3M8WA

Phosphopentomutase from bacillus cereus
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Bacillus cereus Phosphopentomutase Is an Alkaline Phosphatase Family Member That Exhibits an Altered Entry Point into the Catalytic Cycle.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 140
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3m8wA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3m8wA01
3UN5A 1ANIA 3T00A 2XRGA 1ED8A 3BDHA 5HRTA 2GSUA 1EI6A 3NKNA 4GTYA 4MY4A 1P49A 5AJ9A 3A52A 4CXSA 4YR1A 1AJAA 2G9YA 3WAVA 1URAA 1K7HA 1O99A 1SHNA 1ZEFA 4KJDA 4LR2A 4ZG6A 5DLVA 1KHLA 3M8WA 1ANJA 2RH6A 2X98A 1HQAA 4UPHA 3WAYA 4CYSA 4B56A 4KAYA 3TX0A 3SZZA 3WAXA 5GOVA 4LR9A 2W5WA 4UPLA 1E3CP 2XR9A 4UPKA 2W5SA 4N7TA 3Q3QA 1ALKA 1KHNA 3NKPA 3M8ZA 2IUCB 2W5RA 2W5XA 1EQJA 3BDGB 1EJJA 5DLTA 1B8JA 4LRCA 1KHKA 3UO0A 5IJSA 4FDIA 1N2KA 2GA3A 3T01A 5K4PA 5LIAA 1Y7AA 5EGHA 5IJQA 1URBA 5EGEA 3IGYB 3NKMA 4FDJA 4GTWA 4UOOA 5DLWA 3NKRA 4ZGAA 3M8YA 3WBHA 3NKQA 3ED4A 4LR8A 2VQRA 1FSUA 5LRMA 2W8SA 3NVLA 4LREA 4GTZA 4LQYA 5LQQA 4LRDA 2ZKTA 4NWJA 2IUCA 1N2LA 4ZG9A 3DPCA 1Y6VA 3BDGA 3E2DA 3IDDA 3DYCA 3CMRA 4KAVA 1O98A 3UN3A 1E33P 1AJBA 1E1ZP 3KD8A 5L0EA 1KH7A 5L0KA 2W8DA 3T02A 4CXUA 5LRNA 1ALHA 3IGZB 3BDFA 3MK2A 2QZUA 4UOPA 4UORA 3M7VA 1ELZA 1HJKA 3MK1A 3MK0A 1AJCA 3TWZA 1EW9A 2W5QA 3NKOA 2W5TA 4CYRA 3TG0A 3B5QA 1SHQA 4MIVA 1KH9A 4KM4A 1HDHA 4QAXA 2W5VA 4GTXA 1ELXA 2GSOA 1ELYA 1EW2A 2ANHA 3OT9A 1KH4A 4CXKA 1ED9A 4LRBA 3UNYA 3LXQA 1EW8A 4KJGA 1E2SP 4TN0A 1ALJA 2GLQA 4LRAA 4LR7A 2D1GA 4ZG7A 1AUKA 5INHA 1ZEDA 1ALIA 4NWXA 1AJDA 2GSNA 5TJ3A 5KXAA 1ZEBA 3WAWA 5GRRA 4LRFA 5L0BA 3SZYA 1KH5A 5C66A 3UN2A 4MHXA 4UPIA 1KHJA 2IFYA
chains in the Genus database with same CATH superfamily
2F40A 5CCLA 1W2BR 3MZIA 3BM7A 4RW9A 4QR1A 1R89A 4ECVA 1M0SA 3AODA 3SI8A 3M2VB 1XNRF 1OPZA 3FDSA 4JOUA 3ZO7A 3I4HX 2MKYA 2DGSA 3PO5A 1Q8LA 3M2RA 1S1TB 3QLHB 3R6GB 1IR2A 5LT5A 4A8MP 3NKQA 4KPYA 3OHBA 1ZOTA 1ZBTA 4J9PA 3KLIB 1DURA 2DPIA 3WIVA 2VICA 4ILMA 1HL6A 1VFJA 3DYCA 3MOZA 3BSNA 1XNQF 2B5JB 1TTHB 1S1XA 4CO3A 3BDFA 1V9OA 4X65J 1AB8A 3W5XA 1HR0F 1R0BG 2CDQA 3B54A 4CTAB 3FEZA 4WFNQ 2ANHA 1VK8A 4KT0C 2X1GA 2NR0A 1HBNB 4TN0A 3OVSA 1NU4A 2P6SA 1U8SA 5HK4A 4M63A 5AT1B 3LGHA 4PABA 4P9SA 5LMUF 2FZKB 4UPIA 4OYIA 3HKZD 2O66A 1HNIB 2IDEA 3H5SA 2C2OB 3D67A 4X4TA 2IJNA 4HL9A 3VQSA 1SL0A 2OPPB 4N7TA 3Q3QA 4JI4F 1JLQA 2W5RA 4LRCA 3GG0A 2KFZA 3R8YA 3HVAA 3DLBA 1S0NA 1WDTA 4Y00A 2C2DA 3T41A 4MKVA 4HI2A 3EGNA 3CMRA 5T14A 3KYLA 3DOMA 3ENAA 4EBEA 3DLKB 1VQYA 4XDDA 4K4XA 2E5LJ 2PD1A 3UNGC 3K0JA 1FO1A 5GMEA 1FE4A 1KD1T 3HVTA 5C2GA 5I3UB 1U6ZA 1VISA 4CLWA 2H9ZA 5KG7A 1BHNA 2HNZA 2XRGA 2VG6B 1X0FA 1X7VA 3W2VB 3X3UA 2DEJA 2XYHB 4LR9A 2XB2D 1NAQA 2XHCA 2VBXA 1U24A 1YBTA 1PBUA 2LMIA 3PX0A 2YNIA 2O01C 5DM6Q 4IFVB 2G0IA 1KDNA 4MJKA 2CA9A 5A8WB 2QJ3A 4J5OA 1S1WA 1XR5A 1K1QA 3ETOA 3DM2B 4P7TA 1RAOA 2VB6A 2BOAA 3MAAB 3H2VE 5HO4A 3CCQS 3SQOP 1N52B 3HVWA 5KG4A 2RD5C 2WCXA 5B0GA 5KT2A 1Q81T 2DNHA 1RISA 1UW9A 1O0PA 1FRMA 4LFBF 5KFQA 4ZPBA 4MYUA 5KG2A 4BS2A 5K8PA 1WC4A 3PRVA 2XHWA 1ZEFA 5HVFA 2B9EA 4NA1A 5AE1A 4NLUA 4RUAA 2UXBF 2AGQA 1SKRA 3GIIA 4OYAA 2M52A 3R5AA 1SJ3P 1U49A 3SFUA 2W8SA 4LQYA 4U7UD 1T9UA 3HDSA 3GR1A 1HYSB 3QIPA 3R6LB 3C19A 4OX6A 3AAWB 2LQ9A 4KR0B 4AT1B 4XIUA 1YGYA 4JI0F 3T1HF 1GAOA 2AX0A 3M8PA 2QLJB 1T05A 3D3CJ 4NLSA 2HZAA 4CYUB 3ZXWA 1WTFA 3TAQA 1BQMA 3FZBA 1NM2A 1Y4ZB 4L73A 3VGTA 2M70A 4FYWB 1IR0A 1GXTA 5K8OA 4LRFA 2IJFA 2WB4A 4P72A 1UEUA 3P3DA 2FHKA 4TKTA 1N6QA 2FJWA 4DZ6A 1RGVA 2XYGB 2MQOA 3HJFA 5F9LA 1ZAXA 1N5VA 1U47A 3DRXA 4UPHA 1A7GE 3KLHB 5AXLA 5J1EB 1WHXA 2CQIA 4USWA 1UFWA 3V6HA 4CIOA 5D4OA 1K0TA 5K8NA 2ZH7A 1F0XA 1RWNB 4FNIA 2J9DE 3AXMA 3KK1B 2D3UA 2DXDA 3FCWA 1RHJB 2DY1A 4ED0A 3TANA 2LXFA 5CYQB 3SDEA 2CKWA 4B9MA 3SCJE 3MK2A 3I4PA 5FLXY 3BQ1A 1NPRA 2JSXA 2AIRB 4DR2F 1VQ4S 5IZHA 5HSPA 1HQEA 1KLMA 3QGIA 1QTMA 3OTOF 1UWBA 4QPXA 1CJVA 2AKWB 4JBCA 1RTIB 2V69A 3DGVA 2B7CB 3M1VA 4K4YA 5F8JA 4X4QA 4OX7A 3QRRA 2GIFA 1U0SA 4TY8B 2EK1A 4PG6A 4DR6F 1WC5A 5DLFA 3DYAA 4LF5F 2AF6A 3C6TA 1U6BA 1L3TA 3I56S 3MEDA 4DPTA 3MM9B 5D0EA 3KG4A 2PMZD 1S4EA 2HHUA 1L3KA 2YWEA 2V4RA 1YWXA 4MAKA 1LFWA 4B9VA 3L09A 2XY6A 4B9LA 4FF2A 4BLGA 4DQPA 2ZHBA 1CQMA 3NGRA 1CJUA 1FVSA 3I5BA 2FD2A 1Q8IA 1HMVA 1UA1A 3MFIA 1OO0B 4J90A 2X1AA 2JNJA 4H4KA 2AJFE 3MM8A 4HT7A 4LT6A 3D54A 2R7XA 3A3PB 3AD7C 3MTJA 4O3PA 4EFAC 4EMDA 2WONB 5F8LA 5EWEA 5HAOA 3H90A 2MKKA 5EN1A 3V6JA 3CE8A 2LDYA 4DV2J 3LP1B 5C25B 1N54B 2HRUA 1S57A 5A0YA 4NYZA 1XWLA 2GMHA 4MH8A 4WXWA 3GIKA 3L3CA 2V9WA 2DHAA 4K2XA 4CLSA 3AT1B 3GONA 4ALZA 3B4MA 3B6BA 1GTEA 3HKWA 2RQMA 1EJJA 2BE7D 2R7TA 2AYMA 2VOOA 2OPSB 3H5UA 3M2VA 2LYVA 4F4ZA 4E2FB 2FY8A 3OR2B 5LQQA 1NBEB 2DBBA 4FS2A 2ACYA 2HAIA 1HNVB 2KTQA 4NMXA 3QLHA 2KM8B 3MAHA 1NK4A 1GXLA 1SB6A 2OD6A 2CZVC 3RB0A 1J5OB 5DDPC 4DL0C 3KLIA 2YQ0A 4MIVA 2KRRA 1ZTTA 1QVGR 4TNOA 4CXKA 3AJDA 1K44A 2M4MA 2JEJA 4I6AA 3M05A 2COLA 1C2PA 2FVPA 2ZNZA 3W2WA 1RU1A 3RBEA 3PDNA 4ZIWA 2KVQE 1H72C 3JYTA 1R8AA 2Z56B 2GSNA 1Y5NB 2KT2A 4CTAA 5AJ3F 5GADU 1LW2A 1RXOB 4WP3A 2FTRA 1FX2A 5LJ3Y 3UDLA 1DAXA 2OHDA 2OELA 2C42A 1XNRJ 4X62F 2EKYA 1VBXA 3DHXA 3V6DB 3QRPA 4KHRA 4LF2A 3U27A 1HNIA 1TUGB 3TUPA 4QIFA 2HQ3A 4ID5B 4LF6J 4ZIVA 4ED4A 1KFDA 3K57A 2FHMA 3OR1B 2I9SA 1F5AA 4K5RA 4A4JA 4R0EA 2OPPA 1NK6A 5KFKA 3ITHB 5LL6d 2F8MA 3VWSA 4TYBA 2AEJA 5BYRA 2FHOB 1UWAA 3DLEB 2C22A 3ISND 3TNVA 4R8UA 3KJVA 2KT3A 2MKJA 2GSOA 4RW7A 4ED5A 4WIQA 5E3QA 3QT5A 3PJXA 4DX7A 2FLOA 3HFVA 5GAEU 2YKQA 3E01A 1TV6B 1UVIA 1HBMB 1KFSA 5LMUJ 2WSFC 4J9UE 4YMEA 4ZCLA 3NMAA 3TOQA 1G1XA 4B3RJ 3MMBA 3TX8A 3KUGA 4K4VA 2YKOA 2HSEB 1N56A 3MMAB 3CCUS 1HQAA 2HGLA 1WKLA 5HI7A 2C3UA 2HS3A 3P96A 2D3OR 2VG6A 4KO0A 1J5EJ 5L1IA 2LA4A 2AYGA 3BSAA 3BDPA 3DLGB 5DDRC 1Q1KA 3CJQA 3OXLA 3C46A 3RBXA 4LSLB 5EGYA 2HHHJ 2CJXB 3NWRA 2VDIA 1NH7A 4G1IA 2ZZMA 2ZDPA 2XULA 3DDIA 3IFEA 4O4GA 3VZHA 3TG0A 4NZ6A 3M32B 2NS1B 2GVZB 2B8PA 2GJFA 4WTYA 1S6OA 1R8PA 2CXEA 2XS2A 1Q95G 2H65B 5KFCA 2YNHB 1W26A 4RUHA 4Z7YA 3H42A 4C8NA 4ZCIA 1SIWB 1X4EA 3AA9A 1S0MA 2RHSB 2ROPA 1PYTA 1WSRA 1SH0A 2Y1JA 3VR1A 1VRUA 4LF9J 1BE4A 3RBZA 2CQ2A 2KU7A 4DR3J 2QMWA 4O4RA 3MEEB 5IJSA 1UP1A 1N4LA 5E5NA 3FRZA 5IJQA 2W1BA 5EHHA 2DKOB 5C24B 3K5OA 2HQIA 2UXDF 1S0OA 5KFXA 1YX2A 3DGPB 2WSEC 1EP4A 2QO3A 2YVSA 2GVDA 2OO4A 2K7JA 5C42A 1SJ1A 4C8LA 1Y11A 2GQ2A 5ADZA 3SXLA 1ZM3A 1LV5A 4V19X 1HYSA 2F8HA 1S6QB 3NNHA 1HPZB 5MLCV 4DV3J 2GIRA 2QL9B 3HCXA 3D6FB 3GB0A 4LBHA 5D3GB 5H1SV 3O5TB 5FLXU 3MUVP 4CYUA 3A8JA 4O44B 4ZN1A 4LFBJ 3NKNA 1S7HA 4F67A 2CJ9A 3QAUA 1PYOB 3RB4A 2KO1A 3OV7A 4P2SA 1FRKA 4J7CA 4NA3A 1LWFA 4ELUA 2RVJA 1WOSA 4DUZJ 1S48A 5L46A 1CS4A 2EKNA 5BJRA 4G3IA 2ZBRA 3NCRA 4ED2A 2RQKA 1VQ7S 4B3OB 2VL1A 1NK8A 1S6PB 1YDLA 3IGVA 4OLOA 1RWOB 2PT0A 4DHVA 2AJ0A 1VQNS 3DC2A 3G9CA 1NZ8A 1G4CA 1HWJA 1NKCA 2DNQA 1JXEA 2ZJRQ 2CJAA 5IOLA 5EX0A 2GZOA 3H0PA 1B0TA 4ECWA 3M6VA 2ACMA 1YJTA 4F3QA 3VCDA 3CD0A 2O67A 2CQBA 4M1KA 5MAOA 4CNZA 1K8AT 1M5SA 3KHGA 2ZM6F 3JSBA 1TUWA 4I1TA 3G8SA 1S12A 2V34A 2JX2A 3CC2S 4ANEA 2RRBA 3OXGA 3CCSS 3CWJA 4K50A 1FWLA 2H1YA 2VG7B 1WHYA 2AD9A 1SJQA 3MI7X 2BVZA 3MR7A 3IM9A 2V0NA 1U0HB 3OVAA 4TY8A 1T3NA 4HH1A 2M88A 4QW9A 4OHYA 3M6XA 4WXOA 3MM7B 1N36F 1CPZA 3UD3P 1VI7A 1LQ9A 4L3KA 3N28A 1IQZA 1HBOB 3DU5A 4NLQA 1AJBA 3Q2SC 2HK3A 3FFIB 2MZTA 5J2QA 4A8XA 1IR1A 2BQUA 4ECXA 2ZOFA 3NKOA 4QPTA 4DR2J 4OHXA 2P9GA 5DO2A 3H2UB 5AXNA 2DNGA 2HHTA 3BBBA 1N33J 3CNQP 4ZG7A 4IH5A 1RT1A 1U1MA 1XEZA 4ATNA 3OTDA 2ZWPA 4P73A 4F0KA 3BO2A 3LAKA 1GMUA 1FESA 4C6AA 2YKMB 4Y2MA 1RBAA 2AHOB 1ZZFA 1D8ZA 2Y8WA 2Q6CA 5IM0B 3EMTA 3PCOB 1NCLA 4QIEA 2NYIA 4USTA 2JDJA 2GMJA 2GO9A 1N0UA 3OJUA 3NS5A 4O3NA 4C98A 3PW0A 2QLXA 3DRPA 1ZZNA 2XBPA 1XTZA 4KFBB 2YKNA 3EVMA 3FBBA 1E6VA 4H4OB 5JUMA 3OFEA 4NCGA 1N2KA 3W7BA 1URBA 3CJTA 2BUNA 4MT1A 3WBHA 2H4WB 3TA1A 2XTJP 1B70B 2J8SA 1FFWB 3CCLS 4EZ6A 4OI3A 1GEHA 2BMBA 2DTJA 1R8CA 2IRUA 5LRNA 2GIQA 1S59A 1KNZA 4IDKA 1KH9A 2VPWB 1M5KC 2O5DA 1HNVA 4OJGA 3MPDA 2KXHA 3TP2A 4CO5A 1N5SA 5J2PB 1AUKA 1J5OA 4B3MJ 4ZCKA 2KG1A 5C66A 4O3SA 1XMQJ 2FJDB 4R25A 4UUWA 7FDRA 2MPUA 3D4JA 2CWXA 4A8SA 1P1LA 3ICLA 3HM9A 1H2UX 1Y10A 2IA0A 1YG0A 3GIRA 4DU7A 2DJWA 1SCJB 2C28A 3PRBA 4L75A 3CJ2A 4DS4A 3TUJC 4M5JA 1RT7B 4YDXA 4ZJQA 4ZHRB 4UPKA 4IO9Q 3Q8RB 2QN6B 1TKXA 5JVGQ 1R8HA 1HI1A 3M6WA 2JEIA 1IKYA 4IOBA 2BRKA 3UE2A 3LAMA 2EFOA 3K58A 2X7IA 1CEZA 3FKBA 1FT8A 2BACA 3AXKA 4DU8A 4I0WA 1IKWB 1EB0A 4DG1A 3FSYA 4ID5A 2XNQA 3D0GE 3PW2A 4WFBQ 1OMSA 2VODA 4I67A 1IBKF 4F50A 3ZZTA 5KFPA 1AT1B 2C3YA 3I0RA 3T1YF 1AXQA 4CZCA 2CJKA 1YJVA 3MECA 3D2WA 1U4BA 1OY6A 4GC6A 4AL5A 1WF2A 4DX8H 2JJ4D 2HHVA 2YTCA 4M95A 3WAWA 2MGZA 2VBWA 2E7WA 2L3MA 2R8GA 3NCPA 4JV5F 4YDDB 5HJYA 3H25A 2FC9A 3PO4A 2QE5A 4NRUA 4LF7F 1JLEB 1KP6A 4ZVTB 1IUJA 5JXSA 1LWCB 2H5IB 4I69A 3GJSB 4YFUA 2ZH8A 4X2BA 1I51B 1ALKA 1UTAA 4ZITA 3BDGB 2DK2A 4K7QA 4UOOA 1O51A 3NOCA 1W25A 3MMAA 1LWEB 3TEGA 4FBTA 1DQAA 1Y3KA 1S9GA 2RH3A 3DKDA 3M8RA 3QAEA 2RU3A 3KK3B 4USIA 2QZUA 3DLGA 1EARA 4LSLA 1TL3B 4MMOA 2ZFHA 4ZLPA 4ITSA 1R6YA 1KH4A 5ETRA 3C6UB 1H6KX 4YB5A 2A1BA 4KTQA 1KEKA 4IRDA 4JI1J 1RP5A 1MSWD 1SQEA 5L0BA 3M32A 3UN2A 2MB0B 4J9LA 2A2CA 4DV5F 3THPA 1RTHA 2IYGA 1YQHA 1BWVA 2ALYB 4ZCMA 2FVSA 4WP9A 3BSOA 3ZZPA 5F8IA 2FPHX 1AROP 5H9FK 1NK7A 3CPWR 2DO4A 1YJRA 4DXLA 3LP2B 2GA3A 2XMMA 2UV8G 2U2FA 3VAKA 5CA5A 3LQVA 2G1DA 4P52A 1S9EA 4B3TJ 4DSIA 3OUYA 2V4QA 2OH2A 2GGPB 2PE8A 3W9JA 1RBLA 5C24A 4ED7A 4UOPA 2I5JB 3D6MB 1NLKL 3DGPA 2LA6A 3TQ1A 2DNLA 1ITPA 4I64A 5LMNF 3HSZA 4OYBA 5ETNA 1MWQA 4WU3A 5FIIA 4USKA 3CB4A 2MMYA 3HHEA 4CM2A 3T5HA 2YNGA 3CJKA 2NYHA 2EBEA 3NS7B 1HNXF 3LF0A 2LU2A 2DHGA 4NLOA 3G86A 2FJVA 1S6QA 1HPZA 3GE9A 3VHQA 2K7KA 1TP7A 2Z2YB 4MY4A 2HQDA 3KHLA 1FHTA 5D3GA 4DX6A 2PSZA 2MZSA 5HMXA 4KV8B 3KK2B 1RQ0A 4O44A 4DV4J 2YXLA 1KHKA 2BJ8A 1GK8A 4RNFA 4KHMA 4LBPA 4C3MA 5B08A 4RX6A 4OJHA 1UVLA 3WX8A 3BH7B 1S76D 1H3DA 4LUBA 4YY3F 1RSCA 1C0TB 4J9VA 4USUA 4M8LA 3GFYA 3LO3A 3NP5A 3FNNA 4B3OA 4DR7F 5HP1B 1RT2B 5L9XA 3D28A 1BQNA 2UXCF 2HS4A 4DL6A 3O3LA 4F3MA 2AV5A 1PJ6A 1HI0P 4M5LA 1S10A 4ES2A 5KFFA 1TMMA 4K4TA 4DPYA 2HWHA 3EGZA 3AY0A 1H7XA 2D3O1 2R4FA 3TZXA 3FK4A 2B9XA 5I42B 3IN5A 1LKZA 1ZETA 1YJWS 2WHOA 4LSNA 2NXEA 1J27A 4O0NA 4RWXA 4NZ7A 4Y0FA 2M3DA 4DUYF 1EIYB 1MW7A 5LOQA 1PCAA 1GMVA 3LWLA 4UZBA 3K17A 4ECZA 1MMDA 3VAIA 1VIXA 3BH6B 3UO0A 3IR5B 1Y7AA 2J9EA 2KFYA 4E0DA 1Y3JA 2BE9B 4CO1A 3PEJA 5IT9Y 1Q86T 2RKIA 2DHHA 2VDHA 2F63A 4OYMA 4N47A 4KRWA 4M5HA 3R5BA 3RR8A 3EVOA 3KJQB 4F36A 1T9YA 4Q2MA 3BO3A 3ETMA 3M8SA 2GA7A 1SV5B 2E5HA 4DBQA 4EO8A 1NEEA 1IM6A 4QBUA 4DPWA 3ULHA 1HBOA 1JX4A 5L38A 5DGAA 3ZTQA 3CJ0A 3Q8UA 1Q5VA 1YRXA 3ILLA 1T0TV 3ILJA 2OPRA 1RLCL 4OYXA 4OZJA 2ADBA 1JLBA 4MK7A 4DFKA 5RUBA 4UTGA 2GO8A 1RAIB 3T6BA 5F3ZA 3QATA 2AGPA 1I1GA 2BRLA 3VVUA 3BV8A 4A46A 1TVRA 1VRQC 5IM0A 3QYYA 3GJQB 3ILOA 1NB7A 3TAMA 4UT4A 5C2CA 4X64F 1N36J 3VAHA 1VOMA 2DXEA 2AYEA 2HNYB 4KFBA 1HIYA 2BJ9A 2ZH4A 2ZKTA 1VC5A 3M8QB 2C2ZB 1RHUB 4EUVA 3IGNA 1FFSB 1RDRA 2DGXA 1EKRA 3ZZ0A 1NJWA 1NDLA 4DF4A 2CPHA 2MQ8A 4CLPA 4ZPDA 2RDIA 4X4RA 2W4PA 3WDOA 2Z2ZA 1IBMJ 2DPJA 2CPDA 4JI3F 2ZVIA 4WBFA 1HD0A 2H5JB 1JMTA 2PGCA 3M2UB 4K4UA 1NPKA 2JHEA 1X4DA 2ZBCA 4PWWA 2DISA 5BYSA 4HDHA 4FF1A 1KVKA 2DNRA 4DUTA 2DO0A 5J2PA 2HK2A 1K7HA 2P8IA 2DR8A 2H4YB 2DNYA 4QCLA 1NDCA 3L7UA 3NKMA 1JLGB 5I4MA 2ASYA 2YNFA 5DLWA 2MZRA 1D09B 3I5CA 4C48A 2DVIA 4NRTA 4KGXB 5T7LB 4ZHRA 2DR5A 1TKTB 3Q8VA 1N2LA 4ZG9A 1T94A 3GG1A 4RNMA 2XMWA 1LXJA 1S99A 1C0UB 4MFBA 4DN9A 4CXUA 2W2MP 4M5DA 1N5YA 3FQKA 3AQOA 4NXMJ 5D4NA 1KQGB 3W62A 3HZEA 2XO7A 2J7UA 4R0JA 2W5QA 1Q8KA 2ALZA 2MKSA 4JP8A 2XMTA 3D6TB 1IKWA 2EC2A 3W64A 3QT7A 1ZH5A 3ENQA 3MF5A 4HEA9 2LEPA 2C2EA 2DRAA 3JSYA 1S97A 1FF2A 2D9PA 1RWXB 4IRKA 2F4VJ 3EUNA 5J1NA 3MWBA 3J81j 4BWJA 3MURP 3B82A 3DXBA 4NLDA 1DFDA 1VQLS 3CEDA 4I2PB 1P49A 3A8IA 5CCMA 2R7SA 3TAPA 2B9WA 4RW8B 4P2FA 1RWPB 4A8YA 4XK8C 2GMLA 2OJ3A 3SV4A 3AB2B 3IRXB 2OEMA 3HHLA 2E7XA 3QWPA 3D1OA 3KDNA 2H3EB 2J0XA 3KJFB 3MAQA 5K20B 3ED4A 1LWCA 2CADA 2E1AA 4JI6J 1DQ8A 3CDAA 1RT6A 2FLLA 4AD6A 1RKIA 4O3OA 3BDGA 5D4PA 2R3VA 4DV6J 4DR1F 1FA0A 3UN3A 2P2CB 2O3DA 3C2PA 2ZBQA 4CI0B 3TA2A 1JLAA 1SUQB 1LWEA 3TWZA 3HHLD 4X4OA 1CJTA 4J9QA 1IBKJ 3KNGA 3CW2C 1PKUA 4ZVFA 4OZ3A 1KOHA 5ETPA 3T1YJ 1JLFA 1EW8A 3I96A 4IOCQ 3HD2A 4ZDNA 3IXQA 1YRTA 2QFJA 1UFLA 2ZZTA 1DLOB 1A0OB 2OFHX 1QUPA 2DGWA 4ZPAA 4KPCA 2B43A 1MWZA 3C6UA 4ECUA 1I94F 3MXHP 1SI9A 4A8QA 5K5MA 4JV5J 4LF7J 2YPZA 3IRWP 3MD1A 2YQ1A 3CUNA 3KOAA 3I31A 2G2ZA 4AFFA 1NK5A 4F8RA 1U2CA 1X4BA 1FD8A 4FN5A 3HK2A 2AU0A 4K5SA 1N0VC 4XDCA 2F3JA 4X66J 1C4CA 5ETVA 4M5GA 1VC6A 1WORA 4ZP7A 3DRRB 2DNKA 3SFGA 2UZAA 2J6UA 1HJKA 2QSWA 2JFKA 2FZGB 1BQXA 1VLYA 4ANCA 2GGPA 3H98A 2HYIB 1CULB 2HHQA 2I5JA 2KDOA 2Z8QA 1OYDA 4OIXA 4ZMMA 1FKPA 1H2VZ 3DRSA 1KOOA 4AE5A 4MKAA 4RBTA 5BR8F 1LOUA 2GFFA 2PI4A 2CPJA 8AT1B 3KUEA 1FDNA 1ZPWX 4Y2IA 4JI2F 3QGHA 3TJ9A 1SHNA 2XEXA 2GQCA 4F04B 3G71S 2UUCF 3TUZC 1VQSA 4L76A 1HARA 2P9CA 4NLXA 3NCQA 2XY5A 4G1QA 3T01A 4S0MA 1RHKB 2QT7A 2ZEJA 2DNPA 2XMJA 3W8PA 2V4JB 2WBRA 4KV8A 4USMA 2WOMB 4WFYA 3ZZYA 3ISZA 5GAEI 3GYXB 3BPDA 4FVCA 4EO6A 2E5GA 3PYFA 1TUVA 2MLZA 2AZ3A 2B6AA 3A8KA 3PXGa 4HR2A 1TL1A 5IT9U 5A8RA 5DRKA 3SQGB 3MPUB 4OHWA 4LF1A 4NA2A 4RLEA 4YR3A 2B56A 2Z57B 1LW0A 3PFOA 4K59A 3N6LA 4LF4F 3POTB 1ZS6A 5HP1A 2JH3A 3DOKA 4OI6A 2QYGA 2XZDB 1VR6A 2OLWA 3C8YA 3CGIA 4FS1A 2X3GA 1JB0C 3H2LA 2ZJQQ 4OJ1A 2APOA 4P2XA 3SZZA 2R7RA 1E3CP 4X4UA 4EGLA 3O8WA 4N5SA 4NLPA 5I3PA 4PZVA 3AQPA 4K0KJ 2K1RB 1GX5A 4F4WA 2HZVA 4F26A 4IRCA 2OTLS 2L9NA 1F9FA 4GO5X 4LREA 2EFPA 1G6BA 3IR7B 1Y6VA 4OX9J 3TZWA 4YB1P 2CJQA 3BJYA 3BKUA 1U2RA 2HBRB 1ZA1B 3I0SB 4UORA 4WK1A 5CD4A 5FJ4A 3GWCA 1Q0NA 1YJ9S 1UL3A 3BDEA 2RRNA 2ZE2A 3I87A 2VBZA 2ZOGA 2UXCJ 1SKUB 2D7SA 2KZMA 2EK6A 5CZVA 1NZAA 2QG9B 1S77D 1EQ0A 3A8EA 3WX4A 3M9OB 2DGQA 1NSKL 1IBLJ 4NZ0A 3UR0A 5ETOA 1KKHA 2B0GA 2LQBA 3C14B 3GIMA 2GNKA 4KIAA 4DUYJ 2QC3A 2W9CB 3D9BA 3GJTB 3KMQA 3OFFA 2GAHC 4PG8A 2IMWP 3I5AA 3F0NA 3UCZP 3RB3A 2C2MB 1IJEB 3LPEA 4B3SF 5IXUA 3WC0A 4TY9A 1RWKB 4USVA 3OTBA 1WWHA 4Q44A 3DPCA 3G82A 3MM6A 4FKXA 3C15B 2WAQD 5DLGA 2UU9F 4DV1F 4UQGA 2YY3A 1YJ7A 1H2TZ 2CQ1A 2R9LA 4DQSA 4WYWA 1N8RT 5CZXA 3NMRA 1WDDA 3M30B 1T03A 1AA1B 2EXUA 2CPFA 5DQGA 3W8GA 2BJ7A 1U1QA 4B02A 3RB6A 3QFWA 4L72B 2PEHA 4CH1A 1U09A 3OW2R 2VQEF 4PWUA 5AXMA 5KFWA 2XNRA 3UFCX 4ZVGA 1V6HA 4UY8T 2W4CA 2UVRA 4I56A 2EPIA 4DF8A 2XS5A 4CLYA 1JKHB 1RU2A 4FXDA 3N9UC 5CXTA 5DLTA 3M9NB 3N4WA 2VZ9A 2AGOA 2XM3A 4JI5F 5KFTA 1YTYA 1Q7LB 1ACMB 4BDPA 2R8HA 1VJWA 1VIOA 4QWEA 1MN7A 2W2PP 5E2QA 2XY7A 3O1LA 1IWGA 2RIJA 2Q43A 5KFMA 2MYFA 2YKAA 4ELTA 4YEAA 1KVIA 3EXCX 2CNKB 4QJVA 4WIIA 1U1LA 3SCKE 5F8MA 3MEGB 3KTQA 5KFYA 2YWHA 1OS5A 1Y7PA 5DG9A 1TL7B 3L95X 1N48A 2OSRA 1AYEA 2LEAA 3ZZRA 1C0UA 2ZUAA 1CVJA 3ZTOA 3RW6A 5L1LA 1WKJA 1FXDA 1X4FA 1FTRA 3U1MA 3HPOA 4NEZA 2B51A 1DTTB 1SL2A 2NXNA 1U26A 3EYZA 2Z58B 1W7WA 5F41A 3DI6B 3ZC4A 5J2NB 4YR1A 1IWAA 1TAUA 1QAXA 2X98A 2IJRA 4JYAF 5GOVA 3OL6A 1TL4A 1WD6A 3W5YA 2QEXS 1RT3A 4ER8A 2RUGA 3CCTA 4RW8A 5KFZA 2E1MC 3G96A 1XMOF 4I4BA 2U1AA 1YITS 5DDQC 5F0UA 2I6WA 4EWTA 3IRXA 3A3NB 1L3UA 3R1LA 1B7FA 3JTOA 3ENVA 4KY3A 3UD5A 2A10A 4HACB 1LFPA 3BB5A 1JJ4A 4PG7A 3LANA 2VG5B 1GTHA 2M0GB 1NJZA 2N7CA 4EZ9A 3QO9A 4YHHJ 2OP5A 3CCRS 2OFGX 3DN9A 3NOGA 3AB4B 4NWBA 4ECYA 1SUQA 4GKJF 1P6TA 4X4NA 3VALA 1RBOB 1PGZA 2UP1A 2UVUA 3SCIE 1NRKA 4QW8A 4N56A 3HZGA 3D0HE 3NAHA 4QWBA 5DGBA 5A8KB 1Q4RA 3ISNC 2OI2A 1FKAF 2W01A 2V8DA 3QNWB 2X51A 1DLOA 2BA9A 1VQPS 4OZ5A 2IUCB 3PYDA 1RB0A 2CAJA 1HW8A 3R5GA 2HVEA 4I7FA 1NPPA 4FF3A 2QL5B 4EI2A 3PG9A 5FDLA 3KLEA 1RHRB 2HFUA 3GQCA 2IVFB 1V3RA 4U9RA 1X5TA 3OL9A 3W61A 4RJVA 5DM7Q 4ICLA 2W9BA 1WG5A 3RAMA 3PHEA 1UJ4A 4JB8B 4ZLJA 2LVWA 3UI3A 1ALJA 3CJ3A 4PXEA 1PILA 5L1JA 1QAJA 3RRGA 2Q6BA 2NXUA 1VGYA 2CZ9A 3SIPB 3DMJA 4N77A 3T9NA 1FDDA 5LXRA 2VJUA 2UVVA 4ZVOB 4DQIA 2ZBIA 4PG5A 3BKFA 3KNAA 5J2MB 1BMQB 3E3XA 4JI7F 3T5LA 2RF2B 2FB0A 1HQUA 1RUSA 1SC6A 1PC4A 2HG4A 4L74A 1TU0B 4UF4A 2QLBB 2V8VA 4FPIA 2HEKA 8ATCB 3J7ZT 2F1FA 5G0RA 3O44A 5U47A 2IC3B 1RA7A 2R8KA 3TRGA 1M5PC 3T02A 2MQLA 4U7UK 3EICA 2F8EX 2V4JA 1URRA 4IG0A 5LXYA 2IHR1 4UUXA 2WOMA 4P2MA 2W24A 1NKBA 2KRBA 5KFGA 3G6YA 1QY7A 4H4MA 5F9NA 3TJAA 4NXNF 2CRLA 4WE1B 3JSMA 3ZZUA 1OQ6A 1DHMA 1M90T 2IFXA 2XSJA 1KH5A 1WTBA 1NXIA 2YX7A 4QYZJ 1S1VB 3DRYA 1U48A 3MM5B 1GH8A 3OQ2A 2JOQA 1URAA 4DQQA 4CLZA 2IPOB 5IV3A 2M5YA 2WVCA 5HL7Q 1SIZA 4Q43A 3UWTA 2IBOA 2FIUA 2BV3A 1NJYA 3T5KA 1C1BB 2M7SA 1T9VA 2FUG9 4MIAA 3CD6S 2XI2A 1ZM4A 3U1LA 4HDGA 4LF8J 4GVBB 1F3VA 1VBZA 4U7CA 3NXZA 5CHCB 2K1RA 1L3SA 3S01A 1ELZA 5HQMA 2VF3A 4QWAA 4C11A 1SC4B 1MU2B 1RWWB 4I2QB 4FBUA 4PQUA 2FVRA 4ECRA 4DFPA 2M8HA 1URNA 1DY3A 4NLYA 4J9NA 1CJKB 1UVJA 5T41A 4DLEA 1KBRA 2Q79A 2HMIB 1ZYQA 4ZPWR 3UDVA 1ZM9A 3FBEA 4DV7J 4RUCA 3HD1A 3H7HB 5KT7A 2ZD1B 1GT8A 2JVRA 3K8VA 3PX4A 1RI7A 3BDHA 4TQRA 1U8WA 1KTQA 4U8VA 1MWYA 4IUFA 3V81B 4FP9A 4UOGA 1M5HA 3D6HB 3DOLA 1AZSA 1DTQB 2RH6A 1RWVB 1FE0A 3HT3A 1ZPVA 4FDIA 3KKFA 3C14A 2DY9A 2KYXA 3P4UB 2DHXA 4QYZK 2W9CA 3U1NA 3MPVA 3QGPA 3BS9A 2PFDA 1UCNA 4HTIA 1F3FA 2DIVA 1XC9A 1QE1B 2J9CA 2MHEA 1V3SA 2HURA 4E8UA 2BJEA 4CH0S 4DPOA 4MIBA 1HDHA 3Q23A 4YS2A 2K8GA 4Q8FA 1WSVA 3EJMA 3MOJB 2C3MA 3PYGA 2MKHA 4DV0J 4QR2A 3CVKA 5KG6A 1Q5YA 4RW9B 5KT3A 5EDWA 2CYYA 4NI2B 2FY1A 1HNZF 2EWHA 3HSGA 1HKAA 3GCXP 4F02A 1OYEA 5D77A 4DQRA 4DL7A 4CRJA 4UY85 2DB1A 3M2RB 3CDBA 4B3SJ 3BBFA 1JKHA 3NAIA 4ED8A 1NO8A 2Z4PA 5KFIA 1F1BB 3QBCA 3IDDA 1WKKA 3H4DA 2MQNA 3RZAA 1TK8A 3V4IB 3N79A 1CSJA 1Q16B 2HGNA 3HHDA 1YHQS 3BQ2A 1MLAA 2DHSA 2HVHA 5ITHA 1X9WA 2K3KA 4YB7A 2GX8A 3MEGA 4ZJLA 2DGVA 2E5LF 3M4XA 3CO9A 1TL7A 5J1PA 1TK5A 3FVYA 2HHWA 1FJ7A 3EVWA 2DH8A 4C8MA 4B9SA 1H38A 4OL8A 2BE2B 3PY8A 4ZOSA 4OMFG 2CQPA 3Q83A 5B0DA 4BCAA 1K73T 2E5IA 4HVZA 1NUEA 3PZPA 3P49B 5D0GA 4BHQA 5HATA 3UDCA 3SSQA 3VAMA 4TLQA 2EW9A 3K8WA 5AXKA 5D8HB 4JI5J 2DH9A 4AQYJ 2ZH3A 5LRMA 4OI2A 1RCXB 1WEYA 3SSSA 1E6YA 4ECTA 3CDUA 2AW0A 4DLGA 4TXSA 1WF1A 4NCBA 1RTDA 2UUAJ 2N4CA 1UA0A 3CIZA 3OVBA 1NKEA 3IM8A 3MPYA 1Y5LB 3PIPQ 2VBYA 1OQ3A 4HACA 1I5OB 1NK0A 3OL7A 1UMJA 3CCES 1EKSA 2IYIA 4CO4A 3HVRA 1OJ4A 2RS2A 1ZM2A 4P75A 4FYDA 2MLYA 4IKAA 4CH7A 2HNZB 4DCPB 4DL3A 2QRRA 1APSA 2JRSA 4DS5A 2IIHA 3WHIA 1JJCB 5D6GA 3JAMY 2V2KA 3AOAA 3FEYB 4PG4A 1DZ5A 4C9DA 3ET6B 4UOCA 1D0EA 2PA3A 1VQOS 1S1TA 1LXNA 4A8WA 4LQ3A 5DZ7A 4DFMA 5DQIA 1MMLA 2JWNA 2YNIB 4PEOA 1SVDA 1WJ9A 4O0IA 2IUCA 2NZ4A 5KFHA 1OY9A 1Q79A 3WC2A 5M2PA 4XO0A 2H51B 2B5JA 4YN3B 4MIWA 1OPIA 2G13A 1S1WB 4WKRA 4ZPVR 4PKDB 3LTOA 1VMBA 3VGSA 2W5TA 4F4KA 1VJQA 2Y3YA 2E29A 5HQLA 1FRIA 3A13A 3ZNUA 1HBNA 4IR9A 2W4DA 4CLLA 3ADAC 3D7SB 4LRBA 3GJRB 1KSPA 3PACA 1JLCB 2CWKA 3HO1A 1XERA 4PPZA 1AUDA 3UN5A 4OLPA 3T00A 1TZ0A 3GPAA 3N6NA 3GR0A 4CM0A 2QA1A 3FSXA 1TAQA 2VIHA 2VH7A 1FTCA 3OD2A 2LECA 3CCZA 2YKPA 4Q0BB 3J80Y 1B99A 1HFEL 2V50A 4K4WA 1NHVA 3TUIC 2W7PA 2G2OA 1X0PA 1XNQJ 1TR0A 3HX9A 5E7OB 4ZS6A 3MUTP 2LXUA 2RQCA 2W2OP 1HR0J 4J9RA 4YOEA 2RF2A 3JS9A 2Y1IA 1Q82T 2XWYA 3HI9A 3QIPB 1ALHA 3DLKA 1WC6A 1GXUA 1AJCA 3J7Z5 2GJIA 4CYRA 3RTVA 2ATLA 2CJYB 2A3JA 5HVGA 1T05B 2GCFA 3CDWA 4YR2A 2ZH2A 2IC3A 1WOPA 3KUHA 5I3UA 2A6OA 4ECSA 3O6QA 3TYTA 2ZWOA 2K2PA 3N5BA 3H4BA 4OI0A 1S9FA 4JI4J 3AFGA 4WE1A 5DETA 1KONA 4U95A 4QYRA 4IFYB 3W2VA 2XWXA 2ZJPQ 1ANJA 1CQNA 3QSYB 4CT8A 4OYOA 3AHPA 1S1VA 1NSPA 3CTRA 4JI7J 2CQHA 1EQJA 4MK8A 3GV8B 1U1RA 5KG5A 1XR6A 2HRTA 2PDAA 3UCUP 3BKTA 4IFVA 1VC0A 5D15A 1REGX 5A8WA 1U7LA 3MCNA 5FD1A 2LLZA 3EGVA 3KJNB 1WG1A 3SDEB 2MQQA 3DM2A 1IVZA 2O1PA 3NLCA 4OZLA 3KWMA 3K5NA 4GMKA 2E7VA 3MAAA 3IO1A 2NXJA 3R27A 5CH7B 4HI1A 4QU6A 3MPWA 2QA4G 1EHWA 4OV6A 1YLXA 4GVBA 2YX4A 3BQ0A 3PW4A 1CJVB 5HVHA 1CBKA 3M1VB 1AJDA 1MU2A 2HFSA 4C0OC 4LJMA 4LQ9A 3IWXA 1FK9B 2ZH6A 1EI6A 4EU0A 4WJBA 3C6TB 1FNXH 3JB9k 2VV5A 3WAVA 1DRZA 1U1OA 4DV2F 4KAYA 4HHUA 5K9FA 2ZD1A 4DPUA 4ED1A 2HBQB 2HVZA 2R7QA 4HHJA 1ZTWA 3ZZOA 2BOPA 2FC8A 5K4PA 3B78A 3HHKA 1T9WA 1DTQA 1MNEA 4W90B 1UJ5A 4JI8F 3RYLA 3OPKA 3BGFA 2ZVSA 4GVLA 1O98A 2DR7A 2ZHAA 2XZWA 3AD8C 2CUYA 3MM8B 2YWFA 5GMKa 4LFCF 3W66A 2ZUGA 1D9FA 1QE1A 1RWUA 3T3FA 4MKYA 3R7BB 2B4UA 3W9HA 2YX1A 4IR1A 3DLLQ 1ZEDA 1UVMA 5L1KA 3A3OB 1NJIT 2UXBJ 2RUSA 1X5PA 3AOBA 3UDEA 1QSLA 4EBCA 3NGKA 2CDRB 4ELVA 1UETA 3G4SS 1QSYA 5A0YB 4PYAA 3A12A 3FJ2A 2Y1LB 3KLHA 3IBFB 2KN4A 5J1EA 1D9DA 4WU2A 1KLNA 1ULRA 3OBIA 3V2UC 4IQXA 2HHSA 3EZOA 4NI2A 3T1HJ 4JI0J 3KK1A 4M5NA 4M5MA 2XCPA 5CYQA 3SEOA 2BM0A 2HLUA 4RL1A 4LF6F 3FUYA 1FFGB 5IT4A 2D41A 2IVMA 4ILRA 4WFAQ 3EX7B 3M7VA 2B4VA 1FRHA 1PBAA 4F7VA 5HBMB 3I55S 3HFZB 2GW8A 1RTIA 3V4IA 3I6PA 5B0AA 5IS2A 5SUHA 4U96A 3W2WB 2OAUA 1QJHA 2OSQA 2MZJA 3KLGB 3JYTB 3PTWA 3MHYA 2V9KA 1LK7A 3W1YC 3A4TA 1LW2B 2EEYA 2BR0A 1V5VA 2Y0SD 5M2UA 3TVYA 1P8GA 1H73A 4FZVA 2E1CA 2N3LA 3MM9A 3NGTA 2FQQB 3LPYA 2HQCA 5KFVA 1IJFB 1X5OA 1J2VA 1HNZJ 2BYCA 4GKKF 1EQMA 3TJ8A 3PKYA 2MDAA 4B3RF 1NB2A 2FZCB 3PM9A 2BE2A 2KYZA 4ETXA 4NYOA 4D3GA 2N4DA 2BKNA 1UEVA 3MUMP 2CPIA 3JAMU 4RBUA 3Q24A 5C7PA 3CSKA 1J5EF 1V3ZA 2DNMA 4OZ2A 5GAHI 3OTOJ 1WNEA 1XIQA 1BXNA 1O6XA 6FDRA 5L9NA 3IMQJ 4RNOA 3FMBA 5HJXA 4FXWA 4R8UB 2HHHF 2XLIA 3KJVB 1HWUA 1ELYA 4DR6J 2WONA 4RW7B 4LF5J 2KHDA 2R8JA 3TARA 2V8PA 2QGFB 3UW1A 1RAGB 3E01B 3LP1A 2DITA 5C25A 1SJRA 2NLWA 1RYSA 3MMBB 3A52A 4ZVRB 4HH0A 4ENOA 4Q8EA 2V2ZA 4YP3A 3H8YA 3E8OA 3EM1A 1KHNA 3THTA 3KHHA 4KO0B 1Z1ZA 2OPSA 1PAEX 4LF9F 2DT9A 2KB2A 3OR2A 3AJ2A 4DR3F 3NVLA 3GFZA 2LQJA 3CJRA 5ETSA 2W7AA 2GV1A 3ET6A 4UQTA 1M1KT 1WI8A 5CYMB 3J80U 2RAQA 3J7YU 5L0KA 3CO0P 1JNRB 3MR2A 1RJJA 3UQSA 2DR9A 3TVZA 1Y5IB 4O4GB 1M1GA 2RU9A 1YRUA 3AJ1A 4Q5VA 3H59A 1TL5A 4WP8A 5E3AA 1IKXB 3SBMA 4NWXA 2DXFA 5KXAA 2J76E 2XCAA 4LMZA 7FD1A 4DV3F 4FF4A 3DU6A 3HHLC 3RAQA 4J91A 1AJAA 1JLCA 1VRUB 4A47A 4TVAB 3THVA 5B0EA 2CPEA 2D69A 2HIQA 5D0HA 4UPLA 1YBAA 3V6DA 1U45A 1REVB 1U1NA 3CIMA 4OYPA 4MYTA 3BBCA 1FDAA 2HHPA 4P10A 3OR1A 4KAIA 4QR0A 4C97A 4Q0BA 1YSJA 2MEWA 3ITHA 1EP4B 3F41A 4DUZF 4NLGA 2GVDB 2ZZNA 2FJBB 1WHVA 5C42B 2JZ5A 1FJGF 1I6JA 3T6JA 1RTZA 4OI1A 2DCUB 1W2IA 3NRBA 3DLEA 1P9YA 2VONA 3BYPA 1G7CB 2QTWA 5KFOA 2LCWA 4IH7A 5AJ3J 3CULA 3HFKA 2KXFA 1RT4B 2W2NP 2JLEA 4DR4F 2R2SA 4LR7A 2ABYA 5KFAA 1TV6A 4ZPCA 3J7AN 3QRQA 1HBMA 1ZEBA 1KVJA 1UPMB 3L9ZA 4X62J 1UW4A 2EG1A 1IBCB 3ZTPA 2ASJA 5GAGU 4PR6A 3PJWA 1RWMB 2GS8A 4KJDA 5DLVA 1KHLA 3VAGA 2AYBA 4Q45A 3VZIA 1FWKA 2XSFA 1LWFB 3P5BP 2CQCA 4FNHA 3G6VA 4M5KA 1CS4B 3HMJG 4F3OA 4ZVHA 2HPUA 3CJ4A 3ENWA 4IFYA 5KG3A 2XMUA 3WBZA 2DNOA 3PKMA 3MCMA 1VQ9S 4J9MA 3IR6B 3RG6A 4K2JA 3MCSA 2NREA 2V68A 1IQTA 4NPOA 4LSZB 1TKZB 2JC1A 1WUUA 5IC4B 2WRMA 3H5XA 2GVZA 5KFSA 1EETB 4IQMA 2L41A 3NGUA 1TQLA 3KLFB 1UFKA 4BC7A 3GMGA 4IO1A 2PEBA 2ERRA 1E2SP 2ZHOA 3CDEA 2YNHA 3D1QA 3FRYA 2WZ1A 1U25A 3S6EA 2KT5A 4KH0B 3R7NB 2ZOMA 2LEBA 2BM1A 1WEZA 4KYZA 4V1Ak 1G3OA 4V19J 2M9KA 1N33F 1OSDA 3OFGA 1VBYA 5D4LA 5B0CA 2RDJA 4ERDA 3UD4P 4WF9Q 1KHWA 5E33A 1KWMA 4RR5A 2YBVA 2PIIA 1FK9A 3Q8PB 1BLUA 3MEEA 1ZAVA 1VK3A 3K59A 4DEZA 5F8HA 3SV3A 5KT6A 1OIAA 2OMOA 1DQ9A 5EGEA 1VDHA 2EFQA 3H5YA 1CC8A 3MGJA 4Y2AA 3MDFA 3U7JA 2VOPA 4OJ3A 3CCMS 3R5JB 2H54B 5F8NA 1CC7A 2EI5A 2DIUA 4KAVA 4K4SA 2FLNA 3BN7A 2VA2A 3TVKA 2UUBF 3BN4A 4F2SA 5J2QB 4ZP9A 3G87A 3NNCA 4NLWA 2J9DA 1YI2S 3KHRA 2CQ4A 4Y3CA 1P27B 3LXQA 3N5FA 3IAS9 1Q8BA 1JJHA 2CG4A 3O2IA 2HVDA 3VGUA 2XC9A 1RT1B 1RK8A 3CMQA 4P7VA 4HHHA 1EJ7L 3I9ZA 2BJ1A 2OIHA 4D3HA 3KLVA 3RAXA 5AJ9A 3ELHA 3OHAA 2Z2LA 4B3MF 5CYJA 3C66A 2UXDJ 3M8WA 4CO0A 1HD1A 3TX0A 3DRPB 3KDOA 1XMQF 2FGCA 4CT9A 1HNWF 2CNLB 5KFBA 3M9MB 4YR0A 2YKNB 2V67A 1E6VB 3PW5A 4DJBA 4NCGB 1AW0A 3Q8YA 3HP6A 1RT5B 5DS7A 1S6PA 2J6SA 1RAJA 4JI8J 4FYYB 3H40A 2AEFA 3G6ES 2F9DA 2E9TA 5ETTA 2EVZA 4CO2A 1PJ7A 2IM3A 2FYXA 3F56A 3PHTA 3R7SB 4RKUC 5DG7A 2ROEA 1FXRA 2RJZA 5KAKA 4YQWA 4KHPF 1RAFB 4IDKB 3OSPA 1GQEA 2B4PA 3E51A 4LFCJ 3FQLA 2R2RA 1MN9A 1JNZB 2RSQA 3D66A 2I38A 3S8SA 2C2RA 4EBDA 5HBMA 2OMLA 1SPBP 1CLFA 3HSJA 3IA0A 4C8OA 2CZ4A 5A6PA 2VG7A 2RQ4A 1X9SA 1U0HA 1XJWB 3KLGA 2V94A 4PRFA 3WAXA 1KC8T 3MM7A 3GV7B 3GFHA 3QFHA 4N41A 1TKXB 4X84A 4GTWA 4Q2LA 1IKYB 4DSKA 2VKZG 1X31C 1FNMA 3GV5B 2PFFB 1X8DA 5E3CA 3FFIA 1NH8A 2MY8A 1YVFA 4DG1B 1QTNB 1S1UB 1SKSA 1SJ4P 1HW9A 5HMWA 1DBDA 2ZM6J 3FEXB 2QLFB 3I0RB 5IWAF 1GFWB 3US5A 2JVOA 3IG1B 2CQGA 3CJ8A 3MECB 2XZTB 3JXOA 4KGZB 4RUBA 2YKMA 2EFVA 1VCTA 2IVYA 2MGZB 3GIJA 4NE9C 5DDOC 2FGOA 3PEHA 3W5ZA 3GSDA 4W92B 2XLJA 4JI1F 3MR3A 3TI0A 1NDPA 2QIFA 2ZBPA 5LSLA 4DX5A 4H4OA 1X5SA 4GKKJ 4WFXA 1RCOB 1SC1B 3N6MA 5HLFB 3LALA 2RB7A 1S9GB 2OUGA 1PO6A 2CQ3A 3QT6A 4YUDA 4KQZA 3PRDA 2BKPA 1D3WA 3P45B 1SHQA 4B3TF 1T7PA 2ILZA 4KH1B 4I68A 5CYMA 2RRAA 2DD8S 1RZMA 3FGVA 2LP4A 1VS3A 2BJ3A 1RHQB 3DHWC 5L39A 2R8IA 1GX6A 4W98A 1G2EA 3VTIA 5TJ3A 4GRSA 4F0MA 3ZNJ1 3SMZA 1HWLA 4K4ZA 4IH6A 2XYPB 1FKOB 3BZQA 3FBFA 2DCLA 1QUVA 1RTHB 3UVJB 3MMJA 5K14B 4URQU 2KJWA 1IKXA 4C0BA 2C3OA 1B7YB 4OHVA 1RT7A 2BANB 2OEJA 1XR7A 4W4MA 2W5SA 2G1HA 1F2HA 1O5JA 3G8QA 2X3DA 3VF0B 1F9HA 2Q1LA 3B4DA 2Z2MA 3HSDA 5DQHA 2AT1B 2JC0A 2BZ2A 4Y6IA 3CCWA 1IKVB 3FMWA 1REVA 4DV4F 1S9EB 4X4PA 4ZVUB 3OUYB 4DZDA 4JUZA 4RU2A 3KG0A 3C3LA 1X4GA 2BW2A 3OLBA 3R2DJ 2VASA 2KHCA 1M1HA 2AEMA 2J6TA 4PUOB 4ZKAA 1ED9A 3QJPA 1S5ZA 4F25A 1S49A 3QMQA 2NZCA 1JXLA 2PI5A 4RNHA 2E44A 3RGIA 2YNGB 1FEEA 3CJKB 2NQPA 3D5MA 5GRRA 1C1CB 1OWXA 2ADCA 1RT4A 1R31A 2IFYA 1H98A 4JV0A 2DNNA 2AQ4A 4WK3A 2V63A 2CPYA 3I9V9 4CLFA 2XGQA 1RAAB 1JLEA 4FYVB 2X1FA 2NCKL 1O99A 2MZQA 3EE3A 4TYAA 3TEHB 2I8EA 1AFJA 4KGVB 4OYZA 5F0WA 4R5PB 2W2QP 3CD7A 1GNKA 2RMLA 5E3RA 4ZLLA 2EG2A 1KR4A 1FJEB 3QJJA 2CVIA 4NLVA 2LQ5A 5H9EJ 4C8YA 4TU9A 4DL4A 2BBEA 2QYCA 1EX8A 1TMJA 3VVTA 2HWIA 4A8KA 4URSA 3OL8A 3IP0A 1FRJA 1MROB 2VJVA 4U8YA 5K8MA 3KK3A 1FJGJ 1FXLA 1NNDA 2KFNA 3IGZB 1NDKA 4TQSA 4DSLA 1HHQA 1BY9A 1TL3A 1QLNA 2MHNA 2MQMA 1R43A 3W9IA 1BQNB 1AFIA 4KE5A 3GILA 5THWA 2DRDA 2GHVC 4KJGA 1QAIA 3PR4A 3ZFVA 2RS8A 1TKZA 2D74B 3QT8A 4DR4J 5INHA 1EETA 2K06A 3BGRB 3KLFA 3J7A1 1ZA2B 3N01A 4LSNB 3R1HA 3GCWP 3JQJA 3BYRA 3AOCA 4QIGA 4CLTA 3D68A 2E5JA 3IAM9 5DJBA 3TZYA 4LR2A 4EYIB 1Y0HA 2OPQB 2I2YA 2P6TA 1WI6A 3LP2A 3T1AA 5L8RC 2HIYA 3G6XA 1XQIA 2MSTA 2N7YA 4FDJA 5GADI 3T9ZA 3MD3A 3U02A 2A2DA 2RKIB 2OKQA 4ZP8A 4A8OA 4USJC 1VHIA 1RHMB 5ETLA 5HANA 2QLWA 2AX1A 4WWSA 3CC7S 1UVKA 1KQFB 1XN9A 5KFDA 3Q22A 3R2CJ 1BC6A 2CPXA 3MTKA 1IN0A 2AP6A 2MY7A 4U6PA 2M8DB 3Q0AA 3QZ8A 4QAXA 3EWGA 4ECQA 2Y9HA 2ZH5A 4EK2A 3OT9A 4DV5J 5H9EK 3SSRA 3DDKA 4NCAA 5ETMA 1DARA 2QX0A 1FJCA 5ETQA 4PAAA 1MG7A 1WEXA 1ALIA 2OPRB 1WG4A 1L3VA 2D3ZA 4G6VB 2W8KA 4MTPA 1HWIA 5LM7E 5CD4H 3CXCR 4Y2KA 1JLBB 1ANIA 3FCHA 2HNDB 4ES3A 3SZ2A 1IBMF 3T5JA 2VFSA 2G9YA 1N88A 2OGUA 3QJLA 3GP9A 5KT4A 5A2QY 4FXVA 1N34F 3WAYA 4RW4B 5E3PA 3KK2A 2DNZA 1Z4UA 1SC3B 2HHXA 2YWGA 4DSEA 1TVRB 4G65A 3JQMA 1R0AB 2CNNB 3QZ7A 1FEHA 1V5IB 2J0WA 3TAMB 2F7VA 3LWMA 1T8EA 3M8YA 2HFZA 1BUXA 4N76A 2W25A 2ASLA 5LMNJ 3RJMB 5DZ6A 4CNYA 1C0TA 1FRXA 2UUBJ 1RT5A 1RT2A 2DRBA 3G8TA 1HNXJ 2QA4S 6FD1A 2VPYB 2R7UA 2UUWA 4RNNA 2V6AA 4A48A 3UNYA 1VQ5S 1U02A 4BC9A 4NXMF 2VFVA 5AE2A 5I42A 2ZNYA 2YH0A 5GMDA 1UKUA 4CXSA 1VQ6S 2FVCA 1SH2A 4LIRA 1FERA 1PC5A 1Q78A 2F4VF 2WK4A 1S7IA 4OI4A 2ATCB 3QGGA 1FNOA 4C8ZA 2W5XA 1HNWJ 2R7WA 3J81Y 1B8JA 3E2EA 3BREA 2BABA 4YY3J 3P8BB 3NKRA 2YNFB 4J9OA 2JFDA 4NLRA 2PO4A 3PX6A 2MKCA 4DR7J 1JWWA 2LFVA 4QOTA 1T11A 4DOZA 3GFXA 2CNOB 1PIEA 4FYXB 1YJUA 2L9WA 1SV5A 4MFBB 4FPRA 4NASA 4M94A 1T3OA 4M5DB 1N5YB 2KKHA 4Z37A 3B5QA 4JI6F 2D9OA 4KHPJ 2FDNA 1JJ2R 3TR5A 2QV6A 1EW2A 4DV6F 1FI4A 1HI8A 3GZ7A 4RWWA 2VFUA 2N82B 1WACA 2HFVA 3FSIA 1S1UA 1BD6A 3OFHA 3QPIA 3D0IE 2AMCB 3EGWB 5HROB 3CD5A 3R3TA 3IG1A 5H9FJ 2Z0GA 1UPPA 3LH2S 3EXYA 3MFHA 1C4AA 4C3KA 4I6WA 4QIVA 3QQCD 3K5LA 5D78A 4QU7A 4C7QA 1XMBA 1RAEB 4JV1A 1UJ6A 5LSOA 2KXNB 5BYQA 1RYRA 3H20A 2BQ3A 3HHLB 3K5MA 2HNYA 2R2TA 1WELA 2GQQA 2UVWA 1U6FA 3M8QA 1NJXA 4FDFA 1RT6B 2HGMA 3R5DA 2ROGA 2PMWA 1E1ZP 1TFWA 2UUTA 2HRYA 2P5VA 2E1RA 1PSDA 3QSIA 4QQBA 1L5UA 1JLAB 2HVIA 5HLFA 1HBUB 4X66F 1BGXT 1CJTB 2PN6A 4MK9A 3QIDA 5IWAJ 2ILYA 1JLFB 2RNEA 4ED3A 2VQFF 1M5OC 3M2UA 4NMLA 5IV4A 4DI6A 4I6YA 3SZYA 3GYGA 4WKYA 1RTJB 4ZA1A 3K89A 1FWPA 1F60B 4X64J 4KGKA 4PWDB 4H4KC 1X60A 4XPEA 3GSIA 4OZ0A 4QWCA 2HQGA 1KTVA 4A8FA 2VFTA 2W8LA 3M8ZA 1FKOA 2VPXB 1UEKA 3IC1A 3UVJA 1JLGA 3NBPB 4RU9A 5K14A 3PFEA 2KZZA 1YJNS 2GJ2A 4FKYA 2BXJA 2JLFA 2BANA 1XK8A 3G2XA 5T7LA 2KH9A 4LVNP 5C5JA 1TKTA 4LRDA 2I1RA 2G4BA 4DSJA 3AA8A 3ONQA 2Z30B 2MJNA 1FX4A 2C2NA 5KFUA 2HZCA 4JI3J 4NYPA 4DDFA 1X4AA 3K5PA 1IKVA 1ELXA 2XS7A 1TK0A 1NHKL 1A6LA 4F0HA 1F5BA 4ILLA 2GLQA 1SL1A 2BEFA 3NKYA 1QSSA 2VD3A 4OZNA 1R7IA 5E41A 4DCOB 2AWZA 1FKPB 8RUCA 3EDQB 3OSNA 3EPIA 3DRSB 4PUOA 5KFRA 4ID8A 2GSUA 4O3QA 4I2PA 3UCGA 1JIHA 4KBIA 2VFRA 2HS0A 4XPCA 4UZCA 1KRPA 3IBCB 1C1CA 2C3PA 1F9EB 5G4DA 9ATCB 4PYDA 1R3NA 1RLDA 1U1KA 3MR5A 4G1QB 4ZP6A 3TW0A 3PW7A 2WVDA 2ZDOA 2FHJA 5IC6B 4R5PA 4OYWA 5DG8A 6AT1B 4XAKA 5KFJA 2ZH1A 4C4WA 4DL2A 4RW6B 1D1UA 4K0KF 2V2QA 1ICEB 1KH7A 2W8DA 2ZKUA 3MK1A 2WVEA 3P6YC 3MK0A 3DXSX 4LFAF 2B6AB 3SYZA 4WZMA 1VRTB 4B9UA 4OX9F 1TL1B 1MROA 5A8RB 2FHJD 4K8RA 4C3LA 2B7BB 2V8HA 4WFZA 3S7RA 1LW0B 3CF5Q 3C16B 1FDBA 4KJIA 2E9RX 3DOKB 4MKBA 3NEKA 2D1CA 4OZ1A 3Q8SB 2E66A 2CPZA 2IRYA 3BSCA 5HMYA 1N32F 4HKQA 3VGVA 5ETKA 2HFNA 3RW7A 1QD1A 1YK9A 3NL0A 5EWGA 3J7YI 3BGRA 1IBLF 2QZ8A 1IXKA 1SJFA 1UVNA 2J7KA 1SQFA 4DR1J 2MTLA 2WB1D 4U67Q 2Y8YA 2J5AA 1EZZB 3AD9C 4DFJA 4ZVEA 2BW7A 5CABA 2BDPA 1RE1B 1VQ8S 4XTTA 2OPQA 4WYLA 3PR5B 1Q53A 1B0VA 2KL8A 5A2QU 2A6MA 4NWJA 4HTJA 3E2DA 3GU0A 3MMCB 4OQJA 3DRRA 3BF4A 4DL5A 4OFZA 2VC1A 2VPZB 3WZ0A 2QL7B 5KT5A 3CMES 2G2YA 3OXFA 1NMEB 3Q86A 5KFLA 1SXLA 1CG2A 3HF5A 3NWGA 5KTQA 2ZE2B 4ZLNA 2BX6A 2XMVA 1I94J 1CULA 2N3OA 2XMAA 4RPFA 4UOFA 2WVBA 1HLWA 2YWWA 3DCAA 2LQ8A 1UZHA 2JEGA 2L48A 1X4CA 4QIWD 4ES1A 1NSQA 1KHJA 2VC0A 4QWDA 2OTJS 4Z2XA 5EUHA 2YPYA 2PMHA 4ED6A 4HLBA 1BWEA 4M5IA 4TLRA 2X1BA 4GTYA 1HQ2A 2DEIA 3TO8A 4GC7A 4WCEQ 4C8KA 4F4AA 4F4XA 2WBMA 2HNDA 2L9DA 2VA3A 1KS2A 5HN0A 1NHUA 5EGHA 2POKA 1M5VC 2IA6A 2CIMA 4E98A 4RW4A 3JSRA 1GMWA 3RU0A 3NNAA 3LP0B 1X9MA 1RA6A 4IG3B 4C0HA 5JVHQ 2P9EA 3PYEA 1Y00A 3BR8A 1R0AA 4L6V3 3G82B 3MM6B 3Q2TC 2NSBA 3CJ5A 3J81U 4CP5A 1P9QC 4J9SA 5EWFA 2J0SD 2UV8A 4DSFA 3P5TL 5GAGI 2BQRA 3SQGA 1Q7YT 3IBWA 2H48B 5BR8J 1JXVA 3N0VA 3R9LA 1T03B 1VYAA 4F2RA 3NY0A 1GMWD 3IS9B 2NPIA 2D1GA 3L4BC 3POTA 4JI2J 2QFIA 2UUCJ 3B8HA 4EYHB 1ED8A 3BR9A 2KJVA 1LNQA 5JMNA 1HA1A 3L7PA 1NK9A 1N34J 3LGNA 2Y0BB 3V4MA 1RAHB 4B08A 2G0CA 3OJSA 3JQKA 1T02A 4P6QA 1RABB 3V5RA 3ZZZA 2XI3A 1WC3A 4ZGAA 3IWNC 1YBUA 2IAJB 2IY5B 4GTZA 2AJ4A 1QDUB 4ZPTR 5L0EA 1R27B 3I0SA 3FZ2A 2GC8A 3L7OA 1N5TA 4LF4J 2NPFA 2NXCA 1TKDA 4Y34A 2CJBA 2QMUB 3QWUA 3A1YG 5B09A 1F2GA 4CWBA 5BXIA 5B7WA 4DR5F 4ZK7M 2DGOA 3EPGA 3VAJA 5HMZA 4YHHF 2E1PA 2AJQA 3LA0A 2H5EA 9RUBA 3NGSA 1KHVA 2BKOA 2V5HG 3HHNB 1FVQA 1FD2A 1VBKA 3CT9A 4O3RA 3RBDA 2W5WA 1YKWA 2CQDA 2XR9A 4J9KA 3NKPA 5HROA 2JL9A 3HXMA 2XLKA 5B0FA 5LIAA 1EAYC 4ANDA 1QVFR 1ROFA 1RT3B 4B17A 2MXYA 2R2UA 4TU8A 2ZITA 5M2RA 7AT1B 1LWXA 1FSUA 1YZ6A 1HWKA 3Q89A 2HBZB 2WTFA 1LEOA 3C15A 1I3OB 2DR6A 1E33P 4PXDA 3KD8A 2MSSA 1A9NB 2MZ1A 4X65F 4KKOB 2CQ0A 2QMXA 1RADB 1T95A 1S0VA 4FVMA 5KG0A 1T9XA 3BGOP 3M30A 1R0CB 1UAWA 5IFMA 1OSCA 3BGLA 4DN0A 3QO9B 2Y1RI 2JEFA 2CG8A 1HBUA 4NEYA 2AJ1A 2RE1A 3FC9A 3MR6A 2MJUA 1VQMS 3NG8A 5F8GA 1D8YA 3AH6A 1OY8A 3ZTSA 3OLAA 2RT3A 1SKWA 1WC1A 4PCQA 3PJ9A 3LUYA 3D1HA 1LK5A 4CYSA 4B56A 1RTJA 5AE3A 2AJ2A 2J7WA 4KC5A 2NUHA 5KOXA 3JTNA 2JLGA 4CCHA 2UU9J 4DV1J 4PWDA 1S1XB 2LU1A 2W7OA 4I7FB 2CFXA 5FDLB 2DH7A 3KLEB 3CMAS 2A0FB 2WW4A 2LDIA 3DLJA 5F3TA 4B9TA 1NSAA 1PJ5A 2G9OA 4HYKA 3NBPA 1FRLA 4NL5A 2YWKA 2IBKA 4N8OA 2W9AA 4ICLB 3EDRB 2EBGA 3I32A 2W9BB 5LSRA 2HBYB 2PA8D 4KB7A 5I3QA 4ZVSB 1H7WA 2F65A 2RDDA 2VQEJ 4DPXA 2Q66A 2B4OA 4WZQA 3RRKA 2VQFJ 2QA2A 4HT5A 1DTTA 4KSEB 1JQGA 1B64A 4X4VA 1JLQB 1PYSB 5EX3A 5HRTA 3DI6A 3DMJB 2CVEA 5J2NA 2MLXA 1SH3A 4CDIA 3UPFA 4CQ1A 2V8GA 2BJDA 3D3BJ 1WOOA 2K3IA 2GHPA 1VHFA 2FJXA 2PC6A 4YB6A 3W60A 1P1TA 1S4FA 1MMNA 1HQUB 1ELOA 3DOMB 2KM8C 4Z7CA 4P74A 4H54A 2HW3A 2WVFA 1K1SA 3FBCA 3VQTA 3X1LB 1TFYA 5G0RB 5KFNA 2R42A 2L08A 1Z2LA 1VQKS 3MCOA 3HVTB 4N8NA 2VG5A 1EW9A 4IG0B 2IRXA 2HAFA 1QAYA 3BO4A 1K47A 4LF8F 4RW6A 4TU7A 2XQCA 4H4MB 4NLTA 2J8AA 1IM4A 3F73A 3JSMB 2QSFA 3W65A 3CCVS 5B0BA 2C2KB 1JK9B 5SZTA 1VRTA 4JYAJ 2XSJB 2HFOA 3DNCA 5A8KA 3TA0A 2DYAA 2YH1A 2VU5A 3I82A 4ZVPB 4DV7F 2M2BA 4LBIA 3VAFA 3C16A 4PXBA 1B3TA 3BGUA 5CAAA 1XMOJ 1KN6A 2B9YA 4Y65A 4PQAA 4AYBD 1TELA 2OD4A 3NS6A 4DMZA 4LIWA 2R7OA 2AZ1A 3T19A 4C2MA 1PAUB 4RBVA 2G0JA 2HLTA 1R6VA 1VLOA 2YQ3A 2IM0A 4ZVQB 3SCLE 2XMKA 3VV2B 5A76A 2IDLA 4AL6A 3DLHA 3BEGB 4GKJJ 3Q8QB 2XG8A 4LFAJ 1WC0A 4C11B 2HKEA 4USHA 2IM2A 3MMCA 3KMSA 4PQUB 1B0PA 3TQEA 5KG1A 4G1PA 5GVQA 1O8BA 5E0OA 4IOAQ 2VUGA 2DGUA 3HULA 5HQ8A 4Y28C 1U2FA 5CQGA 1F6TA 4LVOP 3EZ5A 1N32J 4RZRA 1SBRA 3DOLB 2VHGA 5J2MA 1AZSB 4BBYA 4L3NA 2EC0A 5GAHU 2FJEB 4OX8A 4ZJOA 2V2VA 4DV0F 2GAGC 3HT0A 3PVXA 4RO0A 4O23A 2OEKA 4Y2CA 2IM1A 1S79A 1S6UA 3EZUA 4LR8A 4TN2A 5IT0A 2LXIA 3KG1A 3M8PB 3KXDA 1BQMB 1RKJA 2MKIA 2EFGA 1UZDA 1QM9A 2ASDA 2F5GA 5A6WA 5D0RA 3LP0A 2A18A 2WSCC 4IG3A 4IYQA 2WW8A 3BPSP 1N6QB 4Q7AA 2ZH9A 4UOHA 4NOHA 2FLPA 4LRAA 4JV2A 3OTCA 4X4SA 3DFEA 2GHWA 2HWTA 3CJSA 3CCJS 5KFEA 3MM5A 1PG5B 3IS9A 1DJ0A 4EEYA 2NUUG 2KVIA 3FCVA 4AUKA 1Z2ZA 1K0VA 2Q3PA 3S1TA 3PIOQ 3TZZA 5IQ6A 1F5CA 4CLKA 1HHTP 3KFWX 3LGMA 4J37A 2J0QD 1C1BA 5LJ5Y 2RHQB 1U1PA 3OTEA 4GO7X 3GLJA 2KG0A 1HQEB 1KLMB 3K2YA 1S72S 1ZAWA 1D9AA 1R8BA 1UWBB 4NXNJ 4AXJA 4BWMA 3GTYX 2IAJA 3PV8A 4AQYF 2XO6A 3WQPA 4I2QA 4F4YA 2W5VA 4GTXA 4ZN3A 3R97A 3UR3C 2UUAF 2MQPA 4B9NA 3DYAB 1XBWA 1AUSL 1CJKA 3MEKA 4AL7A 1KQKA 2HMIA 1YIJS 1KQSR 4P71A 4CLUA 3MEDB 2E9ZA 4ETZA 5IQQA 4PXCA 4PPDA 3HJVA 3HLUA 3V81A 1H0HB 2ZC4A 1YZ7A 3PNIA 2B8QA 3W3SA 1HHSA 1RACB 3M6UA 1K9MT 1WF0A 4ZG6A 2NSCA 1T9TA 3W63A 3RUBL 2KI2A 2F4FA 1B4SA 2F9JA 2RILA 2I0XA 3WIUA 3JTPA 2VKRA 1CJUB 1SQGA 2LKZA 3V6KA 4URGA 4KGMA 4WPAA 1HMVB 4DCJB 3IGYB 2FVQA 4DWIA 2SXLA 4QZVB 3NGDA 2VQRA 1N5QA 1E6YB 3ILIA 2R7VA 1RTDB 4WTOB 2DGTA 4AXIA 4NX9A 3CC4S 2ZC3A 3LOUA 2EFNA 1WHWA 1X4HA 3LW5C 3IWLA 1Y9OA 4KM4A 2B3TB 3F44A 3GYNA 3ZTRA 3RRHA 4OHZA 5JJBA 2HQFA 3R5CA 4OV1A 5KOWA 3K7RA 4UW2A 2XGPA 2C1EB 2FJAB 1FCAA 3DDNA 4KKOA 2IMOA 1H74A 4MHXA 4DR5J 3RR7A
chains in the Genus database with same CATH topology
3UN5A 1ANIA 3T00A 2XRGA 1ED8A 3BDHA 5HRTA 2GSUA 1EI6A 3NKNA 4GTYA 4MY4A 1P49A 5AJ9A 3A52A 4CXSA 4YR1A 1AJAA 2G9YA 3WAVA 1URAA 1K7HA 1O99A 1SHNA 1ZEFA 4KJDA 4LR2A 4ZG6A 5DLVA 1KHLA 3M8WA 1ANJA 2RH6A 2X98A 1HQAA 4UPHA 3WAYA 4CYSA 4B56A 4KAYA 3TX0A 3SZZA 3WAXA 5GOVA 4LR9A 2W5WA 4UPLA 1E3CP 2XR9A 4UPKA 2W5SA 4N7TA 3Q3QA 1ALKA 1KHNA 3NKPA 3M8ZA 2IUCB 2W5RA 2W5XA 1EQJA 3BDGB 1EJJA 5DLTA 1B8JA 4LRCA 1KHKA 3UO0A 5IJSA 4FDIA 1N2KA 2GA3A 3T01A 5K4PA 5LIAA 1Y7AA 5EGHA 5IJQA 1URBA 5EGEA 3IGYB 3NKMA 4FDJA 4GTWA 4UOOA 5DLWA 3NKRA 4ZGAA 3M8YA 3WBHA 3NKQA 3ED4A 4LR8A 2VQRA 1FSUA 5LRMA 2W8SA 3NVLA 4LREA 4GTZA 4LQYA 5LQQA 4LRDA 2ZKTA 4NWJA 2IUCA 1N2LA 4ZG9A 3DPCA 1Y6VA 3BDGA 3E2DA 3IDDA 3DYCA 3CMRA 4KAVA 1O98A 3UN3A 1E33P 1AJBA 1E1ZP 3KD8A 5L0EA 1KH7A 5L0KA 2W8DA 3T02A 4CXUA 5LRNA 1ALHA 3IGZB 3BDFA 3MK2A 2QZUA 4UOPA 4UORA 3M7VA 1ELZA 1HJKA 3MK1A 3MK0A 1AJCA 3TWZA 1EW9A 2W5QA 3NKOA 2W5TA 4CYRA 3TG0A 3B5QA 1SHQA 4MIVA 1KH9A 4KM4A 1HDHA 4QAXA 2W5VA 4GTXA 1ELXA 2GSOA 1ELYA 1EW2A 2ANHA 3OT9A 1KH4A 4CXKA 1ED9A 4LRBA 3UNYA 3LXQA 1EW8A 4KJGA 1E2SP 4TN0A 1ALJA 2GLQA 4LRAA 4LR7A 2D1GA 4ZG7A 1AUKA 5INHA 1ZEDA 1ALIA 4NWXA 1AJDA 2GSNA 5TJ3A 5KXAA 1ZEBA 3WAWA 5GRRA 4LRFA 5L0BA 3SZYA 1KH5A 5C66A 3UN2A 4MHXA 4UPIA 1KHJA 2IFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UN5 A;  1ANI A;  3T00 A;  2XRG A;  1ED8 A;  3BDH A;  5HRT A;  2GSU A;  1EI6 A;  3NKN A;  4GTY A;  4MY4 A;  1P49 A;  5AJ9 A;  3A52 A;  4CXS A;  4YR1 A;  1AJA A;  2G9Y A;  3WAV A;  1URA A;  1K7H A;  1O99 A;  1SHN A;  1ZEF A;  4KJD A;  4LR2 A;  4ZG6 A;  5DLV A;  1KHL A;  3M8W A;  1ANJ A;  2RH6 A;  2X98 A;  1HQA A;  4UPH A;  3WAY A;  4CYS A;  4B56 A;  4KAY A;  3TX0 A;  3SZZ A;  3WAX A;  5GOV A;  4LR9 A;  2W5W A;  4UPL A;  1E3C P;  2XR9 A;  4UPK A;  2W5S A;  4N7T A;  3Q3Q A;  1ALK A;  1KHN A;  3NKP A;  3M8Z A;  2IUC B;  2W5R A;  2W5X A;  1EQJ A;  3BDG B;  1EJJ A;  5DLT A;  1B8J A;  4LRC A;  1KHK A;  3UO0 A;  5IJS A;  4FDI A;  1N2K A;  2GA3 A;  3T01 A;  5K4P A;  5LIA A;  1Y7A A;  5EGH A;  5IJQ A;  1URB A;  5EGE A;  3IGY B;  3NKM A;  4FDJ A;  4GTW A;  4UOO A;  5DLW A;  3NKR A;  4ZGA A;  3M8Y A;  3WBH A;  3NKQ A;  3ED4 A;  4LR8 A;  2VQR A;  1FSU A;  5LRM A;  2W8S A;  3NVL A;  4LRE A;  4GTZ A;  4LQY A;  5LQQ A;  4LRD A;  2ZKT A;  4NWJ A;  2IUC A;  1N2L A;  4ZG9 A;  3DPC A;  1Y6V A;  3BDG A;  3E2D A;  3IDD A;  3DYC A;  3CMR A;  4KAV A;  1O98 A;  3UN3 A;  1E33 P;  1AJB A;  1E1Z P;  3KD8 A;  5L0E A;  1KH7 A;  5L0K A;  2W8D A;  3T02 A;  4CXU A;  5LRN A;  1ALH A;  3IGZ B;  3BDF A;  3MK2 A;  2QZU A;  4UOP A;  4UOR A;  3M7V A;  1ELZ A;  1HJK A;  3MK1 A;  3MK0 A;  1AJC A;  3TWZ A;  1EW9 A;  2W5Q A;  3NKO A;  2W5T A;  4CYR A;  3TG0 A;  3B5Q A;  1SHQ A;  4MIV A;  1KH9 A;  4KM4 A;  1HDH A;  4QAX A;  2W5V A;  4GTX A;  1ELX A;  2GSO A;  1ELY A;  1EW2 A;  2ANH A;  3OT9 A;  1KH4 A;  4CXK A;  1ED9 A;  4LRB A;  3UNY A;  3LXQ A;  1EW8 A;  4KJG A;  1E2S P;  4TN0 A;  1ALJ A;  2GLQ A;  4LRA A;  4LR7 A;  2D1G A;  4ZG7 A;  1AUK A;  5INH A;  1ZED A;  1ALI A;  4NWX A;  1AJD A;  2GSN A;  5TJ3 A;  5KXA A;  1ZEB A;  3WAW A;  5GRR A;  4LRF A;  5L0B A;  3SZY A;  1KH5 A;  5C66 A;  3UN2 A;  4MHX A;  4UPI A;  1KHJ A;  2IFY A; 
#chains in the Genus database with same CATH topology
 2F40 A;  5CCL A;  1W2B R;  3MZI A;  3BM7 A;  4RW9 A;  4QR1 A;  1R89 A;  4ECV A;  1M0S A;  3AOD A;  3SI8 A;  3M2V B;  1XNR F;  1OPZ A;  3FDS A;  4JOU A;  3ZO7 A;  3I4H X;  2MKY A;  2DGS A;  3PO5 A;  1Q8L A;  3M2R A;  1S1T B;  3QLH B;  3R6G B;  1IR2 A;  5LT5 A;  4A8M P;  3NKQ A;  4KPY A;  3OHB A;  1ZOT A;  1ZBT A;  4J9P A;  3KLI B;  1DUR A;  2DPI A;  3WIV A;  2VIC A;  4ILM A;  1HL6 A;  1VFJ A;  3DYC A;  3MOZ A;  3BSN A;  1XNQ F;  2B5J B;  1TTH B;  1S1X A;  4CO3 A;  3BDF A;  1V9O A;  4X65 J;  1AB8 A;  3W5X A;  1HR0 F;  1R0B G;  2CDQ A;  3B54 A;  4CTA B;  3FEZ A;  4WFN Q;  2ANH A;  1VK8 A;  4KT0 C;  2X1G A;  2NR0 A;  1HBN B;  4TN0 A;  3OVS A;  1NU4 A;  2P6S A;  1U8S A;  5HK4 A;  4M63 A;  5AT1 B;  3LGH A;  4PAB A;  4P9S A;  5LMU F;  2FZK B;  4UPI A;  4OYI A;  3HKZ D;  2O66 A;  1HNI B;  2IDE A;  3H5S A;  2C2O B;  3D67 A;  4X4T A;  2IJN A;  4HL9 A;  3VQS A;  1SL0 A;  2OPP B;  4N7T A;  3Q3Q A;  4JI4 F;  1JLQ A;  2W5R A;  4LRC A;  3GG0 A;  2KFZ A;  3R8Y A;  3HVA A;  3DLB A;  1S0N A;  1WDT A;  4Y00 A;  2C2D A;  3T41 A;  4MKV A;  4HI2 A;  3EGN A;  3CMR A;  5T14 A;  3KYL A;  3DOM A;  3ENA A;  4EBE A;  3DLK B;  1VQY A;  4XDD A;  4K4X A;  2E5L J;  2PD1 A;  3UNG C;  3K0J A;  1FO1 A;  5GME A;  1FE4 A;  1KD1 T;  3HVT A;  5C2G A;  5I3U B;  1U6Z A;  1VIS A;  4CLW A;  2H9Z A;  5KG7 A;  1BHN A;  2HNZ A;  2XRG A;  2VG6 B;  1X0F A;  1X7V A;  3W2V B;  3X3U A;  2DEJ A;  2XYH B;  4LR9 A;  2XB2 D;  1NAQ A;  2XHC A;  2VBX A;  1U24 A;  1YBT A;  1PBU A;  2LMI A;  3PX0 A;  2YNI A;  2O01 C;  5DM6 Q;  4IFV B;  2G0I A;  1KDN A;  4MJK A;  2CA9 A;  5A8W B;  2QJ3 A;  4J5O A;  1S1W A;  1XR5 A;  1K1Q A;  3ETO A;  3DM2 B;  4P7T A;  1RAO A;  2VB6 A;  2BOA A;  3MAA B;  3H2V E;  5HO4 A;  3CCQ S;  3SQO P;  1N52 B;  3HVW A;  5KG4 A;  2RD5 C;  2WCX A;  5B0G A;  5KT2 A;  1Q81 T;  2DNH A;  1RIS A;  1UW9 A;  1O0P A;  1FRM A;  4LFB F;  5KFQ A;  4ZPB A;  4MYU A;  5KG2 A;  4BS2 A;  5K8P A;  1WC4 A;  3PRV A;  2XHW A;  1ZEF A;  5HVF A;  2B9E A;  4NA1 A;  5AE1 A;  4NLU A;  4RUA A;  2UXB F;  2AGQ A;  1SKR A;  3GII A;  4OYA A;  2M52 A;  3R5A A;  1SJ3 P;  1U49 A;  3SFU A;  2W8S A;  4LQY A;  4U7U D;  1T9U A;  3HDS A;  3GR1 A;  1HYS B;  3QIP A;  3R6L B;  3C19 A;  4OX6 A;  3AAW B;  2LQ9 A;  4KR0 B;  4AT1 B;  4XIU A;  1YGY A;  4JI0 F;  3T1H F;  1GAO A;  2AX0 A;  3M8P A;  2QLJ B;  1T05 A;  3D3C J;  4NLS A;  2HZA A;  4CYU B;  3ZXW A;  1WTF A;  3TAQ A;  1BQM A;  3FZB A;  1NM2 A;  1Y4Z B;  4L73 A;  3VGT A;  2M70 A;  4FYW B;  1IR0 A;  1GXT A;  5K8O A;  4LRF A;  2IJF A;  2WB4 A;  4P72 A;  1UEU A;  3P3D A;  2FHK A;  4TKT A;  1N6Q A;  2FJW A;  4DZ6 A;  1RGV A;  2XYG B;  2MQO A;  3HJF A;  5F9L A;  1ZAX A;  1N5V A;  1U47 A;  3DRX A;  4UPH A;  1A7G E;  3KLH B;  5AXL A;  5J1E B;  1WHX A;  2CQI A;  4USW A;  1UFW A;  3V6H A;  4CIO A;  5D4O A;  1K0T A;  5K8N A;  2ZH7 A;  1F0X A;  1RWN B;  4FNI A;  2J9D E;  3AXM A;  3KK1 B;  2D3U A;  2DXD A;  3FCW A;  1RHJ B;  2DY1 A;  4ED0 A;  3TAN A;  2LXF A;  5CYQ B;  3SDE A;  2CKW A;  4B9M A;  3SCJ E;  3MK2 A;  3I4P A;  5FLX Y;  3BQ1 A;  1NPR A;  2JSX A;  2AIR B;  4DR2 F;  1VQ4 S;  5IZH A;  5HSP A;  1HQE A;  1KLM A;  3QGI A;  1QTM A;  3OTO F;  1UWB A;  4QPX A;  1CJV A;  2AKW B;  4JBC A;  1RTI B;  2V69 A;  3DGV A;  2B7C B;  3M1V A;  4K4Y A;  5F8J A;  4X4Q A;  4OX7 A;  3QRR A;  2GIF A;  1U0S A;  4TY8 B;  2EK1 A;  4PG6 A;  4DR6 F;  1WC5 A;  5DLF A;  3DYA A;  4LF5 F;  2AF6 A;  3C6T A;  1U6B A;  1L3T A;  3I56 S;  3MED A;  4DPT A;  3MM9 B;  5D0E A;  3KG4 A;  2PMZ D;  1S4E A;  2HHU A;  1L3K A;  2YWE A;  2V4R A;  1YWX A;  4MAK A;  1LFW A;  4B9V A;  3L09 A;  2XY6 A;  4B9L A;  4FF2 A;  4BLG A;  4DQP A;  2ZHB A;  1CQM A;  3NGR A;  1CJU A;  1FVS A;  3I5B A;  2FD2 A;  1Q8I A;  1HMV A;  1UA1 A;  3MFI A;  1OO0 B;  4J90 A;  2X1A A;  2JNJ A;  4H4K A;  2AJF E;  3MM8 A;  4HT7 A;  4LT6 A;  3D54 A;  2R7X A;  3A3P B;  3AD7 C;  3MTJ A;  4O3P A;  4EFA C;  4EMD A;  2WON B;  5F8L A;  5EWE A;  5HAO A;  3H90 A;  2MKK A;  5EN1 A;  3V6J A;  3CE8 A;  2LDY A;  4DV2 J;  3LP1 B;  5C25 B;  1N54 B;  2HRU A;  1S57 A;  5A0Y A;  4NYZ A;  1XWL A;  2GMH A;  4MH8 A;  4WXW A;  3GIK A;  3L3C A;  2V9W A;  2DHA A;  4K2X A;  4CLS A;  3AT1 B;  3GON A;  4ALZ A;  3B4M A;  3B6B A;  1GTE A;  3HKW A;  2RQM A;  1EJJ A;  2BE7 D;  2R7T A;  2AYM A;  2VOO A;  2OPS B;  3H5U A;  3M2V A;  2LYV A;  4F4Z A;  4E2F B;  2FY8 A;  3OR2 B;  5LQQ A;  1NBE B;  2DBB A;  4FS2 A;  2ACY A;  2HAI A;  1HNV B;  2KTQ A;  4NMX A;  3QLH A;  2KM8 B;  3MAH A;  1NK4 A;  1GXL A;  1SB6 A;  2OD6 A;  2CZV C;  3RB0 A;  1J5O B;  5DDP C;  4DL0 C;  3KLI A;  2YQ0 A;  4MIV A;  2KRR A;  1ZTT A;  1QVG R;  4TNO A;  4CXK A;  3AJD A;  1K44 A;  2M4M A;  2JEJ A;  4I6A A;  3M05 A;  2COL A;  1C2P A;  2FVP A;  2ZNZ A;  3W2W A;  1RU1 A;  3RBE A;  3PDN A;  4ZIW A;  2KVQ E;  1H72 C;  3JYT A;  1R8A A;  2Z56 B;  2GSN A;  1Y5N B;  2KT2 A;  4CTA A;  5AJ3 F;  5GAD U;  1LW2 A;  1RXO B;  4WP3 A;  2FTR A;  1FX2 A;  5LJ3 Y;  3UDL A;  1DAX A;  2OHD A;  2OEL A;  2C42 A;  1XNR J;  4X62 F;  2EKY A;  1VBX A;  3DHX A;  3V6D B;  3QRP A;  4KHR A;  4LF2 A;  3U27 A;  1HNI A;  1TUG B;  3TUP A;  4QIF A;  2HQ3 A;  4ID5 B;  4LF6 J;  4ZIV A;  4ED4 A;  1KFD A;  3K57 A;  2FHM A;  3OR1 B;  2I9S A;  1F5A A;  4K5R A;  4A4J A;  4R0E A;  2OPP A;  1NK6 A;  5KFK A;  3ITH B;  5LL6 d;  2F8M A;  3VWS A;  4TYB A;  2AEJ A;  5BYR A;  2FHO B;  1UWA A;  3DLE B;  2C22 A;  3ISN D;  3TNV A;  4R8U A;  3KJV A;  2KT3 A;  2MKJ A;  2GSO A;  4RW7 A;  4ED5 A;  4WIQ A;  5E3Q A;  3QT5 A;  3PJX A;  4DX7 A;  2FLO A;  3HFV A;  5GAE U;  2YKQ A;  3E01 A;  1TV6 B;  1UVI A;  1HBM B;  1KFS A;  5LMU J;  2WSF C;  4J9U E;  4YME A;  4ZCL A;  3NMA A;  3TOQ A;  1G1X A;  4B3R J;  3MMB A;  3TX8 A;  3KUG A;  4K4V A;  2YKO A;  2HSE B;  1N56 A;  3MMA B;  3CCU S;  1HQA A;  2HGL A;  1WKL A;  5HI7 A;  2C3U A;  2HS3 A;  3P96 A;  2D3O R;  2VG6 A;  4KO0 A;  1J5E J;  5L1I A;  2LA4 A;  2AYG A;  3BSA A;  3BDP A;  3DLG B;  5DDR C;  1Q1K A;  3CJQ A;  3OXL A;  3C46 A;  3RBX A;  4LSL B;  5EGY A;  2HHH J;  2CJX B;  3NWR A;  2VDI A;  1NH7 A;  4G1I A;  2ZZM A;  2ZDP A;  2XUL A;  3DDI A;  3IFE A;  4O4G A;  3VZH A;  3TG0 A;  4NZ6 A;  3M32 B;  2NS1 B;  2GVZ B;  2B8P A;  2GJF A;  4WTY A;  1S6O A;  1R8P A;  2CXE A;  2XS2 A;  1Q95 G;  2H65 B;  5KFC A;  2YNH B;  1W26 A;  4RUH A;  4Z7Y A;  3H42 A;  4C8N A;  4ZCI A;  1SIW B;  1X4E A;  3AA9 A;  1S0M A;  2RHS B;  2ROP A;  1PYT A;  1WSR A;  1SH0 A;  2Y1J A;  3VR1 A;  1VRU A;  4LF9 J;  1BE4 A;  3RBZ A;  2CQ2 A;  2KU7 A;  4DR3 J;  2QMW A;  4O4R A;  3MEE B;  5IJS A;  1UP1 A;  1N4L A;  5E5N A;  3FRZ A;  5IJQ A;  2W1B A;  5EHH A;  2DKO B;  5C24 B;  3K5O A;  2HQI A;  2UXD F;  1S0O A;  5KFX A;  1YX2 A;  3DGP B;  2WSE C;  1EP4 A;  2QO3 A;  2YVS A;  2GVD A;  2OO4 A;  2K7J A;  5C42 A;  1SJ1 A;  4C8L A;  1Y11 A;  2GQ2 A;  5ADZ A;  3SXL A;  1ZM3 A;  1LV5 A;  4V19 X;  1HYS A;  2F8H A;  1S6Q B;  3NNH A;  1HPZ B;  5MLC V;  4DV3 J;  2GIR A;  2QL9 B;  3HCX A;  3D6F B;  3GB0 A;  4LBH A;  5D3G B;  5H1S V;  3O5T B;  5FLX U;  3MUV P;  4CYU A;  3A8J A;  4O44 B;  4ZN1 A;  4LFB J;  3NKN A;  1S7H A;  4F67 A;  2CJ9 A;  3QAU A;  1PYO B;  3RB4 A;  2KO1 A;  3OV7 A;  4P2S A;  1FRK A;  4J7C A;  4NA3 A;  1LWF A;  4ELU A;  2RVJ A;  1WOS A;  4DUZ J;  1S48 A;  5L46 A;  1CS4 A;  2EKN A;  5BJR A;  4G3I A;  2ZBR A;  3NCR A;  4ED2 A;  2RQK A;  1VQ7 S;  4B3O B;  2VL1 A;  1NK8 A;  1S6P B;  1YDL A;  3IGV A;  4OLO A;  1RWO B;  2PT0 A;  4DHV A;  2AJ0 A;  1VQN S;  3DC2 A;  3G9C A;  1NZ8 A;  1G4C A;  1HWJ A;  1NKC A;  2DNQ A;  1JXE A;  2ZJR Q;  2CJA A;  5IOL A;  5EX0 A;  2GZO A;  3H0P A;  1B0T A;  4ECW A;  3M6V A;  2ACM A;  1YJT A;  4F3Q A;  3VCD A;  3CD0 A;  2O67 A;  2CQB A;  4M1K A;  5MAO A;  4CNZ A;  1K8A T;  1M5S A;  3KHG A;  2ZM6 F;  3JSB A;  1TUW A;  4I1T A;  3G8S A;  1S12 A;  2V34 A;  2JX2 A;  3CC2 S;  4ANE A;  2RRB A;  3OXG A;  3CCS S;  3CWJ A;  4K50 A;  1FWL A;  2H1Y A;  2VG7 B;  1WHY A;  2AD9 A;  1SJQ A;  3MI7 X;  2BVZ A;  3MR7 A;  3IM9 A;  2V0N A;  1U0H B;  3OVA A;  4TY8 A;  1T3N A;  4HH1 A;  2M88 A;  4QW9 A;  4OHY A;  3M6X A;  4WXO A;  3MM7 B;  1N36 F;  1CPZ A;  3UD3 P;  1VI7 A;  1LQ9 A;  4L3K A;  3N28 A;  1IQZ A;  1HBO B;  3DU5 A;  4NLQ A;  1AJB A;  3Q2S C;  2HK3 A;  3FFI B;  2MZT A;  5J2Q A;  4A8X A;  1IR1 A;  2BQU A;  4ECX A;  2ZOF A;  3NKO A;  4QPT A;  4DR2 J;  4OHX A;  2P9G A;  5DO2 A;  3H2U B;  5AXN A;  2DNG A;  2HHT A;  3BBB A;  1N33 J;  3CNQ P;  4ZG7 A;  4IH5 A;  1RT1 A;  1U1M A;  1XEZ A;  4ATN A;  3OTD A;  2ZWP A;  4P73 A;  4F0K A;  3BO2 A;  3LAK A;  1GMU A;  1FES A;  4C6A A;  2YKM B;  4Y2M A;  1RBA A;  2AHO B;  1ZZF A;  1D8Z A;  2Y8W A;  2Q6C A;  5IM0 B;  3EMT A;  3PCO B;  1NCL A;  4QIE A;  2NYI A;  4UST A;  2JDJ A;  2GMJ A;  2GO9 A;  1N0U A;  3OJU A;  3NS5 A;  4O3N A;  4C98 A;  3PW0 A;  2QLX A;  3DRP A;  1ZZN A;  2XBP A;  1XTZ A;  4KFB B;  2YKN A;  3EVM A;  3FBB A;  1E6V A;  4H4O B;  5JUM A;  3OFE A;  4NCG A;  1N2K A;  3W7B A;  1URB A;  3CJT A;  2BUN A;  4MT1 A;  3WBH A;  2H4W B;  3TA1 A;  2XTJ P;  1B70 B;  2J8S A;  1FFW B;  3CCL S;  4EZ6 A;  4OI3 A;  1GEH A;  2BMB A;  2DTJ A;  1R8C A;  2IRU A;  5LRN A;  2GIQ A;  1S59 A;  1KNZ A;  4IDK A;  1KH9 A;  2VPW B;  1M5K C;  2O5D A;  1HNV A;  4OJG A;  3MPD A;  2KXH A;  3TP2 A;  4CO5 A;  1N5S A;  5J2P B;  1AUK A;  1J5O A;  4B3M J;  4ZCK A;  2KG1 A;  5C66 A;  4O3S A;  1XMQ J;  2FJD B;  4R25 A;  4UUW A;  7FDR A;  2MPU A;  3D4J A;  2CWX A;  4A8S A;  1P1L A;  3ICL A;  3HM9 A;  1H2U X;  1Y10 A;  2IA0 A;  1YG0 A;  3GIR A;  4DU7 A;  2DJW A;  1SCJ B;  2C28 A;  3PRB A;  4L75 A;  3CJ2 A;  4DS4 A;  3TUJ C;  4M5J A;  1RT7 B;  4YDX A;  4ZJQ A;  4ZHR B;  4UPK A;  4IO9 Q;  3Q8R B;  2QN6 B;  1TKX A;  5JVG Q;  1R8H A;  1HI1 A;  3M6W A;  2JEI A;  1IKY A;  4IOB A;  2BRK A;  3UE2 A;  3LAM A;  2EFO A;  3K58 A;  2X7I A;  1CEZ A;  3FKB A;  1FT8 A;  2BAC A;  3AXK A;  4DU8 A;  4I0W A;  1IKW B;  1EB0 A;  4DG1 A;  3FSY A;  4ID5 A;  2XNQ A;  3D0G E;  3PW2 A;  4WFB Q;  1OMS A;  2VOD A;  4I67 A;  1IBK F;  4F50 A;  3ZZT A;  5KFP A;  1AT1 B;  2C3Y A;  3I0R A;  3T1Y F;  1AXQ A;  4CZC A;  2CJK A;  1YJV A;  3MEC A;  3D2W A;  1U4B A;  1OY6 A;  4GC6 A;  4AL5 A;  1WF2 A;  4DX8 H;  2JJ4 D;  2HHV A;  2YTC A;  4M95 A;  3WAW A;  2MGZ A;  2VBW A;  2E7W A;  2L3M A;  2R8G A;  3NCP A;  4JV5 F;  4YDD B;  5HJY A;  3H25 A;  2FC9 A;  3PO4 A;  2QE5 A;  4NRU A;  4LF7 F;  1JLE B;  1KP6 A;  4ZVT B;  1IUJ A;  5JXS A;  1LWC B;  2H5I B;  4I69 A;  3GJS B;  4YFU A;  2ZH8 A;  4X2B A;  1I51 B;  1ALK A;  1UTA A;  4ZIT A;  3BDG B;  2DK2 A;  4K7Q A;  4UOO A;  1O51 A;  3NOC A;  1W25 A;  3MMA A;  1LWE B;  3TEG A;  4FBT A;  1DQA A;  1Y3K A;  1S9G A;  2RH3 A;  3DKD A;  3M8R A;  3QAE A;  2RU3 A;  3KK3 B;  4USI A;  2QZU A;  3DLG A;  1EAR A;  4LSL A;  1TL3 B;  4MMO A;  2ZFH A;  4ZLP A;  4ITS A;  1R6Y A;  1KH4 A;  5ETR A;  3C6U B;  1H6K X;  4YB5 A;  2A1B A;  4KTQ A;  1KEK A;  4IRD A;  4JI1 J;  1RP5 A;  1MSW D;  1SQE A;  5L0B A;  3M32 A;  3UN2 A;  2MB0 B;  4J9L A;  2A2C A;  4DV5 F;  3THP A;  1RTH A;  2IYG A;  1YQH A;  1BWV A;  2ALY B;  4ZCM A;  2FVS A;  4WP9 A;  3BSO A;  3ZZP A;  5F8I A;  2FPH X;  1ARO P;  5H9F K;  1NK7 A;  3CPW R;  2DO4 A;  1YJR A;  4DXL A;  3LP2 B;  2GA3 A;  2XMM A;  2UV8 G;  2U2F A;  3VAK A;  5CA5 A;  3LQV A;  2G1D A;  4P52 A;  1S9E A;  4B3T J;  4DSI A;  3OUY A;  2V4Q A;  2OH2 A;  2GGP B;  2PE8 A;  3W9J A;  1RBL A;  5C24 A;  4ED7 A;  4UOP A;  2I5J B;  3D6M B;  1NLK L;  3DGP A;  2LA6 A;  3TQ1 A;  2DNL A;  1ITP A;  4I64 A;  5LMN F;  3HSZ A;  4OYB A;  5ETN A;  1MWQ A;  4WU3 A;  5FII A;  4USK A;  3CB4 A;  2MMY A;  3HHE A;  4CM2 A;  3T5H A;  2YNG A;  3CJK A;  2NYH A;  2EBE A;  3NS7 B;  1HNX F;  3LF0 A;  2LU2 A;  2DHG A;  4NLO A;  3G86 A;  2FJV A;  1S6Q A;  1HPZ A;  3GE9 A;  3VHQ A;  2K7K A;  1TP7 A;  2Z2Y B;  4MY4 A;  2HQD A;  3KHL A;  1FHT A;  5D3G A;  4DX6 A;  2PSZ A;  2MZS A;  5HMX A;  4KV8 B;  3KK2 B;  1RQ0 A;  4O44 A;  4DV4 J;  2YXL A;  1KHK A;  2BJ8 A;  1GK8 A;  4RNF A;  4KHM A;  4LBP A;  4C3M A;  5B08 A;  4RX6 A;  4OJH A;  1UVL A;  3WX8 A;  3BH7 B;  1S76 D;  1H3D A;  4LUB A;  4YY3 F;  1RSC A;  1C0T B;  4J9V A;  4USU A;  4M8L A;  3GFY A;  3LO3 A;  3NP5 A;  3FNN A;  4B3O A;  4DR7 F;  5HP1 B;  1RT2 B;  5L9X A;  3D28 A;  1BQN A;  2UXC F;  2HS4 A;  4DL6 A;  3O3L A;  4F3M A;  2AV5 A;  1PJ6 A;  1HI0 P;  4M5L A;  1S10 A;  4ES2 A;  5KFF A;  1TMM A;  4K4T A;  4DPY A;  2HWH A;  3EGZ A;  3AY0 A;  1H7X A;  2D3O 1;  2R4F A;  3TZX A;  3FK4 A;  2B9X A;  5I42 B;  3IN5 A;  1LKZ A;  1ZET A;  1YJW S;  2WHO A;  4LSN A;  2NXE A;  1J27 A;  4O0N A;  4RWX A;  4NZ7 A;  4Y0F A;  2M3D A;  4DUY F;  1EIY B;  1MW7 A;  5LOQ A;  1PCA A;  1GMV A;  3LWL A;  4UZB A;  3K17 A;  4ECZ A;  1MMD A;  3VAI A;  1VIX A;  3BH6 B;  3UO0 A;  3IR5 B;  1Y7A A;  2J9E A;  2KFY A;  4E0D A;  1Y3J A;  2BE9 B;  4CO1 A;  3PEJ A;  5IT9 Y;  1Q86 T;  2RKI A;  2DHH A;  2VDH A;  2F63 A;  4OYM A;  4N47 A;  4KRW A;  4M5H A;  3R5B A;  3RR8 A;  3EVO A;  3KJQ B;  4F36 A;  1T9Y A;  4Q2M A;  3BO3 A;  3ETM A;  3M8S A;  2GA7 A;  1SV5 B;  2E5H A;  4DBQ A;  4EO8 A;  1NEE A;  1IM6 A;  4QBU A;  4DPW A;  3ULH A;  1HBO A;  1JX4 A;  5L38 A;  5DGA A;  3ZTQ A;  3CJ0 A;  3Q8U A;  1Q5V A;  1YRX A;  3ILL A;  1T0T V;  3ILJ A;  2OPR A;  1RLC L;  4OYX A;  4OZJ A;  2ADB A;  1JLB A;  4MK7 A;  4DFK A;  5RUB A;  4UTG A;  2GO8 A;  1RAI B;  3T6B A;  5F3Z A;  3QAT A;  2AGP A;  1I1G A;  2BRL A;  3VVU A;  3BV8 A;  4A46 A;  1TVR A;  1VRQ C;  5IM0 A;  3QYY A;  3GJQ B;  3ILO A;  1NB7 A;  3TAM A;  4UT4 A;  5C2C A;  4X64 F;  1N36 J;  3VAH A;  1VOM A;  2DXE A;  2AYE A;  2HNY B;  4KFB A;  1HIY A;  2BJ9 A;  2ZH4 A;  2ZKT A;  1VC5 A;  3M8Q B;  2C2Z B;  1RHU B;  4EUV A;  3IGN A;  1FFS B;  1RDR A;  2DGX A;  1EKR A;  3ZZ0 A;  1NJW A;  1NDL A;  4DF4 A;  2CPH A;  2MQ8 A;  4CLP A;  4ZPD A;  2RDI A;  4X4R A;  2W4P A;  3WDO A;  2Z2Z A;  1IBM J;  2DPJ A;  2CPD A;  4JI3 F;  2ZVI A;  4WBF A;  1HD0 A;  2H5J B;  1JMT A;  2PGC A;  3M2U B;  4K4U A;  1NPK A;  2JHE A;  1X4D A;  2ZBC A;  4PWW A;  2DIS A;  5BYS A;  4HDH A;  4FF1 A;  1KVK A;  2DNR A;  4DUT A;  2DO0 A;  5J2P A;  2HK2 A;  1K7H A;  2P8I A;  2DR8 A;  2H4Y B;  2DNY A;  4QCL A;  1NDC A;  3L7U A;  3NKM A;  1JLG B;  5I4M A;  2ASY A;  2YNF A;  5DLW A;  2MZR A;  1D09 B;  3I5C A;  4C48 A;  2DVI A;  4NRT A;  4KGX B;  5T7L B;  4ZHR A;  2DR5 A;  1TKT B;  3Q8V A;  1N2L A;  4ZG9 A;  1T94 A;  3GG1 A;  4RNM A;  2XMW A;  1LXJ A;  1S99 A;  1C0U B;  4MFB A;  4DN9 A;  4CXU A;  2W2M P;  4M5D A;  1N5Y A;  3FQK A;  3AQO A;  4NXM J;  5D4N A;  1KQG B;  3W62 A;  3HZE A;  2XO7 A;  2J7U A;  4R0J A;  2W5Q A;  1Q8K A;  2ALZ A;  2MKS A;  4JP8 A;  2XMT A;  3D6T B;  1IKW A;  2EC2 A;  3W64 A;  3QT7 A;  1ZH5 A;  3ENQ A;  3MF5 A;  4HEA 9;  2LEP A;  2C2E A;  2DRA A;  3JSY A;  1S97 A;  1FF2 A;  2D9P A;  1RWX B;  4IRK A;  2F4V J;  3EUN A;  5J1N A;  3MWB A;  3J81 j;  4BWJ A;  3MUR P;  3B82 A;  3DXB A;  4NLD A;  1DFD A;  1VQL S;  3CED A;  4I2P B;  1P49 A;  3A8I A;  5CCM A;  2R7S A;  3TAP A;  2B9W A;  4RW8 B;  4P2F A;  1RWP B;  4A8Y A;  4XK8 C;  2GML A;  2OJ3 A;  3SV4 A;  3AB2 B;  3IRX B;  2OEM A;  3HHL A;  2E7X A;  3QWP A;  3D1O A;  3KDN A;  2H3E B;  2J0X A;  3KJF B;  3MAQ A;  5K20 B;  3ED4 A;  1LWC A;  2CAD A;  2E1A A;  4JI6 J;  1DQ8 A;  3CDA A;  1RT6 A;  2FLL A;  4AD6 A;  1RKI A;  4O3O A;  3BDG A;  5D4P A;  2R3V A;  4DV6 J;  4DR1 F;  1FA0 A;  3UN3 A;  2P2C B;  2O3D A;  3C2P A;  2ZBQ A;  4CI0 B;  3TA2 A;  1JLA A;  1SUQ B;  1LWE A;  3TWZ A;  3HHL D;  4X4O A;  1CJT A;  4J9Q A;  1IBK J;  3KNG A;  3CW2 C;  1PKU A;  4ZVF A;  4OZ3 A;  1KOH A;  5ETP A;  3T1Y J;  1JLF A;  1EW8 A;  3I96 A;  4IOC Q;  3HD2 A;  4ZDN A;  3IXQ A;  1YRT A;  2QFJ A;  1UFL A;  2ZZT A;  1DLO B;  1A0O B;  2OFH X;  1QUP A;  2DGW A;  4ZPA A;  4KPC A;  2B43 A;  1MWZ A;  3C6U A;  4ECU A;  1I94 F;  3MXH P;  1SI9 A;  4A8Q A;  5K5M A;  4JV5 J;  4LF7 J;  2YPZ A;  3IRW P;  3MD1 A;  2YQ1 A;  3CUN A;  3KOA A;  3I31 A;  2G2Z A;  4AFF A;  1NK5 A;  4F8R A;  1U2C A;  1X4B A;  1FD8 A;  4FN5 A;  3HK2 A;  2AU0 A;  4K5S A;  1N0V C;  4XDC A;  2F3J A;  4X66 J;  1C4C A;  5ETV A;  4M5G A;  1VC6 A;  1WOR A;  4ZP7 A;  3DRR B;  2DNK A;  3SFG A;  2UZA A;  2J6U A;  1HJK A;  2QSW A;  2JFK A;  2FZG B;  1BQX A;  1VLY A;  4ANC A;  2GGP A;  3H98 A;  2HYI B;  1CUL B;  2HHQ A;  2I5J A;  2KDO A;  2Z8Q A;  1OYD A;  4OIX A;  4ZMM A;  1FKP A;  1H2V Z;  3DRS A;  1KOO A;  4AE5 A;  4MKA A;  4RBT A;  5BR8 F;  1LOU A;  2GFF A;  2PI4 A;  2CPJ A;  8AT1 B;  3KUE A;  1FDN A;  1ZPW X;  4Y2I A;  4JI2 F;  3QGH A;  3TJ9 A;  1SHN A;  2XEX A;  2GQC A;  4F04 B;  3G71 S;  2UUC F;  3TUZ C;  1VQS A;  4L76 A;  1HAR A;  2P9C A;  4NLX A;  3NCQ A;  2XY5 A;  4G1Q A;  3T01 A;  4S0M A;  1RHK B;  2QT7 A;  2ZEJ A;  2DNP A;  2XMJ A;  3W8P A;  2V4J B;  2WBR A;  4KV8 A;  4USM A;  2WOM B;  4WFY A;  3ZZY A;  3ISZ A;  5GAE I;  3GYX B;  3BPD A;  4FVC A;  4EO6 A;  2E5G A;  3PYF A;  1TUV A;  2MLZ A;  2AZ3 A;  2B6A A;  3A8K A;  3PXG a;  4HR2 A;  1TL1 A;  5IT9 U;  5A8R A;  5DRK A;  3SQG B;  3MPU B;  4OHW A;  4LF1 A;  4NA2 A;  4RLE A;  4YR3 A;  2B56 A;  2Z57 B;  1LW0 A;  3PFO A;  4K59 A;  3N6L A;  4LF4 F;  3POT B;  1ZS6 A;  5HP1 A;  2JH3 A;  3DOK A;  4OI6 A;  2QYG A;  2XZD B;  1VR6 A;  2OLW A;  3C8Y A;  3CGI A;  4FS1 A;  2X3G A;  1JB0 C;  3H2L A;  2ZJQ Q;  4OJ1 A;  2APO A;  4P2X A;  3SZZ A;  2R7R A;  1E3C P;  4X4U A;  4EGL A;  3O8W A;  4N5S A;  4NLP A;  5I3P A;  4PZV A;  3AQP A;  4K0K J;  2K1R B;  1GX5 A;  4F4W A;  2HZV A;  4F26 A;  4IRC A;  2OTL S;  2L9N A;  1F9F A;  4GO5 X;  4LRE A;  2EFP A;  1G6B A;  3IR7 B;  1Y6V A;  4OX9 J;  3TZW A;  4YB1 P;  2CJQ A;  3BJY A;  3BKU A;  1U2R A;  2HBR B;  1ZA1 B;  3I0S B;  4UOR A;  4WK1 A;  5CD4 A;  5FJ4 A;  3GWC A;  1Q0N A;  1YJ9 S;  1UL3 A;  3BDE A;  2RRN A;  2ZE2 A;  3I87 A;  2VBZ A;  2ZOG A;  2UXC J;  1SKU B;  2D7S A;  2KZM A;  2EK6 A;  5CZV A;  1NZA A;  2QG9 B;  1S77 D;  1EQ0 A;  3A8E A;  3WX4 A;  3M9O B;  2DGQ A;  1NSK L;  1IBL J;  4NZ0 A;  3UR0 A;  5ETO A;  1KKH A;  2B0G A;  2LQB A;  3C14 B;  3GIM A;  2GNK A;  4KIA A;  4DUY J;  2QC3 A;  2W9C B;  3D9B A;  3GJT B;  3KMQ A;  3OFF A;  2GAH C;  4PG8 A;  2IMW P;  3I5A A;  3F0N A;  3UCZ P;  3RB3 A;  2C2M B;  1IJE B;  3LPE A;  4B3S F;  5IXU A;  3WC0 A;  4TY9 A;  1RWK B;  4USV A;  3OTB A;  1WWH A;  4Q44 A;  3DPC A;  3G82 A;  3MM6 A;  4FKX A;  3C15 B;  2WAQ D;  5DLG A;  2UU9 F;  4DV1 F;  4UQG A;  2YY3 A;  1YJ7 A;  1H2T Z;  2CQ1 A;  2R9L A;  4DQS A;  4WYW A;  1N8R T;  5CZX A;  3NMR A;  1WDD A;  3M30 B;  1T03 A;  1AA1 B;  2EXU A;  2CPF A;  5DQG A;  3W8G A;  2BJ7 A;  1U1Q A;  4B02 A;  3RB6 A;  3QFW A;  4L72 B;  2PEH A;  4CH1 A;  1U09 A;  3OW2 R;  2VQE F;  4PWU A;  5AXM A;  5KFW A;  2XNR A;  3UFC X;  4ZVG A;  1V6H A;  4UY8 T;  2W4C A;  2UVR A;  4I56 A;  2EPI A;  4DF8 A;  2XS5 A;  4CLY A;  1JKH B;  1RU2 A;  4FXD A;  3N9U C;  5CXT A;  5DLT A;  3M9N B;  3N4W A;  2VZ9 A;  2AGO A;  2XM3 A;  4JI5 F;  5KFT A;  1YTY A;  1Q7L B;  1ACM B;  4BDP A;  2R8H A;  1VJW A;  1VIO A;  4QWE A;  1MN7 A;  2W2P P;  5E2Q A;  2XY7 A;  3O1L A;  1IWG A;  2RIJ A;  2Q43 A;  5KFM A;  2MYF A;  2YKA A;  4ELT A;  4YEA A;  1KVI A;  3EXC X;  2CNK B;  4QJV A;  4WII A;  1U1L A;  3SCK E;  5F8M A;  3MEG B;  3KTQ A;  5KFY A;  2YWH A;  1OS5 A;  1Y7P A;  5DG9 A;  1TL7 B;  3L95 X;  1N48 A;  2OSR A;  1AYE A;  2LEA A;  3ZZR A;  1C0U A;  2ZUA A;  1CVJ A;  3ZTO A;  3RW6 A;  5L1L A;  1WKJ A;  1FXD A;  1X4F A;  1FTR A;  3U1M A;  3HPO A;  4NEZ A;  2B51 A;  1DTT B;  1SL2 A;  2NXN A;  1U26 A;  3EYZ A;  2Z58 B;  1W7W A;  5F41 A;  3DI6 B;  3ZC4 A;  5J2N B;  4YR1 A;  1IWA A;  1TAU A;  1QAX A;  2X98 A;  2IJR A;  4JYA F;  5GOV A;  3OL6 A;  1TL4 A;  1WD6 A;  3W5Y A;  2QEX S;  1RT3 A;  4ER8 A;  2RUG A;  3CCT A;  4RW8 A;  5KFZ A;  2E1M C;  3G96 A;  1XMO F;  4I4B A;  2U1A A;  1YIT S;  5DDQ C;  5F0U A;  2I6W A;  4EWT A;  3IRX A;  3A3N B;  1L3U A;  3R1L A;  1B7F A;  3JTO A;  3ENV A;  4KY3 A;  3UD5 A;  2A10 A;  4HAC B;  1LFP A;  3BB5 A;  1JJ4 A;  4PG7 A;  3LAN A;  2VG5 B;  1GTH A;  2M0G B;  1NJZ A;  2N7C A;  4EZ9 A;  3QO9 A;  4YHH J;  2OP5 A;  3CCR S;  2OFG X;  3DN9 A;  3NOG A;  3AB4 B;  4NWB A;  4ECY A;  1SUQ A;  4GKJ F;  1P6T A;  4X4N A;  3VAL A;  1RBO B;  1PGZ A;  2UP1 A;  2UVU A;  3SCI E;  1NRK A;  4QW8 A;  4N56 A;  3HZG A;  3D0H E;  3NAH A;  4QWB A;  5DGB A;  5A8K B;  1Q4R A;  3ISN C;  2OI2 A;  1FKA F;  2W01 A;  2V8D A;  3QNW B;  2X51 A;  1DLO A;  2BA9 A;  1VQP S;  4OZ5 A;  2IUC B;  3PYD A;  1RB0 A;  2CAJ A;  1HW8 A;  3R5G A;  2HVE A;  4I7F A;  1NPP A;  4FF3 A;  2QL5 B;  4EI2 A;  3PG9 A;  5FDL A;  3KLE A;  1RHR B;  2HFU A;  3GQC A;  2IVF B;  1V3R A;  4U9R A;  1X5T A;  3OL9 A;  3W61 A;  4RJV A;  5DM7 Q;  4ICL A;  2W9B A;  1WG5 A;  3RAM A;  3PHE A;  1UJ4 A;  4JB8 B;  4ZLJ A;  2LVW A;  3UI3 A;  1ALJ A;  3CJ3 A;  4PXE A;  1PIL A;  5L1J A;  1QAJ A;  3RRG A;  2Q6B A;  2NXU A;  1VGY A;  2CZ9 A;  3SIP B;  3DMJ A;  4N77 A;  3T9N A;  1FDD A;  5LXR A;  2VJU A;  2UVV A;  4ZVO B;  4DQI A;  2ZBI A;  4PG5 A;  3BKF A;  3KNA A;  5J2M B;  1BMQ B;  3E3X A;  4JI7 F;  3T5L A;  2RF2 B;  2FB0 A;  1HQU A;  1RUS A;  1SC6 A;  1PC4 A;  2HG4 A;  4L74 A;  1TU0 B;  4UF4 A;  2QLB B;  2V8V A;  4FPI A;  2HEK A;  8ATC B;  3J7Z T;  2F1F A;  5G0R A;  3O44 A;  5U47 A;  2IC3 B;  1RA7 A;  2R8K A;  3TRG A;  1M5P C;  3T02 A;  2MQL A;  4U7U K;  3EIC A;  2F8E X;  2V4J A;  1URR A;  4IG0 A;  5LXY A;  2IHR 1;  4UUX A;  2WOM A;  4P2M A;  2W24 A;  1NKB A;  2KRB A;  5KFG A;  3G6Y A;  1QY7 A;  4H4M A;  5F9N A;  3TJA A;  4NXN F;  2CRL A;  4WE1 B;  3JSM A;  3ZZU A;  1OQ6 A;  1DHM A;  1M90 T;  2IFX A;  2XSJ A;  1KH5 A;  1WTB A;  1NXI A;  2YX7 A;  4QYZ J;  1S1V B;  3DRY A;  1U48 A;  3MM5 B;  1GH8 A;  3OQ2 A;  2JOQ A;  1URA A;  4DQQ A;  4CLZ A;  2IPO B;  5IV3 A;  2M5Y A;  2WVC A;  5HL7 Q;  1SIZ A;  4Q43 A;  3UWT A;  2IBO A;  2FIU A;  2BV3 A;  1NJY A;  3T5K A;  1C1B B;  2M7S A;  1T9V A;  2FUG 9;  4MIA A;  3CD6 S;  2XI2 A;  1ZM4 A;  3U1L A;  4HDG A;  4LF8 J;  4GVB B;  1F3V A;  1VBZ A;  4U7C A;  3NXZ A;  5CHC B;  2K1R A;  1L3S A;  3S01 A;  1ELZ A;  5HQM A;  2VF3 A;  4QWA A;  4C11 A;  1SC4 B;  1MU2 B;  1RWW B;  4I2Q B;  4FBU A;  4PQU A;  2FVR A;  4ECR A;  4DFP A;  2M8H A;  1URN A;  1DY3 A;  4NLY A;  4J9N A;  1CJK B;  1UVJ A;  5T41 A;  4DLE A;  1KBR A;  2Q79 A;  2HMI B;  1ZYQ A;  4ZPW R;  3UDV A;  1ZM9 A;  3FBE A;  4DV7 J;  4RUC A;  3HD1 A;  3H7H B;  5KT7 A;  2ZD1 B;  1GT8 A;  2JVR A;  3K8V A;  3PX4 A;  1RI7 A;  3BDH A;  4TQR A;  1U8W A;  1KTQ A;  4U8V A;  1MWY A;  4IUF A;  3V81 B;  4FP9 A;  4UOG A;  1M5H A;  3D6H B;  3DOL A;  1AZS A;  1DTQ B;  2RH6 A;  1RWV B;  1FE0 A;  3HT3 A;  1ZPV A;  4FDI A;  3KKF A;  3C14 A;  2DY9 A;  2KYX A;  3P4U B;  2DHX A;  4QYZ K;  2W9C A;  3U1N A;  3MPV A;  3QGP A;  3BS9 A;  2PFD A;  1UCN A;  4HTI A;  1F3F A;  2DIV A;  1XC9 A;  1QE1 B;  2J9C A;  2MHE A;  1V3S A;  2HUR A;  4E8U A;  2BJE A;  4CH0 S;  4DPO A;  4MIB A;  1HDH A;  3Q23 A;  4YS2 A;  2K8G A;  4Q8F A;  1WSV A;  3EJM A;  3MOJ B;  2C3M A;  3PYG A;  2MKH A;  4DV0 J;  4QR2 A;  3CVK A;  5KG6 A;  1Q5Y A;  4RW9 B;  5KT3 A;  5EDW A;  2CYY A;  4NI2 B;  2FY1 A;  1HNZ F;  2EWH A;  3HSG A;  1HKA A;  3GCX P;  4F02 A;  1OYE A;  5D77 A;  4DQR A;  4DL7 A;  4CRJ A;  4UY8 5;  2DB1 A;  3M2R B;  3CDB A;  4B3S J;  3BBF A;  1JKH A;  3NAI A;  4ED8 A;  1NO8 A;  2Z4P A;  5KFI A;  1F1B B;  3QBC A;  3IDD A;  1WKK A;  3H4D A;  2MQN A;  3RZA A;  1TK8 A;  3V4I B;  3N79 A;  1CSJ A;  1Q16 B;  2HGN A;  3HHD A;  1YHQ S;  3BQ2 A;  1MLA A;  2DHS A;  2HVH A;  5ITH A;  1X9W A;  2K3K A;  4YB7 A;  2GX8 A;  3MEG A;  4ZJL A;  2DGV A;  2E5L F;  3M4X A;  3CO9 A;  1TL7 A;  5J1P A;  1TK5 A;  3FVY A;  2HHW A;  1FJ7 A;  3EVW A;  2DH8 A;  4C8M A;  4B9S A;  1H38 A;  4OL8 A;  2BE2 B;  3PY8 A;  4ZOS A;  4OMF G;  2CQP A;  3Q83 A;  5B0D A;  4BCA A;  1K73 T;  2E5I A;  4HVZ A;  1NUE A;  3PZP A;  3P49 B;  5D0G A;  4BHQ A;  5HAT A;  3UDC A;  3SSQ A;  3VAM A;  4TLQ A;  2EW9 A;  3K8W A;  5AXK A;  5D8H B;  4JI5 J;  2DH9 A;  4AQY J;  2ZH3 A;  5LRM A;  4OI2 A;  1RCX B;  1WEY A;  3SSS A;  1E6Y A;  4ECT A;  3CDU A;  2AW0 A;  4DLG A;  4TXS A;  1WF1 A;  4NCB A;  1RTD A;  2UUA J;  2N4C A;  1UA0 A;  3CIZ A;  3OVB A;  1NKE A;  3IM8 A;  3MPY A;  1Y5L B;  3PIP Q;  2VBY A;  1OQ3 A;  4HAC A;  1I5O B;  1NK0 A;  3OL7 A;  1UMJ A;  3CCE S;  1EKS A;  2IYI A;  4CO4 A;  3HVR A;  1OJ4 A;  2RS2 A;  1ZM2 A;  4P75 A;  4FYD A;  2MLY A;  4IKA A;  4CH7 A;  2HNZ B;  4DCP B;  4DL3 A;  2QRR A;  1APS A;  2JRS A;  4DS5 A;  2IIH A;  3WHI A;  1JJC B;  5D6G A;  3JAM Y;  2V2K A;  3AOA A;  3FEY B;  4PG4 A;  1DZ5 A;  4C9D A;  3ET6 B;  4UOC A;  1D0E A;  2PA3 A;  1VQO S;  1S1T A;  1LXN A;  4A8W A;  4LQ3 A;  5DZ7 A;  4DFM A;  5DQI A;  1MML A;  2JWN A;  2YNI B;  4PEO A;  1SVD A;  1WJ9 A;  4O0I A;  2IUC A;  2NZ4 A;  5KFH A;  1OY9 A;  1Q79 A;  3WC2 A;  5M2P A;  4XO0 A;  2H51 B;  2B5J A;  4YN3 B;  4MIW A;  1OPI A;  2G13 A;  1S1W B;  4WKR A;  4ZPV R;  4PKD B;  3LTO A;  1VMB A;  3VGS A;  2W5T A;  4F4K A;  1VJQ A;  2Y3Y A;  2E29 A;  5HQL A;  1FRI A;  3A13 A;  3ZNU A;  1HBN A;  4IR9 A;  2W4D A;  4CLL A;  3ADA C;  3D7S B;  4LRB A;  3GJR B;  1KSP A;  3PAC A;  1JLC B;  2CWK A;  3HO1 A;  1XER A;  4PPZ A;  1AUD A;  3UN5 A;  4OLP A;  3T00 A;  1TZ0 A;  3GPA A;  3N6N A;  3GR0 A;  4CM0 A;  2QA1 A;  3FSX A;  1TAQ A;  2VIH A;  2VH7 A;  1FTC A;  3OD2 A;  2LEC A;  3CCZ A;  2YKP A;  4Q0B B;  3J80 Y;  1B99 A;  1HFE L;  2V50 A;  4K4W A;  1NHV A;  3TUI C;  2W7P A;  2G2O A;  1X0P A;  1XNQ J;  1TR0 A;  3HX9 A;  5E7O B;  4ZS6 A;  3MUT P;  2LXU A;  2RQC A;  2W2O P;  1HR0 J;  4J9R A;  4YOE A;  2RF2 A;  3JS9 A;  2Y1I A;  1Q82 T;  2XWY A;  3HI9 A;  3QIP B;  1ALH A;  3DLK A;  1WC6 A;  1GXU A;  1AJC A;  3J7Z 5;  2GJI A;  4CYR A;  3RTV A;  2ATL A;  2CJY B;  2A3J A;  5HVG A;  1T05 B;  2GCF A;  3CDW A;  4YR2 A;  2ZH2 A;  2IC3 A;  1WOP A;  3KUH A;  5I3U A;  2A6O A;  4ECS A;  3O6Q A;  3TYT A;  2ZWO A;  2K2P A;  3N5B A;  3H4B A;  4OI0 A;  1S9F A;  4JI4 J;  3AFG A;  4WE1 A;  5DET A;  1KON A;  4U95 A;  4QYR A;  4IFY B;  3W2V A;  2XWX A;  2ZJP Q;  1ANJ A;  1CQN A;  3QSY B;  4CT8 A;  4OYO A;  3AHP A;  1S1V A;  1NSP A;  3CTR A;  4JI7 J;  2CQH A;  1EQJ A;  4MK8 A;  3GV8 B;  1U1R A;  5KG5 A;  1XR6 A;  2HRT A;  2PDA A;  3UCU P;  3BKT A;  4IFV A;  1VC0 A;  5D15 A;  1REG X;  5A8W A;  1U7L A;  3MCN A;  5FD1 A;  2LLZ A;  3EGV A;  3KJN B;  1WG1 A;  3SDE B;  2MQQ A;  3DM2 A;  1IVZ A;  2O1P A;  3NLC A;  4OZL A;  3KWM A;  3K5N A;  4GMK A;  2E7V A;  3MAA A;  3IO1 A;  2NXJ A;  3R27 A;  5CH7 B;  4HI1 A;  4QU6 A;  3MPW A;  2QA4 G;  1EHW A;  4OV6 A;  1YLX A;  4GVB A;  2YX4 A;  3BQ0 A;  3PW4 A;  1CJV B;  5HVH A;  1CBK A;  3M1V B;  1AJD A;  1MU2 A;  2HFS A;  4C0O C;  4LJM A;  4LQ9 A;  3IWX A;  1FK9 B;  2ZH6 A;  1EI6 A;  4EU0 A;  4WJB A;  3C6T B;  1FNX H;  3JB9 k;  2VV5 A;  3WAV A;  1DRZ A;  1U1O A;  4DV2 F;  4KAY A;  4HHU A;  5K9F A;  2ZD1 A;  4DPU A;  4ED1 A;  2HBQ B;  2HVZ A;  2R7Q A;  4HHJ A;  1ZTW A;  3ZZO A;  2BOP A;  2FC8 A;  5K4P A;  3B78 A;  3HHK A;  1T9W A;  1DTQ A;  1MNE A;  4W90 B;  1UJ5 A;  4JI8 F;  3RYL A;  3OPK A;  3BGF A;  2ZVS A;  4GVL A;  1O98 A;  2DR7 A;  2ZHA A;  2XZW A;  3AD8 C;  2CUY A;  3MM8 B;  2YWF A;  5GMK a;  4LFC F;  3W66 A;  2ZUG A;  1D9F A;  1QE1 A;  1RWU A;  3T3F A;  4MKY A;  3R7B B;  2B4U A;  3W9H A;  2YX1 A;  4IR1 A;  3DLL Q;  1ZED A;  1UVM A;  5L1K A;  3A3O B;  1NJI T;  2UXB J;  2RUS A;  1X5P A;  3AOB A;  3UDE A;  1QSL A;  4EBC A;  3NGK A;  2CDR B;  4ELV A;  1UET A;  3G4S S;  1QSY A;  5A0Y B;  4PYA A;  3A12 A;  3FJ2 A;  2Y1L B;  3KLH A;  3IBF B;  2KN4 A;  5J1E A;  1D9D A;  4WU2 A;  1KLN A;  1ULR A;  3OBI A;  3V2U C;  4IQX A;  2HHS A;  3EZO A;  4NI2 A;  3T1H J;  4JI0 J;  3KK1 A;  4M5N A;  4M5M A;  2XCP A;  5CYQ A;  3SEO A;  2BM0 A;  2HLU A;  4RL1 A;  4LF6 F;  3FUY A;  1FFG B;  5IT4 A;  2D41 A;  2IVM A;  4ILR A;  4WFA Q;  3EX7 B;  3M7V A;  2B4V A;  1FRH A;  1PBA A;  4F7V A;  5HBM B;  3I55 S;  3HFZ B;  2GW8 A;  1RTI A;  3V4I A;  3I6P A;  5B0A A;  5IS2 A;  5SUH A;  4U96 A;  3W2W B;  2OAU A;  1QJH A;  2OSQ A;  2MZJ A;  3KLG B;  3JYT B;  3PTW A;  3MHY A;  2V9K A;  1LK7 A;  3W1Y C;  3A4T A;  1LW2 B;  2EEY A;  2BR0 A;  1V5V A;  2Y0S D;  5M2U A;  3TVY A;  1P8G A;  1H73 A;  4FZV A;  2E1C A;  2N3L A;  3MM9 A;  3NGT A;  2FQQ B;  3LPY A;  2HQC A;  5KFV A;  1IJF B;  1X5O A;  1J2V A;  1HNZ J;  2BYC A;  4GKK F;  1EQM A;  3TJ8 A;  3PKY A;  2MDA A;  4B3R F;  1NB2 A;  2FZC B;  3PM9 A;  2BE2 A;  2KYZ A;  4ETX A;  4NYO A;  4D3G A;  2N4D A;  2BKN A;  1UEV A;  3MUM P;  2CPI A;  3JAM U;  4RBU A;  3Q24 A;  5C7P A;  3CSK A;  1J5E F;  1V3Z A;  2DNM A;  4OZ2 A;  5GAH I;  3OTO J;  1WNE A;  1XIQ A;  1BXN A;  1O6X A;  6FDR A;  5L9N A;  3IMQ J;  4RNO A;  3FMB A;  5HJX A;  4FXW A;  4R8U B;  2HHH F;  2XLI A;  3KJV B;  1HWU A;  1ELY A;  4DR6 J;  2WON A;  4RW7 B;  4LF5 J;  2KHD A;  2R8J A;  3TAR A;  2V8P A;  2QGF B;  3UW1 A;  1RAG B;  3E01 B;  3LP1 A;  2DIT A;  5C25 A;  1SJR A;  2NLW A;  1RYS A;  3MMB B;  3A52 A;  4ZVR B;  4HH0 A;  4ENO A;  4Q8E A;  2V2Z A;  4YP3 A;  3H8Y A;  3E8O A;  3EM1 A;  1KHN A;  3THT A;  3KHH A;  4KO0 B;  1Z1Z A;  2OPS A;  1PAE X;  4LF9 F;  2DT9 A;  2KB2 A;  3OR2 A;  3AJ2 A;  4DR3 F;  3NVL A;  3GFZ A;  2LQJ A;  3CJR A;  5ETS A;  2W7A A;  2GV1 A;  3ET6 A;  4UQT A;  1M1K T;  1WI8 A;  5CYM B;  3J80 U;  2RAQ A;  3J7Y U;  5L0K A;  3CO0 P;  1JNR B;  3MR2 A;  1RJJ A;  3UQS A;  2DR9 A;  3TVZ A;  1Y5I B;  4O4G B;  1M1G A;  2RU9 A;  1YRU A;  3AJ1 A;  4Q5V A;  3H59 A;  1TL5 A;  4WP8 A;  5E3A A;  1IKX B;  3SBM A;  4NWX A;  2DXF A;  5KXA A;  2J76 E;  2XCA A;  4LMZ A;  7FD1 A;  4DV3 F;  4FF4 A;  3DU6 A;  3HHL C;  3RAQ A;  4J91 A;  1AJA A;  1JLC A;  1VRU B;  4A47 A;  4TVA B;  3THV A;  5B0E A;  2CPE A;  2D69 A;  2HIQ A;  5D0H A;  4UPL A;  1YBA A;  3V6D A;  1U45 A;  1REV B;  1U1N A;  3CIM A;  4OYP A;  4MYT A;  3BBC A;  1FDA A;  2HHP A;  4P10 A;  3OR1 A;  4KAI A;  4QR0 A;  4C97 A;  4Q0B A;  1YSJ A;  2MEW A;  3ITH A;  1EP4 B;  3F41 A;  4DUZ F;  4NLG A;  2GVD B;  2ZZN A;  2FJB B;  1WHV A;  5C42 B;  2JZ5 A;  1FJG F;  1I6J A;  3T6J A;  1RTZ A;  4OI1 A;  2DCU B;  1W2I A;  3NRB A;  3DLE A;  1P9Y A;  2VON A;  3BYP A;  1G7C B;  2QTW A;  5KFO A;  2LCW A;  4IH7 A;  5AJ3 J;  3CUL A;  3HFK A;  2KXF A;  1RT4 B;  2W2N P;  2JLE A;  4DR4 F;  2R2S A;  4LR7 A;  2ABY A;  5KFA A;  1TV6 A;  4ZPC A;  3J7A N;  3QRQ A;  1HBM A;  1ZEB A;  1KVJ A;  1UPM B;  3L9Z A;  4X62 J;  1UW4 A;  2EG1 A;  1IBC B;  3ZTP A;  2ASJ A;  5GAG U;  4PR6 A;  3PJW A;  1RWM B;  2GS8 A;  4KJD A;  5DLV A;  1KHL A;  3VAG A;  2AYB A;  4Q45 A;  3VZI A;  1FWK A;  2XSF A;  1LWF B;  3P5B P;  2CQC A;  4FNH A;  3G6V A;  4M5K A;  1CS4 B;  3HMJ G;  4F3O A;  4ZVH A;  2HPU A;  3CJ4 A;  3ENW A;  4IFY A;  5KG3 A;  2XMU A;  3WBZ A;  2DNO A;  3PKM A;  3MCM A;  1VQ9 S;  4J9M A;  3IR6 B;  3RG6 A;  4K2J A;  3MCS A;  2NRE A;  2V68 A;  1IQT A;  4NPO A;  4LSZ B;  1TKZ B;  2JC1 A;  1WUU A;  5IC4 B;  2WRM A;  3H5X A;  2GVZ A;  5KFS A;  1EET B;  4IQM A;  2L41 A;  3NGU A;  1TQL A;  3KLF B;  1UFK A;  4BC7 A;  3GMG A;  4IO1 A;  2PEB A;  2ERR A;  1E2S P;  2ZHO A;  3CDE A;  2YNH A;  3D1Q A;  3FRY A;  2WZ1 A;  1U25 A;  3S6E A;  2KT5 A;  4KH0 B;  3R7N B;  2ZOM A;  2LEB A;  2BM1 A;  1WEZ A;  4KYZ A;  4V1A k;  1G3O A;  4V19 J;  2M9K A;  1N33 F;  1OSD A;  3OFG A;  1VBY A;  5D4L A;  5B0C A;  2RDJ A;  4ERD A;  3UD4 P;  4WF9 Q;  1KHW A;  5E33 A;  1KWM A;  4RR5 A;  2YBV A;  2PII A;  1FK9 A;  3Q8P B;  1BLU A;  3MEE A;  1ZAV A;  1VK3 A;  3K59 A;  4DEZ A;  5F8H A;  3SV3 A;  5KT6 A;  1OIA A;  2OMO A;  1DQ9 A;  5EGE A;  1VDH A;  2EFQ A;  3H5Y A;  1CC8 A;  3MGJ A;  4Y2A A;  3MDF A;  3U7J A;  2VOP A;  4OJ3 A;  3CCM S;  3R5J B;  2H54 B;  5F8N A;  1CC7 A;  2EI5 A;  2DIU A;  4KAV A;  4K4S A;  2FLN A;  3BN7 A;  2VA2 A;  3TVK A;  2UUB F;  3BN4 A;  4F2S A;  5J2Q B;  4ZP9 A;  3G87 A;  3NNC A;  4NLW A;  2J9D A;  1YI2 S;  3KHR A;  2CQ4 A;  4Y3C A;  1P27 B;  3LXQ A;  3N5F A;  3IAS 9;  1Q8B A;  1JJH A;  2CG4 A;  3O2I A;  2HVD A;  3VGU A;  2XC9 A;  1RT1 B;  1RK8 A;  3CMQ A;  4P7V A;  4HHH A;  1EJ7 L;  3I9Z A;  2BJ1 A;  2OIH A;  4D3H A;  3KLV A;  3RAX A;  5AJ9 A;  3ELH A;  3OHA A;  2Z2L A;  4B3M F;  5CYJ A;  3C66 A;  2UXD J;  3M8W A;  4CO0 A;  1HD1 A;  3TX0 A;  3DRP B;  3KDO A;  1XMQ F;  2FGC A;  4CT9 A;  1HNW F;  2CNL B;  5KFB A;  3M9M B;  4YR0 A;  2YKN B;  2V67 A;  1E6V B;  3PW5 A;  4DJB A;  4NCG B;  1AW0 A;  3Q8Y A;  3HP6 A;  1RT5 B;  5DS7 A;  1S6P A;  2J6S A;  1RAJ A;  4JI8 J;  4FYY B;  3H40 A;  2AEF A;  3G6E S;  2F9D A;  2E9T A;  5ETT A;  2EVZ A;  4CO2 A;  1PJ7 A;  2IM3 A;  2FYX A;  3F56 A;  3PHT A;  3R7S B;  4RKU C;  5DG7 A;  2ROE A;  1FXR A;  2RJZ A;  5KAK A;  4YQW A;  4KHP F;  1RAF B;  4IDK B;  3OSP A;  1GQE A;  2B4P A;  3E51 A;  4LFC J;  3FQL A;  2R2R A;  1MN9 A;  1JNZ B;  2RSQ A;  3D66 A;  2I38 A;  3S8S A;  2C2R A;  4EBD A;  5HBM A;  2OML A;  1SPB P;  1CLF A;  3HSJ A;  3IA0 A;  4C8O A;  2CZ4 A;  5A6P A;  2VG7 A;  2RQ4 A;  1X9S A;  1U0H A;  1XJW B;  3KLG A;  2V94 A;  4PRF A;  3WAX A;  1KC8 T;  3MM7 A;  3GV7 B;  3GFH A;  3QFH A;  4N41 A;  1TKX B;  4X84 A;  4GTW A;  4Q2L A;  1IKY B;  4DSK A;  2VKZ G;  1X31 C;  1FNM A;  3GV5 B;  2PFF B;  1X8D A;  5E3C A;  3FFI A;  1NH8 A;  2MY8 A;  1YVF A;  4DG1 B;  1QTN B;  1S1U B;  1SKS A;  1SJ4 P;  1HW9 A;  5HMW A;  1DBD A;  2ZM6 J;  3FEX B;  2QLF B;  3I0R B;  5IWA F;  1GFW B;  3US5 A;  2JVO A;  3IG1 B;  2CQG A;  3CJ8 A;  3MEC B;  2XZT B;  3JXO A;  4KGZ B;  4RUB A;  2YKM A;  2EFV A;  1VCT A;  2IVY A;  2MGZ B;  3GIJ A;  4NE9 C;  5DDO C;  2FGO A;  3PEH A;  3W5Z A;  3GSD A;  4W92 B;  2XLJ A;  4JI1 F;  3MR3 A;  3TI0 A;  1NDP A;  2QIF A;  2ZBP A;  5LSL A;  4DX5 A;  4H4O A;  1X5S A;  4GKK J;  4WFX A;  1RCO B;  1SC1 B;  3N6M A;  5HLF B;  3LAL A;  2RB7 A;  1S9G B;  2OUG A;  1PO6 A;  2CQ3 A;  3QT6 A;  4YUD A;  4KQZ A;  3PRD A;  2BKP A;  1D3W A;  3P45 B;  1SHQ A;  4B3T F;  1T7P A;  2ILZ A;  4KH1 B;  4I68 A;  5CYM A;  2RRA A;  2DD8 S;  1RZM A;  3FGV A;  2LP4 A;  1VS3 A;  2BJ3 A;  1RHQ B;  3DHW C;  5L39 A;  2R8I A;  1GX6 A;  4W98 A;  1G2E A;  3VTI A;  5TJ3 A;  4GRS A;  4F0M A;  3ZNJ 1;  3SMZ A;  1HWL A;  4K4Z A;  4IH6 A;  2XYP B;  1FKO B;  3BZQ A;  3FBF A;  2DCL A;  1QUV A;  1RTH B;  3UVJ B;  3MMJ A;  5K14 B;  4URQ U;  2KJW A;  1IKX A;  4C0B A;  2C3O A;  1B7Y B;  4OHV A;  1RT7 A;  2BAN B;  2OEJ A;  1XR7 A;  4W4M A;  2W5S A;  2G1H A;  1F2H A;  1O5J A;  3G8Q A;  2X3D A;  3VF0 B;  1F9H A;  2Q1L A;  3B4D A;  2Z2M A;  3HSD A;  5DQH A;  2AT1 B;  2JC0 A;  2BZ2 A;  4Y6I A;  3CCW A;  1IKV B;  3FMW A;  1REV A;  4DV4 F;  1S9E B;  4X4P A;  4ZVU B;  3OUY B;  4DZD A;  4JUZ A;  4RU2 A;  3KG0 A;  3C3L A;  1X4G A;  2BW2 A;  3OLB A;  3R2D J;  2VAS A;  2KHC A;  1M1H A;  2AEM A;  2J6T A;  4PUO B;  4ZKA A;  1ED9 A;  3QJP A;  1S5Z A;  4F25 A;  1S49 A;  3QMQ A;  2NZC A;  1JXL A;  2PI5 A;  4RNH A;  2E44 A;  3RGI A;  2YNG B;  1FEE A;  3CJK B;  2NQP A;  3D5M A;  5GRR A;  1C1C B;  1OWX A;  2ADC A;  1RT4 A;  1R31 A;  2IFY A;  1H98 A;  4JV0 A;  2DNN A;  2AQ4 A;  4WK3 A;  2V63 A;  2CPY A;  3I9V 9;  4CLF A;  2XGQ A;  1RAA B;  1JLE A;  4FYV B;  2X1F A;  2NCK L;  1O99 A;  2MZQ A;  3EE3 A;  4TYA A;  3TEH B;  2I8E A;  1AFJ A;  4KGV B;  4OYZ A;  5F0W A;  4R5P B;  2W2Q P;  3CD7 A;  1GNK A;  2RML A;  5E3R A;  4ZLL A;  2EG2 A;  1KR4 A;  1FJE B;  3QJJ A;  2CVI A;  4NLV A;  2LQ5 A;  5H9E J;  4C8Y A;  4TU9 A;  4DL4 A;  2BBE A;  2QYC A;  1EX8 A;  1TMJ A;  3VVT A;  2HWI A;  4A8K A;  4URS A;  3OL8 A;  3IP0 A;  1FRJ A;  1MRO B;  2VJV A;  4U8Y A;  5K8M A;  3KK3 A;  1FJG J;  1FXL A;  1NND A;  2KFN A;  3IGZ B;  1NDK A;  4TQS A;  4DSL A;  1HHQ A;  1BY9 A;  1TL3 A;  1QLN A;  2MHN A;  2MQM A;  1R43 A;  3W9I A;  1BQN B;  1AFI A;  4KE5 A;  3GIL A;  5THW A;  2DRD A;  2GHV C;  4KJG A;  1QAI A;  3PR4 A;  3ZFV A;  2RS8 A;  1TKZ A;  2D74 B;  3QT8 A;  4DR4 J;  5INH A;  1EET A;  2K06 A;  3BGR B;  3KLF A;  3J7A 1;  1ZA2 B;  3N01 A;  4LSN B;  3R1H A;  3GCW P;  3JQJ A;  3BYR A;  3AOC A;  4QIG A;  4CLT A;  3D68 A;  2E5J A;  3IAM 9;  5DJB A;  3TZY A;  4LR2 A;  4EYI B;  1Y0H A;  2OPQ B;  2I2Y A;  2P6T A;  1WI6 A;  3LP2 A;  3T1A A;  5L8R C;  2HIY A;  3G6X A;  1XQI A;  2MST A;  2N7Y A;  4FDJ A;  5GAD I;  3T9Z A;  3MD3 A;  3U02 A;  2A2D A;  2RKI B;  2OKQ A;  4ZP8 A;  4A8O A;  4USJ C;  1VHI A;  1RHM B;  5ETL A;  5HAN A;  2QLW A;  2AX1 A;  4WWS A;  3CC7 S;  1UVK A;  1KQF B;  1XN9 A;  5KFD A;  3Q22 A;  3R2C J;  1BC6 A;  2CPX A;  3MTK A;  1IN0 A;  2AP6 A;  2MY7 A;  4U6P A;  2M8D B;  3Q0A A;  3QZ8 A;  4QAX A;  3EWG A;  4ECQ A;  2Y9H A;  2ZH5 A;  4EK2 A;  3OT9 A;  4DV5 J;  5H9E K;  3SSR A;  3DDK A;  4NCA A;  5ETM A;  1DAR A;  2QX0 A;  1FJC A;  5ETQ A;  4PAA A;  1MG7 A;  1WEX A;  1ALI A;  2OPR B;  1WG4 A;  1L3V A;  2D3Z A;  4G6V B;  2W8K A;  4MTP A;  1HWI A;  5LM7 E;  5CD4 H;  3CXC R;  4Y2K A;  1JLB B;  1ANI A;  3FCH A;  2HND B;  4ES3 A;  3SZ2 A;  1IBM F;  3T5J A;  2VFS A;  2G9Y A;  1N88 A;  2OGU A;  3QJL A;  3GP9 A;  5KT4 A;  5A2Q Y;  4FXV A;  1N34 F;  3WAY A;  4RW4 B;  5E3P A;  3KK2 A;  2DNZ A;  1Z4U A;  1SC3 B;  2HHX A;  2YWG A;  4DSE A;  1TVR B;  4G65 A;  3JQM A;  1R0A B;  2CNN B;  3QZ7 A;  1FEH A;  1V5I B;  2J0W A;  3TAM B;  2F7V A;  3LWM A;  1T8E A;  3M8Y A;  2HFZ A;  1BUX A;  4N76 A;  2W25 A;  2ASL A;  5LMN J;  3RJM B;  5DZ6 A;  4CNY A;  1C0T A;  1FRX A;  2UUB J;  1RT5 A;  1RT2 A;  2DRB A;  3G8T A;  1HNX J;  2QA4 S;  6FD1 A;  2VPY B;  2R7U A;  2UUW A;  4RNN A;  2V6A A;  4A48 A;  3UNY A;  1VQ5 S;  1U02 A;  4BC9 A;  4NXM F;  2VFV A;  5AE2 A;  5I42 A;  2ZNY A;  2YH0 A;  5GMD A;  1UKU A;  4CXS A;  1VQ6 S;  2FVC A;  1SH2 A;  4LIR A;  1FER A;  1PC5 A;  1Q78 A;  2F4V F;  2WK4 A;  1S7I A;  4OI4 A;  2ATC B;  3QGG A;  1FNO A;  4C8Z A;  2W5X A;  1HNW J;  2R7W A;  3J81 Y;  1B8J A;  3E2E A;  3BRE A;  2BAB A;  4YY3 J;  3P8B B;  3NKR A;  2YNF B;  4J9O A;  2JFD A;  4NLR A;  2PO4 A;  3PX6 A;  2MKC A;  4DR7 J;  1JWW A;  2LFV A;  4QOT A;  1T11 A;  4DOZ A;  3GFX A;  2CNO B;  1PIE A;  4FYX B;  1YJU A;  2L9W A;  1SV5 A;  4MFB B;  4FPR A;  4NAS A;  4M94 A;  1T3O A;  4M5D B;  1N5Y B;  2KKH A;  4Z37 A;  3B5Q A;  4JI6 F;  2D9O A;  4KHP J;  2FDN A;  1JJ2 R;  3TR5 A;  2QV6 A;  1EW2 A;  4DV6 F;  1FI4 A;  1HI8 A;  3GZ7 A;  4RWW A;  2VFU A;  2N82 B;  1WAC A;  2HFV A;  3FSI A;  1S1U A;  1BD6 A;  3OFH A;  3QPI A;  3D0I E;  2AMC B;  3EGW B;  5HRO B;  3CD5 A;  3R3T A;  3IG1 A;  5H9F J;  2Z0G A;  1UPP A;  3LH2 S;  3EXY A;  3MFH A;  1C4A A;  4C3K A;  4I6W A;  4QIV A;  3QQC D;  3K5L A;  5D78 A;  4QU7 A;  4C7Q A;  1XMB A;  1RAE B;  4JV1 A;  1UJ6 A;  5LSO A;  2KXN B;  5BYQ A;  1RYR A;  3H20 A;  2BQ3 A;  3HHL B;  3K5M A;  2HNY A;  2R2T A;  1WEL A;  2GQQ A;  2UVW A;  1U6F A;  3M8Q A;  1NJX A;  4FDF A;  1RT6 B;  2HGM A;  3R5D A;  2ROG A;  2PMW A;  1E1Z P;  1TFW A;  2UUT A;  2HRY A;  2P5V A;  2E1R A;  1PSD A;  3QSI A;  4QQB A;  1L5U A;  1JLA B;  2HVI A;  5HLF A;  1HBU B;  4X66 F;  1BGX T;  1CJT B;  2PN6 A;  4MK9 A;  3QID A;  5IWA J;  2ILY A;  1JLF B;  2RNE A;  4ED3 A;  2VQF F;  1M5O C;  3M2U A;  4NML A;  5IV4 A;  4DI6 A;  4I6Y A;  3SZY A;  3GYG A;  4WKY A;  1RTJ B;  4ZA1 A;  3K89 A;  1FWP A;  1F60 B;  4X64 J;  4KGK A;  4PWD B;  4H4K C;  1X60 A;  4XPE A;  3GSI A;  4OZ0 A;  4QWC A;  2HQG A;  1KTV A;  4A8F A;  2VFT A;  2W8L A;  3M8Z A;  1FKO A;  2VPX B;  1UEK A;  3IC1 A;  3UVJ A;  1JLG A;  3NBP B;  4RU9 A;  5K14 A;  3PFE A;  2KZZ A;  1YJN S;  2GJ2 A;  4FKY A;  2BXJ A;  2JLF A;  2BAN A;  1XK8 A;  3G2X A;  5T7L A;  2KH9 A;  4LVN P;  5C5J A;  1TKT A;  4LRD A;  2I1R A;  2G4B A;  4DSJ A;  3AA8 A;  3ONQ A;  2Z30 B;  2MJN A;  1FX4 A;  2C2N A;  5KFU A;  2HZC A;  4JI3 J;  4NYP A;  4DDF A;  1X4A A;  3K5P A;  1IKV A;  1ELX A;  2XS7 A;  1TK0 A;  1NHK L;  1A6L A;  4F0H A;  1F5B A;  4ILL A;  2GLQ A;  1SL1 A;  2BEF A;  3NKY A;  1QSS A;  2VD3 A;  4OZN A;  1R7I A;  5E41 A;  4DCO B;  2AWZ A;  1FKP B;  8RUC A;  3EDQ B;  3OSN A;  3EPI A;  3DRS B;  4PUO A;  5KFR A;  4ID8 A;  2GSU A;  4O3Q A;  4I2P A;  3UCG A;  1JIH A;  4KBI A;  2VFR A;  2HS0 A;  4XPC A;  4UZC A;  1KRP A;  3IBC B;  1C1C A;  2C3P A;  1F9E B;  5G4D A;  9ATC B;  4PYD A;  1R3N A;  1RLD A;  1U1K A;  3MR5 A;  4G1Q B;  4ZP6 A;  3TW0 A;  3PW7 A;  2WVD A;  2ZDO A;  2FHJ A;  5IC6 B;  4R5P A;  4OYW A;  5DG8 A;  6AT1 B;  4XAK A;  5KFJ A;  2ZH1 A;  4C4W A;  4DL2 A;  4RW6 B;  1D1U A;  4K0K F;  2V2Q A;  1ICE B;  1KH7 A;  2W8D A;  2ZKU A;  3MK1 A;  2WVE A;  3P6Y C;  3MK0 A;  3DXS X;  4LFA F;  2B6A B;  3SYZ A;  4WZM A;  1VRT B;  4B9U A;  4OX9 F;  1TL1 B;  1MRO A;  5A8R B;  2FHJ D;  4K8R A;  4C3L A;  2B7B B;  2V8H A;  4WFZ A;  3S7R A;  1LW0 B;  3CF5 Q;  3C16 B;  1FDB A;  4KJI A;  2E9R X;  3DOK B;  4MKB A;  3NEK A;  2D1C A;  4OZ1 A;  3Q8S B;  2E66 A;  2CPZ A;  2IRY A;  3BSC A;  5HMY A;  1N32 F;  4HKQ A;  3VGV A;  5ETK A;  2HFN A;  3RW7 A;  1QD1 A;  1YK9 A;  3NL0 A;  5EWG A;  3J7Y I;  3BGR A;  1IBL F;  2QZ8 A;  1IXK A;  1SJF A;  1UVN A;  2J7K A;  1SQF A;  4DR1 J;  2MTL A;  2WB1 D;  4U67 Q;  2Y8Y A;  2J5A A;  1EZZ B;  3AD9 C;  4DFJ A;  4ZVE A;  2BW7 A;  5CAB A;  2BDP A;  1RE1 B;  1VQ8 S;  4XTT A;  2OPQ A;  4WYL A;  3PR5 B;  1Q53 A;  1B0V A;  2KL8 A;  5A2Q U;  2A6M A;  4NWJ A;  4HTJ A;  3E2D A;  3GU0 A;  3MMC B;  4OQJ A;  3DRR A;  3BF4 A;  4DL5 A;  4OFZ A;  2VC1 A;  2VPZ B;  3WZ0 A;  2QL7 B;  5KT5 A;  3CME S;  2G2Y A;  3OXF A;  1NME B;  3Q86 A;  5KFL A;  1SXL A;  1CG2 A;  3HF5 A;  3NWG A;  5KTQ A;  2ZE2 B;  4ZLN A;  2BX6 A;  2XMV A;  1I94 J;  1CUL A;  2N3O A;  2XMA A;  4RPF A;  4UOF A;  2WVB A;  1HLW A;  2YWW A;  3DCA A;  2LQ8 A;  1UZH A;  2JEG A;  2L48 A;  1X4C A;  4QIW D;  4ES1 A;  1NSQ A;  1KHJ A;  2VC0 A;  4QWD A;  2OTJ S;  4Z2X A;  5EUH A;  2YPY A;  2PMH A;  4ED6 A;  4HLB A;  1BWE A;  4M5I A;  4TLR A;  2X1B A;  4GTY A;  1HQ2 A;  2DEI A;  3TO8 A;  4GC7 A;  4WCE Q;  4C8K A;  4F4A A;  4F4X A;  2WBM A;  2HND A;  2L9D A;  2VA3 A;  1KS2 A;  5HN0 A;  1NHU A;  5EGH A;  2POK A;  1M5V C;  2IA6 A;  2CIM A;  4E98 A;  4RW4 A;  3JSR A;  1GMW A;  3RU0 A;  3NNA A;  3LP0 B;  1X9M A;  1RA6 A;  4IG3 B;  4C0H A;  5JVH Q;  2P9E A;  3PYE A;  1Y00 A;  3BR8 A;  1R0A A;  4L6V 3;  3G82 B;  3MM6 B;  3Q2T C;  2NSB A;  3CJ5 A;  3J81 U;  4CP5 A;  1P9Q C;  4J9S A;  5EWF A;  2J0S D;  2UV8 A;  4DSF A;  3P5T L;  5GAG I;  2BQR A;  3SQG A;  1Q7Y T;  3IBW A;  2H48 B;  5BR8 J;  1JXV A;  3N0V A;  3R9L A;  1T03 B;  1VYA A;  4F2R A;  3NY0 A;  1GMW D;  3IS9 B;  2NPI A;  2D1G A;  3L4B C;  3POT A;  4JI2 J;  2QFI A;  2UUC J;  3B8H A;  4EYH B;  1ED8 A;  3BR9 A;  2KJV A;  1LNQ A;  5JMN A;  1HA1 A;  3L7P A;  1NK9 A;  1N34 J;  3LGN A;  2Y0B B;  3V4M A;  1RAH B;  4B08 A;  2G0C A;  3OJS A;  3JQK A;  1T02 A;  4P6Q A;  1RAB B;  3V5R A;  3ZZZ A;  2XI3 A;  1WC3 A;  4ZGA A;  3IWN C;  1YBU A;  2IAJ B;  2IY5 B;  4GTZ A;  2AJ4 A;  1QDU B;  4ZPT R;  5L0E A;  1R27 B;  3I0S A;  3FZ2 A;  2GC8 A;  3L7O A;  1N5T A;  4LF4 J;  2NPF A;  2NXC A;  1TKD A;  4Y34 A;  2CJB A;  2QMU B;  3QWU A;  3A1Y G;  5B09 A;  1F2G A;  4CWB A;  5BXI A;  5B7W A;  4DR5 F;  4ZK7 M;  2DGO A;  3EPG A;  3VAJ A;  5HMZ A;  4YHH F;  2E1P A;  2AJQ A;  3LA0 A;  2H5E A;  9RUB A;  3NGS A;  1KHV A;  2BKO A;  2V5H G;  3HHN B;  1FVQ A;  1FD2 A;  1VBK A;  3CT9 A;  4O3R A;  3RBD A;  2W5W A;  1YKW A;  2CQD A;  2XR9 A;  4J9K A;  3NKP A;  5HRO A;  2JL9 A;  3HXM A;  2XLK A;  5B0F A;  5LIA A;  1EAY C;  4AND A;  1QVF R;  1ROF A;  1RT3 B;  4B17 A;  2MXY A;  2R2U A;  4TU8 A;  2ZIT A;  5M2R A;  7AT1 B;  1LWX A;  1FSU A;  1YZ6 A;  1HWK A;  3Q89 A;  2HBZ B;  2WTF A;  1LEO A;  3C15 A;  1I3O B;  2DR6 A;  1E33 P;  4PXD A;  3KD8 A;  2MSS A;  1A9N B;  2MZ1 A;  4X65 F;  4KKO B;  2CQ0 A;  2QMX A;  1RAD B;  1T95 A;  1S0V A;  4FVM A;  5KG0 A;  1T9X A;  3BGO P;  3M30 A;  1R0C B;  1UAW A;  5IFM A;  1OSC A;  3BGL A;  4DN0 A;  3QO9 B;  2Y1R I;  2JEF A;  2CG8 A;  1HBU A;  4NEY A;  2AJ1 A;  2RE1 A;  3FC9 A;  3MR6 A;  2MJU A;  1VQM S;  3NG8 A;  5F8G A;  1D8Y A;  3AH6 A;  1OY8 A;  3ZTS A;  3OLA A;  2RT3 A;  1SKW A;  1WC1 A;  4PCQ A;  3PJ9 A;  3LUY A;  3D1H A;  1LK5 A;  4CYS A;  4B56 A;  1RTJ A;  5AE3 A;  2AJ2 A;  2J7W A;  4KC5 A;  2NUH A;  5KOX A;  3JTN A;  2JLG A;  4CCH A;  2UU9 J;  4DV1 J;  4PWD A;  1S1X B;  2LU1 A;  2W7O A;  4I7F B;  2CFX A;  5FDL B;  2DH7 A;  3KLE B;  3CMA S;  2A0F B;  2WW4 A;  2LDI A;  3DLJ A;  5F3T A;  4B9T A;  1NSA A;  1PJ5 A;  2G9O A;  4HYK A;  3NBP A;  1FRL A;  4NL5 A;  2YWK A;  2IBK A;  4N8O A;  2W9A A;  4ICL B;  3EDR B;  2EBG A;  3I32 A;  2W9B B;  5LSR A;  2HBY B;  2PA8 D;  4KB7 A;  5I3Q A;  4ZVS B;  1H7W A;  2F65 A;  2RDD A;  2VQE J;  4DPX A;  2Q66 A;  2B4O A;  4WZQ A;  3RRK A;  2VQF J;  2QA2 A;  4HT5 A;  1DTT A;  4KSE B;  1JQG A;  1B64 A;  4X4V A;  1JLQ B;  1PYS B;  5EX3 A;  5HRT A;  3DI6 A;  3DMJ B;  2CVE A;  5J2N A;  2MLX A;  1SH3 A;  4CDI A;  3UPF A;  4CQ1 A;  2V8G A;  2BJD A;  3D3B J;  1WOO A;  2K3I A;  2GHP A;  1VHF A;  2FJX A;  2PC6 A;  4YB6 A;  3W60 A;  1P1T A;  1S4F A;  1MMN A;  1HQU B;  1ELO A;  3DOM B;  2KM8 C;  4Z7C A;  4P74 A;  4H54 A;  2HW3 A;  2WVF A;  1K1S A;  3FBC A;  3VQT A;  3X1L B;  1TFY A;  5G0R B;  5KFN A;  2R42 A;  2L08 A;  1Z2L A;  1VQK S;  3MCO A;  3HVT B;  4N8N A;  2VG5 A;  1EW9 A;  4IG0 B;  2IRX A;  2HAF A;  1QAY A;  3BO4 A;  1K47 A;  4LF8 F;  4RW6 A;  4TU7 A;  2XQC A;  4H4M B;  4NLT A;  2J8A A;  1IM4 A;  3F73 A;  3JSM B;  2QSF A;  3W65 A;  3CCV S;  5B0B A;  2C2K B;  1JK9 B;  5SZT A;  1VRT A;  4JYA J;  2XSJ B;  2HFO A;  3DNC A;  5A8K A;  3TA0 A;  2DYA A;  2YH1 A;  2VU5 A;  3I82 A;  4ZVP B;  4DV7 F;  2M2B A;  4LBI A;  3VAF A;  3C16 A;  4PXB A;  1B3T A;  3BGU A;  5CAA A;  1XMO J;  1KN6 A;  2B9Y A;  4Y65 A;  4PQA A;  4AYB D;  1TEL A;  2OD4 A;  3NS6 A;  4DMZ A;  4LIW A;  2R7O A;  2AZ1 A;  3T19 A;  4C2M A;  1PAU B;  4RBV A;  2G0J A;  2HLT A;  1R6V A;  1VLO A;  2YQ3 A;  2IM0 A;  4ZVQ B;  3SCL E;  2XMK A;  3VV2 B;  5A76 A;  2IDL A;  4AL6 A;  3DLH A;  3BEG B;  4GKJ J;  3Q8Q B;  2XG8 A;  4LFA J;  1WC0 A;  4C11 B;  2HKE A;  4USH A;  2IM2 A;  3MMC A;  3KMS A;  4PQU B;  1B0P A;  3TQE A;  5KG1 A;  4G1P A;  5GVQ A;  1O8B A;  5E0O A;  4IOA Q;  2VUG A;  2DGU A;  3HUL A;  5HQ8 A;  4Y28 C;  1U2F A;  5CQG A;  1F6T A;  4LVO P;  3EZ5 A;  1N32 J;  4RZR A;  1SBR A;  3DOL B;  2VHG A;  5J2M A;  1AZS B;  4BBY A;  4L3N A;  2EC0 A;  5GAH U;  2FJE B;  4OX8 A;  4ZJO A;  2V2V A;  4DV0 F;  2GAG C;  3HT0 A;  3PVX A;  4RO0 A;  4O23 A;  2OEK A;  4Y2C A;  2IM1 A;  1S79 A;  1S6U A;  3EZU A;  4LR8 A;  4TN2 A;  5IT0 A;  2LXI A;  3KG1 A;  3M8P B;  3KXD A;  1BQM B;  1RKJ A;  2MKI A;  2EFG A;  1UZD A;  1QM9 A;  2ASD A;  2F5G A;  5A6W A;  5D0R A;  3LP0 A;  2A18 A;  2WSC C;  4IG3 A;  4IYQ A;  2WW8 A;  3BPS P;  1N6Q B;  4Q7A A;  2ZH9 A;  4UOH A;  4NOH A;  2FLP A;  4LRA A;  4JV2 A;  3OTC A;  4X4S A;  3DFE A;  2GHW A;  2HWT A;  3CJS A;  3CCJ S;  5KFE A;  3MM5 A;  1PG5 B;  3IS9 A;  1DJ0 A;  4EEY A;  2NUU G;  2KVI A;  3FCV A;  4AUK A;  1Z2Z A;  1K0V A;  2Q3P A;  3S1T A;  3PIO Q;  3TZZ A;  5IQ6 A;  1F5C A;  4CLK A;  1HHT P;  3KFW X;  3LGM A;  4J37 A;  2J0Q D;  1C1B A;  5LJ5 Y;  2RHQ B;  1U1P A;  3OTE A;  4GO7 X;  3GLJ A;  2KG0 A;  1HQE B;  1KLM B;  3K2Y A;  1S72 S;  1ZAW A;  1D9A A;  1R8B A;  1UWB B;  4NXN J;  4AXJ A;  4BWM A;  3GTY X;  2IAJ A;  3PV8 A;  4AQY F;  2XO6 A;  3WQP A;  4I2Q A;  4F4Y A;  2W5V A;  4GTX A;  4ZN3 A;  3R97 A;  3UR3 C;  2UUA F;  2MQP A;  4B9N A;  3DYA B;  1XBW A;  1AUS L;  1CJK A;  3MEK A;  4AL7 A;  1KQK A;  2HMI A;  1YIJ S;  1KQS R;  4P71 A;  4CLU A;  3MED B;  2E9Z A;  4ETZ A;  5IQQ A;  4PXC A;  4PPD A;  3HJV A;  3HLU A;  3V81 A;  1H0H B;  2ZC4 A;  1YZ7 A;  3PNI A;  2B8Q A;  3W3S A;  1HHS A;  1RAC B;  3M6U A;  1K9M T;  1WF0 A;  4ZG6 A;  2NSC A;  1T9T A;  3W63 A;  3RUB L;  2KI2 A;  2F4F A;  1B4S A;  2F9J A;  2RIL A;  2I0X A;  3WIU A;  3JTP A;  2VKR A;  1CJU B;  1SQG A;  2LKZ A;  3V6K A;  4URG A;  4KGM A;  4WPA A;  1HMV B;  4DCJ B;  3IGY B;  2FVQ A;  4DWI A;  2SXL A;  4QZV B;  3NGD A;  2VQR A;  1N5Q A;  1E6Y B;  3ILI A;  2R7V A;  1RTD B;  4WTO B;  2DGT A;  4AXI A;  4NX9 A;  3CC4 S;  2ZC3 A;  3LOU A;  2EFN A;  1WHW A;  1X4H A;  3LW5 C;  3IWL A;  1Y9O A;  4KM4 A;  2B3T B;  3F44 A;  3GYN A;  3ZTR A;  3RRH A;  4OHZ A;  5JJB A;  2HQF A;  3R5C A;  4OV1 A;  5KOW A;  3K7R A;  4UW2 A;  2XGP A;  2C1E B;  2FJA B;  1FCA A;  3DDN A;  4KKO A;  2IMO A;  1H74 A;  4MHX A;  4DR5 J;  3RR7 A; 
#chains in the Genus database with same CATH homology
 3UN5 A;  1ANI A;  3T00 A;  2XRG A;  1ED8 A;  3BDH A;  5HRT A;  2GSU A;  1EI6 A;  3NKN A;  4GTY A;  4MY4 A;  1P49 A;  5AJ9 A;  3A52 A;  4CXS A;  4YR1 A;  1AJA A;  2G9Y A;  3WAV A;  1URA A;  1K7H A;  1O99 A;  1SHN A;  1ZEF A;  4KJD A;  4LR2 A;  4ZG6 A;  5DLV A;  1KHL A;  3M8W A;  1ANJ A;  2RH6 A;  2X98 A;  1HQA A;  4UPH A;  3WAY A;  4CYS A;  4B56 A;  4KAY A;  3TX0 A;  3SZZ A;  3WAX A;  5GOV A;  4LR9 A;  2W5W A;  4UPL A;  1E3C P;  2XR9 A;  4UPK A;  2W5S A;  4N7T A;  3Q3Q A;  1ALK A;  1KHN A;  3NKP A;  3M8Z A;  2IUC B;  2W5R A;  2W5X A;  1EQJ A;  3BDG B;  1EJJ A;  5DLT A;  1B8J A;  4LRC A;  1KHK A;  3UO0 A;  5IJS A;  4FDI A;  1N2K A;  2GA3 A;  3T01 A;  5K4P A;  5LIA A;  1Y7A A;  5EGH A;  5IJQ A;  1URB A;  5EGE A;  3IGY B;  3NKM A;  4FDJ A;  4GTW A;  4UOO A;  5DLW A;  3NKR A;  4ZGA A;  3M8Y A;  3WBH A;  3NKQ A;  3ED4 A;  4LR8 A;  2VQR A;  1FSU A;  5LRM A;  2W8S A;  3NVL A;  4LRE A;  4GTZ A;  4LQY A;  5LQQ A;  4LRD A;  2ZKT A;  4NWJ A;  2IUC A;  1N2L A;  4ZG9 A;  3DPC A;  1Y6V A;  3BDG A;  3E2D A;  3IDD A;  3DYC A;  3CMR A;  4KAV A;  1O98 A;  3UN3 A;  1E33 P;  1AJB A;  1E1Z P;  3KD8 A;  5L0E A;  1KH7 A;  5L0K A;  2W8D A;  3T02 A;  4CXU A;  5LRN A;  1ALH A;  3IGZ B;  3BDF A;  3MK2 A;  2QZU A;  4UOP A;  4UOR A;  3M7V A;  1ELZ A;  1HJK A;  3MK1 A;  3MK0 A;  1AJC A;  3TWZ A;  1EW9 A;  2W5Q A;  3NKO A;  2W5T A;  4CYR A;  3TG0 A;  3B5Q A;  1SHQ A;  4MIV A;  1KH9 A;  4KM4 A;  1HDH A;  4QAX A;  2W5V A;  4GTX A;  1ELX A;  2GSO A;  1ELY A;  1EW2 A;  2ANH A;  3OT9 A;  1KH4 A;  4CXK A;  1ED9 A;  4LRB A;  3UNY A;  3LXQ A;  1EW8 A;  4KJG A;  1E2S P;  4TN0 A;  1ALJ A;  2GLQ A;  4LRA A;  4LR7 A;  2D1G A;  4ZG7 A;  1AUK A;  5INH A;  1ZED A;  1ALI A;  4NWX A;  1AJD A;  2GSN A;  5TJ3 A;  5KXA A;  1ZEB A;  3WAW A;  5GRR A;  4LRF A;  5L0B A;  3SZY A;  1KH5 A;  5C66 A;  3UN2 A;  4MHX A;  4UPI A;  1KHJ A;  2IFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...