3M8WA

Phosphopentomutase from bacillus cereus
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
Knots found
sequence length
391
structure length
390
Chain Sequence
b'NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Bacillus cereus Phosphopentomutase Is an Alkaline Phosphatase Family Member That Exhibits an Altered Entry Point into the Catalytic Cycle.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 140
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3m8wA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3m8wA01
1AJBA 4LR7A 1KH9A 3DPCA 1ANIA 3KD8A 1ALKA 2GSOA 1EQJA 5GOVA 5LRMA 3BDHA 2W5QA 4LRDA 1K7HA 3TG0A 5DLWA 3UN2A 1N2LA 5L0KA 4CYSA 1ALJA 3MK1A 1ELYA 3A52A 5AJ9A 4KAVA 1EJJA 1HJKA 3T00A 5LQQA 1ED9A 2W8SA 4NWJA 2XR9A 1KH5A 3WBHA 4ZG9A 4YR1A 1EI6A 4LRAA 2W5RA 4UPLA 1SHQA 4CYRA 3OT9A 1O99A 1ED8A 3BDGA 4LQYA 4NWXA 3MK0A 5IJSA 1ALIA 2G9YA 2GA3A 3DYCA 3M8ZA 3UN5A 5L0EA 5HRTA 3TX0A 3NKRA 3WAXA 4LREA 3NVLA 1E2SP 2ANHA 4KM4A 3M8WA 3SZYA 4LRCA 4UORA 4KJDA 5LRNA 1ELXA 4UPKA 4N7TA 4ZGAA 5IJQA 3WAVA 1AJDA 2GSUA 1E3CP 3UN3A 4MHXA 3T01A 4CXSA 1URBA 2D1GA 1E33P 2W5WA 4GTYA 2X98A 4LR9A 5K4PA 2W5TA 1ZEDA 2W5VA 2W8DA 4UOPA 2IUCB 5EGHA 1ALHA 3NKPA 4QAXA 5DLTA 1SHNA 2XRGA 1URAA 4TN0A 4KJGA 1AJAA 1AJCA 3Q3QA 1B8JA 3TWZA 3CMRA 4ZG6A 3IGZB 3B5QA 4LR2A 4FDJA 1KHNA 1KHKA 1KHLA 4KAYA 4UPIA 4MIVA 4GTWA 3IGYB 1FSUA 3E2DA 1Y7AA 1HDHA 4GTXA 4ZG7A 5DLVA 3NKMA 4LRFA 1N2KA 1Y6VA 4LR8A 3SZZA 5EGEA 3UO0A 1ZEFA 1KH7A 2GLQA 1O98A 2W5XA 3M7VA 4GTZA 1AUKA 5C66A 3ED4A 2W5SA 1ZEBA 4B56A 1EW2A 2QZUA 5GRRA 3NKOA 3NKQA 4CXKA 3T02A 3IDDA 2IFYA 2RH6A 4MY4A 3WAWA 4CXUA 1KHJA 4UOOA 5LIAA 3BDGB 2VQRA 1KH4A 5KXAA 3UNYA 5TJ3A 2ZKTA 4FDIA 1EW9A 3WAYA 2IUCA 3LXQA 3BDFA 1P49A 3NKNA 2GSNA 5L0BA 1ANJA 4UPHA 3MK2A 1ELZA 1HQAA 5INHA 1EW8A 3M8YA 4LRBA 1E1ZP
chains in the Genus database with same CATH superfamily
1HQUA 4USMA 2YQ0A 3M8RA 5KFXA 1HARA 4DUZF 5L0KA 4XPCA 3OTDA 2BRLA 5KTQA 5EUHA 3KG1A 4DL3A 2AX0A 2LKZA 3LGHA 2HBZB 1AROP 4MKAA 1EARA 1WSRA 3E2EA 4EBDA 1F1BB 3MFIA 3TZYA 1ZZNA 2AEMA 2G2YA 2DNHA 2D3ZA 4RUHA 5F8JA 5B09A 3HSGA 1NDPA 1GMWD 2V2ZA 1KFSA 4BWMA 3SQOP 5CZVA 1RI7A 5HROB 4KYZA 4QR1A 4GTXA 5DLVA 3MURP 3O8WA 4LRFA 4UZCA 1TFYA 1VC0A 3M2RB 5AXKA 1TL5A 2GVZA 1ZEBA 2RS8A 4J90A 2MY8A 2V0NA 3CJKA 5HMXA 3ZZ0A 5LJ5Y 2KXFA 3IDDA 4JUZA 4I2QA 5E41A 2W25A 3HF5A 2C3OA 4DQIA 3HCXA 2PMWA 1H73A 1RJJA 2ROGA 5GMDA 4ZPAA 2OUGA 4X2BA 1IN0A 2MSSA 2E7WA 4E0DA 4M5HA 2LDYA 3KTQA 3JQKA 2HAIA 3NS7B 2AKWB 3P96A 4DS4A 3QT6A 2YWWA 4HR2A 3BREA 2DRDA 4S0MA 2LQBA 3HT3A 3MMBB 1EJ7L 4Y34A 2VUGA 3N6MA 2QMWA 1LNQA 1PC4A 3UD3P 1P1LA 3CVKA 5C7PA 2AEFA 1HIYA 2YNFA 3D6HB 3BYPA 3MEDB 2IAJB 2B4OA 4OZ1A 2CVEA 5DLFA 2YKNB 1TMMA 2HFZA 1VBKA 4QPXA 3U7JA 5FD1A 3IS9B 4C97A 5ETOA 4JI3F 2YNIA 2K2PA 5T41A 2ABYA 3PO5A 1X7VA 5IXUA 5J2QA 2YQ1A 4NLXA 3DYAA 2DGQA 1UA1A 2P8IA 3GFHA 2WW8A 2J8SA 3H2UB 1NSQA 5THWA 3B54A 2BQRA 1EKRA 3BS9A 2A6OA 1DARA 3SI8A 3W65A 4DPWA 5BJRA 4YQWA 1IUJA 2D3O1 4IR9A 4KSEB 5A76A 1HNXJ 3FBCA 3R5CA 3MEKA 3QNWB 1EETA 3JQJA 2PO4A 1X9WA 2OTJS 4CYRA 3TAMA 4LF7J 2G9YA 1E6YB 5HRTA 3KLGA 5AJ3F 2JNJA 2AF6A 3RBDA 5EX0A 2PT0A 5L1KA 1PBUA 2LMIA 2CJKA 2A1BA 2UZAA 4PEOA 2COLA 2UVWA 3LGMA 4DV5F 2E5GA 3KG0A 1HW8A 3ILLA 1HYSA 2XRGA 1MLAA 6FDRA 4CLPA 3Q8SB 4FBUA 4LUBA 3T9ZA 4B08A 3M1VA 3MECA 2VJVA 5C5JA 4X4OA 1W26A 4MK9A 1UFWA 1WG4A 1NDCA 3JTOA 4YMEA 3TQ1A 2H5EA 4MY4A 4HT7A 3RUBL 5LJ3Y 3W5XA 4X84A 2CQHA 4C11B 2LA4A 3QATA 3KK3B 3MXHP 3DLJA 1VRTB 1RTHB 5L38A 3GWCA 4B9MA 2BKPA 3OL6A 4IRDA 4DR3J 1TL1A 3EWGA 3ZC4A 2VBWA 5F9LA 2WTFA 4ED4A 1OO0B 3QRPA 3DGPA 1RBLA 2B51A 3UDLA 4ZJLA 3OJUA 3VZIA 2EFOA 1TK5A 4J9VA 3UPFA 5EHHA 3QLHB 1SV5B 1QVFR 3M05A 1M5HA 2FHJA 3NG8A 2V2VA 2VG7A 2ZVIA 4ZDNA 1RKJA 4DU7A 2PEHA 2H54B 2XY5A 3HHKA 2M8HA 1FVSA 2ZHAA 5DS7A 2C2DA 2XLJA 2XMTA 4GO5X 3L9ZA 2CZVC 4K59A 2QLBB 5TJ3A 3NAHA 4RW7A 1TL3A 1O0PA 3KLVA 1RUSA 2HHHF 4Q0BB 2MY7A 4HHUA 3N5FA 1URNA 4UF4A 3I5CA 3G4SS 4KO0B 4NMXA 2LXUA 4USIA 4HI1A 2VIHA 2MQNA 3FRZA 1IBKJ 5KG1A 3BH7B 1UPPA 4KR0B 3FEXB 2OIHA 5A8WB 1XNQJ 4JB8B 3Q23A 1QD1A 5IT0A 4MK7A 4ZGAA 2RRBA 1SBRA 2X1BA 2I5JB 3T41A 4PAAA 2C3YA 4F04B 4MHXA 5IM0B 2GJIA 4DFKA 1Q82T 4IOBA 2HRYA 1VC5A 1TVRB 1N6QB 2FVQA 1BD6A 2ZE2B 3PVXA 1Y7AA 4OJ3A 4JV5F 1SCJB 1T11A 2QSWA 4DR1J 5KFAA 3ZNJ1 2HFNA 4MH8A 1D9DA 1YLXA 1DURA 4DFJA 1PBAA 3T1HF 1SKUB 4F4ZA 2F8MA 1UVMA 3R2CJ 2E5LJ 3H5YA 4TU9A 2D7SA 4X62F 3DRPB 1QY7A 1AUSL 2XY6A 1NK8A 2JLEA 5IQ6A 2DH8A 2FZCB 2Z8QA 3M30A 2MPUA 3TEHB 2HIYA 1ITPA 4OLOA 3UQSA 3MM9B 3BO2A 3IBWA 1WD6A 3GLJA 3JTPA 3I56S 3IRXA 4J91A 2X51A 1NJWA 2ILZA 3DLKB 5D4LA 2P9CA 1WDTA 1RAFB 3DMJA 2IUCB 3HVWA 2CPEA 2DK2A 1KP6A 3SZ2A 2ZUAA 4ZVRB 3CEDA 3BN7A 2MHEA 4PWUA 3CULA 4OYIA 3EDRB 4LFCJ 1Y5IB 4NXMF 4J9OA 4YB7A 1RP5A 1RT1B 1RAEB 3MMAA 2MGZB 2EKNA 3W2VB 1L3SA 3VAKA 3D2WA 3BQ1A 4ZP8A 3NY0A 3WC0A 2OAUA 1WC1A 4NLYA 2JZ5A 4EZ9A 1ALJA 4KQZA 1XNRJ 1H3DA 1ED9A 2HPUA 1F6TA 2C1EB 4H4OA 4O0IA 4ZVEA 1J5EJ 1REGX 1SC6A 3IXQA 4DBQA 1S1XA 2MKIA 2VHGA 1N88A 2YXLA 5BYQA 1RHKB 2ALYB 3IO1A 1RU2A 2E5IA 3R5DA 2UUCJ 2FJDB 1VJWA 4NLOA 4CLSA 2J6SA 2BE2A 4B3MF 5HJYA 4UPIA 2MLZA 4KGXB 3Q8VA 4HYKA 1ZS6A 4YR3A 1M1HA 1IBMJ 5LSOA 1FKPA 5CYMA 4IKAA 1M1KT 4ZLNA 1VLOA 4DEZA 3MM5B 3TAQA 3AJDA 6FD1A 4C3LA 2V50A 2NS1B 1S79A 1SJQA 2HGNA 1CEZA 2HQIA 3HVAA 4YS2A 4YHHJ 4DV0J 2ACYA 5D0HA 5K8PA 1X4BA 1S6UA 1NMEB 3KLIB 2J9DA 3OV7A 3HHEA 3IN5A 4FVCA 3BQ2A 1PJ6A 4UPKA 3T5KA 2FGCA 3TVYA 1DY3A 5BYRA 4NEYA 1RWXB 1SH2A 4DF8A 3CC4S 4ENOA 3EZ5A 4I6WA 4DN0A 1Q95G 3OQ2A 2R2UA 2HS0A 2HHVA 1N34F 1X5PA 1M5VC 4RJVA 2RE1A 1FK9B 1Y5NB 1QJHA 5B7WA 2DR8A 3DM2A 2X7IA 1VQPS 1X8DA 1NSAA 4CXKA 2WVFA 2SXLA 2RMLA 2HURA 4FXDA 3CO0P 3HD2A 3UNYA 4TN2A 2BABA 1EW9A 4L72B 4DX5A 4CCHA 3ZZOA 2EFPA 4BDPA 2W7OA 1C0TA 3M2VA 4ZP9A 3AY0A 1JLBB 3NNAA 1UL3A 2DGXA 3CJ2A 2PD1A 1NJXA 2DJWA 2N3LA 2CPJA 2IA6A 4ZLPA 5L39A 1OQ6A 3UDCA 4BWJA 1R0CB 2FVCA 8RUCA 1BY9A 2IJRA 3OUYA 4LF6J 5HMWA 2XWYA 4K2XA 5DG7A 4DL2A 4H4KA 1FNMA 5DM6Q 2WRMA 2W5WA 4KV8A 5MAOA 2WOMA 4DPUA 3FEZA 3V6DB 3V81A 5HP1A 2IA0A 3MOZA 2NCKL 2V69A 3WHIA 2XCAA 1ZAVA 1O98A 1UWAA 1U48A 1UJ4A 3TVZA 1N4LA 2HNZB 4F4XA 2W2PP 3BDGB 4KPYA 4L3NA 1R8CA 4DR7J 5HQ8A 1IKVB 2CZ9A 1YJRA 1CJKB 1AJBA 4U8VA 1ALKA 2DXDA 1CC8A 2HHQA 4A8SA 4ZHRB 5CD4A 1IXKA 1KVJA 5DJBA 2VKRA 1ZTTA 4USUA 3OR2A 5K8NA 3SMZA 1V9OA 4ID5A 3OW2R 4QWEA 4LQYA 4ECUA 1VQ7S 1CLFA 3TX0A 1UEVA 3VZHA 2KYXA 4ER8A 2MKSA 1YZ7A 3Q8YA 1JXVA 1Y10A 3DI6B 3H4DA 3UD5A 2ZZMA 1Y0HA 3N28A 1K9MT 2WONA 1XK8A 1N54B 4YB6A 3L09A 2I6WA 3BDEA 1Y3JA 1MMLA 4FYXB 4XAKA 1TUGB 1U8WA 2ZDPA 4WFNQ 4ZVUB 4E8UA 3OXLA 5F41A 3JYTB 2V4JB 1Y6VA 2CG4A 4AUKA 2Z2MA 3D6MB 3MMCB 4NLRA 4GC7A 1Q5YA 4UY8T 5A8RB 2CXEA 1AFIA 2ATCB 4B9SA 3S7RA 1LW0B 4ZA1A 3TUJC 2VFTA 1QVGR 4U7UK 3DRRB 1J5OB 4PG5A 5HMYA 1HHTP 4A8FA 1RWOB 4ZPDA 3K2YA 2CPZA 4FBTA 1SUQA 1XEZA 1K1QA 5DG9A 2YX1A 2OSQA 2JVOA 3T3FA 5CYJA 3P6YC 2K06A 4OX9J 2IBKA 2VOPA 1B64A 3MD1A 4YR2A 1DLOB 1HMVA 4HI2A 2UUAF 4J9KA 1U0HA 1S6PA 2B9WA 5F8IA 1ZAWA 2L08A 4DL5A 3UWTA 5LXRA 1PYSB 1T9XA 5HSPA 4F26A 3TR5A 3OVAA 3NOCA 3NWGA 3PX4A 3OTEA 3CD6S 5M2PA 3H20A 1TTHB 3MHYA 3C6TA 2BJDA 3PCOB 1P49A 1KR4A 3RGIA 2YH0A 2H5IB 3R7BB 4JI4J 4M5KA 3QAEA 5EX3A 1JLCA 4NYOA 3OR1B 2ROEA 3M9MB 3ZNUA 4WP9A 1HQEA 5AJ9A 5F0UA 1C4CA 2W4CA 2B4VA 2YNHA 2YX7A 2Z4PA 2W9CA 4WCEQ 2CZ4A 5D0GA 1RWNB 1H7XA 3MWBA 2P6SA 1HWJA 2VKZG 1D8ZA 2BJ3A 1G3OA 5IWAJ 2R8GA 2Q3PA 2R7WA 1JLFB 1UZDA 3KHHA 3PJXA 1PAUB 3R6LB 3NS6A 3RBZA 5K8MA 2BJ9A 2H4WB 3W7BA 2DGUA 2OPSB 4QQBA 2GA7A 4DPXA 3NLCA 1P6TA 1MWZA 4H4KC 1JLGB 4X4VA 3EPIA 3TRGA 3M32B 5A2QY 3AJ1A 4UPHA 1S7IA 3PRDA 5HROA 1E1ZP 3LH2S 3SBMA 3MM7B 3KLFA 1B0PA 2JL9A 2F8EX 3MEEB 3UW1A 3M2RA 3UI3A 1SVDA 1HR0F 1YRTA 3U1MA 3PX0A 3C2PA 3F44A 3ILOA 2IM3A 2YKAA 4USWA 3THTA 3LP1B 4RNFA 1YKWA 2B7CB 5DLGA 4F0HA 5U47A 2OFHX 2CDQA 2VBXA 3PIOQ 4X65J 4WK1A 5DETA 1E6VB 3KK2B 3ETMA 3AOAA 1TQLA 2LQ5A 1FD2A 4O44B 1ZETA 4UY85 4YOEA 3DLEB 1BLUA 1U45A 3OVSA 3MMBA 2QEXS 1UVLA 3G96A 1U1QA 3HKWA 4F4KA 4USTA 1MG7A 3UO0A 2QL9B 3EGNA 4OMFG 3HFVA 2UUTA 1FRJA 2DHXA 2R8JA 1S4EA 2MQPA 2AJ1A 3MD3A 1X60A 2L41A 3MEDA 2HS4A 2IAJA 2MQOA 3PRVA 1H72C 1IKWB 2YKNA 5F8HA 2ATLA 1TUWA 2W01A 2ZH8A 3RBEA 2MMYA 4NPOA 3CPWR 3IS9A 4WZMA 4Y00A 3GP9A 1GX5A 2OEKA 3SXLA 3N79A 2HVHA 4R8UB 4M63A 4HH1A 1NU4A 2ZD1B 3M4XA 1KH5A 3NNHA 3CJ4A 2XGQA 2BUNA 2R4FA 3GYNA 1N36J 3QIPB 1SKSA 2BRKA 2POKA 2LCWA 2HHSA 1SQGA 3R1HA 4YB5A 4A48A 3BR9A 3KYLA 1N52B 2IJNA 2D1GA 2DPIA 5CYQB 2CNLB 2BANB 1RKIA 3NKPA 2R42A 4TN0A 4QJVA 2AWZA 1T8EA 1U6FA 1E6YA 1BQMB 2VC0A 4DL7A 3HD1A 2HQDA 4ED5A 4WXOA 4C48A 4A8WA 4K4VA 2HNDB 2GIRA 2IVYA 3BB5A 4BC9A 5AXMA 1JX4A 4OZNA 1Q86T 4MTPA 1H0HB 4DXLA 2EWHA 2YKQA 2CQGA 4WIIA 4A8QA 2DNKA 1KOHA 5AXLA 3ZXWA 2KZZA 1IVZA 2XR9A 3MR7A 1CG2A 1SC3B 2BQUA 2G2OA 1LWEB 5ETPA 1S48A 4XO0A 4C11A 1FXRA 3KK3A 3FCWA 2WBRA 3MZIA 4QWBA 4TQRA 2KH9A 3PW0A 1RA6A 3I82A 2NUUG 4Q2LA 1FESA 1HLWA 1ELOA 1YBUA 4LFAF 3NCPA 3QLHA 2OEJA 5HL7Q 1SV5A 1EW2A 1X4EA 3A4TA 2LQ9A 4MIWA 3KXDA 4OYZA 4NOHA 4DV2J 3KMSA 2QA4S 1ICEB 1FT8A 5IJQA 4DN9A 3KD8A 4CT8A 1T9VA 3I32A 3JSRA 2IYIA 3V6JA 3QFHA 4JI8F 3ISND 1TR0A 1M90T 4Z7YA 1S72S 1T03B 2WBMA 1YSJA 5K9FA 4K8RA 1ULRA 1B70B 3CDUA 1EKSA 4YP3A 3GYGA 3M8ZA 4FNIA 1VCTA 2CJQA 4J37A 1FDNA 1WKJA 3QQCD 5KFZA 1R7IA 1RSCA 1B0VA 4Q0BA 1B7FA 3O44A 4PXDA 4ED1A 4OLPA 4KO0A 4NLPA 4GO7X 4TY9A 3K8VA 1FXDA 4LJMA 1UVKA 3KFWX 3Q8UA 1GH8A 2MZTA 2DD8S 3ITHB 3ENVA 2DGWA 3BH6B 5A8WA 2MLXA 2XSJA 5LT5A 3OTCA 1PO6A 1XMQJ 2L3MA 3PYEA 4ZK7M 4RWXA 3PG9A 1AZSB 2I5JA 3TEGA 2C22A 1RT4B 3AFGA 2GJFA 1RADB 3LXQA 1VQ4S 3D68A 5L0BA 4B3OB 2EPIA 3CDWA 1TVRA 1N6QA 2BE7D 2HHWA 2HK3A 3LPYA 2ZE2A 2DNQA 2ZBPA 2CNNB 2UXCF 2C2MB 2DO4A 1X5SA 1HD0A 1XN9A 1MN7A 4LBHA 3KG4A 3OTOJ 1S9FA 4FNHA 1NK0A 5F9NA 1N48A 3CJSA 1GXLA 3HMJG 4D3GA 2GMHA 3DRPA 3QZ7A 3PTWA 2YWEA 1N5VA 2BM1A 4OHZA 1P27B 4CQ1A 1Y11A 2HWIA 1T3NA 1YQHA 3H7HB 4ZN1A 1NKBA 3TARA 2VPYB 3TWZA 4UQGA 1SI9A 1O6XA 3UE2A 3MM9A 4ZVPB 1Q7LB 1FSUA 2GS8A 4LR8A 1VDHA 2R7OA 5KG6A 3RRKA 2Y3YA 2V5HG 3DLKA 4RW4B 3BSNA 2XY7A 2DNRA 4JYAF 2R8HA 1HBOB 4KC5A 2APOA 2IUCA 5MLCV 3J7A1 1KN6A 1WEYA 2F3JA 1SQFA 9RUBA 2AYEA 3L7OA 2ZBRA 1OS5A 2FJVA 1WEZA 1HJKA 1FI4A 2W8SA 4RWWA 5KFGA 4WP3A 1RT1A 2ZH9A 1S7HA 5IV3A 1CULB 1R6VA 5IT4A 5JJBA 2MGZA 2GA3A 4JI7F 3W2VA 3WAXA 2OMLA 4DUZJ 2NXCA 3LO3A 4EYHB 4UQTA 2XMAA 3IG1B 4F3MA 3CC2S 3U27A 4DX8H 2JRSA 4M5DB 1JJHA 2KDOA 4OX8A 3FSIA 4J9MA 2IRXA 4FDJA 3BF4A 4ETXA 4ECSA 3BGRB 1MNEA 4HHHA 2VBZA 1MW7A 1YJ7A 3GU0A 5FLXY 3Q24A 4O3OA 1U0SA 2VU5A 4I69A 2RKIB 4F25A 2K1RB 2WVEA 1EAYC 3HM9A 1S0VA 3UVJB 1FFWB 4CT9A 4ELVA 2WVDA 1RBAA 2K7KA 4TYBA 2AJ0A 3PRBA 3TZXA 3DC2A 2GAHC 3A52A 3FMBA 3SCJE 4ILMA 2CQIA 3HHDA 4ED7A 1CJVB 2D3UA 4HH0A 1R27B 2IJFA 3MM5A 1S57A 3BKUA 4JBCA 3HX9A 2R7TA 2IDEA 1HL6A 1HWKA 3CGIA 2EC2A 1KQKA 3ZTPA 1FO1A 4X4NA 5ETMA 1OWXA 1U1OA 1ZA2B 2UU9F 3KLIA 1KNZA 4QIFA 4CLZA 2KN4A 3KJQB 2IC3B 2AYBA 3PR4A 1WDDA 4DFPA 4NA2A 4WZQA 4CLFA 2CFXA 2MKYA 4Y2KA 4JI0F 3DDNA 5E33A 4DR2F 4ZPWR 3T5HA 4CLLA 2VOOA 3RG6A 2KFZA 2GAGC 2QLWA 2QN6B 3X3UA 5GOVA 3CCMS 3EZUA 2X1AA 5KG4A 2G0IA 1FK9A 2XS7A 3GIKA 5LQQA 1FDDA 1Q8KA 1YI2S 1U2CA 4DX6A 4NLTA 5KT4A 3R1LA 2J0QD 1U1RA 1XMOJ 5KG0A 4X4SA 2ZZNA 4RO0A 3MPDA 5F0WA 4QOTA 1JLBA 1YRXA 2W24A 5J2MB 3CCLS 3J81U 5AJ3J 5EGHA 3I87A 1NLKL 5CCMA 1UAWA 3CC7S 3H25A 2Y8YA 4DI6A 4RNMA 1VQ5S 2HFUA 2MDAA 5GADI 2A2CA 3MDFA 5B0BA 2GGPB 3NKOA 3KDNA 3D1OA 4DV5J 2OSRA 1FX2A 2ZM6F 4FP9A 2AX1A 3PYGA 1ANJA 1RCXB 3M8YA 3V6DA 3H8YA 3QZ8A 4R0JA 4CIOA 1QTMA 4QU6A 5T7LB 4W92B 3DXBA 1Y3KA 2O67A 5B0GA 1TK8A 8ATCB 3PIPQ 1F5AA 5KT2A 2RAQA 3PNIA 1GMUA 3F56A 2HNZA 1WSVA 3RBXA 3BDGA 2N3OA 4U6PA 4K4ZA 1IJEB 4K4SA 1IKVA 1JKHB 1TK0A 4UORA 1CJKA 1H2VZ 1R0AB 5L9NA 2E66A 1HNWF 4ZHRA 3D54A 1EZZB 4WK3A 2MZSA 5DQIA 1BQNB 4ECRA 1VQ8S 4BC7A 3NCRA 2FYXA 1MROB 4ZG6A 4ECQA 4I64A 3GJTB 2AYMA 3SEOA 5K20B 3EXCX 5ETQA 1BMQB 2X1GA 5J1EB 4KB7A 4OYWA 3DI6A 3PM9A 4PXEA 1WNEA 5ETRA 5GRRA 1UA0A 1S1VB 5HANA 4DQRA 1LWXA 3GSIA 4F36A 1U09A 2YPYA 3GSDA 5KXAA 4OL8A 2ZJPQ 3J80Y 4NCGB 2KI2A 3V5RA 4CH1A 3JB9k 3I31A 4C8MA 1GMVA 1UEKA 4PWDB 2JLGA 3EUNA 3JYTA 2V4JA 1N2LA 1HWLA 3MMCA 4ZVOB 1RWKB 4Z2XA 2E29A 4R5PB 3HHNB 5A8RA 4JV0A 4CM0A 3BJYA 3QT5A 4NEZA 4ZPVR 2ZH7A 1Z2LA 1LW0A 2JDJA 2HHHJ 5I4MA 3AB4B 3MM6A 2HFOA 1ZA1B 3HHLB 1UETA 1VIOA 1GFWB 4RPFA 1AB8A 5D4NA 1J5OA 1T94A 3J81j 3Q86A 3HVRA 2UP1A 1SJRA 2PMHA 3M9OB 3GIRA 5DDQC 5KT5A 1LK5A 3GJSB 3KJNB 3EYZA 3H90A 3EE3A 2C28A 2DISA 4IRCA 3IC1A 3ZZZA 4ICLB 2MKHA 1FTCA 4JI6J 3C16B 1Y9OA 4FXVA 1DTQB 1TKZB 3LA0A 1DLOA 5CA5A 3SCIE 1T9UA 3QRQA 4L73A 4USKA 2R7VA 3UR0A 4OHYA 2F4VF 3IMQJ 4OYAA 3GIMA 4JV5J 2BJ8A 1D3WA 2OTLS 1HQAA 3TZWA 1WORA 5ADZA 1TU0B 3VAJA 2IHR1 4GMKA 4GRSA 5A6PA 3T1HJ 5B0AA 4K4WA 1HNXF 1SL0A 1K0TA 3QWUA 1X4CA 1H7WA 1LW2B 3CT9A 3E51A 5IJSA 4LF7F 3LGNA 4B3SJ 4X62J 2XSFA 3JS9A 4PG4A 3J7YU 2FY8A 1SC4B 2NSCA 2KT3A 1KEKA 3OR1A 3PKYA 1YGYA 5E3CA 4QZVB 3HSDA 1RTDB 4P2SA 3AQPA 4MAKA 4OI1A 3RJMB 3CD5A 4P73A 1RWWB 4N77A 1NSKL 3G71S 2DNPA 1UPMB 2J5AA 3E3XA 4ANDA 3NKMA 3JSMB 1SJ4P 4I7FB 2GQ2A 2QSFA 4UOHA 3W5YA 2LLZA 3SV3A 1AUKA 4RU2A 4IUFA 3BR8A 1NAQA 2KL8A 1D8YA 1JLFA 3I0SB 2C2ZB 3EZOA 3A3NB 3TI0A 2V8PA 2R2TA 1WC0A 3H5UA 2OPSA 1C1CB 2C3MA 2D9OA 2ASYA 4DR4F 4C8ZA 2CNOB 1F3FA 4OYXA 4U96A 1FWKA 4B9NA 1JLGA 2HBRB 2JX2A 3M32A 3V4IB 2Q66A 3RR8A 1VQ9S 3MM7A 2NXNA 5H1SV 1WKLA 3MEEA 1Z1ZA 2PSZA 4LF8F 1RHRB 1BWEA 5ETKA 1KLNA 2MQ8A 3L7PA 1ZEDA 4UOPA 4ZOSA 4DUYF 4IFVB 4J9NA 3CJRA 3G2XA 3T9NA 4IQMA 1KONA 3RW7A 2MLYA 1AT1B 1RWUA 1L3TA 3GV8B 3J7ZT 5SUHA 1E6VA 3KK2A 1RACB 3M8QB 3GQCA 4K4XA 4B3MJ 4NXNF 4DSFA 4O44A 3DLEA 3BDFA 4I0WA 4OJGA 4DWIA 5KG5A 2BW7A 2ZOGA 3PDNA 3TNVA 1K7HA 2V68A 3GONA 1ELYA 1LWFB 2E7XA 3D7SB 4R25A 3M6VA 2E9RX 3TA1A 2UVUA 1K8AT 1ED8A 4ZVSB 4V19J 4OZ0A 2M5YA 2KFNA 1IKWA 1IBCB 1VMBA 1FD8A 4DSLA 4CDIA 1X4DA 3UR3C 4JI2J 3DRYA 3VAFA 2YY3A 1UFKA 4BHQA 2E1MC 4F4YA 1WG5A 4OHXA 2RILA 4I68A 2FQQB 1VR6A 2BJ1A 4R8UA 1B0TA 4LR9A 4URQU 2ZD1A 3ENQA 5LSLA 4Y3CA 2FVRA 3H5XA 3IBCB 3IBFB 3WX8A 2BA9A 2W2OP 3VVTA 3QIPA 2OHDA 3ENAA 3T19A 3SZZA 4CLWA 2NZCA 4DV7J 2DEIA 4DR1F 2ZH2A 4MFBB 4KGZB 3PFOA 3PKMA 4IH7A 5LIAA 5CYQA 2BANA 1W2IA 1TL7B 1IR2A 3IGVA 5CABA 4LFBF 1BQMA 1T95A 3H42A 2OELA 2R7QA 2HNDA 3DOLB 3VGVA 5HI7A 4NRTA 1Q4RA 3Q83A 4ED8A 2EEYA 3Q22A 2RQCA 1LK7A 4WJBA 2C2EA 3PEHA 3B78A 3MEGB 5ITHA 3UN3A 2QGFB 2NPIA 1TV6B 3QBCA 5LMUF 2DXFA 3MAQA 2W8DA 1ALHA 4IG3A 2HMIB 2C3PA 2YVSA 4BBYA 4P74A 3VGUA 4O23A 2HLUA 1LWEA 4C4WA 3M8SA 3P45B 2YWGA 1U7LA 1U1MA 4Y2CA 5H9FJ 3DU6A 5HLFB 3ED4A 5IS2A 1VHIA 5GMKa 3CDEA 1RHMB 1RAJA 3CF5Q 4P9SA 4TU7A 4OI3A 1Z2ZA 4FYWB 4RW6B 2VG6B 1QM9A 3TO8A 2KVQE 2GSOA 3W66A 1SL1A 1D9AA 3OHBA 3HZEA 2NLWA 5D0EA 5D78A 1VQLS 1XNRF 4Q8FA 2V2QA 2LP4A 5A2QU 2W5RA 3GG0A 5D4PA 1XERA 5KFUA 5F3TA 1S97A 1HW9A 2QA1A 2MXYA 4HLBA 2V6AA 4N7TA 3RZAA 4HHJA 4LBIA 3H5SA 3NBPB 3E01B 4OQJA 3PYFA 1RHUB 1I5OB 2ZJQQ 3W8GA 1T03A 3J7Z5 2DGVA 1S6QB 2EBEA 2WSFC 2W5VA 1CS4B 4KHMA 4ZCLA 1CJUB 5KFCA 2RHQB 2UUCF 4WFBQ 3AA9A 2MQMA 1K44A 1RTJB 1BQXA 4YDDB 1YITS 3E2DA 4DZDA 3P4UB 3M7VA 2CG8A 2W9AA 4JV1A 4JP8A 2P6TA 4Q7AA 2Z2ZA 4QWCA 3SSRA 2MQLA 4C8LA 1RU1A 1BHNA 1S12A 3BM7A 1NDKA 4QBUA 1DZ5A 1CPZA 3ITHA 2QMXA 1ANIA 4ZN3A 2ZH3A 4EBCA 3AA8A 2QLJB 3KKFA 5I42B 2Y9HA 1OJ4A 1AZSA 4FYDA 1I94J 2CQPA 4MJKA 1RT4A 3MUVP 2V8HA 2W2QP 5L0EA 3B82A 4B3OA 4WKYA 4M95A 4LT6A 3M8WA 2MKCA 4O3RA 1DRZA 3R8YA 3FBEA 3FBFA 1DAXA 3LP0B 2RDJA 2XYHB 4NZ0A 2XM3A 4M5IA 1S9EB 1XBWA 3BGOP 1FRMA 1FEEA 1D1UA 2WSCC 5CQGA 1JNRB 4YY3J 2J6TA 2Y0SD 2DR5A 4CO1A 1X4AA 1NZAA 3FMWA 4NCBA 3X1LB 2NREA 2UUAJ 4CO5A 4DF4A 3FNNA 4UOOA 5HQMA 2VPWB 4PXBA 3MGJA 4ZLJA 4ECTA 2G1HA 5INHA 3KJFB 1SL2A 1JLAB 2HKEA 4NYZA 1REVB 4O0NA 4AE5A 2Y1LB 4DR5J 3V4MA 4L3KA 2ZOFA 4L74A 4KAVA 4ALZA 5L1JA 2Y8WA 4RW4A 3U1LA 3H59A 1X9SA 2CIMA 5AT1B 2B9EA 1HBOA 2RUGA 4CZCA 3QT7A 3VVUA 1KRPA 3W60A 1F5BA 3GPAA 3WAVA 2HNYA 2DKOB 2OGUA 5ETSA 2UXBF 4PUOB 1TP7A 3AAWB 5GAGI 1VHFA 1CULA 3CB4A 5M2RA 3SQGB 3TYTA 2HGMA 4CP5A 2GFFA 4IOAQ 2JVRA 4GTZA 4WF9Q 1C2PA 2ZH5A 4IFYB 3IG1A 1SKRA 3PZPA 2HSEB 1FVQA 2MZJA 4M5DA 3CXCR 3A12A 2N7CA 3ZZRA 1KHWA 3ELHA 1RABB 2VC1A 4DPTA 2JFDA 3BGRA 4QW9A 4OYMA 3KUGA 1X0FA 1G7CB 2EFQA 3ZTSA 2F65A 2RKIA 2N82B 1WEXA 2K1RA 1XTZA 1TELA 1FE4A 2FHJD 5C42B 3UVJA 3KUHA 2H65B 4CO0A 1HR0J 4DPOA 3PV8A 2CQ0A 1ZYQA 4CH7A 3CCES 2X98A 4DSJA 2MYFA 1CJVA 1JJ2R 2VBYA 3MR2A 3K5PA 1PGZA 1ZAXA 1GXTA 1PSDA 4FPIA 5HO4A 3OFGA 2GV1A 1N0VC 2KXNB 2AQ4A 1RAGB 2B5JB 5G4DA 2OD4A 3FZBA 5D8HB 2IYGA 1FJ7A 3AOBA 4GVLA 3OL9A 4A8OA 3JXOA 5ETNA 1WTBA 1VLYA 2XZTB 4K7QA 2FJAB 1NNDA 2DNZA 3EJMA 2HVDA 2RT3A 7FD1A 5HAOA 3IR6B 1TFWA 3K89A 3PJWA 1SIZA 2WB4A 2IC3A 3FKBA 1SXLA 3DDIA 4ZKAA 2FC8A 1M5KC 4ZG9A 2J8AA 4QYZK 4LRAA 1SHQA 3SDEB 3M2UB 2P2CB 4U8YA 5A0YB 4OX9F 2YKPA 2YWKA 4NLQA 3RYLA 1NK6A 3B6BA 4K4YA 2KT2A 2ZKUA 2IY5B 1DJ0A 5C2CA 2DNNA 3NXZA 4QU7A 2BVZA 2RQ4A 2E5HA 2M4MA 2Z58B 5AE3A 1XMBA 3HVTA 4ZMMA 1IJFB 2CPXA 1GT8A 3S1TA 4KRWA 3QYYA 2ZC4A 5J2MA 3ONQA 1XR5A 1XQIA 3U1NA 4ILLA 2EFVA 4NCAA 2P5VA 1FDBA 4A8YA 1KH9A 3BKTA 3CCZA 1CQNA 1S9GB 2V34A 4FXWA 3DU5A 2GMLA 4I4BA 5KG2A 3TJ8A 2E9ZA 2BDPA 4MIBA 4NMLA 1Y7PA 2GGPA 3QSIA 4YR1A 1EI6A 2QE5A 2F5GA 2VODA 3DN9A 3W8PA 1U49A 4Y2MA 2MQQA 1KS2A 5T7LA 5IWAF 4DZ6A 3LWLA 3N6LA 1E3CP 4RZRA 3VTIA 1RT7B 1Q8BA 5J1NA 1Q5VA 1LV5A 3I9V9 1JMTA 2PA8D 1JKHA 2W1BA 1TAQA 3FUYA 5EWGA 1R0AA 2CAJA 4PZVA 1S0MA 1IR1A 5J2PB 3DLGB 3HHLD 4HEA9 2IMWP 1U2RA 3MAAB 4QIVA 1FTRA 1BQNA 3N5BA 1OIAA 1QTNB 2HYIB 2E1PA 2LXIA 3LANA 1MROA 1T9WA 1F0XA 1YVFA 5CCLA 4PYDA 2DNMA 2GQCA 2Z2LA 5FLXU 3CCVS 1UEUA 4KAIA 1P9QC 5J1EA 3IR5B 1VQNS 4DCPB 3TQEA 2XNQA 1O8BA 4CWBA 3IWXA 5KG3A 2GC8A 1R8BA 1S1VA 2XLIA 2CQ3A 2QO3A 4I56A 5CXTA 4RNOA 1S1XB 1JNZB 4NCGA 4PXCA 1T05B 1U1KA 4J9LA 5LRNA 4JI8J 1OY6A 4HDGA 2ILYA 4PWDA 4X65F 1NJIT 2DYAA 3T01A 4IO1A 3Q8PB 4LIWA 1IQTA 2CPDA 3I4PA 5DM7Q 4G3IA 4R5PA 2K8GA 2O5DA 2KZMA 1T02A 2MHNA 2DXEA 2LA6A 2V4RA 8AT1B 1HKAA 2B8QA 1HDHA 3HHLA 1AXQA 3CD0A 2V9WA 1NO8A 5GMEA 2GHWA 4QWDA 3POTB 3P3DA 4J9RA 2HAFA 4MK8A 2XQCA 5GVQA 3R5GA 1JK9B 1F2GA 2VB6A 1LQ9A 2OO4A 1IBLJ 1IQZA 3EVWA 3L4BC 5C25B 3IR7B 2GIQA 2B6AB 2V8VA 4ICLA 2EW9A 1FRXA 4NWBA 3C16A 3ISZA 3UN2A 1PIEA 3NMRA 1DTQA 1TKZA 3SSSA 3GIIA 1WOPA 2PEBA 3UN5A 1VIXA 2ZH1A 4LREA 3R5BA 2UXCJ 1HBUB 2XMWA 2RH3A 2KJVA 1WTFA 2DHAA 2XMKA 4A46A 2LEAA 4AXIA 4CM2A 2NYIA 3VV2B 2PN6A 1LW2A 3Q3QA 3RAMA 1HFEL 5KFYA 1CC7A 5C24B 3CWJA 2D69A 1XC9A 1IKYB 3DGVA 4C98A 5LSRA 1H2TZ 1N2KA 4KFBB 2DTJA 2I1RA 4J7CA 3HP6A 1IR0A 1RTDA 2RH6A 3TW0A 4J5OA 4CXUA 2DY1A 2G0CA 4KGVB 1UW4A 2OMOA 5JXSA 3NGDA 4QWAA 3JTNA 2XG8A 1RA7A 3I6PA 3ZTRA 4C8YA 2AGOA 1S1TB 3JSMA 4I7FA 2XI2A 1T7PA 1N56A 4JYAJ 3AOCA 2DT9A 4DL0C 5B08A 2R8KA 3I0SA 1WC3A 2PIIA 1RHQB 4EGLA 2I0XA 2FTRA 2AJ4A 3K58A 2R3VA 4CLUA 4DQPA 1R8AA 3DOKB 2D3OR 3M6UA 3BDPA 5E3RA 1RWMB 3OBIA 2JLFA 3RB6A 1J2VA 1Q79A 2AZ1A 3FEYB 2XTJP 3FK4A 1MWYA 5KFWA 2E1AA 3V4IA 4LF4F 3A3PB 4ITSA 4TY8B 3QJLA 1HNZJ 4UW2A 4C3MA 1KH7A 4X64F 2GLQA 4PABA 4X4QA 3UCUP 1TKTB 4OZJA 2FZGB 3NNCA 4WPAA 4DV1J 4UOFA 5IT9Y 4B9VA 1ZTWA 4O4GB 5DG8A 2RRAA 5E3AA 2CQ4A 4FDIA 3ADAC 4DV2F 2YQ3A 4C0BA 1EW8A 1SJ1A 1UW9A 3BYRA 4LF1A 3I5AA 4C2MA 3JSYA 4CYSA 3FBBA 2CQBA 1EB0A 2NXEA 3GFYA 2IM2A 3M8QA 3J80U 2B0GA 3A8KA 4OIXA 4WE1A 2FIUA 2C2NA 3PW5A 2WHOA 1D9FA 1MN9A 4QR2A 4ZIVA 1KOOA 4ED6A 3KHGA 2R2RA 4ZPTR 3P5TL 1C0UB 1DQ9A 3CCQS 1MWQA 4M5NA 1QAIA 1LWFA 2L9NA 2CWKA 4CI0B 1LEOA 3I96A 4UUWA 4ZITA 1F2HA 2XEXA 3UD4P 4EBEA 2HZVA 2IBOA 4J9UE 2M88A 4O3QA 1S10A 3K17A 1XMQF 2IIHA 3TA2A 2MB0B 4DSKA 3DLHA 2CQCA 1OSCA 1UKUA 2H51B 3Q89A 1L3UA 3IAS9 2NZ4A 1O5JA 2RU9A 4W4MA 2FDNA 3QT8A 4C0OC 2OPPB 2AYGA 2PDAA 3AQOA 4F3QA 2CKWA 1NHVA 3W64A 3HHLC 4DJBA 2CVIA 3D1HA 2OPRB 2JSXA 5I3QA 1U02A 4JI0J 4MFBA 3OFEA 1FKOB 3JAMY 4DR6F 1LKZA 3T1AA 4DR2J 3HFKA 2GQQA 4B9UA 1KC8T 4B02A 2CJYB 1WUUA 1TL7A 4F4WA 3L95X 1R8PA 3ET6B 2AGQA 3FSXA 3LP2B 1PYOB 1F9EB 3SZYA 4CNZA 4ECXA 5H9EK 1T9YA 3OLAA 3BGLA 4C6AA 2C2RA 2ERRA 1CVJA 2R7UA 4NLGA 1VRQC 1MMDA 2HQGA 3DOLA 1L5UA 4H4MB 2YNGB 2A10A 2VD3A 1HWIA 3C15A 4MIVA 4ZJOA 3Q8QB 3KWMA 3MEGA 3A13A 1S59A 2KM8B 2A2DA 1IWGA 2XBPA 5K5MA 2IFYA 4OYBA 4P75A 1TV6A 3NEKA 2CWXA 1I6JA 2HMIA 4M1KA 3ZFVA 3K5MA 3QWPA 3RU0A 3ZZUA 2ZNYA 3WDOA 2AD9A 4IH5A 1JLQB 3R7NB 3KLEB 5HLFA 2DIVA 4F02A 4DU8A 1OMSA 1RLCL 4KH0B 5JMNA 1SQEA 2YTCA 4PRFA 3PHTA 2CNKB 3RW6A 3NS5A 2A3JA 1FA0A 4RW6A 5IZHA 2WVCA 4XK8C 2VG6A 4HKQA 4KJDA 4YR0A 2DRBA 4MKVA 1NK9A 2DIUA 2VFRA 3KNGA 4U95A 4C8KA 2NQPA 3QPIA 1U6ZA 2GO8A 3AD8C 4MIAA 4Y0FA 3HI9A 5HK4A 3FSYA 3TANA 3K5OA 2E5JA 1S1WA 1HNWJ 2XB2D 1RE1B 1M5OC 3EGWB 4UUXA 1FE0A 2VZ9A 2KVIA 4KTQA 4M94A 1URRA 4LSNB 2FVSA 3NBPA 3E01A 4WBFA 4AL5A 5KFBA 3K7RA 1LXNA 4RUBA 3DCAA 3BBBA 1S6QA 1BXNA 1CS4A 3KLFB 1AW0A 1CJUA 1CBKA 4DCJB 4B9LA 2LECA 5LMNF 2ZH4A 1RTJA 5F8MA 1PILA 4ANEA 4N41A 5KAKA 3V6HA 4WKRA 1YX2A 4RW8B 4LIRA 1Y4ZB 1K1SA 2IDLA 3WQPA 5JVHQ 2OLWA 2X3GA 4Y2IA 1V6HA 1RT5B 3C8YA 1L3VA 2E1CA 4WFXA 1T9TA 2ZEJA 4Y28C 2K7JA 3D6TB 3P49B 4NX9A 1S1UB 1U24A 3BBFA 1KQGB 2MKKA 4CO2A 1QLNA 1A9NB 1B99A 5I42A 1NH7A 4KT0C 3SCKE 2DHGA 2RQMA 5K4PA 1JLEB 5A8KB 1N32F 3O1LA 5ETLA 3OSPA 3ULHA 2KG1A 1YRUA 1G1XA 2WK4A 4F0MA 2UXDJ 4ZG7A 1GMWA 1QE1B 3F0NA 4CTAB 2AJQA 3JSBA 4ZP7A 2CPYA 4EO8A 5KOWA 3I9ZA 3LP0A 4IG0B 4RUCA 1X5OA 2WVBA 1W25A 2Q43A 3ZZPA 3I5BA 3RAQA 1Q0NA 2E9TA 3CE8A 1S9EA 1ELZA 2HWHA 3OLBA 2QRRA 3OL7A 4TVAB 1WC5A 3WBZA 1RB0A 4IDKB 2F4VJ 2DB1A 2H3EB 2DNYA 4NWJA 2DNOA 3RR7A 3GJRB 5L8RC 2HHXA 3PW7A 4KHPF 4DFMA 1RWPB 3LF0A 3VALA 4MKYA 1XMOF 3OSNA 1JLAA 1HI0P 1REVA 2Q79A 4K0KF 1B4SA 5ETTA 2GNKA 1V5VA 5HBMB 2RRNA 2FJBB 2DCLA 2Y1RI 4DX7A 1NB2A 2HRUA 3QSYB 4NA3A 2FPHX 3R9LA 3FVYA 3RB4A 1ZM9A 2EFGA 3W61A 2QYGA 2KT5A 2DITA 4OHVA 2HHUA 4D3HA 4OV1A 3M8PB 3DRSB 4PUOA 4KBIA 2RU3A 5L9XA 2DH7A 5G0RB 3SQGA 2CPFA 4K4UA 3TJ9A 1S77D 2HGLA 2B7BB 3T5JA 1FJGF 3QGPA 4QIGA 1F9HA 3G86A 2XLKA 2EVZA 2VQFF 3TJAA 4IFYA 4CNYA 3US5A 1WJ9A 4X66J 3W9HA 2QL5B 4AD6A 1JB0C 2VASA 4NZ6A 5HQLA 3T1YJ 1YZ6A 4JI5F 4NE9C 2H5JB 2YWHA 1ELXA 2R7XA 3VQTA 4DR4J 1RAOA 1ZPVA 3BPSP 3D3BJ 2EKYA 2VPZB 2QFIA 4EEYA 5D6GA 5B0FA 3I0RB 1HI8A 1JXEA 3VWSA 1NZ8A 1MMNA 2FHOB 1IWAA 2KKHA 4AL6A 4N76A 4DV4J 4LF9F 1D0EA 1S6OA 2E7VA 4FS2A 1DTTB 1CQMA 1ZPWX 4HTIA 4B3TF 2CJXB 2QC3A 1RQ0A 3IP0A 5C42A 2CUYA 4LF8J 1OPZA 2ZH6A 5AE2A 4O3NA 4G1PA 1PKUA 3GV7B 3ZTQA 3A1YG 1FNXH 1X4FA 2C2KB 4DUYJ 3BSOA 4H54A 3OTBA 2UUBJ 4RKUC 2AU0A 2QLXA 2HZCA 4NA1A 5CAAA 4HT5A 4PR6A 4QIWD 2YKMB 1X5TA 4DOZA 3KMQA 1NH8A 2B5JA 3KDOA 5KFJA 5GAHI 5DZ7A 4NXNJ 1RT3B 3CJ5A 1VRTA 1WACA 4OX7A 1RTHA 4W98A 4AYBD 3BSCA 2FJWA 4UPLA 3GCXP 3OT9A 1RT6B 4YB1P 4NZ7A 4TYAA 3MTJA 1RCOB 4GVBB 3BV8A 3D0HE 1A7GE 3D67A 4PG8A 4IO9Q 2JEJA 2I8EA 1RTIB 3MI7X 1N5SA 2LQ8A 3BN4A 2PC6A 4U9RA 4NI2B 4P2MA 4DCOB 1KQSR 4N8OA 1S99A 4I2PB 4WFYA 1QSLA 5DLTA 4QAXA 3DHWC 3HT0A 2YKOA 2XSJB 3SDEA 3CMES 3M2UA 4P7TA 4FF4A 1FWPA 3BPDA 1KHKA 2YBVA 4LF5J 2WAQD 5A0YA 4JI6F 1V3RA 5EN1A 3UCZP 2W5XA 4YN3B 3S8SA 2F40A 3AH6A 4ZIWA 3D5MA 3DHXA 4W90B 1N0UA 2KJWA 4XIUA 4ZCMA 1SC1B 3EPGA 4DV3F 4OYOA 4CH0S 3MK2A 4LRBA 4DHVA 4HTJA 5E3PA 4EK2A 1N33J 5F8LA 3MUMP 3SIPB 4GKJJ 1BE4A 3H40A 4OZ3A 4PQUB 1RYRA 1SKWA 1YHQS 1F9FA 2ASDA 2FJEB 4ILRA 4LFBJ 3DNCA 4N5SA 4G65A 3MK0A 1KTVA 3LALA 4KY3A 4B3SF 2R7SA 3PR5B 2ANHA 3D6FB 1VC6A 2VQEJ 2VA2A 4F50A 5J2NB 1S9GA 4PYAA 2J9EA 2GHPA 5GAEI 4WWSA 1AJDA 3QGIA 2RUSA 4QYZJ 2KRRA 3J81Y 2D74B 1Q81T 1HI1A 2D9PA 5IM0A 1R31A 3HSJA 3TZZA 2P9GA 1Y00A 3AXMA 2E44A 1KKHA 1QSYA 4ED2A 4P71A 3NP5A 2XCPA 3HFZB 4PPDA 2QZUA 2WCXA 5LMUJ 3L7UA 3DFEA 2A18A 2AZ3A 1RAIB 1I51B 2EK6A 5LL6d 4KHRA 5BR8F 1RT7A 3QGGA 3QMQA 2DNLA 3G8SA 5KFNA 3VHQA 3O6QA 4ECYA 1O51A 3LOUA 5E3QA 5FDLB 2VG5B 2FGOA 4WTYA 4ES1A 1WHYA 2G1DA 5J2PA 3D28A 3DLGA 3K8WA 4N8NA 2JOQA 1JJCB 3MAAA 1K47A 1DQ8A 3T6JA 4OYPA 3DYCA 2PI4A 3VR1A 4PQAA 2B9YA 3BZQA 2VICA 1Y5LB 4ZPBA 4ES3A 1I1GA 3KLHB 4QYRA 4CO4A 5KFMA 3CCJS 1PJ7A 1FF2A 1ZZFA 4RL1A 3DLLQ 3G8TA 5IOLA 2H9ZA 4C3KA 3EX7B 1NUEA 3ZTOA 4AQYF 4WYLA 4OZ2A 3HDSA 1T05A 2AJFE 4K50A 1QDUB 3HULA 2O01C 2XMJA 5C66A 2D41A 1JWWA 2Y1JA 3GZ7A 1HBNB 2OKQA 2GW8A 3D4JA 2EXUA 4JI1J 2D1CA 2MZRA 1NM2A 4G1IA 3UCGA 1VOMA 1ZM3A 1YBAA 2ASJA 4NLWA 1WHWA 2X1FA 1GQEA 3TX8A 3MK1A 1HPZB 3M6WA 4MYUA 2JEIA 2HK2A 3BBCA 4PWWA 2XGPA 1ZOTA 3POTA 3GFZA 3CTRA 2W4PA 5C2GA 2XO7A 3FRYA 1P9YA 3N01A 2Z56B 1N5YB 5F3ZA 1BGXT 5KT6A 5DQHA 4OZ5A 5DGBA 5C25A 3Q0AA 4ZJQA 4JI2F 2B6AA 4P10A 1R8HA 1VQYA 5CH7B 3CJ0A 4LVNP 3FQLA 4GKKF 4CO3A 1VGYA 5K14B 2A0FB 1H2UX 2XO6A 2OH2A 3VAMA 2Z0GA 2L48A 2OPQB 1U1NA 2C3UA 3AJ2A 2J0SD 1BWVA 1SH0A 1S76D 2J9DE 2XZWA 1HBUA 3FZ2A 1Q16B 4DV7F 2CQ1A 3DOMB 1HD1A 4BS2A 3CDBA 5DQGA 3MCOA 4QCLA 1SIWB 5IV4A 1VRUB 2ZKTA 4RBUA 2MJUA 1YWXA 1GTHA 4HVZA 5C24A 1IKYA 4FVMA 1YJUA 5I3UB 2AV5A 4KFBA 1RHJB 4PG6A 2ALZA 1QAXA 4TLQA 3NOGA 3GR1A 3VQSA 3CCUS 2L9DA 3HK2A 2W2NP 4L76A 3D66A 1WOOA 1GNKA 5LXYA 3OFHA 4NRUA 3NL0A 2DGSA 4V1Ak 1S1TA 2B3TB 4LQ3A 2VH7A 4WU3A 5BYSA 3CIZA 3W5ZA 3TVKA 1RTZA 4USHA 4MYTA 2NXJA 3N0VA 5IC4B 2J0WA 4DDFA 4JI3J 2N7YA 5EGEA 2UXBJ 4C9DA 2G0JA 3DOKA 3N9UC 2GMJA 1UZHA 5F8NA 2J9CA 4A47A 2PI5A 4A8KA 1C1BB 3FJ2A 1UVJA 2R9LA 1RT2B 4WFZA 4DV6F 1UVIA 4LF2A 2CDRB 2JC0A 4C0HA 1W7WA 4TY8A 3NGTA 2HW3A 4R0EA 3ZZYA 2BACA 3G82B 3ILIA 3F73A 2W9BB 3KNAA 1TKTA 3C66A 5KT7A 3BO3A 3QO9B 2IRUA 4O4GA 1O99A 4K4TA 3K5LA 2LVWA 2K3KA 2HFVA 2XC9A 2BM0A 4B3RF 2DGOA 4QIEA 4RW9B 2VFVA 3MF5A 4EO6A 3OL8A 3BGFA 1FERA 2M9KA 1X0PA 2ZOMA 2RDIA 3ENWA 4GTYA 4U7UD 2BV3A 2F4FA 5HVFA 1IKXB 4I67A 4K5RA 2XULA 1AJCA 3CMRA 4Y2AA 3O2IA 2YX4A 1KHNA 5FJ4A 1XWLA 5KFOA 3DRXA 4Q43A 1YJVA 2FD2A 4E98A 2HIQA 4RUAA 3U02A 1C0UA 1FDAA 3MPYA 4OX6A 5L1LA 1PJ5A 1M5SA 3TUZC 1Z4UA 2RNEA 4RX6A 2BMBA 1X4GA 5D15A 2KU7A 4G1QB 1V3SA 1P8GA 3BDHA 1YG0A 5KFHA 3TG0A 1RK8A 2EK1A 2BXJA 3WC2A 1VISA 4TLRA 4ECVA 3MM6B 1JJ4A 1I94F 5E5NA 1P1TA 1HBMB 1VI7A 2DO0A 3R27A 1J27A 2OPPA 5KFRA 5HN0A 2DVIA 1XR6A 1SJFA 2OPRA 3PXGa 1KTQA 1FKOA 1TZ0A 3R6GB 4F2RA 2GZOA 5KFVA 3K5NA 1VQOS 2BOAA 5D77A 3ET6A 4YY3F 3LP2A 2FLNA 2CJBA 1WHVA 3VGSA 5D3GB 1VK3A 4ZCIA 3W63A 2RD5C 4F3OA 3R2DJ 4RBVA 1QUPA 2W8LA 3KHLA 3KK1B 2AEJA 2GSNA 3MFHA 4Q44A 4H4MA 2YNGA 4KKOB 3D9BA 1NPPA 3A3OB 2F9DA 3H98A 3HO1A 3GV5B 5KT3A 4DR5F 4DG1B 3DRRA 1KQFB 3FFIB 1AA1B 2LU1A 3R7SB 1V3ZA 2XI3A 1C4AA 5GAHU 1GXUA 1HHSA 1E2SP 3KJVB 2MTLA 1VBXA 3QAUA 2FY1A 4ZCKA 1OY9A 4YDXA 2U1AA 2XMUA 3C14B 1JLQA 3TOQA 3KLEA 4A4JA 3SFGA 4QW8A 3OJSA 2FLPA 2FJXA 1NK4A 4USVA 2XHCA 2F63A 3NAIA 3IGYB 5H9EJ 3GG1A 1RLDA 2Q1LA 4PPZA 3H0PA 1U1PA 4TNOA 3NWRA 2BR0A 3O5TB 4Q2MA 3UDVA 1U47A 2J7KA 5DZ6A 2ZNZA 2VFSA 4X4RA 1K0VA 2R7RA 2GX8A 4QR0A 1WWHA 4ZPCA 2J7WA 2WSEC 1EQJA 1YJ9S 3AD7C 3CCWA 4ATNA 3QJPA 1KSPA 4ELUA 4DSIA 4LRDA 2NUHA 5DLWA 2KHCA 2UV8A 1EQ0A 4LSNA 5IT9U 3PEJA 2Z57B 1FJCA 3RB0A 1EP4B 4CLKA 2R8IA 2ZJRQ 2N4CA 1HNVB 2HFSA 1NKCA 2P9EA 2VL1A 3GFXA 4HACB 1FXLA 1QAYA 4XDDA 4OI6A 4LRCA 4EYIB 2G2ZA 4O3PA 4EFAC 1XIQA 3OXGA 1V5IB 1N8RT 1FRHA 3IWNC 4J9QA 1H6KX 4RW8A 1NPRA 2KYZA 2RHSB 2HBYB 1S49A 5GAEU 1SB6A 1RT5A 4V19X 1NDLA 1CJTB 4FZVA 3W9JA 2I38A 4UZBA 5D0RA 2DHSA 2Y0BB 3EXYA 3D0IE 1S1UA 1I3OB 1VQKS 2EFNA 5RUBA 2XNRA 4NXMJ 1WC6A 2EBGA 2CPHA 4DUTA 4DR3F 3HKZD 2R2SA 2NR0A 4ZVHA 3PHEA 1JLEA 5A8KA 4N56A 4OV6A 1TMJA 4URSA 3KHRA 4NLDA 1QUVA 3D1QA 3S01A 3IA0A 4PKDB 3HSZA 2HZAA 2DBBA 3H2LA 1QE1A 2KB2A 2VF3A 4CTAA 1FRKA 5KFTA 2AP6A 9ATCB 5IC6B 3LPEA 3RRGA 3SYZA 2AMCB 4IG0A 3OVBA 2Z2YB 2DGTA 3PACA 2V67A 3NVLA 3P5BP 2CPIA 1EIYB 1NHKL 2LEPA 4X4PA 3LP1A 1QSSA 1MU2B 4CYUB 4AT1B 1UWBB 1FNOA 3MOJB 4PG7A 3C3LA 3JAMU 2DR7A 4ES2A 1VBZA 2ZC3A 1RAAB 5AXNA 3MMJA 4IDKA 2DRAA 2FLOA 2MEWA 3MCMA 2W5TA 1WELA 3OPKA 2GIFA 5L1IA 3RB3A 1LFPA 2CADA 2M52A 1KHLA 2ASLA 3KOAA 4OZLA 5H9FK 2H48B 1FRIA 2HVEA 1Q8LA 2IM1A 3LQVA 2DR9A 2RF2B 1KH4A 5HBMA 2NPFA 1Q1KA 4IQXA 4LSZB 3FCHA 3C6UB 1F3VA 3T5LA 4M8LA 1IBKF 1PC5A 2V4QA 4XTTA 3W2WB 2V8DA 1XNQF 1YJNS 3H2VE 5BXIA 1ZBTA 3MCNA 3EVOA 1WHXA 2QMUB 4WU2A 2CRLA 2FHMA 4KGMA 4IRKA 4FKYA 2RJZA 2QT7A 3M8PA 3DRSA 1PG5B 4RLEA 1ALIA 3MM8B 1BUXA 4DS5A 5DDRC 4P72A 2VA3A 5G0RA 4RR5A 2ZZTA 2HVZA 1FFSB 4I6YA 1SPBP 1TKXB 4LSLB 4IG3B 2KM8C 1M5PC 3CJ3A 5KFKA 3N4WA 2I9SA 2G9OA 3WZ0A 1FFGB 4NASA 4M5GA 1AJAA 1UJ6A 1U1LA 4F8RA 1N34J 2ADBA 4BCAA 4RBTA 2KG0A 5EWFA 1JQGA 5I3PA 4ELTA 5IFMA 2E5LF 7AT1B 3SSQA 2BE9B 5DO2A 3ZZTA 1OQ3A 3I0RA 1UTAA 4WFAQ 4LF4J 1NSPA 4M5JA 1KLMB 2QZ8A 3HXMA 3I4HX 4X64J 1DTTA 4AXJA 4TKTA 5SZTA 2GVDB 2ZHOA 4U67Q 3BEGB 3EDQB 2ZWOA 1LWCB 4MT1A 4NLVA 2HRTA 2IFXA 2X3DA 1F5CA 1M1GA 1U25A 3GCWP 2AJ2A 2HQFA 1HNIB 4KJIA 3RAXA 3NKRA 4K5SA 2ADCA 4OI0A 1AYEA 1NEEA 3NGSA 4ED3A 1AUDA 3J7YI 2YKMA 2FC9A 2FUG9 3VGTA 5A6WA 1EQMA 4M5MA 4LFCF 1DHMA 1RT3A 3RTVA 1HQUB 2JJ4D 2PE8A 4LMZA 3AD9C 5LOQA 1RT6A 2NXUA 1VS3A 1WG1A 2M2BA 1KVIA 3E8OA 1NHUA 4GVBA 2XS5A 1RTIA 2V8GA 5HVHA 3QFWA 4ZS6A 2QV6A 1KHJA 4NI2A 3R5AA 2RQKA 4I2PA 1KHVA 3BQ0A 1RDRA 1IBLF 4FF2A 3BO4A 2K3IA 3THVA 3CO9A 1TL4A 3J7AN 2FVPA 1J5EF 4EWTA 1S0OA 1OYDA 1NRKA 3P8BB 1S0NA 3T6BA 3NKYA 4OI4A 2JEFA 3NGKA 3L3CA 1NB7A 2AHOB 2V63A 1PAEX 4IR1A 4TQSA 2CJ9A 3CSKA 3MR5A 3G6ES 2PMZD 2HLTA 2GVZB 5KFDA 2B4UA 3CJKB 4DR6J 1L3KA 4C8NA 2IVFB 4I2QB 1JIHA 4PQUA 1IBMF 3A8EA 2QLFB 1URAA 3N6NA 2BZ2A 4M5LA 5GADU 3CDAA 4RU9A 1OY8A 4O4RA 1SJ3P 2B4PA 5J2NA 2MJNA 3ETOA 1G6BA 1DFDA 3F41A 4AFFA 2DH9A 3K59A 2BJEA 4YHHF 4DV0F 4F0KA 4OHWA 2H4YB 1FRLA 4ZVGA 3EM1A 1KD1T 2W5QA 2QFJA 2ZBIA 2YNFB 4DMZA 3IGNA 2HEKA 1T3OA 2ZDOA 1NBEB 4OI2A 3EVMA 4AL7A 3NMAA 2DY9A 2BX6A 3AT1B 1YJTA 3H4BA 3LTOA 2HNYB 2EI5A 2KRBA 3BKFA 2B56A 4XDCA 2YNIB 1B3TA 2IMOA 1HHQA 5FDLA 2VG5A 4UT4A 2W8KA 3PY8A 5J2QB 2RB7A 5B0DA 3A8IA 3DYAB 2VPXB 2J7UA 1TKDA 4FDFA 2GJ2A 1NKEA 1VK8A 2O66A 3QIDA 2AT1B 1GX6A 4DQSA 1B7YB 1UCNA 4RNHA 2PGCA 4CRJA 1HNZF 2M7SA 2GHVC 2MSTA 5HVGA 3KLHA 1K73T 4A8XA 1G4CA 5F8GA 1YIJS 1N5TA 1EETB 2C2OB 2LYVA 5KFEA 4DV1F 4YUDA 3TAMB 2VQRA 1T0TV 2YWFA 1WI6A 3KLGB 2ZBCA 3B8HA 3VF0B 3CMAS 1NK5A 4EMDA 1RXOB 1NPKA 4KE5A 4LF6F 2H1YA 5E2QA 5LM7E 2W4DA 1OYEA 2VDIA 3CIMA 2IPOB 4L6V3 3R97A 2WW4A 1HYSB 2RS2A 1HBNA 2U2FA 2ZFHA 5LMNJ 3M1VB 3MECB 1WF2A 2OFGX 4DL4A 1EHWA 1U4BA 4P7VA 4Q45A 3MCSA 3GR0A 3MTKA 1H38A 1HPZA 4UOCA 3NGUA 5FIIA 5J1PA 1UFLA 3UDEA 4KJGA 3UFCX 1RISA 2W2MP 4LR2A 1N5YA 4WXWA 2M8DB 2PFFB 5ETVA 2CQ2A 4DR7F 5EWEA 3MR3A 1ZEFA 1IM6A 4U7CA 2DCUB 1TL1B 1N32J 5DRKA 2LU2A 2PA3A 2Y1IA 5K14A 3ICLA 4P2XA 1CSJA 2M3DA 2MKJA 1H74A 3DGPB 2CQDA 3W1YC 1WOSA 4TU8A 4ED0A 5L46A 3TAPA 3KUEA 2LXFA 4LR7A 4LBPA 2OPQA 3MPUB 1VQ6S 4GC6A 5AE1A 2QJ3A 4TXSA 1NK7A 2HHPA 2QL7B 2QX0A 1VYAA 1GAOA 3DOMA 2VG7B 4UTGA 1OSDA 3SFUA 3O3LA 5DDPC 1ACMB 3FCVA 2V94A 5KFQA 1VRUA 4NWXA 4OFZA 4HDHA 3VAGA 4FF3A 2KTQA 4I6AA 3GILA 2F1FA 2ZITA 1FX4A 1IM4A 4LQ9A 2VONA 5I3UA 1UVNA 2FLLA 3CNQP 4KHPJ 4NYPA 3S6EA 4IYQA 4RW7B 3PW2A 1B8JA 1TL3B 3IGZB 4X4TA 3ISNC 5HMZA 4Y65A 2EC0A 3HVTB 4K0KJ 1ROFA 3D0GE 3ILJA 2DEJA 1D09B 2W5SA 3WX4A 1GK8A 2OP5A 1HQ2A 2A6MA 4CLTA 3T02A 1LOUA 1MSWD 2LDIA 1FEHA 1X4HA 4KH1B 3WAYA 2ZVSA 3CCSS 3M9NB 2BW2A 1ZM2A 2V9KA 1VQSA 5KFIA 1AFJA 2XS2A 2VJUA 1LFWA 5E7OB 1WF0A 3QGHA 3R5JB 4E2FB 1FKAF 4FKXA 3G6VA 4Q5VA 2RVJA 5JVGQ 2XHWA 1R0BG 4IOCQ 4HL9A 3DLBA 5DGAA 1C1BA 3MPWA 1RT2A 2AGPA 3DKDA 1FJGJ 4KM4A 3JQMA 2VQFJ 1A0OB 1A6LA 3C46A 3SV4A 2BBEA 2KO1A 4ID8A 2GSUA 3HJFA 3FC9A 3GE9A 3G82A 3K57A 1URBA 2WZ1A 3G87A 2W9BA 2EG2A 2F7VA 4F4AA 1NXIA 1FHTA 4LVOP 4JI5J 3QO9A 4ZVTB 4KAYA 3BGUA 1VFJA 2ROPA 3SCLE 4JI4F 4RW9A 1DBDA 2Q6BA 2GO9A 4LF9J 2DR6A 3M30B 3FGVA 4USJC 4B3TJ 2GCFA 1FCAA 1IKXA 4JV2A 4ZVFA 2J0XA 2ZHBA 4Z7CA 3DPCA 3W9IA 1U8SA 3IRXB 1FWLA 3B4DA 4CLYA 2FB0A 5DDOC 4WYWA 4JOUA 2W7AA 4FYVB 2QYCA 3DMJB 4QPTA 3WBHA 3CW2C 3W3SA 3TA0A 3Q2TC 1Q8IA 1YTYA 4FF1A 2RDDA 4FS1A 2XYPB 4YFUA 4G1QA 3HLUA 1KDNA 1BC6A 3NCQA 2OJ3A 3MR6A 3MMAB 4J9SA 1VBYA 3IRWP 1Q78A 3G6XA 1RAHB 4MKBA 4DQQA 1HBMA 4Q8EA 2RIJA 4GTWA 3I55S 3IFEA 2UXDF 4LFAJ 1U2FA 1G2EA 3OXFA 5B0EA 3HJVA 4DPYA 2N4DA 2BEFA 5D4OA 4B17A 2BKNA 1ZM4A 3WAWA 4H4OB 4NL5A 2HQCA 2HVIA 3V6KA 1H98A 4WIQA 2M0GB 4ECZA 2OI2A 5B0CA 3GMGA 4ERDA 1KBRA 5CZXA 3EGZA 1RZMA 1M0SA 3G8QA 5D3GA 2Q6CA 4EUVA 4ZVQB 1EX8A 3T00A 2UV8G 1VJQA 3DDKA 2G13A 5EDWA 4DV3J 2WB1D 3KK1A 2CJAA 1UMJA 2BE2B 3EGVA 3UNGC 1LXJA 3CJ8A 5T14A 4FN5A 4KKOA 4KGKA 2W7PA 3PO4A 2OEMA 4ZP6A 2HBQB 1FKPB 3W62A 5CYMB 4O3SA 4YEAA 4DG1A 1U6BA 3PJ9A 3TP2A 1JXLA 3FFIA 3G9CA 2JWNA 1RYSA 2MZ1A 1GTEA 3LWMA 1YJWS 2BOPA 3CCTA 4A8MP 4RNNA 2J6UA 3GIJA 2XMMA 2JFKA 2O1PA 2QTWA 1KWMA 3KJVA 1HA1A 4P2FA 3OHAA 3BSAA 2HHTA 4I1TA 3C14A 2UVVA 2DHHA 1X31C 3LW5C 1KFDA 2OD6A 4N47A 3GYXB 3D3CJ 2B9XA 2F9JA 1S4FA 3PYDA 1N36F 3CUNA 4F2SA 2UUWA 2B8PA 2VDHA 1FJEB 5BR8J 1EJJA 3PW4A 4X66F 2HS3A 3CMQA 5KFFA 2G4BA 3T1YF 4ECWA 3IAM9 2Z30B 2JHEA 4F7VA 2RSQA 3DM2B 1R6YA 4NLSA 3LUYA 1SH3A 1WC4A 6AT1B 4DSEA 3ZO7A 1EP4A 2BYCA 1UP1A 2VFUA 3IM9A 4UOGA 1WI8A 4DV4F 2XMVA 3OD2A 1HNVA 2YPZA 3B5QA 5KOXA 4HACA 3AXKA 1C0TB 3M2VB 4K2JA 5CHCB 1HWUA 3A8JA 2I2YA 3TUIC 2NSBA 2O3DA 4FYYB 3IM8A 4DLGA 3GTYX 2XZDB 4AQYJ 2QA4G 3OUYB 5EGYA 2QIFA 2UUBF 2J76E 2LFVA 7FDRA 1CJTA 2JC1A 5KFLA 4EU0A 3WIVA 2PFDA 4WE1B 4F67A 2KXHA 4KV8B 1C1CA 1R3NA 4EI2A 2BQ3A 2WOMB 3V81B 5HP1B 4JI7J 4Z37A 3B4MA 4Y6IA 3CD7A 4B9TA 3R3TA 5HATA 2JEGA 4PCQA 1VQMS 2UVRA 3QRRA 1SHNA 2FZKB 3MPVA 1RWVB 4C7QA 1YDLA 4L75A 4LF5F 3FDSA 3MAHA 4IFVA 4GKKJ 1R89A 3M6XA 2L9WA 1MU2A 3OR2B 3Q2SC 4CYUA 1GEHA 3EICA 1UWBA 1KVKA 5HJXA 4ID5B 1R43A 3RRHA 1XJWB 3AB2B 2IRYA 1RGVA 2KFYA 1S5ZA 3QJJA 3NGRA 4C8OA 5KG7A 1TAUA 3MUTP 2ZWPA 5LRMA 4OJ1A 3C19A 2CYYA 2EG1A 1N33F 2WONB 1PCAA 4GKJF 3IWLA 2DPJA 5E0OA 2RF2A 3GJQB 4ANCA 3V2UC 4KIAA 3C6UA 2IM0A 4J9PA 2HQ3A 3CJTA 2VQEF 2ZBQA 4OJHA 3W2WA 1OPIA 2YH1A 3LAMA 3K0JA 5GAGU 4CXSA 5JUMA 1W2BR 3OFFA 4KPCA 1NCLA 3FQKA 4FPRA 3C15B 3DXSX 4WP8A 2JH3A 1QAJA 4WTOB 2UU9J 4ETZA 2QA2A 2BJ7A 5M2UA 3MM8A 4ZLLA 2HG4A 1U26A 1X9MA 1Q53A 3EMTA 3VAIA 2AIRB 3HPOA 3PX6A 2KHDA 2F8HA 1YK9A 4B56A 3NKQA 1SUQB 2LEBA 1TKXA 2XYGB 2AW0A 4LSLA 1Q7YT 2C42A 2FHKA 1NJZA 4EZ6A 3G6YA 3CJQA 3NKNA 2M70A 1PYTA 3NRBA 1TUVA 2HWTA 3OTOF 2CA9A 2DNGA 1HMVB 1U0HB 4BLGA 5K8OA 1S6PB 4DV6J 5CD4H 1N5QA 3VCDA 1DQAA 1UJ5A 2LQJA 3HZGA 2XWXA 2BKOA 4DL6A 4P6QA 1APSA 3WIUA 1KLMA 1NJYA 1ZH5A 3AODA 2GVDA 2E1RA 3THPA 5KFSA 4IH6A 1LWCA 3GB0A 1E33P 2ZUGA 4XPEA 3C6TB 1S1WB 1F60B 3Q8RB 4URGA 2QG9B 4B3RJ 2MZQA 3VAHA 1RBOB 1HNIA 2VV5A 4G6VB 1JLCB 5IQQA 4X4UA 1WKKA 1HQEB 2B43A 2V2KA 4DLEA 2YNHB 2IVMA 4P52A 2NYHA 4MMOA 1YBTA 2W9CB 1XR7A 1WF1A 3TUPA 3AHPA 2ZM6J 4JI1F 2ACMA 5KFPA 3LAKA 4NLUA 3PFEA 3CCRS
chains in the Genus database with same CATH topology
1AJBA 4LR7A 1KH9A 3DPCA 1ANIA 3KD8A 1ALKA 2GSOA 1EQJA 5GOVA 5LRMA 3BDHA 2W5QA 4LRDA 1K7HA 3TG0A 5DLWA 3UN2A 1N2LA 5L0KA 4CYSA 1ALJA 3MK1A 1ELYA 3A52A 5AJ9A 4KAVA 1EJJA 1HJKA 3T00A 5LQQA 1ED9A 2W8SA 4NWJA 2XR9A 1KH5A 3WBHA 4ZG9A 4YR1A 1EI6A 4LRAA 2W5RA 4UPLA 1SHQA 4CYRA 3OT9A 1O99A 1ED8A 3BDGA 4LQYA 4NWXA 3MK0A 5IJSA 1ALIA 2G9YA 2GA3A 3DYCA 3M8ZA 3UN5A 5L0EA 5HRTA 3TX0A 3NKRA 3WAXA 4LREA 3NVLA 1E2SP 2ANHA 4KM4A 3M8WA 3SZYA 4LRCA 4UORA 4KJDA 5LRNA 1ELXA 4UPKA 4N7TA 4ZGAA 5IJQA 3WAVA 1AJDA 2GSUA 1E3CP 3UN3A 4MHXA 3T01A 4CXSA 1URBA 2D1GA 1E33P 2W5WA 4GTYA 2X98A 4LR9A 5K4PA 2W5TA 1ZEDA 2W5VA 2W8DA 4UOPA 2IUCB 5EGHA 1ALHA 3NKPA 4QAXA 5DLTA 1SHNA 2XRGA 1URAA 4TN0A 4KJGA 1AJAA 1AJCA 3Q3QA 1B8JA 3TWZA 3CMRA 4ZG6A 3IGZB 3B5QA 4LR2A 4FDJA 1KHNA 1KHKA 1KHLA 4KAYA 4UPIA 4MIVA 4GTWA 3IGYB 1FSUA 3E2DA 1Y7AA 1HDHA 4GTXA 4ZG7A 5DLVA 3NKMA 4LRFA 1N2KA 1Y6VA 4LR8A 3SZZA 5EGEA 3UO0A 1ZEFA 1KH7A 2GLQA 1O98A 2W5XA 3M7VA 4GTZA 1AUKA 5C66A 3ED4A 2W5SA 1ZEBA 4B56A 1EW2A 2QZUA 5GRRA 3NKOA 3NKQA 4CXKA 3T02A 3IDDA 2IFYA 2RH6A 4MY4A 3WAWA 4CXUA 1KHJA 4UOOA 5LIAA 3BDGB 2VQRA 1KH4A 5KXAA 3UNYA 5TJ3A 2ZKTA 4FDIA 1EW9A 3WAYA 2IUCA 3LXQA 3BDFA 1P49A 3NKNA 2GSNA 5L0BA 1ANJA 4UPHA 3MK2A 1ELZA 1HQAA 5INHA 1EW8A 3M8YA 4LRBA 1E1ZP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AJB A;  4LR7 A;  1KH9 A;  3DPC A;  1ANI A;  3KD8 A;  1ALK A;  2GSO A;  1EQJ A;  5GOV A;  5LRM A;  3BDH A;  2W5Q A;  4LRD A;  1K7H A;  3TG0 A;  5DLW A;  3UN2 A;  1N2L A;  5L0K A;  4CYS A;  1ALJ A;  3MK1 A;  1ELY A;  3A52 A;  5AJ9 A;  4KAV A;  1EJJ A;  1HJK A;  3T00 A;  5LQQ A;  1ED9 A;  2W8S A;  4NWJ A;  2XR9 A;  1KH5 A;  3WBH A;  4ZG9 A;  4YR1 A;  1EI6 A;  4LRA A;  2W5R A;  4UPL A;  1SHQ A;  4CYR A;  3OT9 A;  1O99 A;  1ED8 A;  3BDG A;  4LQY A;  4NWX A;  3MK0 A;  5IJS A;  1ALI A;  2G9Y A;  2GA3 A;  3DYC A;  3M8Z A;  3UN5 A;  5L0E A;  5HRT A;  3TX0 A;  3NKR A;  3WAX A;  4LRE A;  3NVL A;  1E2S P;  2ANH A;  4KM4 A;  3M8W A;  3SZY A;  4LRC A;  4UOR A;  4KJD A;  5LRN A;  1ELX A;  4UPK A;  4N7T A;  4ZGA A;  5IJQ A;  3WAV A;  1AJD A;  2GSU A;  1E3C P;  3UN3 A;  4MHX A;  3T01 A;  4CXS A;  1URB A;  2D1G A;  1E33 P;  2W5W A;  4GTY A;  2X98 A;  4LR9 A;  5K4P A;  2W5T A;  1ZED A;  2W5V A;  2W8D A;  4UOP A;  2IUC B;  5EGH A;  1ALH A;  3NKP A;  4QAX A;  5DLT A;  1SHN A;  2XRG A;  1URA A;  4TN0 A;  4KJG A;  1AJA A;  1AJC A;  3Q3Q A;  1B8J A;  3TWZ A;  3CMR A;  4ZG6 A;  3IGZ B;  3B5Q A;  4LR2 A;  4FDJ A;  1KHN A;  1KHK A;  1KHL A;  4KAY A;  4UPI A;  4MIV A;  4GTW A;  3IGY B;  1FSU A;  3E2D A;  1Y7A A;  1HDH A;  4GTX A;  4ZG7 A;  5DLV A;  3NKM A;  4LRF A;  1N2K A;  1Y6V A;  4LR8 A;  3SZZ A;  5EGE A;  3UO0 A;  1ZEF A;  1KH7 A;  2GLQ A;  1O98 A;  2W5X A;  3M7V A;  4GTZ A;  1AUK A;  5C66 A;  3ED4 A;  2W5S A;  1ZEB A;  4B56 A;  1EW2 A;  2QZU A;  5GRR A;  3NKO A;  3NKQ A;  4CXK A;  3T02 A;  3IDD A;  2IFY A;  2RH6 A;  4MY4 A;  3WAW A;  4CXU A;  1KHJ A;  4UOO A;  5LIA A;  3BDG B;  2VQR A;  1KH4 A;  5KXA A;  3UNY A;  5TJ3 A;  2ZKT A;  4FDI A;  1EW9 A;  3WAY A;  2IUC A;  3LXQ A;  3BDF A;  1P49 A;  3NKN A;  2GSN A;  5L0B A;  1ANJ A;  4UPH A;  3MK2 A;  1ELZ A;  1HQA A;  5INH A;  1EW8 A;  3M8Y A;  4LRB A;  1E1Z P; 
#chains in the Genus database with same CATH topology
 1HQU A;  4USM A;  2YQ0 A;  3M8R A;  5KFX A;  1HAR A;  4DUZ F;  5L0K A;  4XPC A;  3OTD A;  2BRL A;  5KTQ A;  5EUH A;  3KG1 A;  4DL3 A;  2AX0 A;  2LKZ A;  3LGH A;  2HBZ B;  1ARO P;  4MKA A;  1EAR A;  1WSR A;  3E2E A;  4EBD A;  1F1B B;  3MFI A;  3TZY A;  1ZZN A;  2AEM A;  2G2Y A;  2DNH A;  2D3Z A;  4RUH A;  5F8J A;  5B09 A;  3HSG A;  1NDP A;  1GMW D;  2V2Z A;  1KFS A;  4BWM A;  3SQO P;  5CZV A;  1RI7 A;  5HRO B;  4KYZ A;  4QR1 A;  4GTX A;  5DLV A;  3MUR P;  3O8W A;  4LRF A;  4UZC A;  1TFY A;  1VC0 A;  3M2R B;  5AXK A;  1TL5 A;  2GVZ A;  1ZEB A;  2RS8 A;  4J90 A;  2MY8 A;  2V0N A;  3CJK A;  5HMX A;  3ZZ0 A;  5LJ5 Y;  2KXF A;  3IDD A;  4JUZ A;  4I2Q A;  5E41 A;  2W25 A;  3HF5 A;  2C3O A;  4DQI A;  3HCX A;  2PMW A;  1H73 A;  1RJJ A;  2ROG A;  5GMD A;  4ZPA A;  2OUG A;  4X2B A;  1IN0 A;  2MSS A;  2E7W A;  4E0D A;  4M5H A;  2LDY A;  3KTQ A;  3JQK A;  2HAI A;  3NS7 B;  2AKW B;  3P96 A;  4DS4 A;  3QT6 A;  2YWW A;  4HR2 A;  3BRE A;  2DRD A;  4S0M A;  2LQB A;  3HT3 A;  3MMB B;  1EJ7 L;  4Y34 A;  2VUG A;  3N6M A;  2QMW A;  1LNQ A;  1PC4 A;  3UD3 P;  1P1L A;  3CVK A;  5C7P A;  2AEF A;  1HIY A;  2YNF A;  3D6H B;  3BYP A;  3MED B;  2IAJ B;  2B4O A;  4OZ1 A;  2CVE A;  5DLF A;  2YKN B;  1TMM A;  2HFZ A;  1VBK A;  4QPX A;  3U7J A;  5FD1 A;  3IS9 B;  4C97 A;  5ETO A;  4JI3 F;  2YNI A;  2K2P A;  5T41 A;  2ABY A;  3PO5 A;  1X7V A;  5IXU A;  5J2Q A;  2YQ1 A;  4NLX A;  3DYA A;  2DGQ A;  1UA1 A;  2P8I A;  3GFH A;  2WW8 A;  2J8S A;  3H2U B;  1NSQ A;  5THW A;  3B54 A;  2BQR A;  1EKR A;  3BS9 A;  2A6O A;  1DAR A;  3SI8 A;  3W65 A;  4DPW A;  5BJR A;  4YQW A;  1IUJ A;  2D3O 1;  4IR9 A;  4KSE B;  5A76 A;  1HNX J;  3FBC A;  3R5C A;  3MEK A;  3QNW B;  1EET A;  3JQJ A;  2PO4 A;  1X9W A;  2OTJ S;  4CYR A;  3TAM A;  4LF7 J;  2G9Y A;  1E6Y B;  5HRT A;  3KLG A;  5AJ3 F;  2JNJ A;  2AF6 A;  3RBD A;  5EX0 A;  2PT0 A;  5L1K A;  1PBU A;  2LMI A;  2CJK A;  2A1B A;  2UZA A;  4PEO A;  2COL A;  2UVW A;  3LGM A;  4DV5 F;  2E5G A;  3KG0 A;  1HW8 A;  3ILL A;  1HYS A;  2XRG A;  1MLA A;  6FDR A;  4CLP A;  3Q8S B;  4FBU A;  4LUB A;  3T9Z A;  4B08 A;  3M1V A;  3MEC A;  2VJV A;  5C5J A;  4X4O A;  1W26 A;  4MK9 A;  1UFW A;  1WG4 A;  1NDC A;  3JTO A;  4YME A;  3TQ1 A;  2H5E A;  4MY4 A;  4HT7 A;  3RUB L;  5LJ3 Y;  3W5X A;  4X84 A;  2CQH A;  4C11 B;  2LA4 A;  3QAT A;  3KK3 B;  3MXH P;  3DLJ A;  1VRT B;  1RTH B;  5L38 A;  3GWC A;  4B9M A;  2BKP A;  3OL6 A;  4IRD A;  4DR3 J;  1TL1 A;  3EWG A;  3ZC4 A;  2VBW A;  5F9L A;  2WTF A;  4ED4 A;  1OO0 B;  3QRP A;  3DGP A;  1RBL A;  2B51 A;  3UDL A;  4ZJL A;  3OJU A;  3VZI A;  2EFO A;  1TK5 A;  4J9V A;  3UPF A;  5EHH A;  3QLH B;  1SV5 B;  1QVF R;  3M05 A;  1M5H A;  2FHJ A;  3NG8 A;  2V2V A;  2VG7 A;  2ZVI A;  4ZDN A;  1RKJ A;  4DU7 A;  2PEH A;  2H54 B;  2XY5 A;  3HHK A;  2M8H A;  1FVS A;  2ZHA A;  5DS7 A;  2C2D A;  2XLJ A;  2XMT A;  4GO5 X;  3L9Z A;  2CZV C;  4K59 A;  2QLB B;  5TJ3 A;  3NAH A;  4RW7 A;  1TL3 A;  1O0P A;  3KLV A;  1RUS A;  2HHH F;  4Q0B B;  2MY7 A;  4HHU A;  3N5F A;  1URN A;  4UF4 A;  3I5C A;  3G4S S;  4KO0 B;  4NMX A;  2LXU A;  4USI A;  4HI1 A;  2VIH A;  2MQN A;  3FRZ A;  1IBK J;  5KG1 A;  3BH7 B;  1UPP A;  4KR0 B;  3FEX B;  2OIH A;  5A8W B;  1XNQ J;  4JB8 B;  3Q23 A;  1QD1 A;  5IT0 A;  4MK7 A;  4ZGA A;  2RRB A;  1SBR A;  2X1B A;  2I5J B;  3T41 A;  4PAA A;  2C3Y A;  4F04 B;  4MHX A;  5IM0 B;  2GJI A;  4DFK A;  1Q82 T;  4IOB A;  2HRY A;  1VC5 A;  1TVR B;  1N6Q B;  2FVQ A;  1BD6 A;  2ZE2 B;  3PVX A;  1Y7A A;  4OJ3 A;  4JV5 F;  1SCJ B;  1T11 A;  2QSW A;  4DR1 J;  5KFA A;  3ZNJ 1;  2HFN A;  4MH8 A;  1D9D A;  1YLX A;  1DUR A;  4DFJ A;  1PBA A;  3T1H F;  1SKU B;  4F4Z A;  2F8M A;  1UVM A;  3R2C J;  2E5L J;  3H5Y A;  4TU9 A;  2D7S A;  4X62 F;  3DRP B;  1QY7 A;  1AUS L;  2XY6 A;  1NK8 A;  2JLE A;  5IQ6 A;  2DH8 A;  2FZC B;  2Z8Q A;  3M30 A;  2MPU A;  3TEH B;  2HIY A;  1ITP A;  4OLO A;  3UQS A;  3MM9 B;  3BO2 A;  3IBW A;  1WD6 A;  3GLJ A;  3JTP A;  3I56 S;  3IRX A;  4J91 A;  2X51 A;  1NJW A;  2ILZ A;  3DLK B;  5D4L A;  2P9C A;  1WDT A;  1RAF B;  3DMJ A;  2IUC B;  3HVW A;  2CPE A;  2DK2 A;  1KP6 A;  3SZ2 A;  2ZUA A;  4ZVR B;  3CED A;  3BN7 A;  2MHE A;  4PWU A;  3CUL A;  4OYI A;  3EDR B;  4LFC J;  1Y5I B;  4NXM F;  4J9O A;  4YB7 A;  1RP5 A;  1RT1 B;  1RAE B;  3MMA A;  2MGZ B;  2EKN A;  3W2V B;  1L3S A;  3VAK A;  3D2W A;  3BQ1 A;  4ZP8 A;  3NY0 A;  3WC0 A;  2OAU A;  1WC1 A;  4NLY A;  2JZ5 A;  4EZ9 A;  1ALJ A;  4KQZ A;  1XNR J;  1H3D A;  1ED9 A;  2HPU A;  1F6T A;  2C1E B;  4H4O A;  4O0I A;  4ZVE A;  1J5E J;  1REG X;  1SC6 A;  3IXQ A;  4DBQ A;  1S1X A;  2MKI A;  2VHG A;  1N88 A;  2YXL A;  5BYQ A;  1RHK B;  2ALY B;  3IO1 A;  1RU2 A;  2E5I A;  3R5D A;  2UUC J;  2FJD B;  1VJW A;  4NLO A;  4CLS A;  2J6S A;  2BE2 A;  4B3M F;  5HJY A;  4UPI A;  2MLZ A;  4KGX B;  3Q8V A;  4HYK A;  1ZS6 A;  4YR3 A;  1M1H A;  1IBM J;  5LSO A;  1FKP A;  5CYM A;  4IKA A;  1M1K T;  4ZLN A;  1VLO A;  4DEZ A;  3MM5 B;  3TAQ A;  3AJD A;  6FD1 A;  4C3L A;  2V50 A;  2NS1 B;  1S79 A;  1SJQ A;  2HGN A;  1CEZ A;  2HQI A;  3HVA A;  4YS2 A;  4YHH J;  4DV0 J;  2ACY A;  5D0H A;  5K8P A;  1X4B A;  1S6U A;  1NME B;  3KLI B;  2J9D A;  3OV7 A;  3HHE A;  3IN5 A;  4FVC A;  3BQ2 A;  1PJ6 A;  4UPK A;  3T5K A;  2FGC A;  3TVY A;  1DY3 A;  5BYR A;  4NEY A;  1RWX B;  1SH2 A;  4DF8 A;  3CC4 S;  4ENO A;  3EZ5 A;  4I6W A;  4DN0 A;  1Q95 G;  3OQ2 A;  2R2U A;  2HS0 A;  2HHV A;  1N34 F;  1X5P A;  1M5V C;  4RJV A;  2RE1 A;  1FK9 B;  1Y5N B;  1QJH A;  5B7W A;  2DR8 A;  3DM2 A;  2X7I A;  1VQP S;  1X8D A;  1NSA A;  4CXK A;  2WVF A;  2SXL A;  2RML A;  2HUR A;  4FXD A;  3CO0 P;  3HD2 A;  3UNY A;  4TN2 A;  2BAB A;  1EW9 A;  4L72 B;  4DX5 A;  4CCH A;  3ZZO A;  2EFP A;  4BDP A;  2W7O A;  1C0T A;  3M2V A;  4ZP9 A;  3AY0 A;  1JLB B;  3NNA A;  1UL3 A;  2DGX A;  3CJ2 A;  2PD1 A;  1NJX A;  2DJW A;  2N3L A;  2CPJ A;  2IA6 A;  4ZLP A;  5L39 A;  1OQ6 A;  3UDC A;  4BWJ A;  1R0C B;  2FVC A;  8RUC A;  1BY9 A;  2IJR A;  3OUY A;  4LF6 J;  5HMW A;  2XWY A;  4K2X A;  5DG7 A;  4DL2 A;  4H4K A;  1FNM A;  5DM6 Q;  2WRM A;  2W5W A;  4KV8 A;  5MAO A;  2WOM A;  4DPU A;  3FEZ A;  3V6D B;  3V81 A;  5HP1 A;  2IA0 A;  3MOZ A;  2NCK L;  2V69 A;  3WHI A;  2XCA A;  1ZAV A;  1O98 A;  1UWA A;  1U48 A;  1UJ4 A;  3TVZ A;  1N4L A;  2HNZ B;  4F4X A;  2W2P P;  3BDG B;  4KPY A;  4L3N A;  1R8C A;  4DR7 J;  5HQ8 A;  1IKV B;  2CZ9 A;  1YJR A;  1CJK B;  1AJB A;  4U8V A;  1ALK A;  2DXD A;  1CC8 A;  2HHQ A;  4A8S A;  4ZHR B;  5CD4 A;  1IXK A;  1KVJ A;  5DJB A;  2VKR A;  1ZTT A;  4USU A;  3OR2 A;  5K8N A;  3SMZ A;  1V9O A;  4ID5 A;  3OW2 R;  4QWE A;  4LQY A;  4ECU A;  1VQ7 S;  1CLF A;  3TX0 A;  1UEV A;  3VZH A;  2KYX A;  4ER8 A;  2MKS A;  1YZ7 A;  3Q8Y A;  1JXV A;  1Y10 A;  3DI6 B;  3H4D A;  3UD5 A;  2ZZM A;  1Y0H A;  3N28 A;  1K9M T;  2WON A;  1XK8 A;  1N54 B;  4YB6 A;  3L09 A;  2I6W A;  3BDE A;  1Y3J A;  1MML A;  4FYX B;  4XAK A;  1TUG B;  1U8W A;  2ZDP A;  4WFN Q;  4ZVU B;  4E8U A;  3OXL A;  5F41 A;  3JYT B;  2V4J B;  1Y6V A;  2CG4 A;  4AUK A;  2Z2M A;  3D6M B;  3MMC B;  4NLR A;  4GC7 A;  1Q5Y A;  4UY8 T;  5A8R B;  2CXE A;  1AFI A;  2ATC B;  4B9S A;  3S7R A;  1LW0 B;  4ZA1 A;  3TUJ C;  2VFT A;  1QVG R;  4U7U K;  3DRR B;  1J5O B;  4PG5 A;  5HMY A;  1HHT P;  4A8F A;  1RWO B;  4ZPD A;  3K2Y A;  2CPZ A;  4FBT A;  1SUQ A;  1XEZ A;  1K1Q A;  5DG9 A;  2YX1 A;  2OSQ A;  2JVO A;  3T3F A;  5CYJ A;  3P6Y C;  2K06 A;  4OX9 J;  2IBK A;  2VOP A;  1B64 A;  3MD1 A;  4YR2 A;  1DLO B;  1HMV A;  4HI2 A;  2UUA F;  4J9K A;  1U0H A;  1S6P A;  2B9W A;  5F8I A;  1ZAW A;  2L08 A;  4DL5 A;  3UWT A;  5LXR A;  1PYS B;  1T9X A;  5HSP A;  4F26 A;  3TR5 A;  3OVA A;  3NOC A;  3NWG A;  3PX4 A;  3OTE A;  3CD6 S;  5M2P A;  3H20 A;  1TTH B;  3MHY A;  3C6T A;  2BJD A;  3PCO B;  1P49 A;  1KR4 A;  3RGI A;  2YH0 A;  2H5I B;  3R7B B;  4JI4 J;  4M5K A;  3QAE A;  5EX3 A;  1JLC A;  4NYO A;  3OR1 B;  2ROE A;  3M9M B;  3ZNU A;  4WP9 A;  1HQE A;  5AJ9 A;  5F0U A;  1C4C A;  2W4C A;  2B4V A;  2YNH A;  2YX7 A;  2Z4P A;  2W9C A;  4WCE Q;  2CZ4 A;  5D0G A;  1RWN B;  1H7X A;  3MWB A;  2P6S A;  1HWJ A;  2VKZ G;  1D8Z A;  2BJ3 A;  1G3O A;  5IWA J;  2R8G A;  2Q3P A;  2R7W A;  1JLF B;  1UZD A;  3KHH A;  3PJX A;  1PAU B;  3R6L B;  3NS6 A;  3RBZ A;  5K8M A;  2BJ9 A;  2H4W B;  3W7B A;  2DGU A;  2OPS B;  4QQB A;  2GA7 A;  4DPX A;  3NLC A;  1P6T A;  1MWZ A;  4H4K C;  1JLG B;  4X4V A;  3EPI A;  3TRG A;  3M32 B;  5A2Q Y;  3AJ1 A;  4UPH A;  1S7I A;  3PRD A;  5HRO A;  1E1Z P;  3LH2 S;  3SBM A;  3MM7 B;  3KLF A;  1B0P A;  2JL9 A;  2F8E X;  3MEE B;  3UW1 A;  3M2R A;  3UI3 A;  1SVD A;  1HR0 F;  1YRT A;  3U1M A;  3PX0 A;  3C2P A;  3F44 A;  3ILO A;  2IM3 A;  2YKA A;  4USW A;  3THT A;  3LP1 B;  4RNF A;  1YKW A;  2B7C B;  5DLG A;  4F0H A;  5U47 A;  2OFH X;  2CDQ A;  2VBX A;  3PIO Q;  4X65 J;  4WK1 A;  5DET A;  1E6V B;  3KK2 B;  3ETM A;  3AOA A;  1TQL A;  2LQ5 A;  1FD2 A;  4O44 B;  1ZET A;  4UY8 5;  4YOE A;  3DLE B;  1BLU A;  1U45 A;  3OVS A;  3MMB A;  2QEX S;  1UVL A;  3G96 A;  1U1Q A;  3HKW A;  4F4K A;  4UST A;  1MG7 A;  3UO0 A;  2QL9 B;  3EGN A;  4OMF G;  3HFV A;  2UUT A;  1FRJ A;  2DHX A;  2R8J A;  1S4E A;  2MQP A;  2AJ1 A;  3MD3 A;  1X60 A;  2L41 A;  3MED A;  2HS4 A;  2IAJ A;  2MQO A;  3PRV A;  1H72 C;  1IKW B;  2YKN A;  5F8H A;  2ATL A;  1TUW A;  2W01 A;  2ZH8 A;  3RBE A;  2MMY A;  4NPO A;  3CPW R;  3IS9 A;  4WZM A;  4Y00 A;  3GP9 A;  1GX5 A;  2OEK A;  3SXL A;  3N79 A;  2HVH A;  4R8U B;  4M63 A;  4HH1 A;  1NU4 A;  2ZD1 B;  3M4X A;  1KH5 A;  3NNH A;  3CJ4 A;  2XGQ A;  2BUN A;  2R4F A;  3GYN A;  1N36 J;  3QIP B;  1SKS A;  2BRK A;  2POK A;  2LCW A;  2HHS A;  1SQG A;  3R1H A;  4YB5 A;  4A48 A;  3BR9 A;  3KYL A;  1N52 B;  2IJN A;  2D1G A;  2DPI A;  5CYQ B;  2CNL B;  2BAN B;  1RKI A;  3NKP A;  2R42 A;  4TN0 A;  4QJV A;  2AWZ A;  1T8E A;  1U6F A;  1E6Y A;  1BQM B;  2VC0 A;  4DL7 A;  3HD1 A;  2HQD A;  4ED5 A;  4WXO A;  4C48 A;  4A8W A;  4K4V A;  2HND B;  2GIR A;  2IVY A;  3BB5 A;  4BC9 A;  5AXM A;  1JX4 A;  4OZN A;  1Q86 T;  4MTP A;  1H0H B;  4DXL A;  2EWH A;  2YKQ A;  2CQG A;  4WII A;  4A8Q A;  2DNK A;  1KOH A;  5AXL A;  3ZXW A;  2KZZ A;  1IVZ A;  2XR9 A;  3MR7 A;  1CG2 A;  1SC3 B;  2BQU A;  2G2O A;  1LWE B;  5ETP A;  1S48 A;  4XO0 A;  4C11 A;  1FXR A;  3KK3 A;  3FCW A;  2WBR A;  3MZI A;  4QWB A;  4TQR A;  2KH9 A;  3PW0 A;  1RA6 A;  3I82 A;  2NUU G;  4Q2L A;  1FES A;  1HLW A;  1ELO A;  1YBU A;  4LFA F;  3NCP A;  3QLH A;  2OEJ A;  5HL7 Q;  1SV5 A;  1EW2 A;  1X4E A;  3A4T A;  2LQ9 A;  4MIW A;  3KXD A;  4OYZ A;  4NOH A;  4DV2 J;  3KMS A;  2QA4 S;  1ICE B;  1FT8 A;  5IJQ A;  4DN9 A;  3KD8 A;  4CT8 A;  1T9V A;  3I32 A;  3JSR A;  2IYI A;  3V6J A;  3QFH A;  4JI8 F;  3ISN D;  1TR0 A;  1M90 T;  4Z7Y A;  1S72 S;  1T03 B;  2WBM A;  1YSJ A;  5K9F A;  4K8R A;  1ULR A;  1B70 B;  3CDU A;  1EKS A;  4YP3 A;  3GYG A;  3M8Z A;  4FNI A;  1VCT A;  2CJQ A;  4J37 A;  1FDN A;  1WKJ A;  3QQC D;  5KFZ A;  1R7I A;  1RSC A;  1B0V A;  4Q0B A;  1B7F A;  3O44 A;  4PXD A;  4ED1 A;  4OLP A;  4KO0 A;  4NLP A;  4GO7 X;  4TY9 A;  3K8V A;  1FXD A;  4LJM A;  1UVK A;  3KFW X;  3Q8U A;  1GH8 A;  2MZT A;  2DD8 S;  3ITH B;  3ENV A;  2DGW A;  3BH6 B;  5A8W A;  2MLX A;  2XSJ A;  5LT5 A;  3OTC A;  1PO6 A;  1XMQ J;  2L3M A;  3PYE A;  4ZK7 M;  4RWX A;  3PG9 A;  1AZS B;  2I5J A;  3TEG A;  2C22 A;  1RT4 B;  3AFG A;  2GJF A;  1RAD B;  3LXQ A;  1VQ4 S;  3D68 A;  5L0B A;  4B3O B;  2EPI A;  3CDW A;  1TVR A;  1N6Q A;  2BE7 D;  2HHW A;  2HK3 A;  3LPY A;  2ZE2 A;  2DNQ A;  2ZBP A;  2CNN B;  2UXC F;  2C2M B;  2DO4 A;  1X5S A;  1HD0 A;  1XN9 A;  1MN7 A;  4LBH A;  3KG4 A;  3OTO J;  1S9F A;  4FNH A;  1NK0 A;  5F9N A;  1N48 A;  3CJS A;  1GXL A;  3HMJ G;  4D3G A;  2GMH A;  3DRP A;  3QZ7 A;  3PTW A;  2YWE A;  1N5V A;  2BM1 A;  4OHZ A;  1P27 B;  4CQ1 A;  1Y11 A;  2HWI A;  1T3N A;  1YQH A;  3H7H B;  4ZN1 A;  1NKB A;  3TAR A;  2VPY B;  3TWZ A;  4UQG A;  1SI9 A;  1O6X A;  3UE2 A;  3MM9 A;  4ZVP B;  1Q7L B;  1FSU A;  2GS8 A;  4LR8 A;  1VDH A;  2R7O A;  5KG6 A;  3RRK A;  2Y3Y A;  2V5H G;  3DLK A;  4RW4 B;  3BSN A;  2XY7 A;  2DNR A;  4JYA F;  2R8H A;  1HBO B;  4KC5 A;  2APO A;  2IUC A;  5MLC V;  3J7A 1;  1KN6 A;  1WEY A;  2F3J A;  1SQF A;  9RUB A;  2AYE A;  3L7O A;  2ZBR A;  1OS5 A;  2FJV A;  1WEZ A;  1HJK A;  1FI4 A;  2W8S A;  4RWW A;  5KFG A;  4WP3 A;  1RT1 A;  2ZH9 A;  1S7H A;  5IV3 A;  1CUL B;  1R6V A;  5IT4 A;  5JJB A;  2MGZ A;  2GA3 A;  4JI7 F;  3W2V A;  3WAX A;  2OML A;  4DUZ J;  2NXC A;  3LO3 A;  4EYH B;  4UQT A;  2XMA A;  3IG1 B;  4F3M A;  3CC2 S;  3U27 A;  4DX8 H;  2JRS A;  4M5D B;  1JJH A;  2KDO A;  4OX8 A;  3FSI A;  4J9M A;  2IRX A;  4FDJ A;  3BF4 A;  4ETX A;  4ECS A;  3BGR B;  1MNE A;  4HHH A;  2VBZ A;  1MW7 A;  1YJ7 A;  3GU0 A;  5FLX Y;  3Q24 A;  4O3O A;  1U0S A;  2VU5 A;  4I69 A;  2RKI B;  4F25 A;  2K1R B;  2WVE A;  1EAY C;  3HM9 A;  1S0V A;  3UVJ B;  1FFW B;  4CT9 A;  4ELV A;  2WVD A;  1RBA A;  2K7K A;  4TYB A;  2AJ0 A;  3PRB A;  3TZX A;  3DC2 A;  2GAH C;  3A52 A;  3FMB A;  3SCJ E;  4ILM A;  2CQI A;  3HHD A;  4ED7 A;  1CJV B;  2D3U A;  4HH0 A;  1R27 B;  2IJF A;  3MM5 A;  1S57 A;  3BKU A;  4JBC A;  3HX9 A;  2R7T A;  2IDE A;  1HL6 A;  1HWK A;  3CGI A;  2EC2 A;  1KQK A;  3ZTP A;  1FO1 A;  4X4N A;  5ETM A;  1OWX A;  1U1O A;  1ZA2 B;  2UU9 F;  3KLI A;  1KNZ A;  4QIF A;  4CLZ A;  2KN4 A;  3KJQ B;  2IC3 B;  2AYB A;  3PR4 A;  1WDD A;  4DFP A;  4NA2 A;  4WZQ A;  4CLF A;  2CFX A;  2MKY A;  4Y2K A;  4JI0 F;  3DDN A;  5E33 A;  4DR2 F;  4ZPW R;  3T5H A;  4CLL A;  2VOO A;  3RG6 A;  2KFZ A;  2GAG C;  2QLW A;  2QN6 B;  3X3U A;  5GOV A;  3CCM S;  3EZU A;  2X1A A;  5KG4 A;  2G0I A;  1FK9 A;  2XS7 A;  3GIK A;  5LQQ A;  1FDD A;  1Q8K A;  1YI2 S;  1U2C A;  4DX6 A;  4NLT A;  5KT4 A;  3R1L A;  2J0Q D;  1U1R A;  1XMO J;  5KG0 A;  4X4S A;  2ZZN A;  4RO0 A;  3MPD A;  5F0W A;  4QOT A;  1JLB A;  1YRX A;  2W24 A;  5J2M B;  3CCL S;  3J81 U;  5AJ3 J;  5EGH A;  3I87 A;  1NLK L;  5CCM A;  1UAW A;  3CC7 S;  3H25 A;  2Y8Y A;  4DI6 A;  4RNM A;  1VQ5 S;  2HFU A;  2MDA A;  5GAD I;  2A2C A;  3MDF A;  5B0B A;  2GGP B;  3NKO A;  3KDN A;  3D1O A;  4DV5 J;  2OSR A;  1FX2 A;  2ZM6 F;  4FP9 A;  2AX1 A;  3PYG A;  1ANJ A;  1RCX B;  3M8Y A;  3V6D A;  3H8Y A;  3QZ8 A;  4R0J A;  4CIO A;  1QTM A;  4QU6 A;  5T7L B;  4W92 B;  3DXB A;  1Y3K A;  2O67 A;  5B0G A;  1TK8 A;  8ATC B;  3PIP Q;  1F5A A;  5KT2 A;  2RAQ A;  3PNI A;  1GMU A;  3F56 A;  2HNZ A;  1WSV A;  3RBX A;  3BDG A;  2N3O A;  4U6P A;  4K4Z A;  1IJE B;  4K4S A;  1IKV A;  1JKH B;  1TK0 A;  4UOR A;  1CJK A;  1H2V Z;  1R0A B;  5L9N A;  2E66 A;  1HNW F;  4ZHR A;  3D54 A;  1EZZ B;  4WK3 A;  2MZS A;  5DQI A;  1BQN B;  4ECR A;  1VQ8 S;  4BC7 A;  3NCR A;  2FYX A;  1MRO B;  4ZG6 A;  4ECQ A;  4I64 A;  3GJT B;  2AYM A;  3SEO A;  5K20 B;  3EXC X;  5ETQ A;  1BMQ B;  2X1G A;  5J1E B;  4KB7 A;  4OYW A;  3DI6 A;  3PM9 A;  4PXE A;  1WNE A;  5ETR A;  5GRR A;  1UA0 A;  1S1V B;  5HAN A;  4DQR A;  1LWX A;  3GSI A;  4F36 A;  1U09 A;  2YPY A;  3GSD A;  5KXA A;  4OL8 A;  2ZJP Q;  3J80 Y;  4NCG B;  2KI2 A;  3V5R A;  4CH1 A;  3JB9 k;  3I31 A;  4C8M A;  1GMV A;  1UEK A;  4PWD B;  2JLG A;  3EUN A;  3JYT A;  2V4J A;  1N2L A;  1HWL A;  3MMC A;  4ZVO B;  1RWK B;  4Z2X A;  2E29 A;  4R5P B;  3HHN B;  5A8R A;  4JV0 A;  4CM0 A;  3BJY A;  3QT5 A;  4NEZ A;  4ZPV R;  2ZH7 A;  1Z2L A;  1LW0 A;  2JDJ A;  2HHH J;  5I4M A;  3AB4 B;  3MM6 A;  2HFO A;  1ZA1 B;  3HHL B;  1UET A;  1VIO A;  1GFW B;  4RPF A;  1AB8 A;  5D4N A;  1J5O A;  1T94 A;  3J81 j;  3Q86 A;  3HVR A;  2UP1 A;  1SJR A;  2PMH A;  3M9O B;  3GIR A;  5DDQ C;  5KT5 A;  1LK5 A;  3GJS B;  3KJN B;  3EYZ A;  3H90 A;  3EE3 A;  2C28 A;  2DIS A;  4IRC A;  3IC1 A;  3ZZZ A;  4ICL B;  2MKH A;  1FTC A;  4JI6 J;  3C16 B;  1Y9O A;  4FXV A;  1DTQ B;  1TKZ B;  3LA0 A;  1DLO A;  5CA5 A;  3SCI E;  1T9U A;  3QRQ A;  4L73 A;  4USK A;  2R7V A;  3UR0 A;  4OHY A;  2F4V F;  3IMQ J;  4OYA A;  3GIM A;  4JV5 J;  2BJ8 A;  1D3W A;  2OTL S;  1HQA A;  3TZW A;  1WOR A;  5ADZ A;  1TU0 B;  3VAJ A;  2IHR 1;  4GMK A;  4GRS A;  5A6P A;  3T1H J;  5B0A A;  4K4W A;  1HNX F;  1SL0 A;  1K0T A;  3QWU A;  1X4C A;  1H7W A;  1LW2 B;  3CT9 A;  3E51 A;  5IJS A;  4LF7 F;  3LGN A;  4B3S J;  4X62 J;  2XSF A;  3JS9 A;  4PG4 A;  3J7Y U;  2FY8 A;  1SC4 B;  2NSC A;  2KT3 A;  1KEK A;  3OR1 A;  3PKY A;  1YGY A;  5E3C A;  4QZV B;  3HSD A;  1RTD B;  4P2S A;  3AQP A;  4MAK A;  4OI1 A;  3RJM B;  3CD5 A;  4P73 A;  1RWW B;  4N77 A;  1NSK L;  3G71 S;  2DNP A;  1UPM B;  2J5A A;  3E3X A;  4AND A;  3NKM A;  3JSM B;  1SJ4 P;  4I7F B;  2GQ2 A;  2QSF A;  4UOH A;  3W5Y A;  2LLZ A;  3SV3 A;  1AUK A;  4RU2 A;  4IUF A;  3BR8 A;  1NAQ A;  2KL8 A;  1D8Y A;  1JLF A;  3I0S B;  2C2Z B;  3EZO A;  3A3N B;  3TI0 A;  2V8P A;  2R2T A;  1WC0 A;  3H5U A;  2OPS A;  1C1C B;  2C3M A;  2D9O A;  2ASY A;  4DR4 F;  4C8Z A;  2CNO B;  1F3F A;  4OYX A;  4U96 A;  1FWK A;  4B9N A;  1JLG A;  2HBR B;  2JX2 A;  3M32 A;  3V4I B;  2Q66 A;  3RR8 A;  1VQ9 S;  3MM7 A;  2NXN A;  5H1S V;  1WKL A;  3MEE A;  1Z1Z A;  2PSZ A;  4LF8 F;  1RHR B;  1BWE A;  5ETK A;  1KLN A;  2MQ8 A;  3L7P A;  1ZED A;  4UOP A;  4ZOS A;  4DUY F;  4IFV B;  4J9N A;  3CJR A;  3G2X A;  3T9N A;  4IQM A;  1KON A;  3RW7 A;  2MLY A;  1AT1 B;  1RWU A;  1L3T A;  3GV8 B;  3J7Z T;  5SUH A;  1E6V A;  3KK2 A;  1RAC B;  3M8Q B;  3GQC A;  4K4X A;  4B3M J;  4NXN F;  4DSF A;  4O44 A;  3DLE A;  3BDF A;  4I0W A;  4OJG A;  4DWI A;  5KG5 A;  2BW7 A;  2ZOG A;  3PDN A;  3TNV A;  1K7H A;  2V68 A;  3GON A;  1ELY A;  1LWF B;  2E7X A;  3D7S B;  4R25 A;  3M6V A;  2E9R X;  3TA1 A;  2UVU A;  1K8A T;  1ED8 A;  4ZVS B;  4V19 J;  4OZ0 A;  2M5Y A;  2KFN A;  1IKW A;  1IBC B;  1VMB A;  1FD8 A;  4DSL A;  4CDI A;  1X4D A;  3UR3 C;  4JI2 J;  3DRY A;  3VAF A;  2YY3 A;  1UFK A;  4BHQ A;  2E1M C;  4F4Y A;  1WG5 A;  4OHX A;  2RIL A;  4I68 A;  2FQQ B;  1VR6 A;  2BJ1 A;  4R8U A;  1B0T A;  4LR9 A;  4URQ U;  2ZD1 A;  3ENQ A;  5LSL A;  4Y3C A;  2FVR A;  3H5X A;  3IBC B;  3IBF B;  3WX8 A;  2BA9 A;  2W2O P;  3VVT A;  3QIP A;  2OHD A;  3ENA A;  3T19 A;  3SZZ A;  4CLW A;  2NZC A;  4DV7 J;  2DEI A;  4DR1 F;  2ZH2 A;  4MFB B;  4KGZ B;  3PFO A;  3PKM A;  4IH7 A;  5LIA A;  5CYQ A;  2BAN A;  1W2I A;  1TL7 B;  1IR2 A;  3IGV A;  5CAB A;  4LFB F;  1BQM A;  1T95 A;  3H42 A;  2OEL A;  2R7Q A;  2HND A;  3DOL B;  3VGV A;  5HI7 A;  4NRT A;  1Q4R A;  3Q83 A;  4ED8 A;  2EEY A;  3Q22 A;  2RQC A;  1LK7 A;  4WJB A;  2C2E A;  3PEH A;  3B78 A;  3MEG B;  5ITH A;  3UN3 A;  2QGF B;  2NPI A;  1TV6 B;  3QBC A;  5LMU F;  2DXF A;  3MAQ A;  2W8D A;  1ALH A;  4IG3 A;  2HMI B;  2C3P A;  2YVS A;  4BBY A;  4P74 A;  3VGU A;  4O23 A;  2HLU A;  1LWE A;  4C4W A;  3M8S A;  3P45 B;  2YWG A;  1U7L A;  1U1M A;  4Y2C A;  5H9F J;  3DU6 A;  5HLF B;  3ED4 A;  5IS2 A;  1VHI A;  5GMK a;  3CDE A;  1RHM B;  1RAJ A;  3CF5 Q;  4P9S A;  4TU7 A;  4OI3 A;  1Z2Z A;  4FYW B;  4RW6 B;  2VG6 B;  1QM9 A;  3TO8 A;  2KVQ E;  2GSO A;  3W66 A;  1SL1 A;  1D9A A;  3OHB A;  3HZE A;  2NLW A;  5D0E A;  5D78 A;  1VQL S;  1XNR F;  4Q8F A;  2V2Q A;  2LP4 A;  5A2Q U;  2W5R A;  3GG0 A;  5D4P A;  1XER A;  5KFU A;  5F3T A;  1S97 A;  1HW9 A;  2QA1 A;  2MXY A;  4HLB A;  2V6A A;  4N7T A;  3RZA A;  4HHJ A;  4LBI A;  3H5S A;  3NBP B;  3E01 B;  4OQJ A;  3PYF A;  1RHU B;  1I5O B;  2ZJQ Q;  3W8G A;  1T03 A;  3J7Z 5;  2DGV A;  1S6Q B;  2EBE A;  2WSF C;  2W5V A;  1CS4 B;  4KHM A;  4ZCL A;  1CJU B;  5KFC A;  2RHQ B;  2UUC F;  4WFB Q;  3AA9 A;  2MQM A;  1K44 A;  1RTJ B;  1BQX A;  4YDD B;  1YIT S;  3E2D A;  4DZD A;  3P4U B;  3M7V A;  2CG8 A;  2W9A A;  4JV1 A;  4JP8 A;  2P6T A;  4Q7A A;  2Z2Z A;  4QWC A;  3SSR A;  2MQL A;  4C8L A;  1RU1 A;  1BHN A;  1S12 A;  3BM7 A;  1NDK A;  4QBU A;  1DZ5 A;  1CPZ A;  3ITH A;  2QMX A;  1ANI A;  4ZN3 A;  2ZH3 A;  4EBC A;  3AA8 A;  2QLJ B;  3KKF A;  5I42 B;  2Y9H A;  1OJ4 A;  1AZS A;  4FYD A;  1I94 J;  2CQP A;  4MJK A;  1RT4 A;  3MUV P;  2V8H A;  2W2Q P;  5L0E A;  3B82 A;  4B3O A;  4WKY A;  4M95 A;  4LT6 A;  3M8W A;  2MKC A;  4O3R A;  1DRZ A;  3R8Y A;  3FBE A;  3FBF A;  1DAX A;  3LP0 B;  2RDJ A;  2XYH B;  4NZ0 A;  2XM3 A;  4M5I A;  1S9E B;  1XBW A;  3BGO P;  1FRM A;  1FEE A;  1D1U A;  2WSC C;  5CQG A;  1JNR B;  4YY3 J;  2J6T A;  2Y0S D;  2DR5 A;  4CO1 A;  1X4A A;  1NZA A;  3FMW A;  4NCB A;  3X1L B;  2NRE A;  2UUA J;  4CO5 A;  4DF4 A;  3FNN A;  4UOO A;  5HQM A;  2VPW B;  4PXB A;  3MGJ A;  4ZLJ A;  4ECT A;  2G1H A;  5INH A;  3KJF B;  1SL2 A;  1JLA B;  2HKE A;  4NYZ A;  1REV B;  4O0N A;  4AE5 A;  2Y1L B;  4DR5 J;  3V4M A;  4L3K A;  2ZOF A;  4L74 A;  4KAV A;  4ALZ A;  5L1J A;  2Y8W A;  4RW4 A;  3U1L A;  3H59 A;  1X9S A;  2CIM A;  5AT1 B;  2B9E A;  1HBO A;  2RUG A;  4CZC A;  3QT7 A;  3VVU A;  1KRP A;  3W60 A;  1F5B A;  3GPA A;  3WAV A;  2HNY A;  2DKO B;  2OGU A;  5ETS A;  2UXB F;  4PUO B;  1TP7 A;  3AAW B;  5GAG I;  1VHF A;  1CUL A;  3CB4 A;  5M2R A;  3SQG B;  3TYT A;  2HGM A;  4CP5 A;  2GFF A;  4IOA Q;  2JVR A;  4GTZ A;  4WF9 Q;  1C2P A;  2ZH5 A;  4IFY B;  3IG1 A;  1SKR A;  3PZP A;  2HSE B;  1FVQ A;  2MZJ A;  4M5D A;  3CXC R;  3A12 A;  2N7C A;  3ZZR A;  1KHW A;  3ELH A;  1RAB B;  2VC1 A;  4DPT A;  2JFD A;  3BGR A;  4QW9 A;  4OYM A;  3KUG A;  1X0F A;  1G7C B;  2EFQ A;  3ZTS A;  2F65 A;  2RKI A;  2N82 B;  1WEX A;  2K1R A;  1XTZ A;  1TEL A;  1FE4 A;  2FHJ D;  5C42 B;  3UVJ A;  3KUH A;  2H65 B;  4CO0 A;  1HR0 J;  4DPO A;  3PV8 A;  2CQ0 A;  1ZYQ A;  4CH7 A;  3CCE S;  2X98 A;  4DSJ A;  2MYF A;  1CJV A;  1JJ2 R;  2VBY A;  3MR2 A;  3K5P A;  1PGZ A;  1ZAX A;  1GXT A;  1PSD A;  4FPI A;  5HO4 A;  3OFG A;  2GV1 A;  1N0V C;  2KXN B;  2AQ4 A;  1RAG B;  2B5J B;  5G4D A;  2OD4 A;  3FZB A;  5D8H B;  2IYG A;  1FJ7 A;  3AOB A;  4GVL A;  3OL9 A;  4A8O A;  3JXO A;  5ETN A;  1WTB A;  1VLY A;  2XZT B;  4K7Q A;  2FJA B;  1NND A;  2DNZ A;  3EJM A;  2HVD A;  2RT3 A;  7FD1 A;  5HAO A;  3IR6 B;  1TFW A;  3K89 A;  3PJW A;  1SIZ A;  2WB4 A;  2IC3 A;  3FKB A;  1SXL A;  3DDI A;  4ZKA A;  2FC8 A;  1M5K C;  4ZG9 A;  2J8A A;  4QYZ K;  4LRA A;  1SHQ A;  3SDE B;  3M2U B;  2P2C B;  4U8Y A;  5A0Y B;  4OX9 F;  2YKP A;  2YWK A;  4NLQ A;  3RYL A;  1NK6 A;  3B6B A;  4K4Y A;  2KT2 A;  2ZKU A;  2IY5 B;  1DJ0 A;  5C2C A;  2DNN A;  3NXZ A;  4QU7 A;  2BVZ A;  2RQ4 A;  2E5H A;  2M4M A;  2Z58 B;  5AE3 A;  1XMB A;  3HVT A;  4ZMM A;  1IJF B;  2CPX A;  1GT8 A;  3S1T A;  4KRW A;  3QYY A;  2ZC4 A;  5J2M A;  3ONQ A;  1XR5 A;  1XQI A;  3U1N A;  4ILL A;  2EFV A;  4NCA A;  2P5V A;  1FDB A;  4A8Y A;  1KH9 A;  3BKT A;  3CCZ A;  1CQN A;  1S9G B;  2V34 A;  4FXW A;  3DU5 A;  2GML A;  4I4B A;  5KG2 A;  3TJ8 A;  2E9Z A;  2BDP A;  4MIB A;  4NML A;  1Y7P A;  2GGP A;  3QSI A;  4YR1 A;  1EI6 A;  2QE5 A;  2F5G A;  2VOD A;  3DN9 A;  3W8P A;  1U49 A;  4Y2M A;  2MQQ A;  1KS2 A;  5T7L A;  5IWA F;  4DZ6 A;  3LWL A;  3N6L A;  1E3C P;  4RZR A;  3VTI A;  1RT7 B;  1Q8B A;  5J1N A;  1Q5V A;  1LV5 A;  3I9V 9;  1JMT A;  2PA8 D;  1JKH A;  2W1B A;  1TAQ A;  3FUY A;  5EWG A;  1R0A A;  2CAJ A;  4PZV A;  1S0M A;  1IR1 A;  5J2P B;  3DLG B;  3HHL D;  4HEA 9;  2IMW P;  1U2R A;  3MAA B;  4QIV A;  1FTR A;  1BQN A;  3N5B A;  1OIA A;  1QTN B;  2HYI B;  2E1P A;  2LXI A;  3LAN A;  1MRO A;  1T9W A;  1F0X A;  1YVF A;  5CCL A;  4PYD A;  2DNM A;  2GQC A;  2Z2L A;  5FLX U;  3CCV S;  1UEU A;  4KAI A;  1P9Q C;  5J1E A;  3IR5 B;  1VQN S;  4DCP B;  3TQE A;  2XNQ A;  1O8B A;  4CWB A;  3IWX A;  5KG3 A;  2GC8 A;  1R8B A;  1S1V A;  2XLI A;  2CQ3 A;  2QO3 A;  4I56 A;  5CXT A;  4RNO A;  1S1X B;  1JNZ B;  4NCG A;  4PXC A;  1T05 B;  1U1K A;  4J9L A;  5LRN A;  4JI8 J;  1OY6 A;  4HDG A;  2ILY A;  4PWD A;  4X65 F;  1NJI T;  2DYA A;  3T01 A;  4IO1 A;  3Q8P B;  4LIW A;  1IQT A;  2CPD A;  3I4P A;  5DM7 Q;  4G3I A;  4R5P A;  2K8G A;  2O5D A;  2KZM A;  1T02 A;  2MHN A;  2DXE A;  2LA6 A;  2V4R A;  8AT1 B;  1HKA A;  2B8Q A;  1HDH A;  3HHL A;  1AXQ A;  3CD0 A;  2V9W A;  1NO8 A;  5GME A;  2GHW A;  4QWD A;  3POT B;  3P3D A;  4J9R A;  2HAF A;  4MK8 A;  2XQC A;  5GVQ A;  3R5G A;  1JK9 B;  1F2G A;  2VB6 A;  1LQ9 A;  2OO4 A;  1IBL J;  1IQZ A;  3EVW A;  3L4B C;  5C25 B;  3IR7 B;  2GIQ A;  2B6A B;  2V8V A;  4ICL A;  2EW9 A;  1FRX A;  4NWB A;  3C16 A;  3ISZ A;  3UN2 A;  1PIE A;  3NMR A;  1DTQ A;  1TKZ A;  3SSS A;  3GII A;  1WOP A;  2PEB A;  3UN5 A;  1VIX A;  2ZH1 A;  4LRE A;  3R5B A;  2UXC J;  1HBU B;  2XMW A;  2RH3 A;  2KJV A;  1WTF A;  2DHA A;  2XMK A;  4A46 A;  2LEA A;  4AXI A;  4CM2 A;  2NYI A;  3VV2 B;  2PN6 A;  1LW2 A;  3Q3Q A;  3RAM A;  1HFE L;  5KFY A;  1CC7 A;  5C24 B;  3CWJ A;  2D69 A;  1XC9 A;  1IKY B;  3DGV A;  4C98 A;  5LSR A;  1H2T Z;  1N2K A;  4KFB B;  2DTJ A;  2I1R A;  4J7C A;  3HP6 A;  1IR0 A;  1RTD A;  2RH6 A;  3TW0 A;  4J5O A;  4CXU A;  2DY1 A;  2G0C A;  4KGV B;  1UW4 A;  2OMO A;  5JXS A;  3NGD A;  4QWA A;  3JTN A;  2XG8 A;  1RA7 A;  3I6P A;  3ZTR A;  4C8Y A;  2AGO A;  1S1T B;  3JSM A;  4I7F A;  2XI2 A;  1T7P A;  1N56 A;  4JYA J;  3AOC A;  2DT9 A;  4DL0 C;  5B08 A;  2R8K A;  3I0S A;  1WC3 A;  2PII A;  1RHQ B;  4EGL A;  2I0X A;  2FTR A;  2AJ4 A;  3K58 A;  2R3V A;  4CLU A;  4DQP A;  1R8A A;  3DOK B;  2D3O R;  3M6U A;  3BDP A;  5E3R A;  1RWM B;  3OBI A;  2JLF A;  3RB6 A;  1J2V A;  1Q79 A;  2AZ1 A;  3FEY B;  2XTJ P;  3FK4 A;  1MWY A;  5KFW A;  2E1A A;  3V4I A;  4LF4 F;  3A3P B;  4ITS A;  4TY8 B;  3QJL A;  1HNZ J;  4UW2 A;  4C3M A;  1KH7 A;  4X64 F;  2GLQ A;  4PAB A;  4X4Q A;  3UCU P;  1TKT B;  4OZJ A;  2FZG B;  3NNC A;  4WPA A;  4DV1 J;  4UOF A;  5IT9 Y;  4B9V A;  1ZTW A;  4O4G B;  5DG8 A;  2RRA A;  5E3A A;  2CQ4 A;  4FDI A;  3ADA C;  4DV2 F;  2YQ3 A;  4C0B A;  1EW8 A;  1SJ1 A;  1UW9 A;  3BYR A;  4LF1 A;  3I5A A;  4C2M A;  3JSY A;  4CYS A;  3FBB A;  2CQB A;  1EB0 A;  2NXE A;  3GFY A;  2IM2 A;  3M8Q A;  3J80 U;  2B0G A;  3A8K A;  4OIX A;  4WE1 A;  2FIU A;  2C2N A;  3PW5 A;  2WHO A;  1D9F A;  1MN9 A;  4QR2 A;  4ZIV A;  1KOO A;  4ED6 A;  3KHG A;  2R2R A;  4ZPT R;  3P5T L;  1C0U B;  1DQ9 A;  3CCQ S;  1MWQ A;  4M5N A;  1QAI A;  1LWF A;  2L9N A;  2CWK A;  4CI0 B;  1LEO A;  3I96 A;  4UUW A;  4ZIT A;  1F2H A;  2XEX A;  3UD4 P;  4EBE A;  2HZV A;  2IBO A;  4J9U E;  2M88 A;  4O3Q A;  1S10 A;  3K17 A;  1XMQ F;  2IIH A;  3TA2 A;  2MB0 B;  4DSK A;  3DLH A;  2CQC A;  1OSC A;  1UKU A;  2H51 B;  3Q89 A;  1L3U A;  3IAS 9;  2NZ4 A;  1O5J A;  2RU9 A;  4W4M A;  2FDN A;  3QT8 A;  4C0O C;  2OPP B;  2AYG A;  2PDA A;  3AQO A;  4F3Q A;  2CKW A;  1NHV A;  3W64 A;  3HHL C;  4DJB A;  2CVI A;  3D1H A;  2OPR B;  2JSX A;  5I3Q A;  1U02 A;  4JI0 J;  4MFB A;  3OFE A;  1FKO B;  3JAM Y;  4DR6 F;  1LKZ A;  3T1A A;  4DR2 J;  3HFK A;  2GQQ A;  4B9U A;  1KC8 T;  4B02 A;  2CJY B;  1WUU A;  1TL7 A;  4F4W A;  3L95 X;  1R8P A;  3ET6 B;  2AGQ A;  3FSX A;  3LP2 B;  1PYO B;  1F9E B;  3SZY A;  4CNZ A;  4ECX A;  5H9E K;  1T9Y A;  3OLA A;  3BGL A;  4C6A A;  2C2R A;  2ERR A;  1CVJ A;  2R7U A;  4NLG A;  1VRQ C;  1MMD A;  2HQG A;  3DOL A;  1L5U A;  4H4M B;  2YNG B;  2A10 A;  2VD3 A;  1HWI A;  3C15 A;  4MIV A;  4ZJO A;  3Q8Q B;  3KWM A;  3MEG A;  3A13 A;  1S59 A;  2KM8 B;  2A2D A;  1IWG A;  2XBP A;  5K5M A;  2IFY A;  4OYB A;  4P75 A;  1TV6 A;  3NEK A;  2CWX A;  1I6J A;  2HMI A;  4M1K A;  3ZFV A;  3K5M A;  3QWP A;  3RU0 A;  3ZZU A;  2ZNY A;  3WDO A;  2AD9 A;  4IH5 A;  1JLQ B;  3R7N B;  3KLE B;  5HLF A;  2DIV A;  4F02 A;  4DU8 A;  1OMS A;  1RLC L;  4KH0 B;  5JMN A;  1SQE A;  2YTC A;  4PRF A;  3PHT A;  2CNK B;  3RW6 A;  3NS5 A;  2A3J A;  1FA0 A;  4RW6 A;  5IZH A;  2WVC A;  4XK8 C;  2VG6 A;  4HKQ A;  4KJD A;  4YR0 A;  2DRB A;  4MKV A;  1NK9 A;  2DIU A;  2VFR A;  3KNG A;  4U95 A;  4C8K A;  2NQP A;  3QPI A;  1U6Z A;  2GO8 A;  3AD8 C;  4MIA A;  4Y0F A;  3HI9 A;  5HK4 A;  3FSY A;  3TAN A;  3K5O A;  2E5J A;  1S1W A;  1HNW J;  2XB2 D;  1RE1 B;  1M5O C;  3EGW B;  4UUX A;  1FE0 A;  2VZ9 A;  2KVI A;  4KTQ A;  4M94 A;  1URR A;  4LSN B;  2FVS A;  3NBP A;  3E01 A;  4WBF A;  4AL5 A;  5KFB A;  3K7R A;  1LXN A;  4RUB A;  3DCA A;  3BBB A;  1S6Q A;  1BXN A;  1CS4 A;  3KLF B;  1AW0 A;  1CJU A;  1CBK A;  4DCJ B;  4B9L A;  2LEC A;  5LMN F;  2ZH4 A;  1RTJ A;  5F8M A;  1PIL A;  4ANE A;  4N41 A;  5KAK A;  3V6H A;  4WKR A;  1YX2 A;  4RW8 B;  4LIR A;  1Y4Z B;  1K1S A;  2IDL A;  3WQP A;  5JVH Q;  2OLW A;  2X3G A;  4Y2I A;  1V6H A;  1RT5 B;  3C8Y A;  1L3V A;  2E1C A;  4WFX A;  1T9T A;  2ZEJ A;  4Y28 C;  2K7J A;  3D6T B;  3P49 B;  4NX9 A;  1S1U B;  1U24 A;  3BBF A;  1KQG B;  2MKK A;  4CO2 A;  1QLN A;  1A9N B;  1B99 A;  5I42 A;  1NH7 A;  4KT0 C;  3SCK E;  2DHG A;  2RQM A;  5K4P A;  1JLE B;  5A8K B;  1N32 F;  3O1L A;  5ETL A;  3OSP A;  3ULH A;  2KG1 A;  1YRU A;  1G1X A;  2WK4 A;  4F0M A;  2UXD J;  4ZG7 A;  1GMW A;  1QE1 B;  3F0N A;  4CTA B;  2AJQ A;  3JSB A;  4ZP7 A;  2CPY A;  4EO8 A;  5KOW A;  3I9Z A;  3LP0 A;  4IG0 B;  4RUC A;  1X5O A;  2WVB A;  1W25 A;  2Q43 A;  3ZZP A;  3I5B A;  3RAQ A;  1Q0N A;  2E9T A;  3CE8 A;  1S9E A;  1ELZ A;  2HWH A;  3OLB A;  2QRR A;  3OL7 A;  4TVA B;  1WC5 A;  3WBZ A;  1RB0 A;  4IDK B;  2F4V J;  2DB1 A;  2H3E B;  2DNY A;  4NWJ A;  2DNO A;  3RR7 A;  3GJR B;  5L8R C;  2HHX A;  3PW7 A;  4KHP F;  4DFM A;  1RWP B;  3LF0 A;  3VAL A;  4MKY A;  1XMO F;  3OSN A;  1JLA A;  1HI0 P;  1REV A;  2Q79 A;  4K0K F;  1B4S A;  5ETT A;  2GNK A;  1V5V A;  5HBM B;  2RRN A;  2FJB B;  2DCL A;  2Y1R I;  4DX7 A;  1NB2 A;  2HRU A;  3QSY B;  4NA3 A;  2FPH X;  3R9L A;  3FVY A;  3RB4 A;  1ZM9 A;  2EFG A;  3W61 A;  2QYG A;  2KT5 A;  2DIT A;  4OHV A;  2HHU A;  4D3H A;  4OV1 A;  3M8P B;  3DRS B;  4PUO A;  4KBI A;  2RU3 A;  5L9X A;  2DH7 A;  5G0R B;  3SQG A;  2CPF A;  4K4U A;  3TJ9 A;  1S77 D;  2HGL A;  2B7B B;  3T5J A;  1FJG F;  3QGP A;  4QIG A;  1F9H A;  3G86 A;  2XLK A;  2EVZ A;  2VQF F;  3TJA A;  4IFY A;  4CNY A;  3US5 A;  1WJ9 A;  4X66 J;  3W9H A;  2QL5 B;  4AD6 A;  1JB0 C;  2VAS A;  4NZ6 A;  5HQL A;  3T1Y J;  1YZ6 A;  4JI5 F;  4NE9 C;  2H5J B;  2YWH A;  1ELX A;  2R7X A;  3VQT A;  4DR4 J;  1RAO A;  1ZPV A;  3BPS P;  3D3B J;  2EKY A;  2VPZ B;  2QFI A;  4EEY A;  5D6G A;  5B0F A;  3I0R B;  1HI8 A;  1JXE A;  3VWS A;  1NZ8 A;  1MMN A;  2FHO B;  1IWA A;  2KKH A;  4AL6 A;  4N76 A;  4DV4 J;  4LF9 F;  1D0E A;  1S6O A;  2E7V A;  4FS2 A;  1DTT B;  1CQM A;  1ZPW X;  4HTI A;  4B3T F;  2CJX B;  2QC3 A;  1RQ0 A;  3IP0 A;  5C42 A;  2CUY A;  4LF8 J;  1OPZ A;  2ZH6 A;  5AE2 A;  4O3N A;  4G1P A;  1PKU A;  3GV7 B;  3ZTQ A;  3A1Y G;  1FNX H;  1X4F A;  2C2K B;  4DUY J;  3BSO A;  4H54 A;  3OTB A;  2UUB J;  4RKU C;  2AU0 A;  2QLX A;  2HZC A;  4NA1 A;  5CAA A;  4HT5 A;  4PR6 A;  4QIW D;  2YKM B;  1X5T A;  4DOZ A;  3KMQ A;  1NH8 A;  2B5J A;  3KDO A;  5KFJ A;  5GAH I;  5DZ7 A;  4NXN J;  1RT3 B;  3CJ5 A;  1VRT A;  1WAC A;  4OX7 A;  1RTH A;  4W98 A;  4AYB D;  3BSC A;  2FJW A;  4UPL A;  3GCX P;  3OT9 A;  1RT6 B;  4YB1 P;  4NZ7 A;  4TYA A;  3MTJ A;  1RCO B;  4GVB B;  3BV8 A;  3D0H E;  1A7G E;  3D67 A;  4PG8 A;  4IO9 Q;  2JEJ A;  2I8E A;  1RTI B;  3MI7 X;  1N5S A;  2LQ8 A;  3BN4 A;  2PC6 A;  4U9R A;  4NI2 B;  4P2M A;  4DCO B;  1KQS R;  4N8O A;  1S99 A;  4I2P B;  4WFY A;  1QSL A;  5DLT A;  4QAX A;  3DHW C;  3HT0 A;  2YKO A;  2XSJ B;  3SDE A;  3CME S;  3M2U A;  4P7T A;  4FF4 A;  1FWP A;  3BPD A;  1KHK A;  2YBV A;  4LF5 J;  2WAQ D;  5A0Y A;  4JI6 F;  1V3R A;  5EN1 A;  3UCZ P;  2W5X A;  4YN3 B;  3S8S A;  2F40 A;  3AH6 A;  4ZIW A;  3D5M A;  3DHX A;  4W90 B;  1N0U A;  2KJW A;  4XIU A;  4ZCM A;  1SC1 B;  3EPG A;  4DV3 F;  4OYO A;  4CH0 S;  3MK2 A;  4LRB A;  4DHV A;  4HTJ A;  5E3P A;  4EK2 A;  1N33 J;  5F8L A;  3MUM P;  3SIP B;  4GKJ J;  1BE4 A;  3H40 A;  4OZ3 A;  4PQU B;  1RYR A;  1SKW A;  1YHQ S;  1F9F A;  2ASD A;  2FJE B;  4ILR A;  4LFB J;  3DNC A;  4N5S A;  4G65 A;  3MK0 A;  1KTV A;  3LAL A;  4KY3 A;  4B3S F;  2R7S A;  3PR5 B;  2ANH A;  3D6F B;  1VC6 A;  2VQE J;  2VA2 A;  4F50 A;  5J2N B;  1S9G A;  4PYA A;  2J9E A;  2GHP A;  5GAE I;  4WWS A;  1AJD A;  3QGI A;  2RUS A;  4QYZ J;  2KRR A;  3J81 Y;  2D74 B;  1Q81 T;  1HI1 A;  2D9P A;  5IM0 A;  1R31 A;  3HSJ A;  3TZZ A;  2P9G A;  1Y00 A;  3AXM A;  2E44 A;  1KKH A;  1QSY A;  4ED2 A;  4P71 A;  3NP5 A;  2XCP A;  3HFZ B;  4PPD A;  2QZU A;  2WCX A;  5LMU J;  3L7U A;  3DFE A;  2A18 A;  2AZ3 A;  1RAI B;  1I51 B;  2EK6 A;  5LL6 d;  4KHR A;  5BR8 F;  1RT7 A;  3QGG A;  3QMQ A;  2DNL A;  3G8S A;  5KFN A;  3VHQ A;  3O6Q A;  4ECY A;  1O51 A;  3LOU A;  5E3Q A;  5FDL B;  2VG5 B;  2FGO A;  4WTY A;  4ES1 A;  1WHY A;  2G1D A;  5J2P A;  3D28 A;  3DLG A;  3K8W A;  4N8N A;  2JOQ A;  1JJC B;  3MAA A;  1K47 A;  1DQ8 A;  3T6J A;  4OYP A;  3DYC A;  2PI4 A;  3VR1 A;  4PQA A;  2B9Y A;  3BZQ A;  2VIC A;  1Y5L B;  4ZPB A;  4ES3 A;  1I1G A;  3KLH B;  4QYR A;  4CO4 A;  5KFM A;  3CCJ S;  1PJ7 A;  1FF2 A;  1ZZF A;  4RL1 A;  3DLL Q;  3G8T A;  5IOL A;  2H9Z A;  4C3K A;  3EX7 B;  1NUE A;  3ZTO A;  4AQY F;  4WYL A;  4OZ2 A;  3HDS A;  1T05 A;  2AJF E;  4K50 A;  1QDU B;  3HUL A;  2O01 C;  2XMJ A;  5C66 A;  2D41 A;  1JWW A;  2Y1J A;  3GZ7 A;  1HBN B;  2OKQ A;  2GW8 A;  3D4J A;  2EXU A;  4JI1 J;  2D1C A;  2MZR A;  1NM2 A;  4G1I A;  3UCG A;  1VOM A;  1ZM3 A;  1YBA A;  2ASJ A;  4NLW A;  1WHW A;  2X1F A;  1GQE A;  3TX8 A;  3MK1 A;  1HPZ B;  3M6W A;  4MYU A;  2JEI A;  2HK2 A;  3BBC A;  4PWW A;  2XGP A;  1ZOT A;  3POT A;  3GFZ A;  3CTR A;  2W4P A;  5C2G A;  2XO7 A;  3FRY A;  1P9Y A;  3N01 A;  2Z56 B;  1N5Y B;  5F3Z A;  1BGX T;  5KT6 A;  5DQH A;  4OZ5 A;  5DGB A;  5C25 A;  3Q0A A;  4ZJQ A;  4JI2 F;  2B6A A;  4P10 A;  1R8H A;  1VQY A;  5CH7 B;  3CJ0 A;  4LVN P;  3FQL A;  4GKK F;  4CO3 A;  1VGY A;  5K14 B;  2A0F B;  1H2U X;  2XO6 A;  2OH2 A;  3VAM A;  2Z0G A;  2L48 A;  2OPQ B;  1U1N A;  2C3U A;  3AJ2 A;  2J0S D;  1BWV A;  1SH0 A;  1S76 D;  2J9D E;  2XZW A;  1HBU A;  3FZ2 A;  1Q16 B;  4DV7 F;  2CQ1 A;  3DOM B;  1HD1 A;  4BS2 A;  3CDB A;  5DQG A;  3MCO A;  4QCL A;  1SIW B;  5IV4 A;  1VRU B;  2ZKT A;  4RBU A;  2MJU A;  1YWX A;  1GTH A;  4HVZ A;  5C24 A;  1IKY A;  4FVM A;  1YJU A;  5I3U B;  2AV5 A;  4KFB A;  1RHJ B;  4PG6 A;  2ALZ A;  1QAX A;  4TLQ A;  3NOG A;  3GR1 A;  3VQS A;  3CCU S;  2L9D A;  3HK2 A;  2W2N P;  4L76 A;  3D66 A;  1WOO A;  1GNK A;  5LXY A;  3OFH A;  4NRU A;  3NL0 A;  2DGS A;  4V1A k;  1S1T A;  2B3T B;  4LQ3 A;  2VH7 A;  4WU3 A;  5BYS A;  3CIZ A;  3W5Z A;  3TVK A;  1RTZ A;  4USH A;  4MYT A;  2NXJ A;  3N0V A;  5IC4 B;  2J0W A;  4DDF A;  4JI3 J;  2N7Y A;  5EGE A;  2UXB J;  4C9D A;  2G0J A;  3DOK A;  3N9U C;  2GMJ A;  1UZH A;  5F8N A;  2J9C A;  4A47 A;  2PI5 A;  4A8K A;  1C1B B;  3FJ2 A;  1UVJ A;  2R9L A;  1RT2 B;  4WFZ A;  4DV6 F;  1UVI A;  4LF2 A;  2CDR B;  2JC0 A;  4C0H A;  1W7W A;  4TY8 A;  3NGT A;  2HW3 A;  4R0E A;  3ZZY A;  2BAC A;  3G82 B;  3ILI A;  3F73 A;  2W9B B;  3KNA A;  1TKT A;  3C66 A;  5KT7 A;  3BO3 A;  3QO9 B;  2IRU A;  4O4G A;  1O99 A;  4K4T A;  3K5L A;  2LVW A;  2K3K A;  2HFV A;  2XC9 A;  2BM0 A;  4B3R F;  2DGO A;  4QIE A;  4RW9 B;  2VFV A;  3MF5 A;  4EO6 A;  3OL8 A;  3BGF A;  1FER A;  2M9K A;  1X0P A;  2ZOM A;  2RDI A;  3ENW A;  4GTY A;  4U7U D;  2BV3 A;  2F4F A;  5HVF A;  1IKX B;  4I67 A;  4K5R A;  2XUL A;  1AJC A;  3CMR A;  4Y2A A;  3O2I A;  2YX4 A;  1KHN A;  5FJ4 A;  1XWL A;  5KFO A;  3DRX A;  4Q43 A;  1YJV A;  2FD2 A;  4E98 A;  2HIQ A;  4RUA A;  3U02 A;  1C0U A;  1FDA A;  3MPY A;  4OX6 A;  5L1L A;  1PJ5 A;  1M5S A;  3TUZ C;  1Z4U A;  2RNE A;  4RX6 A;  2BMB A;  1X4G A;  5D15 A;  2KU7 A;  4G1Q B;  1V3S A;  1P8G A;  3BDH A;  1YG0 A;  5KFH A;  3TG0 A;  1RK8 A;  2EK1 A;  2BXJ A;  3WC2 A;  1VIS A;  4TLR A;  4ECV A;  3MM6 B;  1JJ4 A;  1I94 F;  5E5N A;  1P1T A;  1HBM B;  1VI7 A;  2DO0 A;  3R27 A;  1J27 A;  2OPP A;  5KFR A;  5HN0 A;  2DVI A;  1XR6 A;  1SJF A;  2OPR A;  3PXG a;  1KTQ A;  1FKO A;  1TZ0 A;  3R6G B;  4F2R A;  2GZO A;  5KFV A;  3K5N A;  1VQO S;  2BOA A;  5D77 A;  3ET6 A;  4YY3 F;  3LP2 A;  2FLN A;  2CJB A;  1WHV A;  3VGS A;  5D3G B;  1VK3 A;  4ZCI A;  3W63 A;  2RD5 C;  4F3O A;  3R2D J;  4RBV A;  1QUP A;  2W8L A;  3KHL A;  3KK1 B;  2AEJ A;  2GSN A;  3MFH A;  4Q44 A;  4H4M A;  2YNG A;  4KKO B;  3D9B A;  1NPP A;  3A3O B;  2F9D A;  3H98 A;  3HO1 A;  3GV5 B;  5KT3 A;  4DR5 F;  4DG1 B;  3DRR A;  1KQF B;  3FFI B;  1AA1 B;  2LU1 A;  3R7S B;  1V3Z A;  2XI3 A;  1C4A A;  5GAH U;  1GXU A;  1HHS A;  1E2S P;  3KJV B;  2MTL A;  1VBX A;  3QAU A;  2FY1 A;  4ZCK A;  1OY9 A;  4YDX A;  2U1A A;  2XMU A;  3C14 B;  1JLQ A;  3TOQ A;  3KLE A;  4A4J A;  3SFG A;  4QW8 A;  3OJS A;  2FLP A;  2FJX A;  1NK4 A;  4USV A;  2XHC A;  2F63 A;  3NAI A;  3IGY B;  5H9E J;  3GG1 A;  1RLD A;  2Q1L A;  4PPZ A;  3H0P A;  1U1P A;  4TNO A;  3NWR A;  2BR0 A;  3O5T B;  4Q2M A;  3UDV A;  1U47 A;  2J7K A;  5DZ6 A;  2ZNZ A;  2VFS A;  4X4R A;  1K0V A;  2R7R A;  2GX8 A;  4QR0 A;  1WWH A;  4ZPC A;  2J7W A;  2WSE C;  1EQJ A;  1YJ9 S;  3AD7 C;  3CCW A;  4ATN A;  3QJP A;  1KSP A;  4ELU A;  4DSI A;  4LRD A;  2NUH A;  5DLW A;  2KHC A;  2UV8 A;  1EQ0 A;  4LSN A;  5IT9 U;  3PEJ A;  2Z57 B;  1FJC A;  3RB0 A;  1EP4 B;  4CLK A;  2R8I A;  2ZJR Q;  2N4C A;  1HNV B;  2HFS A;  1NKC A;  2P9E A;  2VL1 A;  3GFX A;  4HAC B;  1FXL A;  1QAY A;  4XDD A;  4OI6 A;  4LRC A;  4EYI B;  2G2Z A;  4O3P A;  4EFA C;  1XIQ A;  3OXG A;  1V5I B;  1N8R T;  1FRH A;  3IWN C;  4J9Q A;  1H6K X;  4RW8 A;  1NPR A;  2KYZ A;  2RHS B;  2HBY B;  1S49 A;  5GAE U;  1SB6 A;  1RT5 A;  4V19 X;  1NDL A;  1CJT B;  4FZV A;  3W9J A;  2I38 A;  4UZB A;  5D0R A;  2DHS A;  2Y0B B;  3EXY A;  3D0I E;  1S1U A;  1I3O B;  1VQK S;  2EFN A;  5RUB A;  2XNR A;  4NXM J;  1WC6 A;  2EBG A;  2CPH A;  4DUT A;  4DR3 F;  3HKZ D;  2R2S A;  2NR0 A;  4ZVH A;  3PHE A;  1JLE A;  5A8K A;  4N56 A;  4OV6 A;  1TMJ A;  4URS A;  3KHR A;  4NLD A;  1QUV A;  3D1Q A;  3S01 A;  3IA0 A;  4PKD B;  3HSZ A;  2HZA A;  2DBB A;  3H2L A;  1QE1 A;  2KB2 A;  2VF3 A;  4CTA A;  1FRK A;  5KFT A;  2AP6 A;  9ATC B;  5IC6 B;  3LPE A;  3RRG A;  3SYZ A;  2AMC B;  4IG0 A;  3OVB A;  2Z2Y B;  2DGT A;  3PAC A;  2V67 A;  3NVL A;  3P5B P;  2CPI A;  1EIY B;  1NHK L;  2LEP A;  4X4P A;  3LP1 A;  1QSS A;  1MU2 B;  4CYU B;  4AT1 B;  1UWB B;  1FNO A;  3MOJ B;  4PG7 A;  3C3L A;  3JAM U;  2DR7 A;  4ES2 A;  1VBZ A;  2ZC3 A;  1RAA B;  5AXN A;  3MMJ A;  4IDK A;  2DRA A;  2FLO A;  2MEW A;  3MCM A;  2W5T A;  1WEL A;  3OPK A;  2GIF A;  5L1I A;  3RB3 A;  1LFP A;  2CAD A;  2M52 A;  1KHL A;  2ASL A;  3KOA A;  4OZL A;  5H9F K;  2H48 B;  1FRI A;  2HVE A;  1Q8L A;  2IM1 A;  3LQV A;  2DR9 A;  2RF2 B;  1KH4 A;  5HBM A;  2NPF A;  1Q1K A;  4IQX A;  4LSZ B;  3FCH A;  3C6U B;  1F3V A;  3T5L A;  4M8L A;  1IBK F;  1PC5 A;  2V4Q A;  4XTT A;  3W2W B;  2V8D A;  1XNQ F;  1YJN S;  3H2V E;  5BXI A;  1ZBT A;  3MCN A;  3EVO A;  1WHX A;  2QMU B;  4WU2 A;  2CRL A;  2FHM A;  4KGM A;  4IRK A;  4FKY A;  2RJZ A;  2QT7 A;  3M8P A;  3DRS A;  1PG5 B;  4RLE A;  1ALI A;  3MM8 B;  1BUX A;  4DS5 A;  5DDR C;  4P72 A;  2VA3 A;  5G0R A;  4RR5 A;  2ZZT A;  2HVZ A;  1FFS B;  4I6Y A;  1SPB P;  1TKX B;  4LSL B;  4IG3 B;  2KM8 C;  1M5P C;  3CJ3 A;  5KFK A;  3N4W A;  2I9S A;  2G9O A;  3WZ0 A;  1FFG B;  4NAS A;  4M5G A;  1AJA A;  1UJ6 A;  1U1L A;  4F8R A;  1N34 J;  2ADB A;  4BCA A;  4RBT A;  2KG0 A;  5EWF A;  1JQG A;  5I3P A;  4ELT A;  5IFM A;  2E5L F;  7AT1 B;  3SSQ A;  2BE9 B;  5DO2 A;  3ZZT A;  1OQ3 A;  3I0R A;  1UTA A;  4WFA Q;  4LF4 J;  1NSP A;  4M5J A;  1KLM B;  2QZ8 A;  3HXM A;  3I4H X;  4X64 J;  1DTT A;  4AXJ A;  4TKT A;  5SZT A;  2GVD B;  2ZHO A;  4U67 Q;  3BEG B;  3EDQ B;  2ZWO A;  1LWC B;  4MT1 A;  4NLV A;  2HRT A;  2IFX A;  2X3D A;  1F5C A;  1M1G A;  1U25 A;  3GCW P;  2AJ2 A;  2HQF A;  1HNI B;  4KJI A;  3RAX A;  3NKR A;  4K5S A;  2ADC A;  4OI0 A;  1AYE A;  1NEE A;  3NGS A;  4ED3 A;  1AUD A;  3J7Y I;  2YKM A;  2FC9 A;  2FUG 9;  3VGT A;  5A6W A;  1EQM A;  4M5M A;  4LFC F;  1DHM A;  1RT3 A;  3RTV A;  1HQU B;  2JJ4 D;  2PE8 A;  4LMZ A;  3AD9 C;  5LOQ A;  1RT6 A;  2NXU A;  1VS3 A;  1WG1 A;  2M2B A;  1KVI A;  3E8O A;  1NHU A;  4GVB A;  2XS5 A;  1RTI A;  2V8G A;  5HVH A;  3QFW A;  4ZS6 A;  2QV6 A;  1KHJ A;  4NI2 A;  3R5A A;  2RQK A;  4I2P A;  1KHV A;  3BQ0 A;  1RDR A;  1IBL F;  4FF2 A;  3BO4 A;  2K3I A;  3THV A;  3CO9 A;  1TL4 A;  3J7A N;  2FVP A;  1J5E F;  4EWT A;  1S0O A;  1OYD A;  1NRK A;  3P8B B;  1S0N A;  3T6B A;  3NKY A;  4OI4 A;  2JEF A;  3NGK A;  3L3C A;  1NB7 A;  2AHO B;  2V63 A;  1PAE X;  4IR1 A;  4TQS A;  2CJ9 A;  3CSK A;  3MR5 A;  3G6E S;  2PMZ D;  2HLT A;  2GVZ B;  5KFD A;  2B4U A;  3CJK B;  4DR6 J;  1L3K A;  4C8N A;  2IVF B;  4I2Q B;  1JIH A;  4PQU A;  1IBM F;  3A8E A;  2QLF B;  1URA A;  3N6N A;  2BZ2 A;  4M5L A;  5GAD U;  3CDA A;  4RU9 A;  1OY8 A;  4O4R A;  1SJ3 P;  2B4P A;  5J2N A;  2MJN A;  3ETO A;  1G6B A;  1DFD A;  3F41 A;  4AFF A;  2DH9 A;  3K59 A;  2BJE A;  4YHH F;  4DV0 F;  4F0K A;  4OHW A;  2H4Y B;  1FRL A;  4ZVG A;  3EM1 A;  1KD1 T;  2W5Q A;  2QFJ A;  2ZBI A;  2YNF B;  4DMZ A;  3IGN A;  2HEK A;  1T3O A;  2ZDO A;  1NBE B;  4OI2 A;  3EVM A;  4AL7 A;  3NMA A;  2DY9 A;  2BX6 A;  3AT1 B;  1YJT A;  3H4B A;  3LTO A;  2HNY B;  2EI5 A;  2KRB A;  3BKF A;  2B56 A;  4XDC A;  2YNI B;  1B3T A;  2IMO A;  1HHQ A;  5FDL A;  2VG5 A;  4UT4 A;  2W8K A;  3PY8 A;  5J2Q B;  2RB7 A;  5B0D A;  3A8I A;  3DYA B;  2VPX B;  2J7U A;  1TKD A;  4FDF A;  2GJ2 A;  1NKE A;  1VK8 A;  2O66 A;  3QID A;  2AT1 B;  1GX6 A;  4DQS A;  1B7Y B;  1UCN A;  4RNH A;  2PGC A;  4CRJ A;  1HNZ F;  2M7S A;  2GHV C;  2MST A;  5HVG A;  3KLH A;  1K73 T;  4A8X A;  1G4C A;  5F8G A;  1YIJ S;  1N5T A;  1EET B;  2C2O B;  2LYV A;  5KFE A;  4DV1 F;  4YUD A;  3TAM B;  2VQR A;  1T0T V;  2YWF A;  1WI6 A;  3KLG B;  2ZBC A;  3B8H A;  3VF0 B;  3CMA S;  1NK5 A;  4EMD A;  1RXO B;  1NPK A;  4KE5 A;  4LF6 F;  2H1Y A;  5E2Q A;  5LM7 E;  2W4D A;  1OYE A;  2VDI A;  3CIM A;  2IPO B;  4L6V 3;  3R97 A;  2WW4 A;  1HYS B;  2RS2 A;  1HBN A;  2U2F A;  2ZFH A;  5LMN J;  3M1V B;  3MEC B;  1WF2 A;  2OFG X;  4DL4 A;  1EHW A;  1U4B A;  4P7V A;  4Q45 A;  3MCS A;  3GR0 A;  3MTK A;  1H38 A;  1HPZ A;  4UOC A;  3NGU A;  5FII A;  5J1P A;  1UFL A;  3UDE A;  4KJG A;  3UFC X;  1RIS A;  2W2M P;  4LR2 A;  1N5Y A;  4WXW A;  2M8D B;  2PFF B;  5ETV A;  2CQ2 A;  4DR7 F;  5EWE A;  3MR3 A;  1ZEF A;  1IM6 A;  4U7C A;  2DCU B;  1TL1 B;  1N32 J;  5DRK A;  2LU2 A;  2PA3 A;  2Y1I A;  5K14 A;  3ICL A;  4P2X A;  1CSJ A;  2M3D A;  2MKJ A;  1H74 A;  3DGP B;  2CQD A;  3W1Y C;  1WOS A;  4TU8 A;  4ED0 A;  5L46 A;  3TAP A;  3KUE A;  2LXF A;  4LR7 A;  4LBP A;  2OPQ A;  3MPU B;  1VQ6 S;  4GC6 A;  5AE1 A;  2QJ3 A;  4TXS A;  1NK7 A;  2HHP A;  2QL7 B;  2QX0 A;  1VYA A;  1GAO A;  3DOM A;  2VG7 B;  4UTG A;  1OSD A;  3SFU A;  3O3L A;  5DDP C;  1ACM B;  3FCV A;  2V94 A;  5KFQ A;  1VRU A;  4NWX A;  4OFZ A;  4HDH A;  3VAG A;  4FF3 A;  2KTQ A;  4I6A A;  3GIL A;  2F1F A;  2ZIT A;  1FX4 A;  1IM4 A;  4LQ9 A;  2VON A;  5I3U A;  1UVN A;  2FLL A;  3CNQ P;  4KHP J;  4NYP A;  3S6E A;  4IYQ A;  4RW7 B;  3PW2 A;  1B8J A;  1TL3 B;  3IGZ B;  4X4T A;  3ISN C;  5HMZ A;  4Y65 A;  2EC0 A;  3HVT B;  4K0K J;  1ROF A;  3D0G E;  3ILJ A;  2DEJ A;  1D09 B;  2W5S A;  3WX4 A;  1GK8 A;  2OP5 A;  1HQ2 A;  2A6M A;  4CLT A;  3T02 A;  1LOU A;  1MSW D;  2LDI A;  1FEH A;  1X4H A;  4KH1 B;  3WAY A;  2ZVS A;  3CCS S;  3M9N B;  2BW2 A;  1ZM2 A;  2V9K A;  1VQS A;  5KFI A;  1AFJ A;  2XS2 A;  2VJU A;  1LFW A;  5E7O B;  1WF0 A;  3QGH A;  3R5J B;  4E2F B;  1FKA F;  4FKX A;  3G6V A;  4Q5V A;  2RVJ A;  5JVG Q;  2XHW A;  1R0B G;  4IOC Q;  4HL9 A;  3DLB A;  5DGA A;  1C1B A;  3MPW A;  1RT2 A;  2AGP A;  3DKD A;  1FJG J;  4KM4 A;  3JQM A;  2VQF J;  1A0O B;  1A6L A;  3C46 A;  3SV4 A;  2BBE A;  2KO1 A;  4ID8 A;  2GSU A;  3HJF A;  3FC9 A;  3GE9 A;  3G82 A;  3K57 A;  1URB A;  2WZ1 A;  3G87 A;  2W9B A;  2EG2 A;  2F7V A;  4F4A A;  1NXI A;  1FHT A;  4LVO P;  4JI5 J;  3QO9 A;  4ZVT B;  4KAY A;  3BGU A;  1VFJ A;  2ROP A;  3SCL E;  4JI4 F;  4RW9 A;  1DBD A;  2Q6B A;  2GO9 A;  4LF9 J;  2DR6 A;  3M30 B;  3FGV A;  4USJ C;  4B3T J;  2GCF A;  1FCA A;  1IKX A;  4JV2 A;  4ZVF A;  2J0X A;  2ZHB A;  4Z7C A;  3DPC A;  3W9I A;  1U8S A;  3IRX B;  1FWL A;  3B4D A;  4CLY A;  2FB0 A;  5DDO C;  4WYW A;  4JOU A;  2W7A A;  4FYV B;  2QYC A;  3DMJ B;  4QPT A;  3WBH A;  3CW2 C;  3W3S A;  3TA0 A;  3Q2T C;  1Q8I A;  1YTY A;  4FF1 A;  2RDD A;  4FS1 A;  2XYP B;  4YFU A;  4G1Q A;  3HLU A;  1KDN A;  1BC6 A;  3NCQ A;  2OJ3 A;  3MR6 A;  3MMA B;  4J9S A;  1VBY A;  3IRW P;  1Q78 A;  3G6X A;  1RAH B;  4MKB A;  4DQQ A;  1HBM A;  4Q8E A;  2RIJ A;  4GTW A;  3I55 S;  3IFE A;  2UXD F;  4LFA J;  1U2F A;  1G2E A;  3OXF A;  5B0E A;  3HJV A;  4DPY A;  2N4D A;  2BEF A;  5D4O A;  4B17 A;  2BKN A;  1ZM4 A;  3WAW A;  4H4O B;  4NL5 A;  2HQC A;  2HVI A;  3V6K A;  1H98 A;  4WIQ A;  2M0G B;  4ECZ A;  2OI2 A;  5B0C A;  3GMG A;  4ERD A;  1KBR A;  5CZX A;  3EGZ A;  1RZM A;  1M0S A;  3G8Q A;  5D3G A;  2Q6C A;  4EUV A;  4ZVQ B;  1EX8 A;  3T00 A;  2UV8 G;  1VJQ A;  3DDK A;  2G13 A;  5EDW A;  4DV3 J;  2WB1 D;  3KK1 A;  2CJA A;  1UMJ A;  2BE2 B;  3EGV A;  3UNG C;  1LXJ A;  3CJ8 A;  5T14 A;  4FN5 A;  4KKO A;  4KGK A;  2W7P A;  3PO4 A;  2OEM A;  4ZP6 A;  2HBQ B;  1FKP B;  3W62 A;  5CYM B;  4O3S A;  4YEA A;  4DG1 A;  1U6B A;  3PJ9 A;  3TP2 A;  1JXL A;  3FFI A;  3G9C A;  2JWN A;  1RYS A;  2MZ1 A;  1GTE A;  3LWM A;  1YJW S;  2BOP A;  3CCT A;  4A8M P;  4RNN A;  2J6U A;  3GIJ A;  2XMM A;  2JFK A;  2O1P A;  2QTW A;  1KWM A;  3KJV A;  1HA1 A;  4P2F A;  3OHA A;  3BSA A;  2HHT A;  4I1T A;  3C14 A;  2UVV A;  2DHH A;  1X31 C;  3LW5 C;  1KFD A;  2OD6 A;  4N47 A;  3GYX B;  3D3C J;  2B9X A;  2F9J A;  1S4F A;  3PYD A;  1N36 F;  3CUN A;  4F2S A;  2UUW A;  2B8P A;  2VDH A;  1FJE B;  5BR8 J;  1EJJ A;  3PW4 A;  4X66 F;  2HS3 A;  3CMQ A;  5KFF A;  2G4B A;  3T1Y F;  4ECW A;  3IAM 9;  2Z30 B;  2JHE A;  4F7V A;  2RSQ A;  3DM2 B;  1R6Y A;  4NLS A;  3LUY A;  1SH3 A;  1WC4 A;  6AT1 B;  4DSE A;  3ZO7 A;  1EP4 A;  2BYC A;  1UP1 A;  2VFU A;  3IM9 A;  4UOG A;  1WI8 A;  4DV4 F;  2XMV A;  3OD2 A;  1HNV A;  2YPZ A;  3B5Q A;  5KOX A;  4HAC A;  3AXK A;  1C0T B;  3M2V B;  4K2J A;  5CHC B;  1HWU A;  3A8J A;  2I2Y A;  3TUI C;  2NSB A;  2O3D A;  4FYY B;  3IM8 A;  4DLG A;  3GTY X;  2XZD B;  4AQY J;  2QA4 G;  3OUY B;  5EGY A;  2QIF A;  2UUB F;  2J76 E;  2LFV A;  7FDR A;  1CJT A;  2JC1 A;  5KFL A;  4EU0 A;  3WIV A;  2PFD A;  4WE1 B;  4F67 A;  2KXH A;  4KV8 B;  1C1C A;  1R3N A;  4EI2 A;  2BQ3 A;  2WOM B;  3V81 B;  5HP1 B;  4JI7 J;  4Z37 A;  3B4M A;  4Y6I A;  3CD7 A;  4B9T A;  3R3T A;  5HAT A;  2JEG A;  4PCQ A;  1VQM S;  2UVR A;  3QRR A;  1SHN A;  2FZK B;  3MPV A;  1RWV B;  4C7Q A;  1YDL A;  4L75 A;  4LF5 F;  3FDS A;  3MAH A;  4IFV A;  4GKK J;  1R89 A;  3M6X A;  2L9W A;  1MU2 A;  3OR2 B;  3Q2S C;  4CYU A;  1GEH A;  3EIC A;  1UWB A;  1KVK A;  5HJX A;  4ID5 B;  1R43 A;  3RRH A;  1XJW B;  3AB2 B;  2IRY A;  1RGV A;  2KFY A;  1S5Z A;  3QJJ A;  3NGR A;  4C8O A;  5KG7 A;  1TAU A;  3MUT P;  2ZWP A;  5LRM A;  4OJ1 A;  3C19 A;  2CYY A;  2EG1 A;  1N33 F;  2WON B;  1PCA A;  4GKJ F;  3IWL A;  2DPJ A;  5E0O A;  2RF2 A;  3GJQ B;  4ANC A;  3V2U C;  4KIA A;  3C6U A;  2IM0 A;  4J9P A;  2HQ3 A;  3CJT A;  2VQE F;  2ZBQ A;  4OJH A;  3W2W A;  1OPI A;  2YH1 A;  3LAM A;  3K0J A;  5GAG U;  4CXS A;  5JUM A;  1W2B R;  3OFF A;  4KPC A;  1NCL A;  3FQK A;  4FPR A;  3C15 B;  3DXS X;  4WP8 A;  2JH3 A;  1QAJ A;  4WTO B;  2UU9 J;  4ETZ A;  2QA2 A;  2BJ7 A;  5M2U A;  3MM8 A;  4ZLL A;  2HG4 A;  1U26 A;  1X9M A;  1Q53 A;  3EMT A;  3VAI A;  2AIR B;  3HPO A;  3PX6 A;  2KHD A;  2F8H A;  1YK9 A;  4B56 A;  3NKQ A;  1SUQ B;  2LEB A;  1TKX A;  2XYG B;  2AW0 A;  4LSL A;  1Q7Y T;  2C42 A;  2FHK A;  1NJZ A;  4EZ6 A;  3G6Y A;  3CJQ A;  3NKN A;  2M70 A;  1PYT A;  3NRB A;  1TUV A;  2HWT A;  3OTO F;  2CA9 A;  2DNG A;  1HMV B;  1U0H B;  4BLG A;  5K8O A;  1S6P B;  4DV6 J;  5CD4 H;  1N5Q A;  3VCD A;  1DQA A;  1UJ5 A;  2LQJ A;  3HZG A;  2XWX A;  2BKO A;  4DL6 A;  4P6Q A;  1APS A;  3WIU A;  1KLM A;  1NJY A;  1ZH5 A;  3AOD A;  2GVD A;  2E1R A;  3THP A;  5KFS A;  4IH6 A;  1LWC A;  3GB0 A;  1E33 P;  2ZUG A;  4XPE A;  3C6T B;  1S1W B;  1F60 B;  3Q8R B;  4URG A;  2QG9 B;  4B3R J;  2MZQ A;  3VAH A;  1RBO B;  1HNI A;  2VV5 A;  4G6V B;  1JLC B;  5IQQ A;  4X4U A;  1WKK A;  1HQE B;  2B43 A;  2V2K A;  4DLE A;  2YNH B;  2IVM A;  4P52 A;  2NYH A;  4MMO A;  1YBT A;  2W9C B;  1XR7 A;  1WF1 A;  3TUP A;  3AHP A;  2ZM6 J;  4JI1 F;  2ACM A;  5KFP A;  3LAK A;  4NLU A;  3PFE A;  3CCR S; 
#chains in the Genus database with same CATH homology
 1AJB A;  4LR7 A;  1KH9 A;  3DPC A;  1ANI A;  3KD8 A;  1ALK A;  2GSO A;  1EQJ A;  5GOV A;  5LRM A;  3BDH A;  2W5Q A;  4LRD A;  1K7H A;  3TG0 A;  5DLW A;  3UN2 A;  1N2L A;  5L0K A;  4CYS A;  1ALJ A;  3MK1 A;  1ELY A;  3A52 A;  5AJ9 A;  4KAV A;  1EJJ A;  1HJK A;  3T00 A;  5LQQ A;  1ED9 A;  2W8S A;  4NWJ A;  2XR9 A;  1KH5 A;  3WBH A;  4ZG9 A;  4YR1 A;  1EI6 A;  4LRA A;  2W5R A;  4UPL A;  1SHQ A;  4CYR A;  3OT9 A;  1O99 A;  1ED8 A;  3BDG A;  4LQY A;  4NWX A;  3MK0 A;  5IJS A;  1ALI A;  2G9Y A;  2GA3 A;  3DYC A;  3M8Z A;  3UN5 A;  5L0E A;  5HRT A;  3TX0 A;  3NKR A;  3WAX A;  4LRE A;  3NVL A;  1E2S P;  2ANH A;  4KM4 A;  3M8W A;  3SZY A;  4LRC A;  4UOR A;  4KJD A;  5LRN A;  1ELX A;  4UPK A;  4N7T A;  4ZGA A;  5IJQ A;  3WAV A;  1AJD A;  2GSU A;  1E3C P;  3UN3 A;  4MHX A;  3T01 A;  4CXS A;  1URB A;  2D1G A;  1E33 P;  2W5W A;  4GTY A;  2X98 A;  4LR9 A;  5K4P A;  2W5T A;  1ZED A;  2W5V A;  2W8D A;  4UOP A;  2IUC B;  5EGH A;  1ALH A;  3NKP A;  4QAX A;  5DLT A;  1SHN A;  2XRG A;  1URA A;  4TN0 A;  4KJG A;  1AJA A;  1AJC A;  3Q3Q A;  1B8J A;  3TWZ A;  3CMR A;  4ZG6 A;  3IGZ B;  3B5Q A;  4LR2 A;  4FDJ A;  1KHN A;  1KHK A;  1KHL A;  4KAY A;  4UPI A;  4MIV A;  4GTW A;  3IGY B;  1FSU A;  3E2D A;  1Y7A A;  1HDH A;  4GTX A;  4ZG7 A;  5DLV A;  3NKM A;  4LRF A;  1N2K A;  1Y6V A;  4LR8 A;  3SZZ A;  5EGE A;  3UO0 A;  1ZEF A;  1KH7 A;  2GLQ A;  1O98 A;  2W5X A;  3M7V A;  4GTZ A;  1AUK A;  5C66 A;  3ED4 A;  2W5S A;  1ZEB A;  4B56 A;  1EW2 A;  2QZU A;  5GRR A;  3NKO A;  3NKQ A;  4CXK A;  3T02 A;  3IDD A;  2IFY A;  2RH6 A;  4MY4 A;  3WAW A;  4CXU A;  1KHJ A;  4UOO A;  5LIA A;  3BDG B;  2VQR A;  1KH4 A;  5KXA A;  3UNY A;  5TJ3 A;  2ZKT A;  4FDI A;  1EW9 A;  3WAY A;  2IUC A;  3LXQ A;  3BDF A;  1P49 A;  3NKN A;  2GSN A;  5L0B A;  1ANJ A;  4UPH A;  3MK2 A;  1ELZ A;  1HQA A;  5INH A;  1EW8 A;  3M8Y A;  4LRB A;  1E1Z P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...