3UN3A

Phosphopentomutase t85q variant soaked with glucose 1,6-bisphosphate
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
Knots found
sequence length
391
structure length
391
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDQMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Phosphopentomutase
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
source organism Bacillus cereus
total genus 140
structure length 391
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3un3A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3un3A01
4UPLA 1ZEDA 4UOPA 1ED9A 3M8ZA 3BDHA 4LR9A 3WBHA 2ANHA 2VQRA 3MK2A 1KHJA 2IFYA 3OT9A 5GRRA 2W5SA 1AJDA 2X98A 1ANJA 5L0KA 4NWJA 4KM4A 1FSUA 3IGYB 4LRCA 1KH7A 4FDIA 4LR8A 3SZYA 3T01A 3IGZB 3E2DA 4LRDA 4CXKA 3TG0A 1ALHA 1AJAA 2W5RA 4NWXA 3T02A 4ZG9A 1KHLA 1AUKA 4LRFA 2W5TA 3NKOA 3UN3A 5DLTA 4MIVA 5L0BA 5LIAA 4B56A 1B8JA 1N2LA 2XRGA 2GA3A 2GSUA 4GTXA 3NKNA 1ELZA 1KHKA 1SHQA 2GSNA 1ALKA 4GTWA 4UOOA 3SZZA 5HRTA 4ZG7A 2W8DA 3M8WA 1AJCA 1E2SP 3NKPA 1KH5A 3TX0A 4LREA 5LRNA 3ED4A 2D1GA 2W5WA 5LRMA 2XR9A 1EW2A 2G9YA 3NKQA 1EW9A 4CXSA 1ELXA 5IJQA 4UPKA 5IJSA 4ZG6A 1N2KA 3IDDA 3WAWA 5KXAA 1ALIA 4ZGAA 5C66A 3NVLA 1SHNA 1P49A 2GSOA 5DLWA 1O99A 4CYSA 1KH9A 4KJGA 5AJ9A 1ELYA 3NKMA 4UPIA 5EGEA 1HQAA 3DPCA 5TJ3A 5DLVA 3BDFA 3WAYA 3DYCA 1K7HA 1EW8A 2IUCA 4LRAA 3TWZA 1EI6A 3Q3QA 4N7TA 4KJDA 1ANIA 1AJBA 4KAVA 3NKRA 1ZEBA 4TN0A 3CMRA 3B5QA 3LXQA 4FDJA 3BDGA 4LRBA 3MK0A 1HJKA 1URAA 2ZKTA 3A52A 3MK1A 1HDHA 4GTYA 3WAXA 1ALJA 3M8YA 3UNYA 1Y6VA 1ED8A 5K4PA 3WAVA 2W5QA 2GLQA 3UN2A 4LR2A 3T00A 3UO0A 4KAYA 2IUCB 2QZUA 5EGHA 4YR1A 4CXUA 3KD8A 4CYRA 5L0EA 4QAXA 1E33P 1ZEFA 1Y7AA 1URBA 5LQQA 4GTZA 3BDGB 1E1ZP 2W8SA 4LQYA 1KH4A 5GOVA 2W5VA 1E3CP 2RH6A 4UPHA 3UN5A 4MY4A 2W5XA 4MHXA 1O98A 1EJJA 3M7VA 4UORA 5INHA 1EQJA 1KHNA 4LR7A
chains in the Genus database with same CATH superfamily
4JV2A 1YJ7A 2MQQA 1T3NA 2ZOMA 3CO9A 5KG5A 1X4HA 2IFYA 4QU7A 3BKUA 4WFYA 2IJNA 2PFFB 4OZ1A 1P9YA 1YJVA 2LQJA 4K4WA 4KV8B 3DNCA 3UD5A 2AJFE 1O6XA 2AYEA 2BKPA 1E6VB 3IR6B 1ALKA 5D15A 1XERA 2N7YA 1R0CB 1S99A 1KFDA 2A18A 4P72A 1E6YA 4K2XA 3M9NB 4IO9Q 1DFDA 3EVOA 2XLKA 3NCPA 3L7OA 3J7YI 3CJKB 2CNNB 3NKMA 2KZMA 3S6EA 1IXKA 3FEZA 1X5OA 3CIZA 2FC9A 5HLFB 4FF2A 1R0AB 3QT7A 4LR2A 3B6BA 1Y9OA 4MIBA 1GXUA 2DO4A 2LFVA 4ES1A 2RHSB 1J27A 5CCMA 5INHA 4NEYA 3UI3A 1KTVA 2XZWA 4DFKA 2B5JB 5EX3A 5J2MA 4DMZA 1KONA 2HFNA 2R2RA 2CVEA 2AEMA 3TRGA 2CYYA 3TZXA 3ENQA 2GJFA 5LXYA 1JIHA 1WG4A 3RAQA 3OTEA 2JEIA 1RT3A 2GCFA 3N0VA 3RRKA 3EGVA 3MGJA 5F3ZA 3MPVA 1DTQB 3VGTA 3KLHB 1IN0A 1TKDA 1A6LA 3BSNA 4PYAA 4F3MA 3MEGB 3ZTQA 2E44A 4QCLA 4O3QA 4CH0S 4JV0A 2KXFA 3D54A 4O44A 1QSSA 1NKBA 3I9ZA 4Z7CA 4UT4A 2ZOFA 2PO4A 3TAPA 1NH8A 4Q8FA 4G1PA 1FRKA 2JRSA 1A0OB 3BDGA 1L3SA 2LLZA 1SIZA 4MT1A 2LQ9A 1YBTA 1QE1B 3CD5A 2VUGA 2LXFA 3DN9A 2FIUA 2HVIA 2I9SA 5I3QA 2FVQA 4DUYJ 3QLHB 2OEJA 2IDEA 1GXTA 5DGBA 2NZCA 4DJBA 2V8VA 2DJWA 3R7NB 2NZ4A 4JI0J 3AODA 2C2MB 3Q89A 4M5NA 3HCXA 3LUYA 1JMTA 1N34F 3RBDA 3MM8B 4EZ9A 5L39A 2HIYA 3C2PA 1FJGF 2C2OB 3HULA 4LRFA 5G4DA 1SL2A 3QFHA 3VVUA 3ZC4A 4BS2A 3DHWC 5C7PA 4HI2A 5KFYA 1XR7A 1V3ZA 1Q5YA 3BGFA 1H7XA 3EXCX 5DJBA 3SQOP 2QLBB 1EW9A 4XK8C 1LXNA 3W5YA 2AQ4A 1N2KA 4LSLB 4RW4A 1SJQA 3TEGA 1JXEA 2MLXA 1R8BA 3PO5A 3GPAA 3DYCA 2MQLA 1NDCA 4ERDA 1YJNS 2E7WA 3VALA 1JNRB 3FGVA 2CZVC 3WAXA 1TKTB 2BJ8A 3PRBA 4HKQA 1ZA2B 2DNRA 2QZUA 3HSDA 4X66J 5DDRC 1IKXA 1S6QA 1WF1A 2RB7A 5CABA 3E2EA 3TVYA 2WOMA 3PRVA 2HFOA 3MI7X 3KLFB 2VG7B 2HK3A 3D4JA 4CDIA 1YKWA 4NA3A 1RAGB 1IJEB 4LBIA 1HPZB 1M5OC 1UZDA 3W2WA 4U95A 1W25A 3CCZA 5JUMA 3SYZA 3W1YC 5F8JA 3E2DA 3AXMA 1WEYA 3RR8A 3I32A 1KVIA 2DNKA 3NCRA 2KG1A 2IY5B 1TV6A 2UUTA 4DR7J 1DARA 1B7YB 1ZS6A 3H59A 1SJRA 4N47A 2JLGA 3NKQA 2DNLA 4TY9A 2Z2LA 1JLEB 1JKHA 5AXLA 2NQPA 2ZHAA 2K1RB 4N7TA 4WCEQ 1DTTB 1KEKA 1UVIA 2WSCC 1KLMA 1IQZA 3BQ2A 5L9NA 1S9FA 1QDUB 1RSCA 1FEHA 5U47A 4OX9J 2B9EA 5GOVA 4ID8A 4U7CA 2QV6A 3PM9A 1FKPA 3NGKA 3G6YA 2F9DA 4YS2A 2HZVA 3DGPB 3OD2A 5J2PA 2AGQA 3PHEA 3IBCB 1GK8A 4IYQA 3UCZP 2DNMA 4OV1A 3KKFA 3VGVA 1O8BA 2R7QA 1VYAA 3MR7A 1F5AA 4E2FB 4I6YA 2KJWA 2F8MA 1F2GA 3PYEA 1VBZA 3OFFA 1T05A 1S1VB 5LT5A 4OHVA 4X4PA 3M2VA 2ZNYA 2GVDB 3HSJA 3RR7A 2DHGA 2ZITA 4OYZA 3K5NA 5EX0A 4NCAA 4X4SA 1D8YA 2NR0A 5DRKA 4M5KA 5C66A 4RW9B 3N5FA 2MPUA 3JAMU 4YDXA 4KJGA 4QPTA 5A6WA 4N77A 3H40A 2JFDA 3DLKA 2V50A 4EEYA 3V81B 1BQNA 2HNYA 2EFOA 2CDQA 2D3UA 2DGTA 4DN9A 4CT9A 4C0BA 3CO0P 2ZDPA 1WHXA 5FLXU 3MM5A 5DM6Q 2W2PP 2YPYA 3KXDA 2I6WA 2W5VA 4UOGA 2RH6A 1N32J 3PEHA 5KFXA 2Z30B 4M5HA 4CP5A 4LR9A 2X1AA 2KVQE 3OLBA 4W92B 1MMLA 4B3OA 5J1EA 3KHGA 2RQKA 3M2UA 2OFGX 4DV4J 1G1XA 2NUHA 1HNWJ 3M8PA 1C0TB 5IC6B 2I5JB 3T5KA 1NO8A 1VR6A 4QPXA 1HLWA 2H1YA 2IPOB 4GVBB 5L8RC 1T8EA 3K0JA 4AQYJ 4U7UD 4WYWA 5DDQC 1QLNA 2P6TA 1MNEA 4ZVTB 4AUKA 1W2BR 2Q6CA 1CJVB 3CCJS 3S01A 4LREA 3L7UA 3GIKA 3VQSA 1YJRA 4JI4J 5KG1A 2P9CA 4NLYA 4HDHA 3TI0A 3C15B 3UDLA 4ECVA 1X31C 3MR5A 3V6JA 4B3MF 2CPIA 3Q8RB 4HH1A 3Q83A 3MK0A 2KL8A 1Y6VA 3G86A 4P7TA 3NNHA 1RWWB 3DLLQ 1RWNB 2YKMB 1WDDA 3CTRA 3MMJA 1RWPB 4DV5J 4NXNF 3IS9A 1UCNA 3KLIA 8RUCA 1S10A 2F9JA 4DR1J 3GG0A 4DLEA 5F41A 3VVTA 2MQ8A 1IR0A 2C2EA 1NJZA 1HMVB 2UXDJ 1AJDA 4K4XA 3QATA 1YDLA 3CJQA 5ITHA 3TZWA 4IKAA 1S12A 4DF4A 3PV8A 1B3TA 3JSYA 4NE9C 5C24B 2VONA 1M1KT 3OHBA 4K5SA 4O3OA 4RWXA 3W9JA 2WONA 5K8MA 3F44A 1RT2B 1TR0A 2XGQA 3KTQA 1K7HA 4A8KA 2OHDA 3BEGB 2MMYA 4DUTA 4JOUA 2LECA 2DGSA 5K5MA 4S0MA 1WSRA 4J9PA 4YFUA 3UPFA 5D4OA 1X4BA 4J91A 1EKRA 4I2PB 4FS1A 3PVXA 1DY3A 5IQQA 2CDRB 3TOQA 4RNFA 2L9NA 2RILA 3DM2B 4B9UA 2OEMA 3G96A 3FQKA 4KO0A 4OI1A 4RLEA 5KFQA 5IC4B 4USJC 1VQSA 1WC4A 4LBHA 3MK2A 3ET6A 3LP2A 1LNQA 3R6LB 3THPA 3NL0A 5KG6A 4DSFA 1VQYA 2VC1A 5AJ3J 2X51A 1J5EF 3CJ2A 2DK2A 3OSNA 3H5SA 4DZDA 2QX0A 3MUTP 2IVMA 4X64F 4OMFG 3QBCA 2O66A 2MZ1A 3CCVS 3C46A 4G65A 3FCVA 1V3RA 4R5PA 2I0XA 4ZG6A 4EGLA 1RK8A 3KG1A 3NS6A 1WF2A 1OYEA 5RUBA 1N33F 4JI2F 1KP6A 4JV5F 4CYUB 3BDFA 4NASA 1DQ9A 4QWAA 4J37A 1VJWA 3I6PA 4EBCA 2LQ8A 1BD6A 3FQLA 1HNIA 1ZTWA 3M9OB 2V8GA 1JLCB 2YKPA 3W2VB 3Q23A 4DL3A 1NKEA 4KH1B 3M7VA 4XO0A 3HFZB 1XJWB 1NK0A 1MWQA 2B4OA 4ECRA 3DRSB 1KHWA 2DNZA 3TA2A 1TL7A 1RZMA 2BV3A 3H25A 4F04B 1SC1B 1B70B 2YWWA 4OI0A 1JLGA 4DLGA 3O6QA 2JWNA 2CJBA 4PG6A 2JL9A 4FPIA 1ELOA 3HHLA 5D3GB 4WFZA 3O3LA 2BE9B 3G71S 2ERRA 3JTNA 1U24A 3M8QA 3GONA 4NWBA 1AUSL 3M1VB 3L3CA 2OJ3A 4PQUB 1EW8A 4DXLA 5K8NA 4LRAA 5IS2A 3PIPQ 1NK4A 4NLWA 2NYHA 4NX9A 2B7CB 4USWA 2VFVA 4KKOA 4HL9A 4Z7YA 3ISND 4FF3A 5KFKA 5F8MA 3ZZTA 1H6KX 1NH7A 2G0CA 3PW5A 2RDDA 1FKOB 3HZEA 4EYIB 3NAIA 1CJUA 2HQ3A 5DETA 1F3VA 4IG0B 1HWLA 3QYYA 2HVHA 4R8UA 5I4MA 5ETNA 4AL6A 4DPYA 3OV7A 3I0SB 5DQHA 1HBOB 3JSRA 2JHEA 2W9BB 4MK7A 5IV4A 5CHCB 3LP1B 3H42A 3N01A 4MAKA 2XMMA 4LIRA 4Y2AA 2VV5A 5M2UA 5J2NB 3OVSA 3ZTOA 4C8LA 4KFBA 2DT9A 1RWVB 5LMNF 1FD2A 3ENWA 3GE9A 4NXMF 2C42A 5IJSA 2M4MA 3CD7A 2GIFA 4F2SA 4RL1A 1F5BA 4USUA 4PWDA 4DX5A 2DHXA 5EGEA 2BXJA 3EDQB 3PFOA 3CWJA 1GQEA 2CQ3A 4BDPA 2VF3A 4IRCA 3Q24A 3ZZYA 2BQUA 2GHWA 5C42A 3AJ1A 2FLNA 3WDOA 2ABYA 2FHJA 5D6GA 1X9MA 4DR6F 4L73A 3BR9A 1TL1B 4I64A 5CD4A 4ZPBA 1UJ5A 2OI2A 1IUJA 2E5LF 4FYWB 2IDLA 1YBUA 3THTA 1SIWB 1LK5A 5E7OB 1FD8A 3DU5A 4ZG7A 1CQMA 3DMJB 1U0HB 4NYOA 3RBXA 3TYTA 4EMDA 2KTQA 5HBMB 1FT8A 5EWEA 2HGNA 5HP1A 4C8MA 3M30A 3DHXA 2XSJA 1CVJA 3QAEA 1WC5A 2XWXA 2W4CA 3QRQA 2VB6A 2HVEA 1I1GA 1G2EA 2UUBJ 4LFCF 4DR3J 2DR8A 4I68A 4LF9F 1KQKA 4ZJLA 9RUBA 5A2QY 5H9EJ 4C8KA 2HQGA 2UUAJ 4YUDA 1CC8A 2E1PA 1FFSB 1LW2A 4PG8A 4MJKA 1KH7A 1VHFA 5CD4H 1HHSA 3PTWA 3J7ZT 3MHYA 4CH1A 1XNRJ 3CJ4A 1CBKA 2DVIA 3OFGA 2M0GB 2KT2A 3SQGB 3C16A 1RISA 2XRGA 2GA3A 4OHZA 2IA0A 3V2UC 5A8RA 3TUIC 3CCSS 4C7QA 4XPCA 3NBPA 4F4XA 2RRNA 4ANDA 1TTHB 2B6AA 3QJJA 1RWOB 4FXWA 5LXRA 3PW7A 2VA2A 2ZH5A 2DR6A 2XMWA 3TARA 1S1WA 2LDIA 1U45A 3GR0A 1ZM3A 4FF4A 1JB0C 3LWLA 3DOKB 3S8SA 1PJ7A 2FJDB 4F2RA 2CQCA 5ETOA 2AGPA 2CQIA 1WACA 5I42B 4ELTA 4OIXA 1CLFA 1ZH5A 3DDNA 1VQ7S 4GC6A 2AX0A 2P5VA 1RTJA 1S6PB 4YQWA 1M1GA 4QIGA 2NREA 2R7XA 3HXMA 2PMHA 2IM1A 4WXWA 1N56A 3WBHA 4DX6A 4YP3A 2H54B 3CEDA 1NK7A 2CWKA 4KV8A 2OP5A 3OJSA 5ETMA 3A8EA 4NI2B 5JJBA 2UVVA 1E6VA 3V4IB 4USMA 3QZ7A 2CJXB 3S7RA 1VGYA 2HS3A 1FF2A 3Q8VA 1U1KA 3N6NA 2HHUA 4OI3A 2NXUA 2RS8A 3IFEA 2HHTA 2HHQA 1NXIA 4DPTA 1S9GB 1IQTA 4EFAC 1AJCA 3CJKA 1WNEA 1EW2A 4BC7A 5T41A 3GCXP 4PXDA 1YHQS 2B8QA 3BSAA 5HLFA 4HVZA 1R0AA 4LF1A 4M94A 4WK3A 3CE8A 1ZPWX 3NS7B 1KKHA 1FDAA 3CJSA 4O3PA 2RDJA 4F0MA 2IHR1 1NUEA 4CI0B 3T00A 5GAEU 3UCUP 2B5JA 3O5TB 4I56A 4ES2A 1YJWS 3MCNA 1Q79A 4MKVA 5BYSA 3PEJA 4WU3A 2JZ5A 1BWEA 2HW3A 1ACMB 1TK0A 4UPLA 2WW8A 4J9KA 5KG4A 1RT4B 3ETOA 4PWWA 3DLGB 2PI4A 2GVZB 1TUWA 1DTQA 1RP5A 3KLHA 1SJ4P 4N41A 2C2NA 2IM0A 3ISZA 2FVRA 3MEGA 4KHMA 1ALHA 1RWUA 1T9UA 4W90B 1M5PC 3F73A 2QC3A 2QL5B 3DI6B 3WX4A 2VFUA 1JQGA 1NNDA 1NJXA 2V2ZA 3LGNA 2VHGA 4YB7A 2BDPA 5KFDA 3RU0A 1QE1A 2XI2A 2VKZG 1IKVB 2IRUA 2IVYA 3QLHA 2PC6A 2UVUA 5K4PA 4X84A 2YTCA 3TVZA 3CIMA 4MKBA 4RW8B 1TUVA 1TMJA 1SKUB 2HK2A 1N34J 5CZVA 5ETSA 1WG5A 3PNIA 1FJ7A 1HARA 5KT6A 3KFWX 4A8OA 4DF8A 2VBWA 1FJGJ 3T19A 3P3DA 3U1NA 2M70A 3SEOA 3OT9A 4H4KC 1X4FA 1H98A 1SKSA 1FDNA 3G9CA 4Q0BB 5B0DA 4C4WA 1GX6A 3QGPA 1DJ0A 4B3RF 2HLTA 3TP2A 2AJ0A 3LH2S 4IR9A 1QJHA 2FTRA 4LSLA 2DTJA 4A8YA 3N28A 2W8DA 3NEKA 2B9YA 4PZVA 3HHDA 4R0EA 1FA0A 3JSMB 1ALIA 2C2KB 1F0XA 1ZM4A 1TKTA 4HHHA 2VBXA 2KVIA 4DFJA 2H4YB 4QYZJ 4I7FB 3MMCB 2IM3A 3PW2A 1ED8A 2FHOB 4WKRA 3QRPA 3K17A 3KLFA 2VG7A 3LAMA 3QJPA 2I2YA 1RAIB 4DEZA 1RHUB 1HPZA 2COLA 2MKCA 3N5BA 2HQDA 2ROEA 2EC2A 3PFEA 2JOQA 3H5UA 3A3NB 4DL4A 2E1AA 4OZJA 2MZJA 5CCLA 2DNQA 2XMTA 1WI6A 2QO3A 4ECZA 4CLYA 3ULHA 3Q8QB 4C97A 2W4PA 5G0RB 2G4BA 3FZBA 1VRTB 2R2TA 1K47A 1FE4A 3PIOQ 5E0OA 2R2SA 2MHEA 4CM0A 3O8WA 4YY3F 1JLEA 4FPRA 3BB5A 1F6TA 3FEXB 4AXJA 1VLOA 2HWIA 3M8RA 3KK2B 4KGXB 3C14B 4DV6J 1ZAVA 2K1RA 3GV7B 1DTTA 4ZGAA 3AQPA 3P45B 4XTTA 2GIQA 2DRAA 2WVEA 4OI2A 4LRBA 5KFNA 3FUYA 4RU2A 4KYZA 1T11A 1Q53A 4YEAA 1LXJA 5B0FA 3DGPA 4ZDNA 3HX9A 3BJYA 4ZLLA 1YBAA 4A48A 3ZTRA 3H8YA 2R8JA 1RADB 1S7IA 4UOPA 5KOWA 4I67A 2OEKA 4GO5X 2GAHC 3AT1B 2ANHA 1TKZB 1UJ6A 1T9XA 5EDWA 1IBLJ 1MWZA 3CF5Q 4EUVA 2EFNA 5KFCA 4RNOA 4TU7A 2CAJA 1S1VA 3MTKA 5HN0A 3G82B 2FJWA 3OR1B 2GVDA 2Q3PA 2ZE2B 3KJQB 3U02A 1HYSA 3KK1B 1U0SA 3OFEA 2V9KA 1N5TA 2CJKA 2DB1A 5MAOA 5FD1A 2XMKA 3V81A 1SJ1A 2QYGA 3GJTB 3HZGA 1MLAA 1S57A 1WI8A 2QLWA 2KM8C 1EHWA 3R1LA 4DUYF 2RRAA 1PYOB 2GLQA 1NJWA 2K7JA 2V63A 3I55S 4KGZB 1E33P 4OYWA 4TQRA 1VS3A 1XBWA 1RHQB 4P2XA 2NLWA 4M63A 4XPEA 1FFWB 1FJCA 1C0TA 2I5JA 3HHKA 3BDPA 4LF4F 1VIOA 4GVBA 1ANJA 2BRKA 3MD3A 2ZJPQ 4U9RA 2N4DA 1CJVA 3AOAA 3TNVA 4HTJA 5D0HA 2KXNB 1D9FA 2VBYA 3LPYA 4X4VA 5BR8F 1N2LA 1OMSA 3G8QA 3ILOA 3MPDA 1S5ZA 4B3MJ 3C15A 2MKJA 4ENOA 2FY8A 1R3NA 3D1HA 1UWAA 2QEXS 4NLUA 5B0BA 1O51A 5IJQA 4UOFA 3BGOP 3MR2A 1QAYA 4FF1A 2V67A 2MZTA 2C22A 4DHVA 2FVSA 3B82A 3CGIA 3DCAA 2IBKA 2YKMA 1EETB 1TQLA 1C1BB 1Q5VA 4X66F 5JVGQ 4LSNB 2NXCA 4ED5A 3D0GE 4GRSA 1KH4A 3TUZC 2ZOGA 2W5XA 1S9EB 4FBUA 3KDOA 1HMVA 2VG6B 5D77A 3AD9C 4DX7A 4TQSA 1L3TA 2XMUA 5LM7E 1Q8BA 3AA8A 4CLPA 4CLZA 2C28A 2LQ5A 4UQTA 3RAXA 1WHYA 2D9PA 1OO0B 3IRXB 1HKAA 1S6UA 3FMWA 3G8TA 3POTB 5C24A 4OYPA 3ZXWA 1CG2A 2F5GA 3H98A 3IGZB 2AZ1A 5KG7A 3MM7B 1LV5A 2W5TA 2GJ2A 1U48A 1NSPA 3GYXB 3SBMA 3GSIA 1RT2A 4NLGA 3SZZA 6AT1B 4O4GB 5DLFA 3JQKA 2ASYA 4Y34A 3PHTA 2W25A 4WE1B 1HWJA 1X0FA 2GX8A 3DPCA 4I2PA 5EWGA 4M95A 2BKOA 3AJDA 1M1HA 3DM2A 1EJ7L 2V0NA 3P4UB 2N3LA 2HG4A 5F8GA 4J9QA 1RCOB 4ED1A 4K4ZA 4O0NA 3H4DA 3BZQA 2QL9B 2WW4A 4FNIA 3PY8A 5AXNA 4FKXA 3EM1A 1FX2A 4ECYA 1Y3JA 2HQCA 1J5EJ 4EBEA 3R5CA 4WBFA 1AW0A 3ILJA 3D67A 1QTNB 3N9UC 4X64J 2DHAA 4CLSA 1ZAXA 5E33A 4L76A 2MGZB 4NWXA 2GMLA 2HNZB 4CNZA 3M2VB 4NOHA 3D66A 1N33J 1NHUA 3CCLS 4JI2J 2XS5A 4JV5J 2RUSA 1RGVA 4ANCA 4CYUA 2C3YA 4NLOA 2HHVA 2YWGA 1T94A 3A8JA 2HAFA 3R7SB 4BHQA 4XDDA 2G2ZA 2XULA 4F02A 3BGUA 1N0UA 1EQMA 3P8BB 2RD5C 2GFFA 3TJAA 1VQLS 1JLCA 3W2VA 5LMUF 4DV3F 4C98A 3EX7B 4IG3B 2WK4A 3SCIE 2F63A 2GIRA 5DG8A 4JI8F 3BGRB 1WEZA 3BPSP 2JC0A 2J9CA 2ACMA 3DRSA 2K8GA 4O0IA 2FJBB 3TQEA 1PGZA 2UZAA 5E3CA 4ILMA 4DSEA 2J8SA 1X0PA 4MIAA 2PFDA 3RG6A 1RHRB 4EBDA 4NWJA 2VJUA 5D8HB 2MKSA 3PZPA 2WVDA 4ZLNA 3ZFVA 2QA1A 2GQ2A 2EKNA 2XCPA 4ZA1A 2LXIA 2XC9A 5D3GA 1IR1A 2LEBA 2OPQB 1S0MA 2Y1JA 2DHHA 2AW0A 4DS4A 2RMLA 4ZCMA 5DG7A 2XGPA 1Q95G 3M1VA 3U1MA 2ASDA 4PQUA 1WKJA 3P49B 4NYPA 3MUMP 4OL8A 1O99A 1XTZA 4P2SA 2J7KA 4PPZA 2AZ3A 3DYAB 1FKOA 4QQBA 9ATCB 2KN4A 2OPSB 2GA7A 2MQNA 1RWXB 4IG0A 4EYHB 4L3KA 4ECXA 4LF7F 3UD4P 2H5JB 1BWVA 1LQ9A 4ZPDA 1OPZA 1RUSA 1IM6A 5J2QB 3I0SA 1HBOA 1OPIA 2UXDF 3K2YA 3W7BA 1LWCA 4L3NA 5K8PA 1T03B 3LP1A 5L1KA 4ITSA 2IC3B 4LR8A 3T01A 5J2NA 2JDJA 2JLFA 3AY0A 3NWRA 1YZ7A 4NXMJ 1KHLA 1KRPA 3OUYB 2X3GA 2CWXA 5H1SV 4WP9A 4Y2KA 2V6AA 2RE1A 3C6TB 2A1BA 4ZN1A 5KFOA 1IKWB 5E3PA 4TVAB 1O0PA 4NLVA 2IBOA 2QYCA 3GJRB 1QD1A 3RUBL 4ZVUB 2DYAA 4RKUC 4EO6A 2BA9A 4KRWA 3THVA 1GFWB 1RB0A 3MCSA 2J0SD 2UXCF 3A3PB 2RKIB 5E3RA 1GTEA 3UN2A 3EICA 3WC2A 1Z4UA 4HYKA 4DR6J 1TKXA 1HI0P 2CPFA 3W9HA 1RBOB 4CLFA 1E3CP 1TL1A 3UN5A 2JVOA 3R2DJ 3I96A 3PG9A 5KFHA 1X4EA 5KG2A 1VQ9S 3ZTPA 3NGSA 1KQFB 1RAJA 1Y5NB 2E5LJ 4E98A 2R7TA 2XNQA 1GAOA 2FLOA 5CAAA 1RWKB 3TVKA 2CJQA 2DY1A 3K7RA 3MURP 1F9FA 1Q8IA 2AIRB 2MTLA 3D68A 2XM3A 3TO8A 5IT9U 1Q86T 3DMJA 1U0HA 2C3PA 2XHCA 4P75A 1RTDB 3TZZA 5CXTA 3R1HA 1WDTA 3G4SS 3QZ8A 4H4OB 3ONQA 5HBMA 2WBMA 1FWKA 2NSCA 3UDCA 3W5ZA 2ZBRA 2R7OA 5L46A 4NLTA 3TANA 1LOUA 4Z37A 3LAKA 4F4WA 1QUPA 3FBBA 2XCAA 2DPIA 3VZIA 3OTOJ 3H7HB 4FS2A 3HT0A 1Y11A 4I69A 2ZH1A 1HDHA 3ADAC 3UQSA 4PEOA 2MSSA 3CVKA 2ASLA 3E8OA 1ITPA 2CADA 1JLAB 4CO4A 2PEBA 2V8DA 1S1XB 1L5UA 5A8WB 3JQJA 2QA4G 2FJEB 2Y0BB 4KGMA 5MLCV 3RBZA 4MK9A 3VF0B 3I82A 3TA1A 1TFWA 1NJYA 3PDNA 2CPYA 4FDIA 2OPPB 3SQGA 4RW7A 3J81U 2FLPA 1BQMB 1AUKA 3M2RB 1HBUB 3IRWP 1SB6A 5L9XA 3OL9A 1TL3B 4WFNQ 3H90A 4GMKA 4DV2F 3MAAB 2ZD1B 2XG8A 3PYDA 4ANEA 1LWFB 1HNXF 3CCTA 3DOKA 5KAKA 5JXSA 3RAMA 2ALZA 2R7WA 2CJAA 4DR2F 5I3PA 2E9ZA 3MXHP 3NGDA 2V94A 3NP5A 2R9LA 3GCWP 4WU2A 5I42A 1GMWA 3ZNUA 3HLUA 2YWHA 2DR5A 2OTJS 2H4WB 4YR3A 2ACYA 1S6PA 5KFWA 2IUCB 2APOA 3HK2A 2R8KA 3J80Y 4DDFA 1URNA 1I94F 1H72C 1KTQA 4NI2A 3V4IA 2HWTA 2F65A 2W2MP 3DLJA 4NZ6A 2B3TB 2V2QA 1XEZA 2P8IA 3LGHA 2E5HA 4DUZF 3P5BP 2MQPA 1UL3A 2Q6BA 2QLXA 1S9GA 2NPIA 5K20B 4C8OA 3GQCA 4UTGA 2AJ1A 1DURA 2EBGA 1K1QA 1YWXA 3OTBA 1N5VA 1KN6A 5AE2A 2ZC4A 3A1YG 3HFKA 3SMZA 1RA7A 2QSWA 3ZNJ1 2Y8WA 3HD2A 5DS7A 4IQXA 2LCWA 1M5KC 2LMIA 1AROP 2ZBCA 2ZHOA 1ELXA 3QSIA 4PUOB 3DOMB 2VPWB 3EVWA 1VK8A 1ELYA 1W2IA 1R8AA 2A2CA 2NPFA 2MQOA 4RX6A 3KJNB 4O3NA 2CKWA 2GJIA 3D0IE 3MK1A 3M8YA 3QAUA 5HQLA 2GAGC 1U8WA 3GG1A 2PA8D 3BO4A 4F4AA 1H7WA 3WC0A 1RT4A 4PRFA 2YKAA 2FPHX 3DLGA 3IA0A 2GVZA 4V19J 4PWUA 1S1TB 4IOAQ 2U2FA 4NRTA 1SXLA 5JVHQ 2L08A 2HMIB 2J7WA 2ZC3A 3IGYB 2IYIA 1FRXA 1NEEA 2C3MA 1RKIA 2H3EB 3DI6A 1JWWA 3PKYA 3I5BA 4Y00A 1NSQA 3IO1A 2XS7A 5KTQA 2RVJA 1Y0HA 4DQQA 3P5TL 1MROB 3J7YU 4ZK7M 1UPMB 3NNCA 2KT3A 2QMUB 2AWZA 1IKVA 3EXYA 4OLOA 1HFEL 2PDAA 4BWMA 2PIIA 2W9AA 1Q81T 5BYRA 3PJ9A 3P96A 3OQ2A 2W8KA 4QW9A 2EFPA 3FFIB 3OL8A 4RW8A 2FHKA 4G1QA 1U25A 1Q7LB 3IM8A 4OZNA 3EDRB 2E29A 4MFBB 4HT5A 4LIWA 1ZEFA 5CYQB 5GVQA 2P9EA 3GJQB 1UVMA 2RSQA 4HEA9 4YR0A 1VISA 2NS1B 4LBPA 3KWMA 4Q0BA 1KHJA 4B3RJ 1FE0A 3CMES 2HGLA 4UW2A 3LW5C 4NPOA 1K44A 1S4EA 4N8NA 3OXGA 5HJXA 1DAXA 4ES3A 3NOCA 4ECQA 4I6WA 4ZKAA 3KG0A 2MYFA 3IXQA 2KO1A 1UW4A 2XO7A 3MMBB 2XWYA 3JSMA 3CD6S 2KDOA 5LSLA 3W60A 4Y65A 4FKYA 2A6MA 4ZVGA 3SCJE 4OYIA 4DQPA 3O1LA 3HI9A 3VAHA 1GMWD 2BM1A 4F4YA 4I7FA 3MMCA 4DR5F 1IKYA 1U2FA 1SH0A 2OD6A 4QR2A 3H5XA 3OR2B 4WIQA 1ANIA 2ZWOA 1V5VA 1XC9A 2KHDA 4YB5A 4X4NA 3A52A 5J1NA 4M8LA 1U1NA 2R7UA 3N6MA 4OHWA 3QGGA 3QSYB 1RTJB 4P74A 5ETTA 2HZAA 4OLPA 2LU1A 2MY8A 3SV3A 2NSBA 3E51A 1TFYA 1ICEB 4ZJOA 2ZM6F 2XB2D 5HVGA 2SXLA 4DCOB 5F0WA 2M9KA 1QVFR 3LTOA 4DL0C 5G0RA 2JFKA 1VRTA 3W5XA 3BH7B 4YY3J 1R8HA 4JB8B 5HI7A 1VQKS 5L1IA 1UFKA 6FD1A 3UR0A 4GKJF 2CQDA 1PKUA 2WSEC 3KK2A 5DLTA 3C14A 4Q44A 4OYAA 4RNHA 2QE5A 1KD1T 2NCKL 3G2XA 3L9ZA 3PR4A 2ROGA 2XR9A 4CLKA 4B3SF 1VMBA 2J7UA 1YJ9S 3W64A 4QR1A 1DZ5A 3LPEA 3BREA 1YITS 4DPUA 2XEXA 5F8NA 1M5VC 3M6WA 3TA0A 2R4FA 3PX0A 3PKMA 2ZKTA 2K3KA 2D69A 3OJUA 3UDVA 2W5QA 4CQ1A 1YJTA 5IWAF 2LU2A 1JLBB 2EVZA 1PO6A 2FZGB 2W8SA 4WP3A 3W8PA 1TKZA 3RB0A 2BR0A 4UORA 5HSPA 5D0RA 2R8GA 3HVTB 4BLGA 1NJIT 2CPHA 3G82A 5B0AA 2XLJA 3OR1A 2WSFC 4XDCA 1S49A 1NK9A 2ZE2A 5HL7Q 3D3CJ 2OMLA 4USIA 5DM7Q 2BW7A 2AP6A 3KK1A 2E9RX 5IOLA 2D41A 2HS0A 2I8EA 3A12A 2AJ4A 5KFVA 4HH0A 1MWYA 2DXDA 2FHMA 2QMWA 4CO3A 2E66A 3T41A 4YB1P 4DU7A 3CC2S 5KFGA 4ETXA 3ED4A 4P9SA 3IWNC 3M32B 3SSQA 2OKQA 2YNHB 1PJ6A 3H20A 4P73A 5SZTA 1R6YA 1CEZA 3QPIA 4ZP9A 1EARA 2VZ9A 3GP9A 2RRBA 4K50A 1XIQA 3KLEB 2V2VA 1HQ2A 4CLWA 1TZ0A 2J6SA 4B3TF 4E8UA 4HR2A 1QSYA 4MYTA 1Q4RA 3R5AA 4LF4J 1AUDA 2AYMA 3TAQA 4DFMA 4DZ6A 1S0OA 4LR7A 2ZVIA 2E9TA 2Y1RI 4WFAQ 2YQ0A 4DQIA 2O3DA 1VFJA 4P6QA 3BQ0A 2Z2YB 5DDOC 2ILZA 5BR8J 4IR1A 2W2QP 1FSUA 2E7XA 2LQBA 3AHPA 1WEXA 1WF0A 3EWGA 4J9NA 4HDGA 2NXEA 4ZIWA 3LANA 4WZMA 1FVQA 3KG4A 3NGTA 4GKKF 2Z8QA 3LO3A 4DFPA 1N6QB 3VGSA 2XZTB 3MEEA 1KH5A 1UJ4A 3NY0A 4LFBF 4WFXA 4ELUA 1T9YA 1ZM9A 2ZZTA 1PC5A 4NA2A 2BUNA 1WTBA 2V4JB 1EETA 1N0VC 5IT0A 3TAMB 1C1BA 3CJ3A 3K5OA 2AYBA 3NWGA 2J0WA 3KDNA 1VQMS 4LSNA 2VICA 2AGOA 2QSFA 3R9LA 1S9EA 4LQ9A 2VG6A 4ZPTR 3SDEB 5ETRA 1MN7A 3T5JA 4C48A 2KT5A 1ROFA 3IRXA 2YNGB 3TR5A 1JLFB 3FSIA 5C2GA 2AD9A 5DLGA 3POTA 2WVFA 1PAEX 2YWFA 1MW7A 4JI1F 3MM7A 1HWKA 2DNHA 1URRA 4DG1B 2OAUA 2EFQA 5GADI 4C11B 2DGVA 2HRTA 2BVZA 2PGCA 3VAFA 4O4GA 1NK6A 2CQGA 4OYXA 4QIFA 5KFZA 4WE1A 5HRTA 1PAUB 2FGOA 3JYTB 5IZHA 3FC9A 1VJQA 4DV6F 3VAGA 3O44A 4NMLA 4P10A 2VDHA 1XMBA 3OXFA 5DLWA 2X1BA 2GV1A 1VQOS 4IQMA 1DHMA 4R25A 3W62A 4U96A 2AJ2A 3X3UA 4YMEA 2KJVA 1FNMA 4KT0C 4RUHA 7FDRA 2PI5A 3N4WA 1OQ6A 2HHPA 3EZ5A 3WZ0A 4M5IA 1NSAA 1RAHB 3OW2R 2UV8A 3GFHA 3HM9A 2IJFA 1U1MA 2XO6A 3CDWA 3I9V9 1IBLF 1YIJS 4IFYB 5K9FA 2MGZA 3MMAA 4J9VA 2HNZA 2QN6B 2BANB 2FC8A 2ZJQQ 2YKQA 1XMQF 3IP0A 2YX4A 1HYSB 1T3OA 4CXKA 4Y2IA 1P6TA 2M8HA 2BJ7A 5KFEA 2O1PA 5HROB 2FVCA 2Q1LA 5LSRA 2Q79A 3QJLA 1RYRA 2KFNA 4OI4A 1NPPA 1JNZB 4V1Ak 4WIIA 3CDBA 2N82B 1RXOB 5LMUJ 4AYBD 5GAGI 4DV3J 3JXOA 4LSZB 3BS9A 1OS5A 2YH0A 4RW6B 4URGA 5DLVA 4IG3A 4JI8J 3MTJA 4USHA 2K7KA 2L3MA 4EO8A 3BGRA 4TYAA 3R5JB 3QIDA 4Y28C 4EK2A 1SVDA 1YX2A 4Q43A 4KIAA 1I6JA 5BYQA 2J9EA 4RPFA 3QGIA 1FJEB 4DWIA 3BR8A 3D6FB 4FVMA 4ZLJA 1K0VA 2EXUA 3MOZA 2OPQA 4OV6A 2W5RA 1F5CA 2E7VA 1HA1A 4Q5VA 4HHJA 3IR5B 4GTXA 3NKNA 1BC6A 1WJ9A 2LEAA 5FDLB 1RAFB 2Y1LB 3CMAS 3GU0A 4DL5A 1MMDA 3MECB 2DNYA 3DYAA 5F0UA 3QFWA 5ETKA 4YHHF 2OPSA 4KJIA 3BKTA 4WTYA 3DRXA 4LF7J 2HFVA 3M6XA 4ICLB 2VA3A 1YVFA 1ZM2A 1NDKA 5J2QA 5IFMA 5DO2A 2G0JA 2N3OA 1T03A 3RTVA 5F8LA 3TJ9A 1NKCA 1WC6A 4DU8A 2HLUA 2IC3A 3DFEA 3UW1A 1Y5LB 4NLRA 2YKOA 2BJEA 3CB4A 1SQEA 2LEPA 2POKA 3DC2A 4NLPA 5ETPA 1G3OA 3OL7A 1RT5B 4LT6A 3OUYA 3OTDA 4DBQA 4QIEA 1U1QA 4CLTA 3QT6A 3TG0A 3LALA 2KRBA 2WBRA 1CULB 4KC5A 1F1BB 2B9WA 2CFXA 3C6TA 4DQRA 2BZ2A 2Z4PA 1IKWA 1LWEB 3QGHA 4EI2A 2K3IA 3EGNA 3FDSA 1YJUA 4MKYA 1D09B 4FYXB 2FZKB 5I3UB 2GNKA 3IBWA 1ZTTA 2UXCJ 5KG0A 4OHXA 3BGLA 5FIIA 5HMXA 1RT7A 4F4KA 2RKIA 2E5JA 4O23A 3DRRB 3W8GA 4YOEA 3CMRA 4A8XA 2DGOA 1TU0B 1NDLA 1RABB 2DRDA 3DXBA 1SC3B 1RWMB 3FRYA 2RF2B 3EUNA 4JUZA 1U1LA 5KT7A 3PR5B 4MY4A 2MLZA 2BX6A 2GGPB 4K8RA 4QWEA 2XS2A 5LOQA 1CS4B 2RIJA 2KI2A 2QL7B 3DLHA 3K8VA 3L4BC 3BBBA 4C8NA 4LVOP 4M5MA 2AV5A 2HBZB 1RTDA 3IN5A 1NCLA 1TAQA 4KGVB 2A6OA 1R89A 4H4OA 2WVBA 2P6SA 3HT3A 2MXYA 1QAIA 4LVNP 3VQTA 1N54B 4CWBA 1HBNB 1HQEB 3IG1B 2ZWPA 2WB4A 2J8AA 3NRBA 2CQ2A 4C6AA 4PYDA 4KY3A 4ALZA 3ZZOA 4DX8H 4ZJQA 2DXFA 3R5BA 4V19X 4URSA 1Q8KA 2VFRA 3KNGA 3W65A 4H4MB 1JLAA 3GIRA 3KJVB 2AT1B 3GFXA 1S1XA 3Q22A 2ATCB 5A8WA 4DL2A 3W63A 1U7LA 3T1YF 2V69A 4IDKB 1L3UA 2V5HG 4W4MA 2IYGA 4CZCA 1RCXB 2DISA 1RDRA 2PT0A 3Q8SB 2OPPA 3A3OB 5J1PA 5CA5A 4UUWA 1YRTA 4J9MA 1BQMA 1T7PA 3M2RA 3KHRA 1HBUA 4KAIA 4DV2J 4RUBA 1TL3A 3VZHA 4RZRA 4ZN3A 3MAAA 2HAIA 2ZD1A 3HHLC 1HNXJ 3V5RA 2VJVA 3IM9A 2G9OA 4M5LA 5LIAA 1LWFA 4DR2J 3OFHA 2VH7A 4GTWA 1FXLA 1RAOA 4C9DA 5HMYA 4KTQA 1YRXA 1WD6A 2JEGA 1XMOF 2G9YA 3UNGC 2A0FB 1F9HA 5F8HA 5L1JA 1UMJA 2QZ8A 4PG7A 3MR3A 3SIPB 3MPYA 5KFPA 3MOJB 2RT3A 2IUCA 3GFYA 1RT6B 1H2UX 2ZBIA 1RYSA 1TAUA 1I94J 2H5IB 3GV8B 3JAMY 1FESA 2IMOA 2OSQA 3TUJC 1T95A 1W26A 4RUCA 3E01A 3MDFA 3OBIA 4DUZJ 1EJJA 1VQ4S 1LWCB 1EQJA 2RHQB 2LYVA 5FLXY 1SCJB 2FQQB 2X3DA 4TN2A 2MY7A 2CNLB 4IFVB 2YKNB 4LRCA 1AZSB 3J7AN 1P27B 1KHVA 4TKTA 3RYLA 2Y9HA 2ZDOA 4ZLPA 1SPBP 5L0BA 3KUHA 4PUOA 4UOOA 3DOMA 3OVAA 2QIFA 2XNRA 2VG5B 4PXBA 4K2JA 1S0VA 4LF5F 2JJ4D 4ZPAA 3A4TA 1X4CA 5T7LB 3D5MA 2CA9A 4PKDB 4G6VB 4DR4F 4FDJA 2M3DA 1IJFB 1OSCA 1TKXB 2FJVA 1H73A 1SKWA 2ALYB 3NKYA 3CC4S 1J2VA 1PYTA 1S1TA 5B08A 1HNZF 1RQ0A 5KFUA 3WBZA 1S48A 2HMIA 3SCLE 4A8FA 1HD1A 3KLGB 2B43A 2E1RA 4Y3CA 2W5SA 1HBMB 4WXOA 2DKOB 4IH6A 4ZPCA 2QRRA 4RO0A 3Q8YA 1MROA 3IMQJ 3NKOA 4TU8A 3JTPA 1AB8A 2UP1A 3D6MB 1PIEA 2E5IA 3CSKA 3ZZUA 3FFIA 1CQNA 2Z57B 3VV2B 1S79A 1ZZFA 2LA4A 4IOBA 1SHNA 3KHHA 4ZMMA 3OTOF 2Q66A 1WOPA 2XLIA 3MPWA 2QFJA 2W1BA 4MFBA 3UD3P 3DU6A 1S77D 5CYQA 3CCRS 3HHEA 3MFIA 2XYGB 3AD7C 3ILIA 1X7VA 5CQGA 1Y5IB 1REVB 3CD0A 2WCXA 4AT1B 1WC3A 5AE1A 1TVRB 5KFBA 1UEKA 3K89A 1PG5B 1Q82T 4X65F 4RW7B 4USTA 2B9XA 4U7UK 3HDSA 5DG9A 4YB6A 3MMBA 3A8KA 4RBVA 1UVNA 2V8HA 3MUVP 5AT1B 1LFWA 4QW8A 3RRGA 2PSZA 4DR5J 5A8KB 3GR1A 1CC7A 5H9FK 1TUGB 3GMGA 2HKEA 2CPZA 4USKA 2HRUA 3OR2A 1LW0B 4E0DA 2DEIA 2ZHBA 2VL1A 5KG3A 3CCWA 1JJ4A 3BYRA 1EI6A 1V6HA 5HAOA 2PEHA 3T5HA 2ZM6J 4IOCQ 3K5MA 5K8OA 1UP1A 3KMQA 3I56S 1TELA 3RGIA 3PJXA 4BWJA 2KRRA 4MIWA 4ZVFA 3C3LA 1KHNA 3EVMA 2FB0A 4GKJJ 2RUGA 3RW7A 1U8SA 4ZCIA 4F26A 4J9UE 2GO9A 1LKZA 4ZVOB 5KT4A 4QOTA 4B3SJ 2W9CB 1RU1A 2AYGA 1WKKA 4K0KJ 3V6KA 4Y6IA 5D4NA 4ED0A 1RHJB 1RLDA 2DCLA 3QO9A 3PYGA 2E1CA 4QU6A 3OXLA 1XR5A 2GSOA 4FXVA 1VI7A 3FVYA 5IWAJ 2B0GA 4N5SA 1JLBA 4WTOB 3B5QA 1I51B 2A3JA 3GILA 1YLXA 1R27B 3T1HF 2VPYB 4O3SA 4ED8A 3HVTA 1LEOA 4P52A 1SKRA 4UZCA 3KMSA 3A13A 2VPXB 4KHPF 3AB4B 1TK8A 4Q2LA 1JXVA 3F41A 2ZH2A 1D9AA 1Z2LA 1KNZA 1QTMA 1NBEB 3GTYX 4ZHRB 2F8HA 3FRZA 2MKHA 2VQRA 4DSLA 3MFHA 3FMBA 3D1OA 4C8ZA 3X1LB 2L41A 3OLAA 3V6DB 5EWFA 3SZYA 1G7CB 4M5GA 1N48A 5AXKA 2HHHJ 1WG1A 2EK1A 2AEFA 4Y0FA 3TJ8A 3M32A 4ELVA 1QSLA 3DOLB 5GMKa 4YR2A 1KHKA 2YNHA 5C25B 5EUHA 2XHWA 3DRPB 1U47A 2IIHA 2G1DA 1Y7PA 4RWWA 3M8SA 2W7PA 2I38A 3T6JA 1FRMA 2DGQA 3KLEA 4B3TJ 2MQMA 1Q16B 3O2IA 4G1QB 1RTIB 1FX4A 3D2WA 1SL1A 1LWXA 3CJTA 5A0YB 1S97A 5EGHA 1VHIA 2BJ1A 3LQVA 1C2PA 4DPXA 2Z2MA 1URBA 6FDRA 4LQYA 4QIVA 1A9NB 4NA1A 2ASJA 4LF8J 3EYZA 4NLSA 2HYIB 3BO3A 1Y4ZB 1AFIA 2XBPA 3V6HA 2HURA 2UUCF 4GKKJ 1ZPVA 2LP4A 1D3WA 1D0EA 3BF4A 5KFMA 1N6QA 2HSEB 2MZRA 3T9NA 4LRDA 4LFBJ 3PX6A 1X5SA 4PR6A 2B8PA 4M5DA 3UN3A 1EQ0A 4QIWD 2CPJA 3DDKA 1T9WA 2XMVA 1UEUA 3HVRA 3VAIA 4A4JA 3SXLA 2V4JA 4LFAF 2MZQA 3TAMA 1BMQB 1UFWA 2VQEF 1IKYB 3MF5A 3M4XA 4MK8A 3KLVA 2F4VF 3SCKE 1R0BG 3EJMA 3SDEA 5KFTA 2E1MC 1R6VA 1NZAA 2HHXA 1N4LA 4A8QA 2D1CA 4DN0A 2PMWA 1W7WA 1WORA 3K5PA 3ZO7A 2YNGA 1JLFA 4WPAA 1FTCA 4QBUA 4JI1J 2O67A 3WQPA 3K59A 4UPHA 1ULRA 4PG4A 4UUXA 1RT1B 4MKAA 4DG1A 1JLQB 4C11A 4NYZA 2KM8B 3RJMB 1SH2A 4O3RA 4DV0F 2JLEA 2GC8A 5KFAA 3JYTA 2PMZD 1HL6A 4MIVA 1HR0F 1K1SA 4OFZA 1RA6A 1R7IA 4PXEA 5C5JA 3I5CA 2W5WA 3DLBA 4ZVEA 4JI7F 2DGXA 4G3IA 1Q7YT 1EZZB 2HRYA 3P6YC 1R43A 3PXGa 5BXIA 2YX7A 5T14A 3IGVA 3ZTSA 3PYFA 4KJDA 2B4VA 1DQAA 3UFCX 2M2BA 1SQFA 2H65B 1B0TA 2CIMA 1T02A 3SV4A 1UVLA 5AXMA 4I2QA 4ZVQB 4RR5A 2Z58B 3GYGA 4C0HA 3WHIA 1M90T 4IFYA 1N36F 1HQUB 4I4BA 1RTHB 3D28A 1XMQJ 1D9DA 2BANA 4K4VA 4FDFA 1HNVB 3BH6B 2WB1D 4ER8A 1REGX 1WSVA 3GIIA 3MZIA 4OJ3A 3TQ1A 1VK3A 5GMDA 4LUBA 2OUGA 4JI6F 1RU2A 2NXNA 5HROA 1N8RT 4D3HA 5ADZA 4MMOA 2J9DA 1U4BA 1OIAA 2MEWA 2RU9A 3KOAA 4OQJA 2OFHX 2ZH9A 3PW0A 3BSCA 4WWSA 1OJ4A 1SC6A 1SHQA 4DSKA 2OH2A 2IA6A 4P2FA 1JJ2R 3I5AA 8AT1B 2KG0A 2B51A 1MG7A 4RW6A 4TYBA 1RAAB 1TK5A 1O5JA 4DPWA 4ED4A 4ZCKA 2CQHA 3QIPB 4NZ7A 3CDEA 3VGUA 1V3SA 2G2YA 1XWLA 2Y3YA 4JI5F 3HO1A 2DIVA 1F2HA 1Y10A 2MDAA 3H5YA 2DBBA 3WAVA 3KYLA 2OPRB 4ECSA 4X4QA 1KOOA 1FRIA 3CMQA 5A2QU 1WC1A 2XZDB 2QMXA 3NAHA 1P9QC 2QFIA 2XMJA 2IFXA 3EPIA 4IRKA 1M0SA 2RH3A 2CJ9A 4X62F 3GYNA 4CO0A 3MAHA 2VOOA 2AF6A 2CPXA 3R97A 4X4TA 1RLCL 2CXEA 2PN6A 1NLKL 4U67Q 3ENVA 1C1CB 2M88A 3GB0A 1HHQA 4TY8A 2OMOA 3BBFA 3Q86A 3VCDA 2HZCA 4FN5A 5FDLA 1X9SA 2CZ4A 5IM0A 5HK4A 5EHHA 3MEEB 2L9DA 1H2TZ 2C1EB 3MECA 2GSNA 4YHHJ 4ATNA 2QLFB 1YK9A 2BMBA 3HMJG 3G6XA 2GQCA 3CXCR 3HHNB 2IRXA 3IGNA 3LP0B 3R5GA 4N76A 4CLUA 4ICLA 3JTOA 1HD0A 3IAM9 4JI3F 4CLLA 2YVSA 2QLJB 4I1TA 1TL5A 3ENAA 4QWCA 1R8CA 3JSBA 4FYYB 3LOUA 3Q2SC 1R31A 4B02A 5D0GA 1UAWA 3FCWA 4BC9A 2JX2A 1RT5A 3J7Z5 5LJ3Y 2GSUA 2BOPA 3BQ1A 1ZEDA 4KPCA 3AH6A 4HI1A 2MB0B 1FK9B 1U2CA 1CULA 4LF2A 3QT8A 1HWIA 3GJSB 3MM6B 1LWEA 1FRHA 3I4PA 2HIQA 1KOHA 4IUFA 2RNEA 3JQMA 4X4UA 3CDUA 4G1IA 4Y2CA 5I3UA 2DITA 3IWXA 3RBEA 1KVKA 4NMXA 2YNIB 3DRRA 1FDBA 3NVLA 1L3KA 1KH9A 2HQIA 2VFSA 1NB2A 2OO4A 1DLOB 2DO0A 1CPZA 2F8EX 2R7SA 2RF2A 5KT5A 5E3QA 3U7JA 1VCTA 1SBRA 3F0NA 1AT1B 3UO0A 4UQGA 3DLEB 2GGPA 1CS4A 2L9WA 2AU0A 4GTZA 4H54A 2YX1A 2BJ9A 3NGUA 1UETA 1LFPA 2V68A 1F9EB 1S4FA 1RACB 1H0HB 3MMAB 3PRDA 4CNYA 2ZH8A 1SC4B 1NHKL 2E5GA 1XR6A 2UXBJ 2C3UA 1HBNA 1HQEA 3IG1A 2J76E 2EK6A 4YDDB 1ZOTA 4IH7A 2ZNZA 2YNFB 1OWXA 1VRUB 1CJTB 2W24A 1C0UB 3NKPA 4DV7J 2C2DA 1VC5A 3WIVA 4F3OA 1BUXA 1I3OB 3KUEA 4KBIA 2BE2A 3GIJA 3V4MA 2XSFA 3CDAA 3BV8A 4H4MA 3QQCD 4DCPB 3MM9B 3T1YJ 3KJVA 2HNDB 5LL6d 3TWZA 4J9LA 3AA9A 1BLUA 4IDKA 3G6VA 1RI7A 1K0TA 4FVCA 1X5PA 2GHPA 2CQBA 2Z56B 2RQCA 1J5OB 4ED3A 1IM4A 2RJZA 1EX8A 2HBQB 3IAS9 1APSA 4QWBA 4AL5A 3EPGA 2IMWP 5E2QA 1FRLA 2DHSA 4WZQA 1PBAA 2AHOB 3MEKA 4NCBA 3NOGA 2C2RA 1PYSB 2IAJB 3T6BA 2J0XA 4LF6J 5K14B 4HT7A 2HVDA 1XMOJ 2A10A 1S7HA 4K4YA 3RRHA 1U26A 3H4BA 3KK3B 1MSWD 1Y3KA 2MJNA 4IRDA 1AXQA 4ZP7A 1U6FA 2CPEA 2XYPB 4KSEB 1SV5B 2VKRA 4WKYA 4ZPVR 3W61A 1GTHA 1RT6A 5HATA 4DPOA 1PJ5A 2LDYA 4DQSA 2CQ4A 2V8PA 1U02A 2VC0A 3HVWA 1HQAA 2YH1A 1NK5A 4KAVA 3M6VA 2AKWB 2CJYB 2DIUA 3B54A 1Z1ZA 3LA0A 1PCAA 3I0RB 4QR0A 4A8MP 4OZLA 2VQFF 4MTPA 5THWA 3FZ2A 2IJRA 4ZP6A 3SSRA 4B9VA 4IFVA 4A8SA 2R8IA 2YKNA 2ZH4A 3ZZ0A 2ZH6A 1AZSA 2HFZA 3A8IA 5SUHA 2HPUA 3MCMA 4NLDA 4DL6A 3C6UA 4HACB 2YQ1A 4AFFA 3L09A 3SZ2A 5F8IA 2NYIA 2VODA 3OTCA 3HJVA 1QAJA 2JC1A 1LK7A 4LF5J 2CQPA 2VG5A 4Q2MA 2BQ3A 4W98A 1A7GE 5T7LA 1IWAA 3TX0A 2UU9F 3UVJA 4UOCA 4DR4J 1WKLA 2V2KA 3D7SB 1RT7B 4I0WA 3HJFA 3NG8A 5E3AA 4F4ZA 3HHLD 1SUQB 3F56A 5HVHA 1HNZJ 1NDPA 1VC0A 2GHVC 1KSPA 2ADCA 3L95X 2ZH7A 3CCUS 1ZBTA 4PG5A 1DBDA 2DD8S 2D3ZA 3KUGA 3KLGA 2EC0A 1HBMA 4KH0B 3HFVA 5L1LA 2HS4A 3IWLA 1H38A 5EGYA 1B99A 2YWEA 2B4UA 1EP4B 5IXUA 1IBMF 3HKWA 1WOOA 1U1OA 3GFZA 3WIUA 1VIXA 4YN3B 5A6PA 3AAWB 1VBXA 5KT2A 2PA3A 2EG1A 3C66A 5B0EA 2RAQA 2YY3A 3R6GB 3AB2B 4OX8A 1S72S 1B64A 4CM2A 2O01C 2MZSA 1NHVA 2NUUG 4RBUA 3M8WA 4K4UA 1RHMB 2ZEJA 3MAQA 5GMEA 4OX7A 2CQ0A 2R2UA 3EZUA 1IBKF 1BHNA 1KQSR 2KFZA 4F0KA 5L38A 3Q3QA 1UW9A 2HBYB 1REVA 1S1UB 4XAKA 1N5SA 4TXSA 1SH3A 3R27A 4HHUA 3BBCA 3ITHB 2DXEA 3FEYB 2DH8A 3SI8A 1U49A 1TVRA 4X65J 1RBLA 1Q78A 4XIUA 4MHXA 4RNMA 1KS2A 2XI3A 3CULA 4RU9A 3BKFA 3M8ZA 3KJFB 4Q45A 1NPRA 2HQFA 1QUVA 2CRLA 3VAKA 2R7RA 2FHJD 4K4TA 1WHVA 2XY5A 1YRUA 2O5DA 4CCHA 5A8KA 1X9WA 4ZS6A 4ZITA 2D7SA 3QNWB 1HW9A 2VBZA 3H0PA 1XNQF 4ID5B 4K4SA 1LW0A 1B0VA 3VAMA 1AYEA 3K8WA 3FJ2A 4UPKA 2EW9A 3HVAA 1B4SA 2KXHA 1IR2A 1U09A 3SSSA 5HQMA 3T5LA 1ZEBA 4URQU 1FNXH 3LXQA 3IBFB 3UCGA 4DOZA 2BOAA 3C8YA 5IV3A 1OQ3A 3UNYA 2J6TA 3DRYA 5B7WA 3E01B 2HFSA 1MU2B 3KD8A 3D1QA 1RJJA 2CNOB 4JYAF 3RB6A 3FBFA 1OY8A 1UWBB 5A76A 1VQNS 1XQIA 1WELA 4C3LA 2JEFA 4HTIA 3OPKA 4OHYA 1HI8A 1U1PA 1U1RA 2W9CA 3MCOA 2Z0GA 2DCUB 2DEJA 1F60B 3PX4A 2D3O1 2QGFB 3MM8A 2X1GA 4H4KA 2GW8A 5F3TA 3E3XA 4CTAB 2J5AA 2FJAB 2BABA 2GS8A 4NCGB 5LRMA 3MEDB 4JP8A 1G4CA 3T1HJ 3S1TA 1CJKB 4Z2XA 4OZ3A 1WC0A 1UA1A 3NMAA 3AQOA 2ZUGA 4FYVB 1N5YB 4KHPJ 3HF5A 4A8WA 4QJVA 3VTIA 2UVWA 1B0PA 4HLBA 4DV1F 2BEFA 4CO2A 4U8YA 2QA2A 1PILA 3B78A 2DNNA 2FGCA 5CYMB 2FD2A 4ZHRA 1MN9A 1HIYA 4U6PA 3M05A 2G2OA 1S6OA 5GAEI 2VASA 2CG8A 1FVSA 3CC7S 4CT8A 1ED9A 3V6DA 1RE1B 3B4MA 3HKZD 4KB7A 3UWTA 1NB7A 4WFBQ 4RUAA 4K59A 4DCJB 4X2BA 2OTLS 4P7VA 3DOLA 2AEJA 2JSXA 1P1TA 5C25A 5HJYA 5KT3A 2RQ4A 1CSJA 3DRPA 4NZ0A 3K5LA 4B9TA 2MJUA 1VRQC 4F67A 3AJ2A 4OJHA 2U1AA 2R8HA 2CQ1A 1R8PA 2DNGA 4EWTA 4N56A 1UTAA 3VAJA 2VOPA 4F50A 1RTIA 1U6ZA 1EB0A 4Q7AA 1IWGA 2J0QD 4OJ1A 5A0YA 1ZA1B 1UKUA 1E6YB 4KQZA 3GIMA 1KBRA 1XK8A 4F3QA 2DH7A 3PW4A 4L74A 4NRUA 2HGMA 3PO4A 3TW0A 5KOXA 4B08A 2UUCJ 2HBRB 2WHOA 3M9MB 2LXUA 2OELA 5HMZA 4OZ2A 2FJXA 1I5OB 3BDHA 4L6V3 3DGVA 4ED7A 1T0TV 2ZUAA 2LA6A 2DR9A 1VQ6S 2MKIA 5F9LA 2XQCA 1OY6A 5DZ7A 2V9WA 5GRRA 2YPZA 5J2MB 2OD4A 2Z2ZA 4LFAJ 1FNOA 1C4AA 2VQEJ 4DI6A 1X8DA 4AL7A 1RT3B 2FLLA 3J81j 3NMRA 3HSGA 2J6UA 4DS5A 3DDIA 2ADBA 5IT9Y 2F4VJ 5LRNA 4C3KA 1EKSA 3HP6A 2Y0SD 1KC8T 4CXSA 2N7CA 1BE4A 5CZXA 1H74A 4UOHA 4PXCA 2J9DE 2IM2A 4LMZA 2ZKUA 4O44B 1TMMA 3WAYA 3VR1A 3HSZA 4RW9A 4MH8A 1KDNA 4ECTA 2PE8A 2BJDA 1RT1A 1PC4A 3TZYA 3BDGB 2GMHA 4DV0J 4U8VA 1JLQA 2K2PA 1O98A 4C0OC 3BSOA 4B9NA 4J90A 1Z2ZA 3CJ0A 2RQMA 1N88A 1AA1B 3M6UA 1IBCB 2BE7D 1HR0J 2MHNA 3FSXA 1FEEA 3EGZA 2DNPA 4JI0F 2ZBQA 4BCAA 4JV1A 2KYZA 1ZYQA 1K73T 1KWMA 3N6LA 4JI7J 3QMQA 4K0KF 2HEKA 3CCES 3CPWR 2GO8A 3QO9B 3MD1A 4FP9A 3J81Y 5LSOA 4KGKA 5D78A 3LF0A 2ZVSA 3G6ES 2BACA 1NMEB 3EZOA 3D3BJ 1GEHA 4FZVA 1Q0NA 2KKHA 4Y2MA 1K9MT 1D8ZA 1DRZA 4P2MA 1NK8A 4RW4B 4TN0A 5KFJA 1N36J 1EAYC 2RS2A 1FKAF 3Q0AA 4OZ0A 5M2RA 2DY9A 2EEYA 4RNNA 1HQUA 3T9ZA 3BN7A 4KAYA 2DGUA 2QA4S 3UR3C 1RTHA 5IQ6A 1HNVA 4ED6A 2ZFHA 2V34A 2DGWA 2NXJA 4NXNJ 4JI6J 3MR6A 2BQRA 5D0EA 3NCQA 4PAAA 5E41A 3RB3A 3GLJA 1IKXB 1S6QB 2N4CA 5GADU 3BO2A 2WOMB 5L0KA 4UY85 3BDEA 1HW8A 4F36A 2HHHF 4PABA 1TL4A 8ATCB 4M1KA 3ILLA 2EFVA 4KR0B 1Q1KA 2H5EA 4ZG9A 3W2WB 2G13A 2EBEA 1KQGB 3NS5A 5HANA 2M8DB 2KFYA 1YSJA 2EG2A 1RKJA 1AFJA 3RZAA 4JI5J 4KPYA 7FD1A 3CW2C 2M5YA 3QIPA 1TV6B 5GAHU 1JJHA 5AE3A 2F1FA 1VBKA 4TLRA 1DQ8A 4DR7F 2GMJA 1FWLA 2ROPA 4QWDA 2Q43A 2KHCA 2OPRA 1UPPA 2WAQD 5D4LA 1KR4A 4M5JA 1JKHB 2PD1A 2VIHA 4X62J 2UV8G 4OYOA 3TUPA 1UEVA 4I6AA 3NGRA 5BJRA 4LF8F 2YWKA 2OSRA 1KLMB 2YXLA 3BN4A 1L3VA 3MWBA 5ETLA 1SQGA 1C1CA 4B17A 1FRJA 5LJ5Y 4OX9F 3Q8UA 2VPZB 1P1LA 1FKPB 2EI5A 3BYPA 2B56A 3K58A 2QJ3A 2LVWA 4NLQA 3D6HB 5M2PA 1WUUA 2IRYA 4M5DB 2Y8YA 4K7QA 5J2PB 1PSDA 4JBCA 1AJAA 1XN9A 3J7A1 2VU5A 3G8SA 2ZZMA 1NZ8A 1VLYA 2W2NP 5GAGU 3LP0A 1OYDA 4DSIA 2XY6A 2EFGA 1X4AA 2CVIA 4WYLA 4JI3J 1RTZA 3H2VE 3RB4A 1MMNA 1T05B 3T3FA 4F7VA 3OL6A 4X4OA 2BM0A 3HPOA 2C2ZB 2M52A 2RU3A 2FZCB 2CPDA 3AXKA 5DQGA 5H9EK 3W66A 2B7BB 2H51B 2YBVA 3J80U 2EWHA 2GQQA 4AD6A 5H9FJ 4CO1A 3ZZPA 3NXZA 4ZVHA 3W9IA 1Y7AA 5HMWA 2B4PA 3DLKB 1H2VZ 1BQNB 2HNYB 2X1FA 1NPKA 1FK9A 3BM7A 3MM5B 4X4RA 4WK1A 2JNJA 3MM6A 2EPIA 1YGYA 3B8HA 1T9TA 1N32F 3R5DA 3L7PA 2F7VA 1YZ6A 2H48B 4GO7X 3TX8A 4L72B 3CUNA 5B09A 4AE5A 3MPUB 4B3OB 5J1EB 5DQIA 2P9GA 3M2UB 2FUG9 2YNIA 3FSYA 3RW6A 3M8PB 2BBEA 4DV4F 2BRLA 1ELZA 5GAHI 1HNWF 3UDEA 2OGUA 2XY7A 3CNQP 1DLOA 3IC1A 2VDIA 4OX6A 3CJ5A 3W3SA 3GV5B 4AQYF 4B9MA 2R3VA 2KB2A 1JXLA 4PPDA 1ZZNA 2WZ1A 3TEHB 3DLEA 2CNKB 4I2QB 4JI4F 4CO5A 4ZP8A 1X4DA 4FNHA 1H3DA 1FXDA 4FBTA 5L0EA 2K06A 4CH7A 1X60A 3NLCA 3VWSA 4TU9A 4F25A 3CT9A 3AOBA 4BBYA 4J9OA 2G1HA 3U1LA 1Q8LA 2LKZA 3IS9B 2CUYA 4WP8A 3KLIB 3Q8PB 4DV5F 1BXNA 4ZVRB 3KNAA 2YNFA 4DR1F 2QG9B 1U2RA 2RDIA 1VRUA 1CJTA 3R3TA 3SFUA 1C0UA 2ZH3A 1ZETA 2W9BA 2MSTA 3UE2A 1VC6A 3MM9A 4A46A 3PJWA 4B9LA 2D1GA 5LMNJ 3FK4A 2HNDA 3GSDA 5KXAA 1JK9B 2W2OP 2D9OA 4ETZA 1FERA 2WONB 1X4GA 2M7SA 1GH8A 4ILLA 4J7CA 5HVFA 1J5OA 4UY8T 3NNAA 4WJBA 1AJBA 1VOMA 1YI2S 3ELHA 7AT1B 3R7BB 4ZVSB 2KH9A 3OVBA 2FVPA 5FJ4A 4ILRA 1M5SA 4C2MA 2MKYA 2IAJA 2A2DA 3I87A 2ZZNA 4KO0B 3QWPA 1TP7A 5K14A 4ZPWR 4L75A 2W4DA 4TY8B 1VQ8S 4RJVA 3KK3A 1FFGB 1WWHA 5IM0B 2HVZA 2QT7A 4UZBA 3DXSX 3ET6B 3LP2B 5DGAA 1SV5A 3I4HX 4GVLA 4K5RA 1NM2A 4P71A 4B56A 2MKKA 2X7IA 3CJRA 3ISNC 1VQ5S 5AJ3F 3QWUA 3ZZZA 2JEJA 2V4QA 2DR7A 1EIYB 1C4CA 1SJFA 2KZZA 5AJ9A 3PACA 4LQ3A 3I0RA 1YG0A 2VQFJ 1B7FA 2UUWA 4R5PB 5HO4A 3FNNA 2F3JA 1HJKA 1URAA 4EZ6A 2IVFB 1FDDA 4OYBA 4ZVPB 5EN1A 2OIHA 1WOSA 4QZVB 4OYMA 4OZ5A 3AD8C 2AMCB 4LFCJ 2G0IA 4HACA 4LF9J 4NLXA 1HNIB 2ILYA 4USVA 1S0NA 5DZ6A 2CG4A 1QY7A 1WHWA 1FO1A 1U6BA 2GZOA 2R42A 4KM4A 4PCQA 3KHLA 3D6TB 4RBTA 3DKDA 2UU9J 4C8YA 3CCMS 1HWUA 1GMVA 1T9VA 4FYDA 1OSDA 1VQPS 3Q2TC 3EGWB 1YQHA 1TL7B 3B4DA 4ZOSA 1FTRA 4QYZK 2WRMA 3G87A 2F4FA 5CYJA 2L48A 3CCQS 1SUQA 1JLGB 4IH5A 1NRKA 2BKNA 2DPJA 2XMAA 4CYSA 4ZIVA 4UPIA 1WTFA 3HHLB 2JH3A 3QT5A 2W7AA 5KFLA 4LJMA 1SI9A 5ETQA 3SFGA 3M8QB 2DH9A 3OSPA 4YR1A 1GT8A 4IO1A 1UZHA 1RAEB 1IBMJ 1EP4A 3IR7B 3U27A 4KKOB 1RBAA 1UFLA 4ECUA 1V9OA 4TLQA 1YTYA 3VHQA 3GWCA 3FKBA 2KU7A 2WVCA 3JS9A 2HWHA 4QYRA 2UXBF 1CJUB 3I31A 2BW2A 3FBEA 3H2LA 2XTJP 1X5TA 2F40A 4R8UB 1ZAWA 2FY1A 1FWPA 2R7VA 1Y00A 4PQAA 2QTWA 3T1AA 1B8JA 4DV7F 2W01A 2BE2B 4F0HA 2FDNA 1IBKJ 2JVRA 5IT4A 2OLWA 3GZ7A 5KFIA 3D9BA 2H9ZA 3R8YA 1S1UA 1SJ3P 4KFBB 1P49A 5B0CA 1M5HA 3ITHA 5TJ3A 5C2CA 4GTYA 4DL7A 4PWDB 3D0HE 4ECWA 1G6BA 4EU0A 2EKYA 5LQQA 5B0GA 2HHWA 3BPDA 2KYXA 1N5QA 5C42B 1IVZA 1QM9A 1UVJA 2D74B 4UF4A 1P8GA 2AX1A 4O4RA 3OHAA 5E5NA 4LF6F 2X98A 2P2CB 1RHKB 1XNQJ 2MLYA 4F8RA 2C3OA 4FXDA 2ZJRQ 4ID5A 3JB9k 3US5A 1BY9A 4AXIA 3H2UB 2WTFA 1QAXA 2AJQA 2DNOA 4R0JA 2ATLA 1F3FA 3CJ8A 4MYUA 3ETMA 3IDDA 1GXLA 3FCHA 2BYCA 2VFTA 1OY9A 4B9SA 2UVRA 1NAQA 1JJCB 1SL0A 5KFFA 1S76D 4KE5A 1KFSA 3ICLA 1NSKL 4JYAJ 1MU2A 3NKRA 5CH7B 1KLNA 3R2CJ 3FBCA 1VDHA 3N79A 1FCAA 5F9NA 4GC7A 5HP1B 3M30B 4WF9Q 1NU4A 4CYRA 2XSJB 1UWBA 4QAXA 4OJGA 2DRBA 4CIOA 3C19A 5D4PA 3AFGA 2VD3A 4NL5A 2CZ9A 3C6UB 4CRJA 1HI1A 1KVJA 5JMNA 2FYXA 2UUBF 4DR3F 2D3OR 2I1RA 3PCOB 1QVGR 3K57A 1FXRA 1N52B 2HFUA 1BGXT 3AOCA 1K8AT 4CTAA 3HD1A 4DSJA 3LGMA 1UA0A 4NEZA 1VBYA 2UUAF 1LW2B 4ED2A 3T02A 2HHSA 5ETVA 3WX8A 4NCGA 1D1UA 3UVJB 5KFSA 5DDPC 1JX4A 1GMUA 4D3GA 3MEDA 5KFRA 1CJKA 1S59A 4A47A 1E2SP 1PBUA 2BJ3A 2Y1IA 3ZZRA 1N5YA 3C16B 1UVKA 1XNRF 2ZBPA 1V5IB 3WAWA 4DV1J 2XYHB 4N8OA 4Q8EA 5A8RB 4C3MA 2W7OA 3NBPB 1FHTA 1GX5A 3EMTA 2B6AB 3EE3A 1GNKA 3LWMA 4TNOA 5CYMA 1ALJA 2W8LA 1S1WB 3QRRA 4OI6A 5HQ8A 1FI4A 2YQ3A 4CXUA 4J5OA 1HHTP 1E1ZP 4KHRA 4ZCLA 1BQXA 4J9SA 4J9RA 2V4RA
chains in the Genus database with same CATH topology
4UPLA 1ZEDA 4UOPA 1ED9A 3M8ZA 3BDHA 4LR9A 3WBHA 2ANHA 2VQRA 3MK2A 1KHJA 2IFYA 3OT9A 5GRRA 2W5SA 1AJDA 2X98A 1ANJA 5L0KA 4NWJA 4KM4A 1FSUA 3IGYB 4LRCA 1KH7A 4FDIA 4LR8A 3SZYA 3T01A 3IGZB 3E2DA 4LRDA 4CXKA 3TG0A 1ALHA 1AJAA 2W5RA 4NWXA 3T02A 4ZG9A 1KHLA 1AUKA 4LRFA 2W5TA 3NKOA 3UN3A 5DLTA 4MIVA 5L0BA 5LIAA 4B56A 1B8JA 1N2LA 2XRGA 2GA3A 2GSUA 4GTXA 3NKNA 1ELZA 1KHKA 1SHQA 2GSNA 1ALKA 4GTWA 4UOOA 3SZZA 5HRTA 4ZG7A 2W8DA 3M8WA 1AJCA 1E2SP 3NKPA 1KH5A 3TX0A 4LREA 5LRNA 3ED4A 2D1GA 2W5WA 5LRMA 2XR9A 1EW2A 2G9YA 3NKQA 1EW9A 4CXSA 1ELXA 5IJQA 4UPKA 5IJSA 4ZG6A 1N2KA 3IDDA 3WAWA 5KXAA 1ALIA 4ZGAA 5C66A 3NVLA 1SHNA 1P49A 2GSOA 5DLWA 1O99A 4CYSA 1KH9A 4KJGA 5AJ9A 1ELYA 3NKMA 4UPIA 5EGEA 1HQAA 3DPCA 5TJ3A 5DLVA 3BDFA 3WAYA 3DYCA 1K7HA 1EW8A 2IUCA 4LRAA 3TWZA 1EI6A 3Q3QA 4N7TA 4KJDA 1ANIA 1AJBA 4KAVA 3NKRA 1ZEBA 4TN0A 3CMRA 3B5QA 3LXQA 4FDJA 3BDGA 4LRBA 3MK0A 1HJKA 1URAA 2ZKTA 3A52A 3MK1A 1HDHA 4GTYA 3WAXA 1ALJA 3M8YA 3UNYA 1Y6VA 1ED8A 5K4PA 3WAVA 2W5QA 2GLQA 3UN2A 4LR2A 3T00A 3UO0A 4KAYA 2IUCB 2QZUA 5EGHA 4YR1A 4CXUA 3KD8A 4CYRA 5L0EA 4QAXA 1E33P 1ZEFA 1Y7AA 1URBA 5LQQA 4GTZA 3BDGB 1E1ZP 2W8SA 4LQYA 1KH4A 5GOVA 2W5VA 1E3CP 2RH6A 4UPHA 3UN5A 4MY4A 2W5XA 4MHXA 1O98A 1EJJA 3M7VA 4UORA 5INHA 1EQJA 1KHNA 4LR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UPL A;  1ZED A;  4UOP A;  1ED9 A;  3M8Z A;  3BDH A;  4LR9 A;  3WBH A;  2ANH A;  2VQR A;  3MK2 A;  1KHJ A;  2IFY A;  3OT9 A;  5GRR A;  2W5S A;  1AJD A;  2X98 A;  1ANJ A;  5L0K A;  4NWJ A;  4KM4 A;  1FSU A;  3IGY B;  4LRC A;  1KH7 A;  4FDI A;  4LR8 A;  3SZY A;  3T01 A;  3IGZ B;  3E2D A;  4LRD A;  4CXK A;  3TG0 A;  1ALH A;  1AJA A;  2W5R A;  4NWX A;  3T02 A;  4ZG9 A;  1KHL A;  1AUK A;  4LRF A;  2W5T A;  3NKO A;  3UN3 A;  5DLT A;  4MIV A;  5L0B A;  5LIA A;  4B56 A;  1B8J A;  1N2L A;  2XRG A;  2GA3 A;  2GSU A;  4GTX A;  3NKN A;  1ELZ A;  1KHK A;  1SHQ A;  2GSN A;  1ALK A;  4GTW A;  4UOO A;  3SZZ A;  5HRT A;  4ZG7 A;  2W8D A;  3M8W A;  1AJC A;  1E2S P;  3NKP A;  1KH5 A;  3TX0 A;  4LRE A;  5LRN A;  3ED4 A;  2D1G A;  2W5W A;  5LRM A;  2XR9 A;  1EW2 A;  2G9Y A;  3NKQ A;  1EW9 A;  4CXS A;  1ELX A;  5IJQ A;  4UPK A;  5IJS A;  4ZG6 A;  1N2K A;  3IDD A;  3WAW A;  5KXA A;  1ALI A;  4ZGA A;  5C66 A;  3NVL A;  1SHN A;  1P49 A;  2GSO A;  5DLW A;  1O99 A;  4CYS A;  1KH9 A;  4KJG A;  5AJ9 A;  1ELY A;  3NKM A;  4UPI A;  5EGE A;  1HQA A;  3DPC A;  5TJ3 A;  5DLV A;  3BDF A;  3WAY A;  3DYC A;  1K7H A;  1EW8 A;  2IUC A;  4LRA A;  3TWZ A;  1EI6 A;  3Q3Q A;  4N7T A;  4KJD A;  1ANI A;  1AJB A;  4KAV A;  3NKR A;  1ZEB A;  4TN0 A;  3CMR A;  3B5Q A;  3LXQ A;  4FDJ A;  3BDG A;  4LRB A;  3MK0 A;  1HJK A;  1URA A;  2ZKT A;  3A52 A;  3MK1 A;  1HDH A;  4GTY A;  3WAX A;  1ALJ A;  3M8Y A;  3UNY A;  1Y6V A;  1ED8 A;  5K4P A;  3WAV A;  2W5Q A;  2GLQ A;  3UN2 A;  4LR2 A;  3T00 A;  3UO0 A;  4KAY A;  2IUC B;  2QZU A;  5EGH A;  4YR1 A;  4CXU A;  3KD8 A;  4CYR A;  5L0E A;  4QAX A;  1E33 P;  1ZEF A;  1Y7A A;  1URB A;  5LQQ A;  4GTZ A;  3BDG B;  1E1Z P;  2W8S A;  4LQY A;  1KH4 A;  5GOV A;  2W5V A;  1E3C P;  2RH6 A;  4UPH A;  3UN5 A;  4MY4 A;  2W5X A;  4MHX A;  1O98 A;  1EJJ A;  3M7V A;  4UOR A;  5INH A;  1EQJ A;  1KHN A;  4LR7 A; 
#chains in the Genus database with same CATH topology
 4JV2 A;  1YJ7 A;  2MQQ A;  1T3N A;  2ZOM A;  3CO9 A;  5KG5 A;  1X4H A;  2IFY A;  4QU7 A;  3BKU A;  4WFY A;  2IJN A;  2PFF B;  4OZ1 A;  1P9Y A;  1YJV A;  2LQJ A;  4K4W A;  4KV8 B;  3DNC A;  3UD5 A;  2AJF E;  1O6X A;  2AYE A;  2BKP A;  1E6V B;  3IR6 B;  1ALK A;  5D15 A;  1XER A;  2N7Y A;  1R0C B;  1S99 A;  1KFD A;  2A18 A;  4P72 A;  1E6Y A;  4K2X A;  3M9N B;  4IO9 Q;  1DFD A;  3EVO A;  2XLK A;  3NCP A;  3L7O A;  3J7Y I;  3CJK B;  2CNN B;  3NKM A;  2KZM A;  3S6E A;  1IXK A;  3FEZ A;  1X5O A;  3CIZ A;  2FC9 A;  5HLF B;  4FF2 A;  1R0A B;  3QT7 A;  4LR2 A;  3B6B A;  1Y9O A;  4MIB A;  1GXU A;  2DO4 A;  2LFV A;  4ES1 A;  2RHS B;  1J27 A;  5CCM A;  5INH A;  4NEY A;  3UI3 A;  1KTV A;  2XZW A;  4DFK A;  2B5J B;  5EX3 A;  5J2M A;  4DMZ A;  1KON A;  2HFN A;  2R2R A;  2CVE A;  2AEM A;  3TRG A;  2CYY A;  3TZX A;  3ENQ A;  2GJF A;  5LXY A;  1JIH A;  1WG4 A;  3RAQ A;  3OTE A;  2JEI A;  1RT3 A;  2GCF A;  3N0V A;  3RRK A;  3EGV A;  3MGJ A;  5F3Z A;  3MPV A;  1DTQ B;  3VGT A;  3KLH B;  1IN0 A;  1TKD A;  1A6L A;  3BSN A;  4PYA A;  4F3M A;  3MEG B;  3ZTQ A;  2E44 A;  4QCL A;  4O3Q A;  4CH0 S;  4JV0 A;  2KXF A;  3D54 A;  4O44 A;  1QSS A;  1NKB A;  3I9Z A;  4Z7C A;  4UT4 A;  2ZOF A;  2PO4 A;  3TAP A;  1NH8 A;  4Q8F A;  4G1P A;  1FRK A;  2JRS A;  1A0O B;  3BDG A;  1L3S A;  2LLZ A;  1SIZ A;  4MT1 A;  2LQ9 A;  1YBT A;  1QE1 B;  3CD5 A;  2VUG A;  2LXF A;  3DN9 A;  2FIU A;  2HVI A;  2I9S A;  5I3Q A;  2FVQ A;  4DUY J;  3QLH B;  2OEJ A;  2IDE A;  1GXT A;  5DGB A;  2NZC A;  4DJB A;  2V8V A;  2DJW A;  3R7N B;  2NZ4 A;  4JI0 J;  3AOD A;  2C2M B;  3Q89 A;  4M5N A;  3HCX A;  3LUY A;  1JMT A;  1N34 F;  3RBD A;  3MM8 B;  4EZ9 A;  5L39 A;  2HIY A;  3C2P A;  1FJG F;  2C2O B;  3HUL A;  4LRF A;  5G4D A;  1SL2 A;  3QFH A;  3VVU A;  3ZC4 A;  4BS2 A;  3DHW C;  5C7P A;  4HI2 A;  5KFY A;  1XR7 A;  1V3Z A;  1Q5Y A;  3BGF A;  1H7X A;  3EXC X;  5DJB A;  3SQO P;  2QLB B;  1EW9 A;  4XK8 C;  1LXN A;  3W5Y A;  2AQ4 A;  1N2K A;  4LSL B;  4RW4 A;  1SJQ A;  3TEG A;  1JXE A;  2MLX A;  1R8B A;  3PO5 A;  3GPA A;  3DYC A;  2MQL A;  1NDC A;  4ERD A;  1YJN S;  2E7W A;  3VAL A;  1JNR B;  3FGV A;  2CZV C;  3WAX A;  1TKT B;  2BJ8 A;  3PRB A;  4HKQ A;  1ZA2 B;  2DNR A;  2QZU A;  3HSD A;  4X66 J;  5DDR C;  1IKX A;  1S6Q A;  1WF1 A;  2RB7 A;  5CAB A;  3E2E A;  3TVY A;  2WOM A;  3PRV A;  2HFO A;  3MI7 X;  3KLF B;  2VG7 B;  2HK3 A;  3D4J A;  4CDI A;  1YKW A;  4NA3 A;  1RAG B;  1IJE B;  4LBI A;  1HPZ B;  1M5O C;  1UZD A;  3W2W A;  4U95 A;  1W25 A;  3CCZ A;  5JUM A;  3SYZ A;  3W1Y C;  5F8J A;  3E2D A;  3AXM A;  1WEY A;  3RR8 A;  3I32 A;  1KVI A;  2DNK A;  3NCR A;  2KG1 A;  2IY5 B;  1TV6 A;  2UUT A;  4DR7 J;  1DAR A;  1B7Y B;  1ZS6 A;  3H59 A;  1SJR A;  4N47 A;  2JLG A;  3NKQ A;  2DNL A;  4TY9 A;  2Z2L A;  1JLE B;  1JKH A;  5AXL A;  2NQP A;  2ZHA A;  2K1R B;  4N7T A;  4WCE Q;  1DTT B;  1KEK A;  1UVI A;  2WSC C;  1KLM A;  1IQZ A;  3BQ2 A;  5L9N A;  1S9F A;  1QDU B;  1RSC A;  1FEH A;  5U47 A;  4OX9 J;  2B9E A;  5GOV A;  4ID8 A;  4U7C A;  2QV6 A;  3PM9 A;  1FKP A;  3NGK A;  3G6Y A;  2F9D A;  4YS2 A;  2HZV A;  3DGP B;  3OD2 A;  5J2P A;  2AGQ A;  3PHE A;  3IBC B;  1GK8 A;  4IYQ A;  3UCZ P;  2DNM A;  4OV1 A;  3KKF A;  3VGV A;  1O8B A;  2R7Q A;  1VYA A;  3MR7 A;  1F5A A;  4E2F B;  4I6Y A;  2KJW A;  2F8M A;  1F2G A;  3PYE A;  1VBZ A;  3OFF A;  1T05 A;  1S1V B;  5LT5 A;  4OHV A;  4X4P A;  3M2V A;  2ZNY A;  2GVD B;  3HSJ A;  3RR7 A;  2DHG A;  2ZIT A;  4OYZ A;  3K5N A;  5EX0 A;  4NCA A;  4X4S A;  1D8Y A;  2NR0 A;  5DRK A;  4M5K A;  5C66 A;  4RW9 B;  3N5F A;  2MPU A;  3JAM U;  4YDX A;  4KJG A;  4QPT A;  5A6W A;  4N77 A;  3H40 A;  2JFD A;  3DLK A;  2V50 A;  4EEY A;  3V81 B;  1BQN A;  2HNY A;  2EFO A;  2CDQ A;  2D3U A;  2DGT A;  4DN9 A;  4CT9 A;  4C0B A;  3CO0 P;  2ZDP A;  1WHX A;  5FLX U;  3MM5 A;  5DM6 Q;  2W2P P;  2YPY A;  3KXD A;  2I6W A;  2W5V A;  4UOG A;  2RH6 A;  1N32 J;  3PEH A;  5KFX A;  2Z30 B;  4M5H A;  4CP5 A;  4LR9 A;  2X1A A;  2KVQ E;  3OLB A;  4W92 B;  1MML A;  4B3O A;  5J1E A;  3KHG A;  2RQK A;  3M2U A;  2OFG X;  4DV4 J;  1G1X A;  2NUH A;  1HNW J;  3M8P A;  1C0T B;  5IC6 B;  2I5J B;  3T5K A;  1NO8 A;  1VR6 A;  4QPX A;  1HLW A;  2H1Y A;  2IPO B;  4GVB B;  5L8R C;  1T8E A;  3K0J A;  4AQY J;  4U7U D;  4WYW A;  5DDQ C;  1QLN A;  2P6T A;  1MNE A;  4ZVT B;  4AUK A;  1W2B R;  2Q6C A;  1CJV B;  3CCJ S;  3S01 A;  4LRE A;  3L7U A;  3GIK A;  3VQS A;  1YJR A;  4JI4 J;  5KG1 A;  2P9C A;  4NLY A;  4HDH A;  3TI0 A;  3C15 B;  3UDL A;  4ECV A;  1X31 C;  3MR5 A;  3V6J A;  4B3M F;  2CPI A;  3Q8R B;  4HH1 A;  3Q83 A;  3MK0 A;  2KL8 A;  1Y6V A;  3G86 A;  4P7T A;  3NNH A;  1RWW B;  3DLL Q;  1RWN B;  2YKM B;  1WDD A;  3CTR A;  3MMJ A;  1RWP B;  4DV5 J;  4NXN F;  3IS9 A;  1UCN A;  3KLI A;  8RUC A;  1S10 A;  2F9J A;  4DR1 J;  3GG0 A;  4DLE A;  5F41 A;  3VVT A;  2MQ8 A;  1IR0 A;  2C2E A;  1NJZ A;  1HMV B;  2UXD J;  1AJD A;  4K4X A;  3QAT A;  1YDL A;  3CJQ A;  5ITH A;  3TZW A;  4IKA A;  1S12 A;  4DF4 A;  3PV8 A;  1B3T A;  3JSY A;  4NE9 C;  5C24 B;  2VON A;  1M1K T;  3OHB A;  4K5S A;  4O3O A;  4RWX A;  3W9J A;  2WON A;  5K8M A;  3F44 A;  1RT2 B;  1TR0 A;  2XGQ A;  3KTQ A;  1K7H A;  4A8K A;  2OHD A;  3BEG B;  2MMY A;  4DUT A;  4JOU A;  2LEC A;  2DGS A;  5K5M A;  4S0M A;  1WSR A;  4J9P A;  4YFU A;  3UPF A;  5D4O A;  1X4B A;  4J91 A;  1EKR A;  4I2P B;  4FS1 A;  3PVX A;  1DY3 A;  5IQQ A;  2CDR B;  3TOQ A;  4RNF A;  2L9N A;  2RIL A;  3DM2 B;  4B9U A;  2OEM A;  3G96 A;  3FQK A;  4KO0 A;  4OI1 A;  4RLE A;  5KFQ A;  5IC4 B;  4USJ C;  1VQS A;  1WC4 A;  4LBH A;  3MK2 A;  3ET6 A;  3LP2 A;  1LNQ A;  3R6L B;  3THP A;  3NL0 A;  5KG6 A;  4DSF A;  1VQY A;  2VC1 A;  5AJ3 J;  2X51 A;  1J5E F;  3CJ2 A;  2DK2 A;  3OSN A;  3H5S A;  4DZD A;  2QX0 A;  3MUT P;  2IVM A;  4X64 F;  4OMF G;  3QBC A;  2O66 A;  2MZ1 A;  3CCV S;  3C46 A;  4G65 A;  3FCV A;  1V3R A;  4R5P A;  2I0X A;  4ZG6 A;  4EGL A;  1RK8 A;  3KG1 A;  3NS6 A;  1WF2 A;  1OYE A;  5RUB A;  1N33 F;  4JI2 F;  1KP6 A;  4JV5 F;  4CYU B;  3BDF A;  4NAS A;  1DQ9 A;  4QWA A;  4J37 A;  1VJW A;  3I6P A;  4EBC A;  2LQ8 A;  1BD6 A;  3FQL A;  1HNI A;  1ZTW A;  3M9O B;  2V8G A;  1JLC B;  2YKP A;  3W2V B;  3Q23 A;  4DL3 A;  1NKE A;  4KH1 B;  3M7V A;  4XO0 A;  3HFZ B;  1XJW B;  1NK0 A;  1MWQ A;  2B4O A;  4ECR A;  3DRS B;  1KHW A;  2DNZ A;  3TA2 A;  1TL7 A;  1RZM A;  2BV3 A;  3H25 A;  4F04 B;  1SC1 B;  1B70 B;  2YWW A;  4OI0 A;  1JLG A;  4DLG A;  3O6Q A;  2JWN A;  2CJB A;  4PG6 A;  2JL9 A;  4FPI A;  1ELO A;  3HHL A;  5D3G B;  4WFZ A;  3O3L A;  2BE9 B;  3G71 S;  2ERR A;  3JTN A;  1U24 A;  3M8Q A;  3GON A;  4NWB A;  1AUS L;  3M1V B;  3L3C A;  2OJ3 A;  4PQU B;  1EW8 A;  4DXL A;  5K8N A;  4LRA A;  5IS2 A;  3PIP Q;  1NK4 A;  4NLW A;  2NYH A;  4NX9 A;  2B7C B;  4USW A;  2VFV A;  4KKO A;  4HL9 A;  4Z7Y A;  3ISN D;  4FF3 A;  5KFK A;  5F8M A;  3ZZT A;  1H6K X;  1NH7 A;  2G0C A;  3PW5 A;  2RDD A;  1FKO B;  3HZE A;  4EYI B;  3NAI A;  1CJU A;  2HQ3 A;  5DET A;  1F3V A;  4IG0 B;  1HWL A;  3QYY A;  2HVH A;  4R8U A;  5I4M A;  5ETN A;  4AL6 A;  4DPY A;  3OV7 A;  3I0S B;  5DQH A;  1HBO B;  3JSR A;  2JHE A;  2W9B B;  4MK7 A;  5IV4 A;  5CHC B;  3LP1 B;  3H42 A;  3N01 A;  4MAK A;  2XMM A;  4LIR A;  4Y2A A;  2VV5 A;  5M2U A;  5J2N B;  3OVS A;  3ZTO A;  4C8L A;  4KFB A;  2DT9 A;  1RWV B;  5LMN F;  1FD2 A;  3ENW A;  3GE9 A;  4NXM F;  2C42 A;  5IJS A;  2M4M A;  3CD7 A;  2GIF A;  4F2S A;  4RL1 A;  1F5B A;  4USU A;  4PWD A;  4DX5 A;  2DHX A;  5EGE A;  2BXJ A;  3EDQ B;  3PFO A;  3CWJ A;  1GQE A;  2CQ3 A;  4BDP A;  2VF3 A;  4IRC A;  3Q24 A;  3ZZY A;  2BQU A;  2GHW A;  5C42 A;  3AJ1 A;  2FLN A;  3WDO A;  2ABY A;  2FHJ A;  5D6G A;  1X9M A;  4DR6 F;  4L73 A;  3BR9 A;  1TL1 B;  4I64 A;  5CD4 A;  4ZPB A;  1UJ5 A;  2OI2 A;  1IUJ A;  2E5L F;  4FYW B;  2IDL A;  1YBU A;  3THT A;  1SIW B;  1LK5 A;  5E7O B;  1FD8 A;  3DU5 A;  4ZG7 A;  1CQM A;  3DMJ B;  1U0H B;  4NYO A;  3RBX A;  3TYT A;  4EMD A;  2KTQ A;  5HBM B;  1FT8 A;  5EWE A;  2HGN A;  5HP1 A;  4C8M A;  3M30 A;  3DHX A;  2XSJ A;  1CVJ A;  3QAE A;  1WC5 A;  2XWX A;  2W4C A;  3QRQ A;  2VB6 A;  2HVE A;  1I1G A;  1G2E A;  2UUB J;  4LFC F;  4DR3 J;  2DR8 A;  4I68 A;  4LF9 F;  1KQK A;  4ZJL A;  9RUB A;  5A2Q Y;  5H9E J;  4C8K A;  2HQG A;  2UUA J;  4YUD A;  1CC8 A;  2E1P A;  1FFS B;  1LW2 A;  4PG8 A;  4MJK A;  1KH7 A;  1VHF A;  5CD4 H;  1HHS A;  3PTW A;  3J7Z T;  3MHY A;  4CH1 A;  1XNR J;  3CJ4 A;  1CBK A;  2DVI A;  3OFG A;  2M0G B;  2KT2 A;  3SQG B;  3C16 A;  1RIS A;  2XRG A;  2GA3 A;  4OHZ A;  2IA0 A;  3V2U C;  5A8R A;  3TUI C;  3CCS S;  4C7Q A;  4XPC A;  3NBP A;  4F4X A;  2RRN A;  4AND A;  1TTH B;  2B6A A;  3QJJ A;  1RWO B;  4FXW A;  5LXR A;  3PW7 A;  2VA2 A;  2ZH5 A;  2DR6 A;  2XMW A;  3TAR A;  1S1W A;  2LDI A;  1U45 A;  3GR0 A;  1ZM3 A;  4FF4 A;  1JB0 C;  3LWL A;  3DOK B;  3S8S A;  1PJ7 A;  2FJD B;  4F2R A;  2CQC A;  5ETO A;  2AGP A;  2CQI A;  1WAC A;  5I42 B;  4ELT A;  4OIX A;  1CLF A;  1ZH5 A;  3DDN A;  1VQ7 S;  4GC6 A;  2AX0 A;  2P5V A;  1RTJ A;  1S6P B;  4YQW A;  1M1G A;  4QIG A;  2NRE A;  2R7X A;  3HXM A;  2PMH A;  2IM1 A;  4WXW A;  1N56 A;  3WBH A;  4DX6 A;  4YP3 A;  2H54 B;  3CED A;  1NK7 A;  2CWK A;  4KV8 A;  2OP5 A;  3OJS A;  5ETM A;  3A8E A;  4NI2 B;  5JJB A;  2UVV A;  1E6V A;  3V4I B;  4USM A;  3QZ7 A;  2CJX B;  3S7R A;  1VGY A;  2HS3 A;  1FF2 A;  3Q8V A;  1U1K A;  3N6N A;  2HHU A;  4OI3 A;  2NXU A;  2RS8 A;  3IFE A;  2HHT A;  2HHQ A;  1NXI A;  4DPT A;  1S9G B;  1IQT A;  4EFA C;  1AJC A;  3CJK A;  1WNE A;  1EW2 A;  4BC7 A;  5T41 A;  3GCX P;  4PXD A;  1YHQ S;  2B8Q A;  3BSA A;  5HLF A;  4HVZ A;  1R0A A;  4LF1 A;  4M94 A;  4WK3 A;  3CE8 A;  1ZPW X;  3NS7 B;  1KKH A;  1FDA A;  3CJS A;  4O3P A;  2RDJ A;  4F0M A;  2IHR 1;  1NUE A;  4CI0 B;  3T00 A;  5GAE U;  3UCU P;  2B5J A;  3O5T B;  4I56 A;  4ES2 A;  1YJW S;  3MCN A;  1Q79 A;  4MKV A;  5BYS A;  3PEJ A;  4WU3 A;  2JZ5 A;  1BWE A;  2HW3 A;  1ACM B;  1TK0 A;  4UPL A;  2WW8 A;  4J9K A;  5KG4 A;  1RT4 B;  3ETO A;  4PWW A;  3DLG B;  2PI4 A;  2GVZ B;  1TUW A;  1DTQ A;  1RP5 A;  3KLH A;  1SJ4 P;  4N41 A;  2C2N A;  2IM0 A;  3ISZ A;  2FVR A;  3MEG A;  4KHM A;  1ALH A;  1RWU A;  1T9U A;  4W90 B;  1M5P C;  3F73 A;  2QC3 A;  2QL5 B;  3DI6 B;  3WX4 A;  2VFU A;  1JQG A;  1NND A;  1NJX A;  2V2Z A;  3LGN A;  2VHG A;  4YB7 A;  2BDP A;  5KFD A;  3RU0 A;  1QE1 A;  2XI2 A;  2VKZ G;  1IKV B;  2IRU A;  2IVY A;  3QLH A;  2PC6 A;  2UVU A;  5K4P A;  4X84 A;  2YTC A;  3TVZ A;  3CIM A;  4MKB A;  4RW8 B;  1TUV A;  1TMJ A;  1SKU B;  2HK2 A;  1N34 J;  5CZV A;  5ETS A;  1WG5 A;  3PNI A;  1FJ7 A;  1HAR A;  5KT6 A;  3KFW X;  4A8O A;  4DF8 A;  2VBW A;  1FJG J;  3T19 A;  3P3D A;  3U1N A;  2M70 A;  3SEO A;  3OT9 A;  4H4K C;  1X4F A;  1H98 A;  1SKS A;  1FDN A;  3G9C A;  4Q0B B;  5B0D A;  4C4W A;  1GX6 A;  3QGP A;  1DJ0 A;  4B3R F;  2HLT A;  3TP2 A;  2AJ0 A;  3LH2 S;  4IR9 A;  1QJH A;  2FTR A;  4LSL A;  2DTJ A;  4A8Y A;  3N28 A;  2W8D A;  3NEK A;  2B9Y A;  4PZV A;  3HHD A;  4R0E A;  1FA0 A;  3JSM B;  1ALI A;  2C2K B;  1F0X A;  1ZM4 A;  1TKT A;  4HHH A;  2VBX A;  2KVI A;  4DFJ A;  2H4Y B;  4QYZ J;  4I7F B;  3MMC B;  2IM3 A;  3PW2 A;  1ED8 A;  2FHO B;  4WKR A;  3QRP A;  3K17 A;  3KLF A;  2VG7 A;  3LAM A;  3QJP A;  2I2Y A;  1RAI B;  4DEZ A;  1RHU B;  1HPZ A;  2COL A;  2MKC A;  3N5B A;  2HQD A;  2ROE A;  2EC2 A;  3PFE A;  2JOQ A;  3H5U A;  3A3N B;  4DL4 A;  2E1A A;  4OZJ A;  2MZJ A;  5CCL A;  2DNQ A;  2XMT A;  1WI6 A;  2QO3 A;  4ECZ A;  4CLY A;  3ULH A;  3Q8Q B;  4C97 A;  2W4P A;  5G0R B;  2G4B A;  3FZB A;  1VRT B;  2R2T A;  1K47 A;  1FE4 A;  3PIO Q;  5E0O A;  2R2S A;  2MHE A;  4CM0 A;  3O8W A;  4YY3 F;  1JLE A;  4FPR A;  3BB5 A;  1F6T A;  3FEX B;  4AXJ A;  1VLO A;  2HWI A;  3M8R A;  3KK2 B;  4KGX B;  3C14 B;  4DV6 J;  1ZAV A;  2K1R A;  3GV7 B;  1DTT A;  4ZGA A;  3AQP A;  3P45 B;  4XTT A;  2GIQ A;  2DRA A;  2WVE A;  4OI2 A;  4LRB A;  5KFN A;  3FUY A;  4RU2 A;  4KYZ A;  1T11 A;  1Q53 A;  4YEA A;  1LXJ A;  5B0F A;  3DGP A;  4ZDN A;  3HX9 A;  3BJY A;  4ZLL A;  1YBA A;  4A48 A;  3ZTR A;  3H8Y A;  2R8J A;  1RAD B;  1S7I A;  4UOP A;  5KOW A;  4I67 A;  2OEK A;  4GO5 X;  2GAH C;  3AT1 B;  2ANH A;  1TKZ B;  1UJ6 A;  1T9X A;  5EDW A;  1IBL J;  1MWZ A;  3CF5 Q;  4EUV A;  2EFN A;  5KFC A;  4RNO A;  4TU7 A;  2CAJ A;  1S1V A;  3MTK A;  5HN0 A;  3G82 B;  2FJW A;  3OR1 B;  2GVD A;  2Q3P A;  2ZE2 B;  3KJQ B;  3U02 A;  1HYS A;  3KK1 B;  1U0S A;  3OFE A;  2V9K A;  1N5T A;  2CJK A;  2DB1 A;  5MAO A;  5FD1 A;  2XMK A;  3V81 A;  1SJ1 A;  2QYG A;  3GJT B;  3HZG A;  1MLA A;  1S57 A;  1WI8 A;  2QLW A;  2KM8 C;  1EHW A;  3R1L A;  4DUY F;  2RRA A;  1PYO B;  2GLQ A;  1NJW A;  2K7J A;  2V63 A;  3I55 S;  4KGZ B;  1E33 P;  4OYW A;  4TQR A;  1VS3 A;  1XBW A;  1RHQ B;  4P2X A;  2NLW A;  4M63 A;  4XPE A;  1FFW B;  1FJC A;  1C0T A;  2I5J A;  3HHK A;  3BDP A;  4LF4 F;  1VIO A;  4GVB A;  1ANJ A;  2BRK A;  3MD3 A;  2ZJP Q;  4U9R A;  2N4D A;  1CJV A;  3AOA A;  3TNV A;  4HTJ A;  5D0H A;  2KXN B;  1D9F A;  2VBY A;  3LPY A;  4X4V A;  5BR8 F;  1N2L A;  1OMS A;  3G8Q A;  3ILO A;  3MPD A;  1S5Z A;  4B3M J;  3C15 A;  2MKJ A;  4ENO A;  2FY8 A;  1R3N A;  3D1H A;  1UWA A;  2QEX S;  4NLU A;  5B0B A;  1O51 A;  5IJQ A;  4UOF A;  3BGO P;  3MR2 A;  1QAY A;  4FF1 A;  2V67 A;  2MZT A;  2C22 A;  4DHV A;  2FVS A;  3B82 A;  3CGI A;  3DCA A;  2IBK A;  2YKM A;  1EET B;  1TQL A;  1C1B B;  1Q5V A;  4X66 F;  5JVG Q;  4LSN B;  2NXC A;  4ED5 A;  3D0G E;  4GRS A;  1KH4 A;  3TUZ C;  2ZOG A;  2W5X A;  1S9E B;  4FBU A;  3KDO A;  1HMV A;  2VG6 B;  5D77 A;  3AD9 C;  4DX7 A;  4TQS A;  1L3T A;  2XMU A;  5LM7 E;  1Q8B A;  3AA8 A;  4CLP A;  4CLZ A;  2C28 A;  2LQ5 A;  4UQT A;  3RAX A;  1WHY A;  2D9P A;  1OO0 B;  3IRX B;  1HKA A;  1S6U A;  3FMW A;  3G8T A;  3POT B;  5C24 A;  4OYP A;  3ZXW A;  1CG2 A;  2F5G A;  3H98 A;  3IGZ B;  2AZ1 A;  5KG7 A;  3MM7 B;  1LV5 A;  2W5T A;  2GJ2 A;  1U48 A;  1NSP A;  3GYX B;  3SBM A;  3GSI A;  1RT2 A;  4NLG A;  3SZZ A;  6AT1 B;  4O4G B;  5DLF A;  3JQK A;  2ASY A;  4Y34 A;  3PHT A;  2W25 A;  4WE1 B;  1HWJ A;  1X0F A;  2GX8 A;  3DPC A;  4I2P A;  5EWG A;  4M95 A;  2BKO A;  3AJD A;  1M1H A;  3DM2 A;  1EJ7 L;  2V0N A;  3P4U B;  2N3L A;  2HG4 A;  5F8G A;  4J9Q A;  1RCO B;  4ED1 A;  4K4Z A;  4O0N A;  3H4D A;  3BZQ A;  2QL9 B;  2WW4 A;  4FNI A;  3PY8 A;  5AXN A;  4FKX A;  3EM1 A;  1FX2 A;  4ECY A;  1Y3J A;  2HQC A;  1J5E J;  4EBE A;  3R5C A;  4WBF A;  1AW0 A;  3ILJ A;  3D67 A;  1QTN B;  3N9U C;  4X64 J;  2DHA A;  4CLS A;  1ZAX A;  5E33 A;  4L76 A;  2MGZ B;  4NWX A;  2GML A;  2HNZ B;  4CNZ A;  3M2V B;  4NOH A;  3D66 A;  1N33 J;  1NHU A;  3CCL S;  4JI2 J;  2XS5 A;  4JV5 J;  2RUS A;  1RGV A;  4ANC A;  4CYU A;  2C3Y A;  4NLO A;  2HHV A;  2YWG A;  1T94 A;  3A8J A;  2HAF A;  3R7S B;  4BHQ A;  4XDD A;  2G2Z A;  2XUL A;  4F02 A;  3BGU A;  1N0U A;  1EQM A;  3P8B B;  2RD5 C;  2GFF A;  3TJA A;  1VQL S;  1JLC A;  3W2V A;  5LMU F;  4DV3 F;  4C98 A;  3EX7 B;  4IG3 B;  2WK4 A;  3SCI E;  2F63 A;  2GIR A;  5DG8 A;  4JI8 F;  3BGR B;  1WEZ A;  3BPS P;  2JC0 A;  2J9C A;  2ACM A;  3DRS A;  2K8G A;  4O0I A;  2FJB B;  3TQE A;  1PGZ A;  2UZA A;  5E3C A;  4ILM A;  4DSE A;  2J8S A;  1X0P A;  4MIA A;  2PFD A;  3RG6 A;  1RHR B;  4EBD A;  4NWJ A;  2VJU A;  5D8H B;  2MKS A;  3PZP A;  2WVD A;  4ZLN A;  3ZFV A;  2QA1 A;  2GQ2 A;  2EKN A;  2XCP A;  4ZA1 A;  2LXI A;  2XC9 A;  5D3G A;  1IR1 A;  2LEB A;  2OPQ B;  1S0M A;  2Y1J A;  2DHH A;  2AW0 A;  4DS4 A;  2RML A;  4ZCM A;  5DG7 A;  2XGP A;  1Q95 G;  3M1V A;  3U1M A;  2ASD A;  4PQU A;  1WKJ A;  3P49 B;  4NYP A;  3MUM P;  4OL8 A;  1O99 A;  1XTZ A;  4P2S A;  2J7K A;  4PPZ A;  2AZ3 A;  3DYA B;  1FKO A;  4QQB A;  9ATC B;  2KN4 A;  2OPS B;  2GA7 A;  2MQN A;  1RWX B;  4IG0 A;  4EYH B;  4L3K A;  4ECX A;  4LF7 F;  3UD4 P;  2H5J B;  1BWV A;  1LQ9 A;  4ZPD A;  1OPZ A;  1RUS A;  1IM6 A;  5J2Q B;  3I0S A;  1HBO A;  1OPI A;  2UXD F;  3K2Y A;  3W7B A;  1LWC A;  4L3N A;  5K8P A;  1T03 B;  3LP1 A;  5L1K A;  4ITS A;  2IC3 B;  4LR8 A;  3T01 A;  5J2N A;  2JDJ A;  2JLF A;  3AY0 A;  3NWR A;  1YZ7 A;  4NXM J;  1KHL A;  1KRP A;  3OUY B;  2X3G A;  2CWX A;  5H1S V;  4WP9 A;  4Y2K A;  2V6A A;  2RE1 A;  3C6T B;  2A1B A;  4ZN1 A;  5KFO A;  1IKW B;  5E3P A;  4TVA B;  1O0P A;  4NLV A;  2IBO A;  2QYC A;  3GJR B;  1QD1 A;  3RUB L;  4ZVU B;  2DYA A;  4RKU C;  4EO6 A;  2BA9 A;  4KRW A;  3THV A;  1GFW B;  1RB0 A;  3MCS A;  2J0S D;  2UXC F;  3A3P B;  2RKI B;  5E3R A;  1GTE A;  3UN2 A;  3EIC A;  3WC2 A;  1Z4U A;  4HYK A;  4DR6 J;  1TKX A;  1HI0 P;  2CPF A;  3W9H A;  1RBO B;  4CLF A;  1E3C P;  1TL1 A;  3UN5 A;  2JVO A;  3R2D J;  3I96 A;  3PG9 A;  5KFH A;  1X4E A;  5KG2 A;  1VQ9 S;  3ZTP A;  3NGS A;  1KQF B;  1RAJ A;  1Y5N B;  2E5L J;  4E98 A;  2R7T A;  2XNQ A;  1GAO A;  2FLO A;  5CAA A;  1RWK B;  3TVK A;  2CJQ A;  2DY1 A;  3K7R A;  3MUR P;  1F9F A;  1Q8I A;  2AIR B;  2MTL A;  3D68 A;  2XM3 A;  3TO8 A;  5IT9 U;  1Q86 T;  3DMJ A;  1U0H A;  2C3P A;  2XHC A;  4P75 A;  1RTD B;  3TZZ A;  5CXT A;  3R1H A;  1WDT A;  3G4S S;  3QZ8 A;  4H4O B;  3ONQ A;  5HBM A;  2WBM A;  1FWK A;  2NSC A;  3UDC A;  3W5Z A;  2ZBR A;  2R7O A;  5L46 A;  4NLT A;  3TAN A;  1LOU A;  4Z37 A;  3LAK A;  4F4W A;  1QUP A;  3FBB A;  2XCA A;  2DPI A;  3VZI A;  3OTO J;  3H7H B;  4FS2 A;  3HT0 A;  1Y11 A;  4I69 A;  2ZH1 A;  1HDH A;  3ADA C;  3UQS A;  4PEO A;  2MSS A;  3CVK A;  2ASL A;  3E8O A;  1ITP A;  2CAD A;  1JLA B;  4CO4 A;  2PEB A;  2V8D A;  1S1X B;  1L5U A;  5A8W B;  3JQJ A;  2QA4 G;  2FJE B;  2Y0B B;  4KGM A;  5MLC V;  3RBZ A;  4MK9 A;  3VF0 B;  3I82 A;  3TA1 A;  1TFW A;  1NJY A;  3PDN A;  2CPY A;  4FDI A;  2OPP B;  3SQG A;  4RW7 A;  3J81 U;  2FLP A;  1BQM B;  1AUK A;  3M2R B;  1HBU B;  3IRW P;  1SB6 A;  5L9X A;  3OL9 A;  1TL3 B;  4WFN Q;  3H90 A;  4GMK A;  4DV2 F;  3MAA B;  2ZD1 B;  2XG8 A;  3PYD A;  4ANE A;  1LWF B;  1HNX F;  3CCT A;  3DOK A;  5KAK A;  5JXS A;  3RAM A;  2ALZ A;  2R7W A;  2CJA A;  4DR2 F;  5I3P A;  2E9Z A;  3MXH P;  3NGD A;  2V94 A;  3NP5 A;  2R9L A;  3GCW P;  4WU2 A;  5I42 A;  1GMW A;  3ZNU A;  3HLU A;  2YWH A;  2DR5 A;  2OTJ S;  2H4W B;  4YR3 A;  2ACY A;  1S6P A;  5KFW A;  2IUC B;  2APO A;  3HK2 A;  2R8K A;  3J80 Y;  4DDF A;  1URN A;  1I94 F;  1H72 C;  1KTQ A;  4NI2 A;  3V4I A;  2HWT A;  2F65 A;  2W2M P;  3DLJ A;  4NZ6 A;  2B3T B;  2V2Q A;  1XEZ A;  2P8I A;  3LGH A;  2E5H A;  4DUZ F;  3P5B P;  2MQP A;  1UL3 A;  2Q6B A;  2QLX A;  1S9G A;  2NPI A;  5K20 B;  4C8O A;  3GQC A;  4UTG A;  2AJ1 A;  1DUR A;  2EBG A;  1K1Q A;  1YWX A;  3OTB A;  1N5V A;  1KN6 A;  5AE2 A;  2ZC4 A;  3A1Y G;  3HFK A;  3SMZ A;  1RA7 A;  2QSW A;  3ZNJ 1;  2Y8W A;  3HD2 A;  5DS7 A;  4IQX A;  2LCW A;  1M5K C;  2LMI A;  1ARO P;  2ZBC A;  2ZHO A;  1ELX A;  3QSI A;  4PUO B;  3DOM B;  2VPW B;  3EVW A;  1VK8 A;  1ELY A;  1W2I A;  1R8A A;  2A2C A;  2NPF A;  2MQO A;  4RX6 A;  3KJN B;  4O3N A;  2CKW A;  2GJI A;  3D0I E;  3MK1 A;  3M8Y A;  3QAU A;  5HQL A;  2GAG C;  1U8W A;  3GG1 A;  2PA8 D;  3BO4 A;  4F4A A;  1H7W A;  3WC0 A;  1RT4 A;  4PRF A;  2YKA A;  2FPH X;  3DLG A;  3IA0 A;  2GVZ A;  4V19 J;  4PWU A;  1S1T B;  4IOA Q;  2U2F A;  4NRT A;  1SXL A;  5JVH Q;  2L08 A;  2HMI B;  2J7W A;  2ZC3 A;  3IGY B;  2IYI A;  1FRX A;  1NEE A;  2C3M A;  1RKI A;  2H3E B;  3DI6 A;  1JWW A;  3PKY A;  3I5B A;  4Y00 A;  1NSQ A;  3IO1 A;  2XS7 A;  5KTQ A;  2RVJ A;  1Y0H A;  4DQQ A;  3P5T L;  1MRO B;  3J7Y U;  4ZK7 M;  1UPM B;  3NNC A;  2KT3 A;  2QMU B;  2AWZ A;  1IKV A;  3EXY A;  4OLO A;  1HFE L;  2PDA A;  4BWM A;  2PII A;  2W9A A;  1Q81 T;  5BYR A;  3PJ9 A;  3P96 A;  3OQ2 A;  2W8K A;  4QW9 A;  2EFP A;  3FFI B;  3OL8 A;  4RW8 A;  2FHK A;  4G1Q A;  1U25 A;  1Q7L B;  3IM8 A;  4OZN A;  3EDR B;  2E29 A;  4MFB B;  4HT5 A;  4LIW A;  1ZEF A;  5CYQ B;  5GVQ A;  2P9E A;  3GJQ B;  1UVM A;  2RSQ A;  4HEA 9;  4YR0 A;  1VIS A;  2NS1 B;  4LBP A;  3KWM A;  4Q0B A;  1KHJ A;  4B3R J;  1FE0 A;  3CME S;  2HGL A;  4UW2 A;  3LW5 C;  4NPO A;  1K44 A;  1S4E A;  4N8N A;  3OXG A;  5HJX A;  1DAX A;  4ES3 A;  3NOC A;  4ECQ A;  4I6W A;  4ZKA A;  3KG0 A;  2MYF A;  3IXQ A;  2KO1 A;  1UW4 A;  2XO7 A;  3MMB B;  2XWY A;  3JSM A;  3CD6 S;  2KDO A;  5LSL A;  3W60 A;  4Y65 A;  4FKY A;  2A6M A;  4ZVG A;  3SCJ E;  4OYI A;  4DQP A;  3O1L A;  3HI9 A;  3VAH A;  1GMW D;  2BM1 A;  4F4Y A;  4I7F A;  3MMC A;  4DR5 F;  1IKY A;  1U2F A;  1SH0 A;  2OD6 A;  4QR2 A;  3H5X A;  3OR2 B;  4WIQ A;  1ANI A;  2ZWO A;  1V5V A;  1XC9 A;  2KHD A;  4YB5 A;  4X4N A;  3A52 A;  5J1N A;  4M8L A;  1U1N A;  2R7U A;  3N6M A;  4OHW A;  3QGG A;  3QSY B;  1RTJ B;  4P74 A;  5ETT A;  2HZA A;  4OLP A;  2LU1 A;  2MY8 A;  3SV3 A;  2NSB A;  3E51 A;  1TFY A;  1ICE B;  4ZJO A;  2ZM6 F;  2XB2 D;  5HVG A;  2SXL A;  4DCO B;  5F0W A;  2M9K A;  1QVF R;  3LTO A;  4DL0 C;  5G0R A;  2JFK A;  1VRT A;  3W5X A;  3BH7 B;  4YY3 J;  1R8H A;  4JB8 B;  5HI7 A;  1VQK S;  5L1I A;  1UFK A;  6FD1 A;  3UR0 A;  4GKJ F;  2CQD A;  1PKU A;  2WSE C;  3KK2 A;  5DLT A;  3C14 A;  4Q44 A;  4OYA A;  4RNH A;  2QE5 A;  1KD1 T;  2NCK L;  3G2X A;  3L9Z A;  3PR4 A;  2ROG A;  2XR9 A;  4CLK A;  4B3S F;  1VMB A;  2J7U A;  1YJ9 S;  3W64 A;  4QR1 A;  1DZ5 A;  3LPE A;  3BRE A;  1YIT S;  4DPU A;  2XEX A;  5F8N A;  1M5V C;  3M6W A;  3TA0 A;  2R4F A;  3PX0 A;  3PKM A;  2ZKT A;  2K3K A;  2D69 A;  3OJU A;  3UDV A;  2W5Q A;  4CQ1 A;  1YJT A;  5IWA F;  2LU2 A;  1JLB B;  2EVZ A;  1PO6 A;  2FZG B;  2W8S A;  4WP3 A;  3W8P A;  1TKZ A;  3RB0 A;  2BR0 A;  4UOR A;  5HSP A;  5D0R A;  2R8G A;  3HVT B;  4BLG A;  1NJI T;  2CPH A;  3G82 A;  5B0A A;  2XLJ A;  3OR1 A;  2WSF C;  4XDC A;  1S49 A;  1NK9 A;  2ZE2 A;  5HL7 Q;  3D3C J;  2OML A;  4USI A;  5DM7 Q;  2BW7 A;  2AP6 A;  3KK1 A;  2E9R X;  5IOL A;  2D41 A;  2HS0 A;  2I8E A;  3A12 A;  2AJ4 A;  5KFV A;  4HH0 A;  1MWY A;  2DXD A;  2FHM A;  2QMW A;  4CO3 A;  2E66 A;  3T41 A;  4YB1 P;  4DU7 A;  3CC2 S;  5KFG A;  4ETX A;  3ED4 A;  4P9S A;  3IWN C;  3M32 B;  3SSQ A;  2OKQ A;  2YNH B;  1PJ6 A;  3H20 A;  4P73 A;  5SZT A;  1R6Y A;  1CEZ A;  3QPI A;  4ZP9 A;  1EAR A;  2VZ9 A;  3GP9 A;  2RRB A;  4K50 A;  1XIQ A;  3KLE B;  2V2V A;  1HQ2 A;  4CLW A;  1TZ0 A;  2J6S A;  4B3T F;  4E8U A;  4HR2 A;  1QSY A;  4MYT A;  1Q4R A;  3R5A A;  4LF4 J;  1AUD A;  2AYM A;  3TAQ A;  4DFM A;  4DZ6 A;  1S0O A;  4LR7 A;  2ZVI A;  2E9T A;  2Y1R I;  4WFA Q;  2YQ0 A;  4DQI A;  2O3D A;  1VFJ A;  4P6Q A;  3BQ0 A;  2Z2Y B;  5DDO C;  2ILZ A;  5BR8 J;  4IR1 A;  2W2Q P;  1FSU A;  2E7X A;  2LQB A;  3AHP A;  1WEX A;  1WF0 A;  3EWG A;  4J9N A;  4HDG A;  2NXE A;  4ZIW A;  3LAN A;  4WZM A;  1FVQ A;  3KG4 A;  3NGT A;  4GKK F;  2Z8Q A;  3LO3 A;  4DFP A;  1N6Q B;  3VGS A;  2XZT B;  3MEE A;  1KH5 A;  1UJ4 A;  3NY0 A;  4LFB F;  4WFX A;  4ELU A;  1T9Y A;  1ZM9 A;  2ZZT A;  1PC5 A;  4NA2 A;  2BUN A;  1WTB A;  2V4J B;  1EET A;  1N0V C;  5IT0 A;  3TAM B;  1C1B A;  3CJ3 A;  3K5O A;  2AYB A;  3NWG A;  2J0W A;  3KDN A;  1VQM S;  4LSN A;  2VIC A;  2AGO A;  2QSF A;  3R9L A;  1S9E A;  4LQ9 A;  2VG6 A;  4ZPT R;  3SDE B;  5ETR A;  1MN7 A;  3T5J A;  4C48 A;  2KT5 A;  1ROF A;  3IRX A;  2YNG B;  3TR5 A;  1JLF B;  3FSI A;  5C2G A;  2AD9 A;  5DLG A;  3POT A;  2WVF A;  1PAE X;  2YWF A;  1MW7 A;  4JI1 F;  3MM7 A;  1HWK A;  2DNH A;  1URR A;  4DG1 B;  2OAU A;  2EFQ A;  5GAD I;  4C11 B;  2DGV A;  2HRT A;  2BVZ A;  2PGC A;  3VAF A;  4O4G A;  1NK6 A;  2CQG A;  4OYX A;  4QIF A;  5KFZ A;  4WE1 A;  5HRT A;  1PAU B;  2FGO A;  3JYT B;  5IZH A;  3FC9 A;  1VJQ A;  4DV6 F;  3VAG A;  3O44 A;  4NML A;  4P10 A;  2VDH A;  1XMB A;  3OXF A;  5DLW A;  2X1B A;  2GV1 A;  1VQO S;  4IQM A;  1DHM A;  4R25 A;  3W62 A;  4U96 A;  2AJ2 A;  3X3U A;  4YME A;  2KJV A;  1FNM A;  4KT0 C;  4RUH A;  7FDR A;  2PI5 A;  3N4W A;  1OQ6 A;  2HHP A;  3EZ5 A;  3WZ0 A;  4M5I A;  1NSA A;  1RAH B;  3OW2 R;  2UV8 A;  3GFH A;  3HM9 A;  2IJF A;  1U1M A;  2XO6 A;  3CDW A;  3I9V 9;  1IBL F;  1YIJ S;  4IFY B;  5K9F A;  2MGZ A;  3MMA A;  4J9V A;  2HNZ A;  2QN6 B;  2BAN B;  2FC8 A;  2ZJQ Q;  2YKQ A;  1XMQ F;  3IP0 A;  2YX4 A;  1HYS B;  1T3O A;  4CXK A;  4Y2I A;  1P6T A;  2M8H A;  2BJ7 A;  5KFE A;  2O1P A;  5HRO B;  2FVC A;  2Q1L A;  5LSR A;  2Q79 A;  3QJL A;  1RYR A;  2KFN A;  4OI4 A;  1NPP A;  1JNZ B;  4V1A k;  4WII A;  3CDB A;  2N82 B;  1RXO B;  5LMU J;  4AYB D;  5GAG I;  4DV3 J;  3JXO A;  4LSZ B;  3BS9 A;  1OS5 A;  2YH0 A;  4RW6 B;  4URG A;  5DLV A;  4IG3 A;  4JI8 J;  3MTJ A;  4USH A;  2K7K A;  2L3M A;  4EO8 A;  3BGR A;  4TYA A;  3R5J B;  3QID A;  4Y28 C;  4EK2 A;  1SVD A;  1YX2 A;  4Q43 A;  4KIA A;  1I6J A;  5BYQ A;  2J9E A;  4RPF A;  3QGI A;  1FJE B;  4DWI A;  3BR8 A;  3D6F B;  4FVM A;  4ZLJ A;  1K0V A;  2EXU A;  3MOZ A;  2OPQ A;  4OV6 A;  2W5R A;  1F5C A;  2E7V A;  1HA1 A;  4Q5V A;  4HHJ A;  3IR5 B;  4GTX A;  3NKN A;  1BC6 A;  1WJ9 A;  2LEA A;  5FDL B;  1RAF B;  2Y1L B;  3CMA S;  3GU0 A;  4DL5 A;  1MMD A;  3MEC B;  2DNY A;  3DYA A;  5F0U A;  3QFW A;  5ETK A;  4YHH F;  2OPS A;  4KJI A;  3BKT A;  4WTY A;  3DRX A;  4LF7 J;  2HFV A;  3M6X A;  4ICL B;  2VA3 A;  1YVF A;  1ZM2 A;  1NDK A;  5J2Q A;  5IFM A;  5DO2 A;  2G0J A;  2N3O A;  1T03 A;  3RTV A;  5F8L A;  3TJ9 A;  1NKC A;  1WC6 A;  4DU8 A;  2HLU A;  2IC3 A;  3DFE A;  3UW1 A;  1Y5L B;  4NLR A;  2YKO A;  2BJE A;  3CB4 A;  1SQE A;  2LEP A;  2POK A;  3DC2 A;  4NLP A;  5ETP A;  1G3O A;  3OL7 A;  1RT5 B;  4LT6 A;  3OUY A;  3OTD A;  4DBQ A;  4QIE A;  1U1Q A;  4CLT A;  3QT6 A;  3TG0 A;  3LAL A;  2KRB A;  2WBR A;  1CUL B;  4KC5 A;  1F1B B;  2B9W A;  2CFX A;  3C6T A;  4DQR A;  2BZ2 A;  2Z4P A;  1IKW A;  1LWE B;  3QGH A;  4EI2 A;  2K3I A;  3EGN A;  3FDS A;  1YJU A;  4MKY A;  1D09 B;  4FYX B;  2FZK B;  5I3U B;  2GNK A;  3IBW A;  1ZTT A;  2UXC J;  5KG0 A;  4OHX A;  3BGL A;  5FII A;  5HMX A;  1RT7 A;  4F4K A;  2RKI A;  2E5J A;  4O23 A;  3DRR B;  3W8G A;  4YOE A;  3CMR A;  4A8X A;  2DGO A;  1TU0 B;  1NDL A;  1RAB B;  2DRD A;  3DXB A;  1SC3 B;  1RWM B;  3FRY A;  2RF2 B;  3EUN A;  4JUZ A;  1U1L A;  5KT7 A;  3PR5 B;  4MY4 A;  2MLZ A;  2BX6 A;  2GGP B;  4K8R A;  4QWE A;  2XS2 A;  5LOQ A;  1CS4 B;  2RIJ A;  2KI2 A;  2QL7 B;  3DLH A;  3K8V A;  3L4B C;  3BBB A;  4C8N A;  4LVO P;  4M5M A;  2AV5 A;  2HBZ B;  1RTD A;  3IN5 A;  1NCL A;  1TAQ A;  4KGV B;  2A6O A;  1R89 A;  4H4O A;  2WVB A;  2P6S A;  3HT3 A;  2MXY A;  1QAI A;  4LVN P;  3VQT A;  1N54 B;  4CWB A;  1HBN B;  1HQE B;  3IG1 B;  2ZWP A;  2WB4 A;  2J8A A;  3NRB A;  2CQ2 A;  4C6A A;  4PYD A;  4KY3 A;  4ALZ A;  3ZZO A;  4DX8 H;  4ZJQ A;  2DXF A;  3R5B A;  4V19 X;  4URS A;  1Q8K A;  2VFR A;  3KNG A;  3W65 A;  4H4M B;  1JLA A;  3GIR A;  3KJV B;  2AT1 B;  3GFX A;  1S1X A;  3Q22 A;  2ATC B;  5A8W A;  4DL2 A;  3W63 A;  1U7L A;  3T1Y F;  2V69 A;  4IDK B;  1L3U A;  2V5H G;  4W4M A;  2IYG A;  4CZC A;  1RCX B;  2DIS A;  1RDR A;  2PT0 A;  3Q8S B;  2OPP A;  3A3O B;  5J1P A;  5CA5 A;  4UUW A;  1YRT A;  4J9M A;  1BQM A;  1T7P A;  3M2R A;  3KHR A;  1HBU A;  4KAI A;  4DV2 J;  4RUB A;  1TL3 A;  3VZH A;  4RZR A;  4ZN3 A;  3MAA A;  2HAI A;  2ZD1 A;  3HHL C;  1HNX J;  3V5R A;  2VJV A;  3IM9 A;  2G9O A;  4M5L A;  5LIA A;  1LWF A;  4DR2 J;  3OFH A;  2VH7 A;  4GTW A;  1FXL A;  1RAO A;  4C9D A;  5HMY A;  4KTQ A;  1YRX A;  1WD6 A;  2JEG A;  1XMO F;  2G9Y A;  3UNG C;  2A0F B;  1F9H A;  5F8H A;  5L1J A;  1UMJ A;  2QZ8 A;  4PG7 A;  3MR3 A;  3SIP B;  3MPY A;  5KFP A;  3MOJ B;  2RT3 A;  2IUC A;  3GFY A;  1RT6 B;  1H2U X;  2ZBI A;  1RYS A;  1TAU A;  1I94 J;  2H5I B;  3GV8 B;  3JAM Y;  1FES A;  2IMO A;  2OSQ A;  3TUJ C;  1T95 A;  1W26 A;  4RUC A;  3E01 A;  3MDF A;  3OBI A;  4DUZ J;  1EJJ A;  1VQ4 S;  1LWC B;  1EQJ A;  2RHQ B;  2LYV A;  5FLX Y;  1SCJ B;  2FQQ B;  2X3D A;  4TN2 A;  2MY7 A;  2CNL B;  4IFV B;  2YKN B;  4LRC A;  1AZS B;  3J7A N;  1P27 B;  1KHV A;  4TKT A;  3RYL A;  2Y9H A;  2ZDO A;  4ZLP A;  1SPB P;  5L0B A;  3KUH A;  4PUO A;  4UOO A;  3DOM A;  3OVA A;  2QIF A;  2XNR A;  2VG5 B;  4PXB A;  4K2J A;  1S0V A;  4LF5 F;  2JJ4 D;  4ZPA A;  3A4T A;  1X4C A;  5T7L B;  3D5M A;  2CA9 A;  4PKD B;  4G6V B;  4DR4 F;  4FDJ A;  2M3D A;  1IJF B;  1OSC A;  1TKX B;  2FJV A;  1H73 A;  1SKW A;  2ALY B;  3NKY A;  3CC4 S;  1J2V A;  1PYT A;  1S1T A;  5B08 A;  1HNZ F;  1RQ0 A;  5KFU A;  3WBZ A;  1S48 A;  2HMI A;  3SCL E;  4A8F A;  1HD1 A;  3KLG B;  2B43 A;  2E1R A;  4Y3C A;  2W5S A;  1HBM B;  4WXO A;  2DKO B;  4IH6 A;  4ZPC A;  2QRR A;  4RO0 A;  3Q8Y A;  1MRO A;  3IMQ J;  3NKO A;  4TU8 A;  3JTP A;  1AB8 A;  2UP1 A;  3D6M B;  1PIE A;  2E5I A;  3CSK A;  3ZZU A;  3FFI A;  1CQN A;  2Z57 B;  3VV2 B;  1S79 A;  1ZZF A;  2LA4 A;  4IOB A;  1SHN A;  3KHH A;  4ZMM A;  3OTO F;  2Q66 A;  1WOP A;  2XLI A;  3MPW A;  2QFJ A;  2W1B A;  4MFB A;  3UD3 P;  3DU6 A;  1S77 D;  5CYQ A;  3CCR S;  3HHE A;  3MFI A;  2XYG B;  3AD7 C;  3ILI A;  1X7V A;  5CQG A;  1Y5I B;  1REV B;  3CD0 A;  2WCX A;  4AT1 B;  1WC3 A;  5AE1 A;  1TVR B;  5KFB A;  1UEK A;  3K89 A;  1PG5 B;  1Q82 T;  4X65 F;  4RW7 B;  4UST A;  2B9X A;  4U7U K;  3HDS A;  5DG9 A;  4YB6 A;  3MMB A;  3A8K A;  4RBV A;  1UVN A;  2V8H A;  3MUV P;  5AT1 B;  1LFW A;  4QW8 A;  3RRG A;  2PSZ A;  4DR5 J;  5A8K B;  3GR1 A;  1CC7 A;  5H9F K;  1TUG B;  3GMG A;  2HKE A;  2CPZ A;  4USK A;  2HRU A;  3OR2 A;  1LW0 B;  4E0D A;  2DEI A;  2ZHB A;  2VL1 A;  5KG3 A;  3CCW A;  1JJ4 A;  3BYR A;  1EI6 A;  1V6H A;  5HAO A;  2PEH A;  3T5H A;  2ZM6 J;  4IOC Q;  3K5M A;  5K8O A;  1UP1 A;  3KMQ A;  3I56 S;  1TEL A;  3RGI A;  3PJX A;  4BWJ A;  2KRR A;  4MIW A;  4ZVF A;  3C3L A;  1KHN A;  3EVM A;  2FB0 A;  4GKJ J;  2RUG A;  3RW7 A;  1U8S A;  4ZCI A;  4F26 A;  4J9U E;  2GO9 A;  1LKZ A;  4ZVO B;  5KT4 A;  4QOT A;  4B3S J;  2W9C B;  1RU1 A;  2AYG A;  1WKK A;  4K0K J;  3V6K A;  4Y6I A;  5D4N A;  4ED0 A;  1RHJ B;  1RLD A;  2DCL A;  3QO9 A;  3PYG A;  2E1C A;  4QU6 A;  3OXL A;  1XR5 A;  2GSO A;  4FXV A;  1VI7 A;  3FVY A;  5IWA J;  2B0G A;  4N5S A;  1JLB A;  4WTO B;  3B5Q A;  1I51 B;  2A3J A;  3GIL A;  1YLX A;  1R27 B;  3T1H F;  2VPY B;  4O3S A;  4ED8 A;  3HVT A;  1LEO A;  4P52 A;  1SKR A;  4UZC A;  3KMS A;  3A13 A;  2VPX B;  4KHP F;  3AB4 B;  1TK8 A;  4Q2L A;  1JXV A;  3F41 A;  2ZH2 A;  1D9A A;  1Z2L A;  1KNZ A;  1QTM A;  1NBE B;  3GTY X;  4ZHR B;  2F8H A;  3FRZ A;  2MKH A;  2VQR A;  4DSL A;  3MFH A;  3FMB A;  3D1O A;  4C8Z A;  3X1L B;  2L41 A;  3OLA A;  3V6D B;  5EWF A;  3SZY A;  1G7C B;  4M5G A;  1N48 A;  5AXK A;  2HHH J;  1WG1 A;  2EK1 A;  2AEF A;  4Y0F A;  3TJ8 A;  3M32 A;  4ELV A;  1QSL A;  3DOL B;  5GMK a;  4YR2 A;  1KHK A;  2YNH A;  5C25 B;  5EUH A;  2XHW A;  3DRP B;  1U47 A;  2IIH A;  2G1D A;  1Y7P A;  4RWW A;  3M8S A;  2W7P A;  2I38 A;  3T6J A;  1FRM A;  2DGQ A;  3KLE A;  4B3T J;  2MQM A;  1Q16 B;  3O2I A;  4G1Q B;  1RTI B;  1FX4 A;  3D2W A;  1SL1 A;  1LWX A;  3CJT A;  5A0Y B;  1S97 A;  5EGH A;  1VHI A;  2BJ1 A;  3LQV A;  1C2P A;  4DPX A;  2Z2M A;  1URB A;  6FDR A;  4LQY A;  4QIV A;  1A9N B;  4NA1 A;  2ASJ A;  4LF8 J;  3EYZ A;  4NLS A;  2HYI B;  3BO3 A;  1Y4Z B;  1AFI A;  2XBP A;  3V6H A;  2HUR A;  2UUC F;  4GKK J;  1ZPV A;  2LP4 A;  1D3W A;  1D0E A;  3BF4 A;  5KFM A;  1N6Q A;  2HSE B;  2MZR A;  3T9N A;  4LRD A;  4LFB J;  3PX6 A;  1X5S A;  4PR6 A;  2B8P A;  4M5D A;  3UN3 A;  1EQ0 A;  4QIW D;  2CPJ A;  3DDK A;  1T9W A;  2XMV A;  1UEU A;  3HVR A;  3VAI A;  4A4J A;  3SXL A;  2V4J A;  4LFA F;  2MZQ A;  3TAM A;  1BMQ B;  1UFW A;  2VQE F;  1IKY B;  3MF5 A;  3M4X A;  4MK8 A;  3KLV A;  2F4V F;  3SCK E;  1R0B G;  3EJM A;  3SDE A;  5KFT A;  2E1M C;  1R6V A;  1NZA A;  2HHX A;  1N4L A;  4A8Q A;  2D1C A;  4DN0 A;  2PMW A;  1W7W A;  1WOR A;  3K5P A;  3ZO7 A;  2YNG A;  1JLF A;  4WPA A;  1FTC A;  4QBU A;  4JI1 J;  2O67 A;  3WQP A;  3K59 A;  4UPH A;  1ULR A;  4PG4 A;  4UUX A;  1RT1 B;  4MKA A;  4DG1 A;  1JLQ B;  4C11 A;  4NYZ A;  2KM8 B;  3RJM B;  1SH2 A;  4O3R A;  4DV0 F;  2JLE A;  2GC8 A;  5KFA A;  3JYT A;  2PMZ D;  1HL6 A;  4MIV A;  1HR0 F;  1K1S A;  4OFZ A;  1RA6 A;  1R7I A;  4PXE A;  5C5J A;  3I5C A;  2W5W A;  3DLB A;  4ZVE A;  4JI7 F;  2DGX A;  4G3I A;  1Q7Y T;  1EZZ B;  2HRY A;  3P6Y C;  1R43 A;  3PXG a;  5BXI A;  2YX7 A;  5T14 A;  3IGV A;  3ZTS A;  3PYF A;  4KJD A;  2B4V A;  1DQA A;  3UFC X;  2M2B A;  1SQF A;  2H65 B;  1B0T A;  2CIM A;  1T02 A;  3SV4 A;  1UVL A;  5AXM A;  4I2Q A;  4ZVQ B;  4RR5 A;  2Z58 B;  3GYG A;  4C0H A;  3WHI A;  1M90 T;  4IFY A;  1N36 F;  1HQU B;  4I4B A;  1RTH B;  3D28 A;  1XMQ J;  1D9D A;  2BAN A;  4K4V A;  4FDF A;  1HNV B;  3BH6 B;  2WB1 D;  4ER8 A;  1REG X;  1WSV A;  3GII A;  3MZI A;  4OJ3 A;  3TQ1 A;  1VK3 A;  5GMD A;  4LUB A;  2OUG A;  4JI6 F;  1RU2 A;  2NXN A;  5HRO A;  1N8R T;  4D3H A;  5ADZ A;  4MMO A;  2J9D A;  1U4B A;  1OIA A;  2MEW A;  2RU9 A;  3KOA A;  4OQJ A;  2OFH X;  2ZH9 A;  3PW0 A;  3BSC A;  4WWS A;  1OJ4 A;  1SC6 A;  1SHQ A;  4DSK A;  2OH2 A;  2IA6 A;  4P2F A;  1JJ2 R;  3I5A A;  8AT1 B;  2KG0 A;  2B51 A;  1MG7 A;  4RW6 A;  4TYB A;  1RAA B;  1TK5 A;  1O5J A;  4DPW A;  4ED4 A;  4ZCK A;  2CQH A;  3QIP B;  4NZ7 A;  3CDE A;  3VGU A;  1V3S A;  2G2Y A;  1XWL A;  2Y3Y A;  4JI5 F;  3HO1 A;  2DIV A;  1F2H A;  1Y10 A;  2MDA A;  3H5Y A;  2DBB A;  3WAV A;  3KYL A;  2OPR B;  4ECS A;  4X4Q A;  1KOO A;  1FRI A;  3CMQ A;  5A2Q U;  1WC1 A;  2XZD B;  2QMX A;  3NAH A;  1P9Q C;  2QFI A;  2XMJ A;  2IFX A;  3EPI A;  4IRK A;  1M0S A;  2RH3 A;  2CJ9 A;  4X62 F;  3GYN A;  4CO0 A;  3MAH A;  2VOO A;  2AF6 A;  2CPX A;  3R97 A;  4X4T A;  1RLC L;  2CXE A;  2PN6 A;  1NLK L;  4U67 Q;  3ENV A;  1C1C B;  2M88 A;  3GB0 A;  1HHQ A;  4TY8 A;  2OMO A;  3BBF A;  3Q86 A;  3VCD A;  2HZC A;  4FN5 A;  5FDL A;  1X9S A;  2CZ4 A;  5IM0 A;  5HK4 A;  5EHH A;  3MEE B;  2L9D A;  1H2T Z;  2C1E B;  3MEC A;  2GSN A;  4YHH J;  4ATN A;  2QLF B;  1YK9 A;  2BMB A;  3HMJ G;  3G6X A;  2GQC A;  3CXC R;  3HHN B;  2IRX A;  3IGN A;  3LP0 B;  3R5G A;  4N76 A;  4CLU A;  4ICL A;  3JTO A;  1HD0 A;  3IAM 9;  4JI3 F;  4CLL A;  2YVS A;  2QLJ B;  4I1T A;  1TL5 A;  3ENA A;  4QWC A;  1R8C A;  3JSB A;  4FYY B;  3LOU A;  3Q2S C;  1R31 A;  4B02 A;  5D0G A;  1UAW A;  3FCW A;  4BC9 A;  2JX2 A;  1RT5 A;  3J7Z 5;  5LJ3 Y;  2GSU A;  2BOP A;  3BQ1 A;  1ZED A;  4KPC A;  3AH6 A;  4HI1 A;  2MB0 B;  1FK9 B;  1U2C A;  1CUL A;  4LF2 A;  3QT8 A;  1HWI A;  3GJS B;  3MM6 B;  1LWE A;  1FRH A;  3I4P A;  2HIQ A;  1KOH A;  4IUF A;  2RNE A;  3JQM A;  4X4U A;  3CDU A;  4G1I A;  4Y2C A;  5I3U A;  2DIT A;  3IWX A;  3RBE A;  1KVK A;  4NMX A;  2YNI B;  3DRR A;  1FDB A;  3NVL A;  1L3K A;  1KH9 A;  2HQI A;  2VFS A;  1NB2 A;  2OO4 A;  1DLO B;  2DO0 A;  1CPZ A;  2F8E X;  2R7S A;  2RF2 A;  5KT5 A;  5E3Q A;  3U7J A;  1VCT A;  1SBR A;  3F0N A;  1AT1 B;  3UO0 A;  4UQG A;  3DLE B;  2GGP A;  1CS4 A;  2L9W A;  2AU0 A;  4GTZ A;  4H54 A;  2YX1 A;  2BJ9 A;  3NGU A;  1UET A;  1LFP A;  2V68 A;  1F9E B;  1S4F A;  1RAC B;  1H0H B;  3MMA B;  3PRD A;  4CNY A;  2ZH8 A;  1SC4 B;  1NHK L;  2E5G A;  1XR6 A;  2UXB J;  2C3U A;  1HBN A;  1HQE A;  3IG1 A;  2J76 E;  2EK6 A;  4YDD B;  1ZOT A;  4IH7 A;  2ZNZ A;  2YNF B;  1OWX A;  1VRU B;  1CJT B;  2W24 A;  1C0U B;  3NKP A;  4DV7 J;  2C2D A;  1VC5 A;  3WIV A;  4F3O A;  1BUX A;  1I3O B;  3KUE A;  4KBI A;  2BE2 A;  3GIJ A;  3V4M A;  2XSF A;  3CDA A;  3BV8 A;  4H4M A;  3QQC D;  4DCP B;  3MM9 B;  3T1Y J;  3KJV A;  2HND B;  5LL6 d;  3TWZ A;  4J9L A;  3AA9 A;  1BLU A;  4IDK A;  3G6V A;  1RI7 A;  1K0T A;  4FVC A;  1X5P A;  2GHP A;  2CQB A;  2Z56 B;  2RQC A;  1J5O B;  4ED3 A;  1IM4 A;  2RJZ A;  1EX8 A;  2HBQ B;  3IAS 9;  1APS A;  4QWB A;  4AL5 A;  3EPG A;  2IMW P;  5E2Q A;  1FRL A;  2DHS A;  4WZQ A;  1PBA A;  2AHO B;  3MEK A;  4NCB A;  3NOG A;  2C2R A;  1PYS B;  2IAJ B;  3T6B A;  2J0X A;  4LF6 J;  5K14 B;  4HT7 A;  2HVD A;  1XMO J;  2A10 A;  1S7H A;  4K4Y A;  3RRH A;  1U26 A;  3H4B A;  3KK3 B;  1MSW D;  1Y3K A;  2MJN A;  4IRD A;  1AXQ A;  4ZP7 A;  1U6F A;  2CPE A;  2XYP B;  4KSE B;  1SV5 B;  2VKR A;  4WKY A;  4ZPV R;  3W61 A;  1GTH A;  1RT6 A;  5HAT A;  4DPO A;  1PJ5 A;  2LDY A;  4DQS A;  2CQ4 A;  2V8P A;  1U02 A;  2VC0 A;  3HVW A;  1HQA A;  2YH1 A;  1NK5 A;  4KAV A;  3M6V A;  2AKW B;  2CJY B;  2DIU A;  3B54 A;  1Z1Z A;  3LA0 A;  1PCA A;  3I0R B;  4QR0 A;  4A8M P;  4OZL A;  2VQF F;  4MTP A;  5THW A;  3FZ2 A;  2IJR A;  4ZP6 A;  3SSR A;  4B9V A;  4IFV A;  4A8S A;  2R8I A;  2YKN A;  2ZH4 A;  3ZZ0 A;  2ZH6 A;  1AZS A;  2HFZ A;  3A8I A;  5SUH A;  2HPU A;  3MCM A;  4NLD A;  4DL6 A;  3C6U A;  4HAC B;  2YQ1 A;  4AFF A;  3L09 A;  3SZ2 A;  5F8I A;  2NYI A;  2VOD A;  3OTC A;  3HJV A;  1QAJ A;  2JC1 A;  1LK7 A;  4LF5 J;  2CQP A;  2VG5 A;  4Q2M A;  2BQ3 A;  4W98 A;  1A7G E;  5T7L A;  1IWA A;  3TX0 A;  2UU9 F;  3UVJ A;  4UOC A;  4DR4 J;  1WKL A;  2V2K A;  3D7S B;  1RT7 B;  4I0W A;  3HJF A;  3NG8 A;  5E3A A;  4F4Z A;  3HHL D;  1SUQ B;  3F56 A;  5HVH A;  1HNZ J;  1NDP A;  1VC0 A;  2GHV C;  1KSP A;  2ADC A;  3L95 X;  2ZH7 A;  3CCU S;  1ZBT A;  4PG5 A;  1DBD A;  2DD8 S;  2D3Z A;  3KUG A;  3KLG A;  2EC0 A;  1HBM A;  4KH0 B;  3HFV A;  5L1L A;  2HS4 A;  3IWL A;  1H38 A;  5EGY A;  1B99 A;  2YWE A;  2B4U A;  1EP4 B;  5IXU A;  1IBM F;  3HKW A;  1WOO A;  1U1O A;  3GFZ A;  3WIU A;  1VIX A;  4YN3 B;  5A6P A;  3AAW B;  1VBX A;  5KT2 A;  2PA3 A;  2EG1 A;  3C66 A;  5B0E A;  2RAQ A;  2YY3 A;  3R6G B;  3AB2 B;  4OX8 A;  1S72 S;  1B64 A;  4CM2 A;  2O01 C;  2MZS A;  1NHV A;  2NUU G;  4RBU A;  3M8W A;  4K4U A;  1RHM B;  2ZEJ A;  3MAQ A;  5GME A;  4OX7 A;  2CQ0 A;  2R2U A;  3EZU A;  1IBK F;  1BHN A;  1KQS R;  2KFZ A;  4F0K A;  5L38 A;  3Q3Q A;  1UW9 A;  2HBY B;  1REV A;  1S1U B;  4XAK A;  1N5S A;  4TXS A;  1SH3 A;  3R27 A;  4HHU A;  3BBC A;  3ITH B;  2DXE A;  3FEY B;  2DH8 A;  3SI8 A;  1U49 A;  1TVR A;  4X65 J;  1RBL A;  1Q78 A;  4XIU A;  4MHX A;  4RNM A;  1KS2 A;  2XI3 A;  3CUL A;  4RU9 A;  3BKF A;  3M8Z A;  3KJF B;  4Q45 A;  1NPR A;  2HQF A;  1QUV A;  2CRL A;  3VAK A;  2R7R A;  2FHJ D;  4K4T A;  1WHV A;  2XY5 A;  1YRU A;  2O5D A;  4CCH A;  5A8K A;  1X9W A;  4ZS6 A;  4ZIT A;  2D7S A;  3QNW B;  1HW9 A;  2VBZ A;  3H0P A;  1XNQ F;  4ID5 B;  4K4S A;  1LW0 A;  1B0V A;  3VAM A;  1AYE A;  3K8W A;  3FJ2 A;  4UPK A;  2EW9 A;  3HVA A;  1B4S A;  2KXH A;  1IR2 A;  1U09 A;  3SSS A;  5HQM A;  3T5L A;  1ZEB A;  4URQ U;  1FNX H;  3LXQ A;  3IBF B;  3UCG A;  4DOZ A;  2BOA A;  3C8Y A;  5IV3 A;  1OQ3 A;  3UNY A;  2J6T A;  3DRY A;  5B7W A;  3E01 B;  2HFS A;  1MU2 B;  3KD8 A;  3D1Q A;  1RJJ A;  2CNO B;  4JYA F;  3RB6 A;  3FBF A;  1OY8 A;  1UWB B;  5A76 A;  1VQN S;  1XQI A;  1WEL A;  4C3L A;  2JEF A;  4HTI A;  3OPK A;  4OHY A;  1HI8 A;  1U1P A;  1U1R A;  2W9C A;  3MCO A;  2Z0G A;  2DCU B;  2DEJ A;  1F60 B;  3PX4 A;  2D3O 1;  2QGF B;  3MM8 A;  2X1G A;  4H4K A;  2GW8 A;  5F3T A;  3E3X A;  4CTA B;  2J5A A;  2FJA B;  2BAB A;  2GS8 A;  4NCG B;  5LRM A;  3MED B;  4JP8 A;  1G4C A;  3T1H J;  3S1T A;  1CJK B;  4Z2X A;  4OZ3 A;  1WC0 A;  1UA1 A;  3NMA A;  3AQO A;  2ZUG A;  4FYV B;  1N5Y B;  4KHP J;  3HF5 A;  4A8W A;  4QJV A;  3VTI A;  2UVW A;  1B0P A;  4HLB A;  4DV1 F;  2BEF A;  4CO2 A;  4U8Y A;  2QA2 A;  1PIL A;  3B78 A;  2DNN A;  2FGC A;  5CYM B;  2FD2 A;  4ZHR A;  1MN9 A;  1HIY A;  4U6P A;  3M05 A;  2G2O A;  1S6O A;  5GAE I;  2VAS A;  2CG8 A;  1FVS A;  3CC7 S;  4CT8 A;  1ED9 A;  3V6D A;  1RE1 B;  3B4M A;  3HKZ D;  4KB7 A;  3UWT A;  1NB7 A;  4WFB Q;  4RUA A;  4K59 A;  4DCJ B;  4X2B A;  2OTL S;  4P7V A;  3DOL A;  2AEJ A;  2JSX A;  1P1T A;  5C25 A;  5HJY A;  5KT3 A;  2RQ4 A;  1CSJ A;  3DRP A;  4NZ0 A;  3K5L A;  4B9T A;  2MJU A;  1VRQ C;  4F67 A;  3AJ2 A;  4OJH A;  2U1A A;  2R8H A;  2CQ1 A;  1R8P A;  2DNG A;  4EWT A;  4N56 A;  1UTA A;  3VAJ A;  2VOP A;  4F50 A;  1RTI A;  1U6Z A;  1EB0 A;  4Q7A A;  1IWG A;  2J0Q D;  4OJ1 A;  5A0Y A;  1ZA1 B;  1UKU A;  1E6Y B;  4KQZ A;  3GIM A;  1KBR A;  1XK8 A;  4F3Q A;  2DH7 A;  3PW4 A;  4L74 A;  4NRU A;  2HGM A;  3PO4 A;  3TW0 A;  5KOX A;  4B08 A;  2UUC J;  2HBR B;  2WHO A;  3M9M B;  2LXU A;  2OEL A;  5HMZ A;  4OZ2 A;  2FJX A;  1I5O B;  3BDH A;  4L6V 3;  3DGV A;  4ED7 A;  1T0T V;  2ZUA A;  2LA6 A;  2DR9 A;  1VQ6 S;  2MKI A;  5F9L A;  2XQC A;  1OY6 A;  5DZ7 A;  2V9W A;  5GRR A;  2YPZ A;  5J2M B;  2OD4 A;  2Z2Z A;  4LFA J;  1FNO A;  1C4A A;  2VQE J;  4DI6 A;  1X8D A;  4AL7 A;  1RT3 B;  2FLL A;  3J81 j;  3NMR A;  3HSG A;  2J6U A;  4DS5 A;  3DDI A;  2ADB A;  5IT9 Y;  2F4V J;  5LRN A;  4C3K A;  1EKS A;  3HP6 A;  2Y0S D;  1KC8 T;  4CXS A;  2N7C A;  1BE4 A;  5CZX A;  1H74 A;  4UOH A;  4PXC A;  2J9D E;  2IM2 A;  4LMZ A;  2ZKU A;  4O44 B;  1TMM A;  3WAY A;  3VR1 A;  3HSZ A;  4RW9 A;  4MH8 A;  1KDN A;  4ECT A;  2PE8 A;  2BJD A;  1RT1 A;  1PC4 A;  3TZY A;  3BDG B;  2GMH A;  4DV0 J;  4U8V A;  1JLQ A;  2K2P A;  1O98 A;  4C0O C;  3BSO A;  4B9N A;  4J90 A;  1Z2Z A;  3CJ0 A;  2RQM A;  1N88 A;  1AA1 B;  3M6U A;  1IBC B;  2BE7 D;  1HR0 J;  2MHN A;  3FSX A;  1FEE A;  3EGZ A;  2DNP A;  4JI0 F;  2ZBQ A;  4BCA A;  4JV1 A;  2KYZ A;  1ZYQ A;  1K73 T;  1KWM A;  3N6L A;  4JI7 J;  3QMQ A;  4K0K F;  2HEK A;  3CCE S;  3CPW R;  2GO8 A;  3QO9 B;  3MD1 A;  4FP9 A;  3J81 Y;  5LSO A;  4KGK A;  5D78 A;  3LF0 A;  2ZVS A;  3G6E S;  2BAC A;  1NME B;  3EZO A;  3D3B J;  1GEH A;  4FZV A;  1Q0N A;  2KKH A;  4Y2M A;  1K9M T;  1D8Z A;  1DRZ A;  4P2M A;  1NK8 A;  4RW4 B;  4TN0 A;  5KFJ A;  1N36 J;  1EAY C;  2RS2 A;  1FKA F;  3Q0A A;  4OZ0 A;  5M2R A;  2DY9 A;  2EEY A;  4RNN A;  1HQU A;  3T9Z A;  3BN7 A;  4KAY A;  2DGU A;  2QA4 S;  3UR3 C;  1RTH A;  5IQ6 A;  1HNV A;  4ED6 A;  2ZFH A;  2V34 A;  2DGW A;  2NXJ A;  4NXN J;  4JI6 J;  3MR6 A;  2BQR A;  5D0E A;  3NCQ A;  4PAA A;  5E41 A;  3RB3 A;  3GLJ A;  1IKX B;  1S6Q B;  2N4C A;  5GAD U;  3BO2 A;  2WOM B;  5L0K A;  4UY8 5;  3BDE A;  1HW8 A;  4F36 A;  2HHH F;  4PAB A;  1TL4 A;  8ATC B;  4M1K A;  3ILL A;  2EFV A;  4KR0 B;  1Q1K A;  2H5E A;  4ZG9 A;  3W2W B;  2G13 A;  2EBE A;  1KQG B;  3NS5 A;  5HAN A;  2M8D B;  2KFY A;  1YSJ A;  2EG2 A;  1RKJ A;  1AFJ A;  3RZA A;  4JI5 J;  4KPY A;  7FD1 A;  3CW2 C;  2M5Y A;  3QIP A;  1TV6 B;  5GAH U;  1JJH A;  5AE3 A;  2F1F A;  1VBK A;  4TLR A;  1DQ8 A;  4DR7 F;  2GMJ A;  1FWL A;  2ROP A;  4QWD A;  2Q43 A;  2KHC A;  2OPR A;  1UPP A;  2WAQ D;  5D4L A;  1KR4 A;  4M5J A;  1JKH B;  2PD1 A;  2VIH A;  4X62 J;  2UV8 G;  4OYO A;  3TUP A;  1UEV A;  4I6A A;  3NGR A;  5BJR A;  4LF8 F;  2YWK A;  2OSR A;  1KLM B;  2YXL A;  3BN4 A;  1L3V A;  3MWB A;  5ETL A;  1SQG A;  1C1C A;  4B17 A;  1FRJ A;  5LJ5 Y;  4OX9 F;  3Q8U A;  2VPZ B;  1P1L A;  1FKP B;  2EI5 A;  3BYP A;  2B56 A;  3K58 A;  2QJ3 A;  2LVW A;  4NLQ A;  3D6H B;  5M2P A;  1WUU A;  2IRY A;  4M5D B;  2Y8Y A;  4K7Q A;  5J2P B;  1PSD A;  4JBC A;  1AJA A;  1XN9 A;  3J7A 1;  2VU5 A;  3G8S A;  2ZZM A;  1NZ8 A;  1VLY A;  2W2N P;  5GAG U;  3LP0 A;  1OYD A;  4DSI A;  2XY6 A;  2EFG A;  1X4A A;  2CVI A;  4WYL A;  4JI3 J;  1RTZ A;  3H2V E;  3RB4 A;  1MMN A;  1T05 B;  3T3F A;  4F7V A;  3OL6 A;  4X4O A;  2BM0 A;  3HPO A;  2C2Z B;  2M52 A;  2RU3 A;  2FZC B;  2CPD A;  3AXK A;  5DQG A;  5H9E K;  3W66 A;  2B7B B;  2H51 B;  2YBV A;  3J80 U;  2EWH A;  2GQQ A;  4AD6 A;  5H9F J;  4CO1 A;  3ZZP A;  3NXZ A;  4ZVH A;  3W9I A;  1Y7A A;  5HMW A;  2B4P A;  3DLK B;  1H2V Z;  1BQN B;  2HNY B;  2X1F A;  1NPK A;  1FK9 A;  3BM7 A;  3MM5 B;  4X4R A;  4WK1 A;  2JNJ A;  3MM6 A;  2EPI A;  1YGY A;  3B8H A;  1T9T A;  1N32 F;  3R5D A;  3L7P A;  2F7V A;  1YZ6 A;  2H48 B;  4GO7 X;  3TX8 A;  4L72 B;  3CUN A;  5B09 A;  4AE5 A;  3MPU B;  4B3O B;  5J1E B;  5DQI A;  2P9G A;  3M2U B;  2FUG 9;  2YNI A;  3FSY A;  3RW6 A;  3M8P B;  2BBE A;  4DV4 F;  2BRL A;  1ELZ A;  5GAH I;  1HNW F;  3UDE A;  2OGU A;  2XY7 A;  3CNQ P;  1DLO A;  3IC1 A;  2VDI A;  4OX6 A;  3CJ5 A;  3W3S A;  3GV5 B;  4AQY F;  4B9M A;  2R3V A;  2KB2 A;  1JXL A;  4PPD A;  1ZZN A;  2WZ1 A;  3TEH B;  3DLE A;  2CNK B;  4I2Q B;  4JI4 F;  4CO5 A;  4ZP8 A;  1X4D A;  4FNH A;  1H3D A;  1FXD A;  4FBT A;  5L0E A;  2K06 A;  4CH7 A;  1X60 A;  3NLC A;  3VWS A;  4TU9 A;  4F25 A;  3CT9 A;  3AOB A;  4BBY A;  4J9O A;  2G1H A;  3U1L A;  1Q8L A;  2LKZ A;  3IS9 B;  2CUY A;  4WP8 A;  3KLI B;  3Q8P B;  4DV5 F;  1BXN A;  4ZVR B;  3KNA A;  2YNF A;  4DR1 F;  2QG9 B;  1U2R A;  2RDI A;  1VRU A;  1CJT A;  3R3T A;  3SFU A;  1C0U A;  2ZH3 A;  1ZET A;  2W9B A;  2MST A;  3UE2 A;  1VC6 A;  3MM9 A;  4A46 A;  3PJW A;  4B9L A;  2D1G A;  5LMN J;  3FK4 A;  2HND A;  3GSD A;  5KXA A;  1JK9 B;  2W2O P;  2D9O A;  4ETZ A;  1FER A;  2WON B;  1X4G A;  2M7S A;  1GH8 A;  4ILL A;  4J7C A;  5HVF A;  1J5O A;  4UY8 T;  3NNA A;  4WJB A;  1AJB A;  1VOM A;  1YI2 S;  3ELH A;  7AT1 B;  3R7B B;  4ZVS B;  2KH9 A;  3OVB A;  2FVP A;  5FJ4 A;  4ILR A;  1M5S A;  4C2M A;  2MKY A;  2IAJ A;  2A2D A;  3I87 A;  2ZZN A;  4KO0 B;  3QWP A;  1TP7 A;  5K14 A;  4ZPW R;  4L75 A;  2W4D A;  4TY8 B;  1VQ8 S;  4RJV A;  3KK3 A;  1FFG B;  1WWH A;  5IM0 B;  2HVZ A;  2QT7 A;  4UZB A;  3DXS X;  3ET6 B;  3LP2 B;  5DGA A;  1SV5 A;  3I4H X;  4GVL A;  4K5R A;  1NM2 A;  4P71 A;  4B56 A;  2MKK A;  2X7I A;  3CJR A;  3ISN C;  1VQ5 S;  5AJ3 F;  3QWU A;  3ZZZ A;  2JEJ A;  2V4Q A;  2DR7 A;  1EIY B;  1C4C A;  1SJF A;  2KZZ A;  5AJ9 A;  3PAC A;  4LQ3 A;  3I0R A;  1YG0 A;  2VQF J;  1B7F A;  2UUW A;  4R5P B;  5HO4 A;  3FNN A;  2F3J A;  1HJK A;  1URA A;  4EZ6 A;  2IVF B;  1FDD A;  4OYB A;  4ZVP B;  5EN1 A;  2OIH A;  1WOS A;  4QZV B;  4OYM A;  4OZ5 A;  3AD8 C;  2AMC B;  4LFC J;  2G0I A;  4HAC A;  4LF9 J;  4NLX A;  1HNI B;  2ILY A;  4USV A;  1S0N A;  5DZ6 A;  2CG4 A;  1QY7 A;  1WHW A;  1FO1 A;  1U6B A;  2GZO A;  2R42 A;  4KM4 A;  4PCQ A;  3KHL A;  3D6T B;  4RBT A;  3DKD A;  2UU9 J;  4C8Y A;  3CCM S;  1HWU A;  1GMV A;  1T9V A;  4FYD A;  1OSD A;  1VQP S;  3Q2T C;  3EGW B;  1YQH A;  1TL7 B;  3B4D A;  4ZOS A;  1FTR A;  4QYZ K;  2WRM A;  3G87 A;  2F4F A;  5CYJ A;  2L48 A;  3CCQ S;  1SUQ A;  1JLG B;  4IH5 A;  1NRK A;  2BKN A;  2DPJ A;  2XMA A;  4CYS A;  4ZIV A;  4UPI A;  1WTF A;  3HHL B;  2JH3 A;  3QT5 A;  2W7A A;  5KFL A;  4LJM A;  1SI9 A;  5ETQ A;  3SFG A;  3M8Q B;  2DH9 A;  3OSP A;  4YR1 A;  1GT8 A;  4IO1 A;  1UZH A;  1RAE B;  1IBM J;  1EP4 A;  3IR7 B;  3U27 A;  4KKO B;  1RBA A;  1UFL A;  4ECU A;  1V9O A;  4TLQ A;  1YTY A;  3VHQ A;  3GWC A;  3FKB A;  2KU7 A;  2WVC A;  3JS9 A;  2HWH A;  4QYR A;  2UXB F;  1CJU B;  3I31 A;  2BW2 A;  3FBE A;  3H2L A;  2XTJ P;  1X5T A;  2F40 A;  4R8U B;  1ZAW A;  2FY1 A;  1FWP A;  2R7V A;  1Y00 A;  4PQA A;  2QTW A;  3T1A A;  1B8J A;  4DV7 F;  2W01 A;  2BE2 B;  4F0H A;  2FDN A;  1IBK J;  2JVR A;  5IT4 A;  2OLW A;  3GZ7 A;  5KFI A;  3D9B A;  2H9Z A;  3R8Y A;  1S1U A;  1SJ3 P;  4KFB B;  1P49 A;  5B0C A;  1M5H A;  3ITH A;  5TJ3 A;  5C2C A;  4GTY A;  4DL7 A;  4PWD B;  3D0H E;  4ECW A;  1G6B A;  4EU0 A;  2EKY A;  5LQQ A;  5B0G A;  2HHW A;  3BPD A;  2KYX A;  1N5Q A;  5C42 B;  1IVZ A;  1QM9 A;  1UVJ A;  2D74 B;  4UF4 A;  1P8G A;  2AX1 A;  4O4R A;  3OHA A;  5E5N A;  4LF6 F;  2X98 A;  2P2C B;  1RHK B;  1XNQ J;  2MLY A;  4F8R A;  2C3O A;  4FXD A;  2ZJR Q;  4ID5 A;  3JB9 k;  3US5 A;  1BY9 A;  4AXI A;  3H2U B;  2WTF A;  1QAX A;  2AJQ A;  2DNO A;  4R0J A;  2ATL A;  1F3F A;  3CJ8 A;  4MYU A;  3ETM A;  3IDD A;  1GXL A;  3FCH A;  2BYC A;  2VFT A;  1OY9 A;  4B9S A;  2UVR A;  1NAQ A;  1JJC B;  1SL0 A;  5KFF A;  1S76 D;  4KE5 A;  1KFS A;  3ICL A;  1NSK L;  4JYA J;  1MU2 A;  3NKR A;  5CH7 B;  1KLN A;  3R2C J;  3FBC A;  1VDH A;  3N79 A;  1FCA A;  5F9N A;  4GC7 A;  5HP1 B;  3M30 B;  4WF9 Q;  1NU4 A;  4CYR A;  2XSJ B;  1UWB A;  4QAX A;  4OJG A;  2DRB A;  4CIO A;  3C19 A;  5D4P A;  3AFG A;  2VD3 A;  4NL5 A;  2CZ9 A;  3C6U B;  4CRJ A;  1HI1 A;  1KVJ A;  5JMN A;  2FYX A;  2UUB F;  4DR3 F;  2D3O R;  2I1R A;  3PCO B;  1QVG R;  3K57 A;  1FXR A;  1N52 B;  2HFU A;  1BGX T;  3AOC A;  1K8A T;  4CTA A;  3HD1 A;  4DSJ A;  3LGM A;  1UA0 A;  4NEZ A;  1VBY A;  2UUA F;  1LW2 B;  4ED2 A;  3T02 A;  2HHS A;  5ETV A;  3WX8 A;  4NCG A;  1D1U A;  3UVJ B;  5KFS A;  5DDP C;  1JX4 A;  1GMU A;  4D3G A;  3MED A;  5KFR A;  1CJK A;  1S59 A;  4A47 A;  1E2S P;  1PBU A;  2BJ3 A;  2Y1I A;  3ZZR A;  1N5Y A;  3C16 B;  1UVK A;  1XNR F;  2ZBP A;  1V5I B;  3WAW A;  4DV1 J;  2XYH B;  4N8O A;  4Q8E A;  5A8R B;  4C3M A;  2W7O A;  3NBP B;  1FHT A;  1GX5 A;  3EMT A;  2B6A B;  3EE3 A;  1GNK A;  3LWM A;  4TNO A;  5CYM A;  1ALJ A;  2W8L A;  1S1W B;  3QRR A;  4OI6 A;  5HQ8 A;  1FI4 A;  2YQ3 A;  4CXU A;  4J5O A;  1HHT P;  1E1Z P;  4KHR A;  4ZCL A;  1BQX A;  4J9S A;  4J9R A;  2V4R A; 
#chains in the Genus database with same CATH homology
 4UPL A;  1ZED A;  4UOP A;  1ED9 A;  3M8Z A;  3BDH A;  4LR9 A;  3WBH A;  2ANH A;  2VQR A;  3MK2 A;  1KHJ A;  2IFY A;  3OT9 A;  5GRR A;  2W5S A;  1AJD A;  2X98 A;  1ANJ A;  5L0K A;  4NWJ A;  4KM4 A;  1FSU A;  3IGY B;  4LRC A;  1KH7 A;  4FDI A;  4LR8 A;  3SZY A;  3T01 A;  3IGZ B;  3E2D A;  4LRD A;  4CXK A;  3TG0 A;  1ALH A;  1AJA A;  2W5R A;  4NWX A;  3T02 A;  4ZG9 A;  1KHL A;  1AUK A;  4LRF A;  2W5T A;  3NKO A;  3UN3 A;  5DLT A;  4MIV A;  5L0B A;  5LIA A;  4B56 A;  1B8J A;  1N2L A;  2XRG A;  2GA3 A;  2GSU A;  4GTX A;  3NKN A;  1ELZ A;  1KHK A;  1SHQ A;  2GSN A;  1ALK A;  4GTW A;  4UOO A;  3SZZ A;  5HRT A;  4ZG7 A;  2W8D A;  3M8W A;  1AJC A;  1E2S P;  3NKP A;  1KH5 A;  3TX0 A;  4LRE A;  5LRN A;  3ED4 A;  2D1G A;  2W5W A;  5LRM A;  2XR9 A;  1EW2 A;  2G9Y A;  3NKQ A;  1EW9 A;  4CXS A;  1ELX A;  5IJQ A;  4UPK A;  5IJS A;  4ZG6 A;  1N2K A;  3IDD A;  3WAW A;  5KXA A;  1ALI A;  4ZGA A;  5C66 A;  3NVL A;  1SHN A;  1P49 A;  2GSO A;  5DLW A;  1O99 A;  4CYS A;  1KH9 A;  4KJG A;  5AJ9 A;  1ELY A;  3NKM A;  4UPI A;  5EGE A;  1HQA A;  3DPC A;  5TJ3 A;  5DLV A;  3BDF A;  3WAY A;  3DYC A;  1K7H A;  1EW8 A;  2IUC A;  4LRA A;  3TWZ A;  1EI6 A;  3Q3Q A;  4N7T A;  4KJD A;  1ANI A;  1AJB A;  4KAV A;  3NKR A;  1ZEB A;  4TN0 A;  3CMR A;  3B5Q A;  3LXQ A;  4FDJ A;  3BDG A;  4LRB A;  3MK0 A;  1HJK A;  1URA A;  2ZKT A;  3A52 A;  3MK1 A;  1HDH A;  4GTY A;  3WAX A;  1ALJ A;  3M8Y A;  3UNY A;  1Y6V A;  1ED8 A;  5K4P A;  3WAV A;  2W5Q A;  2GLQ A;  3UN2 A;  4LR2 A;  3T00 A;  3UO0 A;  4KAY A;  2IUC B;  2QZU A;  5EGH A;  4YR1 A;  4CXU A;  3KD8 A;  4CYR A;  5L0E A;  4QAX A;  1E33 P;  1ZEF A;  1Y7A A;  1URB A;  5LQQ A;  4GTZ A;  3BDG B;  1E1Z P;  2W8S A;  4LQY A;  1KH4 A;  5GOV A;  2W5V A;  1E3C P;  2RH6 A;  4UPH A;  3UN5 A;  4MY4 A;  2W5X A;  4MHX A;  1O98 A;  1EJJ A;  3M7V A;  4UOR A;  5INH A;  1EQJ A;  1KHN A;  4LR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...