3UO0A

Phosphorylated bacillus cereus phosphopentomutase soaked with glucose 1,6-bisphosphate
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
Knots found
sequence length
391
structure length
390
Chain Sequence
b'NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Molecular Differences between a Mutase and a Phosphatase: Investigations of the Activation Step in Bacillus cereus Phosphopentomutase.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 138
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3uo0A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3uo0A01
3UN3A 1EJJA 4ZG9A 3NKMA 4CYSA 3WAXA 1Y7AA 4LR2A 4ZG6A 3UN2A 3MK1A 3BDGA 4LR9A 4FDJA 4LRBA 5EGHA 3WAWA 2GSUA 4MY4A 2IFYA 5L0EA 4TN0A 1EI6A 2W5VA 4UORA 5K4PA 4UPLA 3NVLA 4NWJA 4CYRA 4QAXA 4UOOA 4LRFA 2W5RA 1FSUA 4ZGAA 1EW2A 4LQYA 3NKRA 4MHXA 4LR7A 4CXUA 3LXQA 3IGZB 4UOPA 3CMRA 1EW9A 3OT9A 1ALHA 4LRDA 4UPIA 3T02A 2VQRA 4GTZA 1EW8A 4LR8A 1AJAA 1KHNA 1URAA 1HQAA 2W5QA 1O99A 4GTXA 5KXAA 1KH4A 1B8JA 3TG0A 3BDHA 1KH5A 5L0KA 4CXKA 1KHJA 3KD8A 4FDIA 4UPKA 2XR9A 1KH7A 1ELYA 3NKQA 1Y6VA 4LRCA 5TJ3A 3T00A 1E2SP 2IUCB 4KM4A 4KAVA 3MK0A 1EQJA 5INHA 2GLQA 4ZG7A 2GA3A 1AUKA 3SZYA 1P49A 1E33P 1ANJA 3M8ZA 1SHQA 2RH6A 3E2DA 3DYCA 5LRNA 5LQQA 5DLVA 2W5WA 3M7VA 4KAYA 5EGEA 3NKOA 4LREA 1ZEDA 5GRRA 3ED4A 1HJKA 1URBA 2W8SA 2XRGA 3TWZA 5C66A 5LIAA 3NKNA 1KHKA 1AJBA 1ZEBA 1ELXA 4NWXA 4YR1A 3TX0A 5GOVA 4LRAA 1E3CP 3BDFA 1AJDA 5IJQA 3M8WA 1K7HA 3UN5A 1ANIA 5L0BA 3MK2A 4MIVA 2ANHA 1ALIA 3T01A 1ZEFA 4CXSA 1ED8A 1AJCA 3Q3QA 3BDGB 1ALJA 3IDDA 3WBHA 3NKPA 4KJDA 5LRMA 1KHLA 1ELZA 1ED9A 2GSNA 2W5TA 1N2KA 1KH9A 3DPCA 2IUCA 3B5QA 3A52A 1SHNA 2QZUA 4GTYA 3M8YA 4KJGA 2W5XA 3IGYB 4UPHA 5IJSA 5AJ9A 2ZKTA 1O98A 2W8DA 1ALKA 4B56A 1E1ZP 2G9YA 2W5SA 3UO0A 5DLWA 3WAYA 3SZZA 5HRTA 2GSOA 2X98A 4GTWA 4N7TA 3UNYA 2D1GA 1N2LA 5DLTA 3WAVA 1HDHA
chains in the Genus database with same CATH superfamily
2YY3A 2CZVC 1UL3A 1AXQA 4NI2B 5EUHA 2BJ7A 3PX4A 1MW7A 1A9NB 4DJBA 2OPSB 1RU2A 2WSFC 1J5EF 2EFGA 3HPOA 4M5NA 4ZP6A 1WORA 3OJUA 4CO4A 2CQBA 3QMQA 2IDEA 3UDVA 3GP9A 3BF4A 1FRMA 3KHLA 3BN7A 1DQ8A 3CCTA 4WXOA 1RQ0A 1UP1A 2DXFA 2ZVIA 4FNHA 4WYWA 1X31C 5KFYA 4QQBA 4LSLA 3JSYA 3CJ5A 1VJQA 1IBMJ 1GMVA 4MJKA 3Q8QB 1TK8A 3P5TL 1U09A 4ZK7M 3CMAS 4W92B 4RNNA 4DR5F 4Y65A 3ADAC 1HNWJ 4OX6A 3GCXP 5JVHQ 3DLJA 1CQMA 1WDDA 1ALIA 1RAOA 3H2UB 2XZTB 2JVOA 1X4GA 2DGXA 3BPDA 2UP1A 1WC1A 5GMDA 4HTJA 1FXLA 1E1ZP 3KUHA 3K0JA 3J81j 2RKIA 5KFMA 2PE8A 5LMNF 5KG0A 3WAXA 4R8UB 2CQHA 1Y11A 3CD7A 3I82A 2XMTA 2W9BB 4ANCA 3BPSP 3C66A 2CQCA 2M5YA 3HJFA 3NGUA 3S6EA 4NA2A 3VTIA 3OT9A 5DDRC 4C8LA 2BANA 2WW4A 2Z2LA 5HQLA 3TYTA 4MK7A 2HVHA 5J1NA 4LRCA 2HWHA 1RT1A 4KGXB 1LNQA 2AQ4A 5CH7B 4JI2F 3BZQA 2YBVA 3FVYA 3FSXA 1ZTTA 1RKIA 4ZPAA 4X64J 1KQFB 2F8MA 3QRQA 1X5SA 4B9VA 1S9EA 1U47A 3AY0A 1L3KA 1GTEA 4A47A 2DITA 4L75A 1AZSB 2BJDA 2BM0A 3ZZOA 2NR0A 1PAEX 2NREA 3UCGA 4RLEA 2BE2A 3EVOA 3MR3A 3GILA 2K8GA 4QWAA 4X66F 3IM9A 1IQTA 1HPZB 4R0JA 2UXDJ 3HM9A 4ECUA 1X4FA 3T41A 1S57A 3KJVA 4RUBA 3DOMA 4CYRA 1N36F 3DLEB 2NQPA 4ITSA 3RU0A 2G4BA 4L3NA 1WOPA 5HP1B 1NSPA 2XHCA 1RHQB 4MMOA 2DR8A 2JEFA 2QFJA 2K3KA 3DDIA 2YNGA 4X4QA 3E3XA 5E41A 1MWYA 4JP8A 3DMJB 1UVKA 2HKEA 4PWDA 4LIWA 4K2JA 2CJBA 1TTHB 5MLCV 2H4WB 2EC0A 4L76A 4NXNF 2W8KA 2EK6A 4IFVB 5A2QU 1VQ9S 4L74A 4MH8A 4KV8A 1Y3KA 3PJWA 4MIBA 3CMES 1PC4A 2P9CA 3JXOA 4DV7J 3MEDA 2XBPA 2CPYA 2ZD1A 3DXSX 1BLUA 2ADCA 1S9GB 1UA1A 1NO8A 1H73A 5BJRA 1XIQA 2NS1B 3BQ0A 2ALYB 2GFFA 4QR1A 2HMIB 4I69A 5KFNA 2Z58B 1JNRB 3FCVA 1BQMA 3M9MB 4OHXA 3OSNA 2GA3A 3MUMP 3FKBA 2RF2A 3SBMA 2YNIB 5HMYA 1AT1B 2V8PA 3PO4A 3I96A 3A4TA 2C3UA 2E1CA 4BC9A 3QT5A 1X4HA 1GX6A 2XSJB 3B78A 3QT7A 1FFWB 2C1EB 2IAJA 3QSIA 2XQCA 4ZP7A 3RW6A 2OH2A 4H4OA 3FJ2A 3LP2B 4DV2F 5F9NA 3G82B 4LF9F 3QYYA 2VHGA 3CJ0A 2RQCA 3IFEA 3NBPA 2YNFA 3DRRB 3KLGB 3QO9B 1ZAWA 1IUJA 3ZZYA 4C8KA 4X4TA 1RADB 4B3SF 3OJSA 4C4WA 1MMDA 2O01C 1UZDA 1ZM2A 3CJTA 2FHOB 2HIYA 1MN7A 4WU3A 3TO8A 2H51B 2WBRA 1A0OB 1CJKA 3V81B 2IC3A 5KFZA 2FPHX 4RJVA 2MSSA 2RRBA 1SC1B 4WP8A 3DNCA 3NCRA 4DR2J 3UCUP 1W2IA 3KK2B 3DXBA 5KTQA 4XIUA 1FDNA 2UUCF 1RAEB 1SUQB 2VQFJ 2HG4A 3B5QA 3E8OA 1G4CA 1URRA 1FNOA 3V2UC 2CKWA 3BBBA 3K57A 4J9LA 1RBAA 4DR1F 4QPTA 3N6NA 3MMCB 2I38A 2X98A 3A8KA 4JI7J 3CCWA 1UJ6A 3AT1B 4CLLA 4ICLB 1PSDA 1BMQB 1H0HB 3KLHA 5FDLB 2C2NA 1HYSA 1XMQF 1FRJA 4XPCA 2FZCB 1Q82T 1NPRA 1TMJA 4WF9Q 1K1QA 2KXNB 1FWLA 3M8SA 2GJ2A 4BCAA 8AT1B 1KFDA 2NXUA 2CQ2A 1E2SP 3VQSA 5ETMA 1AW0A 1R3NA 1Y9OA 3HT0A 3TW0A 3WDOA 3IR5B 1U6FA 2AJ2A 1OIAA 1RHMB 5HMZA 4I0WA 3MPVA 3KTQA 2V67A 3MM8B 1HKAA 1IKVA 3GR0A 2GVZA 3S1TA 4LMZA 4ED4A 1T11A 3PW4A 4ZVFA 2JLEA 1UETA 2G0IA 1NM2A 4NLDA 3J7ZT 3EYZA 3DI6A 2G9YA 2CNNB 1N8RT 5C42B 4DX8H 3LO3A 5FJ4A 2J5AA 3HVAA 1OPIA 3BKFA 5AJ3F 2V4QA 3JYTA 2ZH8A 2J6SA 4GKKF 1N5TA 2EFPA 4MY4A 2IBKA 3MTJA 3I56S 3NL0A 1T9YA 1CJVB 1QTNB 3NOGA 5FLXY 4J9MA 1YBTA 1UVNA 4CXKA 2DPJA 1WDTA 4DQRA 1NCLA 4DWIA 3D67A 2DHGA 4ZVQB 4GC7A 5DM6Q 3HKZD 4YOEA 3SQGA 1HJKA 1RHKB 3KUEA 3MM7A 2LMIA 4ZLLA 3ZXWA 2WBMA 4F36A 2QLFB 1TKDA 2XMWA 4JUZA 3UW1A 4CXSA 1YBUA 1HMVA 3G8QA 5DZ6A 1AFIA 2ATCB 1S1UA 2J0SD 1KTQA 1W25A 4K4XA 1N88A 5E2QA 5E3CA 1N32J 1UA0A 2DNZA 1HI0P 4LFBJ 1VK3A 4WFYA 3HHDA 4LFCJ 3GFZA 1HDHA 3RAXA 5LOQA 3QRRA 2JH3A 2Y9HA 1M5VC 3UN2A 4GC6A 1NU4A 3OFHA 1QVGR 4TN0A 4DS5A 3O3LA 2EWHA 4J9SA 2BJ8A 4J9OA 1JLAB 5I4MA 2MZ1A 3UD5A 2Z2YB 3IG1A 1ZM4A 3NEKA 1RISA 1GFWB 1RABB 3R5CA 2AX0A 2KT5A 3AH6A 5J1EA 3MEEA 1H6KX 3CCJS 4IH6A 1IBCB 1RAGB 4K4ZA 3AOAA 2CPZA 2EG1A 4CYUB 3M8ZA 5DM7Q 2FJDB 4MKAA 4YEAA 4F25A 2VPYB 1S1VA 4QPXA 5K8PA 4EBEA 1U1OA 1FRHA 3DRYA 3W65A 5KFQA 1SKWA 3MPDA 5IOLA 4DPUA 4L6V3 4J9PA 3NS6A 2VC1A 5IT0A 1ZYQA 3EZUA 1FK9B 3MEGB 1EX8A 3DHXA 3DLHA 4K4UA 5B08A 2X1BA 1JKHA 4MTPA 4ANDA 3LPYA 4JYAJ 2J9EA 2AIRB 3K5MA 4DV0J 2PI5A 3MPYA 2QGFB 2O5DA 2GGPB 3MPWA 4OJ1A 4QIVA 2OD4A 3JSBA 4ZPDA 1B0VA 5A6WA 2G2OA 4B3RF 2GHPA 2DKOB 1W7WA 1CS4A 4JOUA 1FRLA 5HP1A 3KD8A 3VGVA 1FA0A 1VQ8S 1QJHA 1X4CA 4FKXA 2RH3A 4DN0A 1U2RA 2XHWA 3R6GB 2V8VA 4DG1A 3GFYA 4I56A 2ALZA 5C66A 5C5JA 4DR6J 2C2MB 2IRXA 2AHOB 4WZMA 5JXSA 1N33J 3VWSA 3HFVA 1E6YB 1IBKF 2V9KA 5F9LA 3IM8A 4YB1P 2RS2A 5FD1A 3GLJA 3HHEA 2RMLA 1NKEA 2GJIA 2JSXA 2YKMB 4KKOB 3GV5B 2JC1A 1DRZA 1U1LA 4LF8F 1JXEA 5THWA 2BE9B 2DR7A 1RT6B 2L3MA 4LF4F 3AA9A 4IDKB 2MB0B 3BH7B 3HD2A 4PCQA 5HANA 1GXTA 2XGQA 4Z37A 4A4JA 3GPAA 3W64A 2VOPA 3QJJA 4A8WA 3QBCA 3EVMA 2POKA 5HAOA 1ZZNA 1S76D 2FQQB 1K0VA 1HNIB 2HQCA 2EC2A 3QWUA 1ACMB 1FNXH 3I0SB 2E5LF 3NKOA 1C1CB 4PYAA 2R7XA 1NK9A 1LWEB 2FB0A 3T5KA 5K8NA 4K4YA 2VASA 1OS5A 2VPWB 2BE7D 1AJCA 3TARA 4UOCA 3RUBL 1D9DA 2GSNA 1N2KA 1HHQA 1XMOJ 4ZVSB 1UPPA 1N5SA 1IR1A 3MAAB 2V69A 3J7YI 4CH7A 1H98A 1HQEA 4ZDNA 2XWXA 2VBXA 2OFGX 2HBQB 3C15B 1HQUB 4OIXA 5E3QA 4F0KA 4FF1A 5A8KA 3BH6B 4WU2A 4C11B 2HYIB 5C24A 1VIXA 4ZA1A 5HROB 5CYQA 3LTOA 4I6YA 1U0HB 2EEYA 1ZOTA 2VUGA 3TVZA 1JK9B 4ZPCA 5A8WB 4K2XA 1P8GA 1KQSR 3HHNB 1HR0J 3SZYA 3HJVA 2UUAJ 5BYRA 1F9FA 3ILLA 4OMFG 3RAMA 4D3HA 5GAEI 3T1HF 2E5GA 4LF7J 4J91A 2YQ0A 3GE9A 3KK2A 4KJDA 3ITHA 3LGNA 3ELHA 4LJMA 1SV5A 1SHNA 4CLTA 3OPKA 5IQQA 4OLOA 2YH0A 1MN9A 1RDRA 1NLKL 5D78A 2P5VA 3IP0A 3LP0A 1S1WB 5DG9A 2V4RA 1BHNA 5HLFA 1JLFB 2WVDA 2GHVC 1EJJA 2GA7A 3CJ8A 4F26A 4G1QA 3BDGA 3C8YA 4IRDA 3V6DA 4PPZA 2J6TA 2C2OB 3V6KA 2RDDA 3TZWA 1J5EJ 3CCRS 4J9QA 4CI0B 1URAA 2F8EX 1IKXB 3DLKB 3IO1A 1NK8A 2J6UA 5IC6B 2NUUG 4KGVB 2W9CA 2B6AB 2KDOA 1CSJA 1YK9A 1SL2A 3P6YC 3V4IB 1T9UA 4B9MA 2B9WA 4NWXA 1C1BB 3AXKA 2DRAA 4F4ZA 1K7HA 2EFVA 4IUFA 4RU9A 2IDLA 2KYZA 4FBTA 4IG3B 4CLWA 4DR5J 5BYSA 1M5SA 3P3DA 3PHEA 3NCQA 4CT8A 3RB4A 1V9OA 4NYOA 5IXUA 4U6PA 2IVMA 2IMWP 1H38A 2FVSA 2DNMA 4CH0S 3LGHA 2PGCA 3DC2A 2FVPA 1B0TA 3PFOA 1CQNA 3ILJA 2L08A 1WNEA 4P7VA 1CJTB 1RWMB 5KFBA 4B3TF 5LMNJ 2Y1IA 4P10A 1NK5A 2R7VA 4MYTA 4DR4F 4L72B 2UU9F 1UEUA 2C2EA 3QATA 3T02A 1AJAA 3DCAA 5CCLA 1TL7A 1J27A 5KFRA 2K06A 4X84A 5L9NA 3L95X 1TKXB 4MK9A 2BXJA 3AD8C 1U25A 3MM5B 2HNZA 2NSCA 2IY5B 2HK3A 1BWVA 2YH1A 2C28A 1XN9A 2XS5A 3K17A 4K5RA 5HSPA 4ECVA 1F3VA 1Q0NA 4JI2J 2ZZMA 5IJQA 3BB5A 4USUA 3R2DJ 1L3UA 4CIOA 1SC4B 3M30A 1X4AA 3TA1A 4ECZA 4CP5A 3HT3A 4KIAA 4LVNP 2MJNA 3TP2A 1RWUA 3R5GA 3MMAB 5HRTA 4N47A 5DLTA 5EWEA 5CZVA 3OR1B 3NWGA 1Y7PA 2B0GA 5IV3A 2MKJA 1OYDA 3M2VA 5LJ5Y 4X66J 4HHHA 4G65A 4QYRA 3UPFA 2AP6A 2VG6A 3DGPA 5E3PA 3VGTA 4CM0A 1RA7A 2HNDA 4I64A 2AF6A 5ETOA 4UPIA 4LVOP 1LEOA 1N5YB 2BM1A 4OI2A 2W5QA 2YXLA 1N36J 3C16B 4FF4A 1ELYA 3IN5A 2A10A 5F8NA 4RW9B 4DSLA 2YKAA 3CWJA 3ET6B 4PUOB 3A1YG 1ANJA 1E33P 3G6VA 1EZZB 4M5JA 1T3OA 2CQPA 5DLVA 1WEYA 3Q2SC 1Z2LA 3RZAA 5DLFA 3TWZA 2FVCA 2DRBA 2KJVA 2DH7A 5BYQA 5J2PA 4B9TA 1AJDA 3IBWA 4FXWA 4AL5A 2GAHC 4CLUA 1M5KC 5KOXA 3Q8VA 2IUCA 5CD4H 4NLTA 1FXDA 4NXNJ 1EKRA 4ER8A 1TL1A 2O1PA 2CPFA 1RUSA 3IWXA 3PVXA 1DJ0A 3KLFB 3WAVA 3AQPA 1S72S 3DOLB 2OKQA 4ERDA 1S97A 3G96A 4CH1A 2CJQA 2DGTA 2MQOA 2LCWA 4RUCA 2AJ0A 4FYYB 2QJ3A 1MMNA 3Q8SB 5D6GA 4TVAB 4I4BA 4CZCA 4JI3F 2R8JA 2IM0A 5FLXU 5KFFA 1F5BA 4IG0A 1T0TV 1VRTB 4LFAF 2ILZA 4DR7F 3P45B 2F9DA 4LF1A 3F41A 3R97A 4QOTA 3TX0A 4ELVA 4J9UE 2B5JA 2C42A 1RAJA 3CE8A 1LW0B 3D4JA 5LRMA 3VALA 3E01A 3MMBB 3IGYB 5GAHU 4YHHF 5C2CA 5C7PA 3IS9B 4H4KA 4O4RA 4BS2A 3BGUA 1FERA 3L9ZA 5SUHA 5E3AA 2QL9B 4AFFA 3H5YA 4DV2J 4LF9J 2MYFA 2WSEC 2X1GA 3PR5B 4QAXA 1AUSL 2HHTA 2W5RA 3HKWA 1GQEA 5D15A 2QYCA 5T41A 1VOMA 2DHXA 1O5JA 4RW7B 4B3SJ 2PDAA 2B4PA 3QGHA 4C8YA 2ROEA 5L46A 1VLOA 3E2DA 4RW4A 3QLHB 1RCXB 2D74B 3KLIB 3LW5C 1D8ZA 2JNJA 2UXBF 4I67A 3KJFB 2GQCA 3C6UB 4OZ5A 3KWMA 2PMWA 3DRPA 2AYEA 2ZH1A 4DCOB 4EGLA 3QFWA 4NLSA 3DPCA 4YFUA 3M8YA 3RYLA 1DFDA 3VAKA 5H1SV 4X4SA 2UUCJ 4OYAA 3MECB 3CCLS 3MAAA 4N7TA 3M8PA 4B3MF 1IM4A 1WKLA 4RZRA 4DHVA 3D7SB 3C15A 2YKNA 3O8WA 1RAHB 4DR1J 1YBAA 2X3DA 3A8IA 2RS8A 1PBAA 2FVRA 3KG4A 4ZJQA 1IR0A 3F0NA 2W25A 1HI8A 5KT6A 1IM6A 1U0HA 3W5ZA 4DV5F 1VQNS 2AZ1A 4ZHRA 2RRAA 1HA1A 2XLJA 3FFIA 3SV3A 2FVQA 2PEBA 1U2FA 3T00A 1M0SA 3FRYA 3JS9A 2V2ZA 3AB4B 4RU2A 3O2IA 2LQ9A 4CO3A 2OPPA 3QT6A 3H98A 3MM6A 1X5PA 4E98A 3DRXA 3H5XA 1U4BA 1XEZA 4K0KF 3T9ZA 5ETTA 5I42A 4P2FA 1KP6A 1D0EA 4NPOA 1DLOB 1LQ9A 4ED7A 3L7PA 2AJ4A 2CPEA 2FC8A 2LQBA 2UV8G 2AGPA 2R2UA 4OI1A 3I0RA 2FGCA 1TKZA 1RTDB 4AUKA 1H7XA 3M8RA 2ZNZA 1DTTB 3THPA 2K3IA 3KK3A 3HI9A 2YQ3A 5KG6A 2ERRA 5J1PA 2DO0A 5AJ3J 5L1LA 3JQMA 4GKKJ 2IVYA 2VG7A 3D3CJ 4P9SA 4DI6A 3NKYA 3CJRA 2DNOA 1LXNA 1HQAA 1O99A 4AXIA 1F9HA 1TELA 4I68A 2R7RA 5H9FK 3K59A 4CO5A 4K8RA 4ELTA 1X9SA 3EJMA 4NEZA 4O0NA 2IJRA 4A8FA 2EPIA 2H65B 3GQCA 3K8WA 5GOVA 1S0VA 3PEHA 4UF4A 1B0PA 1RWXB 3CDBA 5ADZA 3GIIA 3H25A 3BSNA 4UTGA 3WAYA 2HIQA 1WHVA 3CW2C 2JEIA 2V68A 3CDAA 2ZH9A 2E1AA 2R7QA 3FGVA 3M6VA 5HATA 2FJWA 4DV4F 4LBPA 3RG6A 4OYBA 3M9NB 2AD9A 3CNQP 2GMHA 3GIRA 2LQJA 1ITPA 4CLSA 5AE1A 2Y8YA 3FCHA 2DO4A 1FI4A 4IH7A 4Q0BB 1Q5VA 2CNKB 3OL8A 2MLXA 4NX9A 1OQ6A 2XS2A 3W61A 1B3TA 4H54A 4PG5A 1Y6VA 4EYIB 2VODA 4PQUB 2LXUA 3GCWP 3KHGA 1JLEB 3JTPA 1Q16B 2IA0A 5H9FJ 3EUNA 3PZPA 2PN6A 2HFUA 1RB0A 2M0GB 3G8TA 1R8CA 5F8IA 4HHJA 5DG7A 4F2SA 2JEJA 2CRLA 4USIA 1H74A 2VFSA 4MFBA 4OYMA 3FZ2A 2XO6A 3RW7A 5KFLA 2B7BB 1F60B 4HACB 4KGKA 1WSVA 2J0QD 2LA6A 4F4YA 1MWQA 2OIHA 2QA2A 1X4DA 2UVVA 4JI0J 1UWBB 3OTDA 2AKWB 2AYGA 1REVA 1QAYA 5J2QB 2ZBQA 4YB7A 1KNZA 5KFHA 1CEZA 4WFXA 4WFNQ 5KFXA 4RNFA 1IKWA 3OFFA 3GWCA 4ZN1A 4FS1A 3D3BJ 4TN2A 4DFPA 2WONB 4ED5A 3RBXA 2O66A 3R1HA 1GXUA 1RTHB 4URGA 2XWYA 4A8YA 3ENWA 1KH5A 3MD1A 1M1KT 3HXMA 1Q1KA 2NXEA 4ZP9A 4B3RJ 2VA3A 4EK2A 2FJXA 1IKYB 3A13A 5LXYA 1VLYA 3BGOP 2D9OA 3ET6A 2MKCA 4USJC 1IWGA 1SI9A 2LVWA 2W2NP 1R0AA 2NXJA 4EMDA 3Q22A 1IVZA 2RB7A 4KY3A 3ZZUA 5EWGA 3M2UB 1LV5A 7FDRA 5IV4A 1R8PA 1O98A 3BKTA 2P6TA 5CHCB 1WHWA 2W2QP 2ZVSA 4CO2A 1LW2A 1YJWS 4FZVA 1C0TB 1Q95G 4WIIA 5BR8F 3KLFA 4ZG6A 4ECYA 1B64A 1U48A 3OXFA 4YB5A 3WX8A 2CG4A 1J5OB 2XM3A 2OI2A 1NAQA 4LF8J 3GZ7A 4V19J 1F2HA 2ZH2A 1Q7YT 5C25B 2JOQA 4V1Ak 3FQLA 2SXLA 4UZCA 2MQPA 5K8MA 2WB1D 4C97A 1N48A 1U1MA 4JB8B 4FDIA 4F02A 1Q86T 3CJKA 5K14A 2KT3A 4PWWA 3DOKB 4J9RA 2DNHA 3CJSA 2HQ3A 1F3FA 4ECRA 5L0BA 3QAUA 2M70A 3AJ1A 5CQGA 2E5LJ 1KLNA 1FDBA 3C14A 4P72A 4HHUA 1HIYA 3D0HE 4USHA 2F5GA 1NK0A 4FN5A 2QLWA 3SZ2A 4DQQA 1U6BA 4ES1A 2ZDPA 5JVGQ 2VPZB 3UCZP 3IRXA 2ASLA 1RTJA 1H7WA 1HWLA 2JZ5A 4PR6A 1RXOB 4R25A 2KVIA 2D7SA 2MKYA 1O51A 2CXEA 1S1TA 2I9SA 1UMJA 4DX7A 1VK8A 4U8YA 4HR2A 2RNEA 4UT4A 3W2VA 2QSFA 2OELA 4MHXA 3LXQA 4PQAA 2Z56B 1WACA 3FMBA 4E2FB 5FIIA 5EHHA 1WC5A 5A2QY 1IN0A 1SJFA 5IT9U 2FJAB 1LK5A 3PJXA 5IZHA 2QL5B 2XLIA 3CO0P 3KLEA 3ILOA 1T9XA 1N4LA 2RKIB 2HK2A 5L1IA 3P49B 4FNIA 1G1XA 1YQHA 4XO0A 1MU2A 4NA1A 4YB6A 3QIDA 3UR3C 3DGVA 2HHUA 3T1HJ 1XR5A 1GEHA 4M5GA 4B02A 2MGZA 2P6SA 3UO0A 3NMRA 4G1PA 3H59A 4DL2A 4Y2KA 1VBXA 4LF5F 1QTMA 2BANB 2ZH5A 2UXCF 4FYVB 3LANA 2GQQA 3MECA 4Q44A 4K59A 1FEHA 3R8YA 2LLZA 4J7CA 3TA0A 3ETMA 1R7IA 4ZGAA 2M9KA 2D3UA 1S9EB 2JFDA 2B3TB 1VR6A 2ZBPA 4ZPVR 4UPKA 4MYUA 4RPFA 4RBTA 4Y6IA 3HP6A 2BE2B 3R27A 4OI4A 3TI0A 4QIEA 2Q66A 3SCIE 2EK1A 1NSKL 1RWWB 3CDEA 5HQMA 3M1VA 2N4CA 1EHWA 3MWBA 2WCXA 4B9UA 3ZC4A 2RHSB 3GFXA 2MZJA 3KJVB 3W9IA 3DOMB 2Y1LB 2FZKB 5F8JA 1QSSA 3HDSA 4WP3A 2HHSA 1TL5A 4OQJA 4KGMA 2W5SA 4NLVA 4WPAA 2AZ3A 3H4BA 3HVRA 1YZ7A 2N7YA 1UFKA 4RBVA 1TAUA 1I1GA 3ISZA 2QEXS 2YNGB 5GMKa 2KZMA 3T5JA 4CCHA 3D2WA 4I1TA 2FHJD 2W5VA 5KG7A 4IRCA 2R2TA 4PWDB 4DLGA 2ROPA 2BKOA 1FTCA 4Q7AA 4B3TJ 3J7A1 1B70B 4KGZB 1QSYA 3GU0A 1B99A 4WWSA 4DR4J 3BYRA 4HI1A 5I3UA 2UU9J 1U45A 2Q6CA 4KV8B 1Q8LA 3HCXA 4P71A 3FBEA 2XYPB 5D3GA 2NXCA 5KFUA 4YMEA 3MEDB 4CNYA 4FXVA 1VRQC 4NZ6A 5M2RA 3US5A 5KG5A 3ZTQA 2ZD1B 2BR0A 3M8WA 4IKAA 3TZXA 4DUZJ 2UUBJ 3UFCX 3IA0A 4PEOA 2PIIA 2CVEA 4ED0A 2Z57B 1YSJA 4M5DB 2V50A 3T5LA 2H54B 1I5OB 2WVCA 2LP4A 1BQMB 4RNMA 4WE1A 3H2VE 2GIFA 3AXMA 1FE0A 4LBHA 2BACA 3N4WA 4XPEA 1RYRA 1XBWA 2RF2B 5A6PA 2OEKA 2R8GA 4YY3F 1RWVB 2AEFA 1WOOA 2X51A 5D4PA 5F8HA 5B0GA 1OMSA 2FLLA 4Q0BA 1MNEA 3TEHB 3DLBA 2FY1A 2IAJB 2MXYA 2GLQA 3VGUA 3A3PB 2DNRA 4H4KC 4KAYA 1JLQA 4B17A 4LREA 2AYBA 4B9LA 4H4OB 1OYEA 4JI5F 2VICA 4LRAA 2E5IA 4C8ZA 3NBPB 2XNQA 2YNFB 2E7WA 4NRTA 5CCMA 2VFRA 1BD6A 4DR3F 2V2VA 2BRKA 3GYXB 2A6MA 3EGNA 2DEJA 4BHQA 4CLZA 3PO5A 3KJNB 1N2LA 3D6FB 3OFEA 4OX7A 1NJYA 3N9UC 4ZS6A 2GMJA 2BVZA 4RO0A 4V19X 1CJKB 1Y7AA 2M4MA 2GIRA 2IC3B 1JLBA 4CT9A 1QD1A 2B4OA 3KOAA 2ZZTA 2W24A 1QY7A 3EXCX 2CYYA 3FCWA 1CC7A 3R3TA 3VAIA 2FC9A 4DV6F 4UY85 1JLCA 3CDUA 3H2LA 3SEOA 4N76A 2AGQA 2MQMA 3KDNA 1R0CB 4RX6A 2B51A 3TJAA 1ZA2B 2R7UA 4JI3J 2HRTA 2EKNA 2IIHA 5LQQA 2HW3A 2LECA 1TK5A 5EGYA 5ETKA 4LFAJ 4DR7J 3D9BA 3MFIA 3L3CA 5KFOA 3HHKA 2ZFHA 1TFYA 1FJ7A 3KLHB 4FF3A 1YZ6A 2A0FB 4YS2A 1HYSB 2QE5A 1AA1B 4ZVOB 5LJ3Y 2W1BA 2VU5A 3OQ2A 1HLWA 2HZVA 2ZKTA 3OVAA 2COLA 3MD3A 2OUGA 3VAHA 3SYZA 3EWGA 4M5LA 3TRGA 4PXDA 3G6XA 3GV8B 3OSPA 4YHHJ 5HQ8A 3X3UA 1Y4ZB 3TVKA 1VGYA 4W4MA 1PYOB 4XDDA 1ICEB 1C0TA 2R9LA 1JJHA 2DRDA 3JTOA 3HHLD 2YWKA 3M6UA 1IKVB 4UOPA 4QU6A 2GVZB 3WHIA 2C3YA 3I4HX 4QW9A 1BWEA 1P9QC 1RHUB 2DGVA 4OJ3A 3T9NA 4RW6A 4DS4A 3EGVA 3DI6B 1RTIA 1SHQA 2LU1A 3MURP 4FDFA 3MAHA 4D3GA 5A0YA 4CQ1A 3JYTB 3BGLA 5DQIA 1KQGB 2QG9B 1HW8A 1NK7A 2OMOA 1VQOS 2UXBJ 2QA4G 4I7FA 3G9CA 1Q8BA 2HFZA 2HHWA 4DPWA 4OI0A 3BQ2A 1GNKA 1SXLA 2GMLA 1HHTP 1IQZA 3D1OA 1D3WA 1HL6A 4MKYA 4NZ0A 1UJ5A 4B3MJ 2AJFE 2UUWA 4ZPWR 5D8HB 4Q2MA 3SQGB 2KG0A 1FO1A 1X9WA 3MM7B 2ATLA 3N5FA 1OY6A 4CO1A 4EU0A 5KXAA 3RJMB 2E1MC 3OR2A 2KFZA 4DMZA 1HMVB 3W66A 2N82B 1S1UB 4IYQA 2LEAA 3CIZA 1RHRB 2DGQA 3W5XA 4CDIA 1HBNA 4DV5J 3CJ3A 5LSRA 1T9TA 3UWTA 1ZEDA 2FYXA 2G1DA 1DHMA 3MOZA 4NLOA 1T7PA 4OL8A 3VAJA 1P27B 1TVRA 1UZHA 4K7QA 3IAS9 4K50A 4K0KJ 3GYNA 3KK1A 3MAQA 1DARA 3SZZA 2XLKA 3HHLA 1PJ6A 4R5PA 1NJXA 3KDOA 3IG1B 2HEKA 5IT4A 5J1EB 3FSYA 3H7HB 3MEEB 1F9EB 3NKMA 2IA6A 2LEBA 5GMEA 3IGVA 3OVBA 2HVIA 4ID5A 2RILA 3N01A 3R7NB 1WC3A 4KHMA 4ECSA 1RWKB 5B0EA 2CPHA 3ENAA 1S1VB 1Y3JA 1LWXA 1XJWB 3BDPA 2ZHBA 3I87A 1SJRA 1F2GA 3B54A 2X7IA 5CD4A 4DL6A 1VQSA 2XS7A 1LWCA 2YQ1A 3TA2A 3PKYA 3J7YU 2XULA 2H5JB 3DYAA 1L3VA 2ASJA 3QGGA 2PFFB 4USVA 1KEKA 4G1IA 1PO6A 4A8MP 3BM7A 1JKHB 4HT7A 2DCLA 1UJ4A 3TUIC 2Q6BA 3O5TB 5KFJA 2JJ4D 3WBHA 2DH9A 4YDXA 4AT1B 2HURA 2WOMA 1XWLA 4O3NA 1LXJA 1G6BA 2H9ZA 2B8QA 1H2UX 1BC6A 1TL3A 2GW8A 3K5NA 1CS4B 4DV1F 3PYEA 4ZPBA 3I5BA 4KB7A 4GO7X 4NLWA 5DDPC 1XERA 3N6LA 4U9RA 2BZ2A 3L09A 2R7SA 1Y5IB 2B7CB 2IM2A 3QFHA 4N8OA 1Q4RA 1YJTA 2LQ5A 4DG1B 5GAEU 4DV4J 2IMOA 2DT9A 3TZZA 1HW9A 4FVMA 5AXMA 3GTYX 3TG0A 4RNHA 5KFAA 4ZCKA 2VQEF 1EETB 1V3SA 5JJBA 5LL6d 3Q8PB 2G9OA 4X4PA 3BREA 5K9FA 3M9OB 3OTBA 3KMQA 1S1XA 3ZZPA 4Q5VA 4DU8A 1UVMA 1URNA 1NPPA 1WWHA 2VDIA 1JXVA 2ZBIA 4GO5X 3B82A 2W01A 2Z8QA 1VJWA 1HNVB 1SJ1A 5T7LA 3SMZA 4QU7A 1BGXT 2YVSA 1RT7A 4KAIA 3DKDA 2XG8A 5DDQC 4M5DA 3QIPA 4F4WA 2OGUA 2HFNA 4JI1F 1SJQA 3VAGA 5F8GA 3GG1A 4PG4A 1DY3A 1FDAA 2BRLA 1RT5A 3HX9A 3V4MA 1CJUA 1WG1A 1PIEA 3CDWA 4QWDA 3KFWX 1K8AT 4KYZA 1WKKA 2HHQA 2YWWA 4F8RA 2PO4A 3DHWC 2CJYB 4ED3A 3C2PA 1HNZF 4DFMA 1G2EA 1TP7A 1ZPWX 2CPDA 3GYGA 2BOPA 2W4PA 4Q8FA 2RT3A 1KS2A 1EJ7L 4P52A 2IPOB 4O3QA 1HQEB 2R7TA 2VA2A 2PMZD 3AJ2A 4TYBA 2BJEA 4C9DA 2QA4S 4M8LA 2OTJS 5A8KB 4OI3A 1VISA 5C24B 3FMWA 5CYQB 2IRUA 1SIWB 2MKKA 3Q8YA 1R27B 4LBIA 7FD1A 1NHUA 2RU9A 2VQFF 1LFWA 1TL4A 3SXLA 1U6ZA 2HQDA 1SH3A 3BGRA 2OJ3A 2ZM6F 1NMEB 1R8AA 2N3LA 4NCBA 3BYPA 3BN4A 2EFNA 4KJIA 3R5JB 5LSOA 2ZWOA 3E2EA 5BR8J 1XNQF 2J8AA 2R8KA 4F0MA 3NNHA 3SCKE 2V8DA 2KL8A 2OD6A 2PA3A 4LR8A 2G2YA 3CF5Q 1T03A 1AUDA 2VKRA 3ITHB 2HFSA 4NLUA 1CBKA 4ED6A 1SV5B 2KJWA 3LAKA 1YLXA 1N6QA 4ZG7A 4Y2MA 3EPIA 2V9WA 3FZBA 4OHZA 2F1FA 3LP0B 5DLGA 1O0PA 4CLFA 5ETVA 2PT0A 5HLFB 2Y1RI 3GJRB 4DL4A 2R8IA 4C0OC 1EKSA 2VG5A 4G1QB 1UVIA 1X4EA 3BDGB 5L8RC 1KLMA 3PDNA 1Y00A 4KR0B 2XMAA 3PM9A 2DISA 2PA8D 3V6DB 3V5RA 1NNDA 2FDNA 4DPXA 1H2TZ 5J2MA 3CJ2A 1R31A 2GX8A 1XR6A 4KSEB 2GO8A 1AB8A 1C4CA 4RBUA 3PYFA 1QM9A 4Y2IA 2HQFA 1W2BR 1E6VA 3KG1A 1PJ5A 3Q8UA 2W9CB 3H0PA 3HLUA 2IFYA 3VV2B 4AL7A 1TV6A 4KO0A 3UDCA 4ILLA 3TJ9A 4WTOB 4UUXA 2V2KA 2F63A 1ELOA 3OHAA 3PW5A 3ENQA 1GK8A 2EVZA 1RAIB 2J9CA 1WI6A 3PG9A 5IWAJ 4GTZA 3SIPB 1I94J 4QIFA 4PXEA 5IC4B 1M1GA 4WJBA 3O1LA 4MK8A 1VCTA 3POTA 2MQLA 1KBRA 1NDPA 4USTA 5HMWA 1OSCA 6AT1B 4U7UD 3PW2A 1SIZA 2UUTA 1HD1A 1H3DA 4ED2A 1YWXA 4HLBA 2DNGA 1VBYA 2WW8A 1BUXA 2MKIA 1K0TA 1VQLS 3A12A 5KG2A 3MCMA 2M2BA 3QZ7A 1S6PA 3BBFA 4U95A 5F0UA 5KT3A 2WZ1A 3LPEA 4OZNA 3H20A 1F5AA 2MKSA 1TL7B 4NL5A 2BABA 1JJ4A 3H8YA 2HGMA 3WZ0A 4J90A 1OO0B 1NHKL 3MR7A 4LF5J 3HSJA 2HNZB 2UXCJ 3CCES 4WFBQ 2ZKUA 1SQEA 1Z1ZA 2AYMA 2J8SA 2AJQA 5ETLA 2YWHA 2HRUA 5KFCA 1GMUA 4LRDA 5LT5A 2QX0A 1NDCA 3TOQA 4U7UK 3VZIA 1HWKA 2CPJA 2ZDOA 3M30B 2R2RA 4UQGA 3ZTSA 3UQSA 4B9NA 2XY6A 2HBZB 5A8RA 1FKAF 1KOHA 5ETPA 4JV5F 3C6TA 3LAMA 5HK4A 2W8SA 3JSMA 4J9VA 4DL0C 1F6TA 4YQWA 1J2VA 3ISNC 1HBMA 1Y5LB 4LSNA 1RBOB 4ETZA 2YNHA 3M2VB 4A48A 3D5MA 3E51A 4TU8A 3I9ZA 4HI2A 2VG6B 2K7KA 1VQ7S 3DGPB 1FRIA 2A2DA 2ABYA 2HNDB 2RDIA 2PMHA 1HBUA 1XQIA 4ZJLA 5HN0A 2X1AA 4C3MA 2I5JB 5IM0A 2QTWA 5D0GA 3Q23A 2QYGA 5H9EK 2W2OP 3FDSA 4BC7A 4JYAF 2OSQA 1SQFA 5AE2A 1KVIA 4MKBA 4O4GA 4UOOA 4PYDA 1N34F 2XMJA 1VQPS 2MZTA 5J2PB 3FEXB 1RLDA 4YR2A 5DG8A 1QAJA 2G0CA 4O0IA 1R89A 5HMXA 3MM9A 3EM1A 2IUCB 2HQIA 3B4MA 1TU0B 4ZN3A 2XO7A 1RTZA 1N52B 2WK4A 2VH7A 3OW2R 1TL1B 3AOCA 1S0NA 2DGSA 1U02A 3QPIA 3N5BA 3W5YA 2AU0A 4ZIWA 1WC6A 4HL9A 1IWAA 2CADA 2E5JA 3CC2S 4Y28C 3UDEA 1NKCA 2CQ0A 3PRVA 1VS3A 2DBBA 2MPUA 1N33F 1EP4A 4Q2LA 5CAAA 2PEHA 3M32A 3SDEA 3W9JA 1MSWD 5J2NA 4X4UA 3NOCA 2JDJA 1EAYC 2D1GA 4RR5A 4F67A 4N8NA 3IBCB 4J37A 3RAQA 1K1SA 2VBWA 4IG0B 3ZTPA 3WQPA 4LR2A 3AHPA 5H9EJ 2LDYA 3HO1A 3WAWA 1CULA 1I51B 2BQ3A 1SB6A 5L1KA 4O44B 4EO6A 3LUYA 2XC9A 1NPKA 3G87A 2RDJA 1HNXF 4DUYF 4GVLA 1HBOA 4KHRA 2B5JB 3NNAA 4GVBA 1DURA 3GIMA 1GX5A 2OEMA 3H4DA 3E01B 3FUYA 5E7OB 1XNRF 1EETA 4O3SA 3KNAA 1RT4A 1PKUA 3Q89A 2BKPA 2EBEA 3QT8A 5GADI 2K1RA 3ED4A 1URBA 2GVDA 2PD1A 4ZCIA 4C8OA 2ZJQQ 2Y1JA 4H4MB 2ZOGA 2ACMA 4JI5J 4KFBA 5DS7A 4DQPA 3MCSA 2F40A 2ZH3A 1RZMA 3R6LB 2KZZA 1HNVA 3PYGA 4DR3J 3FQKA 4L73A 2NLWA 3MUTP 1BXNA 2HNYA 3CJ4A 2DJWA 2CWXA 2MJUA 1WKJA 1U1KA 4FDJA 1ZA1B 1QE1A 1KTVA 3H40A 4UORA 5K4PA 4RW4B 3IGNA 1UFWA 2DHHA 1T02A 5F0WA 1EW8A 2DCUB 3NG8A 2CQDA 1O6XA 3GB0A 3CO9A 3EXYA 1TFWA 3DRPB 3DRSA 4ELUA 1EARA 2OO4A 2A18A 2KVQE 4YDDB 2MEWA 4LT6A 4DV6J 1Q78A 3K5LA 3B4DA 2A3JA 3RR8A 6FDRA 3M8PB 2IJNA 4RKUC 3NGKA 4MAKA 3L7UA 4HKQA 4CNZA 2YKNB 4ZKAA 2UZAA 5D0HA 1IJFB 4N41A 4WIQA 4OYZA 4WK1A 1HI1A 1KHLA 2J0XA 2DYAA 5EDWA 3VHQA 4IR1A 4FXDA 3NS7B 1VDHA 4UPHA 4L3KA 2F4VF 3HF5A 3D6MB 1NJWA 4LQ3A 2ZH6A 4LF6F 1S59A 4KHPF 1AROP 1FKOA 2DPIA 4ZHRB 1VMBA 5F3ZA 1SCJB 3FFIB 4NASA 2WVEA 4WXWA 3F73A 4QYZK 1S6OA 4HTIA 4QWBA 2Y3YA 4TNOA 3SQOP 2OPPB 4XTTA 2CQ4A 4LQYA 3MM6B 1RWOB 3ETOA 4DPOA 3A8JA 2W2MP 5I42B 3OUYA 5GAGI 4DV3F 2CJXB 5G4DA 5C2GA 3D1QA 2WB4A 4ZVEA 3WIVA 3IWNC 4YP3A 1Q53A 2P9GA 2CPXA 2HHHJ 4FVCA 2QV6A 4M1KA 3I0RB 2ZE2A 1TKZB 3HHLC 1YVFA 2B4VA 3HFKA 2M3DA 1VQMS 4K4WA 4X4VA 3TUPA 3DDKA 2MQ8A 3KK3B 3PEJA 3F56A 4IO1A 2MLZA 2DH8A 4HYKA 2DXDA 2KRRA 1T9WA 2V4JA 3SCJE 2VG7B 3M2RA 1I3OB 3UNYA 2HAIA 3CCUS 3RBZA 2MZRA 3CC4S 4Z7CA 3W2WA 4Z2XA 4QYZJ 3W63A 3PNIA 2ZBCA 4LQ9A 2A6OA 3TAMA 1IXKA 1Q5YA 3A8EA 2C22A 3T1YF 2NUHA 2FJVA 3EDRB 2CWKA 4NLRA 5DRKA 2JEGA 4OV6A 4X65F 2KKHA 5ETQA 4C3LA 1CG2A 4P6QA 1KQKA 2XB2D 1Y5NB 2IHR1 2G13A 2AWZA 5IQ6A 1ZS6A 1SQGA 2W8LA 3P8BB 3M8QA 4DUTA 4NMXA 2O67A 2W5XA 1DQAA 1FKPB 1RWPB 3T1AA 4MKVA 4TYAA 1T9VA 2NPFA 1FT8A 2LEPA 1F1BB 2HFVA 1QDUB 1RACB 5KOWA 2P9EA 4P2XA 3WBZA 4DPTA 1TKTA 2DTJA 5CABA 3F44A 3RBDA 1RE1B 3NAHA 1FHTA 2MSTA 3QRPA 1K73T 3TJ8A 4RW8A 4F04B 4CXUA 1WEZA 2KFNA 1JJ2R 4C3KA 4U8VA 4MFBB 3PW7A 1WOSA 3K5OA 3NMAA 5GVQA 3EDQB 3LALA 4I2QA 3OBIA 1GMWD 1EQJA 1RSCA 2R8HA 3RTVA 2KHCA 3FBBA 4ALZA 1NSAA 2KU7A 2R7OA 4DL5A 2BQRA 4UOHA 5DGAA 4ID8A 1BE4A 2G2ZA 1SPBP 1REVB 1YJVA 2KH9A 2E66A 4NMLA 3D6HB 1BQNA 2MHNA 2ANHA 1BY9A 1ZETA 1IKWB 4ED8A 4HDHA 5LMUF 1ED9A 2W5TA 3LOUA 1LOUA 4CLPA 4TKTA 1WF1A 2HQGA 2NZ4A 4ZIVA 2RAQA 2JHEA 4P75A 3CUNA 4M94A 2W4CA 4EZ9A 3I6PA 5IT9Y 2C3PA 2I5JA 4KQZA 1RK8A 2M7SA 1VQYA 3R5BA 1DAXA 3LP1A 4DV1J 2RHQB 3NS5A 3O6QA 4NCGB 3U7JA 1WD6A 3MHYA 3BQ1A 4K5SA 3J80Y 1R0AB 2HLUA 3JAMY 2QLJB 5IFMA 3AD9C 3OFGA 4DLEA 1Y0HA 1AUKA 3I5AA 3OXGA 2VQEJ 2J7WA 1PYSB 5EGEA 3P5BP 2E29A 1U24A 2J76E 3FK4A 1LW2B 1RCOB 4PWUA 4USMA 2HS3A 4C98A 2HRYA 2IJFA 1AFJA 3CXCR 2CZ4A 4ZITA 4CTAA 2CJKA 4I6AA 1D09B 3DLGB 2ASDA 2X3GA 3CJQA 4FP9A 1U1PA 3BSCA 3I32A 3MMJA 3IAM9 2APOA 2VBZA 3CJKB 4KH0B 3Q24A 2LFVA 2YX7A 5K14B 2ZH4A 2XY5A 2KM8C 1VHFA 4TU9A 4OYIA 5CYMA 2DHAA 3BEGB 1S12A 3MDFA 1UW4A 2FY8A 4DFJA 2VOOA 1GMWA 3JSRA 5HJYA 1SL1A 4P2SA 4JI1J 2H3EB 4O44A 1TUWA 4IR9A 2RQ4A 4KH1B 1U49A 4YR3A 5G0RB 3J81Y 1S6QB 1XK8A 4YUDA 1Q8KA 2DGUA 5CZXA 3C14B 4NOHA 1K47A 3UD3P 4IQXA 5T14A 3TAQA 2QN6B 1HNZJ 1UFLA 2BJ3A 5LM7E 1RT3A 3IRXB 1RTJB 1QAXA 4AXJA 2XMMA 1EQMA 4Y3CA 2PI4A 4BDPA 3WC2A 1PGZA 3AD7C 3H42A 2JWNA 1S1TB 4DCJB 3U1LA 4DX6A 2DNPA 2QA1A 3BS9A 4RUHA 1LWFB 1WHYA 1B4SA 3BGFA 3W2VB 3K89A 3G4SS 5EWFA 1Z4UA 4KJGA 3IR6B 3MR2A 3THTA 4H4MA 3L4BC 1SL0A 3FSIA 4B56A 2FUG9 2MZSA 2CPIA 3PIPQ 3LWMA 4F7VA 3IXQA 4OHWA 2RUGA 2RSQA 4NXMF 1KHVA 4M95A 3KLEB 2ASYA 5EGHA 1U26A 2XSFA 1RA6A 5L38A 4J5OA 4Y34A 3GIKA 2ZM6J 4MIWA 4WTYA 2HVZA 3Q86A 1FSUA 1S5ZA 4LR7A 4G3IA 3IGZB 3D54A 5HVGA 3CGIA 2Y0BB 4ETXA 1N5QA 1WG4A 4C8MA 2E7XA 2BBEA 1MU2B 4M5MA 1NB7A 3PCOB 1XNQJ 2BUNA 4ZVUB 2DD8S 1RAAB 1YRXA 2OPRA 3K7RA 2MGZB 3VVTA 2BEFA 1P49A 2RH6A 4HEA9 3U1NA 4N77A 4EBDA 2CQIA 4DF4A 1PC5A 2EKYA 5CXTA 5HL7Q 1KWMA 1FCAA 2HWIA 9RUBA 1ZEFA 4J9NA 3RBEA 5L9XA 4JI4F 2C2DA 3GMGA 1P9YA 1RHJB 4I2PA 1SKSA 1JLGA 3PJ9A 4IFYA 2ROGA 3PR4A 1PBUA 1C0UA 2BQUA 2XNRA 1DTQA 2HGNA 4I6WA 4JV2A 4EBCA 3N79A 3TR5A 1GH8A 1WC0A 2MMYA 1XMQJ 3K8VA 1VRUA 2IYIA 2XEXA 4NRUA 2B9YA 3MF5A 5D4LA 2D9PA 3MOJB 1FWPA 3M1VB 3VGSA 2OPQA 7AT1B 1P1TA 3AB2B 3ONQA 4HDGA 1SBRA 2E1PA 2HZCA 2YWFA 2JL9A 1XC9A 2MKHA 2B43A 4NI2A 1KDNA 1T95A 3C19A 5D4OA 9ATCB 2BYCA 2QMXA 2OPSA 4A46A 2NZCA 1S4EA 5CYJA 3NLCA 3UVJB 4DSEA 1U8SA 4TY9A 5E5NA 3M6XA 3I5CA 3JTNA 1EB0A 4X2BA 1FDDA 1YHQS 2MTLA 4OX9F 1ZZFA 3FRZA 3CT9A 4M5KA 1A6LA 3JB9k 1ZTWA 2C2KB 2Y0SD 5AXNA 2QZUA 1FD2A 2JVRA 5AJ9A 2FJBB 1QSLA 4DF8A 2XMKA 1JJCB 2GO9A 5ITHA 3LH2S 5I3UB 1VC6A 2R42A 2IYGA 3K5PA 3UI3A 4O3PA 4JI6F 5D3GB 3HULA 1UAWA 2FZGB 2DGOA 1EI6A 5EX3A 4NWJA 1QUVA 3SSQA 4ZJOA 4AQYF 5HBMB 4BWMA 2CFXA 1OWXA 2GS8A 5KFWA 3I31A 3JQKA 2D41A 1QLNA 4R8UA 3G6ES 2OEJA 2W9BA 1PJ7A 4N5SA 2YKPA 3EGWB 2QMUB 1U7LA 3MR6A 5HVFA 3AFGA 1FVSA 5D4NA 1L3SA 4ZLPA 4WE1B 1HWUA 4AE5A 3ZNJ1 4JV5J 2B9EA 1S0MA 4C48A 1ELZA 3NY0A 4YR0A 4A8OA 3B6BA 1SJ3P 1F0XA 4NEYA 4OJHA 2HS0A 1FKPA 2XTJP 2D3ZA 5HI7A 3OLBA 1YI2S 1UEVA 4JI0F 1OJ4A 1AZSA 1IBLF 3NNCA 1U2CA 2KO1A 3KG0A 3PXGa 4N56A 2CDRB 1N54B 1JLQB 1GXLA 4FBUA 2HS4A 3CTRA 1KHNA 2XMUA 3UR0A 5L0KA 1UW9A 3NGRA 1HPZA 1N34J 2C2RA 2D69A 2IFXA 1REGX 4O3RA 2Z4PA 5KFGA 2Z30B 3D0GE 3RRGA 5B0DA 3DLEA 3PKMA 4OZ0A 1NDLA 3OD2A 3KUGA 3LQVA 3QQCD 3GV7B 4GMKA 3CIMA 4AD6A 2X1FA 1XTZA 3V6HA 4A8SA 1B7FA 4ECQA 1JLBB 3OL6A 1M90T 3ULHA 4HH0A 3D28A 3DMJA 4ZVTB 2Q43A 3J7Z5 2EFOA 2VF3A 2BOAA 2PSZA 2M52A 4BWJA 3DDNA 2DGWA 1JLCB 2HHPA 4ILRA 2U1AA 2E5HA 4U96A 3B8HA 4RUAA 4DN9A 4IFVA 1NB2A 2QL7B 4IOAQ 1X5OA 2G0JA 1UEKA 2DR9A 4LUBA 2RIJA 2KXHA 4PXCA 5KFEA 3NGTA 4FPIA 2OFHX 2P8IA 3WIUA 1S7IA 2VQRA 2EFQA 3BBCA 4NCGA 1YRTA 3CMQA 1GTHA 1MMLA 5TJ3A 1MWZA 1WTBA 1HNXJ 4DUYJ 1NJZA 2C2ZB 5HJXA 1S9GA 4B08A 4GKJF 5GRRA 2ZJPQ 2N4DA 1Z2ZA 1XNRJ 2GCFA 4YR1A 3ZZTA 3QNWB 2HMIA 1IBKJ 4QIGA 2YPYA 2HVEA 3S01A 1MG7A 4M5IA 2VKZG 2F8HA 1V5IB 2J7UA 1NK6A 4NLYA 1KFSA 4RWXA 3QJLA 3DLGA 1MROB 2YNIA 1WELA 1V3RA 4C6AA 1FFGB 1FRKA 5DQGA 4A8XA 3VF0B 4UOGA 4RW6B 4LF4J 2DIVA 1FE4A 4KE5A 1QUPA 2LU2A 2XSJA 2HBRB 2OP5A 3A3NB 1RTIB 2CJ9A 4DL3A 1KC8T 1S99A 3TANA 1KSPA 3HVWA 3CCVS 2JX2A 4DBQA 4AL6A 4OJGA 3PYDA 4O23A 2ZUGA 2DNYA 4DFKA 5A0YB 3SFUA 3LP2A 2BDPA 3AA8A 1KHJA 3G82A 5G0RA 1S6QA 1M5HA 3DRRA 1OPZA 3PIOQ 4HT5A 4I7FB 3KLGA 2YWGA 3QO9A 3G86A 2H48B 4XK8C 1VQKS 1S6UA 3GJQB 1SC3B 1UWAA 1O8BA 4B9SA 1DZ5A 2VONA 3T6JA 2B9XA 2DR6A 5DJBA 3BSOA 1RU1A 2VB6A 2N3OA 1UVLA 4WP9A 3V81A 3PHTA 4PG8A 1LWFA 3S8SA 3D0IE 2G1HA 1R6VA 2FHKA 1YGYA 3OR2B 2F4VJ 1VIOA 4CO0A 1PG5B 2H5EA 4LF6J 3OTOF 4KHPJ 1SUQA 1HBNB 4WZQA 3QGIA 1NK4A 2AJ1A 4X62F 2L9NA 5D0EA 4PRFA 4TY8B 2W7PA 4C7QA 4OZ2A 3U02A 2HVDA 3MMCA 4QWCA 2GV1A 4EYHB 2H1YA 1TVRB 4ICLA 1JIHA 2BW7A 4Q43A 1CVJA 3J80U 3KK1B 3VAFA 4WCEQ 5FDLA 2OLWA 3JAMU 4DV3J 3NAIA 3QSYB 3G8SA 3HHLB 4UOFA 3BKUA 5LXRA 4R5PB 2ZZNA 3U27A 2VFUA 1PAUB 3KMSA 3D66A 4ID5B 2FIUA 5AT1B 4QJVA 3NP5A 1C2PA 3R9LA 2JLGA 2MLYA 1SJ4P 1FFSB 3NXZA 4KRWA 3OLAA 3MM8A 3VAMA 2RVJA 3DM2B 4JI8F 1LWCB 3CC7S 2AEMA 3ISND 3RGIA 3LA0A 1KVKA 3DN9A 5DDOC 3IR7B 1APSA 3DYAB 4EZ6A 3W3SA 2CAJA 2WSCC 2FTRA 2ZJRQ 4QBUA 5C42A 4UY8T 1B8JA 3MCNA 1NSQA 3S7RA 3U1MA 3H90A 3J81U 2EI5A 3SSSA 2L48A 2WOMB 1S10A 4S0MA 3OL7A 3T1YJ 3ZO7A 1SVDA 4CRJA 1NJIT 2RRNA 3EGZA 4OYPA 1TL3B 4QR0A 4FF2A 4USKA 4ECWA 3AOBA 4BLGA 1CPZA 1UTAA 4PPDA 1CJVA 1V5VA 3EZ5A 4X65J 2KXFA 1S48A 3UVJA 4R0EA 1ANIA 1FJEB 3MXHP 1FJGF 1LK7A 2V94A 1OY8A 3PRDA 4OFZA 2Y8WA 1C4AA 4UZBA 1NBEB 4DUZF 2ZUAA 2UUBF 5RUBA 4PKDB 2XCAA 2W4DA 4U7CA 2FGOA 4PZVA 2HWTA 4KPCA 4P2MA 3GSDA 1SKUB 4LSZB 1V6HA 4URQU 1G7CB 3W9HA 4X4OA 4QW8A 4C0HA 3G6YA 1S1XB 1RKJA 2VIHA 2YKOA 5E0OA 2IRYA 2VC0A 4NA3A 2MY7A 1VBKA 2AX1A 1L3TA 3PTWA 5KFTA 5HBMA 5KFIA 4WFAQ 1M5PC 4ZVHA 2YX1A 5T7LB 5KFSA 3UNGC 2FD2A 2E7VA 3HZEA 1KOOA 1UCNA 4QCLA 5LSLA 5B0BA 4NLXA 1RT7B 1WTFA 3TQ1A 3LGMA 1WEXA 2ZH7A 2VL1A 2ZC3A 1AJBA 3QIPB 5IS2A 1R6YA 2GZOA 1JLAA 3KXDA 1KR4A 2KI2A 4DSFA 3GR1A 4CLKA 2QZ8A 3Q3QA 4RL1A 4WYLA 1N0VC 3HSDA 2GJFA 3BR9A 4NCAA 4TQRA 4PG7A 2DHSA 2E9RX 1RT5B 1NH7A 4B3OB 4NLGA 4CYUA 1VYAA 1CJUB 1NH8A 1Q79A 5LMUJ 2DNQA 3H5SA 4OHVA 1CLFA 3RRKA 4NLQA 3HMJG 5EN1A 2MY8A 4W98A 3BR8A 3M6WA 3CULA 2C3OA 2HHXA 1EIYB 3SV4A 2QT7A 1FK9A 3MEGA 2V8HA 3JQJA 3EPGA 1WHXA 3Q83A 2DNLA 5DO2A 1ULRA 2MQNA 4HVZA 4ZOSA 3MTKA 1OSDA 2GAGC 2YPZA 1RI7A 1R8BA 1M1HA 2CZ9A 2GGPA 2IVFB 2L9WA 4ECTA 2BMBA 5KFPA 2XY7A 1KHKA 4DOZA 3BGRB 2N7CA 4OZLA 5F8MA 2LYVA 4PABA 3CCQS 2FHMA 4A8QA 4P73A 3HSGA 2CJAA 3VVUA 4ZVPB 2XCPA 2FJEB 1K9MT 5AE3A 4A8KA 3W8GA 2KHDA 5MAOA 4F2RA 1T03B 2XYGB 2H5IB 2FLOA 3GSIA 2NYHA 5CA5A 4CYSA 2KM8B 3MK1A 3ZFVA 2XGPA 1N6QB 3R5AA 1HARA 1FWKA 1E6YA 3T6BA 3HVTB 4NWBA 3DU6A 4YN3B 3TZYA 2YKMA 4Q8EA 4KKOA 2VJVA 1NZ8A 3WX4A 4W90B 2VG5B 5E33A 3TUJC 1KLMB 3CVKA 3THVA 3HZGA 3CCZA 3GJTB 1ROFA 1RWNB 3PX0A 4ZCMA 3MK0A 1RT6A 5J2MB 4IDKA 2VFTA 4IOCQ 1ZM9A 1E6VB 1ED8A 1ALJA 2UVRA 3UD4P 4ZP8A 4F4KA 3P4UB 1TV6B 1A7GE 2ZEJA 4KBIA 1HNIA 2HFOA 4KO0B 3PFEA 3M05A 3CD5A 4U67Q 3KYLA 4WK3A 1TUVA 4UQTA 2Q79A 4QZVB 3I0SA 3D1HA 1SKRA 1C1CA 4DZDA 2AW0A 2M88A 3POTB 1LWEA 2PFDA 1MROA 1YITS 2ZC4A 1EQ0A 2Z2ZA 3Q2TC 2OMLA 3SSRA 1VI7A 1YJNS 2EBGA 4CLYA 1WC4A 2CA9A 1HWIA 4NXMJ 2O3DA 1VQ6S 4E0DA 2K2PA 1ALHA 1T3NA 2I6WA 2P2CB 3TAPA 1LKZA 2R3VA 4NLPA 1IBMF 1HQUA 1X60A 5A76A 2XZDB 1S0OA 5AXKA 4C11A 4KM4A 5D77A 1S6PB 5B0AA 3OTEA 1WSRA 5HROA 1HNWF 5F41A 1Q7LB 4F50A 3RRHA 2XRGA 5LIAA 4OZ1A 3W62A 1ZEBA 2W9AA 1KHWA 2XI3A 4Y2AA 4MIAA 2NXNA 4P74A 4TLRA 4IQMA 2ZITA 5A8WA 2MHEA 2CG8A 2V5HG 4EEYA 2LKZA 1NKBA 4K4VA 4DU7A 3OL9A 2DNKA 4JI4J 3T19A 4USWA 1YIJS 2WVBA 2VDHA 1ZH5A 5KG4A 2QO3A 1FF2A 4ZLNA 4TQSA 1TR0A 2JRSA 5A8RB 2DXEA 3N6MA 3N28A 5GADU 3C6TB 3JSMB 1EW9A 4WFZA 1YRUA 1HBMB 4LSNB 5K8OA 4TY8A 5E3RA 1FVQA 1S1WA 3CD0A 1PYTA 2YNHB 1JLFA 4UW2A 1S9FA 4O3OA 2DEIA 4X64F 1JMTA 1GT8A 1ZBTA 2YTCA 3SI8A 5INHA 2J0WA 1S77D 2RJZA 3AJDA 2F4FA 3KHRA 2M8HA 1HBUB 3M7VA 3PY8A 2KB2A 5IM0B 3ENVA 5SZTA 5JUMA 1DQ9A 2ILYA 3DLKA 1IKXA 2ZOMA 1BQXA 1T05B 3T01A 2MQQA 1KVJA 2CVIA 2YWEA 5KT2A 1MLAA 3A52A 4PAAA 2AEJA 1QAIA 4C8NA 1VQ5S 4O4GB 2B6AA 2QLBB 4OX9J 4CM2A 2UXDF 1WG5A 2DY9A 1ALKA 2HZAA 3BDEA 4IRKA 3V4IA 4TU7A 1WF0A 4KT0C 3SFGA 5K20B 1C1BA 1IJEB 3HD1A 1KONA 1U1RA 3MM9B 4IG3A 3DM2A 1JWWA 3ZNUA 3MEKA 4OI6A 2ADBA 1WF2A 1HFEL 5B09A 1N5VA 1Y10A 4JI6J 2V2QA 1RP5A 2BJ1A 3BDHA 2IBOA 4AQYJ 1U8WA 3EMTA 2IM1A 1PILA 1SH2A 1OY9A 3IMQJ 1EP4B 3FC9A 3DLLQ 2VJUA 1CJTA 3CPWR 3M32B 4KC5A 3SDEB 1QVFR 2LDIA 5J2NB 2RE1A 3UDLA 1NXIA 3NWRA 1CC8A 1PCAA 2AGOA 1LFPA 4FYWB 5F3TA 1DBDA 4C0BA 1FX2A 4DPYA 1R43A 1Q8IA 5B7WA 2I8EA 1CULB 3CCSS 4DDFA 4DV7F 3K2YA 1TKXA 1WJ9A 3CD6S 4ZLJA 4EUVA 4ED1A 1K44A 3MM5A 1VBZA 2HHVA 2CQGA 4DXLA 2OHDA 4X4NA 1RGVA 1V3ZA 4XDCA 1HBOB 5GAGU 1HHSA 2D3O1 4GVBB 3DU5A 2L9DA 5EX0A 3W7BA 4ZG9A 1S4FA 3MI7X 1TK0A 1RT4B 2L41A 3BO2A 3NVLA 2KT2A 2K1RB 1RT2B 2GVDB 3MGJA 1IBLJ 4M63A 4OHYA 3MMAA 3O44A 3OV7A 3N0VA 2RD5C 2EW9A 3OR1A 2DVIA 4KFBB 2YX4A 5KG1A 4NYZA 2KN4A 1NRKA 4TLQA 3CB4A 4Q45A 2KRBA 3AODA 2J9DE 1RLCL 5DETA 1KN6A 2W7AA 4OZ3A 2GNKA 3GFHA 1N5YA 5B0CA 2HNYB 1R0BG 3BSAA 2E9TA 1U1QA 2QC3A 3C16A 3CEDA 3MR5A 2KG1A 4IOBA 1QE1B 2J7KA 2RQKA 3LF0A 4RW9A 4PUOA 3IC1A 5KT7A 4X4RA 4ENOA 1KKHA 4B3OA 3PW0A 1N0UA 2IM3A 4OYOA 5L39A 3DRSB 2GIQA 3KKFA 4OLPA 1U0SA 4LIRA 4RNOA 3I9V9 1UPMB 2EXUA 2GSUA 2GQ2A 5KFDA 2F7VA 3M4XA 4EFAC 2ZHAA 1OQ3A 2VBYA 3PRBA 3CMRA 2BW2A 1JQGA 2LXFA 3W1YC 1D9FA 4FYDA 2J9DA 3R7BB 5KT5A 1YX2A 3DOLA 4GRSA 3D6TB 3TEGA 3KHHA 3UE2A 4DR2F 2BX6A 4DX5A 4ZCLA 4J9KA 4FS2A 5M2UA 2YKQA 3ZZRA 1L5UA 1FKOB 3H5UA 4GKJJ 4ATNA 2F9JA 4LF2A 2B4UA 2W2PP 3FEYB 1TZ0A 4JI7F 2DR5A 4QR2A 4Y00A 1VRTA 1ZAXA 2E44A 4K4TA 4XAKA 4TXSA 3HSZA 3EE3A 3J7AN 4GTWA 2VZ9A 1UKUA 3OUYB 1FESA 2E1RA 2RQMA 4ANEA 1AYEA 1S7HA 5AXLA 3NGDA 4IH5A 2FLPA 1LW0A 3IRWP 3P96A 4UPLA 4NZ7A 4Z7YA 2ZE2B 3MMBA 4ECXA 2V63A 3T5HA 2RU3A 1NHVA 5ETSA 2HSEB 3HVTA 3IS9A 4LSLB 1FNMA 3QWPA 1TUGB 2ZHOA 4F3OA 2XR9A 5IWAF 1I94F 3MUVP 2ZBRA 4F3MA 1Q81T 1JX4A 3TX8A 2A1BA 2V4JB 3EVWA 3M2RB 2UV8A 4PG6A 2NCKL 2AT1B 3VCDA 2WAQD 2CIMA 1JB0C 5KAKA 1XR7A 3MK2A 1HQ2A 4RW7A 1U1NA 2GC8A 3IDDA 3IWLA 3W2WB 3V6JA 4NE9C 3FBCA 3TAMB 3QLHA 4F4AA 3KLIA 2NPIA 3OXLA 4M5HA 2HPUA 3C6UA 1FXRA 1VQ4S 4FKYA 2A2CA 1X5TA 6FD1A 4PXBA 5BXIA 3ZZZA 2V34A 4URSA 2ZWPA 2W7OA 1GAOA 4AYBD 4OYXA 3NKRA 4IO9Q 3OTOJ 3OVSA 1VHIA 2QMWA 5KG3A 5K5MA 4DSKA 4X62J 1KH4A 3TNVA 1RT1B 3AQOA 3M8QB 5ETNA 1M5OC 4ZVGA 2I0XA 3BV8A 1YG0A 5I3QA 3DYCA 2W5WA 3KNGA 1SC6A 5F8LA 4MT1A 2AMCB 3NKNA 1X9MA 1ELXA 4DL7A 4F3QA 1N32F 1ZPVA 3UN5A 4FPRA 2Q3PA 4E8UA 4LFBF 2F65A 2K7JA 1TKTB 3QGPA 4LFCF 2CUYA 3QJPA 2JLFA 4RW8B 4DEZA 3OHBA 4EO8A 2GHWA 1ZAVA 1FEEA 1T94A 4EWTA 4OV1A 4I2QB 2DY1A 4KTQA 4LRBA 2HBYB 3PX6A 1WUUA 4JI8J 1JXLA 1DLOA 1X4BA 5GAHI 2R2SA 3R2CJ 4JV0A 2AV5A 1RTDA 1BQNB 2Z2MA 4F4XA 2WVFA 2E9ZA 3MZIA 2BKNA 4DCPB 4WKYA 3NKQA 1H2VZ 3L7OA 5DGBA 4KAVA 2VD3A 3GG0A 3ZZ0A 1DTTA 1G3OA 4DQSA 1F5CA 4QIWD 1FJCA 5B0FA 4OYWA 2BV3A 3MFHA 4DQIA 2PC6A 3PACA 3QZ8A 1I6JA 2V8GA 4Y2CA 5I3PA 3ZTOA 2VFVA 4MIVA 3FEZA 1D1UA 3EX7B 3R1LA 3LP1B 2UVUA 4DSJA 1T05A 1X0FA 1H72C 1FJGJ 1X7VA 1TMMA 3SCLE 2CQ1A 4OX8A 3FBFA 4DV0F 3HK2A 4ZMMA 5D0RA 1P1LA 2BA9A 1T8EA 2D3OR 3I4PA 3IBFB 1TAQA 4HH1A 4LRFA 2VPXB 2KFYA 2FLNA 4DZ6A 2UVWA 2QFIA 2OAUA 2D1CA 8ATCB 5KFKA 1HWJA 5ETRA 4CTAB 3FNNA 1FTRA 3C46A 2NYIA 4WBFA 2EG2A 3TUZC 3DFEA 4JBCA 4DR6F 2DIUA 1W26A 2JFKA 2LXIA 5LRNA 3RB6A 1ZM3A 4ZVRB 2Q1LA 2B56A 2XZWA 2XMVA 4G6VB 3BO3A 3VZHA 2ACYA 3RR7A 1UVJA 1FRXA 5M2PA 2WHOA 2I2YA 1NZAA 5CYMB 5HO4A 2MDAA 2XI2A 2Z0GA 4PQUA 4ILMA 2LA4A 3ZTRA 1JLEA 1IR2A 2W8DA 5DLWA 2QRRA 2C3MA 4BBYA 4DSIA 1YJ7A 1VC0A 1XMBA 1RJJA 3UN3A 2LQ8A 1NUEA 2R7WA 4LR9A 2OSRA 4YY3J 2FHJA 4HACA 1RT3B 3KJQB 4ZPTR 3R5DA 3TQEA 1EW2A 4K4SA 2QSWA 4NYPA 3MPUB 2B8PA 1S49A 4QWEA 3GIJA 2HAFA 3NCPA 1RT2A 1UWBA 3VQTA 1NEEA 5J2QA 1KRPA 4F0HA 2VV5A 1KH7A 4UUWA 4FYXB 2M8DB 3MCOA 8RUCA 3RB3A 3K58A 2OTLS 2KYXA 3WC0A 1JNZB 2KTQA 2CDQA 3CSKA 2WONA 1D8YA 2ZOFA 5DZ7A 4EI2A 1YKWA 2U2FA 2DNNA 3X1LB 2DK2A 1RTHA 2CNLB 1VFJA 1XMOF 3GJSB 2DB1A 1E3CP 3BDFA 3T3FA 4JV1A 4CWBA 3HFZB 3ILIA 1S79A 4ES2A 1YTYA 4RWWA 2WTFA 1KH9A 1YJUA 3GONA 3LWLA 4GTYA 4C2MA 1P6TA 5KFVA 5IJSA 4WKRA 1X0PA 3OTCA 3Q0AA 1IKYA 3NGSA 2GSOA 3QAEA 1RYSA 2R4FA 1HD0A 4P7TA 3G2XA 4Y0FA 3NRBA 1B7YB 3AAWB 2QLXA 3W60A 1KD1T 2OPRB 1YJRA 2NSBA 1N56A 2RUSA 5L0EA 1R8HA 1RBLA 3RB0A 3M2UA 3BJYA 2V6AA 2JC0A 1D9AA 5U47A 2F3JA 4GTXA 2I1RA 3G71S 3ICLA 1HR0F 2HLTA 3R7SB 5KT4A 3I55S 2UUAF 5HVHA 3CCMS 3PV8A 1J5OA 4ES3A 3W8PA 4I2PB 1X8DA 2XYHB 4LF7F 2H4YB 1JLGB 2QIFA 3BO4A 5JMNA 3Q8RB 1FD8A 2BJ9A 4IFYB 3EICA 1C0UB 5C25A 1DTQB 2HHHF 2ZNYA 2HGLA 3D68A 3VR1A 3EZOA 1VRUB 1RAFB 2MZQA 2V0NA 3NKPA 3TVYA 3A3OB 4OZJA 1YDLA 3KLVA 1WI8A 2CQ3A 1VC5A 1FX4A 1SH0A 4KPYA 2WRMA 1YJ9S 3C3LA 1NDKA 5L1JA 3DOKA 2CNOB 5DQHA 2OPQB 1TQLA
chains in the Genus database with same CATH topology
3UN3A 1EJJA 4ZG9A 3NKMA 4CYSA 3WAXA 1Y7AA 4LR2A 4ZG6A 3UN2A 3MK1A 3BDGA 4LR9A 4FDJA 4LRBA 5EGHA 3WAWA 2GSUA 4MY4A 2IFYA 5L0EA 4TN0A 1EI6A 2W5VA 4UORA 5K4PA 4UPLA 3NVLA 4NWJA 4CYRA 4QAXA 4UOOA 4LRFA 2W5RA 1FSUA 4ZGAA 1EW2A 4LQYA 3NKRA 4MHXA 4LR7A 4CXUA 3LXQA 3IGZB 4UOPA 3CMRA 1EW9A 3OT9A 1ALHA 4LRDA 4UPIA 3T02A 2VQRA 4GTZA 1EW8A 4LR8A 1AJAA 1KHNA 1URAA 1HQAA 2W5QA 1O99A 4GTXA 5KXAA 1KH4A 1B8JA 3TG0A 3BDHA 1KH5A 5L0KA 4CXKA 1KHJA 3KD8A 4FDIA 4UPKA 2XR9A 1KH7A 1ELYA 3NKQA 1Y6VA 4LRCA 5TJ3A 3T00A 1E2SP 2IUCB 4KM4A 4KAVA 3MK0A 1EQJA 5INHA 2GLQA 4ZG7A 2GA3A 1AUKA 3SZYA 1P49A 1E33P 1ANJA 3M8ZA 1SHQA 2RH6A 3E2DA 3DYCA 5LRNA 5LQQA 5DLVA 2W5WA 3M7VA 4KAYA 5EGEA 3NKOA 4LREA 1ZEDA 5GRRA 3ED4A 1HJKA 1URBA 2W8SA 2XRGA 3TWZA 5C66A 5LIAA 3NKNA 1KHKA 1AJBA 1ZEBA 1ELXA 4NWXA 4YR1A 3TX0A 5GOVA 4LRAA 1E3CP 3BDFA 1AJDA 5IJQA 3M8WA 1K7HA 3UN5A 1ANIA 5L0BA 3MK2A 4MIVA 2ANHA 1ALIA 3T01A 1ZEFA 4CXSA 1ED8A 1AJCA 3Q3QA 3BDGB 1ALJA 3IDDA 3WBHA 3NKPA 4KJDA 5LRMA 1KHLA 1ELZA 1ED9A 2GSNA 2W5TA 1N2KA 1KH9A 3DPCA 2IUCA 3B5QA 3A52A 1SHNA 2QZUA 4GTYA 3M8YA 4KJGA 2W5XA 3IGYB 4UPHA 5IJSA 5AJ9A 2ZKTA 1O98A 2W8DA 1ALKA 4B56A 1E1ZP 2G9YA 2W5SA 3UO0A 5DLWA 3WAYA 3SZZA 5HRTA 2GSOA 2X98A 4GTWA 4N7TA 3UNYA 2D1GA 1N2LA 5DLTA 3WAVA 1HDHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UN3 A;  1EJJ A;  4ZG9 A;  3NKM A;  4CYS A;  3WAX A;  1Y7A A;  4LR2 A;  4ZG6 A;  3UN2 A;  3MK1 A;  3BDG A;  4LR9 A;  4FDJ A;  4LRB A;  5EGH A;  3WAW A;  2GSU A;  4MY4 A;  2IFY A;  5L0E A;  4TN0 A;  1EI6 A;  2W5V A;  4UOR A;  5K4P A;  4UPL A;  3NVL A;  4NWJ A;  4CYR A;  4QAX A;  4UOO A;  4LRF A;  2W5R A;  1FSU A;  4ZGA A;  1EW2 A;  4LQY A;  3NKR A;  4MHX A;  4LR7 A;  4CXU A;  3LXQ A;  3IGZ B;  4UOP A;  3CMR A;  1EW9 A;  3OT9 A;  1ALH A;  4LRD A;  4UPI A;  3T02 A;  2VQR A;  4GTZ A;  1EW8 A;  4LR8 A;  1AJA A;  1KHN A;  1URA A;  1HQA A;  2W5Q A;  1O99 A;  4GTX A;  5KXA A;  1KH4 A;  1B8J A;  3TG0 A;  3BDH A;  1KH5 A;  5L0K A;  4CXK A;  1KHJ A;  3KD8 A;  4FDI A;  4UPK A;  2XR9 A;  1KH7 A;  1ELY A;  3NKQ A;  1Y6V A;  4LRC A;  5TJ3 A;  3T00 A;  1E2S P;  2IUC B;  4KM4 A;  4KAV A;  3MK0 A;  1EQJ A;  5INH A;  2GLQ A;  4ZG7 A;  2GA3 A;  1AUK A;  3SZY A;  1P49 A;  1E33 P;  1ANJ A;  3M8Z A;  1SHQ A;  2RH6 A;  3E2D A;  3DYC A;  5LRN A;  5LQQ A;  5DLV A;  2W5W A;  3M7V A;  4KAY A;  5EGE A;  3NKO A;  4LRE A;  1ZED A;  5GRR A;  3ED4 A;  1HJK A;  1URB A;  2W8S A;  2XRG A;  3TWZ A;  5C66 A;  5LIA A;  3NKN A;  1KHK A;  1AJB A;  1ZEB A;  1ELX A;  4NWX A;  4YR1 A;  3TX0 A;  5GOV A;  4LRA A;  1E3C P;  3BDF A;  1AJD A;  5IJQ A;  3M8W A;  1K7H A;  3UN5 A;  1ANI A;  5L0B A;  3MK2 A;  4MIV A;  2ANH A;  1ALI A;  3T01 A;  1ZEF A;  4CXS A;  1ED8 A;  1AJC A;  3Q3Q A;  3BDG B;  1ALJ A;  3IDD A;  3WBH A;  3NKP A;  4KJD A;  5LRM A;  1KHL A;  1ELZ A;  1ED9 A;  2GSN A;  2W5T A;  1N2K A;  1KH9 A;  3DPC A;  2IUC A;  3B5Q A;  3A52 A;  1SHN A;  2QZU A;  4GTY A;  3M8Y A;  4KJG A;  2W5X A;  3IGY B;  4UPH A;  5IJS A;  5AJ9 A;  2ZKT A;  1O98 A;  2W8D A;  1ALK A;  4B56 A;  1E1Z P;  2G9Y A;  2W5S A;  3UO0 A;  5DLW A;  3WAY A;  3SZZ A;  5HRT A;  2GSO A;  2X98 A;  4GTW A;  4N7T A;  3UNY A;  2D1G A;  1N2L A;  5DLT A;  3WAV A;  1HDH A; 
#chains in the Genus database with same CATH topology
 2YY3 A;  2CZV C;  1UL3 A;  1AXQ A;  4NI2 B;  5EUH A;  2BJ7 A;  3PX4 A;  1MW7 A;  1A9N B;  4DJB A;  2OPS B;  1RU2 A;  2WSF C;  1J5E F;  2EFG A;  3HPO A;  4M5N A;  4ZP6 A;  1WOR A;  3OJU A;  4CO4 A;  2CQB A;  3QMQ A;  2IDE A;  3UDV A;  3GP9 A;  3BF4 A;  1FRM A;  3KHL A;  3BN7 A;  1DQ8 A;  3CCT A;  4WXO A;  1RQ0 A;  1UP1 A;  2DXF A;  2ZVI A;  4FNH A;  4WYW A;  1X31 C;  5KFY A;  4QQB A;  4LSL A;  3JSY A;  3CJ5 A;  1VJQ A;  1IBM J;  1GMV A;  4MJK A;  3Q8Q B;  1TK8 A;  3P5T L;  1U09 A;  4ZK7 M;  3CMA S;  4W92 B;  4RNN A;  4DR5 F;  4Y65 A;  3ADA C;  1HNW J;  4OX6 A;  3GCX P;  5JVH Q;  3DLJ A;  1CQM A;  1WDD A;  1ALI A;  1RAO A;  3H2U B;  2XZT B;  2JVO A;  1X4G A;  2DGX A;  3BPD A;  2UP1 A;  1WC1 A;  5GMD A;  4HTJ A;  1FXL A;  1E1Z P;  3KUH A;  3K0J A;  3J81 j;  2RKI A;  5KFM A;  2PE8 A;  5LMN F;  5KG0 A;  3WAX A;  4R8U B;  2CQH A;  1Y11 A;  3CD7 A;  3I82 A;  2XMT A;  2W9B B;  4ANC A;  3BPS P;  3C66 A;  2CQC A;  2M5Y A;  3HJF A;  3NGU A;  3S6E A;  4NA2 A;  3VTI A;  3OT9 A;  5DDR C;  4C8L A;  2BAN A;  2WW4 A;  2Z2L A;  5HQL A;  3TYT A;  4MK7 A;  2HVH A;  5J1N A;  4LRC A;  2HWH A;  1RT1 A;  4KGX B;  1LNQ A;  2AQ4 A;  5CH7 B;  4JI2 F;  3BZQ A;  2YBV A;  3FVY A;  3FSX A;  1ZTT A;  1RKI A;  4ZPA A;  4X64 J;  1KQF B;  2F8M A;  3QRQ A;  1X5S A;  4B9V A;  1S9E A;  1U47 A;  3AY0 A;  1L3K A;  1GTE A;  4A47 A;  2DIT A;  4L75 A;  1AZS B;  2BJD A;  2BM0 A;  3ZZO A;  2NR0 A;  1PAE X;  2NRE A;  3UCG A;  4RLE A;  2BE2 A;  3EVO A;  3MR3 A;  3GIL A;  2K8G A;  4QWA A;  4X66 F;  3IM9 A;  1IQT A;  1HPZ B;  4R0J A;  2UXD J;  3HM9 A;  4ECU A;  1X4F A;  3T41 A;  1S57 A;  3KJV A;  4RUB A;  3DOM A;  4CYR A;  1N36 F;  3DLE B;  2NQP A;  4ITS A;  3RU0 A;  2G4B A;  4L3N A;  1WOP A;  5HP1 B;  1NSP A;  2XHC A;  1RHQ B;  4MMO A;  2DR8 A;  2JEF A;  2QFJ A;  2K3K A;  3DDI A;  2YNG A;  4X4Q A;  3E3X A;  5E41 A;  1MWY A;  4JP8 A;  3DMJ B;  1UVK A;  2HKE A;  4PWD A;  4LIW A;  4K2J A;  2CJB A;  1TTH B;  5MLC V;  2H4W B;  2EC0 A;  4L76 A;  4NXN F;  2W8K A;  2EK6 A;  4IFV B;  5A2Q U;  1VQ9 S;  4L74 A;  4MH8 A;  4KV8 A;  1Y3K A;  3PJW A;  4MIB A;  3CME S;  1PC4 A;  2P9C A;  3JXO A;  4DV7 J;  3MED A;  2XBP A;  2CPY A;  2ZD1 A;  3DXS X;  1BLU A;  2ADC A;  1S9G B;  1UA1 A;  1NO8 A;  1H73 A;  5BJR A;  1XIQ A;  2NS1 B;  3BQ0 A;  2ALY B;  2GFF A;  4QR1 A;  2HMI B;  4I69 A;  5KFN A;  2Z58 B;  1JNR B;  3FCV A;  1BQM A;  3M9M B;  4OHX A;  3OSN A;  2GA3 A;  3MUM P;  3FKB A;  2RF2 A;  3SBM A;  2YNI B;  5HMY A;  1AT1 B;  2V8P A;  3PO4 A;  3I96 A;  3A4T A;  2C3U A;  2E1C A;  4BC9 A;  3QT5 A;  1X4H A;  1GX6 A;  2XSJ B;  3B78 A;  3QT7 A;  1FFW B;  2C1E B;  2IAJ A;  3QSI A;  2XQC A;  4ZP7 A;  3RW6 A;  2OH2 A;  4H4O A;  3FJ2 A;  3LP2 B;  4DV2 F;  5F9N A;  3G82 B;  4LF9 F;  3QYY A;  2VHG A;  3CJ0 A;  2RQC A;  3IFE A;  3NBP A;  2YNF A;  3DRR B;  3KLG B;  3QO9 B;  1ZAW A;  1IUJ A;  3ZZY A;  4C8K A;  4X4T A;  1RAD B;  4B3S F;  3OJS A;  4C4W A;  1MMD A;  2O01 C;  1UZD A;  1ZM2 A;  3CJT A;  2FHO B;  2HIY A;  1MN7 A;  4WU3 A;  3TO8 A;  2H51 B;  2WBR A;  1A0O B;  1CJK A;  3V81 B;  2IC3 A;  5KFZ A;  2FPH X;  4RJV A;  2MSS A;  2RRB A;  1SC1 B;  4WP8 A;  3DNC A;  3NCR A;  4DR2 J;  3UCU P;  1W2I A;  3KK2 B;  3DXB A;  5KTQ A;  4XIU A;  1FDN A;  2UUC F;  1RAE B;  1SUQ B;  2VQF J;  2HG4 A;  3B5Q A;  3E8O A;  1G4C A;  1URR A;  1FNO A;  3V2U C;  2CKW A;  3BBB A;  3K57 A;  4J9L A;  1RBA A;  4DR1 F;  4QPT A;  3N6N A;  3MMC B;  2I38 A;  2X98 A;  3A8K A;  4JI7 J;  3CCW A;  1UJ6 A;  3AT1 B;  4CLL A;  4ICL B;  1PSD A;  1BMQ B;  1H0H B;  3KLH A;  5FDL B;  2C2N A;  1HYS A;  1XMQ F;  1FRJ A;  4XPC A;  2FZC B;  1Q82 T;  1NPR A;  1TMJ A;  4WF9 Q;  1K1Q A;  2KXN B;  1FWL A;  3M8S A;  2GJ2 A;  4BCA A;  8AT1 B;  1KFD A;  2NXU A;  2CQ2 A;  1E2S P;  3VQS A;  5ETM A;  1AW0 A;  1R3N A;  1Y9O A;  3HT0 A;  3TW0 A;  3WDO A;  3IR5 B;  1U6F A;  2AJ2 A;  1OIA A;  1RHM B;  5HMZ A;  4I0W A;  3MPV A;  3KTQ A;  2V67 A;  3MM8 B;  1HKA A;  1IKV A;  3GR0 A;  2GVZ A;  3S1T A;  4LMZ A;  4ED4 A;  1T11 A;  3PW4 A;  4ZVF A;  2JLE A;  1UET A;  2G0I A;  1NM2 A;  4NLD A;  3J7Z T;  3EYZ A;  3DI6 A;  2G9Y A;  2CNN B;  1N8R T;  5C42 B;  4DX8 H;  3LO3 A;  5FJ4 A;  2J5A A;  3HVA A;  1OPI A;  3BKF A;  5AJ3 F;  2V4Q A;  3JYT A;  2ZH8 A;  2J6S A;  4GKK F;  1N5T A;  2EFP A;  4MY4 A;  2IBK A;  3MTJ A;  3I56 S;  3NL0 A;  1T9Y A;  1CJV B;  1QTN B;  3NOG A;  5FLX Y;  4J9M A;  1YBT A;  1UVN A;  4CXK A;  2DPJ A;  1WDT A;  4DQR A;  1NCL A;  4DWI A;  3D67 A;  2DHG A;  4ZVQ B;  4GC7 A;  5DM6 Q;  3HKZ D;  4YOE A;  3SQG A;  1HJK A;  1RHK B;  3KUE A;  3MM7 A;  2LMI A;  4ZLL A;  3ZXW A;  2WBM A;  4F36 A;  2QLF B;  1TKD A;  2XMW A;  4JUZ A;  3UW1 A;  4CXS A;  1YBU A;  1HMV A;  3G8Q A;  5DZ6 A;  1AFI A;  2ATC B;  1S1U A;  2J0S D;  1KTQ A;  1W25 A;  4K4X A;  1N88 A;  5E2Q A;  5E3C A;  1N32 J;  1UA0 A;  2DNZ A;  1HI0 P;  4LFB J;  1VK3 A;  4WFY A;  3HHD A;  4LFC J;  3GFZ A;  1HDH A;  3RAX A;  5LOQ A;  3QRR A;  2JH3 A;  2Y9H A;  1M5V C;  3UN2 A;  4GC6 A;  1NU4 A;  3OFH A;  1QVG R;  4TN0 A;  4DS5 A;  3O3L A;  2EWH A;  4J9S A;  2BJ8 A;  4J9O A;  1JLA B;  5I4M A;  2MZ1 A;  3UD5 A;  2Z2Y B;  3IG1 A;  1ZM4 A;  3NEK A;  1RIS A;  1GFW B;  1RAB B;  3R5C A;  2AX0 A;  2KT5 A;  3AH6 A;  5J1E A;  3MEE A;  1H6K X;  3CCJ S;  4IH6 A;  1IBC B;  1RAG B;  4K4Z A;  3AOA A;  2CPZ A;  2EG1 A;  4CYU B;  3M8Z A;  5DM7 Q;  2FJD B;  4MKA A;  4YEA A;  4F25 A;  2VPY B;  1S1V A;  4QPX A;  5K8P A;  4EBE A;  1U1O A;  1FRH A;  3DRY A;  3W65 A;  5KFQ A;  1SKW A;  3MPD A;  5IOL A;  4DPU A;  4L6V 3;  4J9P A;  3NS6 A;  2VC1 A;  5IT0 A;  1ZYQ A;  3EZU A;  1FK9 B;  3MEG B;  1EX8 A;  3DHX A;  3DLH A;  4K4U A;  5B08 A;  2X1B A;  1JKH A;  4MTP A;  4AND A;  3LPY A;  4JYA J;  2J9E A;  2AIR B;  3K5M A;  4DV0 J;  2PI5 A;  3MPY A;  2QGF B;  2O5D A;  2GGP B;  3MPW A;  4OJ1 A;  4QIV A;  2OD4 A;  3JSB A;  4ZPD A;  1B0V A;  5A6W A;  2G2O A;  4B3R F;  2GHP A;  2DKO B;  1W7W A;  1CS4 A;  4JOU A;  1FRL A;  5HP1 A;  3KD8 A;  3VGV A;  1FA0 A;  1VQ8 S;  1QJH A;  1X4C A;  4FKX A;  2RH3 A;  4DN0 A;  1U2R A;  2XHW A;  3R6G B;  2V8V A;  4DG1 A;  3GFY A;  4I56 A;  2ALZ A;  5C66 A;  5C5J A;  4DR6 J;  2C2M B;  2IRX A;  2AHO B;  4WZM A;  5JXS A;  1N33 J;  3VWS A;  3HFV A;  1E6Y B;  1IBK F;  2V9K A;  5F9L A;  3IM8 A;  4YB1 P;  2RS2 A;  5FD1 A;  3GLJ A;  3HHE A;  2RML A;  1NKE A;  2GJI A;  2JSX A;  2YKM B;  4KKO B;  3GV5 B;  2JC1 A;  1DRZ A;  1U1L A;  4LF8 F;  1JXE A;  5THW A;  2BE9 B;  2DR7 A;  1RT6 B;  2L3M A;  4LF4 F;  3AA9 A;  4IDK B;  2MB0 B;  3BH7 B;  3HD2 A;  4PCQ A;  5HAN A;  1GXT A;  2XGQ A;  4Z37 A;  4A4J A;  3GPA A;  3W64 A;  2VOP A;  3QJJ A;  4A8W A;  3QBC A;  3EVM A;  2POK A;  5HAO A;  1ZZN A;  1S76 D;  2FQQ B;  1K0V A;  1HNI B;  2HQC A;  2EC2 A;  3QWU A;  1ACM B;  1FNX H;  3I0S B;  2E5L F;  3NKO A;  1C1C B;  4PYA A;  2R7X A;  1NK9 A;  1LWE B;  2FB0 A;  3T5K A;  5K8N A;  4K4Y A;  2VAS A;  1OS5 A;  2VPW B;  2BE7 D;  1AJC A;  3TAR A;  4UOC A;  3RUB L;  1D9D A;  2GSN A;  1N2K A;  1HHQ A;  1XMO J;  4ZVS B;  1UPP A;  1N5S A;  1IR1 A;  3MAA B;  2V69 A;  3J7Y I;  4CH7 A;  1H98 A;  1HQE A;  4ZDN A;  2XWX A;  2VBX A;  2OFG X;  2HBQ B;  3C15 B;  1HQU B;  4OIX A;  5E3Q A;  4F0K A;  4FF1 A;  5A8K A;  3BH6 B;  4WU2 A;  4C11 B;  2HYI B;  5C24 A;  1VIX A;  4ZA1 A;  5HRO B;  5CYQ A;  3LTO A;  4I6Y A;  1U0H B;  2EEY A;  1ZOT A;  2VUG A;  3TVZ A;  1JK9 B;  4ZPC A;  5A8W B;  4K2X A;  1P8G A;  1KQS R;  3HHN B;  1HR0 J;  3SZY A;  3HJV A;  2UUA J;  5BYR A;  1F9F A;  3ILL A;  4OMF G;  3RAM A;  4D3H A;  5GAE I;  3T1H F;  2E5G A;  4LF7 J;  4J91 A;  2YQ0 A;  3GE9 A;  3KK2 A;  4KJD A;  3ITH A;  3LGN A;  3ELH A;  4LJM A;  1SV5 A;  1SHN A;  4CLT A;  3OPK A;  5IQQ A;  4OLO A;  2YH0 A;  1MN9 A;  1RDR A;  1NLK L;  5D78 A;  2P5V A;  3IP0 A;  3LP0 A;  1S1W B;  5DG9 A;  2V4R A;  1BHN A;  5HLF A;  1JLF B;  2WVD A;  2GHV C;  1EJJ A;  2GA7 A;  3CJ8 A;  4F26 A;  4G1Q A;  3BDG A;  3C8Y A;  4IRD A;  3V6D A;  4PPZ A;  2J6T A;  2C2O B;  3V6K A;  2RDD A;  3TZW A;  1J5E J;  3CCR S;  4J9Q A;  4CI0 B;  1URA A;  2F8E X;  1IKX B;  3DLK B;  3IO1 A;  1NK8 A;  2J6U A;  5IC6 B;  2NUU G;  4KGV B;  2W9C A;  2B6A B;  2KDO A;  1CSJ A;  1YK9 A;  1SL2 A;  3P6Y C;  3V4I B;  1T9U A;  4B9M A;  2B9W A;  4NWX A;  1C1B B;  3AXK A;  2DRA A;  4F4Z A;  1K7H A;  2EFV A;  4IUF A;  4RU9 A;  2IDL A;  2KYZ A;  4FBT A;  4IG3 B;  4CLW A;  4DR5 J;  5BYS A;  1M5S A;  3P3D A;  3PHE A;  3NCQ A;  4CT8 A;  3RB4 A;  1V9O A;  4NYO A;  5IXU A;  4U6P A;  2IVM A;  2IMW P;  1H38 A;  2FVS A;  2DNM A;  4CH0 S;  3LGH A;  2PGC A;  3DC2 A;  2FVP A;  1B0T A;  3PFO A;  1CQN A;  3ILJ A;  2L08 A;  1WNE A;  4P7V A;  1CJT B;  1RWM B;  5KFB A;  4B3T F;  5LMN J;  2Y1I A;  4P10 A;  1NK5 A;  2R7V A;  4MYT A;  4DR4 F;  4L72 B;  2UU9 F;  1UEU A;  2C2E A;  3QAT A;  3T02 A;  1AJA A;  3DCA A;  5CCL A;  1TL7 A;  1J27 A;  5KFR A;  2K06 A;  4X84 A;  5L9N A;  3L95 X;  1TKX B;  4MK9 A;  2BXJ A;  3AD8 C;  1U25 A;  3MM5 B;  2HNZ A;  2NSC A;  2IY5 B;  2HK3 A;  1BWV A;  2YH1 A;  2C28 A;  1XN9 A;  2XS5 A;  3K17 A;  4K5R A;  5HSP A;  4ECV A;  1F3V A;  1Q0N A;  4JI2 J;  2ZZM A;  5IJQ A;  3BB5 A;  4USU A;  3R2D J;  1L3U A;  4CIO A;  1SC4 B;  3M30 A;  1X4A A;  3TA1 A;  4ECZ A;  4CP5 A;  3HT3 A;  4KIA A;  4LVN P;  2MJN A;  3TP2 A;  1RWU A;  3R5G A;  3MMA B;  5HRT A;  4N47 A;  5DLT A;  5EWE A;  5CZV A;  3OR1 B;  3NWG A;  1Y7P A;  2B0G A;  5IV3 A;  2MKJ A;  1OYD A;  3M2V A;  5LJ5 Y;  4X66 J;  4HHH A;  4G65 A;  4QYR A;  3UPF A;  2AP6 A;  2VG6 A;  3DGP A;  5E3P A;  3VGT A;  4CM0 A;  1RA7 A;  2HND A;  4I64 A;  2AF6 A;  5ETO A;  4UPI A;  4LVO P;  1LEO A;  1N5Y B;  2BM1 A;  4OI2 A;  2W5Q A;  2YXL A;  1N36 J;  3C16 B;  4FF4 A;  1ELY A;  3IN5 A;  2A10 A;  5F8N A;  4RW9 B;  4DSL A;  2YKA A;  3CWJ A;  3ET6 B;  4PUO B;  3A1Y G;  1ANJ A;  1E33 P;  3G6V A;  1EZZ B;  4M5J A;  1T3O A;  2CQP A;  5DLV A;  1WEY A;  3Q2S C;  1Z2L A;  3RZA A;  5DLF A;  3TWZ A;  2FVC A;  2DRB A;  2KJV A;  2DH7 A;  5BYQ A;  5J2P A;  4B9T A;  1AJD A;  3IBW A;  4FXW A;  4AL5 A;  2GAH C;  4CLU A;  1M5K C;  5KOX A;  3Q8V A;  2IUC A;  5CD4 H;  4NLT A;  1FXD A;  4NXN J;  1EKR A;  4ER8 A;  1TL1 A;  2O1P A;  2CPF A;  1RUS A;  3IWX A;  3PVX A;  1DJ0 A;  3KLF B;  3WAV A;  3AQP A;  1S72 S;  3DOL B;  2OKQ A;  4ERD A;  1S97 A;  3G96 A;  4CH1 A;  2CJQ A;  2DGT A;  2MQO A;  2LCW A;  4RUC A;  2AJ0 A;  4FYY B;  2QJ3 A;  1MMN A;  3Q8S B;  5D6G A;  4TVA B;  4I4B A;  4CZC A;  4JI3 F;  2R8J A;  2IM0 A;  5FLX U;  5KFF A;  1F5B A;  4IG0 A;  1T0T V;  1VRT B;  4LFA F;  2ILZ A;  4DR7 F;  3P45 B;  2F9D A;  4LF1 A;  3F41 A;  3R97 A;  4QOT A;  3TX0 A;  4ELV A;  4J9U E;  2B5J A;  2C42 A;  1RAJ A;  3CE8 A;  1LW0 B;  3D4J A;  5LRM A;  3VAL A;  3E01 A;  3MMB B;  3IGY B;  5GAH U;  4YHH F;  5C2C A;  5C7P A;  3IS9 B;  4H4K A;  4O4R A;  4BS2 A;  3BGU A;  1FER A;  3L9Z A;  5SUH A;  5E3A A;  2QL9 B;  4AFF A;  3H5Y A;  4DV2 J;  4LF9 J;  2MYF A;  2WSE C;  2X1G A;  3PR5 B;  4QAX A;  1AUS L;  2HHT A;  2W5R A;  3HKW A;  1GQE A;  5D15 A;  2QYC A;  5T41 A;  1VOM A;  2DHX A;  1O5J A;  4RW7 B;  4B3S J;  2PDA A;  2B4P A;  3QGH A;  4C8Y A;  2ROE A;  5L46 A;  1VLO A;  3E2D A;  4RW4 A;  3QLH B;  1RCX B;  2D74 B;  3KLI B;  3LW5 C;  1D8Z A;  2JNJ A;  2UXB F;  4I67 A;  3KJF B;  2GQC A;  3C6U B;  4OZ5 A;  3KWM A;  2PMW A;  3DRP A;  2AYE A;  2ZH1 A;  4DCO B;  4EGL A;  3QFW A;  4NLS A;  3DPC A;  4YFU A;  3M8Y A;  3RYL A;  1DFD A;  3VAK A;  5H1S V;  4X4S A;  2UUC J;  4OYA A;  3MEC B;  3CCL S;  3MAA A;  4N7T A;  3M8P A;  4B3M F;  1IM4 A;  1WKL A;  4RZR A;  4DHV A;  3D7S B;  3C15 A;  2YKN A;  3O8W A;  1RAH B;  4DR1 J;  1YBA A;  2X3D A;  3A8I A;  2RS8 A;  1PBA A;  2FVR A;  3KG4 A;  4ZJQ A;  1IR0 A;  3F0N A;  2W25 A;  1HI8 A;  5KT6 A;  1IM6 A;  1U0H A;  3W5Z A;  4DV5 F;  1VQN S;  2AZ1 A;  4ZHR A;  2RRA A;  1HA1 A;  2XLJ A;  3FFI A;  3SV3 A;  2FVQ A;  2PEB A;  1U2F A;  3T00 A;  1M0S A;  3FRY A;  3JS9 A;  2V2Z A;  3AB4 B;  4RU2 A;  3O2I A;  2LQ9 A;  4CO3 A;  2OPP A;  3QT6 A;  3H98 A;  3MM6 A;  1X5P A;  4E98 A;  3DRX A;  3H5X A;  1U4B A;  1XEZ A;  4K0K F;  3T9Z A;  5ETT A;  5I42 A;  4P2F A;  1KP6 A;  1D0E A;  4NPO A;  1DLO B;  1LQ9 A;  4ED7 A;  3L7P A;  2AJ4 A;  2CPE A;  2FC8 A;  2LQB A;  2UV8 G;  2AGP A;  2R2U A;  4OI1 A;  3I0R A;  2FGC A;  1TKZ A;  1RTD B;  4AUK A;  1H7X A;  3M8R A;  2ZNZ A;  1DTT B;  3THP A;  2K3I A;  3KK3 A;  3HI9 A;  2YQ3 A;  5KG6 A;  2ERR A;  5J1P A;  2DO0 A;  5AJ3 J;  5L1L A;  3JQM A;  4GKK J;  2IVY A;  2VG7 A;  3D3C J;  4P9S A;  4DI6 A;  3NKY A;  3CJR A;  2DNO A;  1LXN A;  1HQA A;  1O99 A;  4AXI A;  1F9H A;  1TEL A;  4I68 A;  2R7R A;  5H9F K;  3K59 A;  4CO5 A;  4K8R A;  4ELT A;  1X9S A;  3EJM A;  4NEZ A;  4O0N A;  2IJR A;  4A8F A;  2EPI A;  2H65 B;  3GQC A;  3K8W A;  5GOV A;  1S0V A;  3PEH A;  4UF4 A;  1B0P A;  1RWX B;  3CDB A;  5ADZ A;  3GII A;  3H25 A;  3BSN A;  4UTG A;  3WAY A;  2HIQ A;  1WHV A;  3CW2 C;  2JEI A;  2V68 A;  3CDA A;  2ZH9 A;  2E1A A;  2R7Q A;  3FGV A;  3M6V A;  5HAT A;  2FJW A;  4DV4 F;  4LBP A;  3RG6 A;  4OYB A;  3M9N B;  2AD9 A;  3CNQ P;  2GMH A;  3GIR A;  2LQJ A;  1ITP A;  4CLS A;  5AE1 A;  2Y8Y A;  3FCH A;  2DO4 A;  1FI4 A;  4IH7 A;  4Q0B B;  1Q5V A;  2CNK B;  3OL8 A;  2MLX A;  4NX9 A;  1OQ6 A;  2XS2 A;  3W61 A;  1B3T A;  4H54 A;  4PG5 A;  1Y6V A;  4EYI B;  2VOD A;  4PQU B;  2LXU A;  3GCW P;  3KHG A;  1JLE B;  3JTP A;  1Q16 B;  2IA0 A;  5H9F J;  3EUN A;  3PZP A;  2PN6 A;  2HFU A;  1RB0 A;  2M0G B;  3G8T A;  1R8C A;  5F8I A;  4HHJ A;  5DG7 A;  4F2S A;  2JEJ A;  2CRL A;  4USI A;  1H74 A;  2VFS A;  4MFB A;  4OYM A;  3FZ2 A;  2XO6 A;  3RW7 A;  5KFL A;  2B7B B;  1F60 B;  4HAC B;  4KGK A;  1WSV A;  2J0Q D;  2LA6 A;  4F4Y A;  1MWQ A;  2OIH A;  2QA2 A;  1X4D A;  2UVV A;  4JI0 J;  1UWB B;  3OTD A;  2AKW B;  2AYG A;  1REV A;  1QAY A;  5J2Q B;  2ZBQ A;  4YB7 A;  1KNZ A;  5KFH A;  1CEZ A;  4WFX A;  4WFN Q;  5KFX A;  4RNF A;  1IKW A;  3OFF A;  3GWC A;  4ZN1 A;  4FS1 A;  3D3B J;  4TN2 A;  4DFP A;  2WON B;  4ED5 A;  3RBX A;  2O66 A;  3R1H A;  1GXU A;  1RTH B;  4URG A;  2XWY A;  4A8Y A;  3ENW A;  1KH5 A;  3MD1 A;  1M1K T;  3HXM A;  1Q1K A;  2NXE A;  4ZP9 A;  4B3R J;  2VA3 A;  4EK2 A;  2FJX A;  1IKY B;  3A13 A;  5LXY A;  1VLY A;  3BGO P;  2D9O A;  3ET6 A;  2MKC A;  4USJ C;  1IWG A;  1SI9 A;  2LVW A;  2W2N P;  1R0A A;  2NXJ A;  4EMD A;  3Q22 A;  1IVZ A;  2RB7 A;  4KY3 A;  3ZZU A;  5EWG A;  3M2U B;  1LV5 A;  7FDR A;  5IV4 A;  1R8P A;  1O98 A;  3BKT A;  2P6T A;  5CHC B;  1WHW A;  2W2Q P;  2ZVS A;  4CO2 A;  1LW2 A;  1YJW S;  4FZV A;  1C0T B;  1Q95 G;  4WII A;  5BR8 F;  3KLF A;  4ZG6 A;  4ECY A;  1B64 A;  1U48 A;  3OXF A;  4YB5 A;  3WX8 A;  2CG4 A;  1J5O B;  2XM3 A;  2OI2 A;  1NAQ A;  4LF8 J;  3GZ7 A;  4V19 J;  1F2H A;  2ZH2 A;  1Q7Y T;  5C25 B;  2JOQ A;  4V1A k;  3FQL A;  2SXL A;  4UZC A;  2MQP A;  5K8M A;  2WB1 D;  4C97 A;  1N48 A;  1U1M A;  4JB8 B;  4FDI A;  4F02 A;  1Q86 T;  3CJK A;  5K14 A;  2KT3 A;  4PWW A;  3DOK B;  4J9R A;  2DNH A;  3CJS A;  2HQ3 A;  1F3F A;  4ECR A;  5L0B A;  3QAU A;  2M70 A;  3AJ1 A;  5CQG A;  2E5L J;  1KLN A;  1FDB A;  3C14 A;  4P72 A;  4HHU A;  1HIY A;  3D0H E;  4USH A;  2F5G A;  1NK0 A;  4FN5 A;  2QLW A;  3SZ2 A;  4DQQ A;  1U6B A;  4ES1 A;  2ZDP A;  5JVG Q;  2VPZ B;  3UCZ P;  3IRX A;  2ASL A;  1RTJ A;  1H7W A;  1HWL A;  2JZ5 A;  4PR6 A;  1RXO B;  4R25 A;  2KVI A;  2D7S A;  2MKY A;  1O51 A;  2CXE A;  1S1T A;  2I9S A;  1UMJ A;  4DX7 A;  1VK8 A;  4U8Y A;  4HR2 A;  2RNE A;  4UT4 A;  3W2V A;  2QSF A;  2OEL A;  4MHX A;  3LXQ A;  4PQA A;  2Z56 B;  1WAC A;  3FMB A;  4E2F B;  5FII A;  5EHH A;  1WC5 A;  5A2Q Y;  1IN0 A;  1SJF A;  5IT9 U;  2FJA B;  1LK5 A;  3PJX A;  5IZH A;  2QL5 B;  2XLI A;  3CO0 P;  3KLE A;  3ILO A;  1T9X A;  1N4L A;  2RKI B;  2HK2 A;  5L1I A;  3P49 B;  4FNI A;  1G1X A;  1YQH A;  4XO0 A;  1MU2 A;  4NA1 A;  4YB6 A;  3QID A;  3UR3 C;  3DGV A;  2HHU A;  3T1H J;  1XR5 A;  1GEH A;  4M5G A;  4B02 A;  2MGZ A;  2P6S A;  3UO0 A;  3NMR A;  4G1P A;  3H59 A;  4DL2 A;  4Y2K A;  1VBX A;  4LF5 F;  1QTM A;  2BAN B;  2ZH5 A;  2UXC F;  4FYV B;  3LAN A;  2GQQ A;  3MEC A;  4Q44 A;  4K59 A;  1FEH A;  3R8Y A;  2LLZ A;  4J7C A;  3TA0 A;  3ETM A;  1R7I A;  4ZGA A;  2M9K A;  2D3U A;  1S9E B;  2JFD A;  2B3T B;  1VR6 A;  2ZBP A;  4ZPV R;  4UPK A;  4MYU A;  4RPF A;  4RBT A;  4Y6I A;  3HP6 A;  2BE2 B;  3R27 A;  4OI4 A;  3TI0 A;  4QIE A;  2Q66 A;  3SCI E;  2EK1 A;  1NSK L;  1RWW B;  3CDE A;  5HQM A;  3M1V A;  2N4C A;  1EHW A;  3MWB A;  2WCX A;  4B9U A;  3ZC4 A;  2RHS B;  3GFX A;  2MZJ A;  3KJV B;  3W9I A;  3DOM B;  2Y1L B;  2FZK B;  5F8J A;  1QSS A;  3HDS A;  4WP3 A;  2HHS A;  1TL5 A;  4OQJ A;  4KGM A;  2W5S A;  4NLV A;  4WPA A;  2AZ3 A;  3H4B A;  3HVR A;  1YZ7 A;  2N7Y A;  1UFK A;  4RBV A;  1TAU A;  1I1G A;  3ISZ A;  2QEX S;  2YNG B;  5GMK a;  2KZM A;  3T5J A;  4CCH A;  3D2W A;  4I1T A;  2FHJ D;  2W5V A;  5KG7 A;  4IRC A;  2R2T A;  4PWD B;  4DLG A;  2ROP A;  2BKO A;  1FTC A;  4Q7A A;  4B3T J;  3J7A 1;  1B70 B;  4KGZ B;  1QSY A;  3GU0 A;  1B99 A;  4WWS A;  4DR4 J;  3BYR A;  4HI1 A;  5I3U A;  2UU9 J;  1U45 A;  2Q6C A;  4KV8 B;  1Q8L A;  3HCX A;  4P71 A;  3FBE A;  2XYP B;  5D3G A;  2NXC A;  5KFU A;  4YME A;  3MED B;  4CNY A;  4FXV A;  1VRQ C;  4NZ6 A;  5M2R A;  3US5 A;  5KG5 A;  3ZTQ A;  2ZD1 B;  2BR0 A;  3M8W A;  4IKA A;  3TZX A;  4DUZ J;  2UUB J;  3UFC X;  3IA0 A;  4PEO A;  2PII A;  2CVE A;  4ED0 A;  2Z57 B;  1YSJ A;  4M5D B;  2V50 A;  3T5L A;  2H54 B;  1I5O B;  2WVC A;  2LP4 A;  1BQM B;  4RNM A;  4WE1 A;  3H2V E;  2GIF A;  3AXM A;  1FE0 A;  4LBH A;  2BAC A;  3N4W A;  4XPE A;  1RYR A;  1XBW A;  2RF2 B;  5A6P A;  2OEK A;  2R8G A;  4YY3 F;  1RWV B;  2AEF A;  1WOO A;  2X51 A;  5D4P A;  5F8H A;  5B0G A;  1OMS A;  2FLL A;  4Q0B A;  1MNE A;  3TEH B;  3DLB A;  2FY1 A;  2IAJ B;  2MXY A;  2GLQ A;  3VGU A;  3A3P B;  2DNR A;  4H4K C;  4KAY A;  1JLQ A;  4B17 A;  4LRE A;  2AYB A;  4B9L A;  4H4O B;  1OYE A;  4JI5 F;  2VIC A;  4LRA A;  2E5I A;  4C8Z A;  3NBP B;  2XNQ A;  2YNF B;  2E7W A;  4NRT A;  5CCM A;  2VFR A;  1BD6 A;  4DR3 F;  2V2V A;  2BRK A;  3GYX B;  2A6M A;  3EGN A;  2DEJ A;  4BHQ A;  4CLZ A;  3PO5 A;  3KJN B;  1N2L A;  3D6F B;  3OFE A;  4OX7 A;  1NJY A;  3N9U C;  4ZS6 A;  2GMJ A;  2BVZ A;  4RO0 A;  4V19 X;  1CJK B;  1Y7A A;  2M4M A;  2GIR A;  2IC3 B;  1JLB A;  4CT9 A;  1QD1 A;  2B4O A;  3KOA A;  2ZZT A;  2W24 A;  1QY7 A;  3EXC X;  2CYY A;  3FCW A;  1CC7 A;  3R3T A;  3VAI A;  2FC9 A;  4DV6 F;  4UY8 5;  1JLC A;  3CDU A;  3H2L A;  3SEO A;  4N76 A;  2AGQ A;  2MQM A;  3KDN A;  1R0C B;  4RX6 A;  2B51 A;  3TJA A;  1ZA2 B;  2R7U A;  4JI3 J;  2HRT A;  2EKN A;  2IIH A;  5LQQ A;  2HW3 A;  2LEC A;  1TK5 A;  5EGY A;  5ETK A;  4LFA J;  4DR7 J;  3D9B A;  3MFI A;  3L3C A;  5KFO A;  3HHK A;  2ZFH A;  1TFY A;  1FJ7 A;  3KLH B;  4FF3 A;  1YZ6 A;  2A0F B;  4YS2 A;  1HYS B;  2QE5 A;  1AA1 B;  4ZVO B;  5LJ3 Y;  2W1B A;  2VU5 A;  3OQ2 A;  1HLW A;  2HZV A;  2ZKT A;  3OVA A;  2COL A;  3MD3 A;  2OUG A;  3VAH A;  3SYZ A;  3EWG A;  4M5L A;  3TRG A;  4PXD A;  3G6X A;  3GV8 B;  3OSP A;  4YHH J;  5HQ8 A;  3X3U A;  1Y4Z B;  3TVK A;  1VGY A;  4W4M A;  1PYO B;  4XDD A;  1ICE B;  1C0T A;  2R9L A;  1JJH A;  2DRD A;  3JTO A;  3HHL D;  2YWK A;  3M6U A;  1IKV B;  4UOP A;  4QU6 A;  2GVZ B;  3WHI A;  2C3Y A;  3I4H X;  4QW9 A;  1BWE A;  1P9Q C;  1RHU B;  2DGV A;  4OJ3 A;  3T9N A;  4RW6 A;  4DS4 A;  3EGV A;  3DI6 B;  1RTI A;  1SHQ A;  2LU1 A;  3MUR P;  4FDF A;  3MAH A;  4D3G A;  5A0Y A;  4CQ1 A;  3JYT B;  3BGL A;  5DQI A;  1KQG B;  2QG9 B;  1HW8 A;  1NK7 A;  2OMO A;  1VQO S;  2UXB J;  2QA4 G;  4I7F A;  3G9C A;  1Q8B A;  2HFZ A;  2HHW A;  4DPW A;  4OI0 A;  3BQ2 A;  1GNK A;  1SXL A;  2GML A;  1HHT P;  1IQZ A;  3D1O A;  1D3W A;  1HL6 A;  4MKY A;  4NZ0 A;  1UJ5 A;  4B3M J;  2AJF E;  2UUW A;  4ZPW R;  5D8H B;  4Q2M A;  3SQG B;  2KG0 A;  1FO1 A;  1X9W A;  3MM7 B;  2ATL A;  3N5F A;  1OY6 A;  4CO1 A;  4EU0 A;  5KXA A;  3RJM B;  2E1M C;  3OR2 A;  2KFZ A;  4DMZ A;  1HMV B;  3W66 A;  2N82 B;  1S1U B;  4IYQ A;  2LEA A;  3CIZ A;  1RHR B;  2DGQ A;  3W5X A;  4CDI A;  1HBN A;  4DV5 J;  3CJ3 A;  5LSR A;  1T9T A;  3UWT A;  1ZED A;  2FYX A;  2G1D A;  1DHM A;  3MOZ A;  4NLO A;  1T7P A;  4OL8 A;  3VAJ A;  1P27 B;  1TVR A;  1UZH A;  4K7Q A;  3IAS 9;  4K50 A;  4K0K J;  3GYN A;  3KK1 A;  3MAQ A;  1DAR A;  3SZZ A;  2XLK A;  3HHL A;  1PJ6 A;  4R5P A;  1NJX A;  3KDO A;  3IG1 B;  2HEK A;  5IT4 A;  5J1E B;  3FSY A;  3H7H B;  3MEE B;  1F9E B;  3NKM A;  2IA6 A;  2LEB A;  5GME A;  3IGV A;  3OVB A;  2HVI A;  4ID5 A;  2RIL A;  3N01 A;  3R7N B;  1WC3 A;  4KHM A;  4ECS A;  1RWK B;  5B0E A;  2CPH A;  3ENA A;  1S1V B;  1Y3J A;  1LWX A;  1XJW B;  3BDP A;  2ZHB A;  3I87 A;  1SJR A;  1F2G A;  3B54 A;  2X7I A;  5CD4 A;  4DL6 A;  1VQS A;  2XS7 A;  1LWC A;  2YQ1 A;  3TA2 A;  3PKY A;  3J7Y U;  2XUL A;  2H5J B;  3DYA A;  1L3V A;  2ASJ A;  3QGG A;  2PFF B;  4USV A;  1KEK A;  4G1I A;  1PO6 A;  4A8M P;  3BM7 A;  1JKH B;  4HT7 A;  2DCL A;  1UJ4 A;  3TUI C;  2Q6B A;  3O5T B;  5KFJ A;  2JJ4 D;  3WBH A;  2DH9 A;  4YDX A;  4AT1 B;  2HUR A;  2WOM A;  1XWL A;  4O3N A;  1LXJ A;  1G6B A;  2H9Z A;  2B8Q A;  1H2U X;  1BC6 A;  1TL3 A;  2GW8 A;  3K5N A;  1CS4 B;  4DV1 F;  3PYE A;  4ZPB A;  3I5B A;  4KB7 A;  4GO7 X;  4NLW A;  5DDP C;  1XER A;  3N6L A;  4U9R A;  2BZ2 A;  3L09 A;  2R7S A;  1Y5I B;  2B7C B;  2IM2 A;  3QFH A;  4N8O A;  1Q4R A;  1YJT A;  2LQ5 A;  4DG1 B;  5GAE U;  4DV4 J;  2IMO A;  2DT9 A;  3TZZ A;  1HW9 A;  4FVM A;  5AXM A;  3GTY X;  3TG0 A;  4RNH A;  5KFA A;  4ZCK A;  2VQE F;  1EET B;  1V3S A;  5JJB A;  5LL6 d;  3Q8P B;  2G9O A;  4X4P A;  3BRE A;  5K9F A;  3M9O B;  3OTB A;  3KMQ A;  1S1X A;  3ZZP A;  4Q5V A;  4DU8 A;  1UVM A;  1URN A;  1NPP A;  1WWH A;  2VDI A;  1JXV A;  2ZBI A;  4GO5 X;  3B82 A;  2W01 A;  2Z8Q A;  1VJW A;  1HNV B;  1SJ1 A;  5T7L A;  3SMZ A;  4QU7 A;  1BGX T;  2YVS A;  1RT7 A;  4KAI A;  3DKD A;  2XG8 A;  5DDQ C;  4M5D A;  3QIP A;  4F4W A;  2OGU A;  2HFN A;  4JI1 F;  1SJQ A;  3VAG A;  5F8G A;  3GG1 A;  4PG4 A;  1DY3 A;  1FDA A;  2BRL A;  1RT5 A;  3HX9 A;  3V4M A;  1CJU A;  1WG1 A;  1PIE A;  3CDW A;  4QWD A;  3KFW X;  1K8A T;  4KYZ A;  1WKK A;  2HHQ A;  2YWW A;  4F8R A;  2PO4 A;  3DHW C;  2CJY B;  4ED3 A;  3C2P A;  1HNZ F;  4DFM A;  1G2E A;  1TP7 A;  1ZPW X;  2CPD A;  3GYG A;  2BOP A;  2W4P A;  4Q8F A;  2RT3 A;  1KS2 A;  1EJ7 L;  4P52 A;  2IPO B;  4O3Q A;  1HQE B;  2R7T A;  2VA2 A;  2PMZ D;  3AJ2 A;  4TYB A;  2BJE A;  4C9D A;  2QA4 S;  4M8L A;  2OTJ S;  5A8K B;  4OI3 A;  1VIS A;  5C24 B;  3FMW A;  5CYQ B;  2IRU A;  1SIW B;  2MKK A;  3Q8Y A;  1R27 B;  4LBI A;  7FD1 A;  1NHU A;  2RU9 A;  2VQF F;  1LFW A;  1TL4 A;  3SXL A;  1U6Z A;  2HQD A;  1SH3 A;  3BGR A;  2OJ3 A;  2ZM6 F;  1NME B;  1R8A A;  2N3L A;  4NCB A;  3BYP A;  3BN4 A;  2EFN A;  4KJI A;  3R5J B;  5LSO A;  2ZWO A;  3E2E A;  5BR8 J;  1XNQ F;  2J8A A;  2R8K A;  4F0M A;  3NNH A;  3SCK E;  2V8D A;  2KL8 A;  2OD6 A;  2PA3 A;  4LR8 A;  2G2Y A;  3CF5 Q;  1T03 A;  1AUD A;  2VKR A;  3ITH B;  2HFS A;  4NLU A;  1CBK A;  4ED6 A;  1SV5 B;  2KJW A;  3LAK A;  1YLX A;  1N6Q A;  4ZG7 A;  4Y2M A;  3EPI A;  2V9W A;  3FZB A;  4OHZ A;  2F1F A;  3LP0 B;  5DLG A;  1O0P A;  4CLF A;  5ETV A;  2PT0 A;  5HLF B;  2Y1R I;  3GJR B;  4DL4 A;  2R8I A;  4C0O C;  1EKS A;  2VG5 A;  4G1Q B;  1UVI A;  1X4E A;  3BDG B;  5L8R C;  1KLM A;  3PDN A;  1Y00 A;  4KR0 B;  2XMA A;  3PM9 A;  2DIS A;  2PA8 D;  3V6D B;  3V5R A;  1NND A;  2FDN A;  4DPX A;  1H2T Z;  5J2M A;  3CJ2 A;  1R31 A;  2GX8 A;  1XR6 A;  4KSE B;  2GO8 A;  1AB8 A;  1C4C A;  4RBU A;  3PYF A;  1QM9 A;  4Y2I A;  2HQF A;  1W2B R;  1E6V A;  3KG1 A;  1PJ5 A;  3Q8U A;  2W9C B;  3H0P A;  3HLU A;  2IFY A;  3VV2 B;  4AL7 A;  1TV6 A;  4KO0 A;  3UDC A;  4ILL A;  3TJ9 A;  4WTO B;  4UUX A;  2V2K A;  2F63 A;  1ELO A;  3OHA A;  3PW5 A;  3ENQ A;  1GK8 A;  2EVZ A;  1RAI B;  2J9C A;  1WI6 A;  3PG9 A;  5IWA J;  4GTZ A;  3SIP B;  1I94 J;  4QIF A;  4PXE A;  5IC4 B;  1M1G A;  4WJB A;  3O1L A;  4MK8 A;  1VCT A;  3POT A;  2MQL A;  1KBR A;  1NDP A;  4UST A;  5HMW A;  1OSC A;  6AT1 B;  4U7U D;  3PW2 A;  1SIZ A;  2UUT A;  1HD1 A;  1H3D A;  4ED2 A;  1YWX A;  4HLB A;  2DNG A;  1VBY A;  2WW8 A;  1BUX A;  2MKI A;  1K0T A;  1VQL S;  3A12 A;  5KG2 A;  3MCM A;  2M2B A;  3QZ7 A;  1S6P A;  3BBF A;  4U95 A;  5F0U A;  5KT3 A;  2WZ1 A;  3LPE A;  4OZN A;  3H20 A;  1F5A A;  2MKS A;  1TL7 B;  4NL5 A;  2BAB A;  1JJ4 A;  3H8Y A;  2HGM A;  3WZ0 A;  4J90 A;  1OO0 B;  1NHK L;  3MR7 A;  4LF5 J;  3HSJ A;  2HNZ B;  2UXC J;  3CCE S;  4WFB Q;  2ZKU A;  1SQE A;  1Z1Z A;  2AYM A;  2J8S A;  2AJQ A;  5ETL A;  2YWH A;  2HRU A;  5KFC A;  1GMU A;  4LRD A;  5LT5 A;  2QX0 A;  1NDC A;  3TOQ A;  4U7U K;  3VZI A;  1HWK A;  2CPJ A;  2ZDO A;  3M30 B;  2R2R A;  4UQG A;  3ZTS A;  3UQS A;  4B9N A;  2XY6 A;  2HBZ B;  5A8R A;  1FKA F;  1KOH A;  5ETP A;  4JV5 F;  3C6T A;  3LAM A;  5HK4 A;  2W8S A;  3JSM A;  4J9V A;  4DL0 C;  1F6T A;  4YQW A;  1J2V A;  3ISN C;  1HBM A;  1Y5L B;  4LSN A;  1RBO B;  4ETZ A;  2YNH A;  3M2V B;  4A48 A;  3D5M A;  3E51 A;  4TU8 A;  3I9Z A;  4HI2 A;  2VG6 B;  2K7K A;  1VQ7 S;  3DGP B;  1FRI A;  2A2D A;  2ABY A;  2HND B;  2RDI A;  2PMH A;  1HBU A;  1XQI A;  4ZJL A;  5HN0 A;  2X1A A;  4C3M A;  2I5J B;  5IM0 A;  2QTW A;  5D0G A;  3Q23 A;  2QYG A;  5H9E K;  2W2O P;  3FDS A;  4BC7 A;  4JYA F;  2OSQ A;  1SQF A;  5AE2 A;  1KVI A;  4MKB A;  4O4G A;  4UOO A;  4PYD A;  1N34 F;  2XMJ A;  1VQP S;  2MZT A;  5J2P B;  3FEX B;  1RLD A;  4YR2 A;  5DG8 A;  1QAJ A;  2G0C A;  4O0I A;  1R89 A;  5HMX A;  3MM9 A;  3EM1 A;  2IUC B;  2HQI A;  3B4M A;  1TU0 B;  4ZN3 A;  2XO7 A;  1RTZ A;  1N52 B;  2WK4 A;  2VH7 A;  3OW2 R;  1TL1 B;  3AOC A;  1S0N A;  2DGS A;  1U02 A;  3QPI A;  3N5B A;  3W5Y A;  2AU0 A;  4ZIW A;  1WC6 A;  4HL9 A;  1IWA A;  2CAD A;  2E5J A;  3CC2 S;  4Y28 C;  3UDE A;  1NKC A;  2CQ0 A;  3PRV A;  1VS3 A;  2DBB A;  2MPU A;  1N33 F;  1EP4 A;  4Q2L A;  5CAA A;  2PEH A;  3M32 A;  3SDE A;  3W9J A;  1MSW D;  5J2N A;  4X4U A;  3NOC A;  2JDJ A;  1EAY C;  2D1G A;  4RR5 A;  4F67 A;  4N8N A;  3IBC B;  4J37 A;  3RAQ A;  1K1S A;  2VBW A;  4IG0 B;  3ZTP A;  3WQP A;  4LR2 A;  3AHP A;  5H9E J;  2LDY A;  3HO1 A;  3WAW A;  1CUL A;  1I51 B;  2BQ3 A;  1SB6 A;  5L1K A;  4O44 B;  4EO6 A;  3LUY A;  2XC9 A;  1NPK A;  3G87 A;  2RDJ A;  1HNX F;  4DUY F;  4GVL A;  1HBO A;  4KHR A;  2B5J B;  3NNA A;  4GVB A;  1DUR A;  3GIM A;  1GX5 A;  2OEM A;  3H4D A;  3E01 B;  3FUY A;  5E7O B;  1XNR F;  1EET A;  4O3S A;  3KNA A;  1RT4 A;  1PKU A;  3Q89 A;  2BKP A;  2EBE A;  3QT8 A;  5GAD I;  2K1R A;  3ED4 A;  1URB A;  2GVD A;  2PD1 A;  4ZCI A;  4C8O A;  2ZJQ Q;  2Y1J A;  4H4M B;  2ZOG A;  2ACM A;  4JI5 J;  4KFB A;  5DS7 A;  4DQP A;  3MCS A;  2F40 A;  2ZH3 A;  1RZM A;  3R6L B;  2KZZ A;  1HNV A;  3PYG A;  4DR3 J;  3FQK A;  4L73 A;  2NLW A;  3MUT P;  1BXN A;  2HNY A;  3CJ4 A;  2DJW A;  2CWX A;  2MJU A;  1WKJ A;  1U1K A;  4FDJ A;  1ZA1 B;  1QE1 A;  1KTV A;  3H40 A;  4UOR A;  5K4P A;  4RW4 B;  3IGN A;  1UFW A;  2DHH A;  1T02 A;  5F0W A;  1EW8 A;  2DCU B;  3NG8 A;  2CQD A;  1O6X A;  3GB0 A;  3CO9 A;  3EXY A;  1TFW A;  3DRP B;  3DRS A;  4ELU A;  1EAR A;  2OO4 A;  2A18 A;  2KVQ E;  4YDD B;  2MEW A;  4LT6 A;  4DV6 J;  1Q78 A;  3K5L A;  3B4D A;  2A3J A;  3RR8 A;  6FDR A;  3M8P B;  2IJN A;  4RKU C;  3NGK A;  4MAK A;  3L7U A;  4HKQ A;  4CNZ A;  2YKN B;  4ZKA A;  2UZA A;  5D0H A;  1IJF B;  4N41 A;  4WIQ A;  4OYZ A;  4WK1 A;  1HI1 A;  1KHL A;  2J0X A;  2DYA A;  5EDW A;  3VHQ A;  4IR1 A;  4FXD A;  3NS7 B;  1VDH A;  4UPH A;  4L3K A;  2F4V F;  3HF5 A;  3D6M B;  1NJW A;  4LQ3 A;  2ZH6 A;  4LF6 F;  1S59 A;  4KHP F;  1ARO P;  1FKO A;  2DPI A;  4ZHR B;  1VMB A;  5F3Z A;  1SCJ B;  3FFI B;  4NAS A;  2WVE A;  4WXW A;  3F73 A;  4QYZ K;  1S6O A;  4HTI A;  4QWB A;  2Y3Y A;  4TNO A;  3SQO P;  2OPP B;  4XTT A;  2CQ4 A;  4LQY A;  3MM6 B;  1RWO B;  3ETO A;  4DPO A;  3A8J A;  2W2M P;  5I42 B;  3OUY A;  5GAG I;  4DV3 F;  2CJX B;  5G4D A;  5C2G A;  3D1Q A;  2WB4 A;  4ZVE A;  3WIV A;  3IWN C;  4YP3 A;  1Q53 A;  2P9G A;  2CPX A;  2HHH J;  4FVC A;  2QV6 A;  4M1K A;  3I0R B;  2ZE2 A;  1TKZ B;  3HHL C;  1YVF A;  2B4V A;  3HFK A;  2M3D A;  1VQM S;  4K4W A;  4X4V A;  3TUP A;  3DDK A;  2MQ8 A;  3KK3 B;  3PEJ A;  3F56 A;  4IO1 A;  2MLZ A;  2DH8 A;  4HYK A;  2DXD A;  2KRR A;  1T9W A;  2V4J A;  3SCJ E;  2VG7 B;  3M2R A;  1I3O B;  3UNY A;  2HAI A;  3CCU S;  3RBZ A;  2MZR A;  3CC4 S;  4Z7C A;  3W2W A;  4Z2X A;  4QYZ J;  3W63 A;  3PNI A;  2ZBC A;  4LQ9 A;  2A6O A;  3TAM A;  1IXK A;  1Q5Y A;  3A8E A;  2C22 A;  3T1Y F;  2NUH A;  2FJV A;  3EDR B;  2CWK A;  4NLR A;  5DRK A;  2JEG A;  4OV6 A;  4X65 F;  2KKH A;  5ETQ A;  4C3L A;  1CG2 A;  4P6Q A;  1KQK A;  2XB2 D;  1Y5N B;  2IHR 1;  2G13 A;  2AWZ A;  5IQ6 A;  1ZS6 A;  1SQG A;  2W8L A;  3P8B B;  3M8Q A;  4DUT A;  4NMX A;  2O67 A;  2W5X A;  1DQA A;  1FKP B;  1RWP B;  3T1A A;  4MKV A;  4TYA A;  1T9V A;  2NPF A;  1FT8 A;  2LEP A;  1F1B B;  2HFV A;  1QDU B;  1RAC B;  5KOW A;  2P9E A;  4P2X A;  3WBZ A;  4DPT A;  1TKT A;  2DTJ A;  5CAB A;  3F44 A;  3RBD A;  1RE1 B;  3NAH A;  1FHT A;  2MST A;  3QRP A;  1K73 T;  3TJ8 A;  4RW8 A;  4F04 B;  4CXU A;  1WEZ A;  2KFN A;  1JJ2 R;  4C3K A;  4U8V A;  4MFB B;  3PW7 A;  1WOS A;  3K5O A;  3NMA A;  5GVQ A;  3EDQ B;  3LAL A;  4I2Q A;  3OBI A;  1GMW D;  1EQJ A;  1RSC A;  2R8H A;  3RTV A;  2KHC A;  3FBB A;  4ALZ A;  1NSA A;  2KU7 A;  2R7O A;  4DL5 A;  2BQR A;  4UOH A;  5DGA A;  4ID8 A;  1BE4 A;  2G2Z A;  1SPB P;  1REV B;  1YJV A;  2KH9 A;  2E66 A;  4NML A;  3D6H B;  1BQN A;  2MHN A;  2ANH A;  1BY9 A;  1ZET A;  1IKW B;  4ED8 A;  4HDH A;  5LMU F;  1ED9 A;  2W5T A;  3LOU A;  1LOU A;  4CLP A;  4TKT A;  1WF1 A;  2HQG A;  2NZ4 A;  4ZIV A;  2RAQ A;  2JHE A;  4P75 A;  3CUN A;  4M94 A;  2W4C A;  4EZ9 A;  3I6P A;  5IT9 Y;  2C3P A;  2I5J A;  4KQZ A;  1RK8 A;  2M7S A;  1VQY A;  3R5B A;  1DAX A;  3LP1 A;  4DV1 J;  2RHQ B;  3NS5 A;  3O6Q A;  4NCG B;  3U7J A;  1WD6 A;  3MHY A;  3BQ1 A;  4K5S A;  3J80 Y;  1R0A B;  2HLU A;  3JAM Y;  2QLJ B;  5IFM A;  3AD9 C;  3OFG A;  4DLE A;  1Y0H A;  1AUK A;  3I5A A;  3OXG A;  2VQE J;  2J7W A;  1PYS B;  5EGE A;  3P5B P;  2E29 A;  1U24 A;  2J76 E;  3FK4 A;  1LW2 B;  1RCO B;  4PWU A;  4USM A;  2HS3 A;  4C98 A;  2HRY A;  2IJF A;  1AFJ A;  3CXC R;  2CZ4 A;  4ZIT A;  4CTA A;  2CJK A;  4I6A A;  1D09 B;  3DLG B;  2ASD A;  2X3G A;  3CJQ A;  4FP9 A;  1U1P A;  3BSC A;  3I32 A;  3MMJ A;  3IAM 9;  2APO A;  2VBZ A;  3CJK B;  4KH0 B;  3Q24 A;  2LFV A;  2YX7 A;  5K14 B;  2ZH4 A;  2XY5 A;  2KM8 C;  1VHF A;  4TU9 A;  4OYI A;  5CYM A;  2DHA A;  3BEG B;  1S12 A;  3MDF A;  1UW4 A;  2FY8 A;  4DFJ A;  2VOO A;  1GMW A;  3JSR A;  5HJY A;  1SL1 A;  4P2S A;  4JI1 J;  2H3E B;  4O44 A;  1TUW A;  4IR9 A;  2RQ4 A;  4KH1 B;  1U49 A;  4YR3 A;  5G0R B;  3J81 Y;  1S6Q B;  1XK8 A;  4YUD A;  1Q8K A;  2DGU A;  5CZX A;  3C14 B;  4NOH A;  1K47 A;  3UD3 P;  4IQX A;  5T14 A;  3TAQ A;  2QN6 B;  1HNZ J;  1UFL A;  2BJ3 A;  5LM7 E;  1RT3 A;  3IRX B;  1RTJ B;  1QAX A;  4AXJ A;  2XMM A;  1EQM A;  4Y3C A;  2PI4 A;  4BDP A;  3WC2 A;  1PGZ A;  3AD7 C;  3H42 A;  2JWN A;  1S1T B;  4DCJ B;  3U1L A;  4DX6 A;  2DNP A;  2QA1 A;  3BS9 A;  4RUH A;  1LWF B;  1WHY A;  1B4S A;  3BGF A;  3W2V B;  3K89 A;  3G4S S;  5EWF A;  1Z4U A;  4KJG A;  3IR6 B;  3MR2 A;  3THT A;  4H4M A;  3L4B C;  1SL0 A;  3FSI A;  4B56 A;  2FUG 9;  2MZS A;  2CPI A;  3PIP Q;  3LWM A;  4F7V A;  3IXQ A;  4OHW A;  2RUG A;  2RSQ A;  4NXM F;  1KHV A;  4M95 A;  3KLE B;  2ASY A;  5EGH A;  1U26 A;  2XSF A;  1RA6 A;  5L38 A;  4J5O A;  4Y34 A;  3GIK A;  2ZM6 J;  4MIW A;  4WTY A;  2HVZ A;  3Q86 A;  1FSU A;  1S5Z A;  4LR7 A;  4G3I A;  3IGZ B;  3D54 A;  5HVG A;  3CGI A;  2Y0B B;  4ETX A;  1N5Q A;  1WG4 A;  4C8M A;  2E7X A;  2BBE A;  1MU2 B;  4M5M A;  1NB7 A;  3PCO B;  1XNQ J;  2BUN A;  4ZVU B;  2DD8 S;  1RAA B;  1YRX A;  2OPR A;  3K7R A;  2MGZ B;  3VVT A;  2BEF A;  1P49 A;  2RH6 A;  4HEA 9;  3U1N A;  4N77 A;  4EBD A;  2CQI A;  4DF4 A;  1PC5 A;  2EKY A;  5CXT A;  5HL7 Q;  1KWM A;  1FCA A;  2HWI A;  9RUB A;  1ZEF A;  4J9N A;  3RBE A;  5L9X A;  4JI4 F;  2C2D A;  3GMG A;  1P9Y A;  1RHJ B;  4I2P A;  1SKS A;  1JLG A;  3PJ9 A;  4IFY A;  2ROG A;  3PR4 A;  1PBU A;  1C0U A;  2BQU A;  2XNR A;  1DTQ A;  2HGN A;  4I6W A;  4JV2 A;  4EBC A;  3N79 A;  3TR5 A;  1GH8 A;  1WC0 A;  2MMY A;  1XMQ J;  3K8V A;  1VRU A;  2IYI A;  2XEX A;  4NRU A;  2B9Y A;  3MF5 A;  5D4L A;  2D9P A;  3MOJ B;  1FWP A;  3M1V B;  3VGS A;  2OPQ A;  7AT1 B;  1P1T A;  3AB2 B;  3ONQ A;  4HDG A;  1SBR A;  2E1P A;  2HZC A;  2YWF A;  2JL9 A;  1XC9 A;  2MKH A;  2B43 A;  4NI2 A;  1KDN A;  1T95 A;  3C19 A;  5D4O A;  9ATC B;  2BYC A;  2QMX A;  2OPS A;  4A46 A;  2NZC A;  1S4E A;  5CYJ A;  3NLC A;  3UVJ B;  4DSE A;  1U8S A;  4TY9 A;  5E5N A;  3M6X A;  3I5C A;  3JTN A;  1EB0 A;  4X2B A;  1FDD A;  1YHQ S;  2MTL A;  4OX9 F;  1ZZF A;  3FRZ A;  3CT9 A;  4M5K A;  1A6L A;  3JB9 k;  1ZTW A;  2C2K B;  2Y0S D;  5AXN A;  2QZU A;  1FD2 A;  2JVR A;  5AJ9 A;  2FJB B;  1QSL A;  4DF8 A;  2XMK A;  1JJC B;  2GO9 A;  5ITH A;  3LH2 S;  5I3U B;  1VC6 A;  2R42 A;  2IYG A;  3K5P A;  3UI3 A;  4O3P A;  4JI6 F;  5D3G B;  3HUL A;  1UAW A;  2FZG B;  2DGO A;  1EI6 A;  5EX3 A;  4NWJ A;  1QUV A;  3SSQ A;  4ZJO A;  4AQY F;  5HBM B;  4BWM A;  2CFX A;  1OWX A;  2GS8 A;  5KFW A;  3I31 A;  3JQK A;  2D41 A;  1QLN A;  4R8U A;  3G6E S;  2OEJ A;  2W9B A;  1PJ7 A;  4N5S A;  2YKP A;  3EGW B;  2QMU B;  1U7L A;  3MR6 A;  5HVF A;  3AFG A;  1FVS A;  5D4N A;  1L3S A;  4ZLP A;  4WE1 B;  1HWU A;  4AE5 A;  3ZNJ 1;  4JV5 J;  2B9E A;  1S0M A;  4C48 A;  1ELZ A;  3NY0 A;  4YR0 A;  4A8O A;  3B6B A;  1SJ3 P;  1F0X A;  4NEY A;  4OJH A;  2HS0 A;  1FKP A;  2XTJ P;  2D3Z A;  5HI7 A;  3OLB A;  1YI2 S;  1UEV A;  4JI0 F;  1OJ4 A;  1AZS A;  1IBL F;  3NNC A;  1U2C A;  2KO1 A;  3KG0 A;  3PXG a;  4N56 A;  2CDR B;  1N54 B;  1JLQ B;  1GXL A;  4FBU A;  2HS4 A;  3CTR A;  1KHN A;  2XMU A;  3UR0 A;  5L0K A;  1UW9 A;  3NGR A;  1HPZ A;  1N34 J;  2C2R A;  2D69 A;  2IFX A;  1REG X;  4O3R A;  2Z4P A;  5KFG A;  2Z30 B;  3D0G E;  3RRG A;  5B0D A;  3DLE A;  3PKM A;  4OZ0 A;  1NDL A;  3OD2 A;  3KUG A;  3LQV A;  3QQC D;  3GV7 B;  4GMK A;  3CIM A;  4AD6 A;  2X1F A;  1XTZ A;  3V6H A;  4A8S A;  1B7F A;  4ECQ A;  1JLB B;  3OL6 A;  1M90 T;  3ULH A;  4HH0 A;  3D28 A;  3DMJ A;  4ZVT B;  2Q43 A;  3J7Z 5;  2EFO A;  2VF3 A;  2BOA A;  2PSZ A;  2M52 A;  4BWJ A;  3DDN A;  2DGW A;  1JLC B;  2HHP A;  4ILR A;  2U1A A;  2E5H A;  4U96 A;  3B8H A;  4RUA A;  4DN9 A;  4IFV A;  1NB2 A;  2QL7 B;  4IOA Q;  1X5O A;  2G0J A;  1UEK A;  2DR9 A;  4LUB A;  2RIJ A;  2KXH A;  4PXC A;  5KFE A;  3NGT A;  4FPI A;  2OFH X;  2P8I A;  3WIU A;  1S7I A;  2VQR A;  2EFQ A;  3BBC A;  4NCG A;  1YRT A;  3CMQ A;  1GTH A;  1MML A;  5TJ3 A;  1MWZ A;  1WTB A;  1HNX J;  4DUY J;  1NJZ A;  2C2Z B;  5HJX A;  1S9G A;  4B08 A;  4GKJ F;  5GRR A;  2ZJP Q;  2N4D A;  1Z2Z A;  1XNR J;  2GCF A;  4YR1 A;  3ZZT A;  3QNW B;  2HMI A;  1IBK J;  4QIG A;  2YPY A;  2HVE A;  3S01 A;  1MG7 A;  4M5I A;  2VKZ G;  2F8H A;  1V5I B;  2J7U A;  1NK6 A;  4NLY A;  1KFS A;  4RWX A;  3QJL A;  3DLG A;  1MRO B;  2YNI A;  1WEL A;  1V3R A;  4C6A A;  1FFG B;  1FRK A;  5DQG A;  4A8X A;  3VF0 B;  4UOG A;  4RW6 B;  4LF4 J;  2DIV A;  1FE4 A;  4KE5 A;  1QUP A;  2LU2 A;  2XSJ A;  2HBR B;  2OP5 A;  3A3N B;  1RTI B;  2CJ9 A;  4DL3 A;  1KC8 T;  1S99 A;  3TAN A;  1KSP A;  3HVW A;  3CCV S;  2JX2 A;  4DBQ A;  4AL6 A;  4OJG A;  3PYD A;  4O23 A;  2ZUG A;  2DNY A;  4DFK A;  5A0Y B;  3SFU A;  3LP2 A;  2BDP A;  3AA8 A;  1KHJ A;  3G82 A;  5G0R A;  1S6Q A;  1M5H A;  3DRR A;  1OPZ A;  3PIO Q;  4HT5 A;  4I7F B;  3KLG A;  2YWG A;  3QO9 A;  3G86 A;  2H48 B;  4XK8 C;  1VQK S;  1S6U A;  3GJQ B;  1SC3 B;  1UWA A;  1O8B A;  4B9S A;  1DZ5 A;  2VON A;  3T6J A;  2B9X A;  2DR6 A;  5DJB A;  3BSO A;  1RU1 A;  2VB6 A;  2N3O A;  1UVL A;  4WP9 A;  3V81 A;  3PHT A;  4PG8 A;  1LWF A;  3S8S A;  3D0I E;  2G1H A;  1R6V A;  2FHK A;  1YGY A;  3OR2 B;  2F4V J;  1VIO A;  4CO0 A;  1PG5 B;  2H5E A;  4LF6 J;  3OTO F;  4KHP J;  1SUQ A;  1HBN B;  4WZQ A;  3QGI A;  1NK4 A;  2AJ1 A;  4X62 F;  2L9N A;  5D0E A;  4PRF A;  4TY8 B;  2W7P A;  4C7Q A;  4OZ2 A;  3U02 A;  2HVD A;  3MMC A;  4QWC A;  2GV1 A;  4EYH B;  2H1Y A;  1TVR B;  4ICL A;  1JIH A;  2BW7 A;  4Q43 A;  1CVJ A;  3J80 U;  3KK1 B;  3VAF A;  4WCE Q;  5FDL A;  2OLW A;  3JAM U;  4DV3 J;  3NAI A;  3QSY B;  3G8S A;  3HHL B;  4UOF A;  3BKU A;  5LXR A;  4R5P B;  2ZZN A;  3U27 A;  2VFU A;  1PAU B;  3KMS A;  3D66 A;  4ID5 B;  2FIU A;  5AT1 B;  4QJV A;  3NP5 A;  1C2P A;  3R9L A;  2JLG A;  2MLY A;  1SJ4 P;  1FFS B;  3NXZ A;  4KRW A;  3OLA A;  3MM8 A;  3VAM A;  2RVJ A;  3DM2 B;  4JI8 F;  1LWC B;  3CC7 S;  2AEM A;  3ISN D;  3RGI A;  3LA0 A;  1KVK A;  3DN9 A;  5DDO C;  3IR7 B;  1APS A;  3DYA B;  4EZ6 A;  3W3S A;  2CAJ A;  2WSC C;  2FTR A;  2ZJR Q;  4QBU A;  5C42 A;  4UY8 T;  1B8J A;  3MCN A;  1NSQ A;  3S7R A;  3U1M A;  3H90 A;  3J81 U;  2EI5 A;  3SSS A;  2L48 A;  2WOM B;  1S10 A;  4S0M A;  3OL7 A;  3T1Y J;  3ZO7 A;  1SVD A;  4CRJ A;  1NJI T;  2RRN A;  3EGZ A;  4OYP A;  1TL3 B;  4QR0 A;  4FF2 A;  4USK A;  4ECW A;  3AOB A;  4BLG A;  1CPZ A;  1UTA A;  4PPD A;  1CJV A;  1V5V A;  3EZ5 A;  4X65 J;  2KXF A;  1S48 A;  3UVJ A;  4R0E A;  1ANI A;  1FJE B;  3MXH P;  1FJG F;  1LK7 A;  2V94 A;  1OY8 A;  3PRD A;  4OFZ A;  2Y8W A;  1C4A A;  4UZB A;  1NBE B;  4DUZ F;  2ZUA A;  2UUB F;  5RUB A;  4PKD B;  2XCA A;  2W4D A;  4U7C A;  2FGO A;  4PZV A;  2HWT A;  4KPC A;  4P2M A;  3GSD A;  1SKU B;  4LSZ B;  1V6H A;  4URQ U;  1G7C B;  3W9H A;  4X4O A;  4QW8 A;  4C0H A;  3G6Y A;  1S1X B;  1RKJ A;  2VIH A;  2YKO A;  5E0O A;  2IRY A;  2VC0 A;  4NA3 A;  2MY7 A;  1VBK A;  2AX1 A;  1L3T A;  3PTW A;  5KFT A;  5HBM A;  5KFI A;  4WFA Q;  1M5P C;  4ZVH A;  2YX1 A;  5T7L B;  5KFS A;  3UNG C;  2FD2 A;  2E7V A;  3HZE A;  1KOO A;  1UCN A;  4QCL A;  5LSL A;  5B0B A;  4NLX A;  1RT7 B;  1WTF A;  3TQ1 A;  3LGM A;  1WEX A;  2ZH7 A;  2VL1 A;  2ZC3 A;  1AJB A;  3QIP B;  5IS2 A;  1R6Y A;  2GZO A;  1JLA A;  3KXD A;  1KR4 A;  2KI2 A;  4DSF A;  3GR1 A;  4CLK A;  2QZ8 A;  3Q3Q A;  4RL1 A;  4WYL A;  1N0V C;  3HSD A;  2GJF A;  3BR9 A;  4NCA A;  4TQR A;  4PG7 A;  2DHS A;  2E9R X;  1RT5 B;  1NH7 A;  4B3O B;  4NLG A;  4CYU A;  1VYA A;  1CJU B;  1NH8 A;  1Q79 A;  5LMU J;  2DNQ A;  3H5S A;  4OHV A;  1CLF A;  3RRK A;  4NLQ A;  3HMJ G;  5EN1 A;  2MY8 A;  4W98 A;  3BR8 A;  3M6W A;  3CUL A;  2C3O A;  2HHX A;  1EIY B;  3SV4 A;  2QT7 A;  1FK9 A;  3MEG A;  2V8H A;  3JQJ A;  3EPG A;  1WHX A;  3Q83 A;  2DNL A;  5DO2 A;  1ULR A;  2MQN A;  4HVZ A;  4ZOS A;  3MTK A;  1OSD A;  2GAG C;  2YPZ A;  1RI7 A;  1R8B A;  1M1H A;  2CZ9 A;  2GGP A;  2IVF B;  2L9W A;  4ECT A;  2BMB A;  5KFP A;  2XY7 A;  1KHK A;  4DOZ A;  3BGR B;  2N7C A;  4OZL A;  5F8M A;  2LYV A;  4PAB A;  3CCQ S;  2FHM A;  4A8Q A;  4P73 A;  3HSG A;  2CJA A;  3VVU A;  4ZVP B;  2XCP A;  2FJE B;  1K9M T;  5AE3 A;  4A8K A;  3W8G A;  2KHD A;  5MAO A;  4F2R A;  1T03 B;  2XYG B;  2H5I B;  2FLO A;  3GSI A;  2NYH A;  5CA5 A;  4CYS A;  2KM8 B;  3MK1 A;  3ZFV A;  2XGP A;  1N6Q B;  3R5A A;  1HAR A;  1FWK A;  1E6Y A;  3T6B A;  3HVT B;  4NWB A;  3DU6 A;  4YN3 B;  3TZY A;  2YKM A;  4Q8E A;  4KKO A;  2VJV A;  1NZ8 A;  3WX4 A;  4W90 B;  2VG5 B;  5E33 A;  3TUJ C;  1KLM B;  3CVK A;  3THV A;  3HZG A;  3CCZ A;  3GJT B;  1ROF A;  1RWN B;  3PX0 A;  4ZCM A;  3MK0 A;  1RT6 A;  5J2M B;  4IDK A;  2VFT A;  4IOC Q;  1ZM9 A;  1E6V B;  1ED8 A;  1ALJ A;  2UVR A;  3UD4 P;  4ZP8 A;  4F4K A;  3P4U B;  1TV6 B;  1A7G E;  2ZEJ A;  4KBI A;  1HNI A;  2HFO A;  4KO0 B;  3PFE A;  3M05 A;  3CD5 A;  4U67 Q;  3KYL A;  4WK3 A;  1TUV A;  4UQT A;  2Q79 A;  4QZV B;  3I0S A;  3D1H A;  1SKR A;  1C1C A;  4DZD A;  2AW0 A;  2M88 A;  3POT B;  1LWE A;  2PFD A;  1MRO A;  1YIT S;  2ZC4 A;  1EQ0 A;  2Z2Z A;  3Q2T C;  2OML A;  3SSR A;  1VI7 A;  1YJN S;  2EBG A;  4CLY A;  1WC4 A;  2CA9 A;  1HWI A;  4NXM J;  2O3D A;  1VQ6 S;  4E0D A;  2K2P A;  1ALH A;  1T3N A;  2I6W A;  2P2C B;  3TAP A;  1LKZ A;  2R3V A;  4NLP A;  1IBM F;  1HQU A;  1X60 A;  5A76 A;  2XZD B;  1S0O A;  5AXK A;  4C11 A;  4KM4 A;  5D77 A;  1S6P B;  5B0A A;  3OTE A;  1WSR A;  5HRO A;  1HNW F;  5F41 A;  1Q7L B;  4F50 A;  3RRH A;  2XRG A;  5LIA A;  4OZ1 A;  3W62 A;  1ZEB A;  2W9A A;  1KHW A;  2XI3 A;  4Y2A A;  4MIA A;  2NXN A;  4P74 A;  4TLR A;  4IQM A;  2ZIT A;  5A8W A;  2MHE A;  2CG8 A;  2V5H G;  4EEY A;  2LKZ A;  1NKB A;  4K4V A;  4DU7 A;  3OL9 A;  2DNK A;  4JI4 J;  3T19 A;  4USW A;  1YIJ S;  2WVB A;  2VDH A;  1ZH5 A;  5KG4 A;  2QO3 A;  1FF2 A;  4ZLN A;  4TQS A;  1TR0 A;  2JRS A;  5A8R B;  2DXE A;  3N6M A;  3N28 A;  5GAD U;  3C6T B;  3JSM B;  1EW9 A;  4WFZ A;  1YRU A;  1HBM B;  4LSN B;  5K8O A;  4TY8 A;  5E3R A;  1FVQ A;  1S1W A;  3CD0 A;  1PYT A;  2YNH B;  1JLF A;  4UW2 A;  1S9F A;  4O3O A;  2DEI A;  4X64 F;  1JMT A;  1GT8 A;  1ZBT A;  2YTC A;  3SI8 A;  5INH A;  2J0W A;  1S77 D;  2RJZ A;  3AJD A;  2F4F A;  3KHR A;  2M8H A;  1HBU B;  3M7V A;  3PY8 A;  2KB2 A;  5IM0 B;  3ENV A;  5SZT A;  5JUM A;  1DQ9 A;  2ILY A;  3DLK A;  1IKX A;  2ZOM A;  1BQX A;  1T05 B;  3T01 A;  2MQQ A;  1KVJ A;  2CVI A;  2YWE A;  5KT2 A;  1MLA A;  3A52 A;  4PAA A;  2AEJ A;  1QAI A;  4C8N A;  1VQ5 S;  4O4G B;  2B6A A;  2QLB B;  4OX9 J;  4CM2 A;  2UXD F;  1WG5 A;  2DY9 A;  1ALK A;  2HZA A;  3BDE A;  4IRK A;  3V4I A;  4TU7 A;  1WF0 A;  4KT0 C;  3SFG A;  5K20 B;  1C1B A;  1IJE B;  3HD1 A;  1KON A;  1U1R A;  3MM9 B;  4IG3 A;  3DM2 A;  1JWW A;  3ZNU A;  3MEK A;  4OI6 A;  2ADB A;  1WF2 A;  1HFE L;  5B09 A;  1N5V A;  1Y10 A;  4JI6 J;  2V2Q A;  1RP5 A;  2BJ1 A;  3BDH A;  2IBO A;  4AQY J;  1U8W A;  3EMT A;  2IM1 A;  1PIL A;  1SH2 A;  1OY9 A;  3IMQ J;  1EP4 B;  3FC9 A;  3DLL Q;  2VJU A;  1CJT A;  3CPW R;  3M32 B;  4KC5 A;  3SDE B;  1QVF R;  2LDI A;  5J2N B;  2RE1 A;  3UDL A;  1NXI A;  3NWR A;  1CC8 A;  1PCA A;  2AGO A;  1LFP A;  4FYW B;  5F3T A;  1DBD A;  4C0B A;  1FX2 A;  4DPY A;  1R43 A;  1Q8I A;  5B7W A;  2I8E A;  1CUL B;  3CCS S;  4DDF A;  4DV7 F;  3K2Y A;  1TKX A;  1WJ9 A;  3CD6 S;  4ZLJ A;  4EUV A;  4ED1 A;  1K44 A;  3MM5 A;  1VBZ A;  2HHV A;  2CQG A;  4DXL A;  2OHD A;  4X4N A;  1RGV A;  1V3Z A;  4XDC A;  1HBO B;  5GAG U;  1HHS A;  2D3O 1;  4GVB B;  3DU5 A;  2L9D A;  5EX0 A;  3W7B A;  4ZG9 A;  1S4F A;  3MI7 X;  1TK0 A;  1RT4 B;  2L41 A;  3BO2 A;  3NVL A;  2KT2 A;  2K1R B;  1RT2 B;  2GVD B;  3MGJ A;  1IBL J;  4M63 A;  4OHY A;  3MMA A;  3O44 A;  3OV7 A;  3N0V A;  2RD5 C;  2EW9 A;  3OR1 A;  2DVI A;  4KFB B;  2YX4 A;  5KG1 A;  4NYZ A;  2KN4 A;  1NRK A;  4TLQ A;  3CB4 A;  4Q45 A;  2KRB A;  3AOD A;  2J9D E;  1RLC L;  5DET A;  1KN6 A;  2W7A A;  4OZ3 A;  2GNK A;  3GFH A;  1N5Y A;  5B0C A;  2HNY B;  1R0B G;  3BSA A;  2E9T A;  1U1Q A;  2QC3 A;  3C16 A;  3CED A;  3MR5 A;  2KG1 A;  4IOB A;  1QE1 B;  2J7K A;  2RQK A;  3LF0 A;  4RW9 A;  4PUO A;  3IC1 A;  5KT7 A;  4X4R A;  4ENO A;  1KKH A;  4B3O A;  3PW0 A;  1N0U A;  2IM3 A;  4OYO A;  5L39 A;  3DRS B;  2GIQ A;  3KKF A;  4OLP A;  1U0S A;  4LIR A;  4RNO A;  3I9V 9;  1UPM B;  2EXU A;  2GSU A;  2GQ2 A;  5KFD A;  2F7V A;  3M4X A;  4EFA C;  2ZHA A;  1OQ3 A;  2VBY A;  3PRB A;  3CMR A;  2BW2 A;  1JQG A;  2LXF A;  3W1Y C;  1D9F A;  4FYD A;  2J9D A;  3R7B B;  5KT5 A;  1YX2 A;  3DOL A;  4GRS A;  3D6T B;  3TEG A;  3KHH A;  3UE2 A;  4DR2 F;  2BX6 A;  4DX5 A;  4ZCL A;  4J9K A;  4FS2 A;  5M2U A;  2YKQ A;  3ZZR A;  1L5U A;  1FKO B;  3H5U A;  4GKJ J;  4ATN A;  2F9J A;  4LF2 A;  2B4U A;  2W2P P;  3FEY B;  1TZ0 A;  4JI7 F;  2DR5 A;  4QR2 A;  4Y00 A;  1VRT A;  1ZAX A;  2E44 A;  4K4T A;  4XAK A;  4TXS A;  3HSZ A;  3EE3 A;  3J7A N;  4GTW A;  2VZ9 A;  1UKU A;  3OUY B;  1FES A;  2E1R A;  2RQM A;  4ANE A;  1AYE A;  1S7H A;  5AXL A;  3NGD A;  4IH5 A;  2FLP A;  1LW0 A;  3IRW P;  3P96 A;  4UPL A;  4NZ7 A;  4Z7Y A;  2ZE2 B;  3MMB A;  4ECX A;  2V63 A;  3T5H A;  2RU3 A;  1NHV A;  5ETS A;  2HSE B;  3HVT A;  3IS9 A;  4LSL B;  1FNM A;  3QWP A;  1TUG B;  2ZHO A;  4F3O A;  2XR9 A;  5IWA F;  1I94 F;  3MUV P;  2ZBR A;  4F3M A;  1Q81 T;  1JX4 A;  3TX8 A;  2A1B A;  2V4J B;  3EVW A;  3M2R B;  2UV8 A;  4PG6 A;  2NCK L;  2AT1 B;  3VCD A;  2WAQ D;  2CIM A;  1JB0 C;  5KAK A;  1XR7 A;  3MK2 A;  1HQ2 A;  4RW7 A;  1U1N A;  2GC8 A;  3IDD A;  3IWL A;  3W2W B;  3V6J A;  4NE9 C;  3FBC A;  3TAM B;  3QLH A;  4F4A A;  3KLI A;  2NPI A;  3OXL A;  4M5H A;  2HPU A;  3C6U A;  1FXR A;  1VQ4 S;  4FKY A;  2A2C A;  1X5T A;  6FD1 A;  4PXB A;  5BXI A;  3ZZZ A;  2V34 A;  4URS A;  2ZWP A;  2W7O A;  1GAO A;  4AYB D;  4OYX A;  3NKR A;  4IO9 Q;  3OTO J;  3OVS A;  1VHI A;  2QMW A;  5KG3 A;  5K5M A;  4DSK A;  4X62 J;  1KH4 A;  3TNV A;  1RT1 B;  3AQO A;  3M8Q B;  5ETN A;  1M5O C;  4ZVG A;  2I0X A;  3BV8 A;  1YG0 A;  5I3Q A;  3DYC A;  2W5W A;  3KNG A;  1SC6 A;  5F8L A;  4MT1 A;  2AMC B;  3NKN A;  1X9M A;  1ELX A;  4DL7 A;  4F3Q A;  1N32 F;  1ZPV A;  3UN5 A;  4FPR A;  2Q3P A;  4E8U A;  4LFB F;  2F65 A;  2K7J A;  1TKT B;  3QGP A;  4LFC F;  2CUY A;  3QJP A;  2JLF A;  4RW8 B;  4DEZ A;  3OHB A;  4EO8 A;  2GHW A;  1ZAV A;  1FEE A;  1T94 A;  4EWT A;  4OV1 A;  4I2Q B;  2DY1 A;  4KTQ A;  4LRB A;  2HBY B;  3PX6 A;  1WUU A;  4JI8 J;  1JXL A;  1DLO A;  1X4B A;  5GAH I;  2R2S A;  3R2C J;  4JV0 A;  2AV5 A;  1RTD A;  1BQN B;  2Z2M A;  4F4X A;  2WVF A;  2E9Z A;  3MZI A;  2BKN A;  4DCP B;  4WKY A;  3NKQ A;  1H2V Z;  3L7O A;  5DGB A;  4KAV A;  2VD3 A;  3GG0 A;  3ZZ0 A;  1DTT A;  1G3O A;  4DQS A;  1F5C A;  4QIW D;  1FJC A;  5B0F A;  4OYW A;  2BV3 A;  3MFH A;  4DQI A;  2PC6 A;  3PAC A;  3QZ8 A;  1I6J A;  2V8G A;  4Y2C A;  5I3P A;  3ZTO A;  2VFV A;  4MIV A;  3FEZ A;  1D1U A;  3EX7 B;  3R1L A;  3LP1 B;  2UVU A;  4DSJ A;  1T05 A;  1X0F A;  1H72 C;  1FJG J;  1X7V A;  1TMM A;  3SCL E;  2CQ1 A;  4OX8 A;  3FBF A;  4DV0 F;  3HK2 A;  4ZMM A;  5D0R A;  1P1L A;  2BA9 A;  1T8E A;  2D3O R;  3I4P A;  3IBF B;  1TAQ A;  4HH1 A;  4LRF A;  2VPX B;  2KFY A;  2FLN A;  4DZ6 A;  2UVW A;  2QFI A;  2OAU A;  2D1C A;  8ATC B;  5KFK A;  1HWJ A;  5ETR A;  4CTA B;  3FNN A;  1FTR A;  3C46 A;  2NYI A;  4WBF A;  2EG2 A;  3TUZ C;  3DFE A;  4JBC A;  4DR6 F;  2DIU A;  1W26 A;  2JFK A;  2LXI A;  5LRN A;  3RB6 A;  1ZM3 A;  4ZVR B;  2Q1L A;  2B56 A;  2XZW A;  2XMV A;  4G6V B;  3BO3 A;  3VZH A;  2ACY A;  3RR7 A;  1UVJ A;  1FRX A;  5M2P A;  2WHO A;  2I2Y A;  1NZA A;  5CYM B;  5HO4 A;  2MDA A;  2XI2 A;  2Z0G A;  4PQU A;  4ILM A;  2LA4 A;  3ZTR A;  1JLE A;  1IR2 A;  2W8D A;  5DLW A;  2QRR A;  2C3M A;  4BBY A;  4DSI A;  1YJ7 A;  1VC0 A;  1XMB A;  1RJJ A;  3UN3 A;  2LQ8 A;  1NUE A;  2R7W A;  4LR9 A;  2OSR A;  4YY3 J;  2FHJ A;  4HAC A;  1RT3 B;  3KJQ B;  4ZPT R;  3R5D A;  3TQE A;  1EW2 A;  4K4S A;  2QSW A;  4NYP A;  3MPU B;  2B8P A;  1S49 A;  4QWE A;  3GIJ A;  2HAF A;  3NCP A;  1RT2 A;  1UWB A;  3VQT A;  1NEE A;  5J2Q A;  1KRP A;  4F0H A;  2VV5 A;  1KH7 A;  4UUW A;  4FYX B;  2M8D B;  3MCO A;  8RUC A;  3RB3 A;  3K58 A;  2OTL S;  2KYX A;  3WC0 A;  1JNZ B;  2KTQ A;  2CDQ A;  3CSK A;  2WON A;  1D8Y A;  2ZOF A;  5DZ7 A;  4EI2 A;  1YKW A;  2U2F A;  2DNN A;  3X1L B;  2DK2 A;  1RTH A;  2CNL B;  1VFJ A;  1XMO F;  3GJS B;  2DB1 A;  1E3C P;  3BDF A;  3T3F A;  4JV1 A;  4CWB A;  3HFZ B;  3ILI A;  1S79 A;  4ES2 A;  1YTY A;  4RWW A;  2WTF A;  1KH9 A;  1YJU A;  3GON A;  3LWL A;  4GTY A;  4C2M A;  1P6T A;  5KFV A;  5IJS A;  4WKR A;  1X0P A;  3OTC A;  3Q0A A;  1IKY A;  3NGS A;  2GSO A;  3QAE A;  1RYS A;  2R4F A;  1HD0 A;  4P7T A;  3G2X A;  4Y0F A;  3NRB A;  1B7Y B;  3AAW B;  2QLX A;  3W60 A;  1KD1 T;  2OPR B;  1YJR A;  2NSB A;  1N56 A;  2RUS A;  5L0E A;  1R8H A;  1RBL A;  3RB0 A;  3M2U A;  3BJY A;  2V6A A;  2JC0 A;  1D9A A;  5U47 A;  2F3J A;  4GTX A;  2I1R A;  3G71 S;  3ICL A;  1HR0 F;  2HLT A;  3R7S B;  5KT4 A;  3I55 S;  2UUA F;  5HVH A;  3CCM S;  3PV8 A;  1J5O A;  4ES3 A;  3W8P A;  4I2P B;  1X8D A;  2XYH B;  4LF7 F;  2H4Y B;  1JLG B;  2QIF A;  3BO4 A;  5JMN A;  3Q8R B;  1FD8 A;  2BJ9 A;  4IFY B;  3EIC A;  1C0U B;  5C25 A;  1DTQ B;  2HHH F;  2ZNY A;  2HGL A;  3D68 A;  3VR1 A;  3EZO A;  1VRU B;  1RAF B;  2MZQ A;  2V0N A;  3NKP A;  3TVY A;  3A3O B;  4OZJ A;  1YDL A;  3KLV A;  1WI8 A;  2CQ3 A;  1VC5 A;  1FX4 A;  1SH0 A;  4KPY A;  2WRM A;  1YJ9 S;  3C3L A;  1NDK A;  5L1J A;  3DOK A;  2CNO B;  5DQH A;  2OPQ B;  1TQL A; 
#chains in the Genus database with same CATH homology
 3UN3 A;  1EJJ A;  4ZG9 A;  3NKM A;  4CYS A;  3WAX A;  1Y7A A;  4LR2 A;  4ZG6 A;  3UN2 A;  3MK1 A;  3BDG A;  4LR9 A;  4FDJ A;  4LRB A;  5EGH A;  3WAW A;  2GSU A;  4MY4 A;  2IFY A;  5L0E A;  4TN0 A;  1EI6 A;  2W5V A;  4UOR A;  5K4P A;  4UPL A;  3NVL A;  4NWJ A;  4CYR A;  4QAX A;  4UOO A;  4LRF A;  2W5R A;  1FSU A;  4ZGA A;  1EW2 A;  4LQY A;  3NKR A;  4MHX A;  4LR7 A;  4CXU A;  3LXQ A;  3IGZ B;  4UOP A;  3CMR A;  1EW9 A;  3OT9 A;  1ALH A;  4LRD A;  4UPI A;  3T02 A;  2VQR A;  4GTZ A;  1EW8 A;  4LR8 A;  1AJA A;  1KHN A;  1URA A;  1HQA A;  2W5Q A;  1O99 A;  4GTX A;  5KXA A;  1KH4 A;  1B8J A;  3TG0 A;  3BDH A;  1KH5 A;  5L0K A;  4CXK A;  1KHJ A;  3KD8 A;  4FDI A;  4UPK A;  2XR9 A;  1KH7 A;  1ELY A;  3NKQ A;  1Y6V A;  4LRC A;  5TJ3 A;  3T00 A;  1E2S P;  2IUC B;  4KM4 A;  4KAV A;  3MK0 A;  1EQJ A;  5INH A;  2GLQ A;  4ZG7 A;  2GA3 A;  1AUK A;  3SZY A;  1P49 A;  1E33 P;  1ANJ A;  3M8Z A;  1SHQ A;  2RH6 A;  3E2D A;  3DYC A;  5LRN A;  5LQQ A;  5DLV A;  2W5W A;  3M7V A;  4KAY A;  5EGE A;  3NKO A;  4LRE A;  1ZED A;  5GRR A;  3ED4 A;  1HJK A;  1URB A;  2W8S A;  2XRG A;  3TWZ A;  5C66 A;  5LIA A;  3NKN A;  1KHK A;  1AJB A;  1ZEB A;  1ELX A;  4NWX A;  4YR1 A;  3TX0 A;  5GOV A;  4LRA A;  1E3C P;  3BDF A;  1AJD A;  5IJQ A;  3M8W A;  1K7H A;  3UN5 A;  1ANI A;  5L0B A;  3MK2 A;  4MIV A;  2ANH A;  1ALI A;  3T01 A;  1ZEF A;  4CXS A;  1ED8 A;  1AJC A;  3Q3Q A;  3BDG B;  1ALJ A;  3IDD A;  3WBH A;  3NKP A;  4KJD A;  5LRM A;  1KHL A;  1ELZ A;  1ED9 A;  2GSN A;  2W5T A;  1N2K A;  1KH9 A;  3DPC A;  2IUC A;  3B5Q A;  3A52 A;  1SHN A;  2QZU A;  4GTY A;  3M8Y A;  4KJG A;  2W5X A;  3IGY B;  4UPH A;  5IJS A;  5AJ9 A;  2ZKT A;  1O98 A;  2W8D A;  1ALK A;  4B56 A;  1E1Z P;  2G9Y A;  2W5S A;  3UO0 A;  5DLW A;  3WAY A;  3SZZ A;  5HRT A;  2GSO A;  2X98 A;  4GTW A;  4N7T A;  3UNY A;  2D1G A;  1N2L A;  5DLT A;  3WAV A;  1HDH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...