W9AA 4CH0S 5ETOA 3DLGA 4ZN1A 2ZJQQ 2YWEA 4RWXA 2Y8WA 4G6VB 4JUZA 4AQYF 4DPWA 2KG0A 4JYAF 3G87A 1YJ9S 4WP3A 2V2QA 4FF2A 1V3ZA 2VBXA 2V94A 2V63A 4DJBA 5H9EK 1NSQA 1HBMB 3R1LA 3TUIC 5IM0A 4OX9F 1NZAA 4HH0A 2CJYB 3MR6A 5B0AA 2F4VJ 1MW7A 3D6MB 3Q8UA 1U8WA 3O5TB 4P71A 1JLFA 1S97A 1N34J 1NK6A 1K0TA 3W2WA 3K59A 3VAIA 4X4VA 2DRBA 1SC6A 1Q8KA 1HPZB 1V6HA 2CKWA 4HDGA 2VHGA 2BR0A 3BREA 4A8XA 1F5AA 3TAMA 3GJQB 2MJNA 3R5GA 2O3DA 3LQVA 1VC6A 4O3SA 4H4OB 4N8OA 1M5OC 4DCOB 1RTJB 2V8PA 4L76A 2XWXA 2E1AA 3KHLA 2C28A 1ZPVA 2RJZA 1ACMB 3DXSX 2QIFA 4O0NA 4JI6J 3VQSA 1HNXJ 5CH7B 4ES1A 2HW3A 2J7KA 2VG5A 5A8KA 2NYIA 1EP4A 5AE1A 3MM9A 4ZA1A 4R0JA 3I9ZA 2MZTA 1TZ0A 4FPIA 2CPDA 1SKWA 1KTQA 2WOMB 1U1NA 5J2NA 1KQSR 4RL1A 3CF5Q 5J1NA 2VFVA 2R3VA 4F7VA 1HR0F 5ETTA 3LAMA 3H20A 3TQEA 1PJ7A 4LBIA 2BJEA 2J8SA 2DH7A 4IYQA 4QWDA 1UVJA 5GAHI 1J5EJ 4WBFA 3V6HA 1IKXA 3EDQB 4DHVA 3AT1B 4FPRA 2UXDF 3J7A1 4EK2A 2FVCA 3H25A 3BGRB 2MLXA 2FTRA 2RF2B 2D41A 1CJTB 5I3UB 4ECRA 3HK2A 5CZVA 4LFAJ 3T5KA 4U95A 2UUCJ 1JNZB 2SXLA 1RTHB 3DHWC 3VAKA 4NA3A 4LUBA 1ZM4A 1TL4A 2MHEA 2YH0A 4YP3A 2E1CA 4AUKA 3B4MA 1DTTA 4KFBA 2Y8YA 1RHRB 3HT0A 4NX9A 3P96A 3D3CJ 4YY3J 2HBQB 3DHXA 1NDKA 4IQMA 4F0KA 2GS8A 4Y3CA 4C8NA 2IM0A 3W60A 1RABB 4IKAA 1F5CA 3KLIB 2CQ1A 5BYRA 4DG1A 1U48A 3UD3P 2QGFB 3DRSB 3K5LA 3T1HF 1S5ZA 5L1JA 3I0RB 2BZ2A 2D7SA 5JMNA 1TKZA 1S7IA 4U8YA 3TANA 3GZ7A 1UMJA 4F4AA 2JL9A 1JLBB 2LA6A 2KO1A 3PRBA 4F04B 4DL0C 1G4CA 4G1IA 3BO3A 5D3GB 1QVGR 1T05A 2HVDA 3IN5A 2FJBB 4O3PA 2IYGA 1N52B 4QWCA 4OI0A 3KUHA 2QLBB 2IHR1 2XULA 3QPIA 1D9DA 1PBUA 4G3IA 2DO4A 4DV6F 3NGKA 1FFGB 3HULA 3CGIA 3TX0A 3P3DA 4NI2B 2LMIA 2V4RA 2IVYA 3OHBA 2XBPA 4A47A 3QNWB 2OPQA 4PYAA 3CMES 4F3OA 4KHRA 2VBYA 5EUHA 5KFFA 4EGLA 4PR6A 4DUTA 1VRQC 4PCQA 4DSEA 4ZP7A 3JAMU 4J90A 1RGVA 4Y2MA 2DR7A 4KAIA 4DN9A 3BKUA 4NRUA 3KNAA 1RT3A 3BN7A 4C3MA 2GC8A 4XO0A 4ZVEA 1KQKA 1WDTA 2ZZMA 3BS9A 1JKHB 4LSLA 3T9NA 1HNZF 2VODA 3SDEA 1RU2A 2DT9A 3FRYA 3M2VA 3UDEA 4MFBB 2WHOA 4WFNQ 2CAJA 3EX7B 2DCUB 4USTA 1P9QC 5A0YB 4DR5F 1GX5A 3T1YF 2IJFA 3SEOA 1FHTA 3WX8A 1D9AA 1YLXA 5DG9A 4ZJOA 3QT5A 4IG3B 1CJKB 4ENOA 1U0HA 4JP8A 3TNVA 3VAFA 2CNOB 7FD1A 5HP1B 1K73T 2BXJA 3V4MA 2HIQA 2OI2A 2MZQA 3V81A 1JLGA 5D0EA 4QW8A 1HW8A 1PYOB 5KT2A 5JVHQ 1IKVA 1G3OA 1YBAA 5KFRA 1N0VC 1Y5NB 3SFUA 4WFXA 2K1RA 2LCWA 1YJ7A 2ZEJA 3PW2A 2DXDA 4KKOB 5HMWA 3W5XA 3M7VA 4P2SA 3AHPA 3KKFA 2IYIA 1HQUA 4EFAC 2CG8A 1IQZA 5K14B 4DSKA 5B0GA 4ELTA 1SB6A 4ZHRB 1DJ0A 4TVAB 5AXLA 1JB0C 1TAQA 5LT5A 1S1WA 3CCLS 3P8BB 3CJSA 2HNDA 2IC3A 1PAUB 2APOA 1TL7B 3G6XA 3C16A 4AE5A 1NB7A 1JLAA 4ZPBA 2D74B 2MY7A 4FXDA 1GMVA 4ZJLA 4KO0A 2H3EB 5LXYA 2WW8A 3KLGA 5L9NA 2HMIA 4RNOA 4KHMA 2PA3A 2PGCA 2XLIA 1TMMA 5KFSA 2R8JA 3MOZA
chains in the Genus database with same CATH topology
4UOCA 1SI9A 3PFEA 2K2PA 2XCPA 1R0AB 2XMVA 2FHJD 1X5TA 2FC8A 5A2QY 4PRFA 3M6VA 2M7SA 2GW8A 3C6UA 4YB7A 3RAXA 1IBMF 3NP5A 2YH1A 1KVIA 1O0PA 1SIWB 1HA1A 1D9FA 2LYVA 2J76E 1Z4UA 2IRXA 3LW5C 4DL3A 1PC5A 1X4HA 2EFNA 2VA3A 4DPOA 3POTA 4YY3F 2CPIA 4FYDA 3SZ2A 3CVKA 1CEZA 3SV4A 4NCGA 1CQNA 5DQHA 1RDRA 1FTCA 2KFYA 3T19A 2PI5A 2VL1A 4LSNB 5DLGA 1MU2A 4M5DB 5CYJA 1JLBA 5J2MA 3V5RA 1Y5LB 2P9GA 3X1LB 2YKQA 2VFSA 1UFLA 4B3MF 1HWJA 4MK7A 4C98A 2EFQA 3HHLB 3M9NB 1GX6A 4JI1F 2DBBA 3PO5A 3RAMA 3TYTA 3G6YA 2LU2A 4FBTA 3LGNA 1S1UB 3OPKA 3UR0A 2VV5A 1X0PA 3MFIA 4WYWA 1RT4B 4I4BA 2UVRA 1H2TZ 1H6KX 2CFXA 2AF6A 2GJ2A 2LQ9A 3D1HA 1S6UA 2R2TA 4QU6A 2HAIA 2VFUA 1O5JA 2ATLA 2C3YA 3MEEA 4DV3F 1FRJA 2CJAA 1S72S 2RUGA 3NNHA 4DSFA 3HKZD 5FJ4A 2CJQA 1G1XA 1S99A 2GO8A 3NL0A 1RA7A 2ZC4A 3MM5A 3LGMA 3QJPA 4BC7A 2FB0A 3MPYA 3MM6A 4OI6A 2EG2A 3M1VA 2ZH1A 2BDPA 5F8HA 5DGAA 1FRHA 3MECA 2QFJA 1R27B 3Q23A 1WEZA 2M4MA 4R5PA 1JLQB 2PEHA 4C97A 5D77A 4NZ7A 4XAKA 2A18A 1F5BA 1H7XA 2KM8B 1IKYB 3NBPB 3MMAA 5E5NA 4C8MA 3K0JA 2FD2A 4K4ZA 2DNKA 7FDRA 3FZ2A 2C3MA 2V4JB 4ELVA 1N5QA 1JJHA 2GX8A 3VZHA 1U6ZA 1JNRB 4C8YA 2I5JA 3LWLA 3E8OA 2I38A 3F44A 2ZE2A 3MPWA 3N4WA 3R3TA 2UVUA 3MOJB 2P5VA 5KFLA 2RKIB 2UU9F 4EBCA 3DU5A 2ZKTA 1UETA 3D0HE 3OFEA 4LF6F 5HLFA 1WEXA 3MEDB 4CNYA 4WKYA 3K8WA 2D9PA 3FEXB 2HNYB 3DM2A 1S9GB 1G6BA 3TVKA 2RQCA 1X4CA 2NPIA 2Z2MA 5EDWA 2R7SA 4UQGA 3CJKA 4DFMA 2YNFB 3FRZA 1DQ9A 2I2YA 4ICLB 4QIVA 1NH7A 5IWAF 2DNMA 3TA2A 1WNEA 2AJ1A 4ZCLA 5E41A 3RRHA 3QZ8A 3MM8B 2WBRA 1UJ4A 4IFYB 2XO7A 3Q2TC 2RS8A 2K8GA 4YHHF 2MQMA 2V8VA 4K0KF 1GTHA 2CZ4A 2DNNA 2GMLA 2JEJA 1RTDB 5FDLA 3MTKA 1PC4A 2ADBA 5DG7A 3DLKA 4RW6A 5BYQA 4X64F 3HHEA 2PT0A 3MD1A 3DRPB 1S1XA 1WEYA 3ISNC 3R5AA 1X5OA 1B64A 2KI2A 1YJRA 2BVZA 3LH2S 3CCES 1LWEA 1NHVA 5GVQA 4QCLA 2AWZA 4EO6A 4Q0BA 4BS2A 1YRXA 3ZZZA 5G0RA 1YJWS 1TFWA 2YX7A 2J6TA 1GAOA 4BWMA 2NSCA 4WK3A 3M8PB 3KLFB 1S1TB 1TL3A 3MR3A 1VQ5S 2CIMA 4HH1A 4IO9Q 2IBOA 3R27A 2B9YA 1RT7A 1JLCA 2JFKA 2JLEA 2MHNA 4RW9B 5AJ3F 2ZH7A 1TV6A 2OPPB 4CNZA 2Z8QA 2OSRA 3KG1A 2CVEA 4O3NA 2M8DB 3NMRA 4Y6IA 4MK8A 4HT7A 5E3PA 4C8KA 4L6V3 1UVKA 4MIBA 4O4RA 1HL6A 2Q6BA 4I7FB 5EX0A 3GYXB 2JFDA 4Z2XA 2KFZA 4HTJA 3MAQA 4ZVHA 4DWIA 4F4KA 4F3MA 3LOUA 2QSWA 2HGLA 4LFCF 4NLSA 2DNQA 3D54A 5MLCV 3KYLA 2OMOA 1LWCB 3KHHA 4RW8B 2ROPA 4L72B 2DPJA 3I32A 1N5SA 2R7UA 3BR8A 2X3GA 1ROFA 3C8YA 1KFSA 3VAJA 5FIIA 1HNIB 1HBUB 5GMKa 4OJ3A 5KFOA 5HROB 1KR4A 2LEPA 3PVXA 4IUFA 2ZDOA 4RUHA 3TX8A 4ECXA 2UXBF 4YDDB 5HP1A 4IRKA 4IR1A 2LA4A 1AFIA 5HBMB 1W25A 1TKTB 4HHJA 1ZZFA 5DO2A 1RT6B 3UW1A 2AJQA 3QO9A 2C22A 1NJIT 3KK2B 2KT5A 5DETA 3MF5A 2MKSA 4W92B 4DR7F 4F25A 2Y1RI 4PKDB 1R43A 1T02A 1IR0A 1RKIA 1YRTA 3MEGA 2OFHX 2VPXB 1T3OA 2BQ3A 2RRAA 2F3JA 2PFFB 2AYGA 1VMBA 4NLWA 1SL2A 3M2RA 3OXLA 3CIZA 4RW4B 3SQGA 1R89A 2QZ8A 3W2VA 4LVNP 3KLHB 1RTIA 1KRPA 1B0VA 4FXVA 3H2LA 1QAIA 1M5HA 4ID5A 4FVMA 5KG3A 4JBCA 1APSA 5L9XA 2VBZA 1S1VA 4NRTA 2HPUA 4OX6A 3IGVA 3OR1A 1U47A 2HRYA 4PQUA 1KS2A 4DR2F 1N5TA 3RB4A 2JRSA 1DBDA 1MMDA 1X4EA 1L3SA 5KFHA 2KXHA 2NXUA 2ZH5A 2BE2B 2KRRA 1DARA 1GT8A 1NKCA 1U49A 4DL2A 2M8HA 2E5HA 2V9KA 1R6YA 3KG4A 4BWJA 4WF9Q 4V19J 1FK9B 4ZHRA 1RT2B 2LXUA 2KT3A 3JSMB 2ZD1A 4QR0A 2XS5A 2MDAA 3LANA 1BQMB 3BR9A 4NLRA 3HFKA 5LJ3Y 2KH9A 3RB3A 2KHCA 1VQ9S 5KFQA 1IKWA 1NK9A 2XHWA 4HKQA 2Q6CA 2DB1A 3AA9A 1HD1A 3DOKB 1VIXA 3LO3A 4TU7A 3THVA 4USJC 4KQZA 5F0UA 1UA0A 3D2WA 3TA0A 2X1FA 4A8FA 3I87A 4TLQA 3VZIA 4LQ3A 1Q8IA 3R5DA 3ZZRA 2YKNA 2HFOA 3HHKA 3M4XA 1NK4A 2QE5A 1FA0A 3ZFVA 1MROB 1QVFR 3KJVA 5ADZA 1R31A 1FD2A 3MMCB 4OZNA 4B3SF 1FVQA 4PXCA 4DFJA 3UDLA 2AU0A 2CG4A 2HVZA 4FBUA 3TUZC 2FUG9 3OVBA 2YQ3A 3GYNA 4ZS6A 1N54B 1YRUA 4O0IA 2BOPA 5IM0B 4ZP9A 4NYOA 4B9NA 1F60B 1HWIA 3GSDA 3BJYA 4JV5F 3ENVA 4KR0B 5T7LA 4K4YA 3QAEA 4ECSA 1VFJA 3BN4A 2LXFA 2MKKA 1FE4A 3LUYA 4ZPAA 1B0TA 2JWNA 3CD5A 2CPEA 3PZPA 4R0EA 2HVIA 2OD6A 5AXNA 1D8ZA 1WTBA 2CQ2A 4Y2AA 1JLFB 1C0UA 1D3WA 1LWFB 2M52A 2FJWA 3Q8RB 4IG0B 2DGSA 2OAUA 3M2UB 4F50A 1BWEA 2G13A 4MKBA 1ULRA 4B9TA 3MZIA 4DSLA 1ZTWA 3MR2A 4J9NA 2VASA 1SKSA 1S77D 1TK8A 2ZBIA 4B3TF 4MH8A 2V5HG 1HQEA 4ECYA 3ENQA 3AY0A 4X4TA 3GB0A 4OHXA 3NGDA 3OL9A 4Y2CA 3MXHP 1KNZA 2C2DA 1NK8A 2DGTA 2I9SA 4RU2A 2F40A 4HEA9 5JXSA 4DQPA 4CT8A 3T5LA 2BW2A 2F8EX 3B4DA 2LEBA 3BDPA 5LMNF 5IQQA 1O51A 2EFGA 1X9WA 3RBEA 1YHQS 4C4WA 3TAMB 1X5SA 1WG1A 1N0UA 1C0TB 5B7WA 2BANB 4XPCA 2AX0A 3M6WA 1VRUB 3DRRA 2FVSA 2KXFA 1M90T 2E5JA 3MHYA 4WE1B 3V6JA 3CB4A 4J9QA 4GO7X 1HI8A 2O01C 1C2PA 1BQNA 4UY8T 5IT9Y 2MB0B 4B02A 4LF4F 3BGFA 1UFWA 1NJWA 3O6QA 4K4VA 4PPZA 1LFPA 2VD3A 1P1TA 1AROP 2G0CA 1PSDA 1S1UA 1TVRB 4JI7F 1HD0A 3PHEA 4QYRA 3UDCA 4ED1A 5KFCA 2YKMB 1BD6A 1YG0A 1ZTTA