5EN1A

Crystal structure of hnrnpa2b1 in complex with rna
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
184
structure length
184
Chain Sequence
b'RKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heterogeneous nuclear ribonucleoproteins A2/B1
publication title Molecular basis for the specific and multivariant recognitions of RNA substrates by human hnRNP A2/B1
doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 44
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2015-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5en1A01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5en1A02
3L3CA 3UWTA 1VQMS 3NNHA 2HZCA 2M4MA 3G8TA 5DDRC 3VAHA 3MURP 3HI9A 1UP1A 2LCWA 2EVZA 1HD1A 1DZ5A 1FT8A 4TLQA 1IQTA 2J8AA 2BOPA 1KOOA 1F9FA 2G1DA 2OSQA 1X4EA 2JWNA 2DHAA 1YJWS 4ERDA 2AYBA 2DNGA 3MI7X 1KD1T 2MZ1A 3UCZP 2K8GA 5LJ5Y 1L3KA 4RU2A 2G0CA 4A8XA 1X4BA 2DNLA 5DM7Q 2XSFA 2CQ2A 2MSSA 3R1HA 2OJ3A 2KH9A 3FEYB 3CUNA 2I2YA 5LJ3Y 1K9MT 2CQHA 3DLLQ 3RW6A 2D9PA 2DNKA 3K0JA 1YWXA 2DISA 3CPWR 5H1SV 1NO8A 1N88A 2MY8A 1X5TA 1D9AA 1JJHA 2KRBA 2KG0A 5JVHQ 3MOJB 2CQ1A 3UCUP 5DDOC 1VQ9S 2OIHA 3TO8A 1U6FA 2MJUA 2DITA 1U1KA 2DIUA 1VBXA 3N9UC 3TP2A 2MJNA 4PKDB 4CH0S 4W90B 3B4MA 1YJ9S 2MMYA 2DNPA 1KOHA 3DXBA 2KXNB 2PE8A 5EN1A 1X4AA 1U2FA 2LKZA 2ZJPQ 1X4CA 3US5A 2DH7A 2MZJA 2RT3A 2CJKA 1XN9A 3PIOQ 5LSLA 3CCVS 1DHMA 1HA1A 1U1RA 1WEYA 2SXLA 4PRFA 3CC2S 2DNYA 4IUFA 4YOEA 2FC9A 2MZTA 1WI8A 1H2TZ 2O3DA 3CCQS 1WHXA 2VOPA 3CCRS 2MKCA 3THPA 2MZQA 2J0SD 2FC8A 1U1OA 1WG4A 2MHNA 1VQ5S 5DM6Q 1YTYA 3BO2A 2CPIA 2CQ3A 3MD1A 4WKRA 2YH1A 1JJ4A 2FPHX 2NLWA 5LXRA 2MKJA 1VQ4S 2CPXA 1UFWA 3CCMS 2CPZA 2MQNA 2KM8B 1RK8A 2RS8A 2L9WA 2KXHA 1X5OA 5ITHA 2AYEA 2F9DA 1DRZA 2CPEA 4YUDA 4PR6A 1YHQS 2YTCA 1YJNS 4CIOA 2U1AA 1VQLS 2AYMA 1K8AT 1VC0A 3VAMA 1Q82T 2HYIB 1WF2A 1JMTA 2M7SA 1S72S 2MB0B 1R8PA 1WF0A 2J76E 2RRAA 2FY1A 2CQDA 2JRSA 3MDFA 1H6KX 2DGQA 3UE2A 2E44A 4IOAQ 2MKIA 1OPIA 2AD9A 2M8HA 2YH0A 2D3OR 3VF0B 2L41A 2J0QD 1KC8T 1WG5A 4U67Q 5GAEU 1HD0A 2YKAA 2UP1A 4ZKAA 1WEXA 3Q2TC 2M52A 3EX7B 2ADCA 3CMES 1YI2S 1FJEB 3CMAS 2DGSA 3B4DA 3BEGB 1JJ2R 4C0OC 2FHOB 3MXHP 2MQLA 2DNOA 3PIPQ 1SJ4P 1VC5A 4W92B 2XNRA 2CQIA 2I38A 2CQ0A 4M5DB 3FEXB 4WFBQ 2DGVA 1O0PA 1M5PC 4QU7A 1WF1A 3SDEB 3V4MA 2GHPA 2LA6A 4C4WA 1FXLA 2MQPA 5GMKa 2DHGA 2HGMA 1H2UX 3P49B 3ULHA 1X4DA 4WF9Q 5GAGU 1U6BA 1X4FA 4YB1P 2PEHA 2V94A 3SDEA 2N3LA 5IFMA 1Q81T 1U1PA 1WG1A 2M0GB 1QVGR 3S7RA 3NMRA 2DNQA 1R8HA 3J7ZT 1OIAA 1VQ7S 3U1MA 2RQ4A 2MQQA 2MKHA 1K73T 1NJIT 1WI6A 5D78A 2X1FA 3THTA 3CCLS 3G4SS 2ZJRQ 1SJRA 2K3KA 2CPHA 1DBDA 2RNEA 4QQBA 1SJFA 1B7FA 1HL6A 4BS2A 2CQ4A 2HGLA 2LECA 2ADBA 1FJ7A 2E5GA 2NZ4A 2DK2A 1A9NB 2X1GA 1W2BR 3ZZYA 1UAWA 2A3JA 1H2VZ 4V19X 2N3OA 2LA4A 1KQSR 2LEAA 3I56S 3CF5Q 4OZ0A 2MXYA 3U1LA 5GVQA 1M90T 2KHCA 3P3DA 2Q79A 3CCES 1FJCA 2LYVA 3CD6S 2VODA 3SMZA 3Q2SC 3NNCA 3CCJS 1M1KT 2VONA 1WTBA 2QEXS 4LMZA 5LXYA 1M5VC 4TU7A 1D8ZA 3R27A 1VQOS 1X4GA 5CXTA 2M70A 2CQBA 2MKKA 4UY8T 4WFNQ 2M8DB 1FNXH 3BS9A 2LMIA 4Y00A 2DB1A 2DO4A 1RKJA 1OWXA 4ED5A 1WEZA 2EK6A 3EGZA 2DH8A 2LXIA 2KXFA 2MY7A 2RQCA 1SJ3P 4QPTA 2DNMA 1S79A 1VQPS 1SJQA 3IRWP 3LQVA 2CQCA 2KM8C 1Q7YT 2LEBA 3S6EA 2X1AA 5D77A 1FO1A 5DETA 2QA4S 2KYXA 4J5OA 1M5KC 2CPFA 2CPDA 1U1QA 2DGXA 3G8SA 1AUDA 3BO3A 4F25A 5CYJA 4CQ1A 4LJMA 2L08A 2ZJQQ 3ZZZA 2MQMA 2CPJA 3HHNB 2MPUA 2DHXA 4P6QA 2KU7A 2JVRA 1BY9A 1P27B 3R1LA 2KVIA 4WCEQ 1VBYA 1QVFR 2M88A 2MSTA 2RS2A 1URNA 2XS5A 1VQKS 5GAHU 1WWHA 4F26A 2MZRA 4Y0FA 3IWNC 2DNRA 5BJRA 1SXLA 2E5IA 3I55S 1X0FA 2AYGA 1X4HA 1X5PA 1ZZFA 2OTLS 2HGNA 1VQNS 1CVJA 2DNNA 1VQ8S 1X5SA 2EK1A 1N52B 4EGLA 1U1NA 2XNQA 3G9CA 2GO9A 5GADU 3CXCR 3NNAA 4OZ1A 3VAIA 1PO6A 2BZ2A 3VAGA 3CC7S 2YWKA 4TU9A 3S01A 3CTRA 2N82B 5HL7Q 2JX2A 2OSRA 3MD3A 4FXWA 2RVJA 2KRRA 3CCUS 1P1TA 5DDPC 2XS7A 2DH9A 1ZZNA 4TU8A 5FJ4A 1WHVA 5CA5A 4IO9Q 5IQQA 1FHTA 2CQGA 2JVOA 4WFAQ 3MUTP 5LSOA 2XB2D 4C7QA 3VAJA 4UQTA 2RRBA 2DIVA 2KT5A 2E5HA 1YITS 1NU4A 3TYTA 4QU6A 2MZSA 2F9JA 3UCGA 2RUGA 1M5OC 1U1MA 5HO4A 3OW2R 3LPYA 3JB9k 2MKSA 3VAKA 2DHSA 4CH1A 3CULA 3UD4P 2KG1A 3G6ES 2DO0A 3J7YU 1ZH5A 2DGTA 2M2BA 2MYFA 1PGZA 1N8RT 3D2WA 4WIIA 3RW7A 5MLCV 3H2VE 1OO0B 2DGWA 3NS6A 2HVZA 3EGNA 3H2UB 4FXVA 2ERRA 2D9OA 4IOCQ 1WELA 1A7GE 2WBRA 3P6YC 2F3JA 3VALA 3MUVP 2CPYA 3CCSS 3VAFA 4F02A 2DNHA 2KN4A 1QM9A 1WHYA 2LXUA 5IM0B 3G96A 2KI2A 2LQ5A 1G2EA 3P5TL 2E5JA 3UD3P 4LIRA 2U2FA 2DNZA 1YIJS 2MQOA 3G71S 1Q86T 3S8SA 2B0GA 2KFYA 1VC6A 3NS5A 2DGOA 5JVGQ 2OTJS 1VBZA 2N7CA 5IM0A 2MGZB 1VQ6S 2G4BA 3SXLA 2CQPA 5DDQC 2X1BA 2DGUA 3BO4A 2QFJA 1N54B 4Z2XA 2RU3A 1U1LA 2MGZA 3MUMP 2VOOA 2XS2A 1WHWA 3CC4S 1UW4A 2M9KA
chains in the Genus database with same CATH superfamily
2YBVA 5IT9U 1VK3A 4LQ9A 2EKNA 2HURA 2GS8A 4H4MB 4UOGA 1DQAA 3CJKB 1BMQB 3GR0A 4F36A 4OYZA 3UR0A 2QV6A 3N5BA 5CCMA 3J7AN 3VV2B 2OJ3A 4OYAA 1KVKA 1RWUA 2DR7A 4PG4A 3CDEA 4FKYA 5A8RA 2POKA 4JI3F 2DEIA 4DV4J 1IM6A 1LFPA 2KRBA 3C6UB 2ZUGA 3D4JA 1TR0A 2CQ1A 4C8ZA 4DV0F 3GG0A 4M94A 2KJWA 3MAHA 1DTQB 3SSRA 5FDLB 2ZH7A 2Z30B 3DXBA 4J9MA 5B0DA 5DQGA 3D6MB 3M8QB 3IBFB 4TQSA 5KFUA 1NDPA 1WI8A 3HVTB 1WHXA 4KPCA 3THPA 4C9DA 2BJ7A 4CO2A 4JI1F 1J5EF 4ZVPB 1CJTB 2R7SA 4JV5F 1RT7B 2CPXA 2NSCA 2KM8B 3M8RA 1RK8A 4OZJA 4YS2A 5KT6A 2I5JB 2CFXA 2VF3A 4YDXA 4I2PA 2ZH5A 1F9HA 1SBRA 2ZKTA 1HWLA 4Q2LA 2BDPA 4JV1A 1AXQA 1UWAA 1WF2A 2MB0B 1R8PA 2RRAA 2YPYA 3PKYA 1H6KX 2RKIA 2OPQA 5A0YA 5MAOA 1BE4A 4K0KF 1SCJB 2CZVC 4AL6A 2AJ4A 3T5HA 3CMAS 1S1XB 4X4RA 4DL7A 2VQEJ 2DNOA 2XMVA 4ZP6A 2CQIA 4M5DB 1YRXA 1KHWA 3D1HA 3EVWA 2HQCA 3NXZA 3DDIA 1U2CA 4USJC 2V2ZA 4Q8EA 3M32A 1D9FA 4NI2B 1TK8A 4F04B 2FVRA 3DDKA 3DLKB 1UTAA 3R2CJ 1K73T 3V2UC 4KT0C 1T0TV 4TN2A 1RDRA 1K0VA 4QYRA 1B70B 2IAJA 5G0RA 4NA1A 1OSDA 4F50A 3TVKA 1HL6A 3VGSA 1FFSB 1RT6B 2QL7B 3PJ9A 3OBIA 2LA4A 1KQSR 1GXUA 1S6PA 1NK0A 2NXUA 4GKJJ 1D8ZA 1QAIA 1UWBA 2BE7D 1VQOS 4YQWA 3SCIE 2EPIA 4GC7A 4I2QA 1HNVB 1GT8A 4J9SA 2AEFA 3IR7B 1MU2A 3ZNJ1 2DNMA 4JI0J 1SJQA 2G9OA 1GMWD 3S6EA 3HK2A 3HFKA 4JI6F 4L74A 2C2KB 2G0JA 4NLPA 1EKSA 3GR1A 4DSJA 3E2EA 1BXNA 2LQ8A 4L73A 3PFEA 2MSTA 1EB0A 4F26A 2KKHA 1RHRB 3NGUA 3A13A 4NZ6A 1Q95G 4G65A 2JSXA 1X5SA 4YR3A 2VICA 2FJBB 4P71A 4MYTA 3EMTA 3TAMB 4F4WA 4DCOB 3CC7S 3W62A 4C8LA 3D9BA 1WKJA 3MD3A 4CZCA 3KLIA 1Z2ZA 2XSJA 4JI5J 2KL8A 2R4FA 4HVZA 5THWA 5HJYA 4ANCA 3D0HE 2KO1A 4K59A 5LSOA 4K2XA 2UUAF 2KT5A 4CLLA 4QU6A 4JI8F 3BGRB 1QAYA 1JLFA 1ZM4A 2YY3A 2C2DA 3UNYA 4ICLA 4LF4J 2ZBIA 3I0RA 2M2BA 4Q7AA 2NREA 4WWSA 1PBUA 1T9YA 5HI7A 3ZZRA 9RUBA 2ZNZA 2GJ2A 4P7TA 1KLNA 2PI4A 4X4NA 1VS3A 1RT1A 2I6WA 2XMKA 5BR8F 3MMAB 1Q86T 5ETOA 5ETTA 1WOSA 2RHSB 2V8PA 2MGZB 3BGLA 4Q0BB 4DCPB 2E9TA 4DPOA 3PDNA 4F3OA 1BD6A 4ZCKA 1HR0J 2ASJA 1CULB 2F5GA 2DR6A 1KQFB 5KT4A 1PAUB 4RL1A 5HSPA 3LWLA 2XULA 1JLQB 2XY6A 2M4MA 4YDDB 3I5BA 2D3O1 3IAM9 2JWNA 2DHAA 4CNYA 3GIRA 1MG7A 1LEOA 4A8XA 1N32J 5ETLA 4R8UA 3THVA 1FEHA 3DLLQ 2IHR1 2DNKA 2LLZA 3GCXP 4OX9F 5KG7A 1N88A 1X5TA 3BB5A 3PYGA 2ZM6J 4B9TA 2EC0A 3CDAA 1BQMA 3QT7A 4LF9J 1ZA2B 1K47A 1D0EA 2MJUA 2R7WA 4OYPA 4P10A 2XGPA 4DL5A 4ZLLA 2ACMA 1U2FA 1MN9A 3NCQA 1E6VA 2XCAA 3IO1A 1HBUB 2IIHA 1HI1A 1WEYA 2ZDOA 1A0OB 4KSEB 5LOQA 1HWJA 3R5BA 2R2SA 3OVAA 3HSGA 2MZTA 5M2PA 4ZOSA 3J81U 1PJ7A 1T9TA 4I69A 3Q8SB 3H4DA 1UA1A 2CQ3A 4HL9A 1LWEA 2MQNA 2B5JB 3AD9C 2F9DA 1JXLA 4B3OB 4HHUA 1S97A 2IM1A 2DEJA 3MDFA 2DGQA 3J81j 1KSPA 2ASYA 1KC8T 2BKNA 4YB6A 4O44B 2XY5A 4MK7A 1J2VA 3SBMA 1N33J 2ADCA 3P4UB 1OMSA 4XTTA 1NK6A 1IKVA 4W92B 5KFZA 2V0NA 4WYWA 5L1IA 1CBKA 1RTHB 2IDEA 4KKOA 4X66F 2LA6A 4RW4B 1TKTB 1H2UX 5D4LA 4PG7A 1U6BA 5F8NA 1S1VA 2FVSA 1OIAA 3CJ0A 3ZTPA 2GNKA 3FUYA 4H4KC 3THTA 3H4BA 3CCLS 2ZJRQ 1Q16B 4JB8B 2OFHX 3GFZA 1Q53A 2HGLA 2QYGA 4NLUA 1RHKB 2QZ8A 5CCLA 1S6QB 4V19X 2VV5A 5CZVA 2Q66A 4EBEA 1VCTA 4PQAA 3CCES 3CCJS 2WBMA 3Q23A 4RW8B 1M5VC 3FGVA 1X4GA 3BDPA 4LSZB 3Q8YA 2OKQA 3GJRB 1J5OB 4OZNA 3HM9A 3IR5B 1FRKA 4OLPA 6FD1A 2KXFA 4LQ3A 4FYVB 2YKNA 5JXSA 4WFXA 5E33A 2VU5A 1RTJA 4I68A 3CJSA 1R89A 3MPDA 2BANB 2AJ0A 5DS7A 3HVRA 3DC2A 3GFXA 3PKMA 4QOTA 4YR2A 1RT5B 4P6QA 2KU7A 4FS1A 5E3QA 1RUSA 1Y9OA 1URNA 1H7WA 4OX7A 4C2MA 1HW9A 1NDCA 4JI4F 3NL0A 3DU5A 3K5PA 2CAJA 1EJ7L 2RE1A 2YKPA 1R0AB 2V63A 3C14B 1RGVA 2IA6A 2GO9A 2ZHBA 1C0TB 1TKZB 2FJDB 5HP1B 2RJZA 2BZ2A 3BR8A 2AJFE 3OR1B 1MN7A 4AE5A 3Q8RB 1JLAA 3FK4A 3DGPA 2YNHB 4NLRA 1Z2LA 1C1BB 2RF2B 1FHTA 2E7VA 2C3MA 2WONA 4LFCF 3JSMA 3FRZA 1TL1B 3AB4B 4DL6A 2VB6A 1LW0A 4NCAA 5FIIA 2J7WA 2ZHOA 1WC0A 4EEYA 4MT1A 1MMDA 4NLVA 2XCPA 4JP8A 5FLXU 4KR0B 2VPWB 3J7YU 1ZH5A 3C2PA 5T7LA 1TL4A 5AXLA 2VC0A 3IRXB 1HYSA 2PMZD 1NUEA 3OL8A 1VRQC 4DG1B 5IC4B 4ER8A 3T1YF 2HFVA 4FYDA 1CC7A 4HR2A 1OQ6A 1FRLA 3MUVP 3FCWA 1RTDA 2V5HG 3ENAA 3MR7A 1W25A 3FQLA 1B7YB 4LIRA 1JLCA 2QRRA 3M7VA 5JVGQ 3WHIA 4AQYF 3ONQA 4DR4F 4U7CA 2X1BA 2XO6A 3LO3A 4B9LA 4RW6A 5CD4H 3KLHB 4NOHA 2DD8S 3ZZOA 3L95X 4LVNP 4FBUA 2BW2A 2OUGA 3RU0A 3GV7B 2LU1A 3MMCA 2V2KA 1HFEL 2P9EA 1I94F 1U8SA 1R8CA 1F9FA 1X8DA 1S12A 2VG5B 2WAQD 1X4EA 2DXEA 3MI7X 2MZ1A 3B82A 4K4YA 4GC6A 1XMOF 3SI8A 3DRXA 3FZBA 3CW2C 4OHYA 2DBBA 1NJWA 3A8IA 5H1SV 4J9QA 5D3GA 1H98A 1ZETA 1RTIA 1GXLA 4KHMA 3LGMA 2DITA 4DDFA 4NCGB 2ZITA 2D74B 4PKDB 3RBZA 3AA8A 2PE8A 1JLBB 1P6TA 3T1HF 5LMNJ 2LP4A 3DRPB 1CEZA 4K4SA 3NGRA 2CA9A 1S0VA 5EWGA 5CD4A 1U2RA 1SV5A 3DRYA 4ZVHA 1YTYA 3NOGA 3CJTA 5J2QA 2CWXA 4KGKA 3QIPB 2XYPB 2L9WA 1K1QA 1U0SA 3P5BP 1CG2A 4CNZA 3K59A 2QLJB 2YTCA 4CIOA 7FDRA 2R8GA 4P73A 3BQ2A 3C6TA 1S10A 4NEYA 1M5SA 1ZPWX 2MKIA 2A6MA 2J0QD 1RWMB 4O4RA 5J1NA 1ELOA 1TK0A 5LMUF 3EX7B 3A3NB 3CO0P 3PIPQ 4DSLA 1VC5A 2BV3A 1U02A 3Q8UA 1CSJA 3QAUA 2RDDA 4DUYJ 3AJDA 1J27A 4DX5A 4J91A 3H5YA 2MDAA 2EFQA 2V67A 2BJ8A 2XZTB 2MQQA 4CT9A 3GV8B 1SQFA 5A2QU 3D3CJ 3HFZB 1D8YA 2G2ZA 2NZCA 4C11A 1FNMA 2NZ4A 2JC0A 1KDNA 3O44A 1N0VC 2NQPA 4KQZA 4CI0B 3KK3B 3QAEA 1FJCA 2YPZA 5AE2A 2QEXS 1RYRA 2VQFJ 2IYIA 5CXTA 3ZTRA 4UY85 1MLAA 4ZVOB 3D1QA 4RW9A 3KHGA 1VK8A 4DV2F 2VDHA 1Q7YT 2H51B 2XMUA 3W3SA 2QT7A 3PV8A 1H73A 2Q3PA 3HSZA 3TQEA 2RQKA 4F4AA 8AT1B 3TEGA 3KNAA 1WDDA 3PX0A 4RUCA 3PEHA 3KNGA 4DOZA 1X4HA 1WC4A 3RYLA 3CIZA 3HSDA 4ECRA 4WJBA 3DM2B 1C4AA 3KLEB 4ECYA 3QO9B 2K2PA 4B3RJ 4M8LA 3MM5B 2HHXA 4LF6F 2B7CB 4ED1A 1PC4A 3PO4A 2DHHA 2GVDB 2HBZB 4WFAQ 1TQLA 2KYZA 1RT2B 1F1BB 1XBWA 1U26A 4RNHA 4IQXA 5KOWA 1S9FA 2F9JA 3SQGA 4DV7J 3M6WA 4RW7B 2JFKA 3H8YA 4QPXA 1LOUA 2AEJA 4HH1A 1T7PA 4A8QA 2DO0A 3KK2B 3LTOA 5HROB 2JH3A 3O2IA 3TAQA 3BN7A 2IM3A 2IDLA 4I7FB 5E5NA 3HT3A 2DR5A 3QIDA 4URSA 2ILYA 3JQMA 4O3SA 2DRBA 1UKUA 1XNQJ 1N5TA 2UXBJ 4O0NA 3VAFA 3Q86A 4RBVA 3P5TL 4NYZA 3HCXA 4U96A 4USVA 1EQMA 2DPIA 3FSIA 3KUEA 3EUNA 4OLOA 3B54A 1NPRA 2XMWA 3GJTB 4H54A 3PJXA 3TJAA 2HLTA 3DRRA 2FVPA 4P72A 5JJBA 2C2EA 2QO3A 3UWTA 4CM0A 2HZCA 4C8OA 2HK3A 3MURP 1EQ0A 2B4UA 2E5LJ 3LA0A 2V4JB 1TL7B 1KD1T 3D28A 1Q8LA 1S9GA 5J2NB 5LJ3Y 4X64F 3V4IA 4ECTA 1UL3A 2FZGB 3DHXA 2GX8A 4W98A 3D5MA 2DTJA 4X4VA 4EO8A 5HBMB 2OEMA 4FDFA 2W9BA 1URRA 2IVMA 4DBQA 3GCWP 5EX3A 2QA4G 4UOHA 3UI3A 2EXUA 4XDDA 4YHHF 2CNNB 3LP2A 1DAXA 1RA7A 4YOEA 3TI0A 3BM7A 5C7PA 4W4MA 1FESA 2OPRB 2J0SD 4DUZF 1RYSA 2CPIA 1Y10A 1UFWA 2XC9A 2RB7A 2H5JB 2HAFA 1IKWA 2KXHA 1X5OA 3RRGA 2NXNA 4KGXB 2E1PA 2HHHF 2VPXB 2AYMA 5E2QA 2XQCA 2NCKL 4QR1A 1JMTA 2GMHA 4J9UE 4OJ1A 4WBFA 2CNLB 2YNGB 2M8HA 3QRPA 3MPWA 1AZSA 2XMAA 2CJ9A 3FCVA 1SKRA 3IFEA 4NX9A 4MKYA 4A8WA 5IC6B 4DPYA 5IXUA 2EFOA 1G7CB 4PWDB 3PM9A 4IRDA 2ABYA 3EZ5A 1TP7A 4FPIA 3V4MA 4C4WA 3PEJA 1HMVB 1XWLA 3IS9A 4IDKB 2QL5B 3FBFA 5K9FA 3CCZA 2QYCA 3Q89A 1CJVB 2C2RA 3NMRA 3Q24A 3U1MA 1R0CB 3O5TB 3SCKE 4UT4A 2CVIA 3OL7A 2HQGA 2PC6A 1SJRA 3PZPA 3TEHB 5LSRA 5E0OA 3C3LA 1W2BR 4DV0J 2Z8QA 3E01A 3RB0A 4MKBA 5GVQA 4M63A 2QFIA 3SMZA 4ED3A 3W66A 3R27A 3V5RA 2M8DB 2LMIA 2XGQA 3TX8A 5HVFA 3IA0A 4RKUC 2PGCA 5K5MA 4JI1J 1J5EJ 2YX1A 4ANDA 4F4XA 1X31C 1B64A 1FKOA 4C97A 2OGUA 4DXLA 3DI6B 4F2SA 2HVIA 4CQ1A 4CH7A 3R7BB 3DLBA 3GP9A 1RKIA 2GIRA 2ROEA 1P27B 3MF5A 2BJEA 1X9MA 4CLFA 2B56A 2M88A 4CP5A 4ZHRA 3I5AA 3UPFA 4MYUA 2ATLA 1JKHA 3I55S 4ZCMA 4EK2A 1UPMB 5RUBA 3JSRA 5IQ6A 5DQHA 3SSQA 1LQ9A 3JSYA 4Z7CA 5C2CA 2HHVA 2OSRA 3DLJA 2KRRA 2HBYB 2HQDA 1RAIB 3W2VA 5IQQA 3UDCA 1KRPA 4ZJQA 1HWUA 4NA2A 4K4VA 3C16A 1LWFA 2XB2D 1GH8A 3UVJA 2JHEA 1YITS 3QBCA 1NPPA 1NNDA 1RBOB 1RSCA 3R8YA 1FDNA 1D1UA 2KG1A 1EETB 2G2YA 2X3DA 4G6VB 3UN3A 4HYKA 4DI6A 1N48A 2N4DA 1RI7A 2YKMA 3OXLA 5KFVA 4TKTA 2ASDA 1WOOA 3DMJB 1IKYB 2CZ4A 3A8KA 3A3OB 4WP9A 3ZO7A 3DLEA 3V6DA 3ILLA 4KPYA 2HFSA 4PYAA 3N6NA 1KONA 3GYNA 3QFWA 2HNDA 4IH7A 4KHRA 1WKKA 3BN4A 3JSBA 1SH2A 3KMSA 5IM0A 4OX8A 1UJ6A 2JJ4D 4ZP9A 3LH2S 5H9FJ 1NK5A 4CYUA 3FFIA 1U1LA 4B08A 2J9DE 1NBEB 4C6AA 1R8AA 1RHQB 4F3MA 2H1YA 3MMBA 4ZCIA 5GADI 2GQQA 3PYFA 2J5AA 4B9MA 2O5DA 3QATA 1L3KA 3U1NA 3QZ8A 4DX6A 3M2UA 2MSSA 1V3RA 1S1WA 4RPFA 1TVRA 2CQHA 4NL5A 4USWA 1ZYQA 2PD1A 4PQUA 2FHMA 1IBCB 4PYDA 1QY7A 3BKFA 1S6UA 2W7OA 3ENWA 4BC9A 1GEHA 2VPYB 3SSSA 3TR5A 2CJKA 4XAKA 1XN9A 3H40A 1BWVA 2UUAJ 4BWMA 3IC1A 2F40A 3TANA 3DYAA 5C5JA 3JQKA 2CADA 3LP0A 5L1KA 2W8KA 2MKCA 1UFKA 5ETSA 1RAHB 2YH1A 1TUGB 5LXRA 2MKJA 2BQUA 4B3SF 3F41A 3GSDA 2RS8A 4LF1A 1N36F 2RKIB 3NWRA 2OPQB 3HHLA 2FZKB 3VAMA 2HBRB 3QYYA 1S5ZA 5IS2A 3DRSB 2MLYA 4ZVFA 4DQSA 4LF5F 1AFIA 2YWFA 1FRJA 1UEKA 5DZ6A 4WPAA 5E3CA 3HPOA 3EPGA 1JJ2R 3KJVB 3MXHP 1QUPA 1RAEB 4DPXA 3K8WA 3M32B 4E2FB 2HRYA 1WF1A 5AT1B 3AXMA 4U95A 3M8PA 2Y8WA 1YX2A 2K06A 1X4FA 3AJ1A 4ZVRB 1DURA 3HKZD 3WBZA 5G0RB 2DNQA 3CT9A 3D7SB 3HZGA 4DR1J 3TARA 3W8PA 1IKXA 1GAOA 4M5IA 3QLHB 1YRUA 2FLLA 2CRLA 4NEZA 3QJPA 2K3KA 2RNEA 4OX9J 2CQ4A 2WK4A 1ZM2A 4IG0A 1UAWA 2R2TA 2Z58B 4J9PA 4HT5A 4F7VA 2KHCA 3OTOF 3AFGA 4FN5A 3ILIA 4A8SA 1MU2B 3H5XA 2CQBA 5ETNA 4FYWB 3BV8A 1XK8A 4KGZB 3O6QA 2B9EA 5L8RC 3AB2B 1F5BA 2W2MP 3TUPA 1DTTB 2GAGC 2NUUG 3ZTOA 4ZPWR 1NKEA 2JLFA 1VRUA 1IR2A 2BVZA 2XI3A 4XIUA 3HHNB 5KG4A 4P75A 2R3VA 3GV5B 1WJ9A 3ZZ0A 3UDLA 1CQNA 2GJIA 4UQGA 5HLFA 1N34J 2A1BA 1X5PA 4UW2A 4CLWA 1S7IA 3NAIA 3SYZA 3KUGA 3G9CA 4NLWA 2B9XA 3KLIB 1UVMA 2XSJB 4HI1A 4CLPA 2KHDA 3T5LA 4L76A 1VGYA 1KN6A 4DWIA 3QNWB 5DQIA 4IR1A 5DDPC 2XS7A 2LDYA 1ZZNA 4DMZA 2JVOA 2V69A 3QPIA 1JLFB 1JQGA 2EKYA 4QCLA 4ICLB 2W7AA 3I0RB 2GFFA 4H4OA 1U1MA 4FNIA 2OO4A 2ZBQA 3JB9k 3DNCA 3MEKA 3K5MA 1YBUA 1YZ7A 1N8RT 3MM9A 2JEFA 1Q8KA 3NS6A 1RT1B 3BSAA 1OSCA 1F6TA 2DYAA 1APSA 5DRKA 1A7GE 5HMXA 1HNWJ 1FDAA 1FFGB 2CPYA 4ILRA 4TQRA 1U7LA 5I42B 3CCSS 1QDUB 4F02A 4N77A 2WVEA 3LAMA 2KN4A 2V9KA 2GV1A 4MJKA 5EGYA 1PYOB 3G96A 1IR0A 2E5JA 2E7WA 3CJ8A 2DNZA 4JI7F 3QGIA 4DF8A 4OZ3A 1NKBA 1MW7A 1NMEB 1UVIA 1IBKF 4F2RA 1SC3B 3GIIA 4OI4A 2FB0A 1NJZA 3MEDB 2ZNYA 3I0SA 2FTRA 1CC8A 2J8AA 3ZTSA 1EP4B 4R8UB 2Y9HA 1HNZJ 2OSQA 3HSJA 3OHBA 4JI4J 4CLUA 4A8YA 4KHPF 1NJYA 1FTCA 5E3RA 3UD5A 5AJ3F 3JTPA 3LUYA 1RQ0A 1VDHA 1M5HA 1RBAA 3RW6A 1YWXA 3EVMA 1NO8A 3N6LA 1FRXA 2VJVA 3FDSA 2HZAA 5LM7E 2OIHA 3TO8A 5KT7A 5KFEA 3C15A 4CH0S 2XWXA 1XC9A 2NXCA 2AGOA 3B4MA 3M1VB 4ZP8A 2KXNB 2XHCA 3NBPA 3FBEA 4OHZA 1N0UA 1X4CA 2XG8A 4KFBA 3VR1A 3DKDA 2UUCJ 3PIOQ 2RRNA 2R8IA 1VJWA 2DR8A 2CNKB 1JWWA 3DLHA 1JXEA 2FC8A 2VC1A 3FMWA 4LF8F 3BO2A 1FEEA 1P9YA 4K5RA 4M95A 4ED2A 2N4CA 1TMJA 3M9OB 3T1YJ 4TYAA 1YJNS 2OHDA 1SC1B 2BJDA 4L6V3 1T05A 2D7SA 2HYIB 2FHJA 2IMWP 2M7SA 1WF0A 2CQDA 1R0BG 3KOAA 3MTJA 1IKVB 1TTHB 1SJ1A 1ULRA 2HNZB 3AD8C 4DR4J 1YK9A 2I1RA 3PW5A 3BEGB 3BZQA 1QE1A 3KLFB 4OYWA 3HT0A 5F8LA 5F8HA 1S1VB 4ANEA 4DL0C 2HFZA 2RQMA 2MQPA 5GMKa 2HS3A 1BQNA 2DHGA 3POTA 2VG6B 4OI3A 5L38A 1I94J 3D6HB 2V94A 3OV7A 2BM0A 2M0GB 1QVGR 2F63A 3S7RA 2ZEJA 2CJAA 2Y0SD 1T94A 3R5DA 2KZZA 3UR3C 2W25A 2YNIB 2RIJA 1XMOJ 1SQGA 5F8GA 1JLGB 4KO0B 2IY5B 3J80U 4WU2A 1SJFA 1B7FA 1DTQA 4DZDA 3TAPA 4B9SA 3W60A 1HQUA 1ZAWA 4OZ0A 4ZVUB 3ZZPA 2Q79A 5J2PA 3C19A 2V4RA 2P6TA 3NNCA 4AYBD 2CJXB 4U6PA 3TOQA 3T1HJ 3CJ5A 3HDSA 1TELA 2YKNB 1D09B 3TA2A 4IR9A 1X0PA 4DV5J 1RKJA 4MIWA 1CJTA 2JEGA 1UZHA 1RT7A 1SJ3P 1CPZA 5EWEA 1KNZA 2HK2A 2IM2A 3GLJA 3HHLC 2VG7B 4N7TA 4CO1A 4JV0A 3D0IE 2CPFA 2CPDA 1U1QA 2XWYA 1XMQF 4BCAA 4F25A 1OY6A 4F8RA 4U8YA 2VZ9A 3ZZZA 2VDIA 1S1TA 4ZPVR 2BA9A 3GYGA 2GC8A 1HI8A 3R1LA 5F3TA 3GJQB 3QT8A 4S0MA 1YJUA 1VQKS 1T03A 4RNNA 5BJRA 4LUBA 1SXLA 2OTLS 3R5JB 1CVJA 3HD1A 5LMUJ 1U1NA 4M5DA 2BACA 2Y0BB 4A4JA 2GAHC 2GMLA 4TU9A 3FC9A 1RXOB 4WZQA 1IBMF 1FERA 4NI2A 1LW0B 2YVSA 3KJQB 3LP1A 3OFEA 2LXFA 2PMWA 5K14A 3QSYB 1ZAXA 3R7NB 4DQPA 1HYSB 1CJKB 4CWBA 3K5OA 3ISND 1YJRA 1RTDB 4GKKF 3K89A 2WOMA 4IOCQ 1WELA 3O3LA 3P6YC 2A2DA 2UXDF 1V5IB 3I9V9 2O66A 2B6AA 3JS9A 5D4PA 4IFVB 1NSAA 2M3DA 1FWKA 3GG1A 2HWTA 2Z4PA 1Q8BA 1B3TA 4X4UA 4LF7F 1F0XA 4RW6B 2W7PA 5KFYA 1KEKA 3RG6A 2ILZA 5K8NA 5HVGA 2HMIA 2MEWA 1C2PA 3CMQA 2UU9F 3EWGA 4DV2J 4KV8A 4ZMMA 4RX6A 4DV3J 2ASLA 3DDNA 2V6AA 3QGGA 4Q43A 5DZ7A 3L9ZA 4XPCA 4DV4F 1GFWB 1GK8A 3ZFVA 1H72C 2W2NP 1NH8A 2VFRA 5C24A 4KTQA 1HPZA 1RTIB 3FEYB 2I2YA 4J9OA 1KWMA 3TAMA 2CJQA 5KFGA 4QIEA 1TKXA 2UV8A 1PJ5A 4V19J 4O4GA 2KG0A 5DDOC 3F0NA 3MOZA 1YJ9S 2RUSA 1RE1B 4LF6J 5HVHA 4DSKA 5IT9Y 4QWCA 1XNRJ 2P9CA 1QSLA 3HJFA 3BGRA 1YVFA 3CJRA 1Y00A 2AZ1A 3CC2S 4IRKA 5J2QB 1JIHA 1KQKA 4LR7A 3M2VA 3K58A 1C1CB 1SVDA 4ATNA 3W2WB 3U7JA 4DSEA 4DFKA 3MR2A 3C6TB 1AUSL 1RWWB 2CPEA 2F65A 3OLAA 2IPOB 1NHKL 3PRDA 2W2PP 3KG1A 1UEUA 1GMVA 3T9ZA 5KOXA 1PAEX 4LRCA 5KFBA 1OPIA 2AKWB 2D3OR 4UUXA 1RHMB 3PRVA 3Q2TC 1CULA 4JUZA 4TY8A 5D4NA 3D67A 3CMES 2ALYB 4X4PA 4DHVA 2D3UA 1LXJA 3OXGA 4XDCA 3ETMA 2DKOB 4KH1B 3CSKA 4R5PA 1D3WA 1B0TA 4GO5X 4IO1A 3MAQA 3J7Z5 4O23A 4LBPA 3Q0AA 5BXIA 1T11A 2VIHA 1Y3JA 3VHQA 1T9UA 1ZTWA 4QQBA 2VKZG 4USIA 4GKJF 3WDOA 2D1CA 4M5JA 2LECA 3NLCA 2DK2A 3H90A 3BSOA 1HKAA 4JI0F 1HBUA 2V50A 2CKWA 3M9NB 3EICA 3G6YA 4ZVGA 4YHHJ 4GVBB 2MKKA 5F9LA 4X62F 4Y2KA 4DR6F 1PYSB 2GCFA 3PR4A 1HQEA 3IM8A 5KG3A 4A8FA 4RNOA 3LGHA 5EUHA 4EU0A 3OUYB 2AMCB 4DUZJ 4MAKA 3OTBA 3I82A 3IXQA 2OPPA 4B3OA 3E51A 4B3MF 3T6BA 3D66A 2JNJA 2A10A 2L08A 1TV6B 4Q45A 1GNKA 2FY8A 4QIFA 1N5SA 1UEVA 3OFHA 3DOMA 1LWCB 1O5JA 1F2GA 2E5IA 3V6HA 2HGNA 3BJYA 4DN9A 3MM8A 4JI5F 2BX6A 2VPZB 1Y7PA 4J9NA 1SKUB 3FQKA 3W5XA 4EYHB 2WB1D 4K8RA 3S01A 2AJ2A 4ECUA 1WD6A 4WYLA 4F0HA 4DFMA 3SEOA 4URQU 4LF4F 3SQGB 1SUQB 2R8HA 4IFYA 1Q78A 2CQGA 4NLXA 2IFXA 1S9EB 2R8JA 4OJHA 2UVVA 2HPUA 2Z2YB 3EVOA 2VH7A 5MLCV 3MR5A 1OO0B 2QA1A 1EZZB 1WOPA 3C46A 3VZIA 2F3JA 3VALA 4B9VA 4AD6A 1RB0A 3DFEA 1HR0F 4MK8A 1OYDA 2U2FA 5ADZA 5F8IA 2JLEA 2C2OB 2KFYA 5DLGA 2NS1B 3GU0A 1FD8A 3DRRB 2N7CA 4RUAA 1SKWA 2LQ9A 1KBRA 2BANA 1JLEA 1RWXB 4NASA 2QG9B 4DCJB 1HNXJ 4QYZK 4DV1J 4DL3A 1JXVA 4ECZA 1RT5A 2E1AA 4PG6A 3VAHA 2BJ1A 1XR5A 1HD1A 3MCOA 2YWGA 3OD2A 1DZ5A 7AT1B 4EI2A 4AT1B 1S9GB 2KDOA 2O1PA 2ZM6F 1R8BA 1BWEA 3V4IB 3ENQA 2DNGA 4FYYB 3W5YA 1R0AA 2UVWA 2F8HA 3FBCA 2CXEA 4CO0A 2XSFA 4R0JA 5HP1A 2B9YA 4BBYA 2W9BB 2PN6A 2P2CB 4C8YA 1JJHA 3GIJA 4HACB 1QAJA 2LFVA 2YNHA 3CDWA 2C42A 2RD5C 5A8KB 1P1LA 3A4TA 4O3QA 2VA3A 2AZ3A 1VOMA 2C2MB 1MROB 1HBOA 3LW5C 1N56A 2W8LA 4GO7X 3CGIA 1NSKL 2XTJP 2R7QA 4P7VA 1AYEA 3UN2A 5D0HA 5F41A 3NWGA 3DLGB 5HMWA 5ETMA 4DG1A 2ZWOA 3G82A 2IVFB 3OR2A 2N7YA 4C48A 3QSIA 2KFNA 2GW8A 1GXTA 1ITPA 2MLZA 1AZSB 2FJWA 3MECA 2FY1A 5HQ8A 3D6TB 4M1KA 1B99A 3KK1A 1SIWB 3VF0B 5GAEU 4EZ9A 2OI2A 3GQCA 2QN6B 4ES2A 3IS9B 3J81Y 4CLTA 2I38A 3W9IA 4G3IA 2DGVA 3X3UA 2JEJA 1NCLA 4EMDA 4HLBA 3FEZA 2WSFC 4PAAA 3W9HA 2NXJA 1YJVA 4YB1P 4DX8H 3LF0A 1U1PA 2E9ZA 2UUBF 4WFYA 2DY9A 1NSPA 2ZBCA 2HLUA 3MWBA 4KC5A 2VA2A 3R7SB 3AOAA 2W9AA 3M8WA 3EGVA 2BMBA 4MKVA 2ZOGA 4CRJA 2E5GA 4JI2F 1JLBA 3BH7B 3IWXA 2ZVIA 3N79A 3ISNC 2LDIA 2B4OA 4M5LA 1RADB 2XHWA 4OI6A 3A1YG 2V8VA 4NMLA 3DOLA 1OWXA 2IJRA 4HT7A 5T14A 2G0IA 3GONA 2VD3A 3LQVA 1YDLA 3MHYA 3CJ4A 3N4WA 4B3SJ 3DN9A 2C28A 1N6QA 2DGXA 2EWHA 4ZHRB 1N36J 4ZLNA 4GRSA 2OP5A 1JKHB 1CJUA 1RT4A 2B4PA 2KVIA 2RS2A 2PT0A 2HWIA 4ES1A 4LF5J 1NLKL 4NXNF 2UUTA 3NMAA 1RBLA 2XMTA 4DX7A 1N52B 1S48A 3CXCR 3VAIA 1HNIB 3G87A 2GIFA 2UXCF 2QL9B 2YWKA 3U02A 2FQQB 1SIZA 1LWFB 2AX1A 3HP6A 4Z7YA 3UVJB 4MIAA 1KQGB 1BC6A 3PFOA 1WHVA 3FZ2A 2C22A 3G8QA 2H4WB 1RWPB 2VJUA 1VBKA 1EARA 3KLGA 4ENOA 2E5HA 4K50A 2F4FA 2PFFB 3TZXA 2FIUA 2YKMB 3VAKA 4CH1A 2E66A 5FD1A 1EKRA 3SCJE 5L46A 4CLKA 3QRRA 3DLEB 1K0TA 4FVCA 5A8WA 1NK9A 4A48A 3M9MB 1XEZA 4I4BA 3KK3A 2PDAA 1RP5A 1TZ0A 3G86A 4WXOA 2BABA 4I0WA 4ETXA 2HNDB 4NLYA 3MPYA 4DQIA 3KFWX 3M30A 2DNHA 5IM0B 3KDOA 3EPIA 4CM2A 1G2EA 3IBWA 1UVKA 3BKUA 4USTA 1SL1A 1VC6A 3RBXA 4CYUB 2R2UA 1VBZA 3FFIB 2H4YB 5L9XA 5DGBA 3R5AA 3QMQA 5CH7B 4NWBA 1NK7A 2RU3A 3I96A 2ZE2A 3VTIA 5FLXY 3OTEA 4LRAA 2QIFA 3MMBB 2CVEA 3NG8A 4KH0B 3OSNA 3NNHA 1R43A 3JQJA 1VRTB 1M1HA 2EVZA 2I9SA 3HZEA 2FGCA 2CWKA 2BJ9A 4HHJA 4TLQA 4F4KA 2CIMA 2BOPA 3K5NA 4ZPDA 1S1WB 4WP3A 3FJ2A 1NHUA 3BGOP 3VQSA 1RWKB 2CQ2A 5HAOA 2KH9A 3F44A 2HNYA 1S57A 3LANA 3QO9A 3ITHB 1I3OB 4YMEA 1TFWA 5B0EA 3MOJB 5D6GA 1VQSA 3MM5A 3HO1A 3IGNA 2GVDA 3EXYA 4W90B 4QJVA 3WZ0A 1DARA 4WTYA 3DYAB 2MZJA 5C25A 1U1RA 2ZH8A 4PRFA 2HHTA 3VZHA 2GQ2A 4IUFA 4ED4A 2QLWA 1H2TZ 1R3NA 2AW0A 3E3XA 4KGVB 4I7FA 2L9DA 1RWVB 1Q0NA 2H65B 5KT5A 5KFNA 1JJ4A 4P2FA 4NYOA 1VQ4S 3HHLB 2WVBA 3W5ZA 4DPUA 5CHCB 4PXEA 2AYEA 4NE9C 2K1RA 4UF4A 1S49A 3B78A 4EBDA 1IBLF 2WW4A 2QC3A 3NGTA 2GHVC 2HVHA 4DN0A 4JI7J 2W2QP 4RO0A 1WC3A 2WW8A 2UP1A 1WEXA 4DEZA 2ZKUA 4IYQA 2IM0A 2AF6A 3B4DA 3PO5A 3LWMA 2MQLA 4FYXB 2NYHA 3CNQP 3VQTA 2Y1RI 4WFBQ 3BH6B 1M5PC 2QX0A 1IBKJ 1C0UB 3OSPA 1GX6A 1LFWA 5JUMA 3P49B 4FS2A 1TL7A 1IKXB 3JXOA 2PEHA 2AIRB 3MM6A 4ELUA 5KG6A 5J2NA 1OYEA 3PACA 4KHPJ 3CCTA 4IG0B 5CQGA 3JAMU 4DR2F 4Q2MA 2ADBA 1FJ7A 1SH3A 2KB2A 1U0HB 2BJ3A 3ZZYA 4LBIA 3PX4A 5F0UA 2O01C 3I56S 1Q1KA 4HDHA 3CVKA 3TUIC 4C8KA 2ZBRA 4TYBA 3EGWB 6AT1B 1JB0C 3UN5A 4OI0A 2J8SA 4RJVA 4ES3A 2OPRA 5F9NA 1VRUB 1WEZA 3EGZA 5EX0A 3CWJA 1W26A 4ZPAA 1S79A 1H74A 5A2QY 3IRWP 4ZPBA 1FO1A 1U47A 4CT8A 2L48A 1M5KC 4OYBA 4DJBA 3A8EA 5CYJA 4U9RA 1HIYA 5HLFB 5KFPA 3WX8A 4LSNA 4CTAB 5H9EK 4AXJA 2YNFA 1WWHA 3KLVA 3P96A 4OV6A 4Z37A 3DGVA 1N5YA 4LRDA 4LFBF 2Y1IA 1K1SA 4PWDA 1G1XA 1L3VA 4A46A 4MH8A 4QWBA 3I32A 1F60B 3I4HX 3NNAA 2FHKA 2HQFA 1IJFB 3VVTA 3CTRA 4IDKA 1FKAF 1RISA 5KFTA 2FGOA 3TNVA 3QFHA 4H4OB 2RMLA 3M8YA 1Z4UA 1V5VA 4QYZJ 3NGKA 3H5SA 3HJVA 1MWZA 2HVDA 1A6LA 1VJQA 2ZH6A 4DR5F 1NZAA 1HBNB 2DVIA 3GJSB 2OFGX 1XNQF 5H9FK 4D3HA 2DGTA 3KJNB 1MMNA 4WIIA 1ZOTA 2J6UA 2RH3A 3H2UB 2J9CA 3M2RA 2DR9A 4FVMA 3HHDA 1RLDA 1WHYA 3BDEA 1RA6A 1SL0A 1KTQA 2ZDPA 1JX4A 3PNIA 4FF3A 2HHQA 1WC5A 4Y6IA 5CYMA 4MMOA 2F4VF 2CQPA 1I1GA 2DGUA 2FJEB 3F73A 3AT1B 2QFJA 3SFUA 3OXFA 4KBIA 5B09A 1WKLA 2IBKA 2M9KA 1XMQJ 2EBGA 1VMBA 1UP1A 1FT8A 1E6YA 1YBAA 3JYTA 4DU7A 3WQPA 1U09A 4FNHA 3MPUB 2ZOFA 3ISZA 3H0PA 1RAOA 3Q83A 4YP3A 2WSEC 2QLFB 4YFUA 2EW9A 3NBPB 4KFBB 1RLCL 2DIUA 4HH0A 3V6KA 4F4YA 1ACMB 2HQIA 2W2OP 2XBPA 1X4AA 3KG0A 4NLDA 4X65F 2IRXA 4UOFA 2AX0A 3R6LB 3TA1A 1ZAVA 1EETA 2DNYA 1YGYA 2O3DA 1U1OA 1UA0A 5DM6Q 1B4SA 2KT3A 4WKRA 3DMJA 1AW0A 2WCXA 1IKYA 2FPHX 3CB4A 4FF4A 4GKKJ 2RDIA 1U4BA 1SKSA 4DR7F 1SL2A 2UXDJ 2VFUA 4ITSA 1Q82T 1NJXA 2J76E 5KG0A 3V81B 4KJIA 2VUGA 4OJ3A 4RLEA 1FKPB 5GAHI 2AEMA 2CZ9A 4Y2CA 4U67Q 1HD0A 1RWNB 1QE1B 1ZM9A 4PCQA 2X3GA 2UU9J 3VGVA 1BQNB 3POTB 2JL9A 4L72B 2AGQA 5KG1A 2GHPA 1FI4A 3RGIA 2RSQA 3HHEA 1KTVA 1HHSA 3ULHA 1YG0A 3I6PA 5GAGU 1H38A 4ECWA 3N01A 4YN3B 1VYAA 4YY3F 3UNGC 1VQ7S 4CO5A 4USKA 1NJIT 4KAIA 4H4KA 1PG5B 2ZH1A 1HQUB 1KHVA 3GSIA 3CDUA 2CPHA 1ZTTA 4P74A 4ZP7A 2CJBA 3K7RA 1XR6A 2OPSA 5J2PB 3VCDA 1RHUB 3M6UA 3Q2SC 3T19A 4PXBA 4NRTA 1SI9A 4FBTA 3MFIA 1U8WA 3AAWB 3BS9A 1RABB 2PA3A 3BGFA 2DH8A 2A0FB 4QPTA 4M5HA 1BHNA 4QR0A 1TK5A 1S1TB 2PEBA 3MZIA 1FXDA 3G8SA 1HWKA 3V6JA 4G1IA 4Q5VA 3SV4A 2R7XA 1PSDA 5LL6d 1T03B 2H5EA 3DOKB 2B7BB 2XEXA 2MQMA 1BY9A 3RAMA 3DRSA 4KIAA 4C3MA 3IP0A 1G6BA 2W01A 2GVZA 1T8EA 2DNRA 4TXSA 4O3PA 3QZ7A 4EUVA 3KJVA 1XJWB 2P5VA 1CQMA 4EGLA 1FF2A 5B0CA 3IG1A 1FK9B 4KE5A 3EYZA 1VLYA 1VQYA 3GZ7A 5ETPA 2YQ3A 1S7HA 3LP1B 4ED8A 5HL7Q 4FXWA 5K14B 5KG5A 3NY0A 3H25A 4PPZA 2DJWA 3SCLE 3VAJA 4I6AA 3QLHA 1NU4A 1PIEA 3H42A 2B9WA 2MKSA 1Q7LB 3PYDA 4KGMA 1NSQA 2WOMB 4TY9A 1FWLA 2X7IA 3RBEA 1RTZA 2CNOB 4FKXA 2B6AB 3MAAB 4ZN3A 4ILLA 3WC2A 2BUNA 2IC3B 2LXUA 2NSBA 2HMIB 1YIJS 1NXIA 1DTTA 2B0GA 4X62J 4KV8B 2G2OA 4DR6J 4PWWA 5J1EA 2APOA 2LQJA 1S1UA 5DDQC 3AJ2A 2QMWA 2VFTA 3LALA 4Z2XA 2B4VA 4RWWA 5HMZA 2Z0GA 2ZFHA 2EFNA 1VIOA 3W64A 1WHWA 1UW4A 3N5FA 2AGPA 4KY3A 4B3MJ 5ETVA 2XLIA 5C24B 1HPZB 4JV2A 5SUHA 3BSNA 1GMUA 3FCHA 1TKXB 3UCZP 1TMMA 3ILOA 2DNLA 4O4GB 2R7UA 3NGDA 2HVEA 5BYRA 4ZJOA 3RR7A 3HFVA 3WIVA 4I6WA 5F3ZA 1OJ4A 5GMDA 3RBDA 3GPAA 3GYXB 1CS4A 1U1KA 1LW2B 2DXDA 2EFVA 3HULA 4LSLB 3G6XA 4LVOP 5I3UA 3R6GB 8RUCA 2ZJPQ 4JI3J 2C3YA 3M2VB 4WE1B 1FX2A 2MKYA 1HA1A 2H54B 4ZVQB 4R25A 3A12A 4M5GA 2HRTA 4B9UA 2AQ4A 3ILJA 3OTDA 4RZRA 4OFZA 2FDNA 3C8YA 4FXDA 1FDDA 2PA8D 5KFSA 2XMMA 5I42A 3R5CA 4B3TF 3EE3A 4YUDA 4DSFA 4HTJA 4PXDA 1VQLS 1VC0A 1GMWA 4K5SA 3CIMA 4JV5J 1FDBA 3B6BA 2ZC4A 4TY8B 1SPBP 4OQJA 2AD9A 2YH0A 2CYYA 2K7JA 5B0BA 4PUOA 3FKBA 1S59A 4DLEA 1NM2A 1UVLA 2Y8YA 1YI2S 3MR3A 4FP9A 4Y28C 4C0OC 4DL2A 2XNRA 2A18A 1KLMA 4A8KA 4XK8C 4R5PB 1TUVA 4K7QA 3MEDA 3NP5A 3PW7A 4DR1F 2VBYA 1O8BA 5IWAF 1FJGF 3H2LA 2FYXA 4K0KJ 1EP4A 4C0HA 3H98A 4N8NA 2XZDB 1X4DA 3SDEA 4YEAA 4LFAF 5AXKA 4U7UK 4G1QB 3ENVA 2UUWA 5DG8A 1FE4A 4PXCA 1P9QC 1FWPA 4UZCA 1DBDA 5LT5A 1HHQA 2NPFA 4BS2A 4HKQA 5H9EJ 2G1HA 3M1VA 3GIKA 3ET6B 4NLTA 3VGTA 3HLUA 2Y1LB 4NXMF 4Q8FA 4OZLA 4LR8A 3L4BC 1HQEB 2HFNA 1TL3B 4FZVA 3A3PB 1GTHA 4UY8T 4WIQA 1QSSA 1TL5A 2V8DA 1AT1B 4F0KA 3KHLA 2OPPB 3CD0A 1XTZA 2ZHAA 1IWGA 1VQPS 3HHLD 1WTFA 2XI2A 3OHAA 2FLNA 3JTOA 3UDVA 5HANA 1OPZA 1N34F 1W7WA 4M5MA 2XYGB 3DOMB 2XLKA 1SC4B 1S99A 1R27B 3EZUA 2J9EA 1HBMA 1MWQA 2H3EB 3MM8B 4MKAA 3TX0A 2XS5A 4PZVA 3KXDA 4P2SA 2HNZA 4JI6J 3TVZA 4AL5A 1X0FA 1KFDA 1ZZFA 4P2MA 4ETZA 3FBBA 3MEEA 2DNNA 1IXKA 3KLFA 3PJWA 5M2RA 1BQXA 4QWDA 2BOAA 2O67A 3W65A 5B7WA 5A8RB 1PJ6A 4IFYB 5C42A 2VG6A 3CCUS 3ZZUA 1U49A 3I31A 2KVQE 2WHOA 1BLUA 2YNIA 2DCLA 3T41A 2UUBJ 3I87A 1JLGA 4KO0A 2RUGA 4MK9A 3LPYA 1HNWF 1T95A 3CULA 2F1FA 3UO0A 2BXJA 3D2WA 2BEFA 1BGXT 2W9CA 4FXVA 2WVFA 2ERRA 1G4CA 4I6YA 4JI2J 5KFKA 4JI8J 2R42A 1VI7A 1LXNA 2GA7A 4ZN1A 3W63A 3KKFA 2QJ3A 5DLFA 4I2PB 2LQ5A 2KZMA 5BYQA 4AFFA 2J7UA 2OH2A 1JLEB 4QIVA 2XO7A 1RAGB 2OLWA 2VG7A 4DFPA 5A0YB 1V6HA 3SQOP 1X9SA 2DT9A 5BR8J 1N54B 1HNZF 4O3RA 2PO4A 2J9DA 3KHRA 2JEIA 2XS2A 2CDQA 2DCUB 3JTNA 2E7XA 5IZHA 5B0GA 1TKDA 2GGPA 2A2CA 4CLYA 1O6XA 3NEKA 4PEOA 3CDBA 2J7KA 3SIPB 4NYPA 5DO2A 1RWOB 3NOCA 2IRUA 1KOOA 2NYIA 3MM7A 2YKQA 1XMBA 1REVA 2BE2A 2K8GA 2EI5A 3EDQB 5DM7Q 4NXNJ 3ZC4A 3MTKA 5D0EA 2R9LA 2Q6BA 3CD7A 2E29A 2UUCF 2IAJB 1D9AA 2BR0A 2UXCJ 2AWZA 1FD2A 5CYQA 4ZDNA 1S0MA 2GJFA 1HBOB 3BBCA 4N41A 5E41A 3KWMA 3S1TA 4OI1A 1L3TA 3US5A 5KTQA 5CZXA 3OLBA 3M8ZA 5LSLA 1S6PB 4M5NA 3CCVS 1FCAA 5IT4A 2OEJA 1VFJA 1UWBB 1CJKA 1SQEA 3HVWA 4EFAC 3G82B 3CCQS 2VOPA 3OR2B 1YBTA 5J1PA 4I2QB 5DG9A 2DXFA 2CG4A 5L39A 1GQEA 4DR3F 3PW2A 2B8PA 2RAQA 3MECB 4IFVA 3L09A 4PPDA 3KK1B 5KFMA 5L1JA 2D3ZA 1F5AA 2K3IA 4DSIA 4LRFA 2R7RA 4CCHA 2E44A 4IOAQ 3NRBA 1WACA 3OTCA 1MNEA 4HDGA 4ZCLA 3OVBA 2CUYA 2EFGA 4OJGA 2W1BA 2JLGA 4DV6F 2ZWPA 5KFJA 3M6VA 4NZ0A 3KHHA 4MTPA 4DPTA 2CQ0A 2GIQA 2ZD1A 2VFSA 2D41A 1DFDA 1Q5YA 1JNZB 1F9EB 1UVJA 2P9GA 3VGUA 1FA0A 2HFOA 2Q43A 5DJBA 2LVWA 1WI6A 4X66J 1RACB 3QWUA 2F8EX 3U27A 3PCOB 3MPVA 1CLFA 1AA1B 1EAYC 6FDRA 3EDRB 1T3OA 4FF1A 4BHQA 3AODA 2VBWA 4IG3A 3BSCA 4N47A 2AJQA 3PRBA 4DV5F 1RT3A 3T5JA 3CF5Q 1L3UA 4AXIA 3LAKA 4CO3A 4IRCA 3MEGA 3DOLB 1PBAA 1M1KT 1KVJA 1WTBA 5LXYA 4EZ6A 1R6VA 5A6WA 3TRGA 4X4TA 4NCBA 1RU1A 1C1CA 3GTYX 2DO4A 4UUWA 4RUHA 4ED5A 3W2WA 2RQCA 3AH6A 1N6QB 2HFUA 1F3VA 2HIYA 2FHJD 1I51B 1CJUB 1RT4B 3J80Y 4QR2A 1HHTP 3BO3A 4MFBA 3BKTA 1ROFA 5GAEI 1UVNA 2ZJQQ 5IOLA 3LOUA 2V34A 2MPUA 2BE9B 1IR1A 2A6OA 1IBLJ 2BRLA 3BYRA 2AV5A 3HX9A 5GAHU 2JZ5A 4Y0FA 4PABA 3OVSA 5I4MA 4QIWD 3W1YC 3D1OA 2J0XA 4P2XA 1JK9B 1VQ8S 2BYCA 4UTGA 2W4CA 3CCWA 3QJJA 5KT2A 4XO0A 3GB0A 4ID5A 4OL8A 2YWEA 3EZOA 1BQMB 3KLGB 5K8MA 2DH9A 2EG2A 2XY7A 2HEKA 2QSWA 5B0AA 2VFVA 2R2RA 2RRBA 1E6VB 1TAQA 2QMUB 4K4ZA 3K8VA 1O51A 5A8WB 2V8GA 3UD4P 3G6ES 2RDJA 3NS7B 1NDLA 3H2VE 4DR2J 4LFCJ 2DGWA 2YX4A 3GWCA 4DL4A 3M30B 4IOBA 1LWEB 3KG4A 3KDNA 4DPWA 4GVBA 1QM9A 2CDRB 3R2DJ 2IJNA 4DV3F 1S0OA 3OT9A 3OUYA 2DGOA 4O3OA 2ZE2B 2BQRA 5J2MA 1VQ6S 2ZZNA 2B43A 1YLXA 2V4QA 3SZ2A 3M05A 3BPDA 1Q8IA 1DLOA 3MUMP 3H7HB 1H0HB 1TV6A 3AQPA 4WK3A 3CC4S 1VHFA 2H48B 3DU6A 5F0WA 4LRBA 4AQYJ 2EG1A 5A76A 4KKOB 1LWCA 1NH7A 4WKYA 1LV5A 2ZUAA 5AXMA 3ETOA 2HNYB 4OHXA 2R7VA 5KFCA 4RNFA 4JYAF 2G0CA 4H4MA 1NKCA 3IGVA 4LFBJ 3CJKA 1K9MT 2MTLA 4OV1A 1AROP 2WSCC 3R5GA 2DISA 5EWFA 2IRYA 1XNRF 2P6SA 4C3LA 1NAQA 2MHEA 1X9WA 1SUQA 5C25B 2MMYA 5F8JA 2MLXA 3C6UA 3CEDA 1Q4RA 1S9EA 5FDLA 2GQCA 4X4QA 3A8JA 2SXLA 3IN5A 1FRMA 3M4XA 2L9NA 5A6PA 1MMLA 3M8QA 3CCRS 4DR5J 4NRUA 2MZQA 4J90A 3WX4A 3DHWC 4D3GA 3MD1A 1SB6A 2K1RB 2NLWA 4L3KA 3HVTA 2CPZA 3HVAA 1YKWA 1RTJB 1LK5A 4DS5A 4HI2A 4DUTA 1YHQS 2U1AA 2ZH3A 1ZBTA 8ATCB 4ELVA 2I5JA 1DJ0A 4O3NA 4CLSA 2R8KA 3TZYA 4J9LA 1KS2A 2B3TB 2Z56B 2VKRA 5KFLA 1QJHA 2YKAA 2BKOA 3NCRA 4E8UA 3T3FA 2F4VJ 1FJEB 1H7XA 1SJ4P 4ZVEA 3R9LA 1U48A 3RUBL 2PMHA 1WSRA 1IVZA 2ZH4A 2C3OA 2XM3A 3BBFA 1RCOB 1S1XA 1B0PA 3MM6B 3O1LA 2HGMA 2BM1A 1JLAB 1UJ5A 3DGPB 2N3LA 5IFMA 5E7OB 4WFZA 1VISA 3NCPA 3TA0A 2OMOA 2RQ4A 2OELA 4YR0A 2WONB 3JSMB 4L75A 4HACA 4P9SA 1T9VA 3BYPA 3DLKA 2PI5A 2HHWA 3ZXWA 3M6XA 4X2BA 5T7LB 5A8KA 1WORA 2A3JA 1H2VZ 2L3MA 2N3OA 1Y11A 3ADAC 1MROA 2ATCB 2FJAB 1PILA 1RT6A 3P3DA 7FD1A 2UVUA 3CD6S 3CD5A 2W4DA 4LMZA 2VONA 2F8MA 4X65J 2Z57B 5D0GA 3T5KA 4Y00A 2DB1A 1JLCB 3DLGA 2EEYA 5K8PA 1L3SA 3SFGA 2AU0A 2FJVA 1HNVA 3OL6A 1IQZA 3IR6B 4J9VA 2IMOA 3FRYA 2WVCA 5L9NA 4LSNB 2YNFB 4CLZA 1KFSA 2CPJA 3MMCB 4DR7J 2JVRA 3RZAA 1N5YB 2ZVSA 3CJ3A 4WCEQ 3RRKA 3PTWA 4J37A 2DPJA 2MZRA 4HEA9 3IWNC 4K4UA 1ZPVA 4OI2A 5DGAA 2G13A 2BQ3A 2C2NA 3CE8A 4FF2A 1PO6A 2P8IA 3SV3A 2V8HA 1RAJA 2N82B 5D3GB 5SZTA 3AA9A 4B02A 2FUG9 3IWLA 2R7TA 2GMJA 5IT0A 3W7BA 3X1LB 2HS0A 5HN0A 1PCAA 1FRIA 3TW0A 2C3UA 3TYTA 2WB4A 4YY3J 1R31A 3QGHA 5HO4A 1TU0B 1JNRB 3M2RB 2WRMA 4X84A 3F56A 5D0RA 3RW7A 1SV5B 1UPPA 4ALZA 3EGNA 1VR6A 5KAKA 2QSFA 2KT2A 4BLGA 2GHWA 4LT6A 4XPEA 4Q44A 5CYMB 1HNXF 1RCXB 3TZZA 4DV1F 2XMJA 2AJ1A 3G71S 3QRQA 2VL1A 3AY0A 3MMAA 5I3QA 2UVRA 2Z2ZA 3BPSP 2VQEF 3PW0A 1R6YA 2MGZA 2HIQA 1E6YB 3JYTB 4Q0BA 1FXRA 2VOOA 4DS4A 5DDRC 1M0SA 1FVQA 1IQTA 3PY8A 4ZVTB 2OMLA 2J6TA 1JLQA 2G1DA 2W4PA 4DFJA 2JOQA 4RU2A 4ELTA 1X4BA 4K4WA 3PX6A 1SC6A 3UDEA 2AP6A 3CO9A 1HNIA 3K0JA 1ZS6A 4K2JA 4NA3A 4RBTA 2ZH9A 4ECVA 4C11B 1NZ8A 2MJNA 2R7OA 4EYIB 4USMA 1ZM3A 4A8MP 1QUVA 1RU2A 3WC0A 3MCNA 4X64J 4ECQA 3HKWA 4N76A 1EHWA 4ZITA 4USUA 4WTOB 1Q79A 2IJFA 2F7VA 1QTMA 4ED6A 4RW9B 3EJMA 1T9XA 1HLWA 2IVYA 1YQHA 4KRWA 1V3SA 3RB4A 4PR6A 4ED7A 3B8HA 1KVIA 2B5JA 1MSWD 3T6JA 3W61A 1PYTA 2OAUA 1G3OA 3UE2A 3K5LA 4LIWA 1NEEA 4F3QA 2HHHJ 3QJLA 2M52A 2V2QA 2Y1JA 2CG8A 4RU9A 1K44A 5B08A 4O44A 2GO8A 3FEXB 1VRTA 2FJXA 1T3NA 2YQ1A 1S4EA 4C98A 1T02A 3C66A 1FXLA 5D4OA 1RTHA 3UW1A 1V9OA 2JFDA 4RW4A 3TQ1A 4QIGA 1TKTA 3BQ0A 3MCMA 4WP8A 2X1FA 3ITHA 2E9RX 2OPSB 3G4SS 5KFRA 4O0IA 5HK4A 1F3FA 1QD1A 1RZMA 3KJFB 4C0BA 1WDTA 3MFHA 4E0DA 1WUUA 3GMGA 1KR4A 1TFYA 1S6OA 1S76D 1WC1A 1DY3A 2I0XA 1LNQA 1R7IA 1IM4A 2FVCA 1Y0HA 3NKYA 4WZMA 3ZTQA 3D0GE 1MWYA 2HG4A 2FLOA 1S6QA 4TU7A 4PG5A 3MCSA 4YB5A 1FNXH 2VBZA 2YKOA 2EK6A 2EFPA 4RW8A 3Q8QB 2MY7A 3QQCD 3RB6A 2H5IB 2CQCA 1LKZA 3T9NA 2KM8C 2LEBA 2ROGA 1J5OA 2QA4S 3K17A 3QT5A 5D15A 2WZ1A 4J5OA 4NPOA 4B3TJ 3QWPA 4LJMA 2GVZB 2UV8G 3FSYA 3W9JA 1LK7A 4J9RA 3AHPA 4AUKA 1VBYA 1QVFR 3KMQA 3K57A 3IG1B 1N32F 5KFHA 3GE9A 2EK1A 1FFWB 1Y3KA 2XNQA 4JOUA 5G4DA 1OY9A 5GAGI 1C0UA 2EBEA 4LF9F 3ICLA 1FTRA 5BYSA 3C14A 4ZK7M 5IWAJ 1FJGJ 5CABA 3BREA 4WU3A 1C0TA 1TKZA 3OR1A 5FJ4A 3HMJG 4WK1A 1JJCB 2ZZMA 4LFAJ 4OHWA 4A8OA 2QGFB 2DIVA 1C1BA 4E98A 3UCGA 2RF2A 1WSVA 3LP2B 3BQ1A 2HHPA 4EO6A 1TL1A 1UCNA 5KFOA 3VWSA 3L7PA 4ECSA 2MYFA 1DQ8A 1U0HA 4ZVSB 3I9ZA 1YJTA 2HVZA 5E3AA 4CDIA 4ZS6A 1RJJA 3G6VA 3IRXA 4DU8A 1W2IA 1IKWB 4UZBA 2WTFA 4DQQA 4NXMJ 5K8OA 5J1EB 2KI2A 2HHUA 1S1UB 4DQRA 3S8SA 2OTJS 4OZ2A 5KFAA 3MGJA 1N33F 2G4BA 3SXLA 4I67A 5GMEA 4NLOA 1FRHA 2ZH2A 2VBXA 4B9NA 2OD6A 4ZA1A 3RB3A 2RU9A 3IM9A 3PG9A 2HBQB 1VQMS 5HATA 1TAUA 3KLHA 2FVQA 4N8OA 4CTAA 1EIYB 4BC7A 3AQOA 2KTQA 4ZPTR 4OYXA 2HHSA 5DG7A 1YJWS 4ERDA 1U24A 1Q5VA 1HWIA 4N5SA 1M1GA 4RBUA 2VG5A 1CS4B 2D9PA 5M2UA 4RUBA 1NK4A 3CPWR 4HHHA 5KFFA 5JVHQ 1N5QA 5I3UB 1VQ9S 1U6FA 4IQMA 3GILA 4ECXA 5JMNA 2B51A 3N9UC 3TP2A 4X4OA 1Y5NB 1KOHA 1Y5LB 1NDKA 5EN1A 2NPIA 1XIQA 2LKZA 3AXKA 3E01B 3LPEA 3KUHA 2DH7A 5KT3A 2RT3A 4NCGA 3Q8VA 3PXGa 1DHMA 1HBNA 4OYMA 2YX7A 4F67A 1GTEA 2GZOA 2XLJA 1SH0A 3RTVA 3L7OA 4LREA 5ETQA 1VQ5S 1NK8A 1S4FA 3Q8PB 2YWWA 3DRPA 3CCMS 3O8WA 3P8BB 3HF5A 3GFYA 1VHIA 1FKOB 2HWHA 3TUZC 3RAQA 4TVAB 5F8MA 3AOCA 4UOCA 3QIPA 4PUOB 1UFLA 3NGSA 1S72S 3I5CA 5KFIA 2KJVA 2JRSA 2YXLA 1QSYA 1OS5A 4NZ7A 3RRHA 2ROPA 4OZ5A 2X51A 4R0EA 4KB7A 3J7A1 1KLMB 4QWEA 1LWXA 2HS4A 2MQ8A 3Q22A 2DGSA 2FHOB 5I3PA 2K7KA 1QTNB 1GX5A 2HKEA 1X7VA 3SDEB 4L3NA 4Y2MA 5ETRA 2E1RA 5AE3A 5KFQA 3TJ9A 4WF9Q 1Q81T 2W24A 1WG1A 3W2VB 3PHEA 5IV4A 3J7ZT 5D8HB 1I5OB 5D78A 4ZJLA 3C16B 2C2ZB 3N28A 3N0VA 2IBOA 2XZWA 1OQ3A 4Y2AA 3L7UA 2RHQB 4NLSA 3EXCX 1A9NB 2C1EB 2X1GA 2CJYB 1L5UA 1IN0A 2KFZA 3U1LA 2HZVA 2BKPA 5KFWA 2DRAA 3OL9A 2LYVA 2VODA 2BBEA 2I8EA 3V6DB 4EWTA 2Q1LA 4I1TA 5C2GA 4WFNQ 3HXMA 2HSEB 5ETKA 2BW7A 3K2YA 1PC5A 2Z2MA 4I64A 3OTOJ 2LQBA 3EM1A 4P52A 4V1Ak 3PYEA 2X1AA 5D77A 5DETA 2KYXA 4DR3J 1HBMB 1AFJA 3JAMY 3FSXA 4G1PA 1EX8A 1H3DA 3OQ2A 3V81A 4ZIWA 1FKPA 3AD7C 3MEEB 3BF4A 3GFHA 4DLGA 1VQNS 4LBHA 2LU2A 3LGNA 5C42B 2Y3YA 4NMXA 3M2UB 4DV6J 1ICEB 1HI0P 1TVRB 4OIXA 3VAGA 1WC6A 3RJMB 2JX2A 1V3ZA 2RVJA 1QLNA 3DM2A 4GVLA 3OFGA 1P1TA 3KLEA 4PQUB 3KTQA 2AHOB 1YZ6A 4IO9Q 3MMJA 1U6ZA 4RNMA 2EC2A 3UFCX 3IAS9 5LMNF 4C7QA 3PHTA 5KFDA 2DHSA 2W9CB 1RT2A 3HD2A 4J7CA 4X4SA 1BUXA 4LR9A 5KG2A 4NLQA 3M8SA 1Y4ZB 3LP0B 1PGZA 3HHKA 4ED0A 1TUWA 4RW7A 5EHHA 4ZLJA 4I56A 3KK2A 9ATCB 5HROA 2PIIA 2ACYA 5HJXA 2WBRA 2JC1A 3W8GA 3QT6A 1NB2A 3PW4A 1FX4A 1HQ2A 3H5UA 3IBCB 2NR0A 2JDJA 4OYOA 1VIXA 2MQOA 4QBUA 2LEPA 3NS5A 2E1CA 2ZBPA 3N6MA 3OJSA 2V68A 4IKAA 1T9WA 2YWHA 3BO4A 3OPKA 2GGPB 4B17A 5HQMA 2ALZA 3DOKA 4AL7A 3PVXA 3L3CA 2HW3A 3BBBA 3MM7B 4DUYF 3RR8A 3G8TA 1REVB 1QAXA 3HI9A 2LCWA 2BE2B 4WXWA 1FNOA 2ZC3A 4N56A 4QW9A 3OFFA 3M8PB 2ZZTA 1U25A 4M5KA 3H59A 2AYBA 5LJ5Y 1NB7A 1Z1ZA 3R1HA 4NLGA 2V2VA 3CUNA 1FK9A 5CYQB 2V4JA 3TUJC 3OJUA 1OY8A 2DY1A 4OHVA 1D9DA 2MY8A 2RILA 3UCUP 2FLPA 3TJ8A 3WIUA 3AOBA 1FVSA 3KYLA 5EDWA 1VBXA 3CJQA 3ZNUA 4ZLPA 5AJ3J 2HAIA 3QGPA 2DNPA 3P45B 5HMYA 5HBMA 4PG8A 2VQFF 3UQSA 4A47A 1WNEA 2WVDA 2FC9A 3H20A 4U7UD 3T1AA 3R97A 1WG4A 1X60A 4EBCA 2MHNA 1DQ9A 1UZDA 1YJ7A 3MAAA 2E1MC 4IH5A 3DCAA 4QW8A 4URGA 2QLXA 5ITHA 1DRZA 2IC3A 2B8QA 4J9KA 4K4TA 1K8AT 2J0WA 1S0NA 4LF8J 1RHJB 1YRTA 2QE5A 5K20B 2QMXA 2L41A 1N4LA 1WG5A 2QA2A 4ZKAA 4DZ6A 2ZD1B 2ZOMA 1HARA 4F4ZA 2NUHA 2YNGA 3CJ2A 1U45A 1UJ4A 5L1LA 4B3RF 1XERA 4QU7A 1O0PA 1AB8A 4ILMA 1REGX 4RR5A 1NPKA 4HTIA 4JBCA 4YB7A 1I6JA 1HMVA 2IA0A 1R8HA 1NRKA 4DF4A 2MKHA 3RAXA 4K4XA 1UETA 4DV7F 4JYAJ 1VLOA 5E3PA 4IG3B 1CJVA 1B0VA 3J7YI 4OX6A 1RT3B 4F0MA 2IYGA 1LW2A 4Y65A 4CO4A 3MEGB 4LSLA 4Y2IA 3MM9B 3TVYA 1IWAA 2LEAA 2MXYA 2UXBF 1F2HA 4WE1A 1M90T 2FD2A 5HQLA 3D6FB 3ELHA 3FVYA 1XQIA 1N5VA 3GIMA 1RAFB 2M70A 3D68A 2V9WA 2FZCB 1RAAB 3D3BJ 3D54A 2XYHB 5KFXA 1C4CA 2VHGA 2AT1B 1P8GA 2LXIA 2YQ0A 4KYZA 5IV3A 4ZIVA 4MFBB 3R3TA 4LF2A 1HW8A 4BDPA 4USHA 1S77D 1UMJA 4C8NA 4ZPCA 2D69A 1AUDA 5B0FA 3PR5B 4QZVB 2DHXA 2E5LF 3DI6A 4TLRA 3TZWA 1IJEB 1UW9A 3I0SB 2AYGA 4ID5B 5CAAA 3I4PA 2Z2LA 5GADU 3BR9A 2OD4A 4OZ1A 4Y3CA 4PWUA 4RWXA 4C8MA 4U8VA 2VASA 2HQ3A 2PSZA 4TNOA 4OYIA 3C15B 4OMFG 3E8OA 4TU8A 5CA5A 4G1QA 3MUTP 1KKHA 2HRUA 3DXSX 4UQTA 2BRKA 4FPRA 5AXNA 2DRDA 1ZA1B 2MZSA 2PFDA 1YSJA 5U47A 1M5OC 3FNNA 2M5YA 3OW2R 5T41A 1IBMJ 4MIBA 3ZZTA 3FMBA 3ET6A 4BWJA 2UZAA 2QLBB 2COLA 3VVUA 2D9OA 1FE0A 1TL3A 2QTWA 2NXEA 1F5CA 2J6SA 1Y5IB 2H9ZA 5AE1A 4C3KA 1XR7A 5J2MB 2C3PA 2OEKA 3UD3P 1T05B 3MR6A 4ID8A 3TWZA 4Y34A 1DLOB 1PKUA 4IH6A 4QWAA 2Q6CA 3BGUA 1IUJA 3G2XA 3NAHA 4LF7J 4GMKA 1NHVA 1KP6A 3IMQJ
chains in the Genus database with same CATH topology
3NG8A 3OSNA 3NNHA 1R43A 3DU6A 5F0WA 2J9DE 1VRTB 1VK3A 1R8AA 2EG1A 2EVZA 2I9SA 3HZEA 4LQ9A 2FGCA 4HHJA 4KKOB 4H4MB 4TLQA 1LWCA 1NH7A 4F3MA 4F4KA 2CIMA 2BOPA 4WKYA 3MMBA 3K5NA 4ZPDA 4ZCIA 5GADI 1S1WB 3FJ2A 1DQAA 1LV5A 5AXMA 3ETOA 2HNYB 3CJKB 4OHXA 3GR0A 2GQQA 2R7VA 5KFCA 1NHUA 3UR0A 2J5AA 4B9MA 2O5DA 4RNFA 3VQSA 4JYAF 1L3KA 2QV6A 2G0CA 4H4MA 3U1NA 3QZ8A 3N5BA 5CCMA 3M2UA 2CQ2A 2MSSA 1NKCA 1V3RA 2OJ3A 1S1WA 2KH9A 1RWUA 1TVRA 2HNYA 3F44A 3IGVA 4PG4A 3CDEA 3CJKA 2DR7A 1K9MT 2CQHA 3LANA 3QO9A 4OV1A 5A8RA 1AROP 2WSCC 2POKA 3ITHB 4JI3F 2DISA 5EWFA 4YMEA 1TFWA 2IRYA 4NL5A 1XNRF 1LFPA 5B0EA 2KRBA 3C6UB 1ZYQA 3MOJB 2ZUGA 2P6SA 1TR0A 2CQ1A 5D6GA 1VQSA 2PD1A 4C8ZA 4C3LA 3MM5A 4PQUA 2FHMA 4DV0F 3GG0A 4M94A 3HO1A 1NAQA 2KJWA 3MAHA 1DTQB 2MHEA 1QY7A 1SUQA 3SSRA 1X9WA 5FDLB 3IGNA 3EXYA 4W90B 5C25B 4QJVA 2MMYA 3WZ0A 2ZH7A 3C6UA 5F8JA 1S6UA 3DXBA 3ENWA 4BC9A 2W7OA 4J9MA 1DARA 3CEDA 4WTYA 2VPYB 3SSSA 5B0DA 3DYAB 1Q4RA 5DQGA 1S9EA 3M8QB 2MZJA 3TR5A 2CJKA 4XAKA 1XN9A 3H40A 5FDLA 2GQCA 5C25A 4X4QA 4TQSA 1U1RA 5KFUA 2SXLA 2ZH8A 4PRFA 3IN5A 1FRMA 4BWMA 2HHTA 3IC1A 2F40A 3M4XA 3VZHA 2GQ2A 3TANA 4IUFA 3DYAA 5C5JA 2L9NA 5A6PA 1MMLA 2QLWA 3M8QA 1WI8A 1H2TZ 3HVTB 3LP0A 1R3NA 1WHXA 5L1KA 2AW0A 3CCRS 2W8KA 4NRUA 2MKCA 3E3XA 2MZQA 3THPA 3WX4A 4C9DA 3DHWC 4CO2A 4JI1F 1J5EF 4I7FA 2L9DA 4D3GA 5KT5A 5KFNA 3MD1A 2R7SA 2YH1A 1JJ4A 4JV5F 1SB6A 2K1RB 1RT7B 2NLWA 5LXRA 2MKJA 4NYOA 3HVTA 2BQUA 2CPXA 2NSCA 3HHLB 1VQ4S 4B3SF 2CPZA 3F41A 3HVAA 2KM8B 3M8RA 3GSDA 1RK8A 1RTJB 2RS8A 4OZJA 5CHCB 4PXEA 1LK5A 5KT6A 4DS5A 2AYEA 2I5JB 2CFXA 4HI2A 1N36F 4YDXA 1YHQS 4I2PA 2RKIB 2K1RA 1S49A 2OPQB 2U1AA 3B78A 3HHLA 2ZH5A 1SBRA 2ZH3A 4EBDA 2ZKTA 3VAMA 1HWLA 4Q2LA 1ZBTA 2BDPA 4JV1A 1AXQA 1WF2A 3QYYA 1IBLF 4ELVA 2MB0B 1R8PA 2RRAA 2I5JA 1DJ0A 2GHVC 4O3NA 3PKYA 2R8KA 1H6KX 5IS2A 2RKIA 2HVHA 2OPQA 3DRSB 1KS2A 4ZVFA 4J9LA 4DQSA 4LF5F 4DN0A 2YWFA 1FRJA 1AFIA 2B3TB 5A0YA 5MAOA 2VKRA 5KFLA 4K0KF 1QJHA 2WW8A 2YKAA 2UP1A 3NCRA 5E3CA 2CZVC 4E8UA 4AL6A 2AJ4A 1WEXA 3T3FA 4DEZA 3T5HA 3HPOA 2ZKUA 4IYQA 2IM0A 1FJEB 2AF6A 3CMAS 1S1XB 3B4DA 3EPGA 4X4RA 1JJ2R 3LWMA 3PO5A 3KJVB 4DL7A 1H7XA 3MXHP 2MQLA 1QUPA 2DNOA 1SJ4P 2XMVA 4ZP6A 3VQTA 2CQIA 2Y1RI 4ZVEA 4M5DB 1YRXA 1KHWA 3D1HA 3K8WA 4WFBQ 1U48A 2PMHA 2ZH4A 3M32B 1M5PC 2C3OA 2HRYA 1WF1A 1C0UB 1S1XA 3OSPA 1GX6A 1B0PA 3MM6B 3M8PA 1LFWA 4USJC 3O1LA 2HGMA 5JUMA 3P49B 2BM1A 4FS2A 4Q8EA 1JLAB 1IKXB 1UJ5A 1X4FA 3M32A 1D9FA 2PEHA 2N3LA 5IFMA 5E7OB 3AJ1A 4WFZA 1TK8A 3NCPA 2FVRA 3DDKA 1DURA 3HKZD 3MM6A 3DLKB 5KG6A 3WBZA 5G0RB 3TA0A 2DNQA 5J2NA 4ELUA 3CT9A 2OMOA 3HZGA 2RQ4A 3TARA 1K73T 3V2UC 4KT0C 3PACA 4YR0A 2WONB 1IKXA 3JSMB 1GAOA 4TN2A 1RDRA 1K0VA 4QYRA 2IAJA 3QLHB 1YRUA 3CCTA 2FLLA 2CRLA 3DLKA 4IG0B 5G0RA 4NA1A 3QJPA 2K3KA 5CQGA 2PI5A 1OSDA 2RNEA 4F50A 3TVKA 1HL6A 2HHWA 4DR2F 4Q2MA 2CQ4A 2WK4A 1ZM2A 2ADBA 3M6XA 1RT6B 1FJ7A 1SH3A 2KB2A 4X2BA 5T7LB 5A8KA 4IG0A 3ZZYA 1UAWA 2R2TA 2A3JA 1H2VZ 3PX4A 3OBIA 2L3MA 2N3OA 4J9PA 2LA4A 2O01C 4HT5A 5F0UA 1KQSR 3I56S 1MROA 1Q1KA 2FJAB 1PILA 1GXUA 2KHCA 1S6PA 4HDHA 3CVKA 1RT6A 3P3DA 3OTOF 7FD1A 2UVUA 3CD6S 3TUIC 4C8KA 3CD5A 2W4DA 4FN5A 1NK0A 2NXUA 4LMZA 2VONA 4TYBA 3EGWB 4A8SA 1D8ZA 1QAIA 1MU2B 1UWBA 2F8MA 1VQOS 4YQWA 3T5KA 1JB0C 3H5XA 2CQBA 3SCIE 4OI0A 2EPIA 4ES3A 2OPRA 4GC7A 4I2QA 1HNVB 1XK8A 4Y00A 1GT8A 4J9SA 3O6QA 2DB1A 5F9NA 1JLCB 5L8RC 3AB2B 1VRUB 3DLGA 1F5BA 1WEZA 3IR7B 3EGZA 5EX0A 1DTTB 3CWJA 1MU2A 4ZPAA 5K8PA 1L3SA 2DNMA 1S79A 3SFGA 2AU0A 2FJVA 1SJQA 2NUUG 1HNVA 5A2QY 3IRWP 2G9OA 3OL6A 4ZPWR 1NKEA 1IQZA 4ZPBA 3IR6B 2JLFA 3S6EA 1FO1A 1VRUA 2IMOA 1U47A 4CT8A 3HK2A 2L48A 3HFKA 4JI6F 3FRYA 1M5KC 4DJBA 3A8EA 5CYJA 5L9NA 4LSNB 4U9RA 4NLPA 2YNFB 2BVZA 2XI3A 4XIUA 1KFSA 2CPJA 5HLFB 3GR1A 4DSJA 3HHNB 3MMCB 2JVRA 3E2EA 5KG4A 3RZAA 1N5YB 5KFPA 2ZVSA 3CJ3A 3GV5B 4WCEQ 3RRKA 3PFEA 2MSTA 4LSNA 3ZZ0A 4CTAB 4AXJA 2YNFA 3UDLA 4J37A 1CQNA 1WWHA 4F26A 2GJIA 2KKHA 2MZRA 2DPJA 4HEA9 4UQGA 3KLVA 3P96A 3IWNC 4K4UA 5HLFA 1ZPVA 2A1BA 4Z37A 1X5PA 4UW2A 4OI2A 1N5YA 5DGAA 4LFBF 2Y1IA 4NZ6A 3NAIA 1K1SA 2JSXA 4PWDA 1X5SA 1G1XA 1L3VA 4YR3A 2G13A 3SYZA 4A46A 3G9CA 4MH8A 4QWBA 4NLWA 3I32A 2BQ3A 1F60B 3CE8A 3I4HX 2B9XA 3KLIB 2FJBB 4FF2A 1UVMA 3NNAA 2XSJB 2FHKA 4HI1A 4MYTA 1PO6A 2KHDA 3TAMB 4F4WA 1IJFB 3T5LA 1VGYA 1KN6A 4DWIA 5DQIA 3CC7S 4C8LA 3SV3A 2V8HA 1RAJA 3CTRA 2N82B 4IDKA 5D3GB 1FKAF 4IR1A 1RISA 5KFTA 5SZTA 3MD3A 4CZCA 3AA9A 4B02A 3KLIA 1Z2ZA 5DDPC 2XSJA 2XS7A 2FGOA 2LDYA 3TNVA 2FUG9 1ZZNA 4H4OB 3IWLA 2R7TA 2RMLA 2GMJA 2R4FA 4DMZA 5IT0A 3W7BA 1Z4UA 2JVOA 4HVZA 3X1LB 2HS0A 5THWA 5HN0A 3QPIA 1JLFB 4QYZJ 2EKYA 4QCLA 3D0HE 2KO1A 4K59A 5LSOA 4ICLB 4K2XA 2UUAF 2W7AA 1FRIA 3I0RB 3TW0A