3UN5A

Bacillus cereus phosphopentomutase t85e variant
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
Knots found
sequence length
391
structure length
391
Chain Sequence
b'NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDEMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 143
structure length 391
sequence length 391
chains with identical sequence B, C, D, E, F
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3un5A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3un5A01
4GTYA 3UN5A 3UNYA 2W5XA 4B56A 1ELXA 1ELYA 3T02A 2GSOA 3BDGB 1KHNA 4ZG6A 1EQJA 2W5QA 4YR1A 2GLQA 1ED8A 1K7HA 2D1GA 4ZG7A 2W8SA 3M8YA 1KH5A 4UPIA 5INHA 3NVLA 3BDFA 2W5VA 4LRFA 2RH6A 3B5QA 4MIVA 5EGHA 3WAYA 3TG0A 2QZUA 3NKNA 4LR9A 3SZYA 4CXSA 5K4PA 1N2KA 5GRRA 3MK1A 1KHJA 3ED4A 5IJSA 3T00A 2VQRA 1HDHA 3IGYB 3E2DA 4FDIA 1SHNA 1FSUA 2GSUA 4LR7A 1E33P 1Y6VA 4GTZA 3LXQA 1ZEDA 1KH9A 5L0BA 3DYCA 3MK0A 3WAXA 3DPCA 1O98A 4MY4A 2GA3A 5LRMA 1ELZA 4LRCA 2ANHA 3KD8A 5EGEA 1AJBA 4UORA 2X98A 5DLWA 4UOOA 4GTXA 3M8ZA 1KHKA 1ANIA 3CMRA 1ALKA 5L0EA 4LRAA 4LR8A 3IDDA 2IUCA 3WAVA 1AUKA 4UOPA 4MHXA 4KJGA 2GSNA 5HRTA 1E3CP 1AJDA 3M8WA 1Y7AA 1KH4A 1ALJA 2W5TA 3Q3QA 5LQQA 1ALHA 4LR2A 3SZZA 3OT9A 1B8JA 3NKRA 2XRGA 4KAYA 4QAXA 3NKMA 3UO0A 5IJQA 3NKOA 5GOVA 1KH7A 3BDHA 5AJ9A 5L0KA 3MK2A 4CXKA 3UN3A 1ZEFA 1EJJA 4UPHA 1ANJA 4ZG9A 2W5SA 4KAVA 3M7VA 2W8DA 2XR9A 1O99A 1EW8A 4KJDA 1E1ZP 1HJKA 2IFYA 5DLVA 4CYRA 1EW2A 4UPLA 4CYSA 4LREA 1SHQA 4N7TA 4UPKA 4NWXA 5DLTA 1E2SP 1HQAA 4FDJA 4CXUA 1EI6A 4LQYA 5LRNA 1KHLA 1URAA 2W5RA 3IGZB 1EW9A 5TJ3A 1P49A 3TWZA 3WBHA 3BDGA 1AJCA 4GTWA 2IUCB 1N2LA 2G9YA 2ZKTA 3NKQA 4LRBA 4TN0A 5LIAA 3TX0A 4LRDA 2W5WA 3NKPA 5C66A 1ED9A 1AJAA 3T01A 3UN2A 1URBA 3WAWA 1ALIA 4NWJA 1ZEBA 5KXAA 4ZGAA 4KM4A 3A52A
chains in the Genus database with same CATH superfamily
4JP8A 3RZAA 1RT5A 2FQQB 2VPYB 2AF6A 2HURA 2WCXA 4HDGA 3HXMA 1YTYA 2QLBB 5HROA 4YR2A 3DLLQ 3IM9A 1YKWA 4ILRA 3VGTA 3UCZP 4JV5F 1WEXA 1K0VA 3OL7A 5HO4A 3W62A 5IZHA 2IBKA 1HR0J 2F8HA 5IC4B 4J5OA 1VR6A 1WJ9A 2YQ1A 5HL7Q 4YY3F 3QGGA 3CCRS 4UOOA 4KJIA 1RT5B 2QSWA 4J9PA 2J8SA 1E3CP 5HROB 1Y9OA 4KRWA 2FTRA 2DJWA 5JUMA 3QAUA 5D4PA 3LQVA 5J1NA 2BBEA 4ZPTR 1H74A 2XS7A 3D4JA 4USIA 2WHOA 3QT6A 3U1LA 2D3O1 1CVJA 3CJ5A 3N5BA 4O3RA 4NCBA 1Z1ZA 1RAJA 4A8SA 5TJ3A 4ZIVA 1M5VC 2K06A 2LKZA 1E6VB 4MTPA 3A3NB 1IXKA 5D0HA 5KFFA 3HVAA 2J0XA 1MU2B 4HKQA 1AJAA 4BC9A 2ROEA 1JXVA 3BGRB 1IQTA 1U47A 1DFDA 1U8SA 2JLEA 1WSRA 2M8HA 1S48A 2AU0A 4QYZJ 3OVAA 1SJ1A 2MHEA 1TZ0A 5B0GA 3K5OA 1UFKA 3D0HE 2GSUA 1A6LA 3IWLA 2CRLA 1J5OB 3WAXA 2FHKA 3DPCA 1NDPA 3PW7A 1UP1A 1X60A 4GKJF 4IOCQ 1EQ0A 2L3MA 1LKZA 1CQMA 3H5YA 4F4WA 3G82B 4WYLA 3NG8A 3FEYB 1S0MA 2X7IA 4UOFA 2HWTA 1VQ9S 5KFGA 3G9CA 1QJHA 2RVJA 3GV5B 3HZEA 4EFAC 2W8DA 1KQSR 4KJDA 3PZPA 2DIUA 2ABYA 2R4FA 1SJQA 4Z7YA 2FHMA 2ZUAA 4OYOA 2VA2A 2UVWA 1L3KA 3M4XA 2FVSA 1TP7A 1IKXA 2KM8B 4QJVA 1NMEB 2CPHA 3R6GB 1UJ5A 3CD0A 3MAQA 2LQ5A 2R7WA 3HHEA 2D1GA 1T05B 3IWNC 2VONA 2KFNA 3W65A 5GAHI 1RAHB 2H9ZA 4LF5J 4DN9A 4NLQA 1H6KX 3TQ1A 3MXHP 3D0IE 2ZZNA 4ED0A 5AE1A 1GH8A 1IKXB 4R0JA 1UVNA 3K7RA 4FF2A 2MQMA 1BWEA 1CJTA 1J27A 2KZMA 1SUQA 1SL1A 1S4FA 2DGOA 4ZVHA 2BJ7A 3AXMA 1Q8LA 3RW7A 4FP9A 2XQCA 2MQPA 1AFJA 1PIEA 3SSRA 3LH2S 1VBKA 3MM6A 1L3SA 2C28A 4CO2A 4X65J 3AJDA 4LFBJ 2IM2A 4A46A 1SJ3P 1GFWB 1M1GA 3OD2A 5KFCA 4A8QA 2FVQA 4LRDA 3T01A 3LP2B 1PYSB 3MM9A 3W5XA 4XPCA 2W2PP 5I3UA 3MR7A 3VAIA 4PQUB 3MMAB 4M5MA 1RCXB 1HNXJ 3TZWA 4ED6A 2BX6A 2HRUA 2QZ8A 1WACA 1HPZB 1YI2S 3M1VB 2V2QA 2DNGA 3GMGA 2J9CA 3W9IA 2FLNA 1H0HB 3EWGA 4DV0F 1JLAA 3F0NA 1FJGJ 5J1EA 3NOCA 1LFPA 1TFWA 2F7VA 5HMWA 4ZVRB 3VWSA 5EN1A 1V9OA 5J2MB 4OYXA 4TYBA 3RRHA 2OPPA 3LA0A 4OZLA 3ZTOA 4ELVA 4FYVB 4X62F 1QD1A 1YK9A 4OI4A 1VLYA 2IC3A 1CQNA 4DI6A 1VRTA 1BQMB 4CP5A 1JKHB 4K8RA 3DOMA 1Q5VA 5IM0A 5LL6d 1S97A 1YJWS 5C2GA 2KVIA 3DRRB 2QYCA 2O1PA 4MT1A 2ZBPA 2ZHOA 3FMWA 2VL1A 4NASA 5GAGI 1Q5YA 1S79A 4JV1A 4BWJA 1QTMA 2CQ2A 2PFDA 1N36F 3CMRA 4KIAA 1VRTB 3SQGA 3UCUP 4U7UD 2ZC3A 2OPSA 4B3MJ 3MEEA 4QWAA 3NCRA 2DBBA 3DOKA 4CNZA 2MSTA 1VQ6S 2W8LA 5KOWA 4R8UB 1PGZA 4JI4F 4RW8A 2L08A 1X4GA 3FUYA 2E5LJ 4N56A 4K4UA 4ZJLA 3RBZA 5LMNJ 4WZMA 2R7QA 2G9YA 2CPYA 3PKYA 3VHQA 3A52A 3DOKB 4QBUA 2DD8S 2XC9A 5KT4A 3OVBA 1WTFA 3OJUA 4I0WA 4WF9Q 4KGZB 2Q1LA 1PYOB 3HFZB 4IDKB 2BE2A 3BSAA 3EDRB 4HTJA 3RAMA 1QDUB 1FCAA 4OYIA 4KSEB 2OKQA 3K2YA 2CFXA 1U24A 3B78A 2HFSA 4JI5F 5L0BA 1LK5A 3L7PA 1S1UA 3I0RA 1HNZJ 3K5PA 3FSXA 1KFSA 4PG5A 1U26A 1UFLA 2QO3A 3CPWR 1D3WA 3WC2A 2W4CA 3BKUA 2LDIA 1B0PA 1WF2A 4JI1F 5DDOC 4DPOA 1UZDA 3D6MB 3M7VA 1EAYC 1WOOA 4J9LA 3H2UB 3GCXP 3UD4P 3CB4A 3MEDA 4M5JA 4G3IA 2BV3A 2YPZA 1OYDA 3X3UA 5ITHA 1KRPA 4PAAA 1SJFA 2GJFA 5GVQA 4U7CA 1WEZA 4ZCMA 4FNIA 2XMVA 4Y00A 3I87A 3H5UA 5EGHA 1HBNA 2DTJA 1M5PC 2HAIA 5K4PA 1RWWB 4UUWA 3MWBA 1D8ZA 5F8MA 2YWFA 4I4BA 2RRAA 4DV3J 5A2QU 5A8KA 4I6WA 1DQ9A 4B3SF 1GXTA 3OSPA 2EG1A 5GAEU 4ED7A 4M5DA 1U8WA 2HNZB 4EGLA 3OV7A 5HJXA 1KH7A 1HQUA 4ZG9A 4QCLA 1FRMA 2Y1IA 2IFYA 1AFIA 2ZD1A 3R1HA 3BREA 4LF9J 4CXUA 2MDAA 1XBWA 5M2UA 1EHWA 1N2LA 4LRBA 3PXGa 3W61A 1OYEA 2OELA 2CG8A 2RMLA 1JIHA 2MKIA 3PRDA 4NA3A 1Q86T 1P1LA 1HQUB 3KLFA 5K14A 2DNHA 2MHNA 3ETOA 3K8WA 3PW0A 4H4KC 3HDSA 2CJKA 1T0TV 2V8GA 1NHKL 3M8QA 1O6XA 4C8MA 1NKCA 3B82A 3A8KA 1FWPA 1Y6VA 5F8HA 1XC9A 3PRVA 3R7SB 4WIIA 5HSPA 1DRZA 3P3DA 4O23A 4OX9F 1XERA 3KLFB 3DRSB 2JHEA 3NY0A 2UXBJ 3H8YA 1N33F 1JLQA 4M5GA 4LR2A 5D6GA 1WKKA 1TL1A 1X0FA 1SC3B 1HHTP 3UCGA 3M8QB 2V5HG 1R31A 1HI1A 1B0VA 4CTAB 3HZGA 3DYAA 1EW8A 4ZCIA 4FXWA 4FVMA 1A7GE 1LWCB 2ZE2A 2Z8QA 1G6BA 3TO8A 4OV6A 2XY5A 3L7OA 3US5A 1ZA2B 4CLZA 1WC3A 3N5FA 1NSKL 4M8LA 3FJ2A 2COLA 3HHLC 3I4PA 3PX6A 2EFGA 3R7BB 3WHIA 5CZXA 4DV7F 2H5JB 2C2NA 1RT2A 1YITS 1H2VZ 4LJMA 4OYWA 1VQ4S 1ULRA 1Y5LB 3CIMA 1O5JA 4FDIA 1RLDA 3BKFA 1Q79A 2XHWA 4DQPA 2CQIA 2CVEA 1RT1A 2Z58B 3ZZOA 1T7PA 1FF2A 3NWRA 2DNNA 1RT2B 2MZRA 4IH6A 1KQKA 4YMEA 5A2QY 2DGWA 3VAKA 2IJRA 5F3ZA 2HWHA 3NLCA 1LW2B 4Y2MA 2OJ3A 4KV8B 4NLWA 3Q8VA 2DHXA 2W7PA 1EJ7L 2WW8A 3PYDA 1W7WA 1HHQA 3TEGA 7AT1B 2FGCA 3R5JB 3TVZA 1ZM9A 2R8KA 2ADBA 4NYZA 3CDWA 4K7QA 1NB2A 5FLXY 3ZO7A 4LSLB 3LPEA 2Y9HA 5D0GA 5L39A 3JYTA 4ANEA 2AT1B 3G86A 1FFSB 1CBKA 1HLWA 3BDFA 4K0KF 2AJ1A 3AXKA 2ZKUA 1RWOB 3G87A 4DQIA 4TQRA 4CYUA 4ANCA 1I3OB 4YB7A 5IT4A 5DDRC 2DXDA 3KMSA 2ZOGA 2WONA 3BM7A 2D7SA 3IO1A 3OR2B 1U1NA 2KB2A 4Q44A 4A8YA 3DLKA 2XYPB 1WI8A 2LVWA 1XR7A 1ALJA 5H9FJ 2BYCA 2KL8A 3NKRA 4L73A 5D78A 1SL0A 4CYUB 2JSXA 4UZCA 1TK0A 3OL8A 2CUYA 5KFMA 2WONB 5D8HB 3PR5B 3T41A 2CKWA 4C8ZA 1J5EF 1V6HA 4OZ1A 2OIHA 3EZ5A 1PJ5A 1YWXA 3HULA 1M1KT 3VAGA 2V8DA 1CS4A 4HEA9 1FHTA 2BA9A 1F5AA 5CXTA 2QZUA 1TKDA 2ZH2A 4W4MA 2BE9B 4P2MA 1RA6A 4NLTA 3GFYA 4HHHA 1O0PA 1UJ4A 4ECUA 2I6WA 3EUNA 4AUKA 5IFMA 4JOUA 2Q6CA 1YRTA 3L3CA 2XSJA 1CS4B 2J76E 4Y2CA 3SBMA 1JLFB 3CJRA 4X4TA 4QW8A 1ZYQA 1FRKA 5C24A 2HQ3A 2AEMA 2YQ3A 2LMIA 2Q79A 4ZN1A 1NDKA 1M5KC 4NYOA 2F1FA 3QT7A 3DHWC 1FKOA 3WAWA 1TL3A 2K7JA 3I6PA 4DR2J 4CNYA 2X1AA 8RUCA 1JX4A 1CJKA 4F0HA 3QYYA 4ZP7A 1EQJA 1R3NA 1R7IA 2W8SA 4C98A 5C24B 4GKKF 2VKZG 2R7TA 1AUDA 2GQ2A 4FYXB 1N88A 3GFXA 3SZ2A 2R2SA 3GG1A 2BRLA 3ED4A 4PEOA 3IBFB 2XSFA 2ZVIA 2GHVC 2RU3A 3UR0A 4KTQA 1FKOB 5HBMA 2AQ4A 2GCFA 2VJUA 2C22A 3HSJA 2GQCA 5IV3A 3EXCX 3PW5A 1FVSA 2MGZA 4O44A 4ZN3A 3S1TA 3Q3QA 2C42A 3OXGA 4EI2A 3JQJA 5ETOA 2BZ2A 3PTWA 1RHRB 4URGA 2B9EA 4O4GA 3GIJA 2LCWA 2VQFF 3SEOA 2AEFA 5HBMB 4LQ9A 4PG7A 5A6PA 4MYTA 2E5IA 4G6VB 4HLBA 1XTZA 2E9RX 3IA0A 1QTNB 4P71A 3G4SS 4RWWA 1BQNA 3BB5A 2M52A 2ZJPQ 1K8AT 4JI3J 4Q8FA 1HYSB 3C19A 2W5QA 3CF5Q 5CCMA 3D7SB 1SJ4P 1WORA 6FD1A 3KG4A 2RH6A 3QJLA 4PUOA 2G0IA 2XI2A 2IM1A 2HHTA 1AXQA 4G1QA 2EI5A 4ES3A 5EGEA 4CH7A 5J2QA 5AXNA 2DGXA 2DNKA 3MCMA 1GX5A 4ECTA 3CIZA 2HHVA 3TUIC 4DQRA 3FFIB 3GG0A 2ZH8A 3M2VB 1FFWB 1NHUA 3J81j 4RWXA 4IH7A 2MZJA 1F2HA 2CJAA 4DV6J 4WP8A 2JJ4D 3V6JA 4P2SA 4WBFA 2VH7A 3WDOA 4CYRA 4CO3A 1QAYA 2XI3A 5KT7A 5D4OA 5D0RA 2Y1LB 2ZBRA 4FZVA 1Q82T 1N34F 3FEXB 2G9OA 1TR0A 2B4PA 4USMA 3AAWB 4Y0FA 2GHWA 3PIOQ 1OPZA 2VICA 2YKMB 1A9NB 4DR1F 2WBMA 1UTAA 3OFFA 2PN6A 1VRUA 1X9SA 2A2DA 3GJRB 3AQOA 4PKDB 4PWUA 1S99A 2HKEA 3D9BA 3QQCD 3ULHA 2DR7A 5KAKA 2HNDA 1GK8A 1HIYA 3CDEA 4NZ7A 3BR9A 3VQSA 4C11B 1RAFB 2I1RA 2K3KA 4ZLLA 4AYBD 4YDDB 4FYWB 4J7CA 1WF0A 1KOHA 3TW0A 5SUHA 4BDPA 1PBAA 2ASJA 2FZKB 1VRUB 2RQ4A 1F1BB 3D3BJ 3IS9A 1FK9A 3TRGA 3V6KA 4NLUA 5LSOA 5FIIA 4IOBA 2V63A 3D66A 2A10A 2IRUA 4RUHA 4FPIA 2R2TA 4LFCJ 5KT5A 1IBMJ 1HQAA 1IN0A 1EI6A 2FLLA 2BE7D 1IBKF 3BN4A 3CGIA 1WWHA 5DG8A 2A6OA 1UAWA 2F63A 1S9EA 2NZCA 1T03A 3W9HA 1XMOF 2O66A 3IS9B 2X3GA 4R5PB 1Q7YT 2ZZTA 2VBYA 1LWFA 2F9JA 4HI1A 3T1YJ 4M5LA 3HM9A 4AXIA 3BPSP 3HO1A 4QU6A 3RBEA 3KKFA 2OPQB 1G4CA 2JL9A 4RBTA 1S9EB 1T03B 2XMTA 4KR0B 2I9SA 2EFNA 1VLOA 1ZS6A 1SH3A 2RHSB 1SKWA 1ALKA 3GTYX 4F36A 1DLOA 3WAVA 2U1AA 3GILA 2YY3A 2I2YA 5HJYA 3CCLS 2E1RA 2ZEJA 3MFHA 3KLVA 4JI7F 3NKMA 2XLKA 4NCAA 4WFYA 3EX7B 3CO9A 5T7LB 2GO8A 4TU7A 2FVPA 4NEYA 1FRJA 1RLCL 1E1ZP 3QGHA 3J7Z5 2MB0B 4X62J 1TL7A 3MMJA 4X4NA 3V6DA 2PEHA 1JLEB 2LQBA 4MK9A 2NS1B 4TLRA 2QRRA 3Q24A 4U6PA 3EYZA 3SCIE 4P52A 4XIUA 1OQ3A 3BDGB 4DFKA 4FS1A 4G1PA 4BBYA 2GS8A 3QT5A 3M2UB 5IS2A 2HYIB 3BF4A 1CJVA 1YBAA 2KJVA 4HH1A 5F41A 3ZZZA 1N36J 3V6DB 2OEMA 3D1HA 5T41A 1MW7A 1FRIA 2RF2A 1WC4A 4I67A 2AIRB 2ANHA 3ZTRA 4QR2A 5H1SV 5E2QA 3OTEA 3TOQA 4B9UA 4LF8J 2EBEA 4JI6F 4C8KA 4UY85 3BEGB 2B8PA 3Q2SC 3UN3A 1OQ6A 3MDFA 2WVCA 1FWKA 2RF2B 4F2RA 2V4JB 4X66F 1FEHA 2VFTA 2ROGA 4Q45A 4WK1A 5A8RB 4JI8J 4DSFA 2V94A 2E29A 4X4PA 1VC6A 1RTIA 1XEZA 2B6AB 1WNEA 2DITA 3H2VE 3QO9B 4I2PB 4H4KA 2LA4A 4Q43A 4WFBQ 2OPRB 2CQ3A 4X84A 3JTNA 1FVQA 1U1PA 4JI5J 3A1YG 3LAKA 4MIVA 5DM6Q 3R9LA 5KG3A 3T5LA 5HK4A 3KWMA 3ILIA 1U1QA 4DZDA 4KFBA 3M8SA 2RRBA 1QE1B 3BQ0A 2XG8A 4DR7F 1CG2A 3PG9A 4N5SA 1M5SA 4C97A 1Y4ZB 4KE5A 2EPIA 2Z4PA 5A8WA 2XYGB 4JI1J 4H54A 1CSJA 4DSKA 3E2EA 3BSCA 1KH4A 2HHHJ 3BSNA 4DR5F 3MFIA 1YLXA 4DPTA 3NNAA 4DV1F 1WHYA 3PW2A 2P9EA 4RUBA 2ZDOA 3PEJA 4C7QA 3GR0A 4OZ5A 2R3VA 3G8SA 2VC0A 2A1BA 2XMWA 1S6QB 2WK4A 3HHLA 5BJRA 3R2DJ 2G13A 2IDLA 1NKBA 5A8WB 5G0RA 4GTWA 2DHSA 2H1YA 4OI2A 3DXSX 3OPKA 3AD9C 3Q23A 4NEZA 2CPIA 3CJQA 3QZ7A 3T02A 3MPYA 4OZNA 3V6HA 2BVZA 4KB7A 2AGQA 2O5DA 3PIPQ 3TQEA 4LRFA 3W3SA 3GPAA 1EP4B 1OY8A 3MM7A 4ZHRA 2HVIA 3D67A 2PFFB 3GP9A 4DSLA 1UEVA 4O3QA 1ZA1B 2IMWP 3ET6A 2ZJRQ 3R97A 4MKVA 2X98A 1S10A 2MLYA 3LP0A 3SV3A 2E9ZA 3ADAC 1YRUA 2Q3PA 1VBYA 3NNCA 3T1HJ 4G65A 1RKJA 4DR4F 5ADZA 4N8NA 1UFWA 3HHLD 3FZBA 3Q8QB 2EFOA 4M5KA 2K7KA 1U45A 3SSQA 4KHPF 2GVDA 2JLGA 4ELUA 2QMXA 1S1TA 1D8YA 3ET6B 3O44A 2OO4A 4M63A 5KFDA 5K8OA 5AXLA 3GE9A 1IKYB 3Q8UA 1AJCA 4TY8A 4ZLNA 2QFJA 1XMBA 3L9ZA 1MWZA 2WSFC 2HEKA 1MSWD 4LF4F 3CWJA 5KFUA 1HNWF 2BDPA 2GVDB 1HW8A 3BGFA 2AV5A 4ZMMA 3OXLA 1OY6A 1RE1B 2BKNA 2HIQA 4GO7X 5AJ3J 4GVBB 5D3GB 4C8LA 4TY8B 5ETMA 3H0PA 2XO6A 3RU0A 1C1CB 3MR3A 2ASLA 2QX0A 3P8BB 2G1HA 4QQBA 1LV5A 1S6PB 4ED1A 4HHUA 5BR8F 4F50A 4WCEQ 1FNMA 1Z2ZA 4ES2A 3ITHA 2XS2A 3WX8A 1G3OA 4AE5A 3T9NA 4DV5J 2NREA 4CDIA 2W5RA 1EW9A 5J2PB 3DI6B 4JYAJ 4U9RA 4TN0A 1D9AA 3FMBA 1MMLA 1NSAA 2HGNA 3M2RA 3MM8B 2FLPA 2QT7A 3FCVA 1RHKB 2V8HA 2R8GA 4N8OA 2E7WA 2U2FA 3FBEA 3IM8A 5DO2A 3MR6A 4DPYA 1RDRA 4QYRA 4Z7CA 4HI2A 1KP6A 4I69A 1M5HA 3DGVA 3DLGA 2IY5B 5G4DA 4LMZA 2DGVA 3Q86A 5F8GA 3BBCA 4RNFA 1HMVB 2VODA 1NK9A 4LUBA 4CLUA 1LOUA 1YJNS 3CCTA 4LRCA 5I42A 3M2RB 2OP5A 2QSFA 1Y11A 1R6VA 2J7WA 3J80U 3HT0A 4WKYA 2IAJA 2N7CA 1WHVA 3A8JA 5EWFA 1FE4A 2Q6BA 2YNGA 2P5VA 4I7FA 3QIPB 2UV8G 5HMYA 3DLGB 3W2VA 4YOEA 3BDHA 2CNNB 3KK3A 2W9BA 1Q95G 2XNQA 2MJUA 4LREA 5K9FA 4LF7F 4Y34A 2E5JA 5CD4H 1HNVB 2BQ3A 4L76A 3TX0A 2BRKA 4A8MP 2RUGA 1Q0NA 3DKDA 2GHPA 4H4MB 1KDNA 4K0KJ 5LT5A 1ELYA 5ETKA 4DBQA 4ZIWA 3CJ2A 4DWIA 3KK3B 5ETLA 2RKIA 4Y2KA 2V8VA 2MYFA 4PG8A 2NPFA 1JNRB 5KFVA 5C42A 1J2VA 2CNKB 4DCPB 2PDAA 1RCOB 4OMFG 3H5SA 4IYQA 4XDCA 1CC8A 1O51A 3TAMB 2MKJA 3Q8SB 3U1NA 2HGLA 1FDBA 3PR4A 3H20A 5BYSA 2GVZB 3HSDA 2AKWB 1N5YA 2RQKA 2A3JA 4DX7A 3SZZA 3H98A 3DU5A 4AFFA 3AT1B 2XWXA 1RHQB 2OFGX 1S1XA 4OYPA 5KFWA 2EEYA 5DDQC 2CJQA 4B9SA 1RBLA 5KFIA 4DF4A 4ZVFA 3WIUA 2AWZA 1T9XA 2IA0A 3ENVA 3KOAA 4NE9C 1N5YB 1L5UA 1R8HA 3T3FA 1UPMB 1B99A 4MKBA 3D1OA 2KRRA 2A2CA 1VBZA 2JEIA 4HT7A 2P9CA 2O67A 5BYRA 3VAHA 1QAIA 2HRYA 4ZJOA 4KAIA 3QRQA 1KWMA 2KXHA 3SZYA 2VF3A 4LF6F 1RWMB 4XK8C 2BKPA 1SBRA 2HHSA 4PWDA 5CYQA 4EMDA 2HK2A 4UQGA 3MAAA 2MZQA 4K4ZA 2QTWA 5LM7E 1F5CA 4USHA 5B0CA 4M94A 4DU8A 1DBDA 2AZ3A 3M6XA 2RU9A 4K4WA 4DLEA 3F56A 4W98A 2G2ZA 2WW4A 3CCMS 2QL7B 3I32A 3ILLA 2XMJA 3NBPB 1PJ7A 2ZH7A 1B4SA 1X5PA 5KFSA 3J80Y 4ECQA 1UWBA 2RRNA 4NXMF 1LWEB 4K2XA 3GIKA 4J9MA 2HNYA 4WIQA 2C2RA 4B17A 1GTEA 2WVEA 5I3QA 1REGX 3T5JA 4DZ6A 2DH7A 3MF5A 3L09A 4CI0B 4O0IA 4C4WA 1U02A 1R43A 4LF2A 5HI7A 1KNZA 2BW7A 4RL1A 2W01A 4C48A 1IKVA 1V5VA 5KFAA 3P45B 1TKZA 2CVIA 2J6TA 4J91A 2HNYB 4CXSA 1T9TA 1RYSA 3IBWA 5MLCV 3CD6S 5E3PA 4FS2A 2PD1A 2PIIA 4B9TA 1IJFB 4ED3A 1KVIA 3FK4A 1URNA 4RBUA 1HBOB 2NYHA 2QMWA 4ALZA 2MKYA 4ENOA 4IKAA 1AJDA 3HPOA 3QT8A 3U02A 5C25B 4DUZJ 3I82A 4WFZA 3ETMA 1TKZB 3GFHA 2VQFJ 1MNEA 4WE1A 1P9YA 3TAPA 3KHLA 1VGYA 5DETA 5EUHA 1U0SA 3CDBA 2MQ8A 4I64A 1KKHA 5J2NA 1X31C 1CJUA 3AQPA 1KTQA 2V9WA 4QWCA 4AD6A 4OJ3A 1U1RA 4KPYA 4IG0A 3KK1A 3G6ES 3QSYB 3PO4A 4QIGA 3JTOA 4USKA 3A8IA 1K7HA 1IBCB 2IVMA 1HARA 4WU2A 4CLYA 4DSEA 2WVBA 3NMAA 3M8PA 1FJEB 2F4VJ 2QA4S 2F9DA 1ZAVA 1SIWB 2VHGA 4NOHA 1CJUB 2CPDA 2L41A 5KG6A 4UORA 4IG0B 2LP4A 4L6V3 4NYPA 5IV4A 3KJVB 2RNEA 2KFYA 2GW8A 2DR6A 2DY1A 4P72A 2PT0A 1GAOA 4L75A 3OLBA 1NK4A 2H4WB 5B08A 4XAKA 2AGPA 1H38A 1LEOA 3FQLA 1EW2A 3MAHA 1XNRJ 1REVA 3V4MA 3V4IA 1P9QC 4DR1J 3J7YI 3CSKA 3MOZA 2NXEA 3NKQA 2GJ2A 4NXNJ 4YEAA 5C66A 2F3JA 2MLZA 3DNCA 5U47A 1VHFA 4EUVA 3DRXA 3AJ2A 3DM2B 3GYXB 2FY8A 2RE1A 2HQFA 3ZZTA 4M5IA 1UVMA 1T94A 4ITSA 1RACB 2HQGA 3RR8A 4HR2A 2GNKA 2BOAA 4WXOA 2VFRA 1DURA 3V4IB 2UU9F 1HBMA 3CDAA 3OR1A 3JTPA 1VC0A 2IDEA 4P6QA 5FDLB 2SXLA 2PMWA 2PA8D 3Q83A 1S9GB 5LSLA 2KG1A 3MI7X 2IA6A 2EK1A 5KFYA 3MM5B 2DEJA 2DR8A 2J0QD 3Q8PB 2R2UA 3HVWA 2YQ0A 4PWWA 2FHJA 3BH6B 3W8PA 2NSCA 5HP1B 4KO0B 5AJ9A 4UTGA 5GMEA 1D1UA 1RTJB 4AL6A 4FF1A 2HVHA 4RBVA 4UPHA 2DNZA 3I5AA 2DH9A 4EBEA 2JDJA 5IXUA 4FDJA 3RGIA 3NS7B 1YGYA 3WBHA 1MMNA 2BANA 3CTRA 3CC2S 1KQGB 3EGNA 5IT0A 4F25A 2HVEA 3D28A 2W9CB 4BLGA 4O3OA 2C3YA 5DM7Q 3BZQA 2M3DA 4UQTA 4LIWA 4WJBA 4EWTA 3GR1A 2XGPA 3ZZ0A 3E2DA 2FHJD 2BANB 2C2KB 3VZHA 1LW0B 1FERA 3CCUS 1S1WB 3MEGA 4I68A 4USWA 1RSCA 1GEHA 2LDYA 3PYFA 2DNOA 2EKYA 1F3VA 3NCPA 3CC4S 2YNHB 1S5ZA 1C2PA 2JH3A 1OMSA 4F67A 3LWLA 3IC1A 2QJ3A 4OZ0A 1JLCA 1F60B 1VOMA 1YG0A 4OZ3A 2RIJA 1YJVA 2YX4A 1KQFB 2B7BB 4DL2A 1NJWA 3FNNA 3KLHB 1NKEA 4M1KA 2J9DE 2VUGA 3TI0A 4ZPWR 3M30B 1PBUA 1XQIA 4B3TF 4LF1A 1HL6A 1XMQF 5JXSA 2GC8A 2FY1A 2YX1A 3D3CJ 3O2IA 1NEEA 2X1GA 3M8ZA 3QJPA 3KTQA 1SJRA 4LBIA 3UDCA 1YIJS 1QM9A 2AGOA 2AX0A 3CMAS 2Y0SD 1IUJA 2ZHAA 1TAQA 1NK0A 4PR6A 2VD3A 4MIAA 1WOSA 3C6UA 3NNHA 4PQAA 4KY3A 2Y1JA 1HR0F 2QL5B 3QLHA 1YJTA 4X64F 5E41A 2OD6A 4FN5A 2RUSA 4FDFA 1RHMB 1JJ4A 1U09A 4IRKA 1HWKA 3PJXA 1NU4A 3GONA 5IWAJ 2ZBQA 1UEKA 2UUAF 4K4VA 3KHGA 4F3QA 3KXDA 2C2EA 5L9XA 2HAFA 4PXBA 3IAS9 4ZG6A 2OSQA 3C6UB 2RSQA 5IT9U 4RW9B 3LP1A 2V68A 2B5JB 2OMOA 1UZHA 2UP1A 1PSDA 4YHHJ 4CH0S 4ZOSA 2E5HA 2OFHX 3K5MA 1YDLA 5DQGA 1RB0A 2KFZA 1NDCA 4ATNA 1F2GA 4DR5J 4ED5A 3THTA 2XB2D 2VQEF 1DTQA 2QL9B 4OX7A 2FB0A 3QFWA 1G1XA 2BW2A 3HT3A 2MKKA 4F3OA 3LP1B 4OHYA 4V19X 5AT1B 1KR4A 1FNOA 2QE5A 4GRSA 2E66A 3AB2B 2XS5A 3SCLE 5KT6A 4OHXA 1VC5A 2B51A 2HMIA 4DJBA 3MMCA 2ZDPA 4UUXA 1SC6A 2R8JA 1QSYA 4P2XA 3U7JA 2RDDA 2MZSA 2DNMA 2LXIA 1IKWA 2I5JA 4K4XA 5DGBA 2HFOA 3TNVA 4U8VA 1H72C 3TWZA 4B3RJ 3LPYA 2HZAA 1SCJB 1RYRA 3ENQA 3Q8RB 3OVSA 2B0GA 4LBHA 2R7VA 4UW2A 4F7VA 2YKNA 1KHNA 1Y3KA 5L9NA 2UUCF 1C1BA 3MMCB 3OHAA 4C8OA 1QSLA 2BM1A 1L3VA 1AUSL 4FF4A 1JMTA 1VIOA 3MPDA 3RAQA 3AFGA 1FRLA 3MMBA 4YUDA 2Y8WA 1F3FA 1ELOA 3RG6A 2VDHA 3UI3A 3J7AN 1TKTA 2YNIA 2O3DA 2R7OA 1OIAA 3CT9A 3KG0A 2QLJB 2CPFA 4DR6J 4LF5F 2KYZA 2FJAB 4CIOA 1B0TA 4TYAA 3C6TA 1KHVA 4BWMA 2WVDA 3I0SA 1NM2A 2KVQE 3G96A 4LQYA 2QN6B 2DO0A 4DQSA 3MPWA 3MTKA 5CA5A 1TKTB 1HNWJ 1N8RT 4BS2A 3NKPA 1CEZA 1NPPA 3KYLA 1NO8A 1I1GA 3NGUA 1RHJB 4RU9A 2NLWA 1KH5A 4DU7A 2G2OA 3Q2TC 2DPJA 3W63A 4PYAA 4LFBF 2HBZB 2H65B 5IT9Y 3TP2A 2V69A 4JBCA 1OJ4A 1HNIA 1JWWA 4ECYA 1AJBA 3POTA 3CCVS 1UJ6A 2UUBJ 2LXFA 2O01C 3HHKA 1SC1B 3B4MA 2VZ9A 2VG7A 2XNRA 1HBUA 4DPXA 4ZJQA 1WKJA 1HNXF 1CJTB 3TA2A 1MLAA 1HWIA 1NPRA 3GZ7A 1SUQB 1BHNA 4P7TA 3HSGA 4IO9Q 4CYSA 1TV6A 4OYAA 2ZH6A 3POTB 3UW1A 1PAUB 1IVZA 2YWHA 4NZ0A 3RW6A 1DY3A 1ZM4A 1R0CB 3MM6B 3QGIA 1TL5A 3O6QA 2CIMA 2AJ4A 2W5WA 1ALIA 3IWXA 4EBCA 3I96A 4DS5A 3C46A 3SYZA 3OTBA 5DGAA 1S0NA 3OSNA 2KM8C 1YBTA 1ED8A 2Z2LA 5MAOA 1FJGF 5KFKA 5IC6B 4TVAB 3TX8A 3ENAA 2Z0GA 3MM9B 4I2QA 3B5QA 3SQOP 3KLEA 2BXJA 5I3UB 5DLFA 1RT3A 4MK8A 3GFZA 3ZC4A 3QJJA 4YS2A 4FXDA 1U0HA 3MK0A 1V3RA 3VAJA 3OQ2A 1X4DA 3C15A 3TJ8A 1KHWA 5GADU 4KHRA 1T3OA 1U6ZA 3DGPA 1TTHB 3RB3A 2WAQD 1RGVA 4NLSA 2EC2A 2JWNA 2DGUA 4K59A 2W5TA 3FBCA 1F6TA 3H40A 5EX3A 1SIZA 5AE3A 2HIYA 3KLIA 2FVCA 2GMHA 2VOPA 1U0HB 5CYMA 1RWXB 2PE8A 3C8YA 3M6UA 1AW0A 1JLAB 3QATA 3T1AA 5J1EB 1H2TZ 3CC7S 3C15B 1YHQS 2YWEA 2ADCA 3LANA 3ONQA 4B3MF 2KH9A 4X2BA 3AH6A 1S4EA 4DL7A 1I5OB 3TARA 2OPPB 4DR3J 1RAIB 3KJFB 2Q66A 2AJFE 4YR0A 4XPEA 4IQXA 2IC3B 2XZDB 4ZP9A 4WZQA 2E5LF 2LECA 4YB1P 4TU8A 1IQZA 1WKLA 3DOMB 4QPTA 5IM0B 1Q16B 2VFUA 1RTHA 4EZ6A 1HD0A 4MY4A 5KFLA 4GTXA 1UW4A 3PEHA 1UMJA 2IUCA 2CJXB 2VDIA 4C3LA 2JC0A 1FT8A 3W7BA 4DMZA 1JLGA 4Q0BA 3SQGB 1ZEFA 2OPSB 4TQSA 2GAGC 3TANA 1KLNA 3MEEB 2UXDJ 4OI6A 4CO5A 4CLSA 4X4OA 3M9MB 2YKPA 4RW8B 4CLPA 1WG5A 4NLYA 3S01A 2IUCB 1JB0C 2LLZA 2FC8A 1F9EB 2ZNYA 3HKZD 4KM4A 1JLGB 3TJ9A 4CO4A 4Q0BB 1C4CA 4O0NA 1X4AA 3P5TL 5L1IA 3IG1A 1XJWB 1C0TA 3T00A 4ID5A 3VVUA 3CJ3A 2BE2B 1ZOTA 4BC7A 4GC6A 1VI7A 1FD8A 3MR5A 1PILA 2H3EB 2ZZMA 4F8RA 4PXEA 1S1UB 3I0RB 3KFWX 4P74A 4F4AA 1Y0HA 4ES1A 3IAM9 4QOTA 2MQOA 3JB9k 1DZ5A 3IG1B 2IVFB 3A13A 3UVJA 1C0TB 4ID5B 5HQLA 1NBEB 4HDHA 1XK8A 4IFYA 1R8PA 4X4SA 2ZVSA 2BUNA 4DL6A 2CPEA 4QYZK 4P9SA 1KHLA 4DV3F 4AQYJ 3OFEA 4DG1A 2YXLA 2XZTB 4Y3CA 4CRJA 3MEDB 3HHDA 1BMQB 3HFVA 1S6UA 3MECA 3UVJB 2WSCC 2J8AA 4KHMA 5F9LA 1HQEA 1SV5A 5E33A 1UWAA 2JVRA 7FDRA 3OTCA 5IQ6A 3EMTA 4WYWA 1FTCA 5BXIA 1WC5A 5AXKA 5EDWA 4C0OC 2D3OR 1SVDA 2AZ1A 2XLIA 1GTHA 1HA1A 4F0KA 5KG5A 1HBNB 5E7OB 2LEAA 4FBUA 4U96A 3C14A 3RJMB 4K4SA 4NL5A 4YB5A 4ZITA 1AUKA 1TAUA 5FLXU 3KHHA 3K58A 1SV5B 2B43A 4CT9A 4GVLA 1W2BR 3KMQA 4CLWA 3OTOJ 4KGKA 5A8KB 4CLTA 3MZIA 3RTVA 4TN2A 1FESA 2G2YA 4KC5A 4M5DB 1S7HA 2D9PA 2DNLA 3R6LB 2NSBA 3P96A 2UXCJ 4IR1A 4LSNA 3MR2A 3N6NA 3HMJG 2V4QA 2ZD1B 2HSEB 2UXBF 3LW5C 3EGVA 2UVRA 3C16A 3G6VA 2C2OB 1IWGA 4OHVA 3MURP 4QWBA 6FDRA 4PXCA 3FSIA 1CULA 5LOQA 3H2LA 4NLRA 3P4UB 1QSSA 3TG0A 2HHXA 4LVOP 4DSIA 1N2KA 3LF0A 2NUHA 1R8BA 5K14B 4DV4J 5LXYA 1NDLA 3GWCA 5B0AA 1R0AA 1SKRA 5KFNA 3M32A 4E8UA 1BQXA 3BO3A 3MTJA 4QR0A 1N56A 2PEBA 4QIFA 3WX4A 1TKXA 3PFEA 3KUGA 4EBDA 3MCSA 3CXCR 2ASDA 2DNYA 4C8NA 4MMOA 3OHBA 2XCPA 3IRXA 4D3HA 5HN0A 4ZVEA 1ANJA 2PA3A 1AZSA 1JLQB 2IMOA 4RW7A 3EM1A 1R0AB 2GMLA 3ZZUA 3JAMU 1TL1B 1K44A 1GT8A 2ZWOA 3DLEA 2JEJA 2H4YB 3FQKA 8AT1B 1RKIA 2IVYA 1NXIA 3DYAB 5E5NA 4RJVA 4DL0C 2ZE2B 4RNOA 1TKXB 3PY8A 5GAHU 3MGJA 3CJKA 4NI2A 2ZM6J 4KBIA 2WTFA 2KKHA 2F4FA 3IR7B 2RS2A 2UU9J 1PKUA 2GZOA 3VCDA 3W8GA 4PYDA 4USJC 2CWKA 3JS9A 1W2IA 3WC0A 4I1TA 2I0XA 2CJ9A 4DPUA 2J7UA 5B0EA 1HI0P 1UCNA 5DS7A 1SQEA 1RWPB 5KOXA 1DQAA 4NI2B 3HLUA 1R0BG 2HQDA 4A8KA 1FEEA 1OY9A 1G2EA 2M5YA 2QFIA 2NXUA 3H59A 5IOLA 3CCWA 4DS4A 1APSA 1RT1B 3CCES 1WG4A 3IBCB 2VPXB 4E98A 2AYBA 4ICLA 1T3NA 3KG1A 4XTTA 4A8WA 3DOLA 2R42A 1WG1A 2VG6A 3R27A 2JX2A 1YRXA 1Y10A 1GX6A 1SHQA 1HHSA 2N7YA 1SKSA 1OSCA 4RLEA 5L38A 3ZTPA 2W4DA 3IGVA 4R25A 2ZKTA 3CCZA 1RT4A 3OUYA 2FD2A 5D15A 2HW3A 3W5ZA 1VS3A 4NA1A 2W7OA 5KXAA 2B4OA 5A0YA 4USVA 3EZUA 4AL5A 1Q4RA 4ICLB 4OZ2A 2EFVA 1RP5A 3G2XA 4DXLA 5LMUJ 4DFJA 3DC2A 1WDTA 1X9MA 2CQ0A 3AODA 1VQ8S 2DO4A 3DLBA 4WPAA 3Q8YA 2Y3YA 3KNGA 2KHCA 3JYTB 2RQCA 2J6UA 1NZAA 3DRPA 2H54B 1TMMA 2MKHA 4DSJA 1RT4B 2CG4A 2CQGA 1O98A 4WFAQ 4BCAA 3PO5A 3KD8A 2E1PA 3WZ0A 2ROPA 1GXLA 4MFBA 2KXFA 3D6HB 1S76D 1U1KA 3NS6A 2DY9A 2BEFA 2NXCA 1I6JA 2JZ5A 3O3LA 4W92B 2CQDA 2V6AA 3NKOA 1Z4UA 3DLKB 3DRPB 3THVA 4QW9A 1SKUB 1EIYB 3DMJA 3CMQA 1TVRA 4IFVA 4J9OA 3TZXA 1MROA 3RYLA 2ERRA 5LRNA 2CQBA 4MFBB 2K8GA 4NLPA 1F9HA 2QIFA 3QFHA 1VHIA 3JAMY 3HJFA 3UD5A 3GYNA 2W7AA 3CJ0A 4UOHA 2M88A 4TKTA 1N0VC 1CPZA 5GAGU 4QIWD 2AYMA 4B3TJ 3UNGC 2G1DA 1U2FA 1WI6A 4OHWA 2ILYA 3F41A 3EVWA 4IFVB 1WOPA 3BPDA 7FD1A 3ZZYA 3LAMA 4DDFA 3SFUA 4ED4A 3SXLA 4Z2XA 2DHGA 1IR2A 4ZS6A 4DR2F 1VRQC 8ATCB 4Y65A 3KUEA 1Q8KA 3CO0P 2KO1A 3J7A1 3W64A 1K9MT 2ZHBA 1I94J 1N32J 3U1MA 4K5SA 3HI9A 4X64J 3K5LA 3UO0A 2GV1A 2XSJB 2P8IA 4ED2A 3A3PB 3K17A 2B3TB 2GQQA 2D41A 3H5XA 4JV5J 1E6VA 3AY0A 3D2WA 1T9YA 2H51B 3LGNA 2UUAJ 1MU2A 5DG7A 5GAEI 3HKWA 3MD1A 5KFPA 2D3ZA 3BGRA 1AROP 3NGRA 1U2RA 2R7XA 4YY3J 3VGVA 3UNYA 3VTIA 2X51A 3LGMA 1TL3B 3HF5A 1ZZFA 4J9UE 1IWAA 2HVDA 1CJKB 1J5OA 4A8XA 2VQEJ 2CPXA 4WFNQ 3PHEA 1HQ2A 1R89A 3EXYA 5DLWA 3G82A 2GFFA 4YP3A 5HATA 3BYPA 4JI3F 3ZNJ1 5KT3A 1VQMS 5KT2A 3LALA 2HWIA 3K57A 2C3MA 1I51B 1SB6A 5K20B 3FRYA 1WHWA 1P27B 1M0SA 2AJ2A 1SI9A 3NOGA 2J9DA 2MGZB 4O44B 2HZCA 1L3TA 1NLKL 3B4DA 2NYIA 5E3CA 2ZUGA 2WZ1A 3TJAA 3Q0AA 3NS5A 4O4GB 2RB7A 4KGXB 2ZBIA 2UUCJ 4DPWA 3N01A 1IR0A 1NK5A 1T05A 3UN2A 1HW9A 2YWKA 4GKJJ 1M5OC 3H90A 4ECVA 2B8QA 1FKPA 4ZG7A 3CUNA 4DV6F 1BQNB 2HVZA 1D0EA 4F4YA 3N9UC 2BM0A 2Z30B 1A0OB 3NMRA 4PABA 4LR7A 4USUA 4EO8A 2YKAA 4PUOB 3WBZA 1WDDA 5A6WA 2ATLA 2GAHC 1PAEX 4G1QB 4B9MA 2AHOB 5L1LA 3R3TA 1OSDA 3SFGA 1FKPB 1WF1A 4OI1A 1N4LA 3PJWA 2EVZA 5J2QB 1AB8A 3AD8C 2YKQA 2VC1A 1C4AA 2XRGA 2QA1A 1Q53A 5KFOA 4B02A 4CM2A 2N4DA 5DG9A 1T02A 1KEKA 2CPJA 4OZJA 4ECRA 1O99A 1ZTTA 3KDOA 2RAQA 3CW2C 3F73A 3Q22A 3R5CA 3DN9A 2E9TA 3LP2A 1V3SA 4OJGA 4NMLA 3RRKA 5CYJA 4LBPA 2L48A 1KONA 4PQUA 4CM0A 3MMAA 1E6YA 2CNLB 2DT9A 3FBBA 3BBBA 1HFEL 1XN9A 1SH2A 3WQPA 4OL8A 3H4BA 2HRTA 1U6FA 4RNHA 4ZA1A 1HPZA 3O5TB 3M1VA 2KI2A 4ERDA 4L3NA 4NLDA 4LFCF 4ZVGA 2AJQA 3LO3A 1IBMF 1VJQA 2HBQB 4FBTA 2R7SA 2CAJA 2VV5A 2A0FB 2HNDB 3GU0A 4ZVSB 3MUTP 1KN6A 2KTQA 5LRMA 3N6MA 1AYEA 2UVVA 1XR5A 2M2BA 2KDOA 4XO0A 1E6YB 3QGPA 4V1Ak 5DLGA 4OI3A 4LR8A 1D9FA 2E7VA 3BS9A 5JVHQ 3UDLA 2CQPA 1GMVA 2WSEC 5CAAA 3W1YC 4Y2IA 3T1YF 1N5TA 2DRBA 5J2MA 4LIRA 2IJFA 2W5SA 2CZ9A 4P2FA 4C3KA 2ACMA 4IRCA 1FK9B 4OIXA 1RJJA 2DB1A 3BGUA 2CDRB 1K73T 3ZZRA 1ZM2A 1BQMA 2E1MC 4CCHA 5KG0A 1JKHA 4ZVQB 3QBCA 4L3KA 1YJ9S 3PW4A 4NWJA 2HG4A 1WC6A 1VQ7S 2K3IA 4ZPAA 3DRRA 2JEFA 1AA1B 2V2ZA 2X3DA 4O3NA 1ROFA 4PPZA 2IFXA 5INHA 4P10A 5FJ4A 1K47A 2J0SD 1GQEA 2N4CA 5H9FK 4DV0J 2KG0A 1NSQA 1ZBTA 1LWFB 1B7FA 2DKOB 4EEYA 3LXQA 4RR5A 3FCWA 3X1LB 1UA0A 1N5SA 1TU0B 4LFAF 2W2QP 5HMZA 4OI0A 3EJMA 1YVFA 2QMUB 1VQNS 2IPOB 4R8UA 2V67A 2GSNA 3B8HA 3BDPA 1S0VA 5BYQA 3BJYA 1DLOB 3S6EA 3VGUA 1Y7PA 1CC7A 3MK2A 2IYIA 1NB7A 1NRKA 1WD6A 1MWYA 2A18A 4C6AA 1Y5NB 4PZVA 1RUSA 1BXNA 1URAA 4JV0A 3L4BC 4DUYF 4RX6A 3PRBA 5DZ6A 4CWBA 3UD3P 4LF8F 3L7UA 1VFJA 3TA0A 4F04B 3BDEA 1RWNB 1TL7B 1S1VA 2LU2A 4IDKA 3VALA 3PVXA 2VPZB 3HVTA 1WELA 3J7ZT 2GSOA 1DAXA 2EFQA 3H42A 4QIEA 1U6BA 2UZAA 4F4KA 1EX8A 4TU9A 3JXOA 2POKA 5K5MA 1HD1A 1LXJA 3WIVA 1S0OA 4JI4J 1XNQF 2VQRA 1HDHA 1FX2A 3M6VA 2VJVA 5DRKA 4DF8A 1CJVB 1RK8A 2ZOMA 4JI8F 2Z2ZA 2V0NA 2JNJA 2JFDA 4E2FB 1S1VB 1B70B 4OYBA 3HVTB 3P6YC 5H9EK 2W2NP 2MSSA 3TVYA 3CDUA 5EWEA 4URQU 4MJKA 4U7UK 3NWGA 3AOBA 4NLOA 1VQKS 2DPIA 2LQJA 3HVRA 1GXUA 4UY8T 5KFBA 1LXNA 3N4WA 4CLFA 5DLTA 1YJRA 2G4BA 3OLAA 1ED9A 2YH0A 4F2SA 2HHHF 3O8WA 4ZK7M 3OJSA 2APOA 4GO5X 9RUBA 3EICA 2GO9A 3LWMA 4PXDA 4WFXA 1RTIB 3HD1A 2AW0A 2VB6A 2ILZA 4EO6A 4LR9A 3E01A 2PC6A 5THWA 2N82B 4ZCKA 2LXUA 4OQJA 1FXDA 1H7WA 4YN3B 4AXJA 3FZ2A 2Q43A 3S7RA 2V34A 2HNZA 2M7SA 4KFBB 3NP5A 3IXQA 4ETXA 4QWDA 5M2RA 4Q2LA 1NSPA 3CEDA 2QGFB 1P6TA 3ILJA 2OSRA 1BC6A 1FNXH 2KT5A 4KGMA 3E01B 4HL9A 3W9JA 2L9DA 1OS5A 4FVCA 5L1JA 3HCXA 1U1OA 3PNIA 2DYAA 4DX6A 5HVHA 2ZJQQ 2WVFA 4DQQA 4N7TA 2N3LA 3K59A 3FGVA 4Q2MA 3CNQP 3TUPA 1RWVB 2C3UA 4CO0A 3T1HF 1R8AA 1QAXA 2V4RA 3HHLB 3D0GE 1SXLA 3LTOA 3LGHA 1VQ5S 5G0RB 5KFTA 4B3SJ 2WRMA 2RILA 5KFXA 1QAJA 3TZZA 3NGSA 3SIPB 1S7IA 1IR1A 4P75A 5DJBA 5LJ5Y 1S6OA 1F9FA 1YX2A 1FDNA 1FD2A 2CNOB 2KRBA 3D5MA 5HQMA 4GC7A 2P2CB 1U48A 3DRSA 3R2CJ 1KD1T 3MM7B 4ZHRB 2VASA 5EHHA 1B7YB 3FDSA 2M70A 5L0EA 2DCLA 1QLNA 5CQGA 5KFJA 2D1CA 5F0UA 2ZH3A 4E0DA 4CTAA 1FTRA 4FYDA 3LP0B 1LWCA 1P8GA 3HFKA 4KT0C 5AJ3F 2JC1A 4DEZA 4L72B 1Q78A 4KAVA 1VK3A 3NXZA 2PI4A 2YVSA 4RUAA 3PM9A 3R5GA 5DLVA 2ALZA 2DRAA 3NAHA 2Y1RI 1Q7LB 1KFDA 1JK9B 3GJTB 2YH1A 3FVYA 2HFUA 2LU1A 5AXMA 3NCQA 1S1TB 3G8QA 3OBIA 5KFQA 5HLFA 4OJHA 1IJEB 5GMKa 1N6QA 1ACMB 1X9WA 3HX9A 2XWYA 1RABB 4OX9J 3KLGA 2KJWA 1L3UA 3I9ZA 2CA9A 2HBRB 2HHPA 1N33J 1VIXA 3EVMA 3BO4A 5I3PA 3C2PA 5ETQA 2PSZA 4RKUC 5F3TA 4DV5F 1KHJA 3P49B 2YX7A 3ICLA 1FSUA 2V2KA 3D68A 4QIVA 1S12A 4JYAF 5L46A 5HLFB 2IRXA 5D77A 2W25A 1N6QB 2FDNA 2NXNA 2E5GA 3F44A 5F8JA 4LRAA 4K4YA 2CPZA 2BMBA 3KLGB 3A12A 4AT1B 3RUBL 1LW2A 4CT8A 2FC9A 3EDQB 1RU2A 4KV8A 1VYAA 3VZIA 1UVLA 4ZKAA 3UQSA 4ZDNA 4DV7J 2W8KA 4DV2F 4IUFA 2ZWPA 5HMXA 2J5AA 2C1EB 2UVUA 3ITHB 2FJXA 1EKSA 3DHXA 2V9KA 4LSLA 5L1KA 3MCNA 1NJYA 3UFCX 2ZH5A 4C9DA 3ZNUA 4HYKA 3I55S 1QY7A 3PX0A 2XZWA 5K8MA 1ELXA 4USTA 4ZP8A 5D4NA 2LQ8A 2WBRA 3RR7A 1TUWA 5E3RA 1KS2A 3EE3A 2FYXA 3ZXWA 1JLBA 4WTOB 4YQWA 3E8OA 2ZH1A 2ACYA 2ZBCA 3GIMA 3HJVA 1VQOS 3AB4B 3CE8A 3OR2A 1UVKA 3FSYA 4ZVTB 1S57A 3FKBA 4B3OA 5HVFA 1NJIT 1NK6A 4O3PA 2XO7A 1R27B 2C3PA 3W66A 1VQPS 5I42B 1KVJA 1ALHA 3TYTA 3KUHA 1JLBB 3SV4A 3IMQJ 1UA1A 2B4VA 3QIDA 2IAJB 3EGZA 1LK7A 2QG9B 2YNGB 4NA2A 1NZ8A 2DXEA 1RTDA 4I7FB 3TUZC 3W2VB 2ZH4A 2RDIA 4U95A 4B3OB 3V2UC 4EYHB 4N77A 2MEWA 2W9BB 2DGTA 3ILOA 3GV7B 3ZZPA 4X4VA 2AYGA 1UETA 4WWSA 2XMUA 4B9LA 4YR1A 2C2ZB 1UEUA 1YBUA 3GIRA 4UPIA 2LQ9A 1WUUA 2DNRA 2JLFA 1RTDB 3D6TB 3OFHA 4D3GA 1V5IB 3NKYA 3M05A 4WKRA 2B56A 1U49A 2W2MP 2RHQB 2RKIB 1S59A 4HVZA 5C42B 1RADB 1H98A 3G6XA 1JLFA 3J81U 2QLXA 4N47A 5KFRA 1T95A 3G71S 3VV2B 1MG7A 4M5NA 4XDDA 1WTBA 1TQLA 1J5EJ 3QAEA 1KVKA 3DFEA 5A76A 1SL2A 4J9RA 4KH0B 1PCAA 1JQGA 5B09A 1TUGB 2YKOA 2DVIA 3GJQB 1DJ0A 2B7CB 3RB6A 4ZVOB 1R8CA 2OH2A 2HLUA 4YDXA 2P6SA 3BSOA 4WP3A 2QA2A 2XY6A 2E7XA 1S1XB 4PG4A 4O3SA 2YTCA 3DCAA 2XYHB 2CQ1A 2YBVA 2BKOA 4TXSA 2K2PA 3PCOB 4CLKA 3UN5A 1YSJA 3BO2A 5H9EJ 2C3OA 1LNQA 5I4MA 2EKNA 4KYZA 2OTLS 3FRZA 4K2JA 4KKOA 4OX8A 2IM3A 3RB0A 3NEKA 2QC3A 3IGYB 2FUG9 5DZ7A 1FJ7A 1ICEB 2Y8YA 2R7RA 2CDQA 3B54A 3EPGA 5KFHA 2MKCA 3SDEA 4PWDB 4JI2F 2C2DA 4UF4A 5CYQB 1TL4A 3MAAB 3UDEA 4DCJB 4RUCA 4KKOB 3TR5A 2FZCB 3FCHA 3MPVA 5L0KA 5DQIA 4GKKJ 4J37A 3SI8A 4MKYA 1KBRA 4NCGA 2YNFA 2B4UA 3ZTQA 5E0OA 4WP9A 3GSDA 5C7PA 4PRFA 4MH8A 3SDEB 1UWBB 2BJEA 2HHWA 4K5RA 3BR8A 1HYSA 3VAFA 2V50A 5RUBA 5KFEA 2HK3A 1FI4A 5F8LA 4DLGA 4DUZF 4ZGAA 3MOJB 3EPIA 2FIUA 2KXNB 2AJ0A 2UUTA 2DXFA 1BD6A 4WXWA 5B0DA 2V8PA 5CH7B 3HP6A 3BV8A 1EARA 3PHTA 3DDNA 4UOCA 4UT4A 1XR6A 2MQQA 5LJ3Y 4NCGB 4M95A 2BJ3A 2YNFB 2KT3A 3OTDA 4MK7A 5GRRA 1IKVB 1NHVA 3JSYA 4DOZA 5KG2A 3BGOP 3FFIA 3M2VA 1UL3A 3GB0A 5DQHA 4K50A 1ANIA 1X4HA 4MHXA 3K8VA 5CABA 4Q5VA 4OLOA 1RXOB 3NGDA 1B8JA 3R7NB 4OV1A 4MAKA 2BJ9A 1P1TA 4Q8EA 3J81Y 1OPIA 2F4VF 4CLLA 4B08A 3TZYA 2CZVC 2CXEA 2BJ8A 4R0EA 1VQSA 1EKRA 1JXLA 2XBPA 4WE1B 2YKMA 3SCJE 1PYTA 4RNNA 2P6TA 2W9AA 2FZGB 4ZVUB 2E1AA 1NPKA 1K0TA 3M8RA 2GX8A 2DR9A 2CZ4A 1RQ0A 4QWEA 2M4MA 5J2NB 1CLFA 2ASYA 3T6JA 5JMNA 4C11A 2MKSA 3NAIA 1HWLA 5HVGA 3KK1B 1PJ6A 4W90B 3BN7A 1XNRF 2IJNA 3NKNA 2DEIA 2BJ1A 4F4XA 2AD9A 2B9YA 1UVIA 1SHNA 2MLXA 1RAOA 2NCKL 1RBAA 4NXNF 4JI0F 1H7XA 3M8PB 2BQUA 2FPHX 2MQNA 2IRYA 2EBGA 3D1QA 1X5OA 1N34J 2GMJA 4IQMA 4KJGA 4ZLPA 2CQ4A 3JQKA 1N52B 3LOUA 1Q81T 5IJQA 4URSA 1QUVA 3CJSA 3GSIA 1X4CA 1ZAWA 4ELTA 2DISA 2EK6A 4Y6IA 3IRWP 4QPXA 4UPKA 3SSSA 2GA7A 4Z37A 4R5PA 1KLMA 1WEYA 4RW4A 4DN0A 1TK5A 2AYEA 4ECSA 1REVB 2A6MA 3PYEA 4NRUA 1T9VA 3PFOA 2DRDA 1EETA 1XIQA 4HHJA 1FXLA 5F0WA 1IM6A 2MQLA 4ZCLA 4OHZA 2OPQA 3EGWB 4NMXA 2RDJA 2Z2MA 2FJVA 1QVFR 3OL9A 3W2WA 4LVNP 1KLMB 2NR0A 1FDAA 2OD4A 2EW9A 3B6BA 1MN9A 4RW4B 4EK2A 4FKYA 1HBMB 4RW6A 3OR1B 3W60A 1IBKJ 3ISZA 1EETB 2OEKA 3JSRA 3M8WA 4IRDA 5T7LA 1XMOJ 3VQTA 5K8PA 2R2RA 3CULA 1S77D 3KNAA 4A47A 2XMKA 1FJCA 3RAXA 4NZ6A 5ETTA 1IBLF 2EG2A 4KGVB 3W2WB 1WHXA 4JUZA 1JLEA 1QUPA 3T5KA 2DK2A 4RW6B 3BDGA 5E3AA 2NXJA 3BH7B 3M2UA 3I4HX 4ZVPB 3VVTA 2FVRA 4A8OA 3ELHA 4IG3A 3L95X 2OAUA 4MYUA 2DHAA 2HFZA 4FF3A 3WAYA 2H5IB 4JI7J 4LFAJ 2LFVA 4MIWA 1RT7A 2JOQA 5ETPA 2MTLA 2OLWA 2W1BA 5KFZA 3E3XA 1X5TA 3VF0B 3PX4A 2R9LA 4IG3B 1X4EA 4ECWA 3QWUA 3NGKA 2CJBA 5AE2A 4RPFA 3BQ1A 3ISNC 3TEHB 2AEJA 2GIFA 2V4JA 2VIHA 1RT7B 1NK8A 1LQ9A 2KT2A 4DUYJ 2VBZA 4A4JA 1U1MA 4CH1A 5A8RA 3MEGB 1S49A 4YB6A 4UZBA 4OFZA 2B6AA 2EC0A 3QO9A 4OYMA 2VFVA 4I2PA 1P49A 1FWLA 2OPRA 4ED8A 5ETVA 4IOAQ 3MCOA 3MHYA 5KG7A 3THPA 2VOOA 1URBA 1JLCB 3TAQA 1YJ7A 1U7LA 4CO1A 1PG5B 1LWXA 3RBDA 1XNQJ 4JI6J 1DARA 2F8EX 3OL6A 4IO1A 5T14A 4CZCA 3U27A 2LYVA 1T9UA 1QE1A 4KQZA 4J90A 1YZ7A 2H48B 1TFYA 1RZMA 4C0BA 2BJDA 2KZZA 5IWAF 1BE4A 3NL0A 4X66J 4F02A 1URRA 2GA3A 1N0UA 4QZVB 3DXBA 1RI7A 1SPBP 1Y3JA 1EQMA 1XWLA 1M1HA 4RU2A 1Y7AA 3GLJA 4QR1A 4ZPDA 2CWXA 4YHHF 1EZZB 1FFGB 1N54B 3I5BA 2UUWA 1S6QA 2ATCB 3CVKA 1D09B 2WB4A 1HJKA 2OTJS 1YQHA 2CQHA 3QLHB 4N41A 4HH0A 1HKAA 1ZPVA 2HLTA 5ETRA 4DR7J 2OEJA 4YFUA 1DTTA 3K89A 3CJTA 5ETSA 1EP4A 2JFKA 2GIRA 4PG6A 3CJ8A 1W25A 2QYGA 2XM3A 2ZOFA 5C5JA 4B9VA 3BGLA 3PYGA 4DV1J 1WC1A 4ID8A 1PC5A 1GNKA 2OMLA 3NRBA 2VBWA 2JEGA 2LEPA 4B3RF 5M2PA 2B9XA 2BQRA 4TLQA 1DTTB 3QNWB 4I6AA 2PGCA 2CQCA 4HTIA 2MZTA 1PC4A 5EGYA 2RS8A 3OT9A 1DTQB 2CADA 2ZITA 2DCUB 2J7KA 4CXKA 1EJJA 1Q8BA 1X5SA 3CD5A 3DRYA 1IKYA 4KH1B 5J1PA 1NK7A 5F8IA 2HMIB 2J6SA 3A8EA 2FLOA 1YZ6A 3ZTSA 3MEKA 1NJXA 2Z56B 3JQMA 1IKWB 2I5JB 3CMES 1KSPA 4ZLJA 2F40A 2YWGA 3PKMA 4LT6A 4J9QA 1VISA 4DR6F 4GVBA 5D3GA 1RISA 4DR4J 3BYRA 3HHNB 2NUUG 2YKNB 1T11A 2D9OA 3P5BP 1C1BB 4KHPJ 3IN5A 2E44A 1C1CA 2HS0A 1O8BA 4AL7A 4X4RA 1RBOB 4O4RA 1NNDA 1KH9A 4FXVA 1S6PA 2HBYB 2LA6A 1H2UX 3TVKA 1GMWA 1ZAXA 1KHKA 5CHCB 1F0XA 4N76A 3IDDA 1N48A 4S0MA 3MMBB 3OW2R 2HZVA 1RAAB 1B64A 1NCLA 4QAXA 2ZC4A 4F4ZA 4KAYA 4EYIB 4NPOA 4LF4J 3IR5B 1ZZNA 2YNIB 3R1LA 1RWKB 3S8SA 5J2PA 3LUYA 2XULA 3DI6A 2G0JA 1RHUB 4BHQA 2NQPA 1U25A 2QA4G 3QPIA 2UUBF 3MM8A 1T8EA 3UPFA 3A3OB 4DX8H 1UVJA 2FJBB 3C6TB 3CCSS 4X65F 3I0SB 1VK8A 1ZEBA 2EXUA 1Y00A 2VU5A 3AHPA 2W24A 3RBXA 1ZTWA 3H7HB 2M9KA 4F3MA 3GYGA 2QLFB 2FHOB 2RH3A 1TK8A 2V2VA 4DL5A 5BR8J 3Q89A 1KOOA 2VBXA 1GMWD 2XTJP 1N5QA 1JNZB 1HMVA 2W5VA 4B9NA 3FC9A 3KJQB 1RWUA 3TUJC 2F65A 3R5BA 5B0FA 1H3DA 1E33P 4GTZA 3R5AA 3GV8B 3MPUB 3BBFA 4MKAA 3QSIA 3QIPA 1TUVA 5HRTA 1HNIB 4DV2J 1YJUA 1BLUA 3OXFA 5LQQA 3J7YU 3DLJA 1K1QA 2VG7B 2QLWA 4V19J 3AD7C 1HBUB 4EZ9A 2FGOA 2MY7A 4TY9A 1HNVA 5KG4A 1Q1KA 1Z2LA 1PO6A 4DHVA 4NWXA 4FNHA 5JVGQ 4DFMA 4H4MA 4EU0A 2R8IA 2MZ1A 3QZ8A 4JV2A 1TV6B 2ZFHA 1D9DA 3E51A 2AMCB 3N0VA 1MMDA 1K1SA 1WC0A 1ZETA 2MXYA 4G1IA 2OI2A 5CCLA 1HWUA 3KK2A 2WB1D 4TNOA 4DL3A 3R8YA 3M9OB 3TAMA 3HD2A 3EVOA 1X4FA 1M90T 2X1FA 3DLHA 4J9VA 4I2QB 4U67Q 2GVZA 3KLEB 2I38A 1IM4A 3H4DA 2RT3A 3I5CA 4M5HA 2D69A 1RT3B 4LF7J 3D54A 3DU6A 1U4BA 2EWHA 2L9WA 1V3ZA 5LXRA 4FYYB 1Q8IA 4DR3F 3KK2B 1WSVA 2DH8A 2VKRA 1UKUA 2KYXA 2D74B 1RTZA 3AJ1A 2IM0A 3SMZA 1VQLS 3DGPB 1W26A 1FKAF 4OJ1A 1EB0A 5IQQA 2DHHA 5ETNA 2L9NA 2AX1A 2VPWB 1NUEA 3KLIB 3UWTA 5CYMB 3D6FB 1U2CA 5F8NA 5LIAA 5SZTA 1Y5IB 1RAEB 3C3LA 5LMNF 3JSBA 4J9KA 1SQGA 2J9EA 2GLQA 9ATCB 5DDPC 2PMHA 2XGQA 3TA1A 2BOPA 2UXDF 2F5GA 2FJWA 2W4PA 2D3UA 2BR0A 1KC8T 3H25A 5FD1A 3I31A 2YPYA 3EZOA 1ELZA 4NLXA 4FKXA 1SC4B 3KHRA 1BY9A 4NLGA 1RTHB 2CJYB 4OYZA 3NBPA 4ECZA 2GJIA 1HNZF 2DIVA 2MJNA 5EX0A 1LWEA 2N3OA 4ETZA 1NH8A 5GOVA 2DNQA 2GGPA 1VQYA 2PO4A 4F26A 3AA9A 3R5DA 4LF6J 2K1RA 1E2SP 3CJ4A 3IGZB 2DNPA 3GCWP 2NZ4A 4FPRA 1UPPA 4ZP6A 1X8DA 3T6BA 2RQMA 2HHUA 3PACA 2GGPB 4ZPCA 4C8YA 3BQ2A 4Y2AA 2R8HA 2M0GB 3I56S 2K1RB 4JI2J 3HSZA 4AQYF 4J9SA 3HK2A 3RRGA 2H5EA 4NXMJ 2QEXS 1ZEDA 1HBOA 2OUGA 4I56A 4IR9A 3QWPA 3K5NA 5C25A 3T9ZA 3T19A 2IYGA 2CYYA 4RO0A 3IFEA 1QVGR 4CQ1A 5GMDA 3ENWA 1MN7A 2MMYA 4DUTA 4KPCA 4ANDA 4DX5A 4HACA 1FRXA 2YWWA 2JRSA 2XY7A 2DGQA 4PPDA 4ER8A 1BWVA 1HI8A 2OHDA 1BGXT 3N79A 4ZPVR 2XHCA 2LEBA 3UDVA 3V5RA 2BACA 4IFYB 4P7VA 2RJZA 2G0CA 2W2OP 3ZFVA 1GMUA 4HACB 4LF9F 3N6LA 4ZPBA 1NJZA 4GTYA 4JB8B 1JJHA 4P73A 4DG1B 3OTOF 2KN4A 2R7UA 3O1LA 1ZH5A 3M8YA 4YR3A 4C0HA 2UXCF 4J9NA 3MECB 1VDHA 3CD7A 2XCAA 3CCJS 3DDKA 4H4OA 1HQEB 3KJVA 3DYCA 2HQIA 2BABA 3NGTA 2B9WA 5D4LA 1S72S 4RNMA 5KTQA 2GIQA 1RT6A 3C14B 1OWXA 5B0BA 4H4OB 4DV4F 2Y0BB 2FJDB 3BKTA 2XR9A 1JXEA 5E3QA 4ECXA 2KHDA 4A48A 3VAMA 5HQ8A 3DM2A 2WOMA 1NAQA 2J0WA 1T9WA 1RT6B 4LSNB 1KTVA 1FXRA 3KJNB 2F8MA 4GMKA 2HQCA 3QRPA 3RB4A 1FO1A 2HS4A 3VR1A 2JVOA 3JSMA 4ILMA 2P9GA 3FBFA 3M6WA 3C16B 4WK3A 2UV8A 4JI0J 1RU1A 5CZVA 5FDLA 2QV6A 2WOMB 1S9GA 1CULB 4NWBA 3MD3A 1DHMA 2ZH9A 3MM5A 1R6YA 1JJ2R 2ZM6F 3VGSA 5HP1A 3M32B 4UOPA 4KO0A 3JSMB 1NH7A 1RTJA 2RD5C 4NLVA 2Z57B 4OX6A 3T5HA 2XMMA 5JJBA 4C3MA 2MY8A 2MPUA 2EFPA 1RA7A 4A8FA 5GADI 2M8DB 1X7VA 1ITPA 3IRXB 1SQFA 1DQ8A 1AZSB 4RW7B 3SCKE 3PV8A 2NPIA 2X1BA 1VJWA 4DL4A 2ALYB 4NX9A 3DLEB 4Q7AA 5K8NA 2W9CA 3CCQS 3K0JA 2KU7A 3FEZA 4B56A 3ISND 3CJKB 4RZRA 4X4QA 1VCTA 3NVLA 1FX4A 3UE2A 3QMQA 2XMAA 4K4TA 4Y28C 4ILLA 1BUXA 5F9NA 4DFPA 1G7CB 3MK1A 5IJSA 1LW0A 1S1WA 2HPUA 5C2CA 2VFSA 2Z2YB 2OGUA 1FRHA 2IIHA 5HAOA 4NRTA 5LMUF 4L74A 1IBLJ 1H73A 4X4UA 3MUMP 5CD4A 1OO0B 2YNHA 3GIIA 4F0MA 2VA3A 2FJEB 3GJSB 1LFWA 3M9NB 5D0EA 4WTYA 1UW9A 1HWJA 1VBXA 1FDDA 3I9V9 3DOLB 4DCOB 3KLHA 2DR5A 3IR6B 2IHR1 2VG6B 3UR3C 2HFNA 4QU7A 4LQ3A 5L8RC 3QRRA 2HS3A 4U8YA 4I6YA 3N28A 3M30A 1B3TA 2W5XA 4WU3A 2HFVA 2HHQA 3AOAA 3W5YA 3OUYB 3V81A 3IGNA 3PJ9A 5EWGA 5A0YB 5LSRA 2IBOA 1SH0A 3KDNA 3AA8A 1TMJA 2VG5A 4HT5A 3C66A 2XEXA 2C2MB 2ZNZA 1VMBA 1F5BA 4PCQA 1C0UA 3AOCA 4OLPA 2HGMA 1RAGB 3G6YA 1JJCB 3G8TA 4UOGA 1U1LA 1TELA 1FE0A 3PDNA 2PI5A 3IP0A 3V81B 3A4TA 2VG5B 2E1CA 2I8EA 6AT1B 3DDIA 1X4BA 2XLJA 5HANA 1N5VA 1ZM3A 1C0UB 1MWQA 3MUVP 4UPLA 1S9FA 1X0PA 2PMZD 4MIBA 4C2MA 1XMQJ 1FA0A 5KG1A 3OFGA 2DGSA 1ZPWX 3DMJB 3GQCA 4IH5A 1TVRB 1MROB 5B7WA 2AP6A 4RW9A 1I94F 1AT1B 2B5JA 1N32F 4LSZB
chains in the Genus database with same CATH topology
4GTYA 3UN5A 3UNYA 2W5XA 4B56A 1ELXA 1ELYA 3T02A 2GSOA 3BDGB 1KHNA 4ZG6A 1EQJA 2W5QA 4YR1A 2GLQA 1ED8A 1K7HA 2D1GA 4ZG7A 2W8SA 3M8YA 1KH5A 4UPIA 5INHA 3NVLA 3BDFA 2W5VA 4LRFA 2RH6A 3B5QA 4MIVA 5EGHA 3WAYA 3TG0A 2QZUA 3NKNA 4LR9A 3SZYA 4CXSA 5K4PA 1N2KA 5GRRA 3MK1A 1KHJA 3ED4A 5IJSA 3T00A 2VQRA 1HDHA 3IGYB 3E2DA 4FDIA 1SHNA 1FSUA 2GSUA 4LR7A 1E33P 1Y6VA 4GTZA 3LXQA 1ZEDA 1KH9A 5L0BA 3DYCA 3MK0A 3WAXA 3DPCA 1O98A 4MY4A 2GA3A 5LRMA 1ELZA 4LRCA 2ANHA 3KD8A 5EGEA 1AJBA 4UORA 2X98A 5DLWA 4UOOA 4GTXA 3M8ZA 1KHKA 1ANIA 3CMRA 1ALKA 5L0EA 4LRAA 4LR8A 3IDDA 2IUCA 3WAVA 1AUKA 4UOPA 4MHXA 4KJGA 2GSNA 5HRTA 1E3CP 1AJDA 3M8WA 1Y7AA 1KH4A 1ALJA 2W5TA 3Q3QA 5LQQA 1ALHA 4LR2A 3SZZA 3OT9A 1B8JA 3NKRA 2XRGA 4KAYA 4QAXA 3NKMA 3UO0A 5IJQA 3NKOA 5GOVA 1KH7A 3BDHA 5AJ9A 5L0KA 3MK2A 4CXKA 3UN3A 1ZEFA 1EJJA 4UPHA 1ANJA 4ZG9A 2W5SA 4KAVA 3M7VA 2W8DA 2XR9A 1O99A 1EW8A 4KJDA 1E1ZP 1HJKA 2IFYA 5DLVA 4CYRA 1EW2A 4UPLA 4CYSA 4LREA 1SHQA 4N7TA 4UPKA 4NWXA 5DLTA 1E2SP 1HQAA 4FDJA 4CXUA 1EI6A 4LQYA 5LRNA 1KHLA 1URAA 2W5RA 3IGZB 1EW9A 5TJ3A 1P49A 3TWZA 3WBHA 3BDGA 1AJCA 4GTWA 2IUCB 1N2LA 2G9YA 2ZKTA 3NKQA 4LRBA 4TN0A 5LIAA 3TX0A 4LRDA 2W5WA 3NKPA 5C66A 1ED9A 1AJAA 3T01A 3UN2A 1URBA 3WAWA 1ALIA 4NWJA 1ZEBA 5KXAA 4ZGAA 4KM4A 3A52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTY A;  3UN5 A;  3UNY A;  2W5X A;  4B56 A;  1ELX A;  1ELY A;  3T02 A;  2GSO A;  3BDG B;  1KHN A;  4ZG6 A;  1EQJ A;  2W5Q A;  4YR1 A;  2GLQ A;  1ED8 A;  1K7H A;  2D1G A;  4ZG7 A;  2W8S A;  3M8Y A;  1KH5 A;  4UPI A;  5INH A;  3NVL A;  3BDF A;  2W5V A;  4LRF A;  2RH6 A;  3B5Q A;  4MIV A;  5EGH A;  3WAY A;  3TG0 A;  2QZU A;  3NKN A;  4LR9 A;  3SZY A;  4CXS A;  5K4P A;  1N2K A;  5GRR A;  3MK1 A;  1KHJ A;  3ED4 A;  5IJS A;  3T00 A;  2VQR A;  1HDH A;  3IGY B;  3E2D A;  4FDI A;  1SHN A;  1FSU A;  2GSU A;  4LR7 A;  1E33 P;  1Y6V A;  4GTZ A;  3LXQ A;  1ZED A;  1KH9 A;  5L0B A;  3DYC A;  3MK0 A;  3WAX A;  3DPC A;  1O98 A;  4MY4 A;  2GA3 A;  5LRM A;  1ELZ A;  4LRC A;  2ANH A;  3KD8 A;  5EGE A;  1AJB A;  4UOR A;  2X98 A;  5DLW A;  4UOO A;  4GTX A;  3M8Z A;  1KHK A;  1ANI A;  3CMR A;  1ALK A;  5L0E A;  4LRA A;  4LR8 A;  3IDD A;  2IUC A;  3WAV A;  1AUK A;  4UOP A;  4MHX A;  4KJG A;  2GSN A;  5HRT A;  1E3C P;  1AJD A;  3M8W A;  1Y7A A;  1KH4 A;  1ALJ A;  2W5T A;  3Q3Q A;  5LQQ A;  1ALH A;  4LR2 A;  3SZZ A;  3OT9 A;  1B8J A;  3NKR A;  2XRG A;  4KAY A;  4QAX A;  3NKM A;  3UO0 A;  5IJQ A;  3NKO A;  5GOV A;  1KH7 A;  3BDH A;  5AJ9 A;  5L0K A;  3MK2 A;  4CXK A;  3UN3 A;  1ZEF A;  1EJJ A;  4UPH A;  1ANJ A;  4ZG9 A;  2W5S A;  4KAV A;  3M7V A;  2W8D A;  2XR9 A;  1O99 A;  1EW8 A;  4KJD A;  1E1Z P;  1HJK A;  2IFY A;  5DLV A;  4CYR A;  1EW2 A;  4UPL A;  4CYS A;  4LRE A;  1SHQ A;  4N7T A;  4UPK A;  4NWX A;  5DLT A;  1E2S P;  1HQA A;  4FDJ A;  4CXU A;  1EI6 A;  4LQY A;  5LRN A;  1KHL A;  1URA A;  2W5R A;  3IGZ B;  1EW9 A;  5TJ3 A;  1P49 A;  3TWZ A;  3WBH A;  3BDG A;  1AJC A;  4GTW A;  2IUC B;  1N2L A;  2G9Y A;  2ZKT A;  3NKQ A;  4LRB A;  4TN0 A;  5LIA A;  3TX0 A;  4LRD A;  2W5W A;  3NKP A;  5C66 A;  1ED9 A;  1AJA A;  3T01 A;  3UN2 A;  1URB A;  3WAW A;  1ALI A;  4NWJ A;  1ZEB A;  5KXA A;  4ZGA A;  4KM4 A;  3A52 A; 
#chains in the Genus database with same CATH topology
 4JP8 A;  3RZA A;  1RT5 A;  2FQQ B;  2VPY B;  2AF6 A;  2HUR A;  2WCX A;  4HDG A;  3HXM A;  1YTY A;  2QLB B;  5HRO A;  4YR2 A;  3DLL Q;  3IM9 A;  1YKW A;  4ILR A;  3VGT A;  3UCZ P;  4JV5 F;  1WEX A;  1K0V A;  3OL7 A;  5HO4 A;  3W62 A;  5IZH A;  2IBK A;  1HR0 J;  2F8H A;  5IC4 B;  4J5O A;  1VR6 A;  1WJ9 A;  2YQ1 A;  5HL7 Q;  4YY3 F;  3QGG A;  3CCR S;  4UOO A;  4KJI A;  1RT5 B;  2QSW A;  4J9P A;  2J8S A;  1E3C P;  5HRO B;  1Y9O A;  4KRW A;  2FTR A;  2DJW A;  5JUM A;  3QAU A;  5D4P A;  3LQV A;  5J1N A;  2BBE A;  4ZPT R;  1H74 A;  2XS7 A;  3D4J A;  4USI A;  2WHO A;  3QT6 A;  3U1L A;  2D3O 1;  1CVJ A;  3CJ5 A;  3N5B A;  4O3R A;  4NCB A;  1Z1Z A;  1RAJ A;  4A8S A;  5TJ3 A;  4ZIV A;  1M5V C;  2K06 A;  2LKZ A;  1E6V B;  4MTP A;  3A3N B;  1IXK A;  5D0H A;  5KFF A;  3HVA A;  2J0X A;  1MU2 B;  4HKQ A;  1AJA A;  4BC9 A;  2ROE A;  1JXV A;  3BGR B;  1IQT A;  1U47 A;  1DFD A;  1U8S A;  2JLE A;  1WSR A;  2M8H A;  1S48 A;  2AU0 A;  4QYZ J;  3OVA A;  1SJ1 A;  2MHE A;  1TZ0 A;  5B0G A;  3K5O A;  1UFK A;  3D0H E;  2GSU A;  1A6L A;  3IWL A;  2CRL A;  1J5O B;  3WAX A;  2FHK A;  3DPC A;  1NDP A;  3PW7 A;  1UP1 A;  1X60 A;  4GKJ F;  4IOC Q;  1EQ0 A;  2L3M A;  1LKZ A;  1CQM A;  3H5Y A;  4F4W A;  3G82 B;  4WYL A;  3NG8 A;  3FEY B;  1S0M A;  2X7I A;  4UOF A;  2HWT A;  1VQ9 S;  5KFG A;  3G9C A;  1QJH A;  2RVJ A;  3GV5 B;  3HZE A;  4EFA C;  2W8D A;  1KQS R;  4KJD A;  3PZP A;  2DIU A;  2ABY A;  2R4F A;  1SJQ A;  4Z7Y A;  2FHM A;  2ZUA A;  4OYO A;  2VA2 A;  2UVW A;  1L3K A;  3M4X A;  2FVS A;  1TP7 A;  1IKX A;  2KM8 B;  4QJV A;  1NME B;  2CPH A;  3R6G B;  1UJ5 A;  3CD0 A;  3MAQ A;  2LQ5 A;  2R7W A;  3HHE A;  2D1G A;  1T05 B;  3IWN C;  2VON A;  2KFN A;  3W65 A;  5GAH I;  1RAH B;  2H9Z A;  4LF5 J;  4DN9 A;  4NLQ A;  1H6K X;  3TQ1 A;  3MXH P;  3D0I E;  2ZZN A;  4ED0 A;  5AE1 A;  1GH8 A;  1IKX B;  4R0J A;  1UVN A;  3K7R A;  4FF2 A;  2MQM A;  1BWE A;  1CJT A;  1J27 A;  2KZM A;  1SUQ A;  1SL1 A;  1S4F A;  2DGO A;  4ZVH A;  2BJ7 A;  3AXM A;  1Q8L A;  3RW7 A;  4FP9 A;  2XQC A;  2MQP A;  1AFJ A;  1PIE A;  3SSR A;  3LH2 S;  1VBK A;  3MM6 A;  1L3S A;  2C28 A;  4CO2 A;  4X65 J;  3AJD A;  4LFB J;  2IM2 A;  4A46 A;  1SJ3 P;  1GFW B;  1M1G A;  3OD2 A;  5KFC A;  4A8Q A;  2FVQ A;  4LRD A;  3T01 A;  3LP2 B;  1PYS B;  3MM9 A;  3W5X A;  4XPC A;  2W2P P;  5I3U A;  3MR7 A;  3VAI A;  4PQU B;  3MMA B;  4M5M A;  1RCX B;  1HNX J;  3TZW A;  4ED6 A;  2BX6 A;  2HRU A;  2QZ8 A;  1WAC A;  1HPZ B;  1YI2 S;  3M1V B;  2V2Q A;  2DNG A;  3GMG A;  2J9C A;  3W9I A;  2FLN A;  1H0H B;  3EWG A;  4DV0 F;  1JLA A;  3F0N A;  1FJG J;  5J1E A;  3NOC A;  1LFP A;  1TFW A;  2F7V A;  5HMW A;  4ZVR B;  3VWS A;  5EN1 A;  1V9O A;  5J2M B;  4OYX A;  4TYB A;  3RRH A;  2OPP A;  3LA0 A;  4OZL A;  3ZTO A;  4ELV A;  4FYV B;  4X62 F;  1QD1 A;  1YK9 A;  4OI4 A;  1VLY A;  2IC3 A;  1CQN A;  4DI6 A;  1VRT A;  1BQM B;  4CP5 A;  1JKH B;  4K8R A;  3DOM A;  1Q5V A;  5IM0 A;  5LL6 d;  1S97 A;  1YJW S;  5C2G A;  2KVI A;  3DRR B;  2QYC A;  2O1P A;  4MT1 A;  2ZBP A;  2ZHO A;  3FMW A;  2VL1 A;  4NAS A;  5GAG I;  1Q5Y A;  1S79 A;  4JV1 A;  4BWJ A;  1QTM A;  2CQ2 A;  2PFD A;  1N36 F;  3CMR A;  4KIA A;  1VRT B;  3SQG A;  3UCU P;  4U7U D;  2ZC3 A;  2OPS A;  4B3M J;  3MEE A;  4QWA A;  3NCR A;  2DBB A;  3DOK A;  4CNZ A;  2MST A;  1VQ6 S;  2W8L A;  5KOW A;  4R8U B;  1PGZ A;  4JI4 F;  4RW8 A;  2L08 A;  1X4G A;  3FUY A;  2E5L J;  4N56 A;  4K4U A;  4ZJL A;  3RBZ A;  5LMN J;  4WZM A;  2R7Q A;  2G9Y A;  2CPY A;  3PKY A;  3VHQ A;  3A52 A;  3DOK B;  4QBU A;  2DD8 S;  2XC9 A;  5KT4 A;  3OVB A;  1WTF A;  3OJU A;  4I0W A;  4WF9 Q;  4KGZ B;  2Q1L A;  1PYO B;  3HFZ B;  4IDK B;  2BE2 A;  3BSA A;  3EDR B;  4HTJ A;  3RAM A;  1QDU B;  1FCA A;  4OYI A;  4KSE B;  2OKQ A;  3K2Y A;  2CFX A;  1U24 A;  3B78 A;  2HFS A;  4JI5 F;  5L0B A;  1LK5 A;  3L7P A;  1S1U A;  3I0R A;  1HNZ J;  3K5P A;  3FSX A;  1KFS A;  4PG5 A;  1U26 A;  1UFL A;  2QO3 A;  3CPW R;  1D3W A;  3WC2 A;  2W4C A;  3BKU A;  2LDI A;  1B0P A;  1WF2 A;  4JI1 F;  5DDO C;  4DPO A;  1UZD A;  3D6M B;  3M7V A;  1EAY C;  1WOO A;  4J9L A;  3H2U B;  3GCX P;  3UD4 P;  3CB4 A;  3MED A;  4M5J A;  4G3I A;  2BV3 A;  2YPZ A;  1OYD A;  3X3U A;  5ITH A;  1KRP A;  4PAA A;  1SJF A;  2GJF A;  5GVQ A;  4U7C A;  1WEZ A;  4ZCM A;  4FNI A;  2XMV A;  4Y00 A;  3I87 A;  3H5U A;  5EGH A;  1HBN A;  2DTJ A;  1M5P C;  2HAI A;  5K4P A;  1RWW B;  4UUW A;  3MWB A;  1D8Z A;  5F8M A;  2YWF A;  4I4B A;  2RRA A;  4DV3 J;  5A2Q U;  5A8K A;  4I6W A;  1DQ9 A;  4B3S F;  1GXT A;  3OSP A;  2EG1 A;  5GAE U;  4ED7 A;  4M5D A;  1U8W A;  2HNZ B;  4EGL A;  3OV7 A;  5HJX A;  1KH7 A;  1HQU A;  4ZG9 A;  4QCL A;  1FRM A;  2Y1I A;  2IFY A;  1AFI A;  2ZD1 A;  3R1H A;  3BRE A;  4LF9 J;  4CXU A;  2MDA A;  1XBW A;  5M2U A;  1EHW A;  1N2L A;  4LRB A;  3PXG a;  3W61 A;  1OYE A;  2OEL A;  2CG8 A;  2RML A;  1JIH A;  2MKI A;  3PRD A;  4NA3 A;  1Q86 T;  1P1L A;  1HQU B;  3KLF A;  5K14 A;  2DNH A;  2MHN A;  3ETO A;  3K8W A;  3PW0 A;  4H4K C;  3HDS A;  2CJK A;  1T0T V;  2V8G A;  1NHK L;  3M8Q A;  1O6X A;  4C8M A;  1NKC A;  3B82 A;  3A8K A;  1FWP A;  1Y6V A;  5F8H A;  1XC9 A;  3PRV A;  3R7S B;  4WII A;  5HSP A;  1DRZ A;  3P3D A;  4O23 A;  4OX9 F;  1XER A;  3KLF B;  3DRS B;  2JHE A;  3NY0 A;  2UXB J;  3H8Y A;  1N33 F;  1JLQ A;  4M5G A;  4LR2 A;  5D6G A;  1WKK A;  1TL1 A;  1X0F A;  1SC3 B;  1HHT P;  3UCG A;  3M8Q B;  2V5H G;  1R31 A;  1HI1 A;  1B0V A;  4CTA B;  3HZG A;  3DYA A;  1EW8 A;  4ZCI A;  4FXW A;  4FVM A;  1A7G E;  1LWC B;  2ZE2 A;  2Z8Q A;  1G6B A;  3TO8 A;  4OV6 A;  2XY5 A;  3L7O A;  3US5 A;  1ZA2 B;  4CLZ A;  1WC3 A;  3N5F A;  1NSK L;  4M8L A;  3FJ2 A;  2COL A;  3HHL C;  3I4P A;  3PX6 A;  2EFG A;  3R7B B;  3WHI A;  5CZX A;  4DV7 F;  2H5J B;  2C2N A;  1RT2 A;  1YIT S;  1H2V Z;  4LJM A;  4OYW A;  1VQ4 S;  1ULR A;  1Y5L B;  3CIM A;  1O5J A;  4FDI A;  1RLD A;  3BKF A;  1Q79 A;  2XHW A;  4DQP A;  2CQI A;  2CVE A;  1RT1 A;  2Z58 B;  3ZZO A;  1T7P A;  1FF2 A;  3NWR A;  2DNN A;  1RT2 B;  2MZR A;  4IH6 A;  1KQK A;  4YME A;  5A2Q Y;  2DGW A;  3VAK A;  2IJR A;  5F3Z A;  2HWH A;  3NLC A;  1LW2 B;  4Y2M A;  2OJ3 A;  4KV8 B;  4NLW A;  3Q8V A;  2DHX A;  2W7P A;  1EJ7 L;  2WW8 A;  3PYD A;  1W7W A;  1HHQ A;  3TEG A;  7AT1 B;  2FGC A;  3R5J B;  3TVZ A;  1ZM9 A;  2R8K A;  2ADB A;  4NYZ A;  3CDW A;  4K7Q A;  1NB2 A;  5FLX Y;  3ZO7 A;  4LSL B;  3LPE A;  2Y9H A;  5D0G A;  5L39 A;  3JYT A;  4ANE A;  2AT1 B;  3G86 A;  1FFS B;  1CBK A;  1HLW A;  3BDF A;  4K0K F;  2AJ1 A;  3AXK A;  2ZKU A;  1RWO B;  3G87 A;  4DQI A;  4TQR A;  4CYU A;  4ANC A;  1I3O B;  4YB7 A;  5IT4 A;  5DDR C;  2DXD A;  3KMS A;  2ZOG A;  2WON A;  3BM7 A;  2D7S A;  3IO1 A;  3OR2 B;  1U1N A;  2KB2 A;  4Q44 A;  4A8Y A;  3DLK A;  2XYP B;  1WI8 A;  2LVW A;  1XR7 A;  1ALJ A;  5H9F J;  2BYC A;  2KL8 A;  3NKR A;  4L73 A;  5D78 A;  1SL0 A;  4CYU B;  2JSX A;  4UZC A;  1TK0 A;  3OL8 A;  2CUY A;  5KFM A;  2WON B;  5D8H B;  3PR5 B;  3T41 A;  2CKW A;  4C8Z A;  1J5E F;  1V6H A;  4OZ1 A;  2OIH A;  3EZ5 A;  1PJ5 A;  1YWX A;  3HUL A;  1M1K T;  3VAG A;  2V8D A;  1CS4 A;  4HEA 9;  1FHT A;  2BA9 A;  1F5A A;  5CXT A;  2QZU A;  1TKD A;  2ZH2 A;  4W4M A;  2BE9 B;  4P2M A;  1RA6 A;  4NLT A;  3GFY A;  4HHH A;  1O0P A;  1UJ4 A;  4ECU A;  2I6W A;  3EUN A;  4AUK A;  5IFM A;  4JOU A;  2Q6C A;  1YRT A;  3L3C A;  2XSJ A;  1CS4 B;  2J76 E;  4Y2C A;  3SBM A;  1JLF B;  3CJR A;  4X4T A;  4QW8 A;  1ZYQ A;  1FRK A;  5C24 A;  2HQ3 A;  2AEM A;  2YQ3 A;  2LMI A;  2Q79 A;  4ZN1 A;  1NDK A;  1M5K C;  4NYO A;  2F1F A;  3QT7 A;  3DHW C;  1FKO A;  3WAW A;  1TL3 A;  2K7J A;  3I6P A;  4DR2 J;  4CNY A;  2X1A A;  8RUC A;  1JX4 A;  1CJK A;  4F0H A;  3QYY A;  4ZP7 A;  1EQJ A;  1R3N A;  1R7I A;  2W8S A;  4C98 A;  5C24 B;  4GKK F;  2VKZ G;  2R7T A;  1AUD A;  2GQ2 A;  4FYX B;  1N88 A;  3GFX A;  3SZ2 A;  2R2S A;  3GG1 A;  2BRL A;  3ED4 A;  4PEO A;  3IBF B;  2XSF A;  2ZVI A;  2GHV C;  2RU3 A;  3UR0 A;  4KTQ A;  1FKO B;  5HBM A;  2AQ4 A;  2GCF A;  2VJU A;  2C22 A;  3HSJ A;  2GQC A;  5IV3 A;  3EXC X;  3PW5 A;  1FVS A;  2MGZ A;  4O44 A;  4ZN3 A;  3S1T A;  3Q3Q A;  2C42 A;  3OXG A;  4EI2 A;  3JQJ A;  5ETO A;  2BZ2 A;  3PTW A;  1RHR B;  4URG A;  2B9E A;  4O4G A;  3GIJ A;  2LCW A;  2VQF F;  3SEO A;  2AEF A;  5HBM B;  4LQ9 A;  4PG7 A;  5A6P A;  4MYT A;  2E5I A;  4G6V B;  4HLB A;  1XTZ A;  2E9R X;  3IA0 A;  1QTN B;  4P71 A;  3G4S S;  4RWW A;  1BQN A;  3BB5 A;  2M52 A;  2ZJP Q;  1K8A T;  4JI3 J;  4Q8F A;  1HYS B;  3C19 A;  2W5Q A;  3CF5 Q;  5CCM A;  3D7S B;  1SJ4 P;  1WOR A;  6FD1 A;  3KG4 A;  2RH6 A;  3QJL A;  4PUO A;  2G0I A;  2XI2 A;  2IM1 A;  2HHT A;  1AXQ A;  4G1Q A;  2EI5 A;  4ES3 A;  5EGE A;  4CH7 A;  5J2Q A;  5AXN A;  2DGX A;  2DNK A;  3MCM A;  1GX5 A;  4ECT A;  3CIZ A;  2HHV A;  3TUI C;  4DQR A;  3FFI B;  3GG0 A;  2ZH8 A;  3M2V B;  1FFW B;  1NHU A;  3J81 j;  4RWX A;  4IH7 A;  2MZJ A;  1F2H A;  2CJA A;  4DV6 J;  4WP8 A;  2JJ4 D;  3V6J A;  4P2S A;  4WBF A;  2VH7 A;  3WDO A;  4CYR A;  4CO3 A;  1QAY A;  2XI3 A;  5KT7 A;  5D4O A;  5D0R A;  2Y1L B;  2ZBR A;  4FZV A;  1Q82 T;  1N34 F;  3FEX B;  2G9O A;  1TR0 A;  2B4P A;  4USM A;  3AAW B;  4Y0F A;  2GHW A;  3PIO Q;  1OPZ A;  2VIC A;  2YKM B;  1A9N B;  4DR1 F;  2WBM A;  1UTA A;  3OFF A;  2PN6 A;  1VRU A;  1X9S A;  2A2D A;  3GJR B;  3AQO A;  4PKD B;  4PWU A;  1S99 A;  2HKE A;  3D9B A;  3QQC D;  3ULH A;  2DR7 A;  5KAK A;  2HND A;  1GK8 A;  1HIY A;  3CDE A;  4NZ7 A;  3BR9 A;  3VQS A;  4C11 B;  1RAF B;  2I1R A;  2K3K A;  4ZLL A;  4AYB D;  4YDD B;  4FYW B;  4J7C A;  1WF0 A;  1KOH A;  3TW0 A;  5SUH A;  4BDP A;  1PBA A;  2ASJ A;  2FZK B;  1VRU B;  2RQ4 A;  1F1B B;  3D3B J;  3IS9 A;  1FK9 A;  3TRG A;  3V6K A;  4NLU A;  5LSO A;  5FII A;  4IOB A;  2V63 A;  3D66 A;  2A10 A;  2IRU A;  4RUH A;  4FPI A;  2R2T A;  4LFC J;  5KT5 A;  1IBM J;  1HQA A;  1IN0 A;  1EI6 A;  2FLL A;  2BE7 D;  1IBK F;  3BN4 A;  3CGI A;  1WWH A;  5DG8 A;  2A6O A;  1UAW A;  2F63 A;  1S9E A;  2NZC A;  1T03 A;  3W9H A;  1XMO F;  2O66 A;  3IS9 B;  2X3G A;  4R5P B;  1Q7Y T;  2ZZT A;  2VBY A;  1LWF A;  2F9J A;  4HI1 A;  3T1Y J;  4M5L A;  3HM9 A;  4AXI A;  3BPS P;  3HO1 A;  4QU6 A;  3RBE A;  3KKF A;  2OPQ B;  1G4C A;  2JL9 A;  4RBT A;  1S9E B;  1T03 B;  2XMT A;  4KR0 B;  2I9S A;  2EFN A;  1VLO A;  1ZS6 A;  1SH3 A;  2RHS B;  1SKW A;  1ALK A;  3GTY X;  4F36 A;  1DLO A;  3WAV A;  2U1A A;  3GIL A;  2YY3 A;  2I2Y A;  5HJY A;  3CCL S;  2E1R A;  2ZEJ A;  3MFH A;  3KLV A;  4JI7 F;  3NKM A;  2XLK A;  4NCA A;  4WFY A;  3EX7 B;  3CO9 A;  5T7L B;  2GO8 A;  4TU7 A;  2FVP A;  4NEY A;  1FRJ A;  1RLC L;  1E1Z P;  3QGH A;  3J7Z 5;  2MB0 B;  4X62 J;  1TL7 A;  3MMJ A;  4X4N A;  3V6D A;  2PEH A;  1JLE B;  2LQB A;  4MK9 A;  2NS1 B;  4TLR A;  2QRR A;  3Q24 A;  4U6P A;  3EYZ A;  3SCI E;  4P52 A;  4XIU A;  1OQ3 A;  3BDG B;  4DFK A;  4FS1 A;  4G1P A;  4BBY A;  2GS8 A;  3QT5 A;  3M2U B;  5IS2 A;  2HYI B;  3BF4 A;  1CJV A;  1YBA A;  2KJV A;  4HH1 A;  5F41 A;  3ZZZ A;  1N36 J;  3V6D B;  2OEM A;  3D1H A;  5T41 A;  1MW7 A;  1FRI A;  2RF2 A;  1WC4 A;  4I67 A;  2AIR B;  2ANH A;  3ZTR A;  4QR2 A;  5H1S V;  5E2Q A;  3OTE A;  3TOQ A;  4B9U A;  4LF8 J;  2EBE A;  4JI6 F;  4C8K A;  4UY8 5;  3BEG B;  2B8P A;  3Q2S C;  3UN3 A;  1OQ6 A;  3MDF A;  2WVC A;  1FWK A;  2RF2 B;  4F2R A;  2V4J B;  4X66 F;  1FEH A;  2VFT A;  2ROG A;  4Q45 A;  4WK1 A;  5A8R B;  4JI8 J;  4DSF A;  2V94 A;  2E29 A;  4X4P A;  1VC6 A;  1RTI A;  1XEZ A;  2B6A B;  1WNE A;  2DIT A;  3H2V E;  3QO9 B;  4I2P B;  4H4K A;  2LA4 A;  4Q43 A;  4WFB Q;  2OPR B;  2CQ3 A;  4X84 A;  3JTN A;  1FVQ A;  1U1P A;  4JI5 J;  3A1Y G;  3LAK A;  4MIV A;  5DM6 Q;  3R9L A;  5KG3 A;  3T5L A;  5HK4 A;  3KWM A;  3ILI A;  1U1Q A;  4DZD A;  4KFB A;  3M8S A;  2RRB A;  1QE1 B;  3BQ0 A;  2XG8 A;  4DR7 F;  1CG2 A;  3PG9 A;  4N5S A;  1M5S A;  4C97 A;  1Y4Z B;  4KE5 A;  2EPI A;  2Z4P A;  5A8W A;  2XYG B;  4JI1 J;  4H54 A;  1CSJ A;  4DSK A;  3E2E A;  3BSC A;  1KH4 A;  2HHH J;  3BSN A;  4DR5 F;  3MFI A;  1YLX A;  4DPT A;  3NNA A;  4DV1 F;  1WHY A;  3PW2 A;  2P9E A;  4RUB A;  2ZDO A;  3PEJ A;  4C7Q A;  3GR0 A;  4OZ5 A;  2R3V A;  3G8S A;  2VC0 A;  2A1B A;  2XMW A;  1S6Q B;  2WK4 A;  3HHL A;  5BJR A;  3R2D J;  2G13 A;  2IDL A;  1NKB A;  5A8W B;  5G0R A;  4GTW A;  2DHS A;  2H1Y A;  4OI2 A;  3DXS X;  3OPK A;  3AD9 C;  3Q23 A;  4NEZ A;  2CPI A;  3CJQ A;  3QZ7 A;  3T02 A;  3MPY A;  4OZN A;  3V6H A;  2BVZ A;  4KB7 A;  2AGQ A;  2O5D A;  3PIP Q;  3TQE A;  4LRF A;  3W3S A;  3GPA A;  1EP4 B;  1OY8 A;  3MM7 A;  4ZHR A;  2HVI A;  3D67 A;  2PFF B;  3GP9 A;  4DSL A;  1UEV A;  4O3Q A;  1ZA1 B;  2IMW P;  3ET6 A;  2ZJR Q;  3R97 A;  4MKV A;  2X98 A;  1S10 A;  2MLY A;  3LP0 A;  3SV3 A;  2E9Z A;  3ADA C;  1YRU A;  2Q3P A;  1VBY A;  3NNC A;  3T1H J;  4G65 A;  1RKJ A;  4DR4 F;  5ADZ A;  4N8N A;  1UFW A;  3HHL D;  3FZB A;  3Q8Q B;  2EFO A;  4M5K A;  2K7K A;  1U45 A;  3SSQ A;  4KHP F;  2GVD A;  2JLG A;  4ELU A;  2QMX A;  1S1T A;  1D8Y A;  3ET6 B;  3O44 A;  2OO4 A;  4M63 A;  5KFD A;  5K8O A;  5AXL A;  3GE9 A;  1IKY B;  3Q8U A;  1AJC A;  4TY8 A;  4ZLN A;  2QFJ A;  1XMB A;  3L9Z A;  1MWZ A;  2WSF C;  2HEK A;  1MSW D;  4LF4 F;  3CWJ A;  5KFU A;  1HNW F;  2BDP A;  2GVD B;  1HW8 A;  3BGF A;  2AV5 A;  4ZMM A;  3OXL A;  1OY6 A;  1RE1 B;  2BKN A;  2HIQ A;  4GO7 X;  5AJ3 J;  4GVB B;  5D3G B;  4C8L A;  4TY8 B;  5ETM A;  3H0P A;  2XO6 A;  3RU0 A;  1C1C B;  3MR3 A;  2ASL A;  2QX0 A;  3P8B B;  2G1H A;  4QQB A;  1LV5 A;  1S6P B;  4ED1 A;  4HHU A;  5BR8 F;  4F50 A;  4WCE Q;  1FNM A;  1Z2Z A;  4ES2 A;  3ITH A;  2XS2 A;  3WX8 A;  1G3O A;  4AE5 A;  3T9N A;  4DV5 J;  2NRE A;  4CDI A;  2W5R A;  1EW9 A;  5J2P B;  3DI6 B;  4JYA J;  4U9R A;  4TN0 A;  1D9A A;  3FMB A;  1MML A;  1NSA A;  2HGN A;  3M2R A;  3MM8 B;  2FLP A;  2QT7 A;  3FCV A;  1RHK B;  2V8H A;  2R8G A;  4N8O A;  2E7W A;  2U2F A;  3FBE A;  3IM8 A;  5DO2 A;  3MR6 A;  4DPY A;  1RDR A;  4QYR A;  4Z7C A;  4HI2 A;  1KP6 A;  4I69 A;  1M5H A;  3DGV A;  3DLG A;  2IY5 B;  5G4D A;  4LMZ A;  2DGV A;  3Q86 A;  5F8G A;  3BBC A;  4RNF A;  1HMV B;  2VOD A;  1NK9 A;  4LUB A;  4CLU A;  1LOU A;  1YJN S;  3CCT A;  4LRC A;  5I42 A;  3M2R B;  2OP5 A;  2QSF A;  1Y11 A;  1R6V A;  2J7W A;  3J80 U;  3HT0 A;  4WKY A;  2IAJ A;  2N7C A;  1WHV A;  3A8J A;  5EWF A;  1FE4 A;  2Q6B A;  2YNG A;  2P5V A;  4I7F A;  3QIP B;  2UV8 G;  5HMY A;  3DLG B;  3W2V A;  4YOE A;  3BDH A;  2CNN B;  3KK3 A;  2W9B A;  1Q95 G;  2XNQ A;  2MJU A;  4LRE A;  5K9F A;  4LF7 F;  4Y34 A;  2E5J A;  5CD4 H;  1HNV B;  2BQ3 A;  4L76 A;  3TX0 A;  2BRK A;  4A8M P;  2RUG A;  1Q0N A;  3DKD A;  2GHP A;  4H4M B;  1KDN A;  4K0K J;  5LT5 A;  1ELY A;  5ETK A;  4DBQ A;  4ZIW A;  3CJ2 A;  4DWI A;  3KK3 B;  5ETL A;  2RKI A;  4Y2K A;  2V8V A;  2MYF A;  4PG8 A;  2NPF A;  1JNR B;  5KFV A;  5C42 A;  1J2V A;  2CNK B;  4DCP B;  2PDA A;  1RCO B;  4OMF G;  3H5S A;  4IYQ A;  4XDC A;  1CC8 A;  1O51 A;  3TAM B;  2MKJ A;  3Q8S B;  3U1N A;  2HGL A;  1FDB A;  3PR4 A;  3H20 A;  5BYS A;  2GVZ B;  3HSD A;  2AKW B;  1N5Y A;  2RQK A;  2A3J A;  4DX7 A;  3SZZ A;  3H98 A;  3DU5 A;  4AFF A;  3AT1 B;  2XWX A;  1RHQ B;  2OFG X;  1S1X A;  4OYP A;  5KFW A;  2EEY A;  5DDQ C;  2CJQ A;  4B9S A;  1RBL A;  5KFI A;  4DF4 A;  4ZVF A;  3WIU A;  2AWZ A;  1T9X A;  2IA0 A;  3ENV A;  3KOA A;  4NE9 C;  1N5Y B;  1L5U A;  1R8H A;  3T3F A;  1UPM B;  1B99 A;  4MKB A;  3D1O A;  2KRR A;  2A2C A;  1VBZ A;  2JEI A;  4HT7 A;  2P9C A;  2O67 A;  5BYR A;  3VAH A;  1QAI A;  2HRY A;  4ZJO A;  4KAI A;  3QRQ A;  1KWM A;  2KXH A;  3SZY A;  2VF3 A;  4LF6 F;  1RWM B;  4XK8 C;  2BKP A;  1SBR A;  2HHS A;  4PWD A;  5CYQ A;  4EMD A;  2HK2 A;  4UQG A;  3MAA A;  2MZQ A;  4K4Z A;  2QTW A;  5LM7 E;  1F5C A;  4USH A;  5B0C A;  4M94 A;  4DU8 A;  1DBD A;  2AZ3 A;  3M6X A;  2RU9 A;  4K4W A;  4DLE A;  3F56 A;  4W98 A;  2G2Z A;  2WW4 A;  3CCM S;  2QL7 B;  3I32 A;  3ILL A;  2XMJ A;  3NBP B;  1PJ7 A;  2ZH7 A;  1B4S A;  1X5P A;  5KFS A;  3J80 Y;  4ECQ A;  1UWB A;  2RRN A;  4NXM F;  1LWE B;  4K2X A;  3GIK A;  4J9M A;  2HNY A;  4WIQ A;  2C2R A;  4B17 A;  1GTE A;  2WVE A;  5I3Q A;  1REG X;  3T5J A;  4DZ6 A;  2DH7 A;  3MF5 A;  3L09 A;  4CI0 B;  4O0I A;  4C4W A;  1U02 A;  1R43 A;  4LF2 A;  5HI7 A;  1KNZ A;  2BW7 A;  4RL1 A;  2W01 A;  4C48 A;  1IKV A;  1V5V A;  5KFA A;  3P45 B;  1TKZ A;  2CVI A;  2J6T A;  4J91 A;  2HNY B;  4CXS A;  1T9T A;  1RYS A;  3IBW A;  5MLC V;  3CD6 S;  5E3P A;  4FS2 A;  2PD1 A;  2PII A;  4B9T A;  1IJF B;  4ED3 A;  1KVI A;  3FK4 A;  1URN A;  4RBU A;  1HBO B;  2NYH A;  2QMW A;  4ALZ A;  2MKY A;  4ENO A;  4IKA A;  1AJD A;  3HPO A;  3QT8 A;  3U02 A;  5C25 B;  4DUZ J;  3I82 A;  4WFZ A;  3ETM A;  1TKZ B;  3GFH A;  2VQF J;  1MNE A;  4WE1 A;  1P9Y A;  3TAP A;  3KHL A;  1VGY A;  5DET A;  5EUH A;  1U0S A;  3CDB A;  2MQ8 A;  4I64 A;  1KKH A;  5J2N A;  1X31 C;  1CJU A;  3AQP A;  1KTQ A;  2V9W A;  4QWC A;  4AD6 A;  4OJ3 A;  1U1R A;  4KPY A;  4IG0 A;  3KK1 A;  3G6E S;  3QSY B;  3PO4 A;  4QIG A;  3JTO A;  4USK A;  3A8I A;  1K7H A;  1IBC B;  2IVM A;  1HAR A;  4WU2 A;  4CLY A;  4DSE A;  2WVB A;  3NMA A;  3M8P A;  1FJE B;  2F4V J;  2QA4 S;  2F9D A;  1ZAV A;  1SIW B;  2VHG A;  4NOH A;  1CJU B;  2CPD A;  2L41 A;  5KG6 A;  4UOR A;  4IG0 B;  2LP4 A;  4L6V 3;  4NYP A;  5IV4 A;  3KJV B;  2RNE A;  2KFY A;  2GW8 A;  2DR6 A;  2DY1 A;  4P72 A;  2PT0 A;  1GAO A;  4L75 A;  3OLB A;  1NK4 A;  2H4W B;  5B08 A;  4XAK A;  2AGP A;  1H38 A;  1LEO A;  3FQL A;  1EW2 A;  3MAH A;  1XNR J;  1REV A;  3V4M A;  3V4I A;  1P9Q C;  4DR1 J;  3J7Y I;  3CSK A;  3MOZ A;  2NXE A;  3NKQ A;  2GJ2 A;  4NXN J;  4YEA A;  5C66 A;  2F3J A;  2MLZ A;  3DNC A;  5U47 A;  1VHF A;  4EUV A;  3DRX A;  3AJ2 A;  3DM2 B;  3GYX B;  2FY8 A;  2RE1 A;  2HQF A;  3ZZT A;  4M5I A;  1UVM A;  1T94 A;  4ITS A;  1RAC B;  2HQG A;  3RR8 A;  4HR2 A;  2GNK A;  2BOA A;  4WXO A;  2VFR A;  1DUR A;  3V4I B;  2UU9 F;  1HBM A;  3CDA A;  3OR1 A;  3JTP A;  1VC0 A;  2IDE A;  4P6Q A;  5FDL B;  2SXL A;  2PMW A;  2PA8 D;  3Q83 A;  1S9G B;  5LSL A;  2KG1 A;  3MI7 X;  2IA6 A;  2EK1 A;  5KFY A;  3MM5 B;  2DEJ A;  2DR8 A;  2J0Q D;  3Q8P B;  2R2U A;  3HVW A;  2YQ0 A;  4PWW A;  2FHJ A;  3BH6 B;  3W8P A;  2NSC A;  5HP1 B;  4KO0 B;  5AJ9 A;  4UTG A;  5GME A;  1D1U A;  1RTJ B;  4AL6 A;  4FF1 A;  2HVH A;  4RBV A;  4UPH A;  2DNZ A;  3I5A A;  2DH9 A;  4EBE A;  2JDJ A;  5IXU A;  4FDJ A;  3RGI A;  3NS7 B;  1YGY A;  3WBH A;  1MMN A;  2BAN A;  3CTR A;  3CC2 S;  1KQG B;  3EGN A;  5IT0 A;  4F25 A;  2HVE A;  3D28 A;  2W9C B;  4BLG A;  4O3O A;  2C3Y A;  5DM7 Q;  3BZQ A;  2M3D A;  4UQT A;  4LIW A;  4WJB A;  4EWT A;  3GR1 A;  2XGP A;  3ZZ0 A;  3E2D A;  2FHJ D;  2BAN B;  2C2K B;  3VZH A;  1LW0 B;  1FER A;  3CCU S;  1S1W B;  3MEG A;  4I68 A;  4USW A;  1RSC A;  1GEH A;  2LDY A;  3PYF A;  2DNO A;  2EKY A;  1F3V A;  3NCP A;  3CC4 S;  2YNH B;  1S5Z A;  1C2P A;  2JH3 A;  1OMS A;  4F67 A;  3LWL A;  3IC1 A;  2QJ3 A;  4OZ0 A;  1JLC A;  1F60 B;  1VOM A;  1YG0 A;  4OZ3 A;  2RIJ A;  1YJV A;  2YX4 A;  1KQF B;  2B7B B;  4DL2 A;  1NJW A;  3FNN A;  3KLH B;  1NKE A;  4M1K A;  2J9D E;  2VUG A;  3TI0 A;  4ZPW R;  3M30 B;  1PBU A;  1XQI A;  4B3T F;  4LF1 A;  1HL6 A;  1XMQ F;  5JXS A;  2GC8 A;  2FY1 A;  2YX1 A;  3D3C J;  3O2I A;  1NEE A;  2X1G A;  3M8Z A;  3QJP A;  3KTQ A;  1SJR A;  4LBI A;  3UDC A;  1YIJ S;  1QM9 A;  2AGO A;  2AX0 A;  3CMA S;  2Y0S D;  1IUJ A;  2ZHA A;  1TAQ A;  1NK0 A;  4PR6 A;  2VD3 A;  4MIA A;  1WOS A;  3C6U A;  3NNH A;  4PQA A;  4KY3 A;  2Y1J A;  1HR0 F;  2QL5 B;  3QLH A;  1YJT A;  4X64 F;  5E41 A;  2OD6 A;  4FN5 A;  2RUS A;  4FDF A;  1RHM B;  1JJ4 A;  1U09 A;  4IRK A;  1HWK A;  3PJX A;  1NU4 A;  3GON A;  5IWA J;  2ZBQ A;  1UEK A;  2UUA F;  4K4V A;  3KHG A;  4F3Q A;  3KXD A;  2C2E A;  5L9X A;  2HAF A;  4PXB A;  3IAS 9;  4ZG6 A;  2OSQ A;  3C6U B;  2RSQ A;  5IT9 U;  4RW9 B;  3LP1 A;  2V68 A;  2B5J B;  2OMO A;  1UZH A;  2UP1 A;  1PSD A;  4YHH J;  4CH0 S;  4ZOS A;  2E5H A;  2OFH X;  3K5M A;  1YDL A;  5DQG A;  1RB0 A;  2KFZ A;  1NDC A;  4ATN A;  1F2G A;  4DR5 J;  4ED5 A;  3THT A;  2XB2 D;  2VQE F;  1DTQ A;  2QL9 B;  4OX7 A;  2FB0 A;  3QFW A;  1G1X A;  2BW2 A;  3HT3 A;  2MKK A;  4F3O A;  3LP1 B;  4OHY A;  4V19 X;  5AT1 B;  1KR4 A;  1FNO A;  2QE5 A;  4GRS A;  2E66 A;  3AB2 B;  2XS5 A;  3SCL E;  5KT6 A;  4OHX A;  1VC5 A;  2B51 A;  2HMI A;  4DJB A;  3MMC A;  2ZDP A;  4UUX A;  1SC6 A;  2R8J A;  1QSY A;  4P2X A;  3U7J A;  2RDD A;  2MZS A;  2DNM A;  2LXI A;  1IKW A;  2I5J A;  4K4X A;  5DGB A;  2HFO A;  3TNV A;  4U8V A;  1H72 C;  3TWZ A;  4B3R J;  3LPY A;  2HZA A;  1SCJ B;  1RYR A;  3ENQ A;  3Q8R B;  3OVS A;  2B0G A;  4LBH A;  2R7V A;  4UW2 A;  4F7V A;  2YKN A;  1KHN A;  1Y3K A;  5L9N A;  2UUC F;  1C1B A;  3MMC B;  3OHA A;  4C8O A;  1QSL A;  2BM1 A;  1L3V A;  1AUS L;  4FF4 A;  1JMT A;  1VIO A;  3MPD A;  3RAQ A;  3AFG A;  1FRL A;  3MMB A;  4YUD A;  2Y8W A;  1F3F A;  1ELO A;  3RG6 A;  2VDH A;  3UI3 A;  3J7A N;  1TKT A;  2YNI A;  2O3D A;  2R7O A;  1OIA A;  3CT9 A;  3KG0 A;  2QLJ B;  2CPF A;  4DR6 J;  4LF5 F;  2KYZ A;  2FJA B;  4CIO A;  1B0T A;  4TYA A;  3C6T A;  1KHV A;  4BWM A;  2WVD A;  3I0S A;  1NM2 A;  2KVQ E;  3G96 A;  4LQY A;  2QN6 B;  2DO0 A;  4DQS A;  3MPW A;  3MTK A;  5CA5 A;  1TKT B;  1HNW J;  1N8R T;  4BS2 A;  3NKP A;  1CEZ A;  1NPP A;  3KYL A;  1NO8 A;  1I1G A;  3NGU A;  1RHJ B;  4RU9 A;  2NLW A;  1KH5 A;  4DU7 A;  2G2O A;  3Q2T C;  2DPJ A;  3W63 A;  4PYA A;  4LFB F;  2HBZ B;  2H65 B;  5IT9 Y;  3TP2 A;  2V69 A;  4JBC A;  1OJ4 A;  1HNI A;  1JWW A;  4ECY A;  1AJB A;  3POT A;  3CCV S;  1UJ6 A;  2UUB J;  2LXF A;  2O01 C;  3HHK A;  1SC1 B;  3B4M A;  2VZ9 A;  2VG7 A;  2XNR A;  1HBU A;  4DPX A;  4ZJQ A;  1WKJ A;  1HNX F;  1CJT B;  3TA2 A;  1MLA A;  1HWI A;  1NPR A;  3GZ7 A;  1SUQ B;  1BHN A;  4P7T A;  3HSG A;  4IO9 Q;  4CYS A;  1TV6 A;  4OYA A;  2ZH6 A;  3POT B;  3UW1 A;  1PAU B;  1IVZ A;  2YWH A;  4NZ0 A;  3RW6 A;  1DY3 A;  1ZM4 A;  1R0C B;  3MM6 B;  3QGI A;  1TL5 A;  3O6Q A;  2CIM A;  2AJ4 A;  2W5W A;  1ALI A;  3IWX A;  4EBC A;  3I96 A;  4DS5 A;  3C46 A;  3SYZ A;  3OTB A;  5DGA A;  1S0N A;  3OSN A;  2KM8 C;  1YBT A;  1ED8 A;  2Z2L A;  5MAO A;  1FJG F;  5KFK A;  5IC6 B;  4TVA B;  3TX8 A;  3ENA A;  2Z0G A;  3MM9 B;  4I2Q A;  3B5Q A;  3SQO P;  3KLE A;  2BXJ A;  5I3U B;  5DLF A;  1RT3 A;  4MK8 A;  3GFZ A;  3ZC4 A;  3QJJ A;  4YS2 A;  4FXD A;  1U0H A;  3MK0 A;  1V3R A;  3VAJ A;  3OQ2 A;  1X4D A;  3C15 A;  3TJ8 A;  1KHW A;  5GAD U;  4KHR A;  1T3O A;  1U6Z A;  3DGP A;  1TTH B;  3RB3 A;  2WAQ D;  1RGV A;  4NLS A;  2EC2 A;  2JWN A;  2DGU A;  4K59 A;  2W5T A;  3FBC A;  1F6T A;  3H40 A;  5EX3 A;  1SIZ A;  5AE3 A;  2HIY A;  3KLI A;  2FVC A;  2GMH A;  2VOP A;  1U0H B;  5CYM A;  1RWX B;  2PE8 A;  3C8Y A;  3M6U A;  1AW0 A;  1JLA B;  3QAT A;  3T1A A;  5J1E B;  1H2T Z;  3CC7 S;  3C15 B;  1YHQ S;  2YWE A;  2ADC A;  3LAN A;  3ONQ A;  4B3M F;  2KH9 A;  4X2B A;  3AH6 A;  1S4E A;  4DL7 A;  1I5O B;  3TAR A;  2OPP B;  4DR3 J;  1RAI B;  3KJF B;  2Q66 A;  2AJF E;  4YR0 A;  4XPE A;  4IQX A;  2IC3 B;  2XZD B;  4ZP9 A;  4WZQ A;  2E5L F;  2LEC A;  4YB1 P;  4TU8 A;  1IQZ A;  1WKL A;  3DOM B;  4QPT A;  5IM0 B;  1Q16 B;  2VFU A;  1RTH A;  4EZ6 A;  1HD0 A;  4MY4 A;  5KFL A;  4GTX A;  1UW4 A;  3PEH A;  1UMJ A;  2IUC A;  2CJX B;  2VDI A;  4C3L A;  2JC0 A;  1FT8 A;  3W7B A;  4DMZ A;  1JLG A;  4Q0B A;  3SQG B;  1ZEF A;  2OPS B;  4TQS A;  2GAG C;  3TAN A;  1KLN A;  3MEE B;  2UXD J;  4OI6 A;  4CO5 A;  4CLS A;  4X4O A;  3M9M B;  2YKP A;  4RW8 B;  4CLP A;  1WG5 A;  4NLY A;  3S01 A;  2IUC B;  1JB0 C;  2LLZ A;  2FC8 A;  1F9E B;  2ZNY A;  3HKZ D;  4KM4 A;  1JLG B;  3TJ9 A;  4CO4 A;  4Q0B B;  1C4C A;  4O0N A;  1X4A A;  3P5T L;  5L1I A;  3IG1 A;  1XJW B;  1C0T A;  3T00 A;  4ID5 A;  3VVU A;  3CJ3 A;  2BE2 B;  1ZOT A;  4BC7 A;  4GC6 A;  1VI7 A;  1FD8 A;  3MR5 A;  1PIL A;  2H3E B;  2ZZM A;  4F8R A;  4PXE A;  1S1U B;  3I0R B;  3KFW X;  4P74 A;  4F4A A;  1Y0H A;  4ES1 A;  3IAM 9;  4QOT A;  2MQO A;  3JB9 k;  1DZ5 A;  3IG1 B;  2IVF B;  3A13 A;  3UVJ A;  1C0T B;  4ID5 B;  5HQL A;  1NBE B;  4HDH A;  1XK8 A;  4IFY A;  1R8P A;  4X4S A;  2ZVS A;  2BUN A;  4DL6 A;  2CPE A;  4QYZ K;  4P9S A;  1KHL A;  4DV3 F;  4AQY J;  3OFE A;  4DG1 A;  2YXL A;  2XZT B;  4Y3C A;  4CRJ A;  3MED B;  3HHD A;  1BMQ B;  3HFV A;  1S6U A;  3MEC A;  3UVJ B;  2WSC C;  2J8A A;  4KHM A;  5F9L A;  1HQE A;  1SV5 A;  5E33 A;  1UWA A;  2JVR A;  7FDR A;  3OTC A;  5IQ6 A;  3EMT A;  4WYW A;  1FTC A;  5BXI A;  1WC5 A;  5AXK A;  5EDW A;  4C0O C;  2D3O R;  1SVD A;  2AZ1 A;  2XLI A;  1GTH A;  1HA1 A;  4F0K A;  5KG5 A;  1HBN B;  5E7O B;  2LEA A;  4FBU A;  4U96 A;  3C14 A;  3RJM B;  4K4S A;  4NL5 A;  4YB5 A;  4ZIT A;  1AUK A;  1TAU A;  5FLX U;  3KHH A;  3K58 A;  1SV5 B;  2B43 A;  4CT9 A;  4GVL A;  1W2B R;  3KMQ A;  4CLW A;  3OTO J;  4KGK A;  5A8K B;  4CLT A;  3MZI A;  3RTV A;  4TN2 A;  1FES A;  2G2Y A;  4KC5 A;  4M5D B;  1S7H A;  2D9P A;  2DNL A;  3R6L B;  2NSB A;  3P96 A;  2UXC J;  4IR1 A;  4LSN A;  3MR2 A;  3N6N A;  3HMJ G;  2V4Q A;  2ZD1 B;  2HSE B;  2UXB F;  3LW5 C;  3EGV A;  2UVR A;  3C16 A;  3G6V A;  2C2O B;  1IWG A;  4OHV A;  3MUR P;  4QWB A;  6FDR A;  4PXC A;  3FSI A;  1CUL A;  5LOQ A;  3H2L A;  4NLR A;  3P4U B;  1QSS A;  3TG0 A;  2HHX A;  4LVO P;  4DSI A;  1N2K A;  3LF0 A;  2NUH A;  1R8B A;  5K14 B;  4DV4 J;  5LXY A;  1NDL A;  3GWC A;  5B0A A;  1R0A A;  1SKR A;  5KFN A;  3M32 A;  4E8U A;  1BQX A;  3BO3 A;  3MTJ A;  4QR0 A;  1N56 A;  2PEB A;  4QIF A;  3WX4 A;  1TKX A;  3PFE A;  3KUG A;  4EBD A;  3MCS A;  3CXC R;  2ASD A;  2DNY A;  4C8N A;  4MMO A;  3OHB A;  2XCP A;  3IRX A;  4D3H A;  5HN0 A;  4ZVE A;  1ANJ A;  2PA3 A;  1AZS A;  1JLQ B;  2IMO A;  4RW7 A;  3EM1 A;  1R0A B;  2GML A;  3ZZU A;  3JAM U;  1TL1 B;  1K44 A;  1GT8 A;  2ZWO A;  3DLE A;  2JEJ A;  2H4Y B;  3FQK A;  8AT1 B;  1RKI A;  2IVY A;  1NXI A;  3DYA B;  5E5N A;  4RJV A;  4DL0 C;  2ZE2 B;  4RNO A;  1TKX B;  3PY8 A;  5GAH U;  3MGJ A;  3CJK A;  4NI2 A;  2ZM6 J;  4KBI A;  2WTF A;  2KKH A;  2F4F A;  3IR7 B;  2RS2 A;  2UU9 J;  1PKU A;  2GZO A;  3VCD A;  3W8G A;  4PYD A;  4USJ C;  2CWK A;  3JS9 A;  1W2I A;  3WC0 A;  4I1T A;  2I0X A;  2CJ9 A;  4DPU A;  2J7U A;  5B0E A;  1HI0 P;  1UCN A;  5DS7 A;  1SQE A;  1RWP B;  5KOX A;  1DQA A;  4NI2 B;  3HLU A;  1R0B G;  2HQD A;  4A8K A;  1FEE A;  1OY9 A;  1G2E A;  2M5Y A;  2QFI A;  2NXU A;  3H59 A;  5IOL A;  3CCW A;  4DS4 A;  1APS A;  1RT1 B;  3CCE S;  1WG4 A;  3IBC B;  2VPX B;  4E98 A;  2AYB A;  4ICL A;  1T3N A;  3KG1 A;  4XTT A;  4A8W A;  3DOL A;  2R42 A;  1WG1 A;  2VG6 A;  3R27 A;  2JX2 A;  1YRX A;  1Y10 A;  1GX6 A;  1SHQ A;  1HHS A;  2N7Y A;  1SKS A;  1OSC A;  4RLE A;  5L38 A;  3ZTP A;  2W4D A;  3IGV A;  4R25 A;  2ZKT A;  3CCZ A;  1RT4 A;  3OUY A;  2FD2 A;  5D15 A;  2HW3 A;  3W5Z A;  1VS3 A;  4NA1 A;  2W7O A;  5KXA A;  2B4O A;  5A0Y A;  4USV A;  3EZU A;  4AL5 A;  1Q4R A;  4ICL B;  4OZ2 A;  2EFV A;  1RP5 A;  3G2X A;  4DXL A;  5LMU J;  4DFJ A;  3DC2 A;  1WDT A;  1X9M A;  2CQ0 A;  3AOD A;  1VQ8 S;  2DO4 A;  3DLB A;  4WPA A;  3Q8Y A;  2Y3Y A;  3KNG A;  2KHC A;  3JYT B;  2RQC A;  2J6U A;  1NZA A;  3DRP A;  2H54 B;  1TMM A;  2MKH A;  4DSJ A;  1RT4 B;  2CG4 A;  2CQG A;  1O98 A;  4WFA Q;  4BCA A;  3PO5 A;  3KD8 A;  2E1P A;  3WZ0 A;  2ROP A;  1GXL A;  4MFB A;  2KXF A;  3D6H B;  1S76 D;  1U1K A;  3NS6 A;  2DY9 A;  2BEF A;  2NXC A;  1I6J A;  2JZ5 A;  3O3L A;  4W92 B;  2CQD A;  2V6A A;  3NKO A;  1Z4U A;  3DLK B;  3DRP B;  3THV A;  4QW9 A;  1SKU B;  1EIY B;  3DMJ A;  3CMQ A;  1TVR A;  4IFV A;  4J9O A;  3TZX A;  1MRO A;  3RYL A;  2ERR A;  5LRN A;  2CQB A;  4MFB B;  2K8G A;  4NLP A;  1F9H A;  2QIF A;  3QFH A;  1VHI A;  3JAM Y;  3HJF A;  3UD5 A;  3GYN A;  2W7A A;  3CJ0 A;  4UOH A;  2M88 A;  4TKT A;  1N0V C;  1CPZ A;  5GAG U;  4QIW D;  2AYM A;  4B3T J;  3UNG C;  2G1D A;  1U2F A;  1WI6 A;  4OHW A;  2ILY A;  3F41 A;  3EVW A;  4IFV B;  1WOP A;  3BPD A;  7FD1 A;  3ZZY A;  3LAM A;  4DDF A;  3SFU A;  4ED4 A;  3SXL A;  4Z2X A;  2DHG A;  1IR2 A;  4ZS6 A;  4DR2 F;  1VRQ C;  8ATC B;  4Y65 A;  3KUE A;  1Q8K A;  3CO0 P;  2KO1 A;  3J7A 1;  3W64 A;  1K9M T;  2ZHB A;  1I94 J;  1N32 J;  3U1M A;  4K5S A;  3HI9 A;  4X64 J;  3K5L A;  3UO0 A;  2GV1 A;  2XSJ B;  2P8I A;  4ED2 A;  3A3P B;  3K17 A;  2B3T B;  2GQQ A;  2D41 A;  3H5X A;  4JV5 J;  1E6V A;  3AY0 A;  3D2W A;  1T9Y A;  2H51 B;  3LGN A;  2UUA J;  1MU2 A;  5DG7 A;  5GAE I;  3HKW A;  3MD1 A;  5KFP A;  2D3Z A;  3BGR A;  1ARO P;  3NGR A;  1U2R A;  2R7X A;  4YY3 J;  3VGV A;  3UNY A;  3VTI A;  2X51 A;  3LGM A;  1TL3 B;  3HF5 A;  1ZZF A;  4J9U E;  1IWA A;  2HVD A;  1CJK B;  1J5O A;  4A8X A;  2VQE J;  2CPX A;  4WFN Q;  3PHE A;  1HQ2 A;  1R89 A;  3EXY A;  5DLW A;  3G82 A;  2GFF A;  4YP3 A;  5HAT A;  3BYP A;  4JI3 F;  3ZNJ 1;  5KT3 A;  1VQM S;  5KT2 A;  3LAL A;  2HWI A;  3K57 A;  2C3M A;  1I51 B;  1SB6 A;  5K20 B;  3FRY A;  1WHW A;  1P27 B;  1M0S A;  2AJ2 A;  1SI9 A;  3NOG A;  2J9D A;  2MGZ B;  4O44 B;  2HZC A;  1L3T A;  1NLK L;  3B4D A;  2NYI A;  5E3C A;  2ZUG A;  2WZ1 A;  3TJA A;  3Q0A A;  3NS5 A;  4O4G B;  2RB7 A;  4KGX B;  2ZBI A;  2UUC J;  4DPW A;  3N01 A;  1IR0 A;  1NK5 A;  1T05 A;  3UN2 A;  1HW9 A;  2YWK A;  4GKJ J;  1M5O C;  3H90 A;  4ECV A;  2B8Q A;  1FKP A;  4ZG7 A;  3CUN A;  4DV6 F;  1BQN B;  2HVZ A;  1D0E A;  4F4Y A;  3N9U C;  2BM0 A;  2Z30 B;  1A0O B;  3NMR A;  4PAB A;  4LR7 A;  4USU A;  4EO8 A;  2YKA A;  4PUO B;  3WBZ A;  1WDD A;  5A6W A;  2ATL A;  2GAH C;  1PAE X;  4G1Q B;  4B9M A;  2AHO B;  5L1L A;  3R3T A;  1OSD A;  3SFG A;  1FKP B;  1WF1 A;  4OI1 A;  1N4L A;  3PJW A;  2EVZ A;  5J2Q B;  1AB8 A;  3AD8 C;  2YKQ A;  2VC1 A;  1C4A A;  2XRG A;  2QA1 A;  1Q53 A;  5KFO A;  4B02 A;  4CM2 A;  2N4D A;  5DG9 A;  1T02 A;  1KEK A;  2CPJ A;  4OZJ A;  4ECR A;  1O99 A;  1ZTT A;  3KDO A;  2RAQ A;  3CW2 C;  3F73 A;  3Q22 A;  3R5C A;  3DN9 A;  2E9T A;  3LP2 A;  1V3S A;  4OJG A;  4NML A;  3RRK A;  5CYJ A;  4LBP A;  2L48 A;  1KON A;  4PQU A;  4CM0 A;  3MMA A;  1E6Y A;  2CNL B;  2DT9 A;  3FBB A;  3BBB A;  1HFE L;  1XN9 A;  1SH2 A;  3WQP A;  4OL8 A;  3H4B A;  2HRT A;  1U6F A;  4RNH A;  4ZA1 A;  1HPZ A;  3O5T B;  3M1V A;  2KI2 A;  4ERD A;  4L3N A;  4NLD A;  4LFC F;  4ZVG A;  2AJQ A;  3LO3 A;  1IBM F;  1VJQ A;  2HBQ B;  4FBT A;  2R7S A;  2CAJ A;  2VV5 A;  2A0F B;  2HND B;  3GU0 A;  4ZVS B;  3MUT P;  1KN6 A;  2KTQ A;  5LRM A;  3N6M A;  1AYE A;  2UVV A;  1XR5 A;  2M2B A;  2KDO A;  4XO0 A;  1E6Y B;  3QGP A;  4V1A k;  5DLG A;  4OI3 A;  4LR8 A;  1D9F A;  2E7V A;  3BS9 A;  5JVH Q;  3UDL A;  2CQP A;  1GMV A;  2WSE C;  5CAA A;  3W1Y C;  4Y2I A;  3T1Y F;  1N5T A;  2DRB A;  5J2M A;  4LIR A;  2IJF A;  2W5S A;  2CZ9 A;  4P2F A;  4C3K A;  2ACM A;  4IRC A;  1FK9 B;  4OIX A;  1RJJ A;  2DB1 A;  3BGU A;  2CDR B;  1K73 T;  3ZZR A;  1ZM2 A;  1BQM A;  2E1M C;  4CCH A;  5KG0 A;  1JKH A;  4ZVQ B;  3QBC A;  4L3K A;  1YJ9 S;  3PW4 A;  4NWJ A;  2HG4 A;  1WC6 A;  1VQ7 S;  2K3I A;  4ZPA A;  3DRR A;  2JEF A;  1AA1 B;  2V2Z A;  2X3D A;  4O3N A;  1ROF A;  4PPZ A;  2IFX A;  5INH A;  4P10 A;  5FJ4 A;  1K47 A;  2J0S D;  1GQE A;  2N4C A;  5H9F K;  4DV0 J;  2KG0 A;  1NSQ A;  1ZBT A;  1LWF B;  1B7F A;  2DKO B;  4EEY A;  3LXQ A;  4RR5 A;  3FCW A;  3X1L B;  1UA0 A;  1N5S A;  1TU0 B;  4LFA F;  2W2Q P;  5HMZ A;  4OI0 A;  3EJM A;  1YVF A;  2QMU B;  1VQN S;  2IPO B;  4R8U A;  2V67 A;  2GSN A;  3B8H A;  3BDP A;  1S0V A;  5BYQ A;  3BJY A;  1DLO B;  3S6E A;  3VGU A;  1Y7P A;  1CC7 A;  3MK2 A;  2IYI A;  1NB7 A;  1NRK A;  1WD6 A;  1MWY A;  2A18 A;  4C6A A;  1Y5N B;  4PZV A;  1RUS A;  1BXN A;  1URA A;  4JV0 A;  3L4B C;  4DUY F;  4RX6 A;  3PRB A;  5DZ6 A;  4CWB A;  3UD3 P;  4LF8 F;  3L7U A;  1VFJ A;  3TA0 A;  4F04 B;  3BDE A;  1RWN B;  1TL7 B;  1S1V A;  2LU2 A;  4IDK A;  3VAL A;  3PVX A;  2VPZ B;  3HVT A;  1WEL A;  3J7Z T;  2GSO A;  1DAX A;  2EFQ A;  3H42 A;  4QIE A;  1U6B A;  2UZA A;  4F4K A;  1EX8 A;  4TU9 A;  3JXO A;  2POK A;  5K5M A;  1HD1 A;  1LXJ A;  3WIV A;  1S0O A;  4JI4 J;  1XNQ F;  2VQR A;  1HDH A;  1FX2 A;  3M6V A;  2VJV A;  5DRK A;  4DF8 A;  1CJV B;  1RK8 A;  2ZOM A;  4JI8 F;  2Z2Z A;  2V0N A;  2JNJ A;  2JFD A;  4E2F B;  1S1V B;  1B70 B;  4OYB A;  3HVT B;  3P6Y C;  5H9E K;  2W2N P;  2MSS A;  3TVY A;  3CDU A;  5EWE A;  4URQ U;  4MJK A;  4U7U K;  3NWG A;  3AOB A;  4NLO A;  1VQK S;  2DPI A;  2LQJ A;  3HVR A;  1GXU A;  4UY8 T;  5KFB A;  1LXN A;  3N4W A;  4CLF A;  5DLT A;  1YJR A;  2G4B A;  3OLA A;  1ED9 A;  2YH0 A;  4F2S A;  2HHH F;  3O8W A;  4ZK7 M;  3OJS A;  2APO A;  4GO5 X;  9RUB A;  3EIC A;  2GO9 A;  3LWM A;  4PXD A;  4WFX A;  1RTI B;  3HD1 A;  2AW0 A;  2VB6 A;  2ILZ A;  4EO6 A;  4LR9 A;  3E01 A;  2PC6 A;  5THW A;  2N82 B;  4ZCK A;  2LXU A;  4OQJ A;  1FXD A;  1H7W A;  4YN3 B;  4AXJ A;  3FZ2 A;  2Q43 A;  3S7R A;  2V34 A;  2HNZ A;  2M7S A;  4KFB B;  3NP5 A;  3IXQ A;  4ETX A;  4QWD A;  5M2R A;  4Q2L A;  1NSP A;  3CED A;  2QGF B;  1P6T A;  3ILJ A;  2OSR A;  1BC6 A;  1FNX H;  2KT5 A;  4KGM A;  3E01 B;  4HL9 A;  3W9J A;  2L9D A;  1OS5 A;  4FVC A;  5L1J A;  3HCX A;  1U1O A;  3PNI A;  2DYA A;  4DX6 A;  5HVH A;  2ZJQ Q;  2WVF A;  4DQQ A;  4N7T A;  2N3L A;  3K59 A;  3FGV A;  4Q2M A;  3CNQ P;  3TUP A;  1RWV B;  2C3U A;  4CO0 A;  3T1H F;  1R8A A;  1QAX A;  2V4R A;  3HHL B;  3D0G E;  1SXL A;  3LTO A;  3LGH A;  1VQ5 S;  5G0R B;  5KFT A;  4B3S J;  2WRM A;  2RIL A;  5KFX A;  1QAJ A;  3TZZ A;  3NGS A;  3SIP B;  1S7I A;  1IR1 A;  4P75 A;  5DJB A;  5LJ5 Y;  1S6O A;  1F9F A;  1YX2 A;  1FDN A;  1FD2 A;  2CNO B;  2KRB A;  3D5M A;  5HQM A;  4GC7 A;  2P2C B;  1U48 A;  3DRS A;  3R2C J;  1KD1 T;  3MM7 B;  4ZHR B;  2VAS A;  5EHH A;  1B7Y B;  3FDS A;  2M70 A;  5L0E A;  2DCL A;  1QLN A;  5CQG A;  5KFJ A;  2D1C A;  5F0U A;  2ZH3 A;  4E0D A;  4CTA A;  1FTR A;  4FYD A;  3LP0 B;  1LWC A;  1P8G A;  3HFK A;  4KT0 C;  5AJ3 F;  2JC1 A;  4DEZ A;  4L72 B;  1Q78 A;  4KAV A;  1VK3 A;  3NXZ A;  2PI4 A;  2YVS A;  4RUA A;  3PM9 A;  3R5G A;  5DLV A;  2ALZ A;  2DRA A;  3NAH A;  2Y1R I;  1Q7L B;  1KFD A;  1JK9 B;  3GJT B;  2YH1 A;  3FVY A;  2HFU A;  2LU1 A;  5AXM A;  3NCQ A;  1S1T B;  3G8Q A;  3OBI A;  5KFQ A;  5HLF A;  4OJH A;  1IJE B;  5GMK a;  1N6Q A;  1ACM B;  1X9W A;  3HX9 A;  2XWY A;  1RAB B;  4OX9 J;  3KLG A;  2KJW A;  1L3U A;  3I9Z A;  2CA9 A;  2HBR B;  2HHP A;  1N33 J;  1VIX A;  3EVM A;  3BO4 A;  5I3P A;  3C2P A;  5ETQ A;  2PSZ A;  4RKU C;  5F3T A;  4DV5 F;  1KHJ A;  3P49 B;  2YX7 A;  3ICL A;  1FSU A;  2V2K A;  3D68 A;  4QIV A;  1S12 A;  4JYA F;  5L46 A;  5HLF B;  2IRX A;  5D77 A;  2W25 A;  1N6Q B;  2FDN A;  2NXN A;  2E5G A;  3F44 A;  5F8J A;  4LRA A;  4K4Y A;  2CPZ A;  2BMB A;  3KLG B;  3A12 A;  4AT1 B;  3RUB L;  1LW2 A;  4CT8 A;  2FC9 A;  3EDQ B;  1RU2 A;  4KV8 A;  1VYA A;  3VZI A;  1UVL A;  4ZKA A;  3UQS A;  4ZDN A;  4DV7 J;  2W8K A;  4DV2 F;  4IUF A;  2ZWP A;  5HMX A;  2J5A A;  2C1E B;  2UVU A;  3ITH B;  2FJX A;  1EKS A;  3DHX A;  2V9K A;  4LSL A;  5L1K A;  3MCN A;  1NJY A;  3UFC X;  2ZH5 A;  4C9D A;  3ZNU A;  4HYK A;  3I55 S;  1QY7 A;  3PX0 A;  2XZW A;  5K8M A;  1ELX A;  4UST A;  4ZP8 A;  5D4N A;  2LQ8 A;  2WBR A;  3RR7 A;  1TUW A;  5E3R A;  1KS2 A;  3EE3 A;  2FYX A;  3ZXW A;  1JLB A;  4WTO B;  4YQW A;  3E8O A;  2ZH1 A;  2ACY A;  2ZBC A;  3GIM A;  3HJV A;  1VQO S;  3AB4 B;  3CE8 A;  3OR2 A;  1UVK A;  3FSY A;  4ZVT B;  1S57 A;  3FKB A;  4B3O A;  5HVF A;  1NJI T;  1NK6 A;  4O3P A;  2XO7 A;  1R27 B;  2C3P A;  3W66 A;  1VQP S;  5I42 B;  1KVJ A;  1ALH A;  3TYT A;  3KUH A;  1JLB B;  3SV4 A;  3IMQ J;  1UA1 A;  2B4V A;  3QID A;  2IAJ B;  3EGZ A;  1LK7 A;  2QG9 B;  2YNG B;  4NA2 A;  1NZ8 A;  2DXE A;  1RTD A;  4I7F B;  3TUZ C;  3W2V B;  2ZH4 A;  2RDI A;  4U95 A;  4B3O B;  3V2U C;  4EYH B;  4N77 A;  2MEW A;  2W9B B;  2DGT A;  3ILO A;  3GV7 B;  3ZZP A;  4X4V A;  2AYG A;  1UET A;  4WWS A;  2XMU A;  4B9L A;  4YR1 A;  2C2Z B;  1UEU A;  1YBU A;  3GIR A;  4UPI A;  2LQ9 A;  1WUU A;  2DNR A;  2JLF A;  1RTD B;  3D6T B;  3OFH A;  4D3G A;  1V5I B;  3NKY A;  3M05 A;  4WKR A;  2B56 A;  1U49 A;  2W2M P;  2RHQ B;  2RKI B;  1S59 A;  4HVZ A;  5C42 B;  1RAD B;  1H98 A;  3G6X A;  1JLF A;  3J81 U;  2QLX A;  4N47 A;  5KFR A;  1T95 A;  3G71 S;  3VV2 B;  1MG7 A;  4M5N A;  4XDD A;  1WTB A;  1TQL A;  1J5E J;  3QAE A;  1KVK A;  3DFE A;  5A76 A;  1SL2 A;  4J9R A;  4KH0 B;  1PCA A;  1JQG A;  5B09 A;  1TUG B;  2YKO A;  2DVI A;  3GJQ B;  1DJ0 A;  2B7C B;  3RB6 A;  4ZVO B;  1R8C A;  2OH2 A;  2HLU A;  4YDX A;  2P6S A;  3BSO A;  4WP3 A;  2QA2 A;  2XY6 A;  2E7X A;  1S1X B;  4PG4 A;  4O3S A;  2YTC A;  3DCA A;  2XYH B;  2CQ1 A;  2YBV A;  2BKO A;  4TXS A;  2K2P A;  3PCO B;  4CLK A;  3UN5 A;  1YSJ A;  3BO2 A;  5H9E J;  2C3O A;  1LNQ A;  5I4M A;  2EKN A;  4KYZ A;  2OTL S;  3FRZ A;  4K2J A;  4KKO A;  4OX8 A;  2IM3 A;  3RB0 A;  3NEK A;  2QC3 A;  3IGY B;  2FUG 9;  5DZ7 A;  1FJ7 A;  1ICE B;  2Y8Y A;  2R7R A;  2CDQ A;  3B54 A;  3EPG A;  5KFH A;  2MKC A;  3SDE A;  4PWD B;  4JI2 F;  2C2D A;  4UF4 A;  5CYQ B;  1TL4 A;  3MAA B;  3UDE A;  4DCJ B;  4RUC A;  4KKO B;  3TR5 A;  2FZC B;  3FCH A;  3MPV A;  5L0K A;  5DQI A;  4GKK J;  4J37 A;  3SI8 A;  4MKY A;  1KBR A;  4NCG A;  2YNF A;  2B4U A;  3ZTQ A;  5E0O A;  4WP9 A;  3GSD A;  5C7P A;  4PRF A;  4MH8 A;  3SDE B;  1UWB B;  2BJE A;  2HHW A;  4K5R A;  3BR8 A;  1HYS A;  3VAF A;  2V50 A;  5RUB A;  5KFE A;  2HK3 A;  1FI4 A;  5F8L A;  4DLG A;  4DUZ F;  4ZGA A;  3MOJ B;  3EPI A;  2FIU A;  2KXN B;  2AJ0 A;  2UUT A;  2DXF A;  1BD6 A;  4WXW A;  5B0D A;  2V8P A;  5CH7 B;  3HP6 A;  3BV8 A;  1EAR A;  3PHT A;  3DDN A;  4UOC A;  4UT4 A;  1XR6 A;  2MQQ A;  5LJ3 Y;  4NCG B;  4M95 A;  2BJ3 A;  2YNF B;  2KT3 A;  3OTD A;  4MK7 A;  5GRR A;  1IKV B;  1NHV A;  3JSY A;  4DOZ A;  5KG2 A;  3BGO P;  3FFI A;  3M2V A;  1UL3 A;  3GB0 A;  5DQH A;  4K50 A;  1ANI A;  1X4H A;  4MHX A;  3K8V A;  5CAB A;  4Q5V A;  4OLO A;  1RXO B;  3NGD A;  1B8J A;  3R7N B;  4OV1 A;  4MAK A;  2BJ9 A;  1P1T A;  4Q8E A;  3J81 Y;  1OPI A;  2F4V F;  4CLL A;  4B08 A;  3TZY A;  2CZV C;  2CXE A;  2BJ8 A;  4R0E A;  1VQS A;  1EKR A;  1JXL A;  2XBP A;  4WE1 B;  2YKM A;  3SCJ E;  1PYT A;  4RNN A;  2P6T A;  2W9A A;  2FZG B;  4ZVU B;  2E1A A;  1NPK A;  1K0T A;  3M8R A;  2GX8 A;  2DR9 A;  2CZ4 A;  1RQ0 A;  4QWE A;  2M4M A;  5J2N B;  1CLF A;  2ASY A;  3T6J A;  5JMN A;  4C11 A;  2MKS A;  3NAI A;  1HWL A;  5HVG A;  3KK1 B;  1PJ6 A;  4W90 B;  3BN7 A;  1XNR F;  2IJN A;  3NKN A;  2DEI A;  2BJ1 A;  4F4X A;  2AD9 A;  2B9Y A;  1UVI A;  1SHN A;  2MLX A;  1RAO A;  2NCK L;  1RBA A;  4NXN F;  4JI0 F;  1H7X A;  3M8P B;  2BQU A;  2FPH X;  2MQN A;  2IRY A;  2EBG A;  3D1Q A;  1X5O A;  1N34 J;  2GMJ A;  4IQM A;  4KJG A;  4ZLP A;  2CQ4 A;  3JQK A;  1N52 B;  3LOU A;  1Q81 T;  5IJQ A;  4URS A;  1QUV A;  3CJS A;  3GSI A;  1X4C A;  1ZAW A;  4ELT A;  2DIS A;  2EK6 A;  4Y6I A;  3IRW P;  4QPX A;  4UPK A;  3SSS A;  2GA7 A;  4Z37 A;  4R5P A;  1KLM A;  1WEY A;  4RW4 A;  4DN0 A;  1TK5 A;  2AYE A;  4ECS A;  1REV B;  2A6M A;  3PYE A;  4NRU A;  1T9V A;  3PFO A;  2DRD A;  1EET A;  1XIQ A;  4HHJ A;  1FXL A;  5F0W A;  1IM6 A;  2MQL A;  4ZCL A;  4OHZ A;  2OPQ A;  3EGW B;  4NMX A;  2RDJ A;  2Z2M A;  2FJV A;  1QVF R;  3OL9 A;  3W2W A;  4LVN P;  1KLM B;  2NR0 A;  1FDA A;  2OD4 A;  2EW9 A;  3B6B A;  1MN9 A;  4RW4 B;  4EK2 A;  4FKY A;  1HBM B;  4RW6 A;  3OR1 B;  3W60 A;  1IBK J;  3ISZ A;  1EET B;  2OEK A;  3JSR A;  3M8W A;  4IRD A;  5T7L A;  1XMO J;  3VQT A;  5K8P A;  2R2R A;  3CUL A;  1S77 D;  3KNA A;  4A47 A;  2XMK A;  1FJC A;  3RAX A;  4NZ6 A;  5ETT A;  1IBL F;  2EG2 A;  4KGV B;  3W2W B;  1WHX A;  4JUZ A;  1JLE A;  1QUP A;  3T5K A;  2DK2 A;  4RW6 B;  3BDG A;  5E3A A;  2NXJ A;  3BH7 B;  3M2U A;  3I4H X;  4ZVP B;  3VVT A;  2FVR A;  4A8O A;  3ELH A;  4IG3 A;  3L95 X;  2OAU A;  4MYU A;  2DHA A;  2HFZ A;  4FF3 A;  3WAY A;  2H5I B;  4JI7 J;  4LFA J;  2LFV A;  4MIW A;  1RT7 A;  2JOQ A;  5ETP A;  2MTL A;  2OLW A;  2W1B A;  5KFZ A;  3E3X A;  1X5T A;  3VF0 B;  3PX4 A;  2R9L A;  4IG3 B;  1X4E A;  4ECW A;  3QWU A;  3NGK A;  2CJB A;  5AE2 A;  4RPF A;  3BQ1 A;  3ISN C;  3TEH B;  2AEJ A;  2GIF A;  2V4J A;  2VIH A;  1RT7 B;  1NK8 A;  1LQ9 A;  2KT2 A;  4DUY J;  2VBZ A;  4A4J A;  1U1M A;  4CH1 A;  5A8R A;  3MEG B;  1S49 A;  4YB6 A;  4UZB A;  4OFZ A;  2B6A A;  2EC0 A;  3QO9 A;  4OYM A;  2VFV A;  4I2P A;  1P49 A;  1FWL A;  2OPR A;  4ED8 A;  5ETV A;  4IOA Q;  3MCO A;  3MHY A;  5KG7 A;  3THP A;  2VOO A;  1URB A;  1JLC B;  3TAQ A;  1YJ7 A;  1U7L A;  4CO1 A;  1PG5 B;  1LWX A;  3RBD A;  1XNQ J;  4JI6 J;  1DAR A;  2F8E X;  3OL6 A;  4IO1 A;  5T14 A;  4CZC A;  3U27 A;  2LYV A;  1T9U A;  1QE1 A;  4KQZ A;  4J90 A;  1YZ7 A;  2H48 B;  1TFY A;  1RZM A;  4C0B A;  2BJD A;  2KZZ A;  5IWA F;  1BE4 A;  3NL0 A;  4X66 J;  4F02 A;  1URR A;  2GA3 A;  1N0U A;  4QZV B;  3DXB A;  1RI7 A;  1SPB P;  1Y3J A;  1EQM A;  1XWL A;  1M1H A;  4RU2 A;  1Y7A A;  3GLJ A;  4QR1 A;  4ZPD A;  2CWX A;  4YHH F;  1EZZ B;  1FFG B;  1N54 B;  3I5B A;  2UUW A;  1S6Q A;  2ATC B;  3CVK A;  1D09 B;  2WB4 A;  1HJK A;  2OTJ S;  1YQH A;  2CQH A;  3QLH B;  4N41 A;  4HH0 A;  1HKA A;  1ZPV A;  2HLT A;  5ETR A;  4DR7 J;  2OEJ A;  4YFU A;  1DTT A;  3K89 A;  3CJT A;  5ETS A;  1EP4 A;  2JFK A;  2GIR A;  4PG6 A;  3CJ8 A;  1W25 A;  2QYG A;  2XM3 A;  2ZOF A;  5C5J A;  4B9V A;  3BGL A;  3PYG A;  4DV1 J;  1WC1 A;  4ID8 A;  1PC5 A;  1GNK A;  2OML A;  3NRB A;  2VBW A;  2JEG A;  2LEP A;  4B3R F;  5M2P A;  2B9X A;  2BQR A;  4TLQ A;  1DTT B;  3QNW B;  4I6A A;  2PGC A;  2CQC A;  4HTI A;  2MZT A;  1PC4 A;  5EGY A;  2RS8 A;  3OT9 A;  1DTQ B;  2CAD A;  2ZIT A;  2DCU B;  2J7K A;  4CXK A;  1EJJ A;  1Q8B A;  1X5S A;  3CD5 A;  3DRY A;  1IKY A;  4KH1 B;  5J1P A;  1NK7 A;  5F8I A;  2HMI B;  2J6S A;  3A8E A;  2FLO A;  1YZ6 A;  3ZTS A;  3MEK A;  1NJX A;  2Z56 B;  3JQM A;  1IKW B;  2I5J B;  3CME S;  1KSP A;  4ZLJ A;  2F40 A;  2YWG A;  3PKM A;  4LT6 A;  4J9Q A;  1VIS A;  4DR6 F;  4GVB A;  5D3G A;  1RIS A;  4DR4 J;  3BYR A;  3HHN B;  2NUU G;  2YKN B;  1T11 A;  2D9O A;  3P5B P;  1C1B B;  4KHP J;  3IN5 A;  2E44 A;  1C1C A;  2HS0 A;  1O8B A;  4AL7 A;  4X4R A;  1RBO B;  4O4R A;  1NND A;  1KH9 A;  4FXV A;  1S6P A;  2HBY B;  2LA6 A;  1H2U X;  3TVK A;  1GMW A;  1ZAX A;  1KHK A;  5CHC B;  1F0X A;  4N76 A;  3IDD A;  1N48 A;  4S0M A;  3MMB B;  3OW2 R;  2HZV A;  1RAA B;  1B64 A;  1NCL A;  4QAX A;  2ZC4 A;  4F4Z A;  4KAY A;  4EYI B;  4NPO A;  4LF4 J;  3IR5 B;  1ZZN A;  2YNI B;  3R1L A;  1RWK B;  3S8S A;  5J2P A;  3LUY A;  2XUL A;  3DI6 A;  2G0J A;  1RHU B;  4BHQ A;  2NQP A;  1U25 A;  2QA4 G;  3QPI A;  2UUB F;  3MM8 A;  1T8E A;  3UPF A;  3A3O B;  4DX8 H;  1UVJ A;  2FJB B;  3C6T B;  3CCS S;  4X65 F;  3I0S B;  1VK8 A;  1ZEB A;  2EXU A;  1Y00 A;  2VU5 A;  3AHP A;  2W24 A;  3RBX A;  1ZTW A;  3H7H B;  2M9K A;  4F3M A;  3GYG A;  2QLF B;  2FHO B;  2RH3 A;  1TK8 A;  2V2V A;  4DL5 A;  5BR8 J;  3Q89 A;  1KOO A;  2VBX A;  1GMW D;  2XTJ P;  1N5Q A;  1JNZ B;  1HMV A;  2W5V A;  4B9N A;  3FC9 A;  3KJQ B;  1RWU A;  3TUJ C;  2F65 A;  3R5B A;  5B0F A;  1H3D A;  1E33 P;  4GTZ A;  3R5A A;  3GV8 B;  3MPU B;  3BBF A;  4MKA A;  3QSI A;  3QIP A;  1TUV A;  5HRT A;  1HNI B;  4DV2 J;  1YJU A;  1BLU A;  3OXF A;  5LQQ A;  3J7Y U;  3DLJ A;  1K1Q A;  2VG7 B;  2QLW A;  4V19 J;  3AD7 C;  1HBU B;  4EZ9 A;  2FGO A;  2MY7 A;  4TY9 A;  1HNV A;  5KG4 A;  1Q1K A;  1Z2L A;  1PO6 A;  4DHV A;  4NWX A;  4FNH A;  5JVG Q;  4DFM A;  4H4M A;  4EU0 A;  2R8I A;  2MZ1 A;  3QZ8 A;  4JV2 A;  1TV6 B;  2ZFH A;  1D9D A;  3E51 A;  2AMC B;  3N0V A;  1MMD A;  1K1S A;  1WC0 A;  1ZET A;  2MXY A;  4G1I A;  2OI2 A;  5CCL A;  1HWU A;  3KK2 A;  2WB1 D;  4TNO A;  4DL3 A;  3R8Y A;  3M9O B;  3TAM A;  3HD2 A;  3EVO A;  1X4F A;  1M90 T;  2X1F A;  3DLH A;  4J9V A;  4I2Q B;  4U67 Q;  2GVZ A;  3KLE B;  2I38 A;  1IM4 A;  3H4D A;  2RT3 A;  3I5C A;  4M5H A;  2D69 A;  1RT3 B;  4LF7 J;  3D54 A;  3DU6 A;  1U4B A;  2EWH A;  2L9W A;  1V3Z A;  5LXR A;  4FYY B;  1Q8I A;  4DR3 F;  3KK2 B;  1WSV A;  2DH8 A;  2VKR A;  1UKU A;  2KYX A;  2D74 B;  1RTZ A;  3AJ1 A;  2IM0 A;  3SMZ A;  1VQL S;  3DGP B;  1W26 A;  1FKA F;  4OJ1 A;  1EB0 A;  5IQQ A;  2DHH A;  5ETN A;  2L9N A;  2AX1 A;  2VPW B;  1NUE A;  3KLI B;  3UWT A;  5CYM B;  3D6F B;  1U2C A;  5F8N A;  5LIA A;  5SZT A;  1Y5I B;  1RAE B;  3C3L A;  5LMN F;  3JSB A;  4J9K A;  1SQG A;  2J9E A;  2GLQ A;  9ATC B;  5DDP C;  2PMH A;  2XGQ A;  3TA1 A;  2BOP A;  2UXD F;  2F5G A;  2FJW A;  2W4P A;  2D3U A;  2BR0 A;  1KC8 T;  3H25 A;  5FD1 A;  3I31 A;  2YPY A;  3EZO A;  1ELZ A;  4NLX A;  4FKX A;  1SC4 B;  3KHR A;  1BY9 A;  4NLG A;  1RTH B;  2CJY B;  4OYZ A;  3NBP A;  4ECZ A;  2GJI A;  1HNZ F;  2DIV A;  2MJN A;  5EX0 A;  1LWE A;  2N3O A;  4ETZ A;  1NH8 A;  5GOV A;  2DNQ A;  2GGP A;  1VQY A;  2PO4 A;  4F26 A;  3AA9 A;  3R5D A;  4LF6 J;  2K1R A;  1E2S P;  3CJ4 A;  3IGZ B;  2DNP A;  3GCW P;  2NZ4 A;  4FPR A;  1UPP A;  4ZP6 A;  1X8D A;  3T6B A;  2RQM A;  2HHU A;  3PAC A;  2GGP B;  4ZPC A;  4C8Y A;  3BQ2 A;  4Y2A A;  2R8H A;  2M0G B;  3I56 S;  2K1R B;  4JI2 J;  3HSZ A;  4AQY F;  4J9S A;  3HK2 A;  3RRG A;  2H5E A;  4NXM J;  2QEX S;  1ZED A;  1HBO A;  2OUG A;  4I56 A;  4IR9 A;  3QWP A;  3K5N A;  5C25 A;  3T9Z A;  3T19 A;  2IYG A;  2CYY A;  4RO0 A;  3IFE A;  1QVG R;  4CQ1 A;  5GMD A;  3ENW A;  1MN7 A;  2MMY A;  4DUT A;  4KPC A;  4AND A;  4DX5 A;  4HAC A;  1FRX A;  2YWW A;  2JRS A;  2XY7 A;  2DGQ A;  4PPD A;  4ER8 A;  1BWV A;  1HI8 A;  2OHD A;  1BGX T;  3N79 A;  4ZPV R;  2XHC A;  2LEB A;  3UDV A;  3V5R A;  2BAC A;  4IFY B;  4P7V A;  2RJZ A;  2G0C A;  2W2O P;  3ZFV A;  1GMU A;  4HAC B;  4LF9 F;  3N6L A;  4ZPB A;  1NJZ A;  4GTY A;  4JB8 B;  1JJH A;  4P73 A;  4DG1 B;  3OTO F;  2KN4 A;  2R7U A;  3O1L A;  1ZH5 A;  3M8Y A;  4YR3 A;  4C0H A;  2UXC F;  4J9N A;  3MEC B;  1VDH A;  3CD7 A;  2XCA A;  3CCJ S;  3DDK A;  4H4O A;  1HQE B;  3KJV A;  3DYC A;  2HQI A;  2BAB A;  3NGT A;  2B9W A;  5D4L A;  1S72 S;  4RNM A;  5KTQ A;  2GIQ A;  1RT6 A;  3C14 B;  1OWX A;  5B0B A;  4H4O B;  4DV4 F;  2Y0B B;  2FJD B;  3BKT A;  2XR9 A;  1JXE A;  5E3Q A;  4ECX A;  2KHD A;  4A48 A;  3VAM A;  5HQ8 A;  3DM2 A;  2WOM A;  1NAQ A;  2J0W A;  1T9W A;  1RT6 B;  4LSN B;  1KTV A;  1FXR A;  3KJN B;  2F8M A;  4GMK A;  2HQC A;  3QRP A;  3RB4 A;  1FO1 A;  2HS4 A;  3VR1 A;  2JVO A;  3JSM A;  4ILM A;  2P9G A;  3FBF A;  3M6W A;  3C16 B;  4WK3 A;  2UV8 A;  4JI0 J;  1RU1 A;  5CZV A;  5FDL A;  2QV6 A;  2WOM B;  1S9G A;  1CUL B;  4NWB A;  3MD3 A;  1DHM A;  2ZH9 A;  3MM5 A;  1R6Y A;  1JJ2 R;  2ZM6 F;  3VGS A;  5HP1 A;  3M32 B;  4UOP A;  4KO0 A;  3JSM B;  1NH7 A;  1RTJ A;  2RD5 C;  4NLV A;  2Z57 B;  4OX6 A;  3T5H A;  2XMM A;  5JJB A;  4C3M A;  2MY8 A;  2MPU A;  2EFP A;  1RA7 A;  4A8F A;  5GAD I;  2M8D B;  1X7V A;  1ITP A;  3IRX B;  1SQF A;  1DQ8 A;  1AZS B;  4RW7 B;  3SCK E;  3PV8 A;  2NPI A;  2X1B A;  1VJW A;  4DL4 A;  2ALY B;  4NX9 A;  3DLE B;  4Q7A A;  5K8N A;  2W9C A;  3CCQ S;  3K0J A;  2KU7 A;  3FEZ A;  4B56 A;  3ISN D;  3CJK B;  4RZR A;  4X4Q A;  1VCT A;  3NVL A;  1FX4 A;  3UE2 A;  3QMQ A;  2XMA A;  4K4T A;  4Y28 C;  4ILL A;  1BUX A;  5F9N A;  4DFP A;  1G7C B;  3MK1 A;  5IJS A;  1LW0 A;  1S1W A;  2HPU A;  5C2C A;  2VFS A;  2Z2Y B;  2OGU A;  1FRH A;  2IIH A;  5HAO A;  4NRT A;  5LMU F;  4L74 A;  1IBL J;  1H73 A;  4X4U A;  3MUM P;  5CD4 A;  1OO0 B;  2YNH A;  3GII A;  4F0M A;  2VA3 A;  2FJE B;  3GJS B;  1LFW A;  3M9N B;  5D0E A;  4WTY A;  1UW9 A;  1HWJ A;  1VBX A;  1FDD A;  3I9V 9;  3DOL B;  4DCO B;  3KLH A;  2DR5 A;  3IR6 B;  2IHR 1;  2VG6 B;  3UR3 C;  2HFN A;  4QU7 A;  4LQ3 A;  5L8R C;  3QRR A;  2HS3 A;  4U8Y A;  4I6Y A;  3N28 A;  3M30 A;  1B3T A;  2W5X A;  4WU3 A;  2HFV A;  2HHQ A;  3AOA A;  3W5Y A;  3OUY B;  3V81 A;  3IGN A;  3PJ9 A;  5EWG A;  5A0Y B;  5LSR A;  2IBO A;  1SH0 A;  3KDN A;  3AA8 A;  1TMJ A;  2VG5 A;  4HT5 A;  3C66 A;  2XEX A;  2C2M B;  2ZNZ A;  1VMB A;  1F5B A;  4PCQ A;  1C0U A;  3AOC A;  4OLP A;  2HGM A;  1RAG B;  3G6Y A;  1JJC B;  3G8T A;  4UOG A;  1U1L A;  1TEL A;  1FE0 A;  3PDN A;  2PI5 A;  3IP0 A;  3V81 B;  3A4T A;  2VG5 B;  2E1C A;  2I8E A;  6AT1 B;  3DDI A;  1X4B A;  2XLJ A;  5HAN A;  1N5V A;  1ZM3 A;  1C0U B;  1MWQ A;  3MUV P;  4UPL A;  1S9F A;  1X0P A;  2PMZ D;  4MIB A;  4C2M A;  1XMQ J;  1FA0 A;  5KG1 A;  3OFG A;  2DGS A;  1ZPW X;  3DMJ B;  3GQC A;  4IH5 A;  1TVR B;  1MRO B;  5B7W A;  2AP6 A;  4RW9 A;  1I94 F;  1AT1 B;  2B5J A;  1N32 F;  4LSZ B; 
#chains in the Genus database with same CATH homology
 4GTY A;  3UN5 A;  3UNY A;  2W5X A;  4B56 A;  1ELX A;  1ELY A;  3T02 A;  2GSO A;  3BDG B;  1KHN A;  4ZG6 A;  1EQJ A;  2W5Q A;  4YR1 A;  2GLQ A;  1ED8 A;  1K7H A;  2D1G A;  4ZG7 A;  2W8S A;  3M8Y A;  1KH5 A;  4UPI A;  5INH A;  3NVL A;  3BDF A;  2W5V A;  4LRF A;  2RH6 A;  3B5Q A;  4MIV A;  5EGH A;  3WAY A;  3TG0 A;  2QZU A;  3NKN A;  4LR9 A;  3SZY A;  4CXS A;  5K4P A;  1N2K A;  5GRR A;  3MK1 A;  1KHJ A;  3ED4 A;  5IJS A;  3T00 A;  2VQR A;  1HDH A;  3IGY B;  3E2D A;  4FDI A;  1SHN A;  1FSU A;  2GSU A;  4LR7 A;  1E33 P;  1Y6V A;  4GTZ A;  3LXQ A;  1ZED A;  1KH9 A;  5L0B A;  3DYC A;  3MK0 A;  3WAX A;  3DPC A;  1O98 A;  4MY4 A;  2GA3 A;  5LRM A;  1ELZ A;  4LRC A;  2ANH A;  3KD8 A;  5EGE A;  1AJB A;  4UOR A;  2X98 A;  5DLW A;  4UOO A;  4GTX A;  3M8Z A;  1KHK A;  1ANI A;  3CMR A;  1ALK A;  5L0E A;  4LRA A;  4LR8 A;  3IDD A;  2IUC A;  3WAV A;  1AUK A;  4UOP A;  4MHX A;  4KJG A;  2GSN A;  5HRT A;  1E3C P;  1AJD A;  3M8W A;  1Y7A A;  1KH4 A;  1ALJ A;  2W5T A;  3Q3Q A;  5LQQ A;  1ALH A;  4LR2 A;  3SZZ A;  3OT9 A;  1B8J A;  3NKR A;  2XRG A;  4KAY A;  4QAX A;  3NKM A;  3UO0 A;  5IJQ A;  3NKO A;  5GOV A;  1KH7 A;  3BDH A;  5AJ9 A;  5L0K A;  3MK2 A;  4CXK A;  3UN3 A;  1ZEF A;  1EJJ A;  4UPH A;  1ANJ A;  4ZG9 A;  2W5S A;  4KAV A;  3M7V A;  2W8D A;  2XR9 A;  1O99 A;  1EW8 A;  4KJD A;  1E1Z P;  1HJK A;  2IFY A;  5DLV A;  4CYR A;  1EW2 A;  4UPL A;  4CYS A;  4LRE A;  1SHQ A;  4N7T A;  4UPK A;  4NWX A;  5DLT A;  1E2S P;  1HQA A;  4FDJ A;  4CXU A;  1EI6 A;  4LQY A;  5LRN A;  1KHL A;  1URA A;  2W5R A;  3IGZ B;  1EW9 A;  5TJ3 A;  1P49 A;  3TWZ A;  3WBH A;  3BDG A;  1AJC A;  4GTW A;  2IUC B;  1N2L A;  2G9Y A;  2ZKT A;  3NKQ A;  4LRB A;  4TN0 A;  5LIA A;  3TX0 A;  4LRD A;  2W5W A;  3NKP A;  5C66 A;  1ED9 A;  1AJA A;  3T01 A;  3UN2 A;  1URB A;  3WAW A;  1ALI A;  4NWJ A;  1ZEB A;  5KXA A;  4ZGA A;  4KM4 A;  3A52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...