3LAJA

The structure of the intermediate complex of the arginine repressor from mycobacterium tuberculosis bound to its dna operator and l-arginine.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
156
structure length
149
Chain Sequence
AANRAGRQARIVAILSSAQVRSQNELAALLAAEGIEVTQATLSRDLEELGAVKLRGADGGTGIYVVPEVSGGTDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Arginine repressor
publication title crystal structure of the intermediate complex of the arginine repressor from Mycobacterium tuberculosis bound with its DNA operator reveals detailed mechanism of arginine repression.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 43
structure length 149
sequence length 156
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01316 Arg_repressor Arginine repressor, DNA binding domain
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3lajA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3lajA02
1U6GA 1V3FA 1FOKA 1W7PB 1HKSA 1B9MA 3JTHA 2CWEA 1LEAA 3N4MA 4Z2YA 3D5LA 4B8XA 2YU3A 2Z99A 2IJLA 4FHTA 4G6QA 1IN7A 3K69A 4ZYEA 4U0WA 3GVAA 3TO7A 4HDUA 2XIGA 3FMQA 4NQWA 4A2UA 2EA2A 1PP7U 3WTSC 2FMYA 1WI9A 4XSZF 2PHCB 4HZFA 3EDPA 2PBIA 1QO0D 1KA8A 3F8BA 1WIHA 2RDPA 3B73A 4HV5A 4PCQA 4OMYA 3DV8A 2EWNA 4G8XA 2NAZA 5LLQA 5LRSA 2COMA 1HKTA 1XSVA 2GAUA 1T98A 2CQKA 4LB6B 2ESHA 4D0PA 3GEZA 3FXQA 4L5IA 1HBXG 3GFIA 2QZ8A 3C7JA 2ZNYA 2DFIA 1MKMA 4YIFA 4NB5A 1Z7UA 1SFUA 5HDGA 3T1BA 1RUNA 4S05A 3I0TA 1GVJA 2ACJA 4L0YB 2BEOA 2K86A 4OIQF 2QBYA 3WTXC 1FWZA 2RC4A 3TDUC 3TKYA 1B4AA 5CJ9A 2BBYA 2VONA 1YW7A 1XGMA 3ZMUA 1O3SA 3FXUA 1SD7A 5EEGA 3SQNA 3QAHA 1GXPA 3M9AA 2QM3A 5BPDA 4KNYA 1LNWA 5E20A 2IVMA 2EJRA 2RQPA 3P9CA 1EH1A 3F72A 1ON1A 3ZMZA 3GW2A 1KQ8A 2A6HF 4LMYA 1UCRA 2Z3YA 4IRGA 3ZN0A 1R22A 4U7BA 1BJTA 1IRGA 2VXZA 2A61A 4L9JA 3LAPA 4BQAA 4MTEA 1XMAA 4UXNA 1A04A 4LG0B 3K1NA 4GYIA 1ZLJA 3ZPLA 1G3WA 3HRSA 4EJTA 2WTEA 3K9TA 4ON0A 3TDZC 4U0YA 4S04A 2XAFA 2K7LA 3I59A 4M6YA 3HUGA 3LQQA 3CUQC 2LSOA 5L3CA 3BY6A 3CTAA 3W6JB 3F22A 4O5VA 3RPQA 3GZ6A 5D5WB 1DP7P 2HKOA 5LHIA 5DD8A 4EQQA 1HW1A 4WXDA 3MFKA 2A3SA 3WTUC 1IS1A 2L54A 5KVRA 1QNTA 4K2EA 2VE8A 1BI2A 2XRNA 3M8EA 5DEQA 1LEBA 2P8TA 2RGVA 4HV6A 3EETA 3GUDA 2Y48A 3SHFA 3VOEA 2AXLA 3R4KA 4AIJA 5JR3A 2XAGA 2QBYB 1XXBA 5D4RA 2VC0A 4F7ZA 5HLIA 1U8RA 4YG2F 3MEXA 2FE3A 4U88A 4IJAA 4EGYA 5F1RA 1AB4A 1S7OA 2HDCA 1FT9A 4JQFA 3LA3A 2KIMA 4EM2A 3KP3A 3DFGA 4CHUA 4M9XA 2V1DA 3U2RA 1R1TA 2DPDA 3TGNA 5A2QZ 4RS8A 4KDPA 1KU9A 1KGSA 3K2ZA 2R7DA 4I98B 2G7UA 4BH9A 3HHHA 1SMTA 2RGRA 1IZ1A 5F64A 3D0SA 3IL2A 3OPFA 4XRFA 5CVRA 2H94A 2YPRA 1E17A 1FX7A 4KIGA 2Q2EA 3IKTA 2LKPA 5H20A 1R00A 3WGGA 2Z5UA 2OQRA 2EA4A 1UHWA 2GA2A 2Q0OA 2PMUA 2EV0A 3LSTA 3HRUA 4EJUA 1WQ2A 4ZZDA 1WRJA 2JTVA 3ZMDA 3O2PE 2FBIA 4EM1A 1ZG1A 1MD0A 3ML6A 3V7SA 1ZG3A 4HF2A 4L0ZB 3FX3A 1BC7C 3E6MA 3I58A 3QPTA 3GFMA 1RIOH 2NRAC 3WTZA 4RAZA 5LEKA 2QVOA 3MCZA 3J80K 3EYYA 2G7HA 1JE8A 3HHGA 4BYYA 3T8TA 3E5UA 4KFCA 5DCMA 3U1DA 3VFZA 5FD5A 4AD9A 3ECOA 2WWYA 1XGOA 1IW7F 1K78B 1BBYA 1U3EM 2ZMEB 1K7AA 5FLXZ 2OZ6A 4M74A 4KUMA 2F2EA 1BM9A 1SD6A 1TTYA 3C1DA 5L3BA 2FF4A 4R8HA 2DI3A 3KEQA 4XBFA 1FYKA 4PGGA 1YS7A 3REOA 1K6OA 1BI3A 3ZMTA 4A5MA 2M1BA 4R79A 3G73A 3RJPA 3CO7C 2A5YB 3V7CA 4UV8A 1F1ZA 2W24A 3H3UA 2L02A 3NUHA 1I27A 4YFKF 1ZRFA 2EFOA 3VEPA 4RGRA 1S29A 2PEXA 2OU2A 4DDQA 1BI1A 1K79A 1T0FA 4GFQA 4M73A 2QQBA 4LJZF 1G3TA 3VB2A 4HQMA 1YO5C 5E18F 3W6KB 4GCVA 3AAFA 3EYIA 1CF7B 5E8IA 3H92A 3CAGA 2M5WA 3MMLB 5HDKA 1EH7A 3CLOA 5H6QA 3RKXA 4MNUA 1FBQA 1R7JA 5L3EA 4UVBA 4A6EA 3WGIA 3IRQA 2AS5F 1W5TA 1Z1DA 2IP2A 5ILVA 3KCCA 1OYIA 4LLLA 2VN2A 2OD5A 2XHKA 2B0LA 1BIAA 3L00A 1IF1A 2PFBA 5CVIA 1R36A 1UB9A 1Z9CA 1G3YA 4A0YA 3CUQA 2O3FA 1SFXA 2FOKA 2PMHA 3QOPA 3BZ6A 3QU3A 4IPAA 1Y0UA 3IWFA 1L0OC 2OAZA 5IT9Z 1ZARA 4H0EA 4M72A 1XCVA 1HW2A 2JPBA 4EJOA 1PUEE 3JSPA 1S8NA 3HSRA 3RYPA 2RV8A 1TNTA 4PZJA 2V1UA 1U2WA 3H3ZA 3WU1B 3RYRA 3G3ZA 1XGSA 1KU3A 3HTSB 2QYOA 2MLGA 1TNSA 1HSJA 4Y13A 2ADUA 4XLPF 3EQLF 2VBZA 4HF0A 3C18A 4KA4A 4YFNF 1P4XA 2DK8A 3E3VA 1LDDA 2GIVA 2HFHA 1W5SA 3DPTA 2MD5A 2HYFA 3GO5A 1YYVA 2XAQA 5FGMA 1EK8A 2P7CB 2K27A 4MQ9F 3BP8A 1ZYRF 3HRMA 1LQ1A 5FFZA 1I1GA 4LFUA 3T5XA 3LFKA 2L3DA 4L9TA 5DCFA 3KEOA 1ZH5A 4HAMA 1XDSA 1LDJA 1LDKB 4QWQA 1TQIA 1W7PD 1ZRCA 2YX7A 3L2CA 2QENA 1FSHA 1FBSA 2JZYA 1WQGA 3JSOA 2GXBA 3IHUA 3DQVC 2P7VB 1TQPA 4I09A 3FF5A 2O6GE 3JW4A 1TW3A 4EMSA 2J5OA 1ZVUA 4LK0F 1J0RA 4U7DA 1G4DA 2KIFA 1F9NA 4KT5C 1EV7A 1YTYA 4A5NA 2HGCA 5HLGA 2BYVE 3GXOA 2R3SA 3RKYA 2NS0A 2STTA 1TQMA 3Q9SA 2RNJA 3ELKA 3M8FA 2FBKA 3L7WA 1OYWA 1S7AA 1MJAA 1BI0A 3FXRA 1HSTA 2QUFA 2EFWA 4M9ZA 2ZJ2A 3KP4A 1FNNA 4KC6A 5D5UB 5ICCA 3K0LA 4Y17A 2DAOA 2CO5A 1REPC 2CSOA 2HTSA 4AVPA 1SFEA 2ZKZA 1YW9A 2HQNA 4RGXA 3HOSA 1GHCA 4L9VA 2MH9A 2P5LC 2EFQA 1KQ0A 5ICGA 4KYWA 1U5TC 1BGWA 2XGXA 2JT1A 2A68F 3HIFA 2VT3A 3HOTA 3KETA 2H27A 4CICA 1B1BA 3ZN1A 5TJJA 3SZTA 4ZH4F 2STWA 2VE9A 2W57A 4OIOF 2XCRB 1P4WA 3M1EA 1XSDA 1O7LA 4UVCA 4UNOA 1B6AA 2M30A 1OMIA 3KLOA 4L9NA 2MH2A 5EEHA 3CJNA 3V4GA 5HS9A 1O3QA 4QLCU 2XAHA 4OU0A 3O6BB 3KFWX 2XUBA 5LGTA 4DQ2A 1WKMA 1SMYF 2IW5A 3F8CA 4WWCA 2W84A 2K02A 4L5JA 4WX9A 4ESFA 3BPXA 4I2OA 3F21A 2FNAA 4Q5SF 2RN7A 1IN6A 5HS7A 4WCGA 4MGRA 4G0VA 2M87A 2WV0A 4AWXB 4PGHA 3WTVC 2FEZA 3JAMK 2IA1A 4RGUA 4ESBA 2MBFA 3V8JA 4HX7A 3PQKA 1IXSB 2VT2A 4CO8A 2A69F 3RKWA 4Q48A 2M45A 3F6OA 2UZKA 5LGUA 5D6EA 4I7HA 1W4MA 1QBJA 3E6BA 2P4WA 5TRDA 5D5VB 1XDUA 5DUKA 2V1XA 1IN4A 1Q1HA 3ULQB 3I59B 4KB4A 1OPCA 4IHSA 1FZPB 2MLKA 1XSXA 4M9SA 4ZYGA 2TDXA 2NNYA 3J80Z 1F4KA 1ZGJA 5DYMA 2XCOA 1MJ9A 4GXOA 3GZ5A 2HWVA 2OQGA 2EFNA 3F8FA 3GYHX 4WXHA 2MA3A 2ESNA 3FOEA 1BIBA 2QLZA 1FYLA 2P6SA 3NEUA 5JI6A 1OYYA 2V6CA 5D6FA 4AIKA 2FU4A 4XLNF 4IHTA 1IXRC 5ICFA 4M6XA 2DO7A 2Z9OA 4MTDA 1AOYA 1UHMA 3B02A 5CVUA 4HX8A 2FXAA 2X4HA 3MZHA 3BOQA 1X3UA 3DXJF 2Z33A 3E5QA 2NYXA 3BWGA 1O3TA 2KRFA 3KP7A 1FPQA 2E1NA 1ZG5A 1DD5A 4XSXF 1L3LA 1FP1D 1EH8A 1USTA 5K1YA 2UWMA 5DDGA 2ISZA 1R5HA 2HZTA 2JSCA 3ERED 2IA2A 1MDMA 4G7HF 3WODF 1DPRA 3CUOA 5AONA 5E1XA 2DQLA 2D1VA 3GLXA 5D8LB 3FMRA 3BDDA 3CO6C 4HYEA 3F8MA 5ILSA 2Y0MA 2YSRA 1PP8F 3QX3A 2FQ3A 2XKOA 5L3GA 2RKHA 4MEYF 5HLHA 4LB5A 4BNCA 5FFXA 4RAYA 3FM5A 4ZYDA 5CVJA 1I1SA 4EGZA 4ENJA 3FZVA 3HYIA 4OINF 1DDNA 3BJ6A 3Q9VA 3P7NA 2K4JA 1R1UA 2R7FA 2FBHA 4KB2A 4NHJA 5DD4A 2XCQA 1H9GA 2LDUA 3P9IA 1FYMA 3DEUA 4ETSA 3T8RA 1XXCA 4EJVA 3TO9A 2VODA 1KYWA 4HQEA 1RI7A 3RIRA 3GFLA 5DCMB 3ISPA 4G0UA 3F6VA 1BN5A 3CDHA 1G3SA 2KJCA 3QU6A 1U5TA 2PQ8A 4Q4ZF 3COAC 1IUYA 2ELHA 4OIRF 1QZZA 4OIPF 1W7PA 4PDKA 4YIIA 1FC3A 4CXFA 3R0AA 3KP6A 4DNCA 3J81K 2EV5A 4O6JA 1DPUA 1QZYA 3KP2A 2IA0A 1BC8C 5BQTA 5LHHA 4KN4X 4JK1X 4RB1A 1FLIA 3FM3A 3I71A 1SD4A 3WE2A 3LWFA 4UHTA 3FOFA 3IKVA 3I64A 1YW8A 1BOAA 5J8FA 1I6XA 2KJBA 5ED4A 1WWXA 4BHPA 5LGNA 4GO1A 3WTYC 1YLFA 3RTRA 1YIOA 3MZYA 4J3NA 2K4BA 4M71A 1XGNA 4Y15A 4E70A 3IC7A 4G0WA 3I5UA 4G9YA 3PQJA 1LB2A 5D8KB 1VTNC 1J75A 4FM9A 1F5TA 1TBXA 1ZGAA 2XROA 3WU0A 1JHHA 1SD5A 4ENNA 2QQAA 1KU2A 1I5ZA 3BROA 5AIQA 3KZZA 2ZFWA 5K5OA 3GF2A 2XAJA 4EV0A 1XB4A 2H6CA 1J5YA 4WK8F 1MGTA 4N0BA 4RB2C 5ERIA 4KAWX 3I54A 6PAXA 2PJPA 1WQHA 2EFPA 3C3WA 3V8LA 3CUQB 1XCBA 5K5RA 2W85A 5ILUA 1QPMA 2ISYA 4ASNA 1JGSA 4G7OF 2ETHA 5BPIA 1MZBA 4N9IA 4FT8A 1E2XA 2FNPA 1R1VA 2HYGD 4LG0A 3K1MA 2O8XA 4EVIA 5BS6A 5ICEA 3BUEA 3RDIA 1XXAA 2HS5A 4RB0A 4EJWA 3OOPA 1DUXC 4CDGA 1FY7A 3NQOA 4P96A 3DPLC 2QWWA 1QQIA 1ON2A 1UFMA 1YG2A 3N97A 3E6CC 5K5QA 2XVCA 3R61A 1D5VA 2E1CA 3L4JA 2KIUA 3NRVA 5BMZA 2FMLA 2DW4A 1IXCA 4UUVA 4WF2A 2RVCA 1WQFA 2ZFZA 1R5GA 2YR2A 4WXCA 3TOAA 1S6LA 3FHZA 1ZHFA 4I02A 1YQAA 5BOXA 3KP5A 2UXXA 3OEPA 2GWRA 2X0LA 4HDVA 4CGZA 4A12A 1O7FA 3R0JA 4MEXF 1STZA 4EM0B 5JVOA 1R58A 3MQ0A 1LVAA 3ROUA 2VBWA 1P92A 4A6DA 4I01A 4AIHA 1Z6TA 1ODDA 4Q47A 2BE5F 4UV9A 2UXNA 1CGPA 2DBBA 1IRFA 3ECHA 3PFIA 3L4KA 3P9KA 4FX4A 1ZN2A 2IRFG 1Z6RA 4KIBA 1AWCA 1EH6A 3FWEA 1KU7A 3ZP5A 1O57A 3QPHA 4G6DA 1J7KA 5CYVA 4LLNA 4ENKA 4LLGF 1P6RA 2J5PA 2O61A 1H0MA 2CW0F 2PN6A 1FSEA 2BV6A 2YX4A 2DU9A 2P6TA 3OREA 2FA5A 1RUOA 5CVVA 2CG4A 4HX4A 2OBPA 2W25A 4P9UA 3F8NA 1USSA 1H9TA 3SXYA 5L3DA 4HA8A 1YS6A 2MC3A 2LF8A 2HR3A 3Q5FA 1HXDA 2H6BA 3JAMZ 2D1HA 1D8KA 1ULYA 2JPCA 3OV8A 2D45A 1BJAA 1JHFA 3ZQ7A 2ZNZA 4RGSA 2VC1A 2HEOA 1HW5A 3LA7A 1XN7A 4B09A 5LEJA 3E5XA 3F3XA 2XV4S 3WTWC 5DV5A 5HVQC 1P2FA 1GE9A 3E97A 4A0XA 1OKRA 2V9VA 3J7AO 4G7ZF 4I0AA 4BXUA 1J2XA 1K78A 1OR7A 5J6XA 3WE3A 2E7XA 2ZMEA 2M8EA 2FSWA 2O03A 5HS8A 5F6FA 3WTTC 1C0WA 2CYYA 3HSFA 4YFXF 2GXGA 4IVNA 2H09A 3E6DA 4GGGA 4OOIA 3MWMA 2C6YA 1FBUA 1WSUA 5E1ZB 4HBLA 4IXAA 4N9HA 1R23A 5A2QK 4BHCA 2OA4A 4HF1A 3O3KA 1KQ9A 3KZYA 2FRHA 1T2KA 4O3MA 5JVTA 1J59A 2HOEA 3SZPA 2XASA 4GYGA 5AIPA 3BPVA 3FMSA 3DP7A 4KN7X 2GQQA 3GWZA 3M7GA 3R60A 4KDDA 5CLSA 2XKPA 3RPUA 3HRTA 2PI0A 1QGPA 2DK5A 4ZZLA 3HTUA 2HTJA 3TOBA 4L18B 2EK5A 4BHBA 1HKQA 5DUIA 1CF7A 1T6SA 3BJOA 1JXSA 1KYZA 2JRTA 3VODA 3I4PA 3ZMSA 5JFRA 3LQRA 4G94A 3ABUA 5D4SA 3R6SA 4LD5A 2P5MA 1RZ4A 4RB3C 2F5CA 2EB7A 3QP5A 4BAYA 1Z05A 4IRIA 2VOOA 1Z91A 4HLYA 1B59A 2GA1A 1B9NA 3L09A 3GX4X 1LJ9A 1G6NA 1D8JA 2ZO4A 1ZREA 4HW0A 4UVAA 2DTRA 4U0VA 4KMFA 4ZYHA 5IT3A 2E7WA 2KKOA 2VBXA 2L4AA 2Y3PA 1XD7A 3LPXA 4IRHA 2CGPA 5FLXK 2EV6A 3BJAA 3V7RA 4CZZA 3SFZA 3F23A 5FO5A 1XMKA 3S2WA 4A0ZA 4JBAA 2VOPA 2IT0A 2ZXJA 5E8GA 3RI4A 5KK1A 2F5FA 5D5XB 2O0YA 4HLXA 1IN5A 4R1HA 1FP2A 2L01A 1NHAA 4ENMA 5H6RA 3MAJA 3TQNA 4FX0A 3T0YA 2OZUA 5FB2A 3J81Z 2NNNA 2F5DA 3KLNA 3VA7A 1RNLA 2CFXA 2LF7A 2P5VA 2P5KA 4KIFA 1P4AA 2Y75A 3IRRA 1IN8A 2PLYA 3EUHA 1GXQA 2L4MA 2ZCWA 4LK1F 4ESJA 5J8CA 2DQRA 5FD6A 1U78A 5LHGA 4OMZA 1J9IA 2WC2A 1O3RA 1TW2A 3TO6A 3DF8A 4I0BA 4P55A 1MJBA 3L9FA 1ONVA 2PG4A 3KE2A 1ZLKA 3ZMVA 2DPUA 4P5OA 2V79A 1MDMB 3JTGA 3QRFF 3WGHA 5L3FA 3DKWA 1IAWA 2GZWA 3I53A 2KWAA 5HOOA 2QQ9A 5LRRA 4P9FA 5E17F 4LGWA 2HKXA 2A07F 3ABTA 1V4RA 1T38A 4IF4A 4CYDA 1ISEA 5JHUA 3LA2A 4MQVA 1ZRDA 2G9WA 2A6EF 2HQRA 1D3YA 3U9GA 2D2WA 3V8KA 2LNBA 2DLLA 1B4BA 5HDNA 2DT5A 3LAJA 5LBQA 1HQCA 2IPQX 5IT9K 2ZBKA 1PDNC 1TLHB 1SAXA 4KICA 2F5EA 1T39A 1ZAOA 3HSEA 3GFJA 4TV7A 3IWZA 4HOBA 2BGCA 3K1PA 2Q8KA 4KMUX 1S3JA 5E1WA 3QP6A 1YFHA 3WG9A 2VBYA 1U5TB 4MHGA
chains in the Genus database with same CATH superfamily
4BU2A 1U6GA 2EIKH 4BKWA 1QHGA 3ZQQA 1V3FA 2LBFB 1VNDA 1AKHB 2HOTA 1FOKA 4WJ4A 1JGGA 1W7PB 1J6WA 1JKQC 4C2MK 1HKSA 1B9MA 3JTHA 2CWEA 1LEAA 2KHMA 2OF7A 3DTIA 3IP4B 1OCRH 4Z2YA 3N4MA 4RM3A 3D5LA 2P81A 1YJNI 4JP0A 4B8XA 4C3JC 4UUSB 3S16C 1FMVA 2YU3A 3Q0WA 2Z99A 3GTLK 2IJLA 1JOEA 4FHTA 4G6QA 2QSGX 2VXDA 1IN7A 4DYQA 3K69A 4XOPA 4ZDPA 4ZYEA 2F4OB 2HDDA 3GIRA 2COBA 1TWCJ 1YJ9I 4U0WA 3JRCA 3EQLA 3GVAA 3H5NA 2XSDC 2MABA 4P1WA 1JT6A 1QVTA 3TO7A 2K9SA 5C3EK 4YFNA 3AD7C 4C2TA 3GEEA 1PJRA 3KX2A 4DBRA 4S0HB 2WB1A 2XIGA 3FMQA 3K4BA 4NQWA 4QSHA 4A2UA 4HDUA 4RLQA 2EA2A 1UMQA 3HKZN 2R92C 1PP7U 2B63C 3WTSC 2FMYA 4CUGA 1IJWC 2KPMA 1WI9A 1WJFA 4XSZF 2CMPA 3HJEA 3TP0A 2DCEA 2X6OA 2PHCB 4HZFA 3EDPA 3OYBA 4G12A 2PBIA 4C2MC 1KZHA 1QO0D 1KA8A 2QSFX 4Y3OA 2E2IJ 4RBOA 3F8BA 1WIHA 4A3BK 1ZQ3P 2Z16A 2RDPA 3HKZL 3B73A 4HV5A 4PCQA 4OMYA 1VQPI 2VQLA 3DV8A 2EWNA 3BQZA 4G8XA 2NAZA 2HQ5A 5LLQA 5LRSA 2V9PA 4KT6A 1ETVA 3AD8C 2COMA 1HKTA 1R71A 1XSVA 2GAUA 4LQYA 4A3MK 5FKOA 1T98A 2CQKA 5EGOB 1LFBA 2R7OA 4LB6B 4IHYA 2ESHA 2LREA 1W0TA 1SVOA 4HNUA 4D0PA 3GEZA 3FXQA 2PMZN 1G51A 4L5IA 1XMXA 1HBXG 2LVSA 3W2VA 3GFIA 2QZ8A 1P7JA 3RZDC 3C7JA 2ZNYA 2DFIA 1MKMA 4YIFA 3CMAI 4NB5A 1Z7UA 1SFUA 5HDGA 1F7VA 3T1BA 1RUNA 2DODA 1X2NA 3I0TA 4S05A 1GVJA 2ACJA 4L0YB 2BEOA 3GTGJ 4X6AJ 1AHDP 2WAQN 2K86A 3GTJJ 2NVYK 4OIQF 2QBYA 2PMZL 5HLTA 1QPIA 3WTXC 1FWZA 2RC4A 5FRNA 4A3BC 3TDUC 3TKYA 3JRFA 1B4AA 5CJ9A 5TGTA 2BBYA 2EQRA 2CH0A 1T0FC 3HOZC 2WY8Q 3F9KA 4OAZA 2VONA 1YW7A 1XGMA 3ZMUA 1O3SA 5IYDC 2WAQL 2DDBA 1OCCH 3FXUA 1WOSA 1SD7A 3S2DJ 1Y1VJ 5EEGA 4BXXK 4UB6C 3HEFA 3SQNA 3QAHA 3FBIB 1GXPA 1XZPA 1ZQ1C 1SFOC 3M9AA 2QM3A 5BPDA 4KNYA 1LNWA 2G0EA 5E20A 2DMUA 2VQGA 5KAIC 5M5YK 2E5ZA 2LKSA 2IVMA 2EJRA 2L5QA 2RQPA 3P9CA 1EH1A 3OYHA 3ZOBA 1YE9A 3F72A 4G6TB 1E3OC 1ON1A 3E7LA 3ZMZA 1PJ7A 3JRIA 1V5VA 3FBNB 3GW2A 1KQ8A 1UHSA 2A6HF 4LMYA 4XRMA 1UCRA 2Z3YA 4IRGA 3ZN0A 2DMQA 1JKRC 4YELA 1R22A 4U7BA 4A3KK 1BJTA 1IRGA 2VXZA 1RR7A 1ZTRA 5M5WJ 3CP2A 2A61A 2CUZA 4L9JA 3LAPA 4BQAA 4MTEA 1XMAA 1VJEA 4OIQA 4UXNA 1A04A 4Y33A 4LG0B 4DW6A 3K1NA 3I55I 1TWCA 5FLVA 4GYIA 1ZLJA 1I6HK 2HPMA 3CC7I 1W1WE 1JJ6C 2FOWA 1X1AA 4BXXC 3ZPLA 1G3WA 3DKYA 3MD2A 4HG2A 3HRSA 4EJTA 4GTCA 3JRAA 3N0BA 2WTEA 3K9TA 2R7SA 4ON0A 3N3YA 3TDZC 3CD6I 1WCMK 4XQFA 2E19A 2L9VA 2Z1DA 3IH2A 4U0YA 2YU9A 5JFEA 4S04A 2XF6A 3G2BA 3WG7H 2XAFA 2DOEA 3W2WA 2GXAA 2K7LA 3I59A 4X1EA 4E7KA 2DA4A 2LOOA 2LY2A 4M6YA 1DQUA 3HUGA 2BW3B 3LQQA 4QTRA 3CUQC 2LSOA 5L3CA 3BY6A 1ACIA 3CTAA 4Z6YA 3W6JB 3F22A 3MKZA 2CRGA 4O5VA 3RPQA 2QCOA 3GZ6A 5D5WB 1DP7P 5CPRB 2A6HA 2HKOA 5LHIA 5DD8A 4EQQA 1HW1A 4WXDA 5FROA 2B7EA 3MFKA 2A3SA 3BR2A 4XLHA 2CUJA 3WTUC 1IS1A 2L54A 5KVRA 1QNTA 3RKQA 4K2EA 2L7KA 1V54H 2VE8A 1I6HC 3S17J 1BI2A 2XRNA 3M8EA 4Y7NJ 5DEQA 1MBFA 1LEBA 2P8TA 2RGVA 3BTCA 1ZKGA 4HV6A 4A3DJ 3EETA 3GUDA 2LMDA 2Y48A 4RMNA 3SHFA 3VOEA 2AXLA 1WCMC 3CQZA 5C44K 3R4KA 4MLOA 1PVEA 2ZB9A 2V6SA 2XF7A 2M8GX 5J4YA 4XIDA 4AIJA 5JR3A 2XAGA 4YRVA 2QBYB 3GMEA 2Z2SB 3GTQJ 2LY1A 1XXBA 5D4RA 3U21A 2A68A 1Z3YA 2DT6A 2VC0A 4F7ZA 2R7WA 5HLIA 1U8RA 2HVQA 4YG2F 3MEXA 2FE3A 4U88A 4IJAA 4EGYA 4ZH4A 5F1RA 1AB4A 2AQFA 1ETKA 1S7OA 4BY1J 2HDCA 1FT9A 5FKLA 4JQFA 3GCMA 3LA3A 2K3PA 2B9SA 2KIMA 3M07A 4ANJA 4EM2A 1ENHA 2L9SA 3KP3A 1L0WA 3DFGA 4QJVB 4CHUA 4M9XA 2V1DA 3U2RA 1HI9A 1R1TA 2PJRA 1WZ2A 1VQ6I 2DPDA 3TGNA 4BJTA 5A2QZ 1O27A 4C3HC 4RS8A 2QA4I 4KDPA 1KU9A 1KGSA 3K2ZA 2R7DA 4CSWA 2M4KA 3HOUK 3A0BC 4I98B 4BUPA 4E7SA 1O24A 2G7UA 3OYFA 2VASA 4UUTA 4BH9A 1I50J 3HHHA 1DCOA 5DTDA 3A2KA 4A69C 3WHCA 1SMTA 3BCAA 2RGRA 1D0XA 1MSEC 2NXNB 4A3EJ 4LITA 1IV8A 1IZ1A 5F64A 4KM8A 2D6FC 5E68A 2KDOA 3D0SA 3IL2A 3OPFA 3BP8C 3KPHA 4MFDA 5FJ8J 3GTPK 5IYCJ 5HNFA 4XRFA 1QZEA 5CVRA 2H94A 2YPRA 2VJ5A 2V6TA 2OTLI 1E17A 2DA1A 1FX7A 4M3BA 4KIGA 4YG2A 2M0CA 3CMMA 2Q2EA 3HGYA 3IKTA 2LKPA 5M3MK 5F0HA 3H35A 5H20A 4ZDOA 2BY3A 1R00A 3K2AA 3WGGA 1A5JA 1QVUA 1MNMC 4AYBD 1XC5A 2Z5UA 2OQRA 5GADJ 2EA4A 1I3QJ 1UHWA 4RA2A 4ZC3A 1JT0A 2R7ZC 2DOAA 4Y52J 2GA2A 1APLC 2Q0OA 1Q1VA 2PMUA 1OCTC 4GDFA 3ASNH 2EV0A 3LSTA 3HRUA 4EJUA 3H3VL 1XX5A 1IO2A 1QHHD 1WQ2A 1EJ9A 1EI6A 5C4JC 4AH6A 4ZZDA 3HOZJ 1OQYA 1WRJA 1SANA 2HQAA 1GVDA 2JTVA 3ZMDA 1VLOA 1Y8QB 1PUFA 2CV1A 3O2PE 4A3FK 1TWFK 2FBIA 3IAM2 3S14J 3GTMJ 4XORA 1ORKA 4EM1A 1ZG1A 1MD0A 1SFOJ 3OIPA 4AM3A 1NG6A 3ML6A 3BTLA 3V7SA 1EF4A 1ZG3A 4HF2A 1NTCA 4XKWA 4L0ZB 3FX3A 3OMYA 4W1UA 2E1MC 1BC7C 3E6MA 4A93C 3I58A 3QPTA 2JA7K 3GFMA 1X2MA 2EBIA 1B8IA 1RIOH 4F3QA 3L1PA 3HGGA 2NRAC 3S1NK 3CCYA 4BJ6C 1LUJB 1ZGWA 3WTZA 4RAZA 3GTOK 2JJ7A 2KRHA 5LEKA 3I4NJ 2QVOA 5H2FC 3MCZA 1POGA 4CYCA 3J80K 3EYYA 1T8IA 2O8KA 1IDYA 1V55H 1SAUA 1MBHA 1WH7A 2G7HA 1VQ7I 2CFAB 4E6KG 1JE8A 3HOVJ 3HHGA 4BYYA 1MBKA 2RAEA 3T8TA 3E5UA 4ZDLA 4KFCA 5DCMA 4I76A 1BDFA 4A3FC 3U1DA 3KZIC 5E79C 3VFZA 1TWFC 3HBLA 5FD5A 3ZQLA 1DGRM 4AD9A 2CU7A 3ECOA 2WWYA 1K83C 1XGOA 3CC4I 1IW7F 2GAHC 2E2JK 2QF7A 2L0KA 2R92A 1K78B 3IH3A 1BBYA 5GAHJ 4PAAA 2B63A 2WV1A 1U3EM 3IPJA 2DMPA 2EILH 1R9TK 2ZMEB 1K7AA 5TISC 5FLXZ 2OZ6A 3Q0UA 4M74A 5J47A 1Y6IA 4RLFA 1OCOH 2F2EA 4KUMA 3S1NC 4RAGA 1BM9A 1SD6A 1TTYA 3GTOC 2VKDA 3JCUC 3C1DA 1DP3A 2EZKA 5L3BA 4BDZA 2ME6A 2FF4A 2ICWG 3S0XA 4R8HA 1IL2A 2DI3A 1IV6A 4IX7A 2M0MA 2Y2ZA 5IP7C 3KEQA 3WHBA 4XBFA 1FYKA 4PGGA 1YS7A 3S15J 4BBSJ 1YIJI 1IE0A 3REOA 3FISA 1K6OA 3HKZD 1BI3A 3FKIJ 3ZMTA 4A5MA 4J19A 1V5GA 3QPLA 2M1BA 2XPVA 4R79A 3G73A 3RJPA 5GAEJ 1WSRA 4PFPA 3CO7C 2DXIA 2A5YB 2VKEA 3V7CA 3HOYC 4KJZA 4UV8A 3BZCA 2E2JC 1F1ZA 2W24A 3H3UA 4ZJZA 2L02A 3NUHA 2Y0SL 1I27A 3GBGA 1S7EA 3S1QC 2JA6C 3CJQB 3A1YA 1R9TC 2AO9A 4YFKF 1I3QA 3CZ6A 4D5FA 1ZRFA 2EFOA 1IW7A 2E2HK 3VEPA 4RGRA 1S29A 2E2IK 2PEXA 2WB1N 1WORA 5GAGJ 4PJNA 2HDWA 5TJ3A 4C45A 1VH2A 3M4OC 1FIPA 2OU2A 2V7FA 4F91B 4DDQA 1BI1A 4LOCA 1K79A 2VQCA 1T0FA 2ECCA 3DXJA 4GFQA 4M73A 1P7IA 2GIZA 2PMZD 4IL6C 2LTPA 2DT7B 4XICA 4BE1A 4BQOA 1J6XA 2WB1L 2QQBA 4LJZF 1G3TA 3VB2A 1SFOA 1XZQB 4HQMA 1YO5C 5E18F 3T00A 3W6KB 2WAQD 2GM4A 1B8IB 4GCVA 3AAFA 5C4XK 2O7OA 3EYIA 1CF7B 3I4MK 3OR1C 2W7VA 4BEHA 2DDAA 3H92A 2CQNA 2M5WA 5E8IA 3CAGA 1HA8A 3MMLB 3GTJK 5HDKA 3GTGK 4M3DA 4X6AK 1EH7A 3CLOA 5H6QA 3RKXA 3H0GJ 4MNUA 1FBQA 5DS9A 3S2HJ 3WODA 4G7HA 2K9NA 5JLXA 4IO9F 1R7JA 2VUMK 5L3EA 4UVBA 4A6EA 3WGIA 3IRQA 1USOA 4PUSA 2AS5F 1TT5B 1W5TA 2Y30A 2R5ZA 3FXJA 1UELB 3H5AA 2JA5C 3KIOA 1Z1DA 1WOOA 3GTKK 3RPUD 1TWHC 2IP2A 1X1BA 5ILVA 1YRNA 4M3GA 3KCCA 5M5XJ 1Y1VK 4KITB 1OYIA 3QQAA 2H1KA 1JI8A 4LLLA 1MBJA 3L2WA 2JH3A 2VN2A 2OD5A 4E7JA 1D1BA 2XHKA 2B0LA 4E7IA 1BIAA 3L00A 1IF1A 4EEFG 2PFBA 5FLMC 5CVIA 3H36A 1R36A 4XL9A 1UB9A 4OINA 3ZGKA 4IHXA 1Z9CA 1G3YA 3VYTB 2I10A 3I4MC 1TP4A 2R93K 3VDXA 4A0YA 3CUQA 4O2DA 2O3FA 1SFXA 2HPIA 3BR0A 2FOKA 3DBLB 2PMHA 5GTHC 3TFHA 5M5WK 2VUMC 3QOPA 3N0CA 5CQGA 1O2FB 4P5AA 3BZ6A 3QU3A 1PJ6A 4IPAA 3V42A 5D4DA 5BNGA 3GTKC 3BG6A 2ZSIB 1Y0UA 3IWFA 1L0OC 2OAZA 5IT9Z 1ZARA 2NVQC 2DFFA 3A01B 4H0EA 4M72A 3B6CA 4AU7A 1XCVA 4KMDA 4D9JA 5IOSA 1VRQC 3ZXSA 1HW2A 1D0ZA 2JPBA 2P0WA 4EJOA 2VPLA 1PUEE 3KYLA 3JSPA 3HC7A 4B47A 2YUSA 1S8NA 3FXLA 2XAUA 3GDZA 5JHFA 1U8BA 1JJ8C 3HSRA 4JOMA 3RYPA 1BW5A 2RV8A 3E0JB 1TNTA 4PZJA 2V1UA 1G2HA 4JX4A 1U2WA 3BTJA 3SYTA 3H3ZA 4Q4ZA 2R93C 3WU1B 3RYRA 3G3ZA 3CJRB 1XGSA 1KU3A 2M2EA 3HTSB 3MMYB 1SC7A 2QYOA 2MLGA 3SZGA 2CW8A 1HSJA 1TNSA 2A6TA 3BG5A 2CQ7A 3FXKA 4Y13A 3OSFA 2HVSA 1WSVA 3S1MJ 1LFUP 2ADUA 4XLPF 2PPBA 3EQLF 2M7BA 1AU7A 4KMUA 2VBZA 4HF0A 1KQ4A 3C18A 4KA4A 5M3FJ 4DIQA 4II3A 4YFNF 2RQQA 1BR2A 4A3DK 1P4XA 1TWGK 2W1OA 1UJ8A 3K7AC 4P9SA 2DK8A 3E3VA 1LDDA 2GIVA 2HFHA 3QYEA 2ZXWH 1W5SA 4A3LJ 1WGXA 3DPTA 3GTQK 2LY9A 3OL4A 2GSUA 2MD5A 2BZTA 3DU5A 3TW6A 2HYFA 4XN0A 5IP9C 3GO5A 3BT9A 1YYVA 4RAFA 3OR2C 4KATA 2XAQA 5FGMA 1EK8A 2P7CB 2IGNA 4BY1K 2K27A 1WH5A 5EZGA 1JTXA 4MQ9F 2LD5A 3BP8A 2QEXI 1ZYRF 4M3EA 3HRMA 1B72B 1LQ1A 1VQKI 2Y69H 5FFZA 2MD0A 3BG3A 1Y1WK 1BA5A 1TWAJ 4GTFA 3K4MA 1I1GA 4LFUA 3CCVI 3T5XA 2IGMA 4FASD 3LFKA 3BQYA 2L3DA 3A8IA 2HYJA 4L9TA 5DCFA 2PA8L 3KEOA 2JA8C 1TWGC 1ZH5A 2A5WA 3CCJI 4XLPA 4HAMA 1E3HA 1XDSA 3A4CA 1LDJA 1LE8A 2R7ZA 4GTLA 1I50K 2KQRA 3QYBA 1LDKB 4QWQA 1MMGA 2YU9J 3MZ8A 1TQIA 1W7PD 1ZRCA 2DFEA 2YX7A 4A3EK 4MIMA 5EYRA 1UV7A 1MMDA 4C30A 3L2CA 4PK4A 4DZJA 2QENA 1FSHA 1FBSA 3J7ZI 2JA2A 2NVTJ 2JZYA 4XKBA 3H3VD 1MIJA 4KMHA 1WQGA 3BLYA 3JSOA 2GXBA 3IHUA 3FHNA 3DLLF 3DQVC 3S1RJ 1MNEA 1Y1WC 1JUPA 3GTLC 4MQ9A 2OCEA 4CH7A 1IRXA 1SFKA 2P7VB 4CA0A 1TQPA 1ZYRA 4I09A 3FF5A 4BE2A 2O6GE 5J1UA 3JW4A 1TW3A 1TL8A 5FKKA 4EMSA 4XONA 1J98A 5C3EC 2J5OA 2X85A 4PJJA 1ZVUA 3CQZJ 3RZOJ 2HXOA 4LK0F 4BKXA 1J0RA 2MC4A 1XPXA 2IGKA 4KMAA 3BG7A 2NVXK 4U7DA 4LIVA 1G4DA 4C9YA 5L46A 2KIFA 3GTMK 1F9NA 4KT5C 3LSJA 2QSHX 3QWLA 1EV7A 1MSFC 4G7OA 3PIPF 1YTYA 1DU6A 4BBRJ 4A5NA 3S8PA 2HGCA 5HLGA 5EF6A 1K83A 2JVHA 4ZTFA 4BY7K 4V2FA 2BYVE 4IQJA 3GXOA 2R3SA 3RKYA 5EG0B 2CV2A 2NS0A 3MVPA 3K70D 3HPHA 2STTA 1TQMA 2NS8A 3Q9SA 4HNVA 4A3MC 2RNJA 2ZFUA 3ELKA 3M8FA 2BXYA 2FBKA 1A36A 1JUMA 4CCJA 2I5UA 3L7WA 2O9LA 4B4CA 4BGDA 1OYWA 1LKXA 2KZVA 3DKXA 2R7VA 1S7AA 1MJAA 5EJCA 5IOTA 4LR2A 1BI0A 3FXRA 1HSTA 2QUFA 2K40A 3DBRB 4V19K 2ECBA 3IV5A 4PJMA 2XPUA 1A6QA 3M3YK 3PM1A 5E3OA 2EFWA 4M9ZA 2NVXC 2JK3A 2ZJ2A 3KP4A 1FNNA 3P5JA 4C3IJ 4KC6A 1U9NA 5D5UB 5ICCA 2NVYC 3K0LA 4Y17A 2DAOA 3H3VK 4LK0A 2CO5A 1REPC 1TWAA 3LSIA 2JVGA 3A8JA 2CSOA 3BCBA 2HTSA 4AVPA 1SFEA 2ZKZA 3I9V2 5KHDA 4JYKA 4U87A 4BY7C 3AG1H 2X1DA 1YW9A 3HOXJ 1FOYA 4A3CJ 3T02A 2HQNA 4RGXA 1LE8B 3HOSA 4WILA 2JA6A 3JRGA 1GHCA 3IH4A 4L9VA 2MH9A 1R9TA 2W48A 5TMFA 2DOFA 4NQWB 4N4OB 2P5LC 3JSTA 5B1BH 2EFQA 1KQ0A 2EINH 5ICGA 4KYWA 1U5TC 2OCCH 1BGWA 2Y0SD 2XGXA 3C2GA 2JT1A 2A68F 1HF0A 2BY1A 3HIFA 2VT3A 3HOTA 3KETA 2H27A 4F93B 1F7UA 4CICA 1B1BA 3ZN1A 5IYBK 5TJJA 3SZTA 4GTAA 3M3YC 3S15K 2FQ4A 4ZH4F 1IC8A 2STWA 1J09A 5EEAA 2VE9A 2W57A 2ZXHA 4CCOA 4OIOF 1YNNA 3SJMA 2XCRB 3MN2A 4A3KC 1P4WA 2CUFA 2R4GA 4MEXA 5KNLA 4A3GJ 3M1EA 1XSDA 1O2BA 2EBBA 1X4PA 4A3JK 1O7LA 2CQQA 1YX5A 2VKHA 2WB1D 4UVCA 4UNOA 1B6AA 1ETXA 2M30A 2XPWA 4JX6A 1OMIA 3KLOA 4L9NA 1E3PA 2MH2A 5EEHA 3MKYB 3CJNA 3V4GA 2HOSA 3H5RA 2V6UA 2XGDA 5HS9A 1O3QA 9ANTA 3AH5A 1ZXOA 4QLCU 2XAHA 4OU0A 3O6BB 3G1LA 5F0CA 3KFWX 2XUBA 5LGTA 2JA5A 4DQ2A 2EIMH 2R5YA 1TWHA 3HM5A 1I3AA 1WKMA 3FDYA 4FETA 1SMYF 2IW5A 3F8CA 5FKNA 4WWCA 4C3JJ 4EATA 3OYEA 3S16J 2W84A 4BQNA 3K10A 3FXMA 2DMTA 3AD9C 3AQPA 1WJEA 2K02A 4L5JA 3CF5F 2JA8J 1D1AA 4WX9A 1DCHA 5J40A 2LK2A 4XR6A 4OIOA 4ESFA 3BPXA 1RC9A 1BJZA 3OYGA 5HL8A 4A3JC 4I2OA 5J4VA 3LSKA 1XZPB 3F21A 2FNAA 4LLGA 3K70C 4Q5SF 5CQEA 3HOWK 1Z3XA 4D5CA 2RN7A 2R92J 1IN6A 5HS7A 2CW0A 2B63J 4WCGA 2L9NA 3AL0B 4MGRA 2VUMA 4G0VA 2KLOA 5C44C 2M87A 2WV0A 4AWXB 5M5XK 3Q3SA 4C2MJ 4PGHA 3GTKA 4IKFA 5E3MA 1Z0XA 1BW6A 3WTVC 2BVMA 2FEZA 3JAMK 2DA3A 2IA1A 2ZJQF 4RGUA 4GTBA 4ESBA 4F52A 2MBFA 3V8JA 4HX7A 3PQKA 2FQTA 3LSMA 2GSOA 1GDTA 1IXSB 2VT2A 3PO2K 3GEIA 4CO8A 2A69F 1GUUA 3RKWA 4Q48A 2IEKA 1SMYA 2M45A 1ETOA 3F6OA 2UZKA 5LGUA 3O8HA 5D6EA 3G71I 4I7HA 1W4MA 1QBJA 1W5CC 3E6BA 3X2QH 3CCQI 2P4WA 3C2HA 5FKMA 5C3EJ 1HC8A 5TRDA 2UV1A 5D5VB 1VGXA 3VWBA 3HOWC 3RZDJ 1XDUA 5DUKA 1JTYA 2V1XA 1IN4A 1Q1HA 3ULQB 5IOZA 2YS9A 2L7MP 1K4SA 5IORA 1VQ5I 2BY0A 3I59B 4KB4A 1OPCA 4IHSA 3HUGB 1FZPB 4Q5SA 3HOUC 2MLKA 4QIWN 1XSXA 4M9SA 1VQNI 4ZYGA 4PFOA 1WI3A 2TDXA 3H0DA 4JX5A 3A0HC 3UNGC 4A3BJ 2HXIA 2NNYA 1PYVA 3J80Z 1X3ZB 1F4KA 1ZGJA 5DYMA 3OYMA 2CV0A 2XCOA 1MJ9A 1DGWY 3D5RC 1SVMA 3PO2C 5IYDJ 4GRIA 4BJ5C 2BOLA 4GXOA 4QIWL 3GTPC 3EUAA 3GZ5A 2K5CA 2WAQA 4RMFA 3H9JA 2HNHA 3ZQFA 2HWVA 3CMYA 2A69A 4AVZA 2OQGA 1WPKA 2EFNA 3A02A 1PJ5A 3F8FA 4KARA 3GYHX 4WXHA 1SVLA 2QGUA 3OS1A 4ILDA 1HLVA 2MA3A 2ESNA 2IS1A 3FOEA 1BIBA 2ZUEA 1Z77A 2QLZA 2P6SA 3OL3A 1FYLA 1OJLA 3S1MK 3NEUA 5JI6A 1OYYA 2V6CA 3ZQGA 5D6FA 4AIKA 3FXOA 2FU4A 2BVLA 4XLNF 3A8KA 5F1JA 3DBHB 1FEXA 4A3IK 1NG7A 5K7FA 1U9OA 4IHTA 1IXRC 5ICFA 4M6XA 3ZRGA 4I6ZA 1D1CA 4BXXJ 2DO7A 3OIQA 3SZZA 3F0CA 3PSIA 2PJRB 2IAIA 3PO3K 2PA8D 2Z9OA 4MTDA 1AOYA 4YEJA 1X1CA 5JVGF 4W97A 2GBYA 1UHMA 3B02A 3CJTB 5CVUA 3PL8A 5B1AH 1WJBA 4HX8A 2JA7C 2FXAA 2X4HA 3MZHA 3BOQA 2BHYA 1QRYA 1X3UA 4D7MA 1X58A 3DXJF 3O8GA 2Z33A 3E5QA 2NYXA 3BWGA 1O3TA 4DOZA 2VKVA 1GT0C 2KRFA 3KP7A 1FPQA 2E1NA 1ZG5A 1DD5A 4XSXF 3GTLA 4A3IC 1L3LA 2XC7A 2Q1ZB 1TWCK 2LR8A 2MFZA 4M6VA 1FP1D 5JLWA 1W36D 1EH8A 1USTA 5K1YA 2LYCA 2UWMA 4XLNA 4J01A 5DDGA 2ISZA 1I6HJ 1F43A 1R5HA 2HZTA 2Q2EB 4ABZA 1VQMI 4DBQA 2JSCA 2KZGA 4CCNA 3ERED 2IA2A 3DLAA 1MDMA 5GP9A 1UG0A 4G7HF 1WCMJ 3WODF 1DPRA 2M9HA 2VIXA 3CUOA 3AL0C 5AONA 5E1XA 2DQLA 2D1VA 3GLXA 5D8LB 3FMRA 3BDDA 2Y9ZA 3CO6C 3TEDA 2NVTK 4HYEA 4FCYA 3PNYA 3F8MA 5ILSA 2Y0MA 2YSRA 1PP8F 2V6EA 3QX3A 2ID3A 1FJLA 1HQMA 2FQ3A 5K7HA 2XKOA 4IHWA 5L3GA 2RKHA 3E1SA 4MEYF 5HLHA 4LB5A 1MH3A 3L2RA 4IEJA 4BNCA 3GZNB 3FK7A 5FFXA 1SEUA 4F55A 3NWSA 3OYAA 1PUFB 4RAYA 1R4MB 3FM5A 5CVJA 4ZYDA 1I1SA 2OPTA 4PSWA 4EGZA 4ENJA 3FZVA 3HYIA 4UY8I 1TWCC 4XNFA 1ZR4A 4OINF 1DDNA 3BJ6A 1A35A 3Q9VA 2DA2A 3P7NA 2K9LA 4XSXA 2K4JA 1R1UA 3DTEA 3VSKA 1FIAA 2R7FA 4DJAA 2FBHA 4MFEA 4C3HJ 4KB2A 4NHJA 2GOMA 5DD4A 2XCQA 1H9GA 2LDUA 4AIDA 1HCRA 1ETQA 3P9IA 2DYSH 5J3LA 1FYMA 3MKLA 1VQ8I 3DEUA 4P5BA 3CLQA 3G1OA 3K4LA 3QOEA 3T8RA 4ETSA 4RDUA 2NVYA 2E2HC 2EZHA 3TP3A 4CYCB 1XXCA 2E2IC 4XCHA 3ZQHA 4EJVA 3TO9A 2VODA 2EIJH 5LD2C 1KYWA 1R5ID 4HQEA 1O4XA 4C2UA 2XF5A 1BS2A 1RI7A 2LH9A 3RIRA 3GFLA 5DCMB 3WU2C 3ISPA 2OTJI 3S2DK 1W0UA 4G0UA 3F6VA 4MEYA 2V9KA 2HI3A 1T08B 3PNVA 1JKOC 1BN5A 2GOXB 4HEA2 3CDHA 2N8GA 3Q0VA 5HNHA 1G59A 3SDBA 1G3SA 3HB9A 3AQOA 2KJCA 3QU6A 1U5TA 2E35A 2PQ8A 1T95A 4Q4ZF 3COAC 1QU3A 3QYFA 1IUYA 2LBFA 1AKHA 2ELHA 4OIRF 1QZZA 4OIPF 5C4XC 1W7PA 2R7ZJ 4PDKA 2E1OA 3HOUJ 2ZXIA 2BXZA 4YIIA 3GTGC 4B48A 4X6AC 4E7HA 1FC3A 3GTJC 4PSXA 5HODA 4NNJA 1INNA 4CXFA 3R0AA 5C4JJ 3KP6A 1MW7A 2LP0A 4DNCA 4UUSA 2WA0A 3ABLH 3J81K 2EV5A 1GV2A 4BDYA 2IS6A 5B5EC 1K61A 1T56A 4O6JA 1DPUA 2IBDA 1MMAA 4I99C 3LSPA 4KN4A 1OCZH 4JK1A 3HOXK 1QZYA 2O5RA 3KP2A 2IA0A 3RCOA 1BC8C 3ADAC 1Y1VC 1Z21A 3U1KA 3QPSA 5BQTA 3LFUA 5LHHA 1W36C 3S32A 4KN4X 2VI6A 4JK1X 5M3MJ 4RB1A 1FLIA 3B6AA 3FM3A 3I71A 3ONQA 3OSGA 4A93J 1SD4A 2QQ8A 3BC8A 3CCRI 2ZC2A 1G8XA 1OR7C 3WE2A 1WCMA 1EKEA 3LWFA 4UHTA 4QPQA 3FOFA 3PNTA 3IKVA 3I64A 2ZMEC 1RKWA 1TZLA 1KONA 3NAUA 1FOXA 2CQXA 2K3FA 4Y4RA 4M3FA 1BOBA 1YW8A 1ITYA 4OIRA 2VPRA 4OIPA 4LK1A 1BOAA 3OYLA 5J8FA 1WJAA 1I6XA 2KJBA 3SZYA 2IS4A 3I56I 2VL8A 1LVKA 5ED4A 1WWXA 4BHPA 5LGNA 4GO1A 4A3FJ 3WTYC 5EGEA 1TWFJ 2ELKA 2F6CA 1YLFA 3RTRA 5EGOA 1YIOA 3MZYA 4J3NA 1DU0A 1K83J 3S17K 2NVUB 1O29A 2K4BA 4HNTA 4Y7NK 4M71A 2R7TA 4AUXA 1XGNA 4GTEA 4Y15A 4E70A 3H9GA 3IC7A 4G0WA 3I5UA 4BEHB 4G9YA 1OCPA 3OS2A 1JQWA 2QKMB 4FE4A 5EGHA 3FIWA 3PQJA 1LB2A 5D8KB 4IOAF 3S1NJ 2BY2A 1VTNC 1J75A 1LPQA 1VFCA 2ZSHB 1NK3P 4NC6A 3GTOJ 4FM9A 1N77A 1TT0A 1F5TA 5IOQA 1TBXA 1XTAA 2R5ZB 1ZGAA 2DN0A 2XROA 3WU0A 2X48A 2DJNA 1JHHA 5J1RA 1SD5A 4ENNA 1BR4A 2QQAA 3J7AY 3GEHA 5IP7J 1KU2A 1BR1A 1I5ZA 1YRNB 3BROA 2MG4A 4IZZA 5AIQA 1N78A 3KZZA 2ZFWA 5K5OA 4B44A 2E60A 3CC2I 3BTIA 3GF2A 1MBEA 2E71A 2XAJA 4EV0A 2DJIA 1T33A 4CCKA 1ERDA 2R0QC 1XB4A 2H6CA 2R92K 1J5YA 4WK8F 1MGTA 1V5FA 4XN3A 4N0BA 1YHQI 3HOYJ 3SFIA 2UUZA 4Y7NC 2B63K 5B66C 2E2JJ 3TFIA 4RB2C 4A3DC 3TMOA 5ERIA 4KAWX 3S1QJ 2XDVA 2JA6J 3I54A 2A6EA 1IG7A 1ZELA 3CCUI 1R9TJ 1K4TA 6PAXA 2PJPA 2EFPA 3C3WA 3V8LA 1IRZA 1WQHA 2Y0SA 2WAFA 3CUQB 1XCBA 5K5RA 2W85A 4XMYA 3GTQC 3ABKH 4RM2A 5ILUA 1QPMA 3M4OJ 2ISYA 1YI2I 4B3AA 4ASNA 1OISA 2DTZA 2KISA 1JGSA 4G7OF 2MGQA 2ETHA 5BPIA 1MZBA 4V2GA 2ID6A 2ZJPF 2L7ZA 4B1RA 3L2QA 5FJ8K 3IUOA 5IYCK 3JREA 4N9IA 2H1LA 4FT8A 1E2XA 4XLEA 2FNPA 4BY1C 2JMWA 1R1VA 2F4IA 2HYGD 4LG0A 2R7QA 4ZTJA 1H88C 3GTPA 1O25A 3K1MA 2O8XA 2KFDA 1YX3A 4EVIA 5BS6A 5ICEA 3RDIA 3BUEA 2KT0A 1XXAA 3RZDK 4XK4A 2HS5A 4RB0A 4EJWA 1Y39A 2X1EA 3OOPA 4QIWD 1DUXC 2IXSA 1R4NB 3OOUA 4CDGA 1FY7A 3NQOA 4CZCA 4P96A 1I3QK 3G4AA 3DPLC 3BR3A 4Y52K 1K6YA 2QWWA 4GZYA 1QQIA 2BW3A 2XRLA 1ON2A 1UFMA 1YG2A 2E2HJ 3CESA 1I50C 1YNJA 1X3WB 3N97A 1YX2A 3E6CC 5K5QA 3HOZK 1RETA 2JA5J 2AQEA 2XVCA 3R61A 2JQ7A 1D5VA 3T01A 2DA7A 2M7AA 4A3EC 1TWHJ 2E1CA 2K9MA 5IYDK 1YOVB 2CS3A 3L4JA 2KIUA 3OYCA 4BACA 3NRVA 4E7LA 2X6WA 3S14K 5IYCC 2WY7Q 4F92B 5BMZA 2FMLA 1SFOK 2DW4A 3VYRB 4IQ4A 1IXCA 1S5LC 4WF2A 4DZPA 5B3SH 4UUVA 1TWFA 2RVCA 3HPGA 3KYCB 3W3CA 3CP8A 4XKCA 4ZYAA 2GLOA 1WQFA 3BP3A 4NBQA 3ZQIA 5FLMJ 3OYDA 4BLBA 2ZFZA 1R5GA 2DFHA 2YR2A 5C4XJ 4WXCA 3TOAA 1S6LA 3FHZA 2ME0A 1WFXA 1ZHFA 4XKVA 1E0EA 4I02A 2W4SA 3I4MJ 3H1CA 1I3QC 2JA7A 1YQAA 4Y52C 2W00A 5BOXA 2Y31A 3I4NK 3KP5A 2Y9YA 2UXXA 1IQ0A 3OEPA 2IS2A 2ELJA 1VQ4I 2GWRA 2X0LA 4HDVA 2HOAA 3N05A 2VUMJ 2FQOA 3GTOA 1VQOI 2WAEA 2GSNA 4CGZA 4XSZA 5KCMA 4A12A 1O7FA 1LFPA 2DMNA 3HOVK 3R0JA 2R7RA 2VJJA 4MEXF 3GTKJ 1STZA 3W2AA 4EM0B 5LFAA 1N75A 5JVOA 1R58A 1VQ9I 1NK2P 1VZ0A 3OIOA 2NOJB 1FMWA 5EZHA 3MQ0A 2NVQJ 3G4CA 3S14C 1LVAA 3GTMC 3ROUA 3PUFA 2VBWA 1P92A 4QJVA 4LOWA 4A6DA 4I01A 4AIHA 1Z6TA 3NWTA 1ODDA 4Q47A 2E36A 4OAYA 2L7FP 3HZJA 3TTGA 1WJCA 2BE5F 4NC7A 3LSGA 2OC6A 3ZQCA 1BL0A 4UV9A 2UXNA 1CGPA 4AYBA 2R93J 2K85A 2DBBA 3C2BA 3I3LA 1IRFA 1MBGA 3ECHA 3PFIA 3I4NC 3EUHC 4XLAA 4CCLA 3L4KA 3P9KA 1A31A 1VF9A 4FX4A 1ZN2A 2IRFG 4L5EA 1Z6RA 4KIBA 2E34A 1AWCA 2DYRH 3HOVC 3ABMH 1EH6A 2VQHA 3DTKA 3FWEA 3ZP5A 1KU7A 1O57A 4BBSK 4N4NB 3FKIK 3QPHA 1JUSA 2JN6A 3LSRA 1YJWI 4G6DA 1J7KA 4IOCF 2F48A 5CYVA 4XRSA 3J7YJ 4LLNA 4ENKA 4LLGF 2E1MB 3PFYA 1P6RA 3K7AJ 3S3NA 5IY5H 1QA6A 2J5PA 2O61A 2KP6A 1H0MA 2CW0F 3ASOH 1ZK8A 2PX9A 2PN6A 1FSEA 2CUEA 2BV6A 2YX4A 2DU9A 2P6TA 2LLKA 3OREA 2FA5A 1RUOA 3AG4H 5CVVA 2CG4A 5IP9J 3CCMI 1HDPA 4HX4A 2OBPA 1I39A 4KISA 2GAGC 4XM3A 2W25A 2E2HA 2E2IA 2BE5A 4P9UA 1AA7A 3Q3QA 3F8NA 3DWLE 1USSA 1H9TA 2NS7A 3VPRA 5F08A 3SXYA 1TC3C 2L9RA 5L3DA 1WOPA 4HA8A 4BE0A 1YCLA 4BQQA 1YS6A 2MC3A 1V5EA 2LF8A 4LIUA 5F0FA 5IYBC 1X4OA 2XB5A 2HR3A 3S15C 4BBSC 3Q5FA 1HXDA 2H6BA 2DA5A 3AG3H 3SEQA 1H89C 3HL2A 2JWTA 3FKIC 3JAMZ 1O28A 1M1EB 4FISA 2D1HA 1D8KA 1ULYA 1Y56A 2JPCA 3OV8A 4C3HK 4X0GA 2D45A 2RREA 1BJAA 1JHFA 1TWGJ 3ZQ7A 2XSJC 2E5NA 2ZNZA 1JVIA 4KASA 2FJ1A 4FQGA 4RGSA 2FX0A 2VC1A 4M1XA 2HEOA 1ZBSA 1VI0A 2V26A 3H0GK 3S2HK 1HW5A 3LA7A 3GTGA 2OJED 1XN7A 3GTJA 3QODA 4B09A 5LEJA 3E5XA 3KYDB 3F3XA 2XV4S 3WTWC 4WJ3M 2LC2A 4GFBA 5DV5A 5EDNA 3S3OA 2X6YA 1ETWA 4UB8C 5HVQC 1P2FA 2CFAA 4NUBA 1GE9A 5E3NA 4GT9A 4DYCA 3E97A 2ZUFA 4A0XA 5F04A 1S72I 1Y1VA 1OKRA 5FRMA 1MH4A 2V9VA 1Y1WJ 3J7AO 4G7ZF 3GTLJ 3HKZA 4I0AA 2MSYA 4NDLA 4BXUA 1J2XA 1K78A 1OR7A 2WBMA 4GTDA 2O5IA 2R7ZK 5J6XA 3WE3A 4AC0A 2E7XA 2ZMEA 2V4JC 2M8EA 1J6VA 2FSWA 3PIOF 2O03A 5HS8A 5F6FA 4FZBA 4HSTA 3H0GC 3WTTC 1C0WA 3S2HC 2EZLA 5C4JK 2R93A 2KRCA 3NARA 2CYYA 3HSFA 4YFXF 2LFBA 3DEEA 2RNGA 2KIQA 4QPOA 2GXGA 4IVNA 4XLFA 2H09A 3G4SI 3E6DA 2TRTA 4GGGA 4OOIA 3MWMA 2C6YA 1F36A 3AG2H 3JRHA 1IUFA 1FBUA 3LL7A 1R49A 1WSUA 5E1ZB 4HBLA 2PMZA 4IXAA 4N9HA 1R23A 2MYSA 4A93K 4HSRA 5A2QK 2RH6A 1WJDA 4BHCA 4BLAA 2OA4A 4HF1A 3O3KA 3LOCA 1KQ9A 3KZYA 4A3MJ 1YITI 2FRHA 5DM6F 1T2KA 4O3MA 2A05A 3TL4X 2CJJA 4G7ZA 5JVTA 1IBAA 4KM9A 2OV7A 4NC8A 4KN7A 3CMEI 1J59A 2HOEA 3SZPA 3MKWB 2XASA 4GYGA 5AIPA 1FTZA 3G1MA 3HXLA 3K6GA 3BPVA 4II2A 4OWRB 3FMSA 2R5YB 3DP7A 2FUG2 4PJ0C 4KN7X 2NVXJ 1EQRA 3VYUB 2GQQA 3GLLA 3GWZA 3M7GA 1OLTA 2NVYJ 3R60A 3AKZA 3D5SC 4YFXA 4KDDA 5CLSA 1U0JA 2XKPA 3OWTA 3RPUA 1K83K 3H9QA 1X1PA 1JKPC 3HRTA 2F4MB 4E4HA 5M3FK 3K4CA 2PI0A 1QGPA 2DK5A 3JRBA 2X51A 1DCPA 1XZQA 4ZZLA 3HTUA 4BY7J 2HTJA 3TOBA 1XS9A 2CFOA 4L18B 1TWGA 2EK5A 4BHBA 1HKQA 5DUIA 1CF7A 1FOWA 4A3LK 1T6SA 3BJOA 1JXSA 1KYZA 5IPAA 2JRTA 2OUMA 4DGWB 1MNDA 2ZJRF 3VODA 3I4PA 3LMMA 3GTQA 2XGCA 1IGNA 3ZMSA 1NH3A 5JFRA 5M5YJ 2KDZA 2L2OA 3K4KA 3SDGA 3ZR8X 4NOIA 1H8AC 3LQRA 1MMSA 5IP7K 4G94A 3UKGA 3ABUA 5D4SA 2JSPA 3R6SA 1A6IA 3M3YJ 4BXFA 3A03A 4LD5A 3L2VA 4IHVA 2P5MA 4PABA 3VSLA 3S1MC 1RZ4A 3OYNA 4RB3C 3W6VA 2F5CA 1TWAK 2MW8A 2EB7A 3QP5A 3S93A 4BAYA 4A3KJ 1P9QC 1IDZA 1Z05A 3HOYK 4IRIA 2VOOA 1Y1WA 2LRDA 3LSHA 1Z91A 2DA6A 4XOTA 4HLYA 2WADA 4FE7A 3S1QK 2JA6K 1B59A 4HPQA 2GA1A 1EFWA 1B9NA 1S9HA 3L09A 3GX4X 1LJ9A 4A3LC 2YU9K 2H8WA 3M4OK 1G6NA 4CCMA 3JRDA 1D8JA 1I50A 2ZO4A 1ZREA 3PO3C 4HW0A 1WJ5A 1UAAA 1F93A 5GPCA 5IP6A 2EPFA 4UVAA 3HDDA 2X9DA 3DCFA 2JUCA 5IYBJ 4XLCA 2DTRA 2Y0SN 4U0VA 3BR5A 3RQIA 3OS0A 4KMFA 4ZYHA 5IT3A 2E7WA 3BR6A 2KKOA 2VBXA 3A01A 4ITVA 4XRSG 3S1RK 1TWAC 2L4AA 2Y3PA 3OY9A 1R6RA 1XD7A 1UZCA 2M34A 3LPXA 3ZCOA 3CF2A 4IRHA 4J00A 3DU6A 2CGPA 5FLXK 4A3JJ 2EV6A 3BJAA 3V7RA 2VLAA 1OFCX 4CZZA 3G6EI 3SFZA 3F23A 4PJLA 3K4NA 5FO5A 3JR9A 5K7ZA 2R7UA 5TMCA 1FTTA 2EH3A 1XMKA 2JUGA 2BHZA 3S2WA 3TW7A 4JBAA 4A0ZA 2VOPA 3S3MA 2ZXJA 5E8GA 2IT0A 3CQZK 2YU9C 3RZOK 1RR8C 2JA5K 3RI4A 5KK1A 2F5FA 3FKJA 2O0YA 3HG9A 5D5XB 3TFJA 4HRIA 4HLXA 4MO7A 4B3XA 1TWHK 1IN5A 5C44J 4R1HA 1FP2A 1X1DA 1O26A 2L01A 1NHAA 3BZKA 4ENMA 5H6RA 2NVXA 3D1NI 3MAJA 4DYRA 2HU9A 3EPZA 2X6XA 4LG3A 3TQNA 2NVTC 2O5JA 4FX0A 3T0YA 4BBRK 3CDLA 2TCTA 3KEYA 3GTMA 1ETYA 2OZUA 5FB2A 3BG9A 3J81Z 5FLMK 3S1RC 3PSFA 5KAFC 2NNNA 3CCSI 3DPUA 2F5DA 3KLNA 3VA7A 2R7XA 1RNLA 2CFXA 2LF7A 2P5VA 2W7NA 2P5KA 3RSNA 2I8DA 1USMA 4KIFA 3HOWJ 1XG1A 1P4AA 3VYSB 2Y75A 3UR3C 3IRRA 1IN8A 2PLYA 3CQZC 3AFHA 3EUHA 4H4KC 1ZR2A 3RZOC 1GXQA 5DM7F 5CKTA 2L4MA 2ZCWA 4YFKA 4LK1F 4ESJA 4C3IK 5J8CA 1EA3A 2DQRA 5FD6A 2NVQK 1U78A 2EZIA 5LHGA 5GTIC 1B72A 3GSIA 4OMZA 1MMNA 4BBRC 1J9IA 1Y8RB 2WC2A 3RQ4A 4B43A 1O3RA 3M1CA 1WHUA 2F5VA 1HDDC 2V1NA 2VJIA 2LG4A 3PO2J 1TW2A 3TO6A 3DF8A 4I0BA 1Z7LA 3OYIA 4P55A 2FD5A 3IAS2 4A3CK 3GTPJ 4YIRX 2VJ4A 1MJBA 3L9FA 1HOMA 4LJZA 1RKTA 1ONVA 2PG4A 1I6VA 3S2DC 3KE2A 1ZLKA 3ZMVA 1C0AA 3OYKA 3CCEI 2DPUA 4P5OA 2V79A 1MDMB 3JTGA 3QRFF 3SEZA 2VB6A 3WGHA 4FTHA 5L3FA 4D1QA 3DKWA 1RRJA 1IAWA 2GZWA 3I53A 2M4GA 1RPWA 2D5VA 2KWAA 5HOOA 2QQ9A 5LRRA 4BS9A 4C3IC 4P9FA 5E17F 2KMUA 1XPPA 5F27A 4LGWA 4AYBN 2HKXA 4BL0B 2K9QA 2A07F 1CQTA 3FKIA 3ABTA 1V4RA 2CW7A 1T38A 4A3GK 2QKLB 4IF4A 4CYDA 3K7AK 2M3AA 1ISEA 1X19A 5J1YA 1Y0NA 3BR1A 3OYJA 5JHUA 3LA2A 4MQVA 3PJRA 3HOXC 1ZRDA 4A3CC 4AYBL 1O2AA 2G9WA 3EUKL 2A6EF 3ERMA 3FK6A 2HQRA 2X1CA 1D3YA 3U9GA 2D2WA 3V8KA 2HZDA 2LNBA 5IP9K 2DLLA 1Z67A 1D5YA 3TBIA 1B4BA 1X31C 2KL4A 1WVRA 3M8JA 5E3LA 2H8RA 5HDNA 2JA7J 1VQLI 2DT5A 1N25A 2IGOA 3LAJA 3L2UA 5LBQA 2JRMA 3CCLI 1HQCA 2IPQX 5IT9K 2ZBKA 1PDNC 4C3JK 3S16K 1TLHB 2AHQA 3DEWA 1SAXA 3K4JA 4KICA 3HXAA 2F5EA 1T39A 3ESWB 1ZAOA 3HSEA 5GPAA 4D7NA 3PUBA 5IOYA 1D0YA 3GFJA 2NOGA 4A3IJ 4TV7A 3IWZA 2JA8K 4HOBA 2BGCA 3K1PA 2Q8KA 4E7ZA 4A3GC 2AXTC 5EG0A 1RESA 1GLNA 4KMUX 3LNQA 1UG2A 1S3JA 5E1WA 3CDIA 2HVRA 5CHPA 2LKXA 3QP6A 2XB0X 1YFHA 2XGEA 3WG9A 1RU0A 2VBYA 3S17C 2W82A 3H0GA 1U5TB 3PO3J 4MHGA 1GV5A
chains in the Genus database with same CATH topology
1U6GA 4BKWA 1V3FA 1FOKA 1W7PB 1HKSA 1B9MA 3JTHA 2CWEA 1LEAA 3N4MA 4Z2YA 3D5LA 4B8XA 4C3JC 2YU3A 2Z99A 2IJLA 4FHTA 4G6QA 1IN7A 3K69A 4ZYEA 4U0WA 3GVAA 3TO7A 4HDUA 2XIGA 3FMQA 4NQWA 4A2UA 2EA2A 1PP7U 3WTSC 2FMYA 1WI9A 4XSZF 2PHCB 4HZFA 3EDPA 2PBIA 4C2MC 1QO0D 1KA8A 3F8BA 1WIHA 2RDPA 3B73A 4HV5A 4PCQA 4OMYA 3DV8A 2EWNA 4G8XA 2NAZA 5LLQA 5LRSA 2COMA 1HKTA 1XSVA 2GAUA 4LQYA 1T98A 2CQKA 4LB6B 2ESHA 4D0PA 3GEZA 3FXQA 4L5IA 1HBXG 3GFIA 2QZ8A 3C7JA 2ZNYA 2DFIA 1MKMA 4YIFA 4NB5A 1Z7UA 1SFUA 5HDGA 3T1BA 1RUNA 4S05A 3I0TA 1GVJA 2ACJA 4L0YB 2BEOA 2K86A 4OIQF 2QBYA 3WTXC 1FWZA 2RC4A 3TDUC 3TKYA 1B4AA 5CJ9A 2BBYA 2VONA 1YW7A 1XGMA 3ZMUA 1O3SA 3FXUA 1SD7A 5EEGA 3SQNA 3QAHA 1GXPA 3M9AA 2QM3A 5BPDA 4KNYA 1LNWA 5E20A 2IVMA 2EJRA 2RQPA 3P9CA 1EH1A 3F72A 1ON1A 3ZMZA 3GW2A 1KQ8A 2A6HF 4LMYA 1UCRA 2Z3YA 4IRGA 3ZN0A 1R22A 4U7BA 1BJTA 1IRGA 2VXZA 2A61A 4L9JA 3LAPA 4BQAA 4MTEA 1XMAA 4UXNA 1A04A 4LG0B 3K1NA 1TWCA 4GYIA 1ZLJA 3ZPLA 1G3WA 4GTCA 3HRSA 4EJTA 3N0BA 2WTEA 3K9TA 4ON0A 3N3YA 3TDZC 2YU9A 4U0YA 5JFEA 4S04A 2XAFA 2K7LA 3I59A 4M6YA 3HUGA 3LQQA 3CUQC 2LSOA 5L3CA 3BY6A 3CTAA 3W6JB 3F22A 4O5VA 3RPQA 3GZ6A 5D5WB 1DP7P 2HKOA 5LHIA 5DD8A 4EQQA 1HW1A 4WXDA 3MFKA 2A3SA 3WTUC 1IS1A 2L54A 5KVRA 1QNTA 4K2EA 2VE8A 1BI2A 2XRNA 3M8EA 5DEQA 1LEBA 2P8TA 2RGVA 4HV6A 3EETA 3GUDA 2Y48A 3SHFA 3VOEA 2AXLA 3CQZA 3R4KA 4AIJA 5JR3A 2XAGA 2QBYB 1XXBA 5D4RA 2VC0A 4F7ZA 5HLIA 1U8RA 4YG2F 3MEXA 2FE3A 4U88A 4IJAA 4EGYA 5F1RA 1AB4A 1S7OA 2HDCA 1FT9A 4JQFA 3LA3A 2KIMA 4EM2A 3KP3A 3DFGA 4CHUA 4M9XA 2V1DA 3U2RA 1R1TA 2DPDA 3TGNA 5A2QZ 1O27A 4C3HC 4RS8A 4KDPA 1KU9A 1KGSA 3K2ZA 2R7DA 4I98B 1O24A 2G7UA 4BH9A 3HHHA 1SMTA 2RGRA 1IZ1A 5F64A 4KM8A 3D0SA 3IL2A 3OPFA 4XRFA 5CVRA 2H94A 2YPRA 1E17A 1FX7A 4KIGA 2Q2EA 3IKTA 2LKPA 5H20A 1R00A 3WGGA 2Z5UA 2OQRA 2EA4A 1UHWA 2GA2A 2Q0OA 2PMUA 2EV0A 3LSTA 3HRUA 4EJUA 1WQ2A 4ZZDA 1WRJA 2JTVA 3ZMDA 3O2PE 2FBIA 4EM1A 1ZG1A 1MD0A 3ML6A 3V7SA 1ZG3A 4HF2A 4L0ZB 3FX3A 1BC7C 3E6MA 3I58A 3QPTA 3GFMA 1RIOH 2NRAC 3WTZA 4RAZA 5LEKA 2QVOA 3MCZA 3J80K 3EYYA 2G7HA 2CFAB 1JE8A 3HHGA 4BYYA 3T8TA 3E5UA 4KFCA 5DCMA 3U1DA 3VFZA 5FD5A 4AD9A 3ECOA 2WWYA 1XGOA 1IW7F 2R92A 1K78B 1BBYA 2B63A 1U3EM 2ZMEB 1K7AA 5FLXZ 2OZ6A 4M74A 4KUMA 2F2EA 1BM9A 1SD6A 1TTYA 3C1DA 5L3BA 2FF4A 3S0XA 4R8HA 2DI3A 3KEQA 4XBFA 1FYKA 4PGGA 1YS7A 3REOA 1K6OA 1BI3A 3ZMTA 4A5MA 2M1BA 4R79A 3G73A 3RJPA 3CO7C 2A5YB 3V7CA 4UV8A 1F1ZA 2W24A 3H3UA 2L02A 3NUHA 1I27A 1I3QA 4YFKF 1ZRFA 2EFOA 3VEPA 4RGRA 1S29A 2PEXA 5TJ3A 2OU2A 4DDQA 1BI1A 1K79A 1T0FA 4GFQA 4M73A 2QQBA 4LJZF 1G3TA 3VB2A 1SFOA 4HQMA 1YO5C 5E18F 3W6KB 4GCVA 3AAFA 3EYIA 1CF7B 5E8IA 3H92A 3CAGA 2M5WA 3MMLB 5HDKA 1EH7A 3CLOA 5H6QA 3RKXA 4MNUA 1FBQA 1R7JA 5L3EA 4UVBA 4A6EA 3WGIA 3IRQA 2AS5F 1W5TA 1Z1DA 2IP2A 5ILVA 3KCCA 1OYIA 4LLLA 2JH3A 2VN2A 2OD5A 2XHKA 2B0LA 1BIAA 3L00A 1IF1A 2PFBA 5CVIA 1R36A 1UB9A 1Z9CA 1G3YA 4A0YA 3CUQA 2O3FA 1SFXA 2FOKA 2PMHA 3QOPA 3N0CA 4P5AA 3BZ6A 3QU3A 4IPAA 1Y0UA 3IWFA 1L0OC 2OAZA 5IT9Z 1ZARA 4H0EA 4M72A 4KMDA 1XCVA 5IOSA 1HW2A 2JPBA 4EJOA 1PUEE 3JSPA 1S8NA 3HSRA 3RYPA 2RV8A 1TNTA 4PZJA 2V1UA 1U2WA 3H3ZA 3WU1B 3RYRA 3G3ZA 1XGSA 1KU3A 3HTSB 2QYOA 2MLGA 1TNSA 1HSJA 4Y13A 2ADUA 4XLPF 3EQLF 2VBZA 4HF0A 1KQ4A 3C18A 4KA4A 4YFNF 1P4XA 2DK8A 3E3VA 1LDDA 2GIVA 2HFHA 1W5SA 3DPTA 2GSUA 2MD5A 2HYFA 3GO5A 1YYVA 4KATA 2XAQA 5FGMA 1EK8A 2P7CB 2K27A 4MQ9F 3BP8A 1ZYRF 3HRMA 1LQ1A 5FFZA 4GTFA 1I1GA 4LFUA 3T5XA 3LFKA 2L3DA 4L9TA 5DCFA 3KEOA 1ZH5A 4HAMA 1XDSA 1LDJA 2R7ZA 4GTLA 1LDKB 4QWQA 1TQIA 1W7PD 1ZRCA 2YX7A 3L2CA 2QENA 1FSHA 1FBSA 2JZYA 4KMHA 1WQGA 3JSOA 2GXBA 3IHUA 3DQVC 2P7VB 1TQPA 4I09A 3FF5A 2O6GE 3JW4A 1TW3A 4EMSA 2J5OA 1ZVUA 4LK0F 1J0RA 4KMAA 4U7DA 1G4DA 2KIFA 1F9NA 4KT5C 1EV7A 1YTYA 4A5NA 2HGCA 5HLGA 1K83A 2BYVE 3GXOA 2R3SA 3RKYA 2NS0A 2STTA 1TQMA 3Q9SA 2RNJA 3ELKA 3M8FA 2FBKA 3L7WA 1OYWA 1S7AA 1MJAA 5IOTA 4LR2A 1BI0A 3FXRA 1HSTA 2QUFA 2EFWA 4M9ZA 2ZJ2A 3KP4A 1FNNA 4KC6A 5D5UB 5ICCA 3K0LA 4Y17A 2DAOA 2CO5A 1REPC 1TWAA 2CSOA 2HTSA 4AVPA 1SFEA 2ZKZA 1YW9A 2HQNA 4RGXA 3HOSA 2JA6A 1GHCA 4L9VA 1R9TA 2MH9A 2P5LC 2EFQA 1KQ0A 5ICGA 4KYWA 1U5TC 1BGWA 2XGXA 2JT1A 2A68F 3HIFA 2VT3A 3HOTA 3KETA 2H27A 4CICA 1B1BA 3ZN1A 5TJJA 3SZTA 4GTAA 4ZH4F 2STWA 2VE9A 2W57A 4OIOF 2XCRB 1P4WA 3M1EA 1XSDA 1O2BA 1O7LA 4UVCA 4UNOA 1B6AA 2M30A 1OMIA 3KLOA 4L9NA 2MH2A 5EEHA 3CJNA 3V4GA 5HS9A 1O3QA 3AH5A 1ZXOA 4QLCU 2XAHA 4OU0A 3O6BB 3KFWX 2XUBA 5LGTA 2JA5A 4DQ2A 1TWHA 1WKMA 1SMYF 2IW5A 3F8CA 4WWCA 2W84A 3AQPA 2K02A 4L5JA 4WX9A 4ESFA 3BPXA 4I2OA 3F21A 2FNAA 4Q5SF 2RN7A 1IN6A 5HS7A 4WCGA 4MGRA 2VUMA 4G0VA 2M87A 2WV0A 4AWXB 4PGHA 3GTKA 3WTVC 2FEZA 3JAMK 2IA1A 4RGUA 4GTBA 4ESBA 2MBFA 3V8JA 4HX7A 3PQKA 2GSOA 1IXSB 2VT2A 4CO8A 2A69F 3RKWA 4Q48A 2M45A 3F6OA 2UZKA 5LGUA 5D6EA 4I7HA 1W4MA 1QBJA 3E6BA 2P4WA 5TRDA 5D5VB 1XDUA 5DUKA 2V1XA 1IN4A 1Q1HA 3ULQB 5IORA 3I59B 4KB4A 1OPCA 4IHSA 1FZPB 2MLKA 1XSXA 4M9SA 4ZYGA 2TDXA 2NNYA 3J80Z 1F4KA 1ZGJA 5DYMA 2XCOA 1MJ9A 4GXOA 3GZ5A 2HWVA 2OQGA 2EFNA 3F8FA 4KARA 3GYHX 4WXHA 4ILDA 2MA3A 2ESNA 3FOEA 1BIBA 2QLZA 1FYLA 2P6SA 3NEUA 5JI6A 1OYYA 2V6CA 5D6FA 4AIKA 2FU4A 4XLNF 4IHTA 1IXRC 5ICFA 4M6XA 2DO7A 2Z9OA 4MTDA 1AOYA 1UHMA 3B02A 5CVUA 4HX8A 2FXAA 2X4HA 3MZHA 3BOQA 1X3UA 3DXJF 2Z33A 3E5QA 2NYXA 3BWGA 1O3TA 2KRFA 3KP7A 1FPQA 2E1NA 1ZG5A 1DD5A 4XSXF 3GTLA 1L3LA 1FP1D 1EH8A 1USTA 5K1YA 2UWMA 5DDGA 2ISZA 1R5HA 2HZTA 2JSCA 3ERED 2IA2A 1MDMA 4G7HF 3WODF 1DPRA 3CUOA 5AONA 5E1XA 2DQLA 2D1VA 3GLXA 5D8LB 3FMRA 3BDDA 3CO6C 4HYEA 3F8MA 5ILSA 2Y0MA 2YSRA 1PP8F 3QX3A 2FQ3A 2XKOA 5L3GA 2RKHA 4MEYF 5HLHA 4LB5A 4BNCA 5FFXA 4RAYA 3FM5A 4ZYDA 5CVJA 1I1SA 4EGZA 4ENJA 3FZVA 3HYIA 4OINF 1DDNA 3BJ6A 3Q9VA 3P7NA 2K4JA 1R1UA 2R7FA 2FBHA 4KB2A 4NHJA 5DD4A 2XCQA 1H9GA 2LDUA 3P9IA 1FYMA 3DEUA 4P5BA 4ETSA 3T8RA 2NVYA 1XXCA 4EJVA 3TO9A 2VODA 1KYWA 4HQEA 1RI7A 3RIRA 3GFLA 5DCMB 3ISPA 4G0UA 3F6VA 1BN5A 3CDHA 1G3SA 3AQOA 2KJCA 3QU6A 1U5TA 2PQ8A 4Q4ZF 3COAC 1IUYA 2ELHA 4OIRF 1QZZA 4OIPF 1W7PA 4PDKA 4YIIA 1FC3A 4CXFA 3R0AA 3KP6A 4DNCA 3J81K 2EV5A 4O6JA 1DPUA 1QZYA 3KP2A 2IA0A 1BC8C 5BQTA 5LHHA 4KN4X 4JK1X 4RB1A 1FLIA 3FM3A 3I71A 1SD4A 3WE2A 1WCMA 3LWFA 4UHTA 3FOFA 3IKVA 3I64A 1YW8A 1BOAA 5J8FA 1I6XA 2KJBA 5ED4A 1WWXA 4BHPA 5LGNA 4GO1A 5EGEA 3WTYC 1YLFA 3RTRA 1YIOA 3MZYA 4J3NA 1O29A 2K4BA 4M71A 1XGNA 4GTEA 4Y15A 4E70A 3IC7A 4G0WA 3I5UA 4G9YA 5EGHA 3PQJA 1LB2A 5D8KB 1VTNC 1J75A 4FM9A 5IOQA 1F5TA 1TBXA 1ZGAA 2XROA 3WU0A 1JHHA 1SD5A 4ENNA 2QQAA 1KU2A 1I5ZA 3BROA 5AIQA 3KZZA 2ZFWA 5K5OA 3GF2A 2XAJA 4EV0A 1XB4A 2H6CA 1J5YA 4WK8F 1MGTA 4N0BA 4RB2C 5ERIA 4KAWX 3I54A 6PAXA 2PJPA 1WQHA 2EFPA 3C3WA 3V8LA 3CUQB 1XCBA 5K5RA 2W85A 5ILUA 1QPMA 2ISYA 4ASNA 1JGSA 4G7OF 2ETHA 5BPIA 1MZBA 4N9IA 4FT8A 1E2XA 2FNPA 1R1VA 2HYGD 4LG0A 3GTPA 1O25A 3K1MA 2O8XA 4EVIA 5BS6A 5ICEA 3BUEA 3RDIA 1XXAA 2HS5A 4RB0A 4EJWA 3OOPA 1DUXC 4CDGA 1FY7A 3NQOA 3G4AA 4P96A 3DPLC 2QWWA 1QQIA 1ON2A 1UFMA 1YG2A 3N97A 3E6CC 5K5QA 2XVCA 3R61A 1D5VA 2E1CA 3L4JA 2KIUA 3NRVA 5BMZA 2FMLA 2DW4A 1IXCA 4UUVA 4WF2A 1TWFA 2RVCA 1WQFA 4BLBA 2ZFZA 1R5GA 2YR2A 4WXCA 3TOAA 1S6LA 3FHZA 1ZHFA 4I02A 2JA7A 1YQAA 5BOXA 3KP5A 2UXXA 3OEPA 2GWRA 2X0LA 4HDVA 3GTOA 2GSNA 4CGZA 4A12A 1O7FA 3R0JA 4MEXF 1STZA 4EM0B 5JVOA 1R58A 3MQ0A 3G4CA 1LVAA 3ROUA 2VBWA 1P92A 4A6DA 4I01A 4AIHA 1Z6TA 1ODDA 4Q47A 2BE5F 4UV9A 2UXNA 1CGPA 2DBBA 1IRFA 3ECHA 3PFIA 3L4KA 3P9KA 4FX4A 1ZN2A 2IRFG 1Z6RA 4KIBA 1AWCA 1EH6A 3FWEA 1KU7A 3ZP5A 1O57A 3QPHA 4G6DA 1J7KA 5CYVA 4LLNA 4ENKA 4LLGF 1P6RA 2J5PA 2O61A 1H0MA 2CW0F 2PN6A 1FSEA 2BV6A 2YX4A 2DU9A 2P6TA 3OREA 2FA5A 1RUOA 5CVVA 2CG4A 4HX4A 2OBPA 2E2HA 2W25A 2E2IA 4P9UA 3Q3QA 3F8NA 1USSA 1H9TA 3SXYA 5L3DA 4HA8A 1YS6A 2MC3A 2LF8A 2HR3A 3Q5FA 1HXDA 2H6BA 3JAMZ 1O28A 2D1HA 1D8KA 1ULYA 2JPCA 3OV8A 2D45A 1BJAA 1JHFA 3ZQ7A 4KASA 2ZNZA 4RGSA 2VC1A 4M1XA 2HEOA 1ZBSA 1HW5A 3LA7A 3GTGA 1XN7A 3GTJA 4B09A 5LEJA 3E5XA 3F3XA 2XV4S 3WTWC 5DV5A 5HVQC 1P2FA 2CFAA 1GE9A 4GT9A 3E97A 4A0XA 1Y1VA 1OKRA 2V9VA 3J7AO 4G7ZF 4I0AA 4BXUA 1J2XA 1K78A 1OR7A 4GTDA 5J6XA 3WE3A 2E7XA 2ZMEA 2M8EA 2FSWA 2O03A 5HS8A 5F6FA 4FZBA 3WTTC 1C0WA 2R93A 2CYYA 3HSFA 4YFXF 2GXGA 4IVNA 2H09A 3E6DA 4GGGA 4OOIA 3MWMA 2C6YA 1FBUA 1WSUA 5E1ZB 4HBLA 4IXAA 4N9HA 1R23A 5A2QK 2RH6A 4BLAA 4BHCA 2OA4A 4HF1A 3O3KA 1KQ9A 3KZYA 2FRHA 1T2KA 4O3MA 5JVTA