5FJ4A

Structure of the standard kink turn hmkt-7 as stem loop bound with u1a and l7ae proteins
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
97
structure length
97
Chain Sequence
b'TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
publication title A Critical Base Pair in K-Turns Determines the Conformational Class Adopted, and Correlates with Biological Function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 26
structure length 97
sequence length 97
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2015-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5fj4A00
1VQMS 2KI2A 1UFWA 2DHXA 5DM6Q 1AUDA 3ULHA 2DNHA 3ZZZA 2MQPA 2ERRA 2FC8A 2N7CA 3MURP 2U2FA 2JVOA 1FHTA 2MYFA 1X5PA 2E5JA 3BS9A 3N9UC 2RNEA 5DDPC 1WG4A 2XS5A 5GMKa 4M5DB 2N3OA 3BO2A 3VAFA 2LECA 1M5PC 1VQ5S 3VF0B 4FXVA 2DNNA 5LSOA 2KG0A 5LJ3Y 3CCLS 3MD1A 2DNLA 1P1TA 5IM0A 2CQGA 2CPHA 2DNYA 2XNQA 1VQOS 1FJ7A 3U1MA 2E44A 2D9PA 2DISA 2DITA 4LMZA 1FO1A 1QVGR 2XB2D 2N3LA 2MSTA 1X5OA 4TU8A 2F9JA 3SXLA 2VOPA 3CUNA 2KU7A 2MKHA 1W2BR 3S7RA 2DH9A 4J5OA 2B0GA 2DGWA 1YJ9S 2DGOA 4U67Q 1H2TZ 3G71S 1L3KA 2FC9A 1M90T 3CCRS 2HGLA 3R1HA 3TP2A 5D77A 3UCGA 3VALA 1WEXA 5BJRA 3NNAA 2AYMA 4PRFA 2MJUA 4C7QA 1VQPS 2OIHA 2MSSA 2I38A 1URNA 3UCUP 1DHMA 5GAEU 2CPXA 1OWXA 5GAGU 4YUDA 2AYGA 1SJRA 2ADCA 2YWKA 1D9AA 3J7YU 2LA4A 3MUTP 3IRWP 2MZJA 2CPYA 2AYEA 1M5KC 2RUGA 3CMAS 4CH1A 2MQNA 1Q7YT 1S72S 1CVJA 3HHNB 1KD1T 2DGTA 2DGSA 1U1LA 2DNGA 2KH9A 2HZCA 2L08A 3MDFA 2OTLS 3TYTA 2MB0B 4PR6A 2LMIA 1M5VC 4Y00A 2ZJRQ 3MI7X 1Q86T 5LSLA 1U1KA 3BO3A 3R1LA 1VBZA 1U1PA 2O3DA 1X4EA 2DNRA 5EN1A 2GHPA 1SJQA 4ERDA 2X1AA 2JX2A 2KYXA 1N52B 2MGZB 3P5TL 2MKJA 1VC6A 2VODA 2DNZA 2JVRA 4IO9Q 4Z2XA 3VAMA 3P3DA 1U1QA 1WTBA 2MKSA 2MKKA 2CPZA 3MUMP 3CC4S 3CCSS 2YTCA 2NZ4A 3UWTA 2F9DA 1M1KT 1HD1A 4CIOA 3G9CA 2XSFA 3I55S 1K73T 1OPIA 2WBRA 2ZJQQ 3HI9A 2DNKA 3UE2A 2EK6A 2KT5A 4CQ1A 1U6BA 4YB1P 1IQTA 1WHVA 2LA6A 2X1BA 5GVQA 2J0SD 1OIAA 2J8AA 5MLCV 3CCUS 1PO6A 1R8PA 4QU6A 2KFYA 2MZRA 2M7SA 2XNRA 2EK1A 1VQ7S 1KOHA 1DZ5A 2CQ2A 1YJWS 4F02A 1O0PA 2OTJS 1WHYA 1OO0B 3LQVA 1M5OC 2M4MA 3NNHA 3S8SA 2DH7A 3IWNC 1YHQS 2RQ4A 2QA4S 2CPEA 3H2UB 1VC5A 4OZ0A 3P6YC 2OJ3A 2CQBA 2KRBA 1HA1A 4YOEA 2HGNA 1WF1A 2U1AA 3CULA 2JWNA 2DNOA 2M8HA 5JVGQ 3P49B 5H1SV 2CQ4A 4UY8T 3OW2R 2DHAA 4ZKAA 2MXYA 3CCES 2G4BA 2MY7A 1B7FA 1F9FA 2AYBA 2KVIA 2DNQA 1WWHA 4P6QA 1K9MT 4PKDB 1G2EA 1X5TA 4IOAQ 2DHGA 3MUVP 3Q2TC 5FJ4A 1WEZA 1H2UX 1XN9A 3PIPQ 2D3OR 2L41A 3CC2S 2CPIA 2KN4A 2I2YA 4OZ1A 2JRSA 1JMTA 2DGUA 2VONA 3Q2SC 5DDQC 5DETA 2N82B 2FPHX 2NLWA 5IQQA 1UW4A 3ZZYA 5LXRA 4WFBQ 2X1FA 1WHWA 1RK8A 2DGVA 2UP1A 1X4BA 3LPYA 1DRZA 4CH0S 2A3JA 2DIUA 1WHXA 2XS2A 3CXCR 1WG5A 2EVZA 5HO4A 2FHOB 2CQCA 4QU7A 4ED5A 2YH1A 3G6ES 1X4FA 2OSRA 2J76E 1YI2S 4LIRA 3NMRA 1FT8A 1NO8A 2F3JA 1X4GA 2MY8A 3THTA 1FJEB 2RRBA 2RS8A 4IOCQ 3J7ZT 1X4HA 3MD3A 4WIIA 1WELA 1WF2A 3PIOQ 4TLQA 1H6KX 2MPUA 1VQ4S 4F25A 5CA5A 2MZTA 2GO9A 2YKAA 2MQMA 1K8AT 4Y0FA 2HYIB 3DLLQ 4IUFA 5DDRC 3MOJB 1U6FA 3NS5A 5CYJA 4WKRA 1DBDA 2CPJA 2KM8B 1UP1A 3I56S 3CC7S 2DIVA 2DO4A 3NS6A 2Q79A 1WI8A 2V94A 1UAWA 2CJKA 5LXYA 2CQ3A 4V19X 4C4WA 3L3CA 1NJIT 5IM0B 5D78A 5CXTA 2VOOA 3US5A 2DGXA 1Q82T 1ZH5A 1SXLA 3CCVS 3H2VE 2E5GA 1WG1A 1U1NA 2K3KA 3FEYB 4QQBA 1X4AA 4A8XA 3G8SA 2LEAA 2CQ1A 4QPTA 4EGLA 1BY9A 1FJCA 1WEYA 2M0GB 2LEBA 2DHSA 1HD0A 2AD9A 3VAGA 1X5SA 2PE8A 2G1DA 2KXNB 2CQHA 2CQDA 1YITS 1FNXH 3UD4P 5LJ5Y 2BZ2A 2MGZA 3G4SS 1VQ6S 1X4CA 3CCJS 2J0QD 3TO8A 2MJNA 3K0JA 1SJ4P 1U1OA 1VBYA 3NNCA 1P27B 2ADBA 2E5HA 2LQ5A 2D9OA 2RT3A 1YWXA 3VAHA 5GADU 3CCQS 3VAKA 2KHCA 3BO4A 1A9NB 3CCMS 2M2BA 1PGZA 1SJ3P 2HGMA 3VAIA 2CQ0A 2M8DB 3SDEB 1N8RT 4W90B 1S79A 5DM7Q 5GAHU 3RW7A 1VQ9S 3VAJA 2MZ1A 3CTRA 1JJ2R 1VQKS 2OSQA 4UQTA 2DK2A 2K8GA 2L9WA 1D8ZA 4TU9A 2RVJA 2KRRA 3R27A 1ZZFA 3MXHP 1U1MA 2RU3A 3S6EA 2CPFA 2FY1A 4WFAQ 4F26A 2DNPA 2KXFA 2M70A 2RRAA 1QVFR 1H2VZ 2M9KA 3CMES 2QFJA 2CQIA 1YTYA 5JVHQ 2LYVA 3BEGB 3EX7B 1ZZNA 5ITHA 2CPDA 1SJFA 2MQQA 4TU7A 1NU4A 2ZJPQ 4WCEQ 2DO0A 3RW6A 2M88A 1U1RA 3CPWR 2PEHA 2MQOA 4WF9Q 2LCWA 2G0CA 4LJMA 3UCZP 3SDEA 2SXLA 2MMYA 2KM8C 1KQSR 3EGZA 1FXLA 2DNMA 2RQCA 2DB1A 1VQ8S 3EGNA 2KXHA 1U2FA 2RS2A 1HL6A 3B4DA 1YJNS 2MQLA 1VBXA 1R8HA 3S01A 2CQPA 3B4MA 2E5IA 2YH0A 3G8TA 3SMZA 3D2WA 3V4MA 3UD3P 4WFNQ 1JJ4A 2XS7A 2X1GA 1WI6A 1Q81T 3U1LA 2QEXS 2LXUA 3FEXB 1X4DA 5IFMA 3THPA 1JJHA 2MHNA 2M52A 3CD6S 1N54B 2HVZA 5HL7Q 1QM9A 5DDOC 3G96A 2MZQA 2LXIA 2BOPA 1N88A 3JB9k 4RU2A 1RKJA 2MZSA 1KOOA 1VC0A 1VQLS 3CF5Q 1KC8T 1X0FA 1VQNS 2DGQA 2LKZA 1YIJS 3DXBA 2MKCA 2MKIA 4BS2A 1A7GE 1WF0A 4FXWA 2DH8A 4C0OC 4W92B 2KG1A
chains in the Genus database with same CATH superfamily
3A8EA 3ISZA 1AUDA 1BMQB 1X7VA 4RNFA 3DHWC 2HHHF 4PEOA 1J2VA 4M94A 2RNEA 2HS4A 3P4UB 1S97A 2BVZA 2ZD1B 4E0DA 1VQOS 2KJVA 3QZ7A 2ZZTA 2F9JA 2E7VA 1TMJA 4P74A 2DGOA 5A8RB 4UT4A 2C2EA 3C66A 5GADI 1L3KA 2QRRA 2E1PA 2H54B 2OGUA 2F4VJ 3TZXA 2PT0A 4ICLB 3UCUP 5GAEU 3DOMA 1GXUA 1NPPA 1CQNA 2VD3A 5HJYA 4FBUA 1U1LA 5F9NA 2GIRA 1VDHA 2PA8D 4G1PA 2DRBA 2LQJA 3K8VA 4DXLA 2HS3A 1C0TB 1YZ7A 1RSCA 2LMIA 4PYAA 2W4PA 2Z8QA 1C4AA 4LR9A 4AQYF 1R8BA 2MGZB 4ILMA 1TL1B 4MIWA 1OYEA 4DCOB 5J2MB 4TQSA 2KHDA 1XK8A 5ETMA 3R7NB 4DR6F 2MKKA 5KFUA 4ZVRB 2UUWA 3QSIA 5F8GA 3G9CA 3I55S 3D9BA 2ZH1A 3HFZB 3HF5A 2G13A 2RIJA 1JLEB 1FKPB 3OBIA 5K20B 2P9CA 2GJIA 3LO3A 4D3HA 2CQ2A 1D9FA 4DG1A 3MECA 2B4VA 4RNOA 2HHUA 4C48A 3E3XA 2C2DA 1RWKB 2GMJA 4I2PB 3W66A 3ZC4A 2V2ZA 1F9EB 3CULA 3AODA 3AH6A 1NZAA 1GAOA 1F9FA 1JLBB 4JI3J 1Y4ZB 1R0AB 1Q7LB 3O6QA 3F0NA 3QLHA 3CB4A 3CC2S 3C3LA 1IM4A 2QC3A 4LF9J 2VONA 5B0GA 2X3DA 1YDLA 3Q83A 1AFJA 3WIVA 1MMLA 1IKXA 1QJHA 4EEYA 2OEKA 3Q8RB 3PACA 4C2MA 2YH1A 3ZZUA 2G0IA 3MM6A 1LEOA 1WORA 5J2QB 4EO8A 1RT7B 2YNFB 2RRBA 4FN5A 3MMJA 3TR5A 3LUYA 4LIWA 2QGFB 1VQ4S 4JI2J 3L4BC 1VR6A 3LOUA 1WC6A 1V3RA 4IYQA 2KM8B 1YJTA 2C2NA 2P8IA 3M4XA 4F8RA 4P2XA 1O5JA 4U9RA 3PO5A 4B02A 2ZHAA 1M1HA 2IDLA 1SXLA 3LH2S 2WW8A 3OLBA 5CZXA 3POTB 4MYTA 3TOQA 2RRNA 2AD9A 1SH2A 3L7OA 4PWDA 3MEGA 2CQHA 2KZZA 1HNXF 2HNYA 1JNRB 1S59A 3RB4A 2MJNA 5HMWA 4DU8A 3FFIB 3VAKA 2HMIA 4OYPA 4CLZA 1N34J 4CO2A 5HN0A 5ETRA 2CQ0A 1RTDA 2YXLA 4AFFA 1PKUA 4AXJA 3TUPA 2VG5B 3S6EA 2QL7B 3HHLC 2M70A 1H2VZ 1FVQA 4F7VA 4XO0A 2L48A 4DR1J 2QA2A 1IR0A 3G8QA 3MMBA 3BEGB 2C2ZB 2BJ3A 2HWIA 1RKIA 2M88A 3M2UA 1LWCA 3ZNJ1 2EPIA 4DQRA 5J2PA 4O44A 4YS2A 3JTOA 2RQCA 4ZJQA 2W2PP 4QYRA 5G0RA 5I4MA 1MROB 2UVVA 4DL6A 4O3NA 1R8AA 4DCPB 1WUUA 2ZEJA 4N8OA 3H5SA 5KG4A 4YB6A 2G2ZA 1GK8A 4OJHA 1UA1A 3CJTA 3TVZA 3ZTOA 3DN9A 2MZQA 4OFZA 3NBPB 2IJFA 5HQ8A 1FWLA 1KOOA 1S6PA 2Y0BB 1JKHB 3RAMA 2IMWP 3BSAA 4FXWA 4C0OC 2OKQA 3M8YA 1RBLA 1S57A 1YRUA 1NKBA 4OV6A 1DFDA 1QTNB 4WE1B 3UVJA 4JV1A 1SUQA 4OHXA 5GMKa 1S4EA 3DRYA 3VQSA 1N33F 1HNVA 3QSYB 1JLGA 5IXUA 2OP5A 3ZZPA 5A0YA 3SXLA 5L46A 3HVAA 2DGWA 4C9DA 3GCWP 3CDWA 3KLIB 2JEJA 3QMQA 4M5KA 4HKQA 1U6ZA 2ZFHA 2OH2A 4YQWA 5KT4A 4I6YA 4PRFA 4EO6A 4K4XA 1TL3A 2Z56B 3T5KA 2IM1A 2ZWOA 1S5ZA 2JJ4D 4ZIWA 5CCLA 1EKSA 2Z2ZA 1D9AA 3NWRA 1HBNB 2RUGA 3AB2B 1PC5A 3EJMA 4FVCA 2EBGA 2HZCA 4ALZA 4CLYA 4EBDA 4QYZJ 2ZJRQ 4UF4A 1SVDA 5LSLA 1KWMA 1LKZA 5EN1A 4K4WA 1Y5IB 1LFPA 1U7LA 5E3CA 4ID5B 2BRLA 4GO5X 3W65A 4C11B 3ICLA 1VRTA 5I42A 3AQPA 1S99A 5LL6d 5KFTA 5MLCV 1NK8A 1H38A 3K5MA 1R8PA 1EAYC 1TKTB 1ZPVA 1U48A 1WKJA 5DG9A 2RAQA 2OTJS 3R6LB 2OFGX 1CJKA 1M5OC 4OZ0A 3OFFA 2QA4G 3EPIA 2HW3A 3QAUA 3W2VB 2OPQB 2RKIA 4ENOA 4DQSA 1HHTP 1HW8A 2EW9A 3PDNA 1H73A 3TZZA 4CLTA 1J5OA 2VPWB 3GYGA 4FF3A 1SKUB 5IV4A 2ZITA 3U02A 3LP1A 1F5BA 2B5JA 3OT9A 4RL1A 3QRRA 2IYGA 1X4BA 2A3JA 1GX6A 3CXCR 2CQCA 3G6ES 3MAQA 4YR0A 4XDCA 1FT8A 1IKYA 1S1UA 4RKUC 4KV8B 1WOPA 3AD9C 3HSGA 2HPUA 1RBAA 1YK9A 3I5AA 1RAGB 1K8AT 3FCWA 2HYIB 2AV5A 3V6HA 3O8WA 3PYDA 2XMAA 3M1VA 3KLEB 4DV4F 4X4QA 1XQIA 4OLOA 5KFFA 3T1HJ 5HSPA 2W8KA 2FVRA 1PC4A 1RAAB 3MAAB 2PE8A 5C24B 3NG8A 3TRGA 4LVNP 2NSBA 5FD1A 1KHWA 1U1OA 2WTFA 2RU9A 3M30A 3BO4A 3QGHA 2DR7A 2XY6A 3SDEB 1OYDA 1VQKS 2ZC4A 4O23A 1JK9B 1RP5A 1AXQA 3OTDA 4A8MP 4PABA 2EG1A 1UVMA 4KR0B 3DU6A 4WFAQ 1T3NA 4BHQA 5KFJA 2QYGA 3T41A 1GQEA 4PXCA 1OMSA 1ZZNA 2DXDA 2Q6CA 2QTWA 1VYAA 4QYZK 3IG1A 1Y3KA 1F3FA 4XAKA 2OELA 1TAUA 3EGVA 2ZE2B 4C8NA 3SCLE 3Q8QB 1LWFA 2XHCA 1VQ8S 3V81A 3KJQB 2OI2A 3D6TB 4AYBD 1NSPA 3DYAB 1LNQA 1QD1A 2GZOA 4U7CA 1DAXA 1KLMB 5KFPA 1UETA 1CJTA 2E7XA 2IAJA 4Q8EA 3W8GA 1RGVA 4O3OA 1TV6A 2C3PA 3H0PA 4B17A 2UV8G 1IKWA 1RKJA 3VR1A 1EP4B 4GKJF 2FZKB 2Z30B 1A7GE 5HROA 1VRUB 3EWGA 1UFWA 1APSA 1BQMB 3ZZZA 2GVZA 3C8YA 3MMCB 4YDXA 1X5PA 4K4SA 3M2VA 5SZTA 4F4KA 5KFHA 3RRKA 2VG6A 1C1BA 3T9ZA 3TJ8A 3AHPA 4CLWA 1FDNA 3UFCX 3MWBA 3KLFA 4WTOB 1TU0B 2ZH5A 3LF0A 4C8OA 2A2CA 3JYTB 2HFOA 2RDJA 2FJXA 2HGLA 1GMUA 1N32J 3M8PA 3TP2A 1HPZA 3RG6A 1CJVA 2PFDA 3J81U 2F5GA 1NAQA 3RU0A 3MM5A 3WBZA 4WTYA 2V0NA 2YNHA 3MOZA 3D3CJ 3BGRA 2NUUG 3QZ8A 1PAUB 2BE2B 3BZQA 2F4VF 1CJUA 3EMTA 4Y2CA 4QPXA 2E1CA 3MEDA 3BGFA 4IQXA 1RTHB 1SJQA 1ZAVA 4KKOB 3TQEA 2GGPB 1UKUA 4P72A 2DNZA 4IO9Q 4LQ9A 4IFYA 3IR6B 3KK3A 3TI0A 5M2RA 3MUMP 3CC4S 4JYAJ 3ZTQA 1S7IA 1C2PA 5FDLB 4WKYA 1OPIA 3IRXB 4CQ1A 5I3QA 1HNWJ 3TAMB 4DZ6A 3PHEA 1OIAA 2OLWA 5RUBA 4O4GB 1DLOB 2EFQA 3SQGB 1B0TA 4QWDA 3FQLA 4N8NA 1EHWA 1RHMB 1KOHA 2FIUA 5DGBA 3C6TA 2HHSA 1OQ6A 5KT5A 2Z2LA 1C0UA 2ZNYA 4ED8A 2JWNA 2DNOA 2M8HA 3BKUA 2EFNA 3UDCA 3C16B 1ZAWA 2OPRB 3SYZA 3TX0A 1VBKA 1BWVA 4M5DA 3I4PA 1JMTA 3V4IB 5DQGA 3Q2SC 3M8SA 4M5IA 5HBMB 2ILZA 2RMLA 2BKPA 4L73A 2LDYA 3OR2B 2IVFB 4JI3F 4HHHA 2E9TA 3M8ZA 1U49A 3ETMA 3OFHA 4LF9F 4J9NA 3M8RA 1X4HA 2J7WA 3C2PA 3MM8B 4X84A 4J9OA 1ICEB 2MQMA 2J7UA 1AW0A 4DV2J 3NLCA 4LSNA 4ZCIA 3PYGA 2DO4A 3MFHA 2H48B 2GJ2A 4V19X 3TUJC 1LK5A 3L9ZA 4TVAB 1NSKL 1RLDA 4LR7A 1FRXA 2E9RX 4JI2F 4FXDA 1Y00A 4IRDA 1FJGJ 5KFGA 2CQDA 2OD6A 2YPYA 2WW4A 3G4SS 1S10A 3DMJB 1G6BA 2RHQB 4LREA 3OUYA 1QTMA 1UPMB 2D9OA 4JI0J 4ED3A 3CDAA 3SEOA 3GG1A 3KXDA 2LQ8A 1VQ9S 3B78A 1NDCA 3HMJG 3BQ0A 4WU2A 3LW5C 1LW2B 2ZHBA 4XPEA 2EXUA 3BKFA 2A0FB 2GCFA 1G4CA 1OS5A 3ET6B 4J9RA 1N34F 3DI6A 2YX7A 2EC0A 1ACMB 1RAEB 5A6WA 1LV5A 4HL9A 3QRPA 1RAOA 2BW2A 4NWBA 2IJRA 2LQ9A 3E2EA 2XLJA 1AROP 4ZLNA 2O1PA 4CZCA 1FXLA 3K57A 3MR6A 4LF8J 4DR1F 1RBOB 3VGSA 3NGUA 1MNEA 3LP0A 2E5IA 2UZAA 1VHIA 4NYOA 2AGQA 3D2WA 5J1EA 1JWWA 2JLGA 3PJ9A 3AXKA 4J9VA 3R7BB 4NRTA 1JXVA 4ZLLA 1FKOA 4LBIA 2AX1A 2WAQD 1S1TA 3T1AA 5B0CA 1YIJS 3TAQA 3BPDA 1X60A 2KG1A 2OEMA 2KI2A 4DX6A 3G6VA 2IM3A 4NA1A 2NYHA 1Y9OA 2WSFC 4RBUA 3MURP 5MAOA 1H98A 2MYFA 3N9UC 2BANA 2E9ZA 1P8GA 4MAKA 1ZM3A 1HHSA 2DNNA 1XNRJ 4TXSA 4J9MA 4ZK7M 1F2GA 2BQRA 2AJ4A 2JH3A 1FE4A 2ZVIA 3WC2A 2E44A 3CJ5A 4EWTA 4UQGA 1SKRA 2VOPA 3I5CA 3W2WB 5CYMB 4DR4J 5B08A 3BB5A 2V68A 3EZOA 3TA1A 1NSQA 5A8WA 2GA7A 2WVDA 3LA0A 4KPCA 2DHHA 2VPYB 2AYMA 4ZMMA 2VPXB 4Q0BB 4ANEA 3HHLD 1DHMA 2HQCA 1RHRB 2MZJA 1DURA 4C97A 4OZ5A 4Q8FA 2APOA 1KD1T 3M32A 3N0VA 1T9VA 3UN5A 2CA9A 1NRKA 2HVHA 3PR4A 2OTLS 2C3OA 2WRMA 6AT1B 1S48A 5F8MA 3H90A 4FKXA 4DG1B 2O3DA 3MECB 1TR0A 2WOMA 1RT4B 3CE8A 4OHZA 1YSJA 2JVRA 2FJEB 3T5JA 4HYKA 3D7SB 4ER8A 3GR0A 1RISA 4QCLA 2WBRA 1NK5A 3OL6A 4YB1P 4OYMA 1JXEA 4R5PA 4KIAA 3QLHB 4PG7A 1HBMA 3R5GA 5DRKA 2YKNA 4DFPA 2Q3PA 3FSIA 3NNHA 1LWEA 4IQMA 2W2OP 2UXBJ 1IKXB 3LGHA 1HA1A 4DR3J 1HWIA 3TJAA 1HQEB 4I68A 2R8HA 5JVGQ 4FYXB 5BYSA 2A1BA 5EWEA 5DQHA 2CQ4A 2AT1B 5T7LA 4CH7A 5K14A 2BRKA 1G2EA 2JLFA 2YKQA 3GFXA 4L3NA 2BEFA 3EVOA 1X0PA 4DLEA 2F8MA 2N82B 4P10A 5IQQA 2H65B 2OEJA 3WC0A 5D6GA 4JI6J 1EARA 2FJAB 4TYAA 3W5ZA 3FNNA 5BR8J 2CJQA 1QAIA 3DLJA 3THTA 4DUYJ 2BJEA 5DG7A 1Z2ZA 5GAGI 4GRSA 1U47A 5LT5A 2RH3A 1WF2A 3MEGB 4PWDB 4MIAA 2XSJA 2ROPA 3KMQA 2VBWA 3X1LB 2V8VA 3NS5A 1YBTA 3ISNC 2OFHX 2BJ8A 5K8PA 4G1IA 2GQ2A 2K7KA 4CLSA 5HVFA 4P2FA 3QIPA 4PXEA 3US5A 4U7UK 3ILIA 3MR3A 2ZH7A 3R5CA 4A8QA 3H2VE 2E5GA 2QL5B 3GU0A 3BSCA 5KT7A 4JBCA 2W4CA 3G8SA 2QMWA 1YITS 1PBUA 2EFGA 3MMBB 4I6AA 2W8LA 1KFDA 3Q0AA 5GADU 3T1HF 2Q66A 2YWHA 4BWMA 2HGMA 4WFZA 2WB4A 1S79A 5DM7Q 1UEKA 3DNCA 4RX6A 2WZ1A 2CDQA 1FX2A 1SL0A 1S0OA 1JQGA 4J9KA 4F26A 1NJWA 2BX6A 3HK2A 2H4YB 3ADAC 2CUYA 2C42A 1FTCA 3V5RA 1Z1ZA 3TUZC 1FDBA 3HHEA 1OY9A 2ROGA 1OQ3A 2MMYA 2KM8C 1ZM2A 1XBWA 3K5PA 4USTA 2W9CA 2GMLA 4PZVA 3EYZA 1VBXA 3TUIC 2XMKA 3B4MA 2J9DA 5L1JA 3BSOA 3V4MA 3UD3P 4K5SA 3UVJB 3MCNA 5KG1A 3MEKA 3U1LA 1SUQB 3R8YA 2D74B 1I5OB 1QE1A 5A76A 1HNZJ 1HNVB 2B7CB 3U1NA 3OHAA 3AOAA 3HHLA 1VQYA 1JLGB 4DSLA 3OQ2A 3HPOA 1YJVA 1D09B 2ZH2A 3CD7A 3CF5Q 3R5DA 1U09A 4DSKA 4C8ZA 4ZLJA 3N6LA 4ZLPA 2DHXA 4ILRA 4PUOA 2N7CA 1U02A 4ZPBA 1I94F 1MSWD 4KO0A 2YBVA 1VQ5S 4DQIA 3NP5A 2GQCA 5C2GA 3CIZA 3ZZTA 2XNQA 3QJPA 4PQAA 3E8OA 2JEIA 2AGOA 5A8KA 3PX4A 2W25A 1YRXA 1X5OA 4TU8A 1F1BB 5HP1B 3CUNA 3KLVA 4IG0A 3S7RA 2JZ5A 2M5YA 5KTQA 2E66A 4NL5A 1KQKA 1SIZA 3CCRS 4ZVSB 5GAHI 1NK6A 2B4OA 2QJ3A 3RB0A 3OR1A 3NGDA 2OIHA 2BJ1A 4TY9A 1RWXB 4DI6A 3BBCA 5HANA 2V5HG 3DRSB 1VRTB 2CADA 2Z4PA 3MPYA 5I42B 5B0AA 1N32F 5K9FA 2CKWA 2DGTA 1TL7A 2ZBIA 1HBUA 3WX8A 4OV1A 1WC5A 1JIHA 4IH6A 4DPTA 3FVYA 2CZ9A 3DRRB 1U26A 3MEEA 3HXMA 2HQGA 2QZ8A 4OIXA 1EJ7L 1N5VA 5KT2A 3KYLA 3CWJA 3P3DA 2Z2MA 2RKIB 2MKSA 4BWJA 3I5BA 4CO1A 4RWXA 2HIQA 3A4TA 4ZCMA 3A3NB 3PTWA 2HKEA 1RTJA 3E01B 2N7YA 4NI2A 2V4JB 4LF6J 1DZ5A 3LP1B 1X9MA 1I1GA 1GNKA 5CYQB 3TZWA 3S8SA 4KY3A 4JYAF 4B9SA 2CPEA 4U7UD 1GH8A 6FD1A 2CVIA 2IMOA 4FVMA 4KGZB 4RLEA 4USKA 1HNWF 1QSSA 2PGCA 4OJGA 4DF8A 2XHWA 2DHAA 2HZAA 1L3TA 2ZOFA 4NMLA 1DQAA 4NLRA 1WWHA 4QWEA 3MR2A 2HFVA 4FYWB 2L41A 2CG4A 4HHJA 2UVWA 3W9HA 2HQ3A 4WFBQ 5G4DA 4ED6A 3AD7C 2UP1A 3LPYA 5IC6B 1E6YB 3CSKA 2C3YA 4ZJOA 1HYSA 2O67A 3GZ7A 2ZBCA 4LSLA 3ZNUA 2B4PA 1N6QB 3PV8A 3J7YI 1NJZA 2EFOA 4ZVPB 2F7VA 2GO9A 2YKAA 1T05B 3I87A 4Y0FA 1Q1KA 2CPJA 3MAHA 1IBKJ 2HLUA 3NS6A 3M30B 2HEKA 3BQ1A 4B9NA 4QZVB 5K8OA 2AMCB 1NLKL 1RZMA 4DUTA 2CQ3A 4HT5A 1HKAA 2YQ3A 3AAWB 2WVCA 2G1HA 4FS1A 3GIJA 3PEJA 3C15A 3SCIE 4DV2F 1UZDA 2XYPB 5KFRA 4K59A 3TW0A 2EBEA 1UWBA 2ZUGA 3ZTSA 2W7OA 2BZ2A 4YMEA 4DR2J 1REVA 4ZCLA 1SJ4P 3SV4A 3H5YA 4ZPCA 2YWWA 3IG1B 4LF7J 5T14A 1KKHA 2I5JA 2R7WA 3M7VA 1N8RT 4H4KA 5D0GA 3OVBA 3CD5A 2MZ1A 3CCZA 1UCNA 1NK9A 2V9WA 2OD4A 1FJGF 4PXBA 2KRRA 3M9NB 1S76D 2QO3A 4FYDA 3CMES 1T9UA 3NAIA 2CDRB 4RJVA 1AZSB 4JI0F 2BM1A 2J0XA 5ITHA 1F60B 4A8KA 1FK9A 4EUVA 1TV6B 1TL5A 4YHHJ 4WF9Q 3D6HB 5HMYA 3KUGA 1T9XA 2G0CA 4KHPJ 4J9QA 2P9EA 1RT5A 3M6XA 2MQLA 3CJRA 3BQ2A 3MPDA 2A10A 3F73A 2YH0A 1NM2A 3G8TA 4YP3A 4WFNQ 3W60A 2HBZB 4P9SA 3BN4A 3BN7A 1S9EB 4I2QB 2ZH8A 4K0KJ 2HBQB 1QLNA 5HL7Q 3GWCA 4OL8A 5DDOC 3PY8A 1YRTA 3TA0A 3CDUA 2VG6B 4LF8F 4X62J 4J90A 1C1BB 4MKBA 4Y28C 5C42A 4DFKA 1VLYA 1RI7A 3KLFB 4BS2A 2C2MB 3BV8A 3D67A 2E29A 2GO8A 4WP8A 2KO1A 4USJC 4U96A 4EI2A 1HPZB 1FVSA 2XYHB 1CJVB 2N3OA 3MM5B 2KG0A 3MD1A 1VIOA 2YNHB 5IM0A 1VIXA 3BH6B 1D8YA 3AA8A 1KVJA 2JLEA 3OTCA 4WYLA 2FHKA 2VUGA 4ECUA 2O66A 3A12A 2XGPA 3I9ZA 5CH7B 4URGA 3MM9A 1CJUB 1F0XA 3V6DA 3W5YA 1XNRF 3MEDB 2Z58B 2ZBQA 4AD6A 4FF2A 1S1XA 2DEJA 3KG4A 2IRUA 4OZJA 2BMBA 4IDKA 4IFYB 3DOLA 4DR4F 3VVTA 1V3SA 4K4TA 2IHR1 4UOGA 2YWGA 4TLRA 2DNGA 2EEYA 2RF2A 4NMXA 2UVUA 4BDPA 3CJ8A 3K89A 4B3TJ 2NSCA 5D3GA 5I3UA 1YJUA 5KFCA 5J1PA 2CXEA 4DL2A 2BOAA 1UEUA 3K5LA 2UUTA 1HMVB 4C98A 3D5MA 1T0TV 2GVDB 3RBEA 5B7WA 1WJ9A 2BE7D 3MR5A 2X1BA 1R0BG 5F0WA 3K17A 4FDFA 4CM2A 3NGRA 2B6AA 2ATLA 3FSXA 3IWNC 4OX9J 4UUXA 1O6XA 2XCAA 2R8KA 1HBOA 2HK3A 4F3QA 1S0VA 2V63A 1IJFB 5AXLA 4O3RA 2WK4A 2NREA 3V2UC 4ZA1A 3MCSA 2AEMA 5KAKA 2UXBF 2K3IA 4DR3F 4X4RA 4LSNB 2DR5A 4I64A 4QW8A 1S6QA 2NZCA 1IKVB 5H9FJ 2VASA 1RA7A 5HLFA 3UDEA 2X3GA 4KFBA 4QJVA 4GVBA 1YI2S 1NEEA 3CJ0A 3P96A 2XG8A 3AD8C 3MFIA 5F9LA 3Q22A 5ETTA 3PFOA 1T03B 2NXUA 4NLGA 4NRUA 4JI6F 3KG0A 2KT3A 3H40A 1RLCL 3J7AN 3I32A 4I56A 4L75A 5BR8F 2BR0A 3K5NA 2ASJA 4GKKJ 1UP1A 2QSFA 3I56S 2Q1LA 2Q79A 1T8EA 3EE3A 2FLNA 1ZOTA 2XTJP 2YNGB 4DUYF 3RRHA 1NJIT 1Q0NA 1U0SA 2E1RA 4OZ3A 4F36A 1NDKA 2CNLB 2HHQA 2K3KA 5B0DA 3FEYB 3P45B 4A8XA 2DY9A 4ELVA 3DGVA 4DQQA 1UL3A 3IBCB 3FUYA 2VFTA 1FNXH 5LJ5Y 2RILA 4J91A 3DI6B 4O0IA 1X4CA 3TO8A 2ADBA 3KJVA 1EETB 1HNIB 2HHVA 1TL4A 4K4UA 4MFBA 3BYPA 4XDDA 3VAIA 1FI4A 2YNIB 3D1HA 5AE1A 1T95A 5AXNA 1HW9A 1H72C 2L9WA 3HSDA 3PZPA 1ZZFA 2W9BB 3LP0B 2QLFB 2LP4A 5J2NA 4DV3J 2XO7A 4K2JA 3FMWA 5J1EB 4ECSA 4AL5A 1CEZA 2DPJA 1N48A 4USHA 2ZJPQ 2GMHA 3QNWB 2DO0A 1S9GA 2XY7A 1FXDA 2LCWA 1S1TB 1TKDA 1HWJA 4JV0A 1CQMA 1FTRA 3NGTA 3BJYA 2CWXA 4J9LA 3C6UA 4C8YA 3FQKA 5KFQA 4M8LA 1JLFB 2VZ9A 2BJ9A 4F2SA 3MF5A 1D9DA 3MMAB 3VGTA 3CD6S 2PSZA 3BGLA 2PO4A 4NX9A 4PG4A 4CI0B 3PR5B 5EUHA 3RB3A 3RB6A 4C3LA 5B0BA 3IGVA 2F40A 1CS4A 4ZP6A 4DWIA 4LFBJ 2LKZA 5L1LA 5E33A 4FYYB 3ISND 4UOFA 2PIIA 1ELOA 3GYXB 3ILJA 4Y2KA 2Q6BA 4N7TA 1HNZF 1SPBP 2FC8A 3MR7A 3PM9A 1TAQA 2OPPB 3MM7A 4FXVA 5KG0A 4ANDA 4ES1A 5KFBA 1REGX 4LRFA 3QT5A 2DISA 3N79A 2Y1LB 4ZPWR 4ZVHA 3Q8UA 1QSLA 2AIRB 1WSVA 4FNIA 4X4SA 4XPCA 4L72B 2ACMA 5F0UA 4ZVQB 4NCGA 3KLGA 2HNZA 5H9FK 5CCMA 3G71S 1D1UA 4N5SA 1TK0A 2B9WA 1RT6A 2DKOB 2PI4A 4L6V3 4OZ2A 3TAPA 2GS8A 4FZVA 1TP7A 5D4LA 4F4AA 1URNA 1IR1A 4ZN1A 2VFSA 4YUDA 2ADCA 2KYZA 3MUTP 1T94A 2CNNB 2LQBA 4YR3A 4GO7X 2Y8YA 3MCOA 2V9KA 3GONA 3HKZD 4R5PB 3TYTA 4PR6A 1U0HA 2QLXA 1JLCA 2Y1IA 2J8SA 2HSEB 1BHNA 2YKNB 3RBXA 3M6VA 1LWEB 4Q5VA 4DUZJ 4NPOA 4MKVA 4RUCA 1OPZA 3CJKB 1HI8A 3QFHA 1GEHA 1KVKA 1L3SA 1ZA1B 1TUVA 5K14B 1WHVA 1JLQA 1KQGB 4FKYA 4X4UA 5I3PA 3QFWA 4N77A 4IRKA 4AT1B 4MKYA 2ZDOA 3LQVA 2M4MA 5CQGA 2YKOA 2OPSA 1VC5A 2DVIA 1S0NA 4QIWD 3DOKA 1TKXA 4NYPA 3WQPA 1N36J 2EKNA 2MXYA 2YKMB 2FVQA 4LF6F 4HH1A 4WBFA 1HWUA 1K9MT 4YDDB 1KQFB 1LW0B 4DN9A 2VC0A 2IIHA 3EZUA 2KN4A 2XSJB 1PILA 4JI8J 4DPOA 4KRWA 1W25A 5CABA 1RHQB 1FFSB 2FZCB 2XS2A 2EVZA 1J27A 3MTKA 4FBTA 4QIFA 2VIHA 3QIPB 3G87A 4JP8A 4LIRA 5A8RA 4RW7A 3BREA 2MY8A 3A8KA 1NDLA 1QSYA 2G2YA 4TN2A 2ZH4A 2B7BB 3ZTRA 1CC7A 3J80U 1FRKA 3DM2B 3NRBA 1T9WA 1WACA 5IZHA 4JI5J 3SSSA 3GE9A 4PG6A 1NJXA 2ZBRA 4ICLA 2W4DA 3O5TB 1TKZA 2KTQA 1NMEB 3FBBA 2E7WA 4C0HA 2HZVA 2BABA 1IJEB 2RE1A 4OX6A 3H7HB 1ZH5A 2IC3A 4ED0A 1SH0A 2QFIA 1BY9A 1IWAA 3B8HA 2V8PA 4GC7A 1IBKF 3QATA 3H8YA 2BW7A 4RU9A 4MH8A 2MGZA 2PMWA 1KRPA 3UDLA 1TZ0A 3Q86A 4KAIA 2XO6A 1ZBTA 2LQ5A 3VAHA 2RT3A 4QWCA 5EDWA 1XMBA 1PGZA 1SH3A 1WSRA 2M8DB 4M1KA 3RW7A 4ETZA 4Q2MA 3CTRA 3O3LA 2W9CB 3N6NA 4RBTA 2KVQE 4DU7A 4P2MA 4JOUA 1K1SA 1SC3B 2RD5C 4GVLA 4LRAA 4P75A 1TUWA 3KTQA 4DR2F 1N5QA 4KGMA 5KG5A 3PRBA 4LF7F 3SZ2A 3KK2B 1SJFA 2BYCA 3FC9A 3BBBA 5T41A 2YY3A 2F1FA 4CNYA 3HHLB 1P1LA 2AP6A 4F4YA 1KQSR 3K2YA 4ES3A 1JLBA 1HHQA 5KFMA 2DTJA 2QA1A 5KFVA 4NZ7A 1HL6A 2IDEA 1HWKA 2YPZA 1R8HA 3OXGA 5F8IA 3M2RB 4Y2AA 3HX9A 4MKAA 4RNNA 4DPUA 3K58A 2XMJA 4YHHF 4KHPF 3BGOP 3SIPB 1HQUA 2CYYA 4LRBA 1GTEA 5E7OB 4FS2A 3G6YA 5A8KB 1QUVA 5J2QA 1ZAXA 1HI0P 4B3SJ 1RT7A 2YNFA 4NLUA 3SFGA 2LVWA 4KQZA 1SBRA 4IG0B 2FVSA 2Y9HA 5AJ3J 2VQFJ 3QWUA 2J9EA 2MQPA 2ERRA 3EICA 4K0KF 1KP6A 3JSYA 1FRJA 2UUAJ 1RUSA 4X62F 1GMWD 2GHVC 2C3UA 3VF0B 1S1VA 2C2RA 2NXEA 5ETOA 3KK1B 4KH1B 2CPHA 2XEXA 5ETKA 3EXCX 3PW5A 2DITA 4XTTA 2AF6A 3AA9A 3Q8PB 4RW9B 1TL7B 4HTJA 2J6UA 3SCKE 3W64A 1IQZA 2CJXB 3R1HA 3O2IA 4A4JA 4F2RA 1WEXA 3UPFA 1J5EJ 3IP0A 3V6KA 4EMDA 3KHGA 3GFZA 2AJ2A 2CPXA 5GAGU 1BXNA 1TQLA 2YWKA 2FVPA 1UJ5A 3IRWP 1VRQC 1W7WA 2AYEA 4FPRA 1M5KC 2VG5A 4JI7J 2LU2A 2MQNA 1Q7YT 4IH7A 3JXOA 4B9TA 4R8UA 4DEZA 3H42A 2KL8A 4A46A 5HK4A 3HVRA 4HT7A 4IO1A 4OYAA 3R1LA 4YY3J 1X4EA 2X1AA 2JX2A 1ZM4A 3H5XA 3D54A 1U1QA 1RADB 1RXOB 1UWAA 3R5AA 2CPZA 3KJFB 4ED2A 2VBXA 5GMEA 3HI9A 2NR0A 4B3TF 4J37A 3CCUS 3I0RB 4F0MA 3CJ4A 3W7BA 3GMGA 4A47A 3O44A 3QJJA 2VJUA 3HO1A 1BWEA 1KSPA 3HD2A 3P6YC 4CDIA 1CG2A 3QQCD 2U1AA 2DCUB 1Y3JA 2LXFA 4LF2A 1H7WA 1HYSB 1R3NA 4RW6A 3PXGa 2AYBA 4CNZA 2DNQA 4WE1A 1JLAB 2DRAA 2JC1A 4ECZA 4M5MA 4OX9F 5FJ4A 1D3WA 2D3OR 4F3MA 3QYYA 3HJVA 4AE5A 2NLWA 3T1YJ 1UW4A 4G65A 3HKWA 4DL5A 2DIUA 1WHXA 3CCTA 3HD1A 2NXCA 1MU2A 3W9JA 2AX0A 4ELTA 5L1KA 4F4XA 3MZIA 3C15B 2DY1A 4KGXB 2DEIA 3PRDA 1UWBB 4ED7A 5CA5A 3CD0A 2W7AA 1EZZB 4Q2LA 3NCQA 4OMFG 3ZTPA 1DBDA 1XWLA 3ZZRA 3AJ2A 4X66J 3OL7A 1UFLA 3CJ3A 4ECWA 3ITHB 3HULA 3Q23A 1V5VA 3CT9A 2YX4A 1VISA 2VOOA 2YWEA 4MK8A 2XMTA 1VLOA 3FMBA 1U1NA 1X4AA 4RNHA 4F67A 3PJXA 4LBPA 3WHIA 2F8EX 3NOGA 2G1DA 2KXNB 1B0VA 4GKKF 3B82A 3UD4P 1N56A 4EBCA 1DARA 4RUAA 4C11A 2JOQA 5KG7A 3K7RA 2JEFA 3ZO7A 4H4OB 5GAHU 3L95X 2DK2A 1RT5B 1FE0A 5KFZA 4J9UE 3KDNA 5HQMA 5J1NA 4HHUA 4P71A 1U1MA 2HWTA 2KXFA 1BGXT 3GG0A 4O3SA 4ZP8A 4NLTA 4NASA 4R25A 2OPQA 3W2VA 4WCEQ 1GMWA 1N5YB 3DC2A 4M5JA 2VU5A 3RBDA 3R5BA 1MG7A 4RUBA 2R7OA 4DQPA 3PKYA 2DXEA 5C42B 2V50A 5KT3A 4DV3F 4ZPDA 2CQPA 2R7RA 1Z2LA 4OLPA 3IBFB 2GJFA 1JJ4A 1Q8BA 5IQ6A 4Q44A 1RHKB 2XS7A 3QRQA 2CG8A 2E1MC 2P6SA 5IFMA 4FNHA 2UUCJ 3THPA 3W1YC 1TFWA 4E8UA 1T7PA 2QYCA 3WIUA 2VJVA 5E3RA 4AUKA 1IBMJ 2MZSA 1NZ8A 1KC8T 4EYIB 1VQNS 2D1CA 1PCAA 3MM9B 3MPUB 2CVEA 3V6DB 2ASYA 4WU3A 3H20A 4RNMA 2K1RB 4YB5A 3AOBA 2MLXA 3C14A 1VGYA 2W1BA 1M5PC 1S1XB 3KLEA 1K0TA 2N4CA 3CCLS 4LFBF 4IDKB 2CQGA 2BJDA 2FTRA 3DOLB 4KH0B 3W3SA 1Q5YA 2XB2D 3OSPA 2MSTA 1KVIA 1EQMA 2KU7A 4WZQA 3BKTA 2DH9A 1KNZA 3HSJA 2RF2B 3MAAA 1VQSA 5C24A 5ADZA 4KHMA 3VHQA 5D3GB 3DLKA 4RBVA 1U45A 2HRUA 3LGMA 5I3UB 1WC1A 4QIGA 5F8JA 3HSZA 2PFFB 1WC3A 2AYGA 2VF3A 3IXQA 3KNGA 3J7YU 1ROFA 1YBUA 3K8WA 2WBMA 2OUGA 2CJAA 4WXOA 2MDAA 3KJNB 2OHDA 3T5HA 1U8SA 1RWVB 4CT9A 3J81Y 3MTJA 2ZKUA 4WPAA 1RTZA 3GV5B 4H4KC 2QX0A 5IWAJ 2XMVA 2ZE2A 1NJYA 1NXIA 4LRDA 4LRCA 2IPOB 3AFGA 1N0VC 3I0SB 3OVSA 2GX8A 1EKRA 1DJ0A 1F5CA 1HD1A 3LAMA 4ECTA 3DYAA 3QGIA 2DNKA 3UE2A 1UMJA 5D8HB 4DMZA 1M5SA 2LA6A 3M8QA 4U8YA 1YKWA 2FJDB 3C19A 1JNZB 3D0IE 4K5RA 1A0OB 2FGOA 4DUZF 3SV3A 2YWFA 1H74A 4YEAA 2CJBA 3G82B 5KG3A 4DDFA 2OMLA 1IXKA 2ZVSA 1EP4A 3T9NA 5HLFB 2M3DA 3JAMY 3QO9A 3X3UA 2VV5A 2L9NA 1BQMA 4X4OA 3GIRA 4ZVEA 3PFEA 4I7FB 1SJ1A 1NHUA 1OY6A 2FHMA 4DV6J 3Q8SB 3CO0P 1FDAA 2DGUA 1G3OA 5DETA 4WYWA 4KB7A 3ZZYA 2VQEJ 5LMNJ 2J7KA 2V34A 3OTOJ 4ECVA 1N36F 2XBPA 5KFEA 2DJWA 5BXIA 4K4VA 3R7SB 2GIQA 1OSDA 2KB2A 2OSRA 3GPAA 2MQ8A 3QAEA 1PJ5A 3JSMB 1IWGA 4Q7AA 3JYTA 2WCXA 2RS8A 4JI8F 3U27A 1B99A 2V8GA 3HCXA 3A13A 1G1XA 4O3PA 3BGUA 1ULRA 4IUFA 3J81j 1GTHA 5AXMA 3GJSB 2DIVA 3NAHA 3KHLA 1WI8A 2V94A 4WK3A 5LXYA 2C1EB 1DQ9A 2DR6A 3PW7A 3NXZA 1I94J 4DPYA 3GILA 4LR8A 3W62A 2BE2A 3T6JA 1DTQB 2VICA 2V2KA 4K4YA 1WG1A 2FVCA 5DQIA 2X7IA 4JI5F 5A2QY 4KE5A 4QPTA 2DHSA 3I96A 4PG8A 3SQOP 1WKLA 3QGPA 4KKOA 3VGUA 4TQRA 2GGPA 2V4QA 1NSAA 3GV8B 5GMDA 4NLYA 1HFEL 2CWKA 3GCXP 3LWMA 4DSJA 3NCPA 2W2MP 3CCQS 5FDLA 4W90B 1T9YA 3QT6A 4N76A 2ABYA 2ILYA 4LT6A 3TAMA 4N41A 4OJ1A 1DLOA 2AJ0A 4MTPA 2RU3A 1KEKA 3C6UB 2FY1A 2F4FA 7FD1A 3QIDA 4ZIVA 3IWXA 2V8HA 2Y1JA 4XIUA 4M63A 4ANCA 1YTYA 3IAM9 2LYVA 5HMXA 3TVYA 4X4VA 4KSEB 5DG8A 2H5EA 5K8MA 4X4NA 1URRA 1VCTA 2HQFA 3UCZP 1WC4A 4F0KA 4I6WA 1V5IB 2RS2A 1B64A 1NB7A 2XMWA 4H4MB 3TA2A 4A8WA 3AJ1A 3Q8VA 2IM0A 4Q43A 3V4IA 3DLGB 1S0MA 5HBMA 3FEXB 4RW8B 2CJYB 3LAKA 2B8PA 2CJ9A 2IY5B 4NXNJ 3OR2A 4DV7J 3EDRB 3NEKA 3IGNA 4V1Ak 3LP2B 4X2BA 1SKSA 4IOBA 1X0FA 1EQ0A 4OI4A 4NCBA 2MKIA 2FHJD 3JTPA 2HNZB 1RYRA 5HAOA 2MKYA 2RB7A 3JAMU 4USUA 3MM8A 1TELA 1RT6B 2U2FA 3CVKA 1XMOJ 3D28A 2HAIA 5JUMA 5DDPC 3HT0A 3VAFA 4B3SF 4AL7A 2DNYA 5AJ3F 4LMZA 2PD1A 2VQFF 5C5JA 3PVXA 1FKAF 2HG4A 4ELUA 3R2CJ 4OZNA 2UUAF 4ZVFA 4Y2IA 2R2RA 5CD4H 4X64J 3IR7B 3UCGA 3NNAA 3L7UA 2HVEA 4HTIA 3LGNA 3TX8A 5ETPA 1IBLJ 3NY0A 3HM9A 1NK4A 3IS9B 2R2SA 4B9LA 4KJIA 3QJLA 1S72S 1CVJA 3HHNB 1NPKA 4E98A 2DYAA 1HLWA 4Z37A 1J5EF 2W2QP 9ATCB 4B9UA 3ET6A 4RO0A 4CTAA 5A2QU 1NKCA 1C1CA 3GJTB 2OPSB 1SL2A 4JI7F 2AJ1A 1NK0A 7FDRA 3DOKB 4JB8B 3T3FA 1TKXB 4QW9A 3PYFA 4EK2A 2XI3A 3VVUA 2KT2A 1K73T 2BKOA 3Q89A 5GVQA 4YY3F 4Y34A 2R2UA 1PJ6A 2YVSA 1SQEA 4UW2A 2KFYA 6FDRA 1YJWS 4RZRA 3Q24A 3OFGA 4DN0A 2VL1A 5IV3A 2GNKA 1FFGB 4L74A 1RWWB 2B8QA 4OHWA 5F8HA 2ZZMA 2ASDA 2RDIA 1MWYA 4Y3CA 2PA3A 4URQU 4NXMJ 1TFYA 4RW7B 1IR2A 1BQNB 4IG3B 3HHKA 3RTVA 1X5TA 2DHGA 1WEZA 2ZKTA 4CWBA 3ENVA 1VFJA 1Q78A 1TKZB 2FPHX 2PMHA 4K2XA 1WD6A 2X1FA 2KZMA 3GFHA 4HI2A 4M5GA 2CZVC 2XMMA 4ZHRA 4ZVOB 3W2WA 5CYMA 4M5HA 4JI1J 2Z57B 2G2OA 4M5LA 2IC3B 5DO2A 1RT1A 4BLGA 4QOTA 1FJEB 2AQ4A 2B43A 1ITPA 2B4UA 3T1YF 1XR7A 3KMSA 1XNQJ 4K7QA 1JB0C 1S6UA 4TLQA 2HBYB 1RAHB 3CEDA 4Q0BA 1YG0A 4Z7YA 2HFZA 1U6FA 2JL9A 3CC7S 2JSXA 3E51A 3PW0A 4WK1A 3DU5A 3H4BA 3HDSA 1X9WA 5E3QA 4PPZA 3HLUA 4NYZA 2CQ1A 1FJCA 4X65J 1LQ9A 2R4FA 1OSCA 3VAGA 1RT4A 4BC9A 1O51A 4X66F 3GSIA 1YJRA 5KFDA 2Z0GA 1YWXA 2R3VA 4R0JA 1LXJA 1A9NB 3DOMB 5L9NA 2R9LA 3A1YG 4TU9A 2FHJA 5EX0A 4WFXA 1YBAA 4CO4A 3UN3A 5JVHQ 1GMVA 4B3OA 2Y3YA 4ZPTR 4CO3A 2B9YA 4ZDNA 2RQKA 1FRIA 2MLYA 1HQEA 1HQUB 3CPWR 1N4LA 1YGYA 4Y2MA 3UDVA 4OYZA 3EGZA 1KLNA 2DB1A 1KN6A 3EGNA 3R97A 4DL3A 1FWPA 3M9MB 2RSQA 5CHCB 5D4PA 2PMZD 3S01A 1KFSA 3A3PB 1S1WA 3LPEA 4PQUA 2QEXS 3BR8A 2AEJA 5IS2A 4ZPVR 1S1VB 2H3EB 5K5MA 1GT8A 3D0HE 3G96A 2H4WB 1N88A 3ETOA 3H98A 3OSNA 4NLDA 2DR8A 2UXDJ 1NH8A 1WDTA 2DH8A 3HFVA 2ATCB 5LM7E 2UUCF 3UNGC 4PWWA 1UVJA 3OPKA 2V2VA 4RR5A 3BS9A 4QR1A 4K4ZA 3D68A 1IBMF 2QL9B 3IM9A 3QWPA 4HVZA 4G6VB 2YQ1A 2BQ3A 2D9PA 1WTFA 2H51B 2GIFA 4OX8A 1W2BR 1KR4A 3MM6B 3GJRB 4R8UB 4U67Q 2JDJA 3N6MA 3PYEA 1M90T 5D77A 3VALA 2ZH9A 1U4BA 3P5BP 4ZVGA 1RQ0A 3HP6A 2C28A 3BDPA 1NB2A 1RT2A 2R7SA 3FZBA 2LA4A 1RWUA 5E3PA 4Y6IA 1WC0A 1P9QC 3DDNA 2K2PA 4MYUA 1FNOA 5KFXA 4DSEA 5ETLA 2XQCA 5H9EJ 3C46A 2CRLA 4Y00A 3GP9A 1UEVA 1KTVA 5DS7A 5EWGA 2GHPA 3PEHA 1MWZA 4CCHA 4DLGA 3L09A 2HNYB 3CMQA 2HFSA 3RR8A 2B56A 2W01A 4EBEA 3CCSS 2HMIB 3UWTA 2F9DA 3I6PA 1M1KT 3R6GB 1RTDB 3CNQP 4RW6B 3ZXWA 2VB6A 1TVRA 1PO6A 1VMBA 4DFMA 5IWAF 3TANA 4DV5J 5EX3A 2JEGA 4UUWA 2DH7A 3EVMA 2ZM6J 1YHQS 2IYIA 3QPIA 1FD8A 2R7XA 1MU2B 2AJFE 3M2UB 1LWCB 4ED1A 4RW4A 4I0WA 1O8BA 4FF1A 3IA0A 5H1SV 5J2PB 4O44B 1B7FA 2IA0A 4HLBA 3OTBA 3PX6A 5G0RB 1XR5A 3MUVP 4C8KA 2FQQB 4ZPAA 4PYDA 1XN9A 2J0WA 4ECRA 2I2YA 1IN0A 1UW9A 2XZWA 2AHOB 4DJBA 2FYXA 4QBUA 4ID8A 2AZ3A 2UVRA 4DX7A 4X4TA 1C4CA 3R2DJ 4FYVB 3IC1A 4NZ0A 5HP1A 1NO8A 2F3JA 3RJMB 4DV6F 1S6PB 2QG9B 4JI4J 3VGVA 4IOCQ 4F4WA 2GQQA 3I31A 2VQEF 4WIIA 2HAFA 3JQKA 5LMNF 1WELA 4NLOA 4CT8A 3OTOF 1RWOB 5DDRC 5CYJA 5DZ7A 4LBHA 3DRSA 4C4WA 3G6XA 5F8LA 2CNOB 3M05A 4UY85 3OFEA 4QQBA 5A0YB 2PEBA 3DRRA 4LF4F 4DV0J 2FD2A 3FCHA 2WSCC 1VQ6S 2E1AA 3MCMA 2P2CB 3JTNA 2J0QD 3K0JA 3NNCA 2E5HA 2MHEA 1TL3B 4HACA 4QIEA 3JQMA 1NDPA 3RAXA 5B0EA 5L8RC 1SJ3P 3QT8A 3VAJA 4NZ6A 1XJWB 4UQTA 2I8EA 3D6MB 2K8GA 1D8ZA 3I82A 2VFUA 3E01A 2AU0A 4NLWA 4A8FA 2V4JA 5AE2A 3O1LA 3T19A 4OZLA 5CYQA 4PCQA 3P8BB 1SC1B 1HIYA 3NMAA 5H9EK 1FFWB 2MQOA 2IBKA 4J7CA 1SQFA 3V6JA 2V8DA 5FIIA 4NLXA 1Q4RA 3VZIA 2I1RA 4UTGA 2ALYB 3NGSA 1RDRA 1WI6A 1Q81T 3C14B 4FF4A 1JJHA 1CJKB 1E6YA 1QM9A 4MIBA 5CD4A 3GSDA 2WHOA 3SFUA 2DGQA 2IRYA 1N6QA 1VHFA 4IFVA 4K50A 3ULHA 2DNHA 1T05A 1S4FA 1CSJA 4I1TA 1NCLA 2ZC3A 3DLKB 4NXNF 4PG5A 1J5OB 4DV7F 4LSZB 1U8WA 2H5IB 3I9V9 2B5JB 2C2OB 1FJ7A 3DLEA 1FO1A 3KLHA 1ZETA 3DKDA 1YQHA 5F8NA 3TEHB 1PG5B 2K7JA 2D69A 3DCAA 5E3AA 5CZVA 1XMOF 1IKYB 1S1UB 3DLBA 3WDOA 5BJRA 1RABB 3EM1A 1VQPS 1F3VA 2I38A 1SL1A 3OVAA 2RDDA 3M1VB 3GIMA 2EKYA 4X64F 4EYHB 5HJXA 2JFKA 1GX5A 1NHKL 2UUBJ 3M8QB 4OI3A 5JXSA 1AZSA 1U1PA 3F44A 1IBLF 3NS7B 1P9YA 1JX4A 4LFCJ 2KYXA 1S7HA 2VODA 4RWWA 2ZBPA 4NEZA 1ZA2B 5C25A 4C3MA 2GAHC 3EUNA 2RHSB 2YTCA 2NZ4A 3QO9B 4D3GA 4DPWA 3R9LA 2KT5A 1WNEA 4NLPA 2H1YA 4F0HA 3H4DA 3TEGA 5FLXY 2CIMA 1S9EA 4I2QA 1O0PA 2VFVA 3M6UA 4YN3B 2BKNA 3H2UB 3AQOA 4YOEA 2J6TA 3TVKA 1U25A 4AL6A 1XEZA 3WZ0A 1E6VA 4CLFA 3FGVA 3OW2R 3CCES 1LWFB 2FY8A 3OV7A 1UVNA 4P6QA 4YFUA 3V81B 4DL0C 3FJ2A 3GYNA 2E5LJ 4ZS6A 1SKWA 3PHTA 1FRLA 1CJTB 2IAJB 4MK9A 1FNMA 1AFIA 2QMUB 4NXMF 3TNVA 1WG5A 4OQJA 5EHHA 2XZDB 1IKWB 4WWSA 4NOHA 4ZJLA 2EI5A 4MT1A 5HROB 3DDIA 3PIOQ 2C22A 1Q5VA 3ZFVA 1X31C 2GC8A 2GVZB 1TMMA 4M5NA 4IKAA 4ATNA 4B9MA 2L9DA 4JI1F 3M2VB 3ENWA 3RR7A 4TKTA 2NS1B 1AYEA 1YX2A 3FBFA 1PBAA 5CXTA 1Y0HA 4CLKA 7AT1B 1XNQF 3FBEA 3EPGA 2NXJA 2Q43A 3BF4A 1HD0A 2FDNA 3GIIA 1UJ6A 2W7PA 2IFXA 3RAQA 3M8PB 4OHYA 1VBYA 3OL8A 1HMVA 4DX8H 3UO0A 1RYSA 2KHCA 2GVDA 3CCMS 2LDIA 4LF1A 1HQ2A 4X65F 1RACB 4NCAA 3A3OB 1B4SA 3PX0A 3BGRB 1S9FA 2CPFA 2P5VA 4J9PA 1QVFR 2M9KA 5KG2A 2QIFA 3WX4A 1FEEA 3EX7B 3B6BA 4FPIA 4I4BA 3D3BJ 3FEZA 3RGIA 1RCOB 1RWPB 4LJMA 2R8JA 3H5UA 3KK3B 1QY7A 2AW0A 5IT4A 2KXHA 2FLLA 4KGKA 3DRPA 4ZN3A 2QLBB 3SMZA 3AOCA 2ALZA 4B08A 2JHEA 3NKYA 3AXMA 1IKVA 5FLXU 1N54B 2HVZA 2AEFA 3C6TB 2XULA 2ZUAA 1DTTA 1C0UB 2KKHA 4NLQA 3KDOA 2MKCA 2NPFA 4K8RA 1T03A 2WB1D 3I4HX 4IR1A 4DV1J 1N5TA 1SCJB 4PXDA 3QGGA 2ZNZA 1RJJA 1WG4A 4M5DB 2I0XA 2UXDF 2YNGA 1SI9A 4QR0A 1R0CB 2HHPA 5DJBA 1P1TA 1UPPA 2VG7A 1R6YA 1L5UA 5HI7A 4HDGA 3W5XA 4RPFA 1YJ9S 1UTAA 1F2HA 5KFOA 2BV3A 2D3UA 3RRGA 4CTAB 2JC0A 2EFPA 2H9ZA 1EETA 4CYUA 1HNIA 2C2KB 3M9OB 1C1CB 4JV2A 4C7QA 3FBCA 1LWXA 2X51A 3DGPA 1WDDA 1OWXA 2F65A 4DS5A 2YNIA 2D7SA 2W24A 1VOMA 3CMAS 1RAJA 4CH1A 2W9BA 2V69A 4YB7A 2AZ1A 2POKA 3R5JB 3Q8YA 2KH9A 2XMUA 2MTLA 2ZZNA 2HFUA 1T3OA 1H0HB 3HVTA 2ZDPA 3QT7A 3MI7X 2FJVA 1Q86T 3FRYA 3BO3A 1VBZA 1IUJA 4ERDA 4L76A 1N52B 5D0RA 5LSRA 3IFEA 1R43A 2MKJA 4USIA 2XZTB 3OUYB 4QIVA 2PN6A 1Q8KA 2XSFA 2HHWA 5LOQA 1LOUA 1EX8A 2EK6A 3H59A 1CULA 1IQTA 2PDAA 1Q8LA 4W4MA 2J8AA 1JLFA 3EDQB 4ZOSA 1F5AA 2G0JA 3LTOA 2P6TA 1VQ7S 1YJ7A 3MMAA 4NA3A 1OO0B 2R7UA 2WONA 2IBOA 2V2QA 4LQ3A 1RAFB 4WP9A 2QLJB 4ZHRB 2HWHA 1XMQJ 3P49B 3KFWX 4PWUA 4UY8T 3PCOB 1RT1B 3MGJA 4PPDA 2G4BA 5KFYA 4DV5F 1RWNB 2XYGB 2ZM6F 2OPPA 1RTIA 2UXCJ 1VJQA 4B9VA 1WOSA 4DBQA 3ZZOA 2A2DA 1RU1A 1FKOB 1T02A 3FSYA 3MPWA 4WIQA 4O4RA 3MPVA 1Q16B 4F3OA 3JSRA 4TYBA 2LLZA 5D15A 2QMXA 1BE4A 4Z7CA 1V6HA 5GAEI 4USVA 3JS9A 4CM0A 2MPUA 2K06A 4F25A 3TARA 3RZAA 1NKEA 2OAUA 4HI1A 2NXNA 1YVFA 2BANB 2COLA 1BLUA 1QAYA 4JI4F 2XCPA 1PIEA 4N47A 3J80Y 3D4JA 3EXYA 2HNDA 1CLFA 4EGLA 3KHRA 2LEBA 2WSEC 2DR9A 5A8WB 3GR1A 3CCJS 4B3OB 4QWBA 3CJKA 5B0FA 2M2BA 3LANA 4ZVUB 4TY8A 2OSQA 4DV0F 1JXLA 2LFVA 1HR0J 1HWLA 2DNPA 1S1WB 3M32B 3VWSA 3HFKA 4PQUB 4N56A 2FGCA 2VKZG 5KG6A 2MQQA 4TU7A 1SB6A 2WOMB 2GFFA 1LFWA 1RT3A 3SCJE 4ZCKA 4G3IA 2EC2A 2JNJA 3H25A 4DSIA 1Q53A 2P9GA 2BXJA 5AT1B 4USMA 1VI7A 2YKMA 4CLUA 1XTZA 1U2FA 3T6BA 1BUXA 2KDOA 3B4DA 1K0VA 1LW0A 2FB0A 3DFEA 4RUHA 3IO1A 4NEYA 3K5OA 5L1IA 4B3MJ 1X4DA 1HBMB 2MHNA 1H7XA 2M52A 3THVA 1FCAA 2BOPA 4CLPA 3JB9k 4RU2A 2NPIA 3GJQB 4P52A 1SC6A 1Q8IA 3PO4A 3DXBA 4S0MA 3DM2A 5T7LB 1VQMS 5M2UA 1YLXA 2HHTA 2O5DA 3N5BA 3NOCA 1Q95G 4G1QA 1FX4A 2JVOA 3KUEA 1BQXA 3CO9A 5LSOA 1SV5A 1RT2B 2DNLA 1JJCB 2N3LA 3BSNA 2MKHA 3MHYA 5JJBA 4Q45A 4CO0A 1Y5NB 4Y65A 4OYIA 1M5HA 2MJUA 4ZVTB 3DDKA 3D0GE 2XWXA 3BDEA 2ZD1A 1DY3A 1XERA 2ZOMA 3JQJA 3UQSA 2MLZA 2YQ0A 5HQLA 3NGKA 2HVDA 3VCDA 2R8IA 5D0HA 4JV5J 2Y0SD 5KFIA 4DCJB 2L08A 2MB0B 1TVRB 3KK2A 4IH5A 2R42A 2DNRA 1V3ZA 5KT6A 1MWQA 3P5TL 2QE5A 3SI8A 4ES2A 1XR6A 3OJUA 1FDDA 4Z2XA 5EGYA 3AY0A 2UUBF 2QSWA 4RW4B 4NLVA 2WVFA 4DR7J 3M2RA 4MMOA 1U6BA 1FF2A 1W2IA 5C2CA 5ETNA 2ZH3A 1C0TA 4LFCF 4F04B 2MZRA 4NE9C 1R27B 2VKRA 4F50A 2JFDA 2R8GA 3AJDA 4P7TA 2QA4S 1DQ8A 3GB0A 1TL1A 1IBCB 4WFYA 3M8WA 5J2MA 3FZ2A 2KFZA 3NL0A 4B3RJ 4LVOP 5DLFA 4OYBA 1F6TA 3VZHA 4IR9A 2V67A 2A6MA 1L3UA 1RB0A 2A18A 3AT1B 1PYOB 1AUSL 1JLEA 1S12A 4OX7A 4PKDB 1FKPA 3FKBA 3G2XA 5M2PA 4BC7A 2B9EA 1H2UX 3EVWA 5KFKA 2D3ZA 2JRSA 2GAGC 5DDQC 3U7JA 3KK1A 5LXRA 4LF5J 1QE1B 1N5SA 4I2PA 1UVKA 1UJ4A 2VPZB 2FHOB 3EZ5A 4LFAJ 4RW9A 2W9AA 2F8HA 3N28A 2HLTA 2E5LF 4M95A 1R0AA 2FUG9 3N5FA 3MD3A 1LXNA 1QAXA 2MZTA 1TUGB 4PUOB 5LMUJ 4OYXA 2VDIA 4OI0A 3FCVA 4WKRA 2C3MA 4KO0B 1AT1B 1FRHA 2QN6B 5AE3A 4HACB 2UU9J 1UAWA 2CJKA 3AB4B 3L3CA 3RYLA 3ILLA 5K8NA 2A6OA 2EFVA 2R7VA 2DGXA 1FXRA 1NHVA 1X5SA 4BCAA 2VA3A 4ZITA 2LEPA 2OMOA 4WJBA 5IOLA 2J9DE 1PYTA 1P27B 3J7A1 3OR1B 5BYRA 5KFNA 2EG2A 2RJZA 1KS2A 1RU2A 2RVJA 1UFKA 1RHJB 3IN5A 4ECQA 3I0RA 3MXHP 2NUHA 4DF4A 1PJ7A 3POTA 8ATCB 4DL7A 3PJWA 1HBUB 1WKKA 4A48A 3FK4A 2QFJA 2NQPA 3J7Z5 1H3DA 2HRYA 2H5JB 5E0OA 4HR2A 5B09A 2ZWPA 3MEEB 3FFIA 2PEHA 2LU1A 2D41A 2BJ7A 2SXLA 2RUSA 4DR5J 1B0PA 4ECXA 1S77D 2PI5A 1IVZA 3KHHA 1JLAA 5E2QA 4IFVB 3M6WA 4CO5A 1R8CA 2HBRB 5ETVA 3A8IA 1VK8A 1RTJB 3IWLA 4NI2B 3RUBL 2J5AA 4ZP7A 2HHHJ 1Q79A 3KNAA 1NPRA 3PKMA 3DLEB 2ZOGA 1FA0A 3KLHB 2KFNA 5KFSA 1FERA 1MROA 1VJWA 3IM8A 4PAAA 2VBZA 3IAS9 3GFYA 4C0BA 1S49A 1CC8A 4OI1A 1FHTA 4ITSA 2E5JA 2L3MA 2FZGB 8AT1B 2XS5A 2GHWA 3ITHA 5LJ3Y 4KTQA 1WOOA 3PRVA 3NBPA 3HHDA 4DV1F 1JKHA 1SQGA 1V9OA 4J5OA 2B0GA 3BPSP 3DXSX 3RBZA 5F3TA 1TTHB 2FC9A 4LSLB 2R7QA 3KUHA 3S1TA 2O01C 1MLAA 5THWA 3DLHA 2FJWA 2VA2A 2J6SA 4E2FB 1I6JA 1MN7A 1F9HA 3D6FB 3LWLA 1T9TA 4OYWA 2Z2YB 1A6LA 1M1GA 4OYOA 4H4OA 1EIYB 4AQYJ 5C25B 4NLSA 3DHXA 2IRXA 4GC6A 3CCWA 3DRXA 2UV8A 1G7CB 4TNOA 4XK8C 4DR6J 4DL4A 1HARA 3MDFA 4W98A 4A8YA 4ILLA 3KLIA 1U1KA 4KHRA 1SC4B 3D66A 2QLWA 1N5YA 5E41A 4OJ3A 1ZTWA 4JUZA 1VC6A 1MMDA 3VAMA 1REVB 2HQIA 4ETXA 3SBMA 3D1OA 4OI2A 2XGQA 2I5JB 4UZBA 1HBNA 1E6VB 2D3O1 4KBIA 1NH7A 5C7PA 4WP3A 4FP9A 3A8JA 1K44A 5F3ZA 3EGWB 1QAJA 3GIKA 2DCLA 2XWYA 1FD2A 3N4WA 4URSA 2IA6A 1UZHA 2RQ4A 4ID5A 4DSFA 1B70B 2FLOA 1L3VA 2KRBA 2HRTA 1FK9B 5CAAA 2J9CA 2CFXA 1UVLA 2WVBA 1AA1B 2I9SA 4ECYA 2BE9B 1VS3A 5IT9Y 2FJBB 2MY7A 3VQTA 2HK2A 1QUPA 4KPYA 2KVIA 3F56A 2K1RA 4IOAQ 1RAIB 4P7VA 3PIPQ 4I67A 1TKTA 2CPIA 4O3QA 1I51B 4OZ1A 1XMQF 2YX1A 3OXLA 2DGVA 3OJSA 1DRZA 2AWZA 1X9SA 4QU7A 4ED5A 4UZCA 1X4FA 2J76E 4OI6A 3OHBA 2BACA 3NMRA 2V6AA 3CW2C 2UXCF 5SUHA 2ZHOA 5D4OA 4HEA9 4OHVA 5ETSA 1OJ4A 3TJ9A 1RWMB 4CLLA 4LUBA 3H2LA 4UOCA 4MK7A 1NUEA 3MOJB 4J9SA 1Z4UA 4C3KA 3CDEA 4MJKA 4C8LA 1XIQA 3BH7B 1HNXJ 5IM0B 2BM0A 4P73A 4A8OA 5D78A 2XY5A 2DXFA 3CCVS 4KV8A 3OTEA 4U95A 1CBKA 2VDHA 3UN2A 2NCKL 2RQMA 2AKWB 3G86A 3ILOA 1K47A 4C8MA 4ZP9A 3UR0A 1T11A 2CNKB 4X4PA 4CRJA 3I0SA 1I3OB 1N0UA 3W61A 1MW7A 5JMNA 3HZGA 3R27A 3JSBA 3PW4A 1GFWB 1FEHA 1R6VA 2HIYA 2RRAA 3DRPB 5EWFA 4WZMA 2Y8WA 4A8SA 4USWA 5DLGA 3KKFA 3K59A 2G9OA 2FLPA 3G82A 4DPXA 2AGPA 5IT0A 2CPDA 1U2CA 1NU4A 3HT3A 3RW6A 1U1RA 1DTTB 5DGAA 3SDEA 5KFWA 1HR0F 2OO4A 1NBEB 2DNMA 3CJSA 2B9XA 1ZPWX 2IVYA 1YJNS 1PSDA 3D1QA 5D4NA 4I7FA 5E5NA 1TK5A 5HMZA 3UR3C 4CP5A 4EU0A 2IJNA 2X1GA 4QR2A 3KWMA 1NNDA 5A6PA 3CJ2A 5KFAA 5U47A 2B6AB 2DBBA 2VG7B 2LXIA 1MMNA 3JSMA 1VC0A 1VQLS 1N33J 1HBOB 2VH7A 4O0NA 3QBCA 3GTYX 1RA6A 1WF0A 4UOHA 3Q2TC 5KFLA 4V19J 2KJWA 2BDPA 4B3MF 5DM6Q 3TWZA 5IT9U 1KLMA 5KOXA 5DZ6A 4CYUB 3BO2A 3CDBA 3HZEA 1GXTA 2LECA 3DGPB 1D0EA 1S6QB 2W2NP 5D0EA 3U1MA 5L39A 1DTQA 3L7PA 1QVGR 3W9IA 3PNIA 1ZS6A 2NYIA 4KFBB 2XI2A 4GVBB 1VRUA 1H2TZ 5HVHA 3HVTB 4EZ9A 2VC1A 3OLAA 4DZDA 3MMCA 3ENQA 2XM3A 3TQ1A 4C6AA 4DS4A 1YZ6A 2MSSA 5IC4B 2WVEA 1OY8A 1Y5LB 3HVWA 1SJRA 1VK3A 2AJQA 2CPYA 4L3KA 1ZM9A 1PYSB 1IM6A 2HFNA 2DGSA 1CULB 1QDUB 3BYRA 2Y1RI 5HVGA 4H54A 1X8DA 1NK7A 3F41A 2CAJA 2VHGA 1M5VC 3OXFA 1BC6A 1BD6A 2WONB 4LF4J 1WTBA 1P6TA 3ONQA 3T5LA 3KJVB 4DOZA 4JV5F 3UI3A 3ENAA 4KC5A 1RHUB 3ELHA 2BUNA 4MFBB 4R0EA 4CIOA 4H4MA 2ZJQQ 3PG9A 3R3TA 2J0SD 1U2RA 1KONA 3DLGA 4QU6A 4RW8A 1U24A 2M7SA 3OD2A 5L9XA 2XNRA 1RTIB 2EK1A 5J2NB 4F02A 1WHYA 2HVIA 1RTHA 4ED4A 3TZYA 3BBFA 2B3TB 2OJ3A 1LK7A 2CQBA 2I6WA 2DD8S 4DR7F 3LP2A 1EB0A 2HGNA 5AXKA 1WF1A 4WXWA 1S9GB 1R89A 3NWGA 1B7YB 3IRXA 4ZKAA 2B51A 3OL9A 3W63A 4O4GA 1KBRA 3SQGA 1ZTTA 4U6PA 3PW2A 4B3RF 1AB8A 4DFJA 1WHWA 3FRZA 1RK8A 2YKPA 4CH0S 1UVIA 4IRCA 2XLKA 1KHVA 5HO4A 1KTQA 4DX5A 3NCRA 3LALA 4DV4J 1X4GA 2V4RA 1CS4B 3KG1A 3C16A 2OPRA 2HNDB 3J7ZT 3CJQA 3IMQJ 1H6KX 4LF5F 3CIMA 5KOWA 3KOAA 2R7TA 3DLLQ 9RUBA 3SSRA 3UD5A 4EZ6A 4LFAF 3IS9A 2DPIA 1SIWB 1M0SA 1R31A 3MM7B 4QWAA 1FESA 3W8PA 2HHXA 3FDSA 2R2TA 2ACYA 4TY8B 1Q82T 2ASLA 1TK8A 4NCGB 2GW8A 2LEAA 8RUCA 3KLGB 5LMUF 3GLJA 1WEYA 2M0GB 5L38A 2ZH6A 2UU9F 2ROEA 2EWHA 1XC9A 3VTIA 2VFRA 2QV6A 5ETQA 3B54A 1Y10A 1FWKA 1RT3B 3N01A 4HDHA 5F41A 3CGIA 4I69A 2CZ4A 3SSQA 1FRMA 2IM2A 2HS0A 1MN9A 1JJ2R 3IBWA 4KYZA 1HI1A 1S6OA 4F4ZA 1RE1B 3VV2B 2MEWA 1ZYQA 2CQIA 1Y11A 1KDNA 2HQDA 2BA9A 3ZZ0A 1U0HB 4BBYA 3DMJA 1JLCB 2PC6A 1UA0A 1RCXB 3GQCA 5HATA 2BQUA 2IVMA 3GV7B 1W26A 1CPZA 2F63A 1BQNA 2QT7A 2DRDA 3IR5B 4IG3A 1LW2A 4GKJJ 2N4DA 2BBEA 1B3TA 3UW1A 1GXLA 1JLQB 4G1QB 2VBYA 1K1QA 4NA2A 1PAEX 2LXUA 4GMKA 4EFAC 4U8VA 2XC9A 4DR5F 1SV5B 3UNYA 4HH0A 4AXIA 2GV1A 3BM7A 1R7IA 4KGVB 2DT9A 1Y7PA 3BR9A 5BYQA 2XLIA 4KT0C 4P2SA 4DHVA 4W92B 2HURA 4YR2A 3HJFA
chains in the Genus database with same CATH topology
4IR1A 3A8EA 4ZLPA 3ISZA 1N5TA 2DHXA 1AUDA 4PXDA 1X7VA 4RNFA 3DHWC 4ILRA 2CVEA 3QGGA 3V6DB 4PUOA 2ASYA 4WU3A 3H20A 2HHHF 4RNMA 2K1RB 2N7CA 4YB5A 2ZNZA 1RJJA 4ZPBA 1I94F 1J2VA 1MSWD 4KO0A 4M94A 1VGYA 2RNEA 1WG4A 4M5DB 1VQ5S 1M5PC 2HS4A 1S97A 2BVZA 2I0XA 1S1XB 4DQIA 3KLEA 3NP5A 2UXDF 2YNGA 1SI9A 2GQCA 1K0TA 2N4CA 4QR0A 3CCLS 4LFBF 2ZD1B 2HHPA 5DJBA 1P1TA 3CIZA 4IDKB 2CQGA 1R6YA 2VG7A 2XNQA 2KJVA 3ZZTA 2BJDA 1VQOS 1L5UA 2FTRA 3QJPA 3DOLB 4PQAA 5HI7A 3E8OA 2JEIA 2AGOA 5A8KA 3PX4A 3W3SA 2W25A 2XB2D 3QZ7A 3OSPA 2MSTA 1YRXA 1X5OA 4TU8A 1KVIA 4HDGA 2F9JA 5HP1B 3CUNA 2KU7A 3KLVA 4IG0A 3S7RA 4WZQA 2DH9A 1YJ9S 2DGOA 2JZ5A 1KNZA 2M5YA 5KTQA 5A8RB 2RF2B 2C2EA 3C66A 5GADI 5KFOA 2BV3A 2E66A 4NL5A 1VQSA 5C24A 1L3KA 5ADZA 1KQKA 2D3UA 2QRRA 1SIZA 3CCRS 4KHMA 3RRGA 4CTAB 5D3GB 2JC0A 3DLKA 4RBVA 5GAHI 2EFPA 1NK6A 2H9ZA 1EETA 1U45A 2B4OA 2HRUA 1HNIA 3LGMA 5I3UB 3M9OB 3RB0A 1C1CB 3OR1A 4C7QA 4JV2A 3NGDA 2OIHA 2PT0A 4QIGA 5F8JA 2X51A 3DGPA 2PFFB 4ICLB 3UCUP 5GAEU 4TY9A 1OWXA 3DOMA 4DS5A 2YNIA 2AYGA 1GXUA 3IXQA 1CQNA 2D7SA 3KNGA 3J7YU 2V5HG 3DRSB 1VRTB 1ROFA 2W24A 2Z4PA 3MPYA 5I42B 2VD3A 1VOMA 3K8WA 2WBMA 3CMAS 1RAJA 4CH1A 2W9BA 5B0AA 4FBUA 1N32F 2CJAA 4YB7A 5K9FA 4WXOA 2POKA 2CKWA 2DGTA 2MDAA 1U1LA 2ZBIA 1HBUA 5F9NA 2KH9A 2GIRA 2XMUA 2PA8D 4G1PA 2DRBA 2LQJA 3K8VA 4OV1A 2HS3A 3T5HA 1JIHA 2ZZNA 1C0TB 4IH6A 3FVYA 1T3OA 1H0HB 3HVTA 1U8SA 2LMIA 2ZDPA 3MI7X 3DRRB 2W4PA 4CT9A 2Z8QA 3FRYA 1Q86T 3J81Y 2FJVA 1C4AA 3BO3A 1VBZA 3MTJA 2ZKUA 3GV5B 1U26A 4AQYF 3MEEA 4H4KC 1IUJA 3HXMA 4ERDA 1R8BA 2QZ8A 4OIXA 1N5VA 5KT2A 1N52B 5LSRA 2MGZB 3IFEA 2XMVA 3KYLA 4ILMA 1TL1B 4MIWA 3CWJA 1R43A 2MKJA 2ZE2A 1NJYA 4USIA 3P3DA 5J2MB 2Z2MA 3OUYB 4TQSA 4QIVA 2KHDA 2RKIB 1XK8A 2MKSA 4BWJA 4DR6F 3I5BA 2MKKA 5KFUA 1N0VC 3I0SB 2PN6A 2UUWA 2GX8A 3OVSA 4CO1A 1HD1A 1DJ0A 1F5CA 4RWXA 2HIQA 3LAMA 4ECTA 4ZCMA 2XSFA 3DYAA 5F8GA 3I55S 3G9CA 1LOUA 3QGIA 2HHWA 2ZH1A 2DNKA 3UE2A 2EK6A 1UMJA 2G13A 3HF5A 3H59A 5D8HB 4DMZA 1M5SA 1IQTA 2LA6A 2RIJA 3M8QA 2PDAA 1Q8LA 1JLEB 2FJDB 2J8AA 1RTJA 3E01B 1FKPB 2N7YA 1JLFA 3OBIA 1JNZB 2P9CA 4ZOSA 1F5AA 3D0IE 4K5RA 2V4JB 2GJIA 2P6TA 1VQ7S 3LO3A 2FGOA 4DUZF 4D3HA 2CQ2A 3MMAA 2YWFA 4DG1A 3LP1B 3SV3A 1DZ5A 4YEAA 1X9MA 1I1GA 2CJBA 3MECA 1GNKA 4NA3A 1OO0B 5CYQB 2B4VA 4RNOA 2HHUA 3S8SA 2R7UA 4JYAF 4B9SA 4DDFA 5KG3A 2OMLA 2CPEA 1IXKA 3E3XA 2WONA 2IBOA 2C2DA 1GH8A 6FD1A 2CVIA 2IMOA 2ZVSA 4FVMA 1EP4A 3T9NA 4LQ3A 2GMJA 4I2PB 5HLFB 3ZC4A 4ZHRB 4RLEA 3CULA 1HNWF 2HWHA 2M3DA 1QSSA 3AH6A 1NZAA 2PGCA 3JAMY 3P49B 3KFWX 4OJGA 3QO9A 2XHWA 4PWUA 4DF8A 4UY8T 2DHAA 1GAOA 1L3TA 1RT1B 3X3UA 3MGJA 2ZOFA 4NMLA 2VV5A 2L9NA 1BQMA 4PPDA 2G4BA 1DQAA 1F9FA 1JLBB 4NLRA 5KFYA 1WWHA 1Y4ZB 4X4OA 4QWEA 4DV5F 1R0AB 1Q7LB 3O6QA 4ZVEA 3PFEA 3MR2A 4I7FB 3QLHA 1SJ1A 2ZM6F 1NHUA 2FHMA 3CB4A 2OPPA 1RTIA 2L41A 3CC2S 3Q8SB 3C3LA 1IM4A 1FDAA 2CG4A 4HHJA 2DGUA 2UVWA 1G3OA 2VONA 5DETA 4B9VA 4WYWA 4DBQA 2HQ3A 4KB7A 5B0GA 3ZZYA 4WFBQ 5G4DA 4ED6A 1AFJA 2J7KA 2UP1A 1MMLA 1IKXA 3LPYA 1QJHA 2A2DA 3ZZOA 4ECVA 1N36F 2XBPA 5KFEA 4EEYA 1FKOB 3Q8RB 1E6YB 3PACA 2DJWA 4K4VA 1T02A 4C2MA 3FSYA 3CSKA 3MPWA 2GIQA 4O4RA 1OSDA 2KB2A 2YH1A 3MPVA 1Q16B 4F3OA 2OSRA 2C3YA 3ZZUA 3QAEA 3JSRA 3MM6A 4TYBA 2LLZA 2O67A 1HYSA 3GZ7A 3JSMB 4Q7AA 3JYTA 2QMXA 5J2QB 2ZBCA 4EO8A 1V6HA 4LSLA 1RT7B 2WCXA 2YNFB 2RRBA 2RS8A 4FN5A 2B4PA 3MMJA 4JI8F 3U27A 5GAEI 2V8GA 1N6QB 3TR5A 3LUYA 4LIWA 1G1XA 3PV8A 3J7YI 1NJZA 2EFOA 3BGUA 4O3PA 2MPUA 1VQ4S 2F7VA 4F25A 3TARA 2GO9A 2YKAA 3RZAA 1T05B 1NKEA 3I87A 3LOUA 4Y0FA 1Q1KA 1ULRA 1V3RA 2OAUA 4IYQA 4IUFA 4HI1A 1GTHA 2CPJA 3MAHA 2KM8B 5AXMA 1YJTA 1YVFA 2BANB 2HLUA 2DIVA 3NAHA 3NS6A 3KHLA 1WI8A 3M30B 4B9NA 3BQ1A 3M4XA 4QZVB 2COLA 2V94A 4WK3A 1BLUA 5K8OA 5LXYA 1QAYA 1DQ9A 2CQ3A 3PW7A 4HT5A 4F8RA 2YQ3A 1O5JA 3AAWB 3GILA 4JI4F 4U9RA 2BE2A 3T6JA 1DTQB 2XCPA 4B02A 2ZHAA 4FS1A 3PO5A 2V2KA 1SXLA 4N47A 4K4YA 1WG1A 2FVCA 3LH2S 3J80Y 5DQIA 2WW8A 3OLBA 3GIJA 4JI5F 3PEJA 5CZXA 3EXYA 5A2QY 3POTB 4KE5A 2HNDA 1CLFA 4QPTA 4EGLA 3KHRA 4MYTA 3SCIE 2LEBA 4DV2F 2WSEC 2DHSA 3I96A 2RRNA 3TOQA 4PG8A 2AD9A 1SH2A 3L7OA 5KFRA 2DR9A 3QGPA 3MEGA 4PWDA 4K59A 3TW0A 2EBEA 2CQHA 5A8WB 4KKOA 4TQRA 2KZZA 1UWBA 2ZUGA 2W7OA 2BZ2A 2GGPA 2V4QA 4YMEA 1HNXF 2HNYA 3GR1A 1JNRB 3GV8B 3CCJS 4B3OB 3RB4A 2MJNA 5HMWA 1REVA 4ZCLA 4NLYA 1HFEL 3SV4A 1SJ4P 3H5YA 3LWMA 4QWBA 3CJKA 4ZPCA 4DSJA 3IG1B 3NCPA 3CCQS 3FFIB 5T14A 3VAKA 2HMIA 2I5JA 4CO2A 5B0FA 5HN0A 2M2BA 5FDLA 3LANA 2CQ0A 2R7WA 1N8RT 4W90B 4H4KA 4N76A 2ABYA 1RTDA 2ILYA 3OVBA 3CD5A 4AFFA 3CCZA 2MZ1A 4TY8A 2OSQA 1NK9A 2V9WA 4LT6A 4DV0F 4AXJA 2OD4A 3TAMA 1FJGF 4PXBA 4N41A 4OJ1A 1DLOA 2KRRA 3M9NB 2AJ0A 1JXLA 4MTPA 2VG5B 2RU3A 3S6EA