4LR7A

Phosphopentomutase s154a variant
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
Knots found
sequence length
391
structure length
390
Chain Sequence
b'NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTAADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 142
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 4lr7A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lr7A01
3TG0A 3IGYB 1ANIA 2XR9A 3BDHA 4LRAA 5TJ3A 2W5TA 3UO0A 4LRFA 5EGEA 4B56A 4LR7A 1E2SP 4NWXA 2W5QA 4CXSA 1KHLA 4GTZA 5EGHA 4CYSA 1KHNA 1ED9A 4UORA 1E1ZP 3KD8A 4KJGA 5DLTA 4ZG9A 3TWZA 3BDFA 4LR2A 1EJJA 2W5SA 1SHQA 3WAXA 3E2DA 2X98A 3Q3QA 1KH7A 1ALHA 1ZEBA 4GTXA 3TX0A 4GTYA 2XRGA 4FDIA 1ELZA 4NWJA 4UPIA 4ZG7A 4LREA 2W5WA 1EW8A 1O99A 2GSOA 4GTWA 1ZEDA 1FSUA 4MIVA 3WBHA 3B5QA 3M8YA 3NKRA 3UN2A 3BDGA 3NVLA 1KH5A 1EW2A 3OT9A 3IDDA 2W8SA 4LRBA 3NKQA 4KJDA 5KXAA 1HQAA 5LIAA 1B8JA 5IJQA 4LR8A 3NKPA 3T01A 1KH9A 1EQJA 1N2LA 1ANJA 1Y6VA 3UN5A 5LRMA 1ALJA 1N2KA 1P49A 4UPHA 3MK1A 1Y7AA 1KHKA 1ALIA 2W5RA 3M8WA 1K7HA 1O98A 1AJCA 4CYRA 1ALKA 5GRRA 2IUCB 1ELYA 5IJSA 1URAA 4CXUA 1AJDA 2W8DA 1SHNA 4KAVA 5L0EA 4LRCA 4KM4A 2QZUA 4UPKA 3M8ZA 4ZG6A 3IGZB 1ZEFA 5AJ9A 5L0BA 1E33P 3WAVA 1HDHA 4MY4A 4TN0A 5HRTA 4LRDA 3UNYA 2GSUA 1ELXA 3MK2A 3SZYA 3DPCA 5LRNA 5LQQA 5INHA 4LQYA 3WAWA 3UN3A 5GOVA 2VQRA 1AJBA 2GSNA 2GLQA 1EW9A 3MK0A 1AUKA 1ED8A 3CMRA 1EI6A 1E3CP 2D1GA 5DLVA 4CXKA 4UOPA 3DYCA 2ZKTA 3M7VA 3NKNA 1URBA 2W5XA 1KH4A 3ED4A 4ZGAA 5C66A 2ANHA 2GA3A 1HJKA 4KAYA 2G9YA 2RH6A 2W5VA 4YR1A 5K4PA 3WAYA 2IUCA 5DLWA 1AJAA 4QAXA 4UPLA 3T00A 5L0KA 3A52A 3NKOA 4LR9A 3NKMA 2IFYA 1KHJA 3LXQA 3BDGB 4MHXA 3T02A 3SZZA 4UOOA 4N7TA 4FDJA
chains in the Genus database with same CATH superfamily
1WI8A 4NX9A 3JSBA 1KHNA 4F0KA 4DSLA 3R5JB 3D6HB 4KHRA 1NDCA 4EK2A 1RTJB 1OWXA 1EETA 4I2QB 2PSZA 2XLJA 3H59A 3KDNA 1S76D 2QL9B 2MLXA 3ET6A 2Z8QA 3M8YA 4OI6A 4F3OA 2HZVA 1BGXT 4WYWA 3K17A 3TRGA 4OMFG 3SQGA 3C6UA 3SYZA 4DUYF 2CZVC 1VLOA 3CMES 3G2XA 3TUZC 1YITS 1H2TZ 2CJXB 5KT5A 3BZQA 3VVTA 3QGPA 4TN0A 4P72A 1MMNA 2VPWB 3V81A 2UVRA 4LF4J 4JI3J 4TU8A 2Q6CA 4H4KC 2MKHA 4LF8J 4B9MA 1JNZB 3O6QA 4KGZB 3DXSX 4ZK7M 1TKZB 2GNKA 2P9GA 1JLBB 4C3KA 4QWDA 1YBAA 2JSXA 4Q5VA 5LJ3Y 1MN9A 1GXLA 2E1PA 2ILYA 4USMA 2HIYA 3DLGB 1IBCB 4A8KA 5DLTA 4JI4F 2ZDPA 1SHQA 3SCKE 4YHHF 1NDPA 4ZOSA 2VA2A 2V4JB 1HR0J 3GV7B 1P1LA 4ZA1A 2BVZA 2J9DA 1LWCB 5CD4H 2FQQB 2PDAA 3D54A 3PDNA 1TKDA 4WKYA 5LM7E 1JKHA 3VQSA 1RHUB 2AYGA 2FDNA 5E33A 3KLHB 5DJBA 4UOFA 5KFIA 4USUA 4ZIVA 3W60A 4C8NA 1RTHA 2VPZB 4YY3J 2RUSA 1PAEX 4PG5A 2RS8A 2XMUA 1N5SA 4YDDB 4ELVA 4RW7A 4DV2F 1Y4ZB 5J1EA 1Z2ZA 5HATA 3CJ2A 1KHJA 4I2PA 1N52B 4B3OB 2ZE2B 4LQ3A 1VHIA 5J2NB 5LMUF 4XIUA 2Z2MA 1WUUA 4NLQA 3HZGA 2UUAJ 8AT1B 2BANA 3AAWB 2BRLA 1S7HA 4OYIA 3NKRA 5E3RA 2R3VA 4DL3A 2BX6A 2IJFA 1HBUA 3J81U 2EFPA 3OPKA 3DRPB 1G1XA 2H48B 1SJ3P 3KUHA 3H5XA 1CG2A 4RW8B 2XSFA 5KFEA 2NXEA 5B0GA 2XY5A 3AT1B 2FZGB 5ETNA 1YWXA 3FC9A 5D4OA 4DEZA 2DHSA 3OR2A 2DGVA 1RHRB 3RAMA 4DR2F 2OGUA 3KDOA 1KS2A 3JQJA 3W65A 4OQJA 5M2UA 2OSQA 3HVTB 3ZO7A 1UVJA 3I32A 1A6LA 2YKNA 4OYWA 3ZZTA 3PO5A 1I94F 5C7PA 5I3QA 2PI4A 1JMTA 2WW8A 4LSNB 4Z2XA 1R8BA 2R7OA 4QW8A 5CYQA 2DRAA 5BR8J 4I69A 5KFHA 4X64F 3K7RA 4HH1A 2J0QD 3QAUA 2E9ZA 3HX9A 1TL3B 3UDVA 1S0OA 4GC6A 4DFPA 3UDLA 2UP1A 1VC5A 1B0PA 1WOSA 2EW9A 1UVIA 3L4BC 4LREA 4V19J 2CJAA 3KJNB 3DM2B 4MK7A 3MM9B 5LIAA 3IBCB 4NPOA 2E7XA 3A3NB 1WC1A 3IAM9 4CXUA 2V67A 5DDQC 1OSDA 4C8LA 3M8PB 4IO1A 5KFVA 4A48A 1OY6A 1FTRA 4Q44A 2W9AA 3J7YI 5IC4B 1HQEA 3TARA 1KHWA 5A8KB 2R7SA 1TZ0A 4JI5F 2G2ZA 4A8WA 2GHWA 1LQ9A 1VQ7S 4DS4A 3NS6A 4DR6J 1LFPA 4KGMA 2LA4A 3IM9A 3BJYA 1EQMA 3LW5C 2LEBA 2HNYA 1X0PA 3GILA 4C3MA 1WD6A 2DPJA 4LBIA 4JI1F 2DNRA 2XS2A 1CULA 3LP2A 2HKEA 2CRLA 1PYSB 1K1SA 2XS7A 2IVFB 2DH7A 5KFQA 4J9SA 4J7CA 1WEYA 4B9VA 2ILZA 1DJ0A 3OR1A 5KFPA 2IC3B 1UW9A 4G1IA 1IUJA 3NCQA 4DFMA 2DVIA 2X3DA 2FJAB 4NCAA 1RP5A 5J2MB 2ZZTA 2IBOA 2DEJA 4USKA 4X2BA 2AJ2A 2UVVA 2XGPA 4RKUC 5JMNA 5EX3A 2GSNA 4ID8A 2KZMA 2FVQA 1FEEA 3DLKA 2IJNA 2QSWA 3IN5A 2H1YA 2JNJA 2YKMB 5LXRA 4CH1A 2HQ3A 2IAJA 2QLFB 3A52A 1Q78A 2VFRA 3VCDA 4YQWA 2VDHA 2DRDA 2EFQA 3ZTPA 4OJ3A 4WTYA 4C8ZA 3MGJA 1RT6B 4CXSA 3QATA 3I4PA 4NLYA 4JP8A 2F9JA 4QBUA 2BZ2A 3AB2B 3ITHB 5E0OA 3HK2A 1S1WB 2V8VA 2YWFA 1RWPB 3KJFB 3EXYA 3UCZP 3VAJA 5KT6A 3VV2B 2HVEA 2V2QA 3W2VB 3KLFA 3CIMA 3OVBA 4OYAA 2CNNB 3H0PA 2E1AA 2VFVA 4WFBQ 4IFVB 2VG5B 1RYRA 1Q8LA 3IWXA 1YBTA 3FJ2A 2HVZA 1RHMB 1RTJA 4I2QA 2RQMA 4OYXA 1WC5A 2HQCA 4DR7J 4FXWA 1F5CA 4UUXA 2ZH7A 3THVA 3H2LA 4BBYA 1J5EF 2UUWA 1QSSA 1SKRA 1RUSA 1Y00A 2ZFHA 5A8RB 1V5VA 5KG7A 1FX4A 4Q2LA 4DV2J 4QZVB 1LV5A 2H4WB 3P96A 4KFBB 3CCUS 1F2HA 4D3HA 1ZPWX 4O0IA 3KNGA 1GAOA 3FMBA 2KJVA 5F8GA 5HAOA 1TKZA 4CO3A 4MYUA 1JLBA 4C8MA 3DHXA 2V2KA 1D1UA 3AXMA 1UZDA 1X5TA 4UQGA 3IXQA 1ICEB 4OYBA 2DHHA 2GHVC 3NS7B 2M70A 2GX8A 3DLGA 4EO6A 3ENAA 4IRDA 4DWIA 3DLBA 5GADI 2AD9A 3M2VB 2C2ZB 1U25A 1M5KC 3E2EA 1N36F 2VIHA 2EBEA 4LF1A 3RR8A 2DBBA 4JI8J 2V4JA 4MY4A 2R7UA 4KO0B 1M5VC 1KBRA 1LWCA 2L9NA 3OJSA 3H4BA 1EARA 1VRQC 2HFOA 2XULA 4L76A 2BJDA 3MEDB 1H2UX 4UUWA 1XEZA 5CH7B 2UXBJ 1APSA 4NXMF 3WAYA 3H2VE 2RAQA 3KLHA 1H6KX 3H5UA 4Y0FA 4M5KA 2DHAA 4DJBA 1KHVA 3F56A 2HRYA 4TKTA 2OLWA 2CWXA 4E0DA 1PJ6A 3VAGA 3G6YA 1WNEA 2RF2B 1G3OA 2DYAA 1EJ7L 2BJ3A 2WVDA 2CG4A 4RJVA 3LF0A 1RWVB 2J0XA 1WHYA 1RGVA 4JV0A 2M3DA 1ZA1B 1YG0A 3M8RA 5KG1A 1L5UA 1F0XA 5IFMA 3VAHA 4QJVA 3TAMB 4B3OA 2ZE2A 3MTKA 2ASDA 5J2NA 2HLUA 2QL5B 1K0TA 4ED2A 2ZKUA 4J9PA 3K8VA 2AZ3A 3KG4A 2XWYA 4OJ1A 2KVIA 3AD9C 4LFBJ 2DNPA 3CUNA 3DLLQ 2MQQA 3DPCA 2LMIA 2GGPB 4ZIWA 4ED7A 3PCOB 3G9CA 2KG1A 1VHFA 3DRPA 5KFXA 3NAIA 2PI5A 1TAUA 2DO0A 2ZH1A 1Y3KA 1KDNA 2BM1A 2CPFA 2F1FA 3H40A 4RW8A 2CPJA 4Y3CA 3BKUA 3OW2R 2M2BA 2DEIA 2DR5A 1YVFA 4N7TA 1T95A 3IGYB 2C42A 4C48A 4JI5J 3P5BP 3M6UA 1H38A 4AL5A 2YH0A 3G6ES 3VF0B 4I1TA 1SL2A 2MKKA 2ZBIA 1PO6A 2BV3A 1K8AT 2J8AA 3HVTA 1U1MA 3Q3QA 1FWLA 4QPXA 1FSUA 2AHOB 1W26A 1VFJA 5KAKA 4LSNA 4OLPA 5CA5A 4N8NA 2IFXA 2KXHA 3QT5A 5FJ4A 4ZJQA 3V6DB 1ALIA 1LFWA 2VQEF 3BH7B 5DG7A 1TL3A 3CPWR 3NNHA 1RWOB 3HT3A 5LRNA 4Q0BB 3DM2A 4A47A 1FRIA 3TZXA 4CWBA 3MM9A 2BJ8A 1WORA 3ETOA 2KH9A 1IN0A 3P45B 1SUQB 2EFVA 1RA7A 3TA1A 4XK8C 2Z2ZA 1KVKA 3VGUA 3M8PA 2CJKA 2W5QA 2ASJA 4GMKA 1HNIB 2GFFA 4PZVA 4KJGA 2IRYA 2VD3A 2NS1B 1SIZA 3PM9A 2XMKA 1ELZA 3MUTP 5A8KA 5HBMB 3HJFA 2BOAA 2XG8A 2ZBQA 3JQKA 2HHHJ 1LEOA 4FVCA 3UPFA 3BSNA 2YY3A 1ZZNA 1PILA 2AYMA 4NLRA 2P8IA 4DCPB 1P49A 2CUYA 3PRBA 2DH9A 1Y7PA 3K5LA 1CJTB 5B0DA 1HDHA 3GFZA 4F3MA 3GTYX 4KPCA 2DIUA 1Y10A 1SH3A 2Z56B 3M30B 3QFWA 1NJZA 3EUNA 4K50A 4J9OA 1F60B 2M88A 4QOTA 2ATCB 5D6GA 2ACYA 2YQ0A 2LKZA 2IC3A 3LGNA 1J5EJ 2JL9A 1SXLA 2N3OA 3GPAA 3O1LA 5HSPA 4O44B 4HT7A 4PG6A 5J2MA 2XO6A 1CQMA 2BXJA 3BH6B 3TYTA 2KHDA 3OUYB 5DGAA 4F2RA 3VR1A 3FQKA 3J7A1 3KKFA 1FT8A 1N32J 4ES1A 2Y1IA 2WCXA 3EVWA 1IR1A 1ALHA 4W90B 4YR2A 3D1OA 2JZ5A 2NLWA 1C1CB 2KT2A 1GEHA 1T9YA 3W66A 3WBHA 3D4JA 2VFSA 2HG4A 3WHIA 4R0JA 3I9V9 2VQFF 3LA0A 2LU1A 4DPWA 1TU0B 1RT6A 2Y1LB 2XTJP 4YMEA 2UVUA 2OKQA 3JB9k 4U7UD 5M2RA 3SSQA 2FVRA 2EI5A 3SIPB 1MN7A 1S1WA 3D0HE 2RS2A 4CI0B 3B4DA 3FKBA 3M9OB 5GAGI 4KR0B 3W2VA 2UUCF 2FLLA 2RH3A 3MMAB 5HI7A 3M9NB 1HNXJ 1N56A 1UFKA 1NHVA 4X66F 1WF1A 4IFVA 2VG5A 1E6YB 2D9OA 2N82B 4A8SA 3CJ3A 1QAXA 2VL1A 2LQBA 4MHXA 3O44A 4DPOA 5C25B 3CWJA 3PIOQ 3FBFA 4OX9J 2B4OA 5KG0A 4R5PB 2K7JA 3C16B 2ZVSA 1U1LA 5C5JA 1YIJS 5A8RA 1FRLA 1R31A 4GKKF 4WXOA 4KFBA 4JYAJ 4NEYA 3OT9A 2KXFA 1NAQA 3P8BB 4P2SA 1X9WA 4QW9A 3S8SA 4TXSA 3HSJA 1ULRA 3WQPA 3EPIA 4EEYA 1NM2A 3MM7B 5BXIA 1FDBA 3RBZA 5CHCB 2W4DA 4LIRA 4N76A 5HRTA 3L9ZA 1JXVA 3KLVA 1R0AB 5KFGA 5M2PA 1P6TA 3ZZ0A 3PJXA 3CCES 1K1QA 3H8YA 1MROB 3F73A 3PW5A 2ZZNA 3POTB 1D9FA 4FN5A 1OPIA 3M2VA 4QIVA 2EK6A 1QLNA 2IFYA 5T7LB 4CLUA 1RWKB 3FEZA 4KO0A 1W25A 1OS5A 2J7KA 4IH5A 2G0CA 4IG0B 5AXMA 2OEMA 2FJWA 4CYSA 2HNDB 2VPYB 2EKYA 3FCVA 2DGOA 3MEDA 3PYGA 4ZDNA 4WFYA 1QSLA 3JYTB 1ZM9A 1A9NB 1MMLA 4W92B 1N0UA 2DGTA 5KT7A 4KHPF 3SV3A 1KH9A 1N2LA 3PTWA 5AT1B 1FRXA 2RF2A 4F36A 2AMCB 4P6QA 1FJ7A 2AEJA 2QE5A 3ZC4A 3NMAA 3GFHA 2QZUA 4FPRA 2YNGB 5IWAF 3LTOA 3TAMA 4IH7A 2DNZA 1Q82T 4CO4A 2MLZA 2XEXA 1GK8A 4LVOP 4RUAA 3HFVA 1CSJA 5IZHA 4DCOB 1X4BA 2DR8A 3ULHA 2BABA 2DRBA 4ILLA 4P2FA 2I38A 2VBXA 5TJ3A 1LOUA 5A2QU 1DQ9A 2ALZA 2GGPA 1LNQA 1KP6A 3EDRB 1QTMA 4U8YA 2F8MA 2HBQB 2MY8A 3CJKB 3R6GB 3IFEA 1Q4RA 3NRBA 4USTA 5EHHA 3AJ1A 3OL6A 2HSEB 1K44A 3C14B 3EGNA 3TUPA 3N0VA 4UW2A 1D8YA 3OXGA 3MPVA 3D1HA 3AOCA 4OJHA 2KDOA 2BQRA 4NLXA 2I6WA 2OEKA 4OYZA 3MTJA 2EC2A 4B9NA 2V9WA 1NK9A 4QIGA 4ECXA 2UU9F 5F9NA 4N8OA 4DDFA 2DNKA 5INHA 2VQRA 3W8GA 2F9DA 2KZZA 4WFZA 3QQCD 3IBWA 1XK8A 1RAHB 3PRVA 2E5LF 1N5YB 3HMJG 3V6DA 1J5OB 1O6XA 3HFKA 1HHSA 1ZZFA 1T11A 5H9FK 1NK0A 1DRZA 2RB7A 1SJFA 1IJFB 2CXEA 4RL1A 3LQVA 4NLTA 4Q0BA 5KG5A 1WTBA 3FVYA 3MM6A 1CJUB 3IRXB 2OSRA 4RU2A 3MXHP 2HPUA 4PKDB 3PW2A 1SUQA 1CVJA 4UY85 1E6VB 3AJ2A 3VALA 2L9DA 1TL4A 1EX8A 4ZVOB 4NOHA 3FNNA 1ROFA 4DR1J 2B7CB 4DR4F 4DL0C 1HNIA 5GMKa 3ZZZA 4AL7A 4PRFA 2J7WA 3GJQB 2QT7A 4ZLLA 2MYFA 3J7YU 1FEHA 3QFHA 5HBMA 1RABB 3KK2B 3OTEA 1V6HA 5JUMA 3M9MB 1NPPA 2OPPB 2H5JB 3ELHA 5HMXA 1U0HB 1CJTA 1DARA 3D9BA 4JI0F 3GIMA 1EP4B 1B64A 1J27A 4DV4J 2IPOB 5A6WA 3M30A 5G0RB 4QCLA 1UJ5A 3CB4A 4F02A 1RISA 1SVDA 1BXNA 3V2UC 2R7WA 5KFFA 1N54B 3GJRB 4O44A 3UWTA 1UVLA 3MEKA 4EBDA 4GKKJ 3PW7A 4P52A 4KJDA 4ZPDA 4URQU 1VLYA 4KQZA 3SCLE 3OUYA 2RILA 5LRMA 1HARA 4FBUA 5ETRA 3HVAA 3D7SB 4M63A 5DDRC 4M95A 4OZ3A 1VC6A 1SKWA 4IH6A 2MQMA 5L0BA 3W3SA 1C1CA 3ILIA 2I2YA 5GMEA 2N3LA 1ZYQA 2IJRA 3RTVA 2V69A 1FDDA 1L3VA 2GVDB 4EZ9A 4LBHA 1REGX 2AYEA 2MKSA 5BYQA 3G82B 1GH8A 5I42B 2RRAA 1KFDA 1TL7B 5KFRA 3W1YC 1TMJA 1SCJB 4DZDA 3VQTA 2ZZMA 4UORA 1VQYA 3C8YA 3MMAA 2P5VA 3MPUB 3FSXA 3S1TA 1YDLA 4X84A 1E6YA 8ATCB 2OH2A 2Q1LA 2B56A 4DU8A 3A8JA 1NJXA 1V3ZA 4LRBA 1WSRA 5HQLA 2DCUB 5C25A 1TUGB 4MK8A 3BN7A 1KNZA 4QU7A 1NPKA 1JJHA 1J2VA 4R5PA 1V3RA 4FNIA 1UEKA 4YS2A 5J2QB 3C16A 3CCTA 3IRWP 3HHLD 4Y00A 3MK2A 2KHCA 3CCMS 4K4YA 3IG1B 2MQPA 4A8OA 4ZCKA 4KGVB 1HHTP 4FYXB 4F2SA 3TVKA 2ADCA 1GQEA 2LQJA 4K0KJ 1V3SA 2KYXA 3C3LA 3R7SB 1HWUA 2V63A 1ANIA 2B0GA 1UETA 1SH2A 4OV6A 3T5JA 1R0AA 3LPEA 3R6LB 3KD8A 3AQPA 1UFLA 3MR5A 4CNYA 1MROA 3POTA 5HN0A 2W5WA 4PXEA 2V4RA 1ZEDA 5GADU 1VIXA 3QJLA 5T7LA 4HTJA 1SIWB 4LR8A 3I6PA 1VI7A 4IUFA 3KG1A 4IG0A 3W5YA 2HNDA 4M5IA 2WSCC 2CDRB 4N5SA 2M7SA 2ZITA 1WG4A 1TL1B 1VBXA 3JYTA 1R0CB 3GB0A 3ENWA 2WK4A 4PG4A 2HRTA 4C8YA 4F4WA 1CC8A 2OD6A 3G8QA 1S1XA 2U2FA 2ZUGA 2WOMB 3MWBA 3UR3C 2DTJA 1H3DA 4KRWA 2FJBB 1HFEL 4E2FB 2A2CA 4NZ0A 3OXFA 4NXNF 3RJMB 2YNGA 2W5TA 3BO3A 3JTOA 3BKTA 1L3KA 3PZPA 2VHGA 2FHKA 2E1CA 3IGVA 2OPQB 3GZ7A 5H9FJ 4Q8EA 4LJMA 2LEAA 3PG9A 3HSDA 2ADBA 2XS5A 1DTTB 3T5LA 4AXIA 3NKPA 2PC6A 1MLAA 2FLOA 1PSDA 4B17A 2WVCA 3VAKA 4B08A 2VG6B 3CJKA 2RU3A 1N33J 4C0HA 2HHQA 1P9QC 4NMXA 2HAIA 2K2PA 3C14A 4CP5A 5K14B 2KN4A 2RJZA 5DZ6A 2N4DA 2QX0A 1BWEA 2C2NA 2JX2A 1XMQF 5L9XA 2ZKTA 2YQ1A 5ADZA 3EYZA 2RHSB 1OY8A 3MPDA 3ZTOA 4F25A 2C2RA 2GQ2A 3CSKA 2ZD1A 4I56A 4QIWD 1JJ2R 1YGYA 3QJPA 3PEJA 2IMOA 1IJEB 1U8WA 4F7VA 2IVYA 2M4MA 4DUZF 1A7GE 3BDFA 4RZRA 1FXRA 3VWSA 2VJUA 1EHWA 1KC8T 1N5YA 3HFZB 2XRGA 2R8IA 2H65B 1J5OA 5D3GB 1URNA 3UE2A 4GTWA 4P73A 1HL6A 2DT9A 2LYVA 3MFHA 1Q5YA 2QG9B 1SJ4P 4RW9B 1FHTA 4DF4A 2AU0A 1CJUA 2HNZB 3IRXA 4DQIA 2MMYA 2B7BB 3N01A 4DV1J 1S12A 3GP9A 5ITHA 3HPOA 3OV7A 5A0YB 4L3KA 1E6VA 3DDNA 2Q43A 1S1UB 4KV8B 4MIWA 1RXOB 2ACMA 3ED4A 2L9WA 2QMUB 1OIAA 2HFSA 2ANHA 2KI2A 1PBAA 4JBCA 4DU7A 3RB4A 1IBMF 3UNGC 1M1HA 3BQ2A 2FGCA 3KK2A 3DN9A 4HDGA 1S72S 3D28A 2FVCA 1NO8A 3TI0A 3DKDA 2OPPA 4X4TA 1C1BB 2V6AA 4KBIA 1U0HA 1WG5A 2WSFC 1RB0A 4IFYB 2I1RA 1ZAWA 3TUIC 1TVRB 1EP4A 2ASYA 4C6AA 2KM8C 4ANEA 3T1YJ 1Y6VA 5G0RA 4ZVGA 4EBCA 2JFDA 1DTQB 4G1PA 5GAEU 4MFBB 5ETLA 2OD4A 3KJQB 1XMBA 2X1BA 1NPRA 2HHWA 5HP1B 3DRRB 3T3FA 2MJUA 4OZ2A 3M1VB 2NYIA 3B8HA 1I5OB 3AY0A 4NEZA 4QQBA 1NCLA 3W2WB 1S57A 2YBVA 4AD6A 3CCVS 3KK3B 3N6MA 2J0SD 2LQ5A 3MMCB 4JI7J 5D8HB 4WFAQ 4BS2A 5B0AA 5HMZA 3NNCA 2XYPB 4ZP7A 5K9FA 2CQCA 3A4TA 1OSCA 4K4TA 5F8MA 2YKAA 2LEPA 3FK4A 2B9XA 4LFAJ 2IIHA 4Y2CA 2XLIA 3CJRA 3DRSB 2GIRA 1K0VA 3MR7A 3ZNJ1 4HKQA 2GVDA 2H5IB 3KOAA 1F3VA 5LXYA 1R6YA 2HVDA 3G82A 4ZLJA 2KFZA 4ES3A 1L3SA 5I42A 1TL7A 4EMDA 2HK3A 2BW7A 3SDEB 4X62J 4LF7F 1U45A 3C66A 3GYXB 1CS4B 2J0WA 2H54B 4OIXA 1VC0A 4ZCLA 1RU1A 3FDSA 2OO4A 3W5ZA 3R1HA 3A13A 1VBKA 3FSYA 5ETQA 1NK6A 4K8RA 2VH7A 2MHEA 3C6UB 2ZH4A 4PXDA 3EM1A 5AXNA 3U02A 3MUMP 1SC1B 4J9VA 4MIAA 2UV8A 1UWBB 2DNYA 4LF6F 5J2QA 1VS3A 1XQIA 5AXKA 4R25A 5HQMA 2XGQA 4LRAA 3V81B 4F0HA 2OPSB 2JFKA 2GQCA 1E2SP 4O23A 1HLWA 1WHVA 4NZ7A 3IG1A 3MAAB 1RAFB 4ZPBA 3GLJA 1MWQA 2I8EA 1AB8A 3BGRB 1RA6A 2GC8A 2GO8A 2A10A 2LXIA 4PWDA 4GVBB 4UOHA 3OQ2A 2QTWA 4P71A 3EX7B 1YRUA 1HW8A 2V68A 2HRUA 4ECQA 3ENVA 4FKYA 5L39A 2UXDJ 4IDKB 1LKZA 5T14A 1F3FA 1HNZF 2VG7B 4BDPA 1VIOA 5KFYA 4DZ6A 4LQYA 3BQ1A 1FDNA 2YWGA 5JVHQ 7FD1A 2E5JA 4C11B 3G4SS 2R7TA 1YZ7A 2B4PA 5IT0A 1YSJA 1T9XA 1Z1ZA 2PN6A 3PW4A 1S9FA 4F8RA 1T9TA 3PW0A 1FE4A 2IHR1 5KFAA 4X4NA 2G0JA 3VGVA 1KEKA 1TL1A 1TMMA 5I3UB 1VQMS 2R2TA 4RWXA 3ZZYA 2HURA 1NB2A 1WG1A 2QMWA 2E5HA 1E1ZP 1NHKL 3M6WA 4DUZJ 3KMQA 3K58A 2WOMA 2XMMA 1ZH5A 2MB0B 2AV5A 1GXUA 3VZHA 2ABYA 1HWLA 4OV1A 1RHQB 2HVHA 1EW8A 4KJIA 4MMOA 2DNNA 1X5SA 5F9LA 3G6XA 3MD3A 5D4PA 2F40A 3RAQA 4LF4F 4JI3F 4LF8F 2V94A 1HWKA 1HHQA 5IJQA 2XNQA 3T1AA 3I56S 2D1CA 3ICLA 2B51A 2LECA 1U1NA 3CF5Q 2FY1A 3BBFA 1QAJA 4EO8A 2OPQA 4MKBA 2ZJQQ 4M5MA 2Q3PA 1BLUA 4PWUA 4CLFA 5A6PA 2HIQA 3W9IA 2RUGA 3UN3A 1M5SA 1DTTA 2JWNA 3FRZA 3BYPA 2RVJA 2XMWA 3D0GE 4JV5J 2UUBJ 2VG6A 4O3RA 1HR0F 2XI2A 3L3CA 2CJQA 4ZLNA 2VKZG 1KQFB 2RQCA 4NWXA 3SV4A 1EZZB 4GTZA 5I3PA 1LK5A 1VQ9S 1GMUA 2HHSA 2DPIA 1WC0A 1FNXH 1FXDA 2X98A 1PIEA 2VA3A 3BO4A 2A6MA 3UD3P 2ZH5A 2LQ9A 2ZHOA 3JSMB 5G4DA 4YFUA 2MY7A 1X4GA 2GVZB 4AXJA 1KLNA 1X5OA 2N4CA 1EQJA 4YY3F 4QYRA 1GTEA 4PPZA 3U1NA 2RRNA 3RW6A 4LF2A 3KUGA 3BQ0A 2MTLA 5D3GA 1D9DA 4A8FA 3NGTA 4MYTA 2ZH9A 1XBWA 3PHEA 2NCKL 4RW9A 1VQPS 1X9MA 2GIFA 2CVEA 4MK9A 5F8JA 2HNZA 3T5HA 2UUAF 3PX0A 1Y0HA 3TR5A 2E7VA 1X9SA 2JLEA 5DM7Q 3RG6A 3QIPB 4X4RA 4CIOA 5A0YA 3PJWA 4Z37A 5D0GA 4LVNP 2BE7D 5FDLB 1S1UA 3QWUA 1WI6A 4KV8A 5ETTA 3EZOA 1N34J 2ZOMA 3DYAB 1VQ8S 3OJUA 4TLRA 1NRKA 4LMZA 4R8UB 1QUVA 2V50A 5K8NA 2FY8A 3JTPA 5HANA 4DUTA 3N9UC 1QJHA 4ETZA 4UOCA 3TEGA 3WC0A 1C1BA 5GAHI 2L41A 4YP3A 4ILMA 2AZ1A 1IBKJ 4IFYA 3NL0A 5HMWA 1PJ7A 5E3CA 4QPTA 1TVRA 3MK0A 5BR8F 1RT2B 2HWHA 4A8MP 3G86A 1DTQA 4ZITA 2F8EX 1ZS6A 2AJ0A 3ETMA 5HP1A 3DRRA 1R27B 1FCAA 3MD1A 2CQGA 4Y2AA 1YHQS 3TG0A 3M1VA 1Z2LA 4ZPAA 4J9MA 3Q8VA 3W2WA 1TV6B 2E9RX 1NKCA 3KK3A 3MMCA 3HULA 2OMLA 3IO1A 3KHLA 1Q7YT 4DSKA 3I4HX 2GJ2A 4BLGA 3NCPA 1FX2A 2VBZA 1NSQA 4TN2A 2QL7B 3PKYA 3H90A 3RAXA 4TY8A 5H9EK 2IM2A 2XHWA 3D5MA 1OPZA 2H9ZA 5D0EA 4GKJJ 1ANJA 4N56A 3DRSA 3T6BA 3SFUA 2X1FA 3PKMA 5GRRA 4YEAA 1AJDA 5E3PA 5E2QA 2AJ1A 3U27A 1PYTA 5DM6Q 3GG0A 1HNZJ 1R8CA 2GMLA 1BY9A 1H7WA 4FF3A 1U1PA 3SDEA 1EKSA 2FPHX 1M90T 1UEVA 4A8XA 5E3QA 1FK9B 3R2CJ 5A76A 4TU7A 1M1KT 1AJAA 4GC7A 2HS0A 1CS4A 2ZC4A 2HW3A 4UOOA 2XMAA 3GV8B 1T94A 4TY9A 4B56A 1NH7A 2B3TB 1WACA 1SJ1A 3MM5A 1BE4A 2Z2LA 2MDAA 1T9WA 2UZAA 2AGOA 1UWBA 5ETOA 2ZWPA 1KH5A 4ICLB 3ZFVA 2HFUA 1XR7A 3W61A 4DV6J 3HHLC 1IWGA 2OPSA 3TNVA 2YNHB 3MAAA 3QT8A 3M8WA 4OHXA 3CJ0A 1NK4A 3CDEA 2LDIA 4AYBD 4ECZA 2DNHA 2ZOFA 3BGRA 3CTRA 1QM9A 4Q7AA 4CQ1A 3ZZOA 4DBQA 1U09A 3OFGA 2QGFB 1RWMB 1XJWB 1Q0NA 3Q24A 2J6UA 1RDRA 1T05B 4BWMA 1CQNA 4GVBA 4HLBA 4DX7A 1JLAB 2YQ3A 1WC6A 4IDKA 2WAQD 4DV7J 3T5KA 3B78A 2D7SA 4ES2A 1KTQA 2VG7A 2DGQA 5KFTA 4PWWA 3QZ8A 2M8DB 2POKA 5I4MA 4I4BA 4BWJA 1HI0P 4TYAA 4C11A 2IBKA 4J9UE 2KVQE 4P9SA 2WW4A 1P9YA 3TX0A 4TLQA 2F7VA 1VDHA 3CCJS 2WHOA 3QNWB 2JVOA 3MF5A 2BACA 4DR7F 2PD1A 3UVJB 2FC8A 2XNRA 1FFWB 3D6FB 2A0FB 4B3MJ 1PJ5A 5L38A 3HDSA 5I3UA 1AFJA 4KE5A 2DGSA 1YRXA 2DK2A 2IMWP 3MOJB 1KHKA 2AWZA 5KFDA 4TQSA 3R9LA 3GSDA 2R7VA 4OZLA 3PIPQ 4RUHA 2CQDA 3O3LA 1W2IA 4OI1A 3SBMA 1X4AA 1DLOB 1KOOA 1F1BB 1UCNA 2YX7A 4FS2A 4I6YA 1GX6A 4K4SA 2BYCA 4RUBA 3TJ8A 3TX8A 4FKXA 1LWFB 4B3TJ 8RUCA 2XZDB 1HPZB 5E41A 1WOPA 3G6VA 1GT8A 2Y9HA 2KT3A 2ZWOA 1YKWA 3WX8A 4WKRA 4F4AA 2MZTA 3KG0A 4NYPA 3EICA 3EZUA 3DRXA 1RAAB 2KRBA 4U9RA 4WIIA 1SBRA 4DSEA 4JI8F 1B70B 4DL2A 3B5QA 1VQ5S 1QTNB 4C98A 2NSBA 4PR6A 3MEEB 5EX0A 5L1LA 5LSRA 4P7TA 4X65J 3L09A 2QFIA 2XM3A 2HYIB 3KLEB 4IR9A 2IA6A 1L3UA 2UV8G 3Q8RB 2B6AB 2JEJA 2UXBF 2W8DA 3F0NA 1QUPA 2X7IA 2CFXA 4J90A 2A18A 1PG5B 4X4SA 2GSUA 3NLCA 5IM0B 3JSMA 2GQQA 1RTZA 2B8PA 4WCEQ 1NJIT 2GVZA 2HHPA 4QYZJ 1VQKS 4HI2A 1IKXB 2CDQA 1S1VB 3FUYA 4M94A 5IT9U 2C22A 3QAEA 5L0KA 4K5RA 3Q8PB 4NL5A 3GQCA 5IOLA 1IKWB 4DQSA 1JIHA 1X31C 1PCAA 1DBDA 2YKPA 1PYOB 2LQ8A 1KVIA 2KU7A 1TAQA 4KB7A 1I6JA 1KLMB 4CLWA 4EGLA 3KWMA 4ETXA 1T03B 2NXJA 2XYHB 4LFBF 2ZBCA 2OTLS 4F4XA 2EWHA 1T3NA 3QIPA 2B5JB 4RU9A 3IS9B 4NASA 4ED0A 3CDWA 5FDLA 3I5BA 1SI9A 1R8AA 2IDEA 3QPIA 5DS7A 4A8QA 5H9EJ 4YR0A 3R27A 4G65A 1B3TA 2CPZA 5AJ9A 4V19X 3B82A 1NLKL 1HWIA 3DYAA 3FCHA 4C97A 4NLVA 4I6AA 2AYBA 2W9BB 2QFJA 1SL1A 4HVZA 3CD0A 4R8UA 2CZ9A 4P7VA 4GRSA 1TQLA 1UP1A 2HGLA 1NU4A 2VODA 1HJKA 3BV8A 2W5VA 5JXSA 2DHXA 2K8GA 1FVQA 2ZBRA 1WF2A 1EKRA 3FBCA 4NMLA 2N7CA 4ZVPB 3J7AN 2RHQB 2AX1A 2GS8A 3GYGA 4J9RA 4I67A 1X0FA 3JAMU 4FXVA 4ECTA 1RT2A 5IQ6A 1U6BA 2JC1A 2UXCJ 3J81Y 2QRRA 3TVYA 2QIFA 2RMLA 1FKOB 2Z30B 4F50A 2HWIA 3DLJA 1RCXB 1XNRF 1SH0A 2G2OA 5IV4A 1HQAA 1MG7A 4ELTA 1PC4A 2D3UA 4YB7A 4Q8FA 3M6XA 1RTDB 3LGMA 4XPCA 3MCMA 1TV6A 2AT1B 2Z58B 2MPUA 2W5RA 3OFEA 3JTNA 4DXLA 3BBBA 2MSTA 4I7FA 4CM2A 1IBLJ 2K06A 5BYSA 2Y3YA 3GV5B 1G7CB 3R5BA 2CIMA 3ZZUA 1UL3A 1IQTA 3R5DA 1NMEB 3GU0A 1EAYC 2VJVA 2J9CA 2C2MB 1JLGB 2HHHF 3IR6B 2K1RB 5EUHA 1NSKL 4O4GB 1KTVA 3C2PA 2DB1A 4LR7A 3BBCA 4FYWB 3ISND 2IM0A 3FZ2A 2LA6A 1Q5VA 2AIRB 4IRKA 3GJSB 1K9MT 1XNQJ 2DISA 3ONQA 3GJTB 5KFWA 2B9WA 4RW6B 1FK9A 1KOHA 3MPYA 2RKIB 1O99A 3SXLA 4RO0A 1UTAA 1IM6A 3V5RA 4AT1B 2EG1A 2Z57B 1S9GB 1NUEA 1QY7A 4DOZA 4IO9Q 2HAFA 1HBNB 3O5TB 1NDKA 5LJ5Y 2GIQA 2QO3A 2BKOA 5B0EA 2R8GA 2NXCA 2BUNA 2FC9A 3EJMA 3M8ZA 4QR0A 3S7RA 5ETVA 3CIZA 4UQTA 3UNYA 3IR5B 4RNFA 2UUTA 3RBXA 1HNVB 3MOZA 3E01A 4X4OA 3DLEB 2ZNYA 4ICLA 4NCGB 1M0SA 3FCWA 3QIDA 3TA0A 1IR2A 4NRUA 1VGYA 1N32F 4DV0J 1JJCB 3W9HA 3OTOJ 2VONA 1NEEA 4LT6A 2YNHA 4ZN3A 1U48A 4CLLA 2FGOA 2DY1A 4FPIA 2V4QA 2RNEA 2GAHC 1YJRA 4RW4B 4RNHA 4IOBA 4YB1P 2FZCB 4A46A 3WDOA 3NG8A 2XMJA 2W24A 1T05A 1N6QB 1VQLS 2W2QP 1WF0A 1JLAA 2M9KA 3JAMY 4K7QA 2MLYA 2V9KA 3TVZA 5D78A 3TP2A 1JLQB 2O67A 5DLFA 1HNXF 4DL5A 3VAFA 5CQGA 3A1YG 2V0NA 3CC4S 3QSYB 5GMDA 5KG4A 1RAEB 4QIFA 1VJWA 3RRGA 5F3ZA 4ZJOA 1SJQA 1FTCA 2BQ3A 4C8OA 2E1RA 3UVJA 1NJYA 5DQIA 1XC9A 5J2PB 4OX9F 4WXWA 3R8YA 3RU0A 4PYDA 1EI6A 1UVNA 1U1QA 1Q16B 4X4PA 5B09A 1NXIA 1OMSA 4LR9A 2R8KA 4RPFA 5KFZA 1FRHA 3BF4A 1NNDA 1FRMA 4JYAF 3HSZA 4PABA 1RADB 3MDFA 1DLOA 1WKLA 3L95X 4BC7A 5KT2A 5LMNJ 1S77D 1GTHA 2HHUA 1NJWA 2KT5A 1NK7A 3D67A 4F04B 4FDIA 4LFCJ 6AT1B 2LVWA 1LWFA 4FXDA 1R8PA 1HPZA 2XC9A 4C7QA 4FNHA 4MKYA 2LXFA 3NOGA 2JHEA 3DOKB 4YN3B 3Q0AA 4A8YA 4DV5F 2HHVA 1D9AA 2JLFA 1Q8KA 1TFYA 4XPEA 4FF1A 1K7HA 5FD1A 1F5AA 4HEA9 1FRJA 1GNKA 5LQQA 4UY8T 1M1GA 2AJ4A 2VKRA 3MEEA 3TO8A 3AA8A 1BQXA 5F41A 2D41A 3KLEA 1B99A 1U4BA 5DQHA 5CYMA 1HNWJ 1KVJA 1Y5LB 4HHHA 2PMZD 2B6AA 3KLGB 4O3SA 4K4UA 4FDJA 3NGDA 2HWTA 5IM0A 3VAIA 5MLCV 5B7WA 3EDQB 1IKXA 4H54A 2DR6A 1S1VA 3HKWA 2JEIA 2QC3A 3UDCA 3HJVA 4NLWA 5C42B 2ROPA 4OHZA 1XMOJ 1FJCA 2HLTA 1MMDA 5KFBA 3NBPA 7AT1B 2VOOA 2AEMA 5CZVA 5KG6A 1XNRJ 5AJ3J 1IKWA 2YX1A 4UT4A 3MM6B 3FSIA 3RB0A 1URRA 1B7YB 1OJ4A 3KHHA 4HH0A 3RRHA 1M5HA 2G1DA 1KLMA 4CO1A 1T03A 1V9OA 4Z7YA 3WAVA 3T1HJ 1ELXA 4P74A 3H98A 5E5NA 5IS2A 2GAGC 3CD5A 1Y5NB 2EBGA 4NLOA 1P1TA 2B5JA 4KGKA 3IS9A 1FVSA 1UKUA 2FTRA 2B4UA 1YJVA 3N6LA 2GA3A 2V8PA 1VK3A 3DU6A 4KY3A 1TELA 2DNOA 3GR1A 2R4FA 9RUBA 3H4DA 4M5DB 4F26A 1RWUA 2CNOB 2V8HA 3QLHB 4PPDA 1FA0A 2BJ9A 3TZYA 2C3UA 1UVMA 4Q45A 5KFLA 2IYGA 1FJGJ 4DV3J 2W9BA 2HQFA 2MZJA 2V2VA 2WTFA 4U95A 2W25A 4HR2A 2GO9A 3LP0B 2JJ4D 3J7Z5 3SCIE 1VQ6S 3K59A 4ECSA 2ZVIA 2OEJA 1B0VA 2MEWA 4CM0A 5EWGA 5ETKA 3W7BA 2HVIA 5F8NA 4ECRA 3UD4P 2W8LA 4CLTA 5L0EA 4ZG6A 1F9HA 1FKOA 2BKNA 3BR8A 3T19A 1AJBA 4JI6J 4ZPTR 3LALA 5D77A 4LQ9A 3CMRA 2XQCA 1S0MA 1TUWA 4CXKA 2QLBB 2M5YA 3DYCA 1HI8A 1RTDA 2E66A 3K5OA 4UTGA 4KAYA 2VBWA 2HK2A 1FKPB 5GVQA 2J9DE 2ALYB 3RZAA 3VAMA 2ASLA 3NKMA 2XSJB 1QDUB 2X51A 3G87A 2AQ4A 5BJRA 5F0UA 1SL0A 4RNMA 3CJQA 3H5YA 3K2YA 4DR1F 3NCRA 4DN0A 2FHJA 4L72B 2W5SA 5B0CA 2G2YA 4OI2A 3RGIA 2RQ4A 3LPYA 2PMWA 2DNQA 4X4UA 4B3SJ 2F63A 3QGIA 1JLGA 4F4KA 2K1RA 4DSJA 4O4GA 2Z4PA 2QLWA 3A8KA 2C2KB 5IC6B 2OFHX 2I5JB 1N8RT 4CRJA 3EPGA 2R2UA 1AUDA 1W7WA 2MZRA 2KJWA 2OPRB 4RW6A 1IM4A 4ZPWR 1E33P 2RKIA 1VOMA 4B3RJ 4LF9J 4DV4F 2GLQA 1S9GA 2O01C 4WE1B 5FLXU 1IQZA 2Y0SD 1RK8A 2V8DA 2XLKA 3I0SB 2MQ8A 1HBNA 1RLCL 4LF5J 3CO0P 3GWCA 3D2WA 5KTQA 1S49A 1X7VA 3ZTRA 1IKVB 1GMWA 4K5SA 3MMBB 3CD7A 3Q8QB 1HNVA 3UO0A 3DLEA 4EI2A 1WSVA 4NCGA 3SEOA 1WC3A 2DXEA 3AH6A 3U1LA 2QN6B 1TK8A 3CMQA 3P6YC 3D66A 3EGZA 1VJQA 1RHKB 3EGVA 3JS9A 3ZZPA 3ZTQA 3LH2S 1HI1A 4HL9A 2FUG9 3EE3A 3MCOA 1YJNS 4RW4A 1HIYA 2DCLA 3DDKA 4DR5J 2C2DA 5CD4A 2D9PA 4DV5J 1Y7AA 5B0BA 1N6QA 1G2EA 2WVBA 5IJSA 3L7UA 1Q86T 2W1BA 3CVKA 3PR5B 2MKIA 5CYJA 2W2PP 3BSAA 4K59A 5L9NA 2GMJA 3J81j 4QR1A 2DJWA 2O3DA 2FZKB 1JLQA 4ID5B 4QWAA 1E3CP 1X60A 4IQMA 4WFXA 5KOWA 2Y1RI 1S4EA 3Q86A 3OL7A 2MZQA 3Q8YA 5J1PA 1RBOB 1BC6A 5KFOA 2OHDA 4N47A 4Y2MA 3R7NB 1CLFA 3C46A 1S6QB 2F4VF 2EPIA 5J2PA 3FRYA 1KR4A 3T41A 1Q95G 1AA1B 1S1XB 3IM8A 3HHEA 2NXUA 3HM9A 1ZPVA 2VASA 2ZDOA 2RD5C 1NK5A 2CJ9A 4B9LA 4CO5A 3PY8A 1YJ7A 3M8SA 4Z7CA 1OO0B 1QE1A 4CLZA 2RSQA 3TJAA 3D3CJ 1H72C 2EK1A 1ZTWA 2GZOA 2C1EB 4YUDA 4K0KF 2WBMA 5DRKA 2X3GA 4WK3A 1N0VC 1PKUA 4DR3J 4IOAQ 3NY0A 1RLDA 2ZOGA 2YWKA 1R7IA 3DOKA 3MCNA 2UVWA 1PBUA 3EZ5A 3WX4A 3BPSP 3ISZA 5FLXY 2VC1A 1T02A 1F2GA 3LXQA 1CEZA 2NSCA 4AQYJ 1OQ3A 2G9OA 2J9EA 2YWWA 1JLCB 3I5AA 2C3MA 3PX6A 4Y65A 2V5HG 2OFGX 3QBCA 4CLSA 4I0WA 2DHGA 2JEFA 3KK1B 2RIJA 2CPIA 2F3JA 2B4VA 2OELA 3AA9A 3BR9A 3AB4B 2HBYB 2K7KA 3KLGA 2ZD1B 2QMXA 2PEHA 3UN2A 3NVLA 2EFGA 4B9SA 1XR5A 5L1KA 2BMBA 2HEKA 1FD2A 4G1QB 4MKAA 3P5TL 4E98A 1ALKA 4R0EA 1RWNB 4WP3A 4LRCA 5C42A 5H1SV 3GE9A 2DGWA 4J9QA 3H42A 4GVLA 3GONA 1ED8A 2HQDA 3HHLA 5DG8A 5C66A 4H4KA 4DQPA 1CBKA 1U24A 1S0NA 4YR1A 1MSWD 3IP0A 4FS1A 3MM8B 4XDDA 3NNAA 4K2JA 1LXNA 4CZCA 1DQ8A 4LIWA 5HMYA 3OHAA 4OZNA 1N33F 1WWHA 4URSA 2O66A 2D69A 3NWRA 2HZCA 1SB6A 4M5DA 3RBEA 1T3OA 2HGNA 3QLHA 3UD5A 3H25A 5C2GA 3M2RA 3UN5A 3MK1A 3HHKA 4HACB 4PG8A 1C0TA 1R43A 1AJCA 1NBEB 2AGPA 2J5AA 3TQ1A 1LWXA 2RE1A 2F5GA 1FXLA 4DPYA 4ZVFA 3LP0A 4NRTA 4A4JA 3O8WA 2E5IA 5GOVA 2HBRB 1NKBA 3EVMA 5DLVA 3BDPA 4DUYJ 4U8VA 3NKNA 1N4LA 5DETA 1JWWA 3N6NA 4U7CA 2KYZA 1S0VA 5A2QY 1ZM3A 2BDPA 4Y2KA 5KFMA 3BDGB 4CTAB 1U2CA 4DX6A 4OI0A 3SCJE 4CH7A 4HI1A 1WKKA 4J5OA 2SXLA 2K3KA 4GTXA 1BHNA 2CPYA 1RT3B 2IM3A 4DV1F 2XZTB 1FKPA 3A8EA 4YR3A 2GSOA 1Q81T 1JX4A 2C2OB 3B54A 2FVPA 5LT5A 2XSJA 5HVFA 4ZN1A 2CG8A 3IWLA 5KFCA 3T01A 4PQUB 1KD1T 4CLKA 2A6OA 1Y5IB 2YVSA 4ZVSB 4JI4J 1IXKA 2FJVA 2AW0A 4ZVTB 2HFVA 3IMQJ 2ZH6A 4YHHJ 1F5BA 1KQSR 2D74B 4PCQA 2O1PA 1W2BR 3F44A 3OTCA 1PC5A 3RUBL 3QZ7A 1TK5A 1UFWA 1D3WA 4WU2A 5DG9A 4ERDA 4NLDA 2R2RA 2YX4A 1RT4B 5F8IA 1VCTA 2I5JA 2G9YA 3SZ2A 2CPEA 3ISNC 1EIYB 4UF4A 4UPLA 2WRMA 1T0TV 2CA9A 2OPRA 2Q6BA 1S6PB 5A8WB 3ILLA 2AX0A 4G6VB 3KYLA 4ENOA 2MKYA 4UZCA 3T1YF 3D0IE 4WE1A 1GXTA 1DFDA 1Q1KA 2F65A 3ILJA 3I0SA 2F4VJ 3J80U 3W64A 1S7IA 3GSIA 4K4VA 4ZG7A 2L08A 2NPIA 3RB6A 4FP9A 2APOA 3W62A 2DGUA 2MXYA 1IKVA 3MMBA 5LMUJ 3UDEA 1OQ6A 4USWA 5EWEA 2JVRA 1UMJA 5AE1A 3MFIA 2X1AA 2NPFA 4JI7F 1NKEA 3OFHA 3MUVP 4OHVA 2IUCB 4XDCA 5CCMA 4UPKA 1SQGA 3OBIA 4LRDA 4O0NA 1Q7LB 3JQMA 5EN1A 3GCWP 3P3DA 4WPAA 4FYYB 4LFAF 4FDFA 4PWDB 2MKCA 4UOPA 3NS5A 4J9LA 1K47A 1Y3JA 4QWCA 1FD8A 5L1JA 5SZTA 1VRTB 1HBOB 1YLXA 2FJDB 3SI8A 3KTQA 1RZMA 3N79A 1UA1A 3MZIA 4DR2J 4TNOA 4X62F 1U47A 1VK8A 3HLUA 1RBAA 4PUOB 2HHTA 3KHGA 4ID5A 5DZ7A 4WF9Q 1VYAA 5D0RA 3LWMA 4WIQA 1U1RA 1FE0A 3Q8SB 1H98A 2CQ1A 1I94J 3DC2A 3RR7A 1TUVA 3A3PB 4B9UA 3K5PA 4ELUA 4U67Q 3LAMA 1T9UA 3DMJB 4X64J 5HVGA 5F0WA 5T41A 2BE2B 4QWBA 1S6QA 4IKAA 4WZQA 2XY7A 3M05A 2DNGA 4J37A 1VRUB 3I55S 5KFUA 1M5PC 2ZJPQ 1Y9OA 4OX7A 1ZEFA 1MW7A 3AOAA 2Y8WA 2NR0A 1K73T 1HYSB 3FBBA 4DSIA 1AUKA 1JLFB 1RJJA 1REVB 2FVSA 4ANCA 3Q22A 2W2NP 4M5NA 2L48A 2FJXA 4BHQA 2OMOA 3HO1A 2YPYA 4OHWA 3FEXB 4NLGA 2ZUAA 4OI3A 3BS9A 5L8RC 1S9EB 2UXDF 1LW2B 2QA4G 2ZHAA 1Q8BA 4ED8A 3CJTA 4KAIA 3US5A 3M4XA 4ECYA 3RW7A 2GMHA 4I6WA 3J80Y 3EVOA 1OYEA 2ZJRQ 3TZZA 1RBLA 1G6BA 3UQSA 4QU6A 2J76E 1R6VA 3DRYA 2WB1D 2Y0BB 1JLCA 1NSAA 2KB2A 1A0OB 3AJDA 4OX6A 1FI4A 1JJ4A 4M1KA 4RR5A 2PFFB 4CYRA 4JB8B 4JI1J 3PYDA 3BREA 1RT1B 1DY3A 4KAVA 2QA1A 3KK1A 1U6FA 3K57A 4P10A 2BR0A 2R7RA 4ER8A 4YDXA 4E8UA 1NZ8A 3UI3A 2ZH8A 4O4RA 3CC2S 2WB4A 4G1QA 1U1KA 1S6OA 2QJ3A 2RQKA 4DX8H 3L7PA 2QLXA 5FIIA 1ZM2A 1YX2A 3PYFA 5LOQA 5AE2A 3DOMB 2LXUA 3WBZA 2EEYA 2KXNB 4DF8A 4ANDA 2XZWA 4ZVQB 2VDIA 3UFCX 1ED9A 3DU5A 4ECVA 1UEUA 1LWEB 4O3NA 4LR2A 4YOEA 1RTIB 1ZEBA 4IQXA 3IR7B 4GTYA 4RWWA 1U2RA 2QZ8A 1UWAA 3QT6A 1RYSA 4ZMMA 1EW2A 3CE8A 3MM8A 3R5GA 1UW4A 2GJIA 3IA0A 3W8PA 2W4PA 3I31A 1X4DA 3Q89A 4JV5F 2UUBF 2AJQA 2ROEA 3ZZRA 3IGZB 1X4HA 2CQIA 2MKJA 4AE5A 1BD6A 1AXQA 4TYBA 2V2ZA 2QLJB 2KKHA 5L46A 5D0HA 3K5MA 1S10A 4DCJB 4HACA 3I87A 4NLSA 2R42A 4DG1B 1F9EB 1YQHA 4ITSA 1WJ9A 4ED3A 4IYQA 2CYYA 4KC5A 5CZXA 2KTQA 2NXNA 4RBTA 3OLBA 5GAEI 3NOCA 4FBTA 2G4BA 1S5ZA 2KFYA 2XI3A 4TU9A 2VV5A 1QVFR 5DDPC 2OAUA 2ZBPA 3WAXA 3E2DA 1KKHA 4O3PA 3MR2A 2WBRA 3X1LB 2EFNA 2FLNA 4H4MB 4EFAC 3NP5A 5DQGA 4B9TA 3BDGA 1WDDA 1HBMB 3NKQA 5KXAA 2XCPA 4CTAA 2QA2A 2Q79A 1X4EA 1X5PA 4PEOA 2DR7A 2YKMA 3THTA 5JVGQ 3NGUA 1C2PA 2OP5A 3VGSA 4DQRA 2B9YA 3WC2A 2JOQA 3E51A 1RT3A 1RAIB 3E8OA 4FYDA 1SKSA 1YK9A 3CT9A 1BUXA 3WAWA 3LGHA 3TUJC 4TY8B 5HVHA 2BA9A 3THPA 2WSEC 3ITHA 3CCSS 3UW1A 5HLFB 4PQUA 2RRBA 1UAWA 4OYMA 2VU5A 5K8MA 4V1Ak 3CDUA 3BGLA 1N36J 1N34F 3LAKA 3BDEA 3NKOA 2C3PA 3EXCX 3BM7A 2X1GA 3QJJA 3A8IA 1WELA 4P2MA 4F0MA 2HMIB 3C6TB 2OUGA 3W63A 1KHLA 3D1QA 5IXUA 1Q53A 3HKZD 3TWZA 1LW0B 1RT4A 4QIEA 2CKWA 4YB5A 1ZOTA 4WBFA 1XTZA 4NXMJ 4ECWA 1VQOS 5GAGU 4HDHA 2VZ9A 1IBKF 2P6TA 3OLAA 2PGCA 1TKTB 1S6PA 5A8WA 1JXEA 1VBZA 2YTCA 3OTDA 4ATNA 3FZBA 4KTQA 3VHQA 3HSGA 1Q79A 3MM5B 4IG3B 3NGSA 1Z4UA 1B4SA 1HQUB 2Q66A 2QEXS 2CPHA 3PO4A 2MJNA 3WZ0A 3IBFB 3SZYA 2JH3A 3DNCA 4AL6A 3C15B 1ZA2B 3TAQA 3JXOA 5EDWA 2PEBA 4WYLA 3OXLA 4ZHRB 2W7AA 2AEFA 2IUCA 4CCHA 2E5GA 2ZEJA 4M5HA 2M8HA 1C4AA 2H4YB 1RAGB 4ZPCA 1H2VZ 1WKJA 3K0JA 4GKJF 2HS3A 5BYRA 2MHNA 4QWEA 1FRKA 2XHCA 4D3GA 1S4FA 4L74A 2NZ4A 2NYHA 1CJKB 4ED4A 3BGUA 2FIUA 2RU9A 1KQGB 1VRTA 3PR4A 1HBOA 4ZVUB 2DIVA 4DLGA 1KQKA 3DI6B 1VQ4S 1X8DA 4PG7A 3ZXWA 1PAUB 2VBYA 5THWA 2W7PA 4DSFA 4PUOA 1FFSB 3VGTA 2CQHA 2KFNA 4RX6A 2LCWA 2Z2YB 4LBPA 5LL6d 2NZCA 4P2XA 2WVEA 4RNNA 2R8HA 4MTPA 4KSEB 3IGNA 2CQPA 1GFWB 3FEYB 3R2DJ 2GW8A 3DMJA 3GR0A 1BMQB 1RT5B 5LSOA 2LFVA 2BE2A 2VQEJ 4DPTA 2WZ1A 5K5MA 4Q43A 1VRUA 4LSLB 1DURA 3QRQA 3HI9A 3T6JA 1O0PA 3LP1B 3PACA 2HFNA 4DV6F 2PFDA 4CT8A 3MI7X 2FJEB 1HYSA 2AJFE 4M5GA 2J6TA 1JLFA 2B43A 1WEXA 3MEGB 1RHJB 1REVA 3KFWX 2FHJD 3P49B 3V6JA 3ZTSA 3A3OB 3QO9B 1ZBTA 2JDJA 3CJSA 1S48A 5HJYA 5CXTA 3EGWB 3CW2C 3IDDA 3LUYA 1FO1A 4EBEA 3CD6S 3MURP 3FQLA 3G71S 1S9EA 4ZPVR 1LW2A 3HHNB 4DV7F 3ZNUA 1FNMA 3I0RB 5D4LA 3G96A 1EW9A 1SC4B 4FF2A 1RAOA 1S79A 1FFGB 2CQ4A 2D3OR 2BJ1A 2LLZA 3MR3A 2IM1A 1S97A 1AUSL 4IR1A 1RT1A 2DNLA 3CCZA 2RT3A 4CNZA 3CJ5A 1SKUB 4NCBA 2YNFB 2F8HA 1GMWD 4B3MF 3BDHA 4WK1A 2NQPA 4PXBA 2CPDA 4BCAA 3BN4A 3W9JA 3I82A 1BQNB 3BB5A 2E7WA 4DS5A 4FYVB 1B7FA 3DOMA 2VICA 4MT1A 1S59A 2MZ1A 3TJ9A 4M8LA 2I0XA 3QRPA 2Y1JA 3N5BA 3U1MA 5CABA 5IT4A 3I9ZA 1UZHA 3CEDA 4NA2A 4K4XA 1O5JA 1LWEA 1IKYB 3QGHA 1RTIA 1MNEA 5ETSA 4B3TF 4KM4A 1C4CA 4K4WA 2J6SA 4CO2A 1S99A 4NZ6A 2KO1A 2P9EA 2E29A 2VQFJ 3QMQA 4WU3A 3R1LA 2CADA 2R7XA 4ZVEA 1JLEB 2RDIA 1H7XA 2WONB 2YNIB 1KH4A 1QD1A 3TA2A 2CJBA 2A3JA 3GIJA 2RDJA 2ERRA 1FWPA 3CDAA 2DNMA 2A2DA 2HQGA 3CO9A 4KYZA 3VVUA 3MCSA 4OHYA 4DFKA 2UUCJ 4X65F 2E44A 2VF3A 1S6UA 4X66J 4LSZB 2W9CB 3B4MA 2NUHA 3HVRA 4L3NA 1XR6A 4DG1A 3DGPB 5HL7Q 2PO4A 2HGMA 1X4FA 3BGFA 2B9EA 1RWXB 2CNKB 3OL8A 2DKOB 3QSIA 4MH8A 4RBVA 2IDLA 4DI6A 2MQLA 4X4VA 1U7LA 5DGBA 4ZVRB 3T9NA 5HROB 6FDRA 4GO5X 4IRCA 4KIAA 4JI2F 1SHNA 2VOPA 2CZ4A 3HF5A 4OZ5A 3KHRA 2KL8A 4N41A 3CJ4A 2K3IA 3PJ9A 4ZS6A 4H4MA 5F8LA 3UCGA 2ZHBA 3TANA 1HBMA 1YRTA 2PE8A 2JLGA 1URBA 4IOCQ 4NLPA 1NDLA 2CJYB 5ETPA 2MSSA 7FDRA 4EYIB 5K8OA 2YWHA 4I7FB 3B6BA 1NSPA 2ZM6F 2BJ7A 3KUEA 5EWFA 2P6SA 3OVSA 2BEFA 4C0OC 1KSPA 1UPMB 4LUBA 1G4CA 2KRRA 5HLFA 2FD2A 1HMVB 1KH7A 4RNOA 1F6TA 1YJWS 3F41A 3RYLA 1AT1B 5F8HA 2EKNA 3AD7C 1TKXB 5HQ8A 2XBPA 5LSLA 1DQAA 1YBUA 4J91A 2R7QA 3GFYA 4DLEA 4CDIA 2HMIA 3CMAS 3C6TA 2IA0A 4HHUA 4ZCMA 5DLGA 4JUZA 1LW0A 5L1IA 4MIBA 4BC9A 3RRKA 2YKQA 4EWTA 2YH1A 1TKTA 4KHPJ 5C24B 3I96A 2Y8YA 3AODA 2V8GA 3MAQA 4ILRA 5K8PA 4DL4A 4OLOA 4IG3A 5KT4A 4C3LA 2UXCF 1HQUA 4ED5A 1D8ZA 1TTHB 5B08A 2VC0A 3KLIB 4EU0A 3VZIA 5IWAJ 1TL5A 1CJVB 3E01B 3VTIA 3V4IB 1L3TA 4G3IA 3C15A 4UOGA 1Y11A 2ZC3A 4ZG9A 1I3OB 3O2IA 2Z0GA 3MM7A 3OD2A 1H73A 4ZHRA 2CAJA 2DD8S 3BYRA 3V4MA 1RAJA 1IBLF 1DZ5A 1SQFA 3KJVB 1FDAA 4N77A 4OZJA 5F3TA 3NGRA 2DR9A 1FESA 3TZWA 3PRDA 3QGGA 2CQ0A 4USHA 2P9CA 4OZ0A 1RCOB 2HQIA 5EGYA 3R5AA 4EYHB 4OI4A 2CPXA 4M5JA 5AXLA 2GA7A 2W2OP 3GFXA 4NA3A 1CJKA 1H0HB 4Y28C 4MJKA 2RDDA 4ED1A 1VQNS 3JSYA 3SMZA 3BKFA 1WC4A 4EZ6A 1UJ6A 3DI6A 2DXDA 3RBDA 3EMTA 5AE3A 3K5NA 3BEGB 1MU2B 1XNQF 1T9VA 5K20B 3DHWC 4MKVA 1JB0C 4NI2B 2UU9J 3OHBA 2XMTA 1TK0A 1WTFA 5D4NA 4F67A 4FF4A 1IWAA 1AZSB 3AFGA 5J1NA 3Q2TC 2J8SA 2HS4A 4ZJLA 4WWSA 4MAKA 3CULA 2E5LJ 1RT5A 2KM8B 3GYNA 4O3OA 4P75A 2LDYA 2C3YA 4ED6A 4LSLA 3I5CA 1HQ2A 3PFEA 1SC3B 5IV3A 2C28A 1RE1B 3M32B 3LP1A 2D3O1 4X4QA 2MGZB 1AYEA 2YXLA 4DX5A 4DN9A 1TP7A 1JXLA 2O5DA 3KNAA 2XMVA 4DV0F 1YJ9S 3OTOF 3AOBA 4WFNQ 2XCAA 3MEGA 4HT5A 3MECB 4ZKAA 1QAYA 4ALZA 1ZAXA 3QO9A 2F4FA 3K89A 2HZAA 1RU2A 4O3QA 4KHMA 2MZSA 2N7YA 4DR4J 3M7VA 2GHPA 2W5XA 1Q8IA 2OI2A 2EC0A 4WP8A 1WEZA 4W4MA 1U49A 2E1MC 5SUHA 4H4OB 4CT9A 3SFGA 3PEHA 1N88A 3NEKA 1GX5A 3I0RA 3OVAA 3CDBA 2W2MP 3BSCA 3PFOA 4NYOA 3GG1A 5MAOA 2ZH2A 1RACB 1XERA 1HA1A 2BW2A 5CYMB 3DLHA 4JI0J 2AP6A 2YNFA 4ECUA 5KG2A 1R0BG 1B8JA 1MWYA 2CQ3A 5E3AA 2IY5B 2W8KA 2W4CA 3H2UB 5IQQA 1ZTTA 4UPHA 3HZEA 4HYKA 3H20A 1JQGA 4CLPA 2CQBA 3PVXA 1R8HA 1BQNA 2E9TA 4JI2J 4KPYA 4WJBA 4K2XA 3NBPB 4L73A 3J7ZT 4DL6A 2NREA 1NZAA 1RT7B 1NB7A 5LMNF 3S6EA 4OYOA 3CXCR 3FFIB 4F4YA 3LOUA 1IKYA 1SJRA 4EUVA 2U1AA 4LFCF 3L7OA 1AROP 4Y2IA 2NUUG 1VMBA 1KFSA 4PYAA 4U7UK 4LRFA 4CYUB 3M8QB 1TR0A 2ZM6J 2BJEA 4KKOB 4HTIA 5KFKA 1JLEA 1KN6A 2WONA 2YNIA 4ZLPA 3PHTA 3QRRA 1RKJA 4UPIA 5HK4A 3PNIA 1FF2A 3M2UB 3E3XA 2L3MA 3FGVA 4RBUA 1IR0A 1GMVA 1HWJA 1LK7A 2BQUA 4KGXB 5B0FA 3DOLB 3TEHB 3AQOA 4ZCIA 1N5QA 2W9CA 3BO2A 1HNWF 4AFFA 3TAPA 2VUGA 3DGPA 1UVKA 4USIA 1XN9A 2ZH3A 1NHUA 3MHYA 3NKYA 4CO0A 4OX8A 2MQOA 2QYGA 3PYEA 1YI2S 2VFTA 1BWVA 1C0UB 2FHMA 3S01A 3EWGA 4AUKA 1WOOA 3K8WA 5HROA 1SV5B 3H7HB 3MPWA 4TVAB 1XWLA 3NGKA 1U6ZA 1XMOF 3OTBA 3GCXP 3T02A 5U47A 3TW0A 5AJ3F 1UA0A 2HFZA 4M5LA 3PXGa 3TQEA 3IAS9 1AFIA 1D0EA 3MAHA 1OYDA 2EFOA 4C4WA 2GCFA 2B8QA 4DQQA 5ETMA 4ZVHA 3CCQS 3T1HF 2PT0A 4OFZA 5KFJA 3GIIA 5C2CA 1S1TB 5KFSA 4XAKA 3D6MB 1ALJA 2AF6A 4WP9A 3HD2A 4W98A 1LXJA 1KWMA 1HMVA 1BQMB 3ILOA 3KMSA 5E7OB 5IT9Y 1TKXA 2ATLA 2BKPA 1FJGF 4DV3F 1U8SA 2W01A 4F3QA 2OTJS 4DHVA 1EETB 3AD8C 1D09B 3SQOP 2AGQA 4I68A 3ET6B 4QAXA 2H5EA 1WDTA 4GO7X 3R5CA 3IC1A 2IRUA 2YWEA 3HXMA 3R97A 4DPXA 3SQGB 4Y34A 1MWZA 1P8GA 5C24A 3G8TA 6FD1A 3LWLA 4PQAA 1IVZA 1EJJA 3NWGA 2BM0A 3PV8A 3DXBA 2CQ2A 1RSCA 4NYZA 4NXNJ 5D15A 2P2CB 3W5XA 2CWKA 3KLIA 2LP4A 3V6HA 4JI6F 1V5IB 2BOPA 1CJVA 4B02A 3V4IA 4UZBA 1N2KA 3MR6A 1DAXA 3WIUA 2VFUA 4OZ1A 1KRPA 4USJC 2H51B 3KJVA 3QT7A 1SQEA 1N5TA 2G1HA 4Y6IA 1PGZA 4DFJA 3QWPA 2R8JA 2QA4S 3OSNA 3R3TA 4ZGAA 3A12A 2QSFA 1F9FA 1YZ6A 5DLWA 3MMJA 2C3OA 2V34A 4B3SF 3SZZA 3DCAA 4DPUA 1EQ0A 4CH0S 5EGEA 3Q83A 3HCXA 2FLPA 1XMQJ 2QYCA 4URGA 4C8KA 4L6V3 1JKHB 2XO7A 1HKAA 1MU2A 2OJ3A 3T9ZA 1U26A 3D3BJ 2VPXB 4NWJA 4NI2A 2IYIA 4KH1B 1RI7A 1RTHB 4B3RF 4LF9F 4WZMA 4I64A 4FVMA 2G0IA 1AZSA 3HP6A 1ACMB 2FB0A 1B0TA 1JNRB 2QV6A 4RW7B 1VQSA 4LF5F 1QAIA 3R7BB 4RUCA 2PA8D 5J1EB 1QSYA 1URAA 2FHOB 3HHDA 2A1BA 4DMZA 4I2PB 2XB2D 1OY9A 4F4ZA 4KT0C 1O8BA 1SC6A 2IVMA 2DH8A 3M32A 3LO3A 3P4UB 2KG0A 4KH0B 2MGZA 1QE1B 1TFWA 2XY6A 3NXZA 4NWBA 2OIHA 2EG2A 1I1GA 2M0GB 4C2MA 1SPBP 2BANB 1U0SA 3FBEA 3MECA 4JV1A 2GV1A 4C9DA 1HBUB 1FWKA 3UR0A 3PX4A 4DR5F 2I9SA 2DITA 3BPDA 5EGHA 3ADAC 2XWXA 1I51B 2DGXA 2COLA 3Q2SC 3X3UA 5CAAA 2DXFA 1WHXA 3OSPA 1EB0A 1IBMJ 3OR2B 1ELOA 3GIRA 3GIKA 5K14A 3CCRS 1X4CA 4H4OA 1VBYA 3KXDA 3UCUP 3M6VA 3N5FA 1ZETA 4OL8A 2DY9A 4NE9C 4U6PA 2YKNB 2D3ZA 3CCWA 5KOXA 1VR6A 1HD0A 1YJTA 4K4ZA 1NK8A 2BE9B 5DDOC 3V6KA 3NAHA 5CYQB 1O51A 5KG3A 1CPZA 2YKOA 2JC0A 2D1GA 1RWWB 1M5OC 1FNOA 5HJXA 2WVFA 1YJUA 2H3EB 1WHWA 3T00A 4ZP6A 3TOQA 3ENQA 2CVIA 1KONA 1R3NA 4PXCA 4NA1A 4USVA 3CCLS 4PAAA 3CGIA 1VISA 3CNQP 1FJEB 4C0BA 3DFEA 3DGVA 3Q23A 1QVGR 1RT7A 4CLYA 4HHJA 1HD1A 4JV2A 3HHLB 1T7PA 3QYYA 3FFIA 2PMHA 4DL7A 4S0MA 5KT3A 4MIVA 2MQNA 4OJGA 1CC7A 4U96A 4DR3F 2W8SA 1UJ4A 4CYUA 2EXUA 1HQEB 2R9LA 3M8QA 2ROGA 5KFNA 4KKOA 2FYXA 1R89A 1O98A 1JK9B 2J7UA 4NLUA 1UPPA 4OYPA 3SSRA 4AQYF 2CNLB 3M2UA 4LF7J 2PIIA 2HNYB 4YB6A 4QR2A 4TQRA 4QYZK 2LU2A 1FKAF 1RQ0A 3M2RB 1N5VA 2BBEA 2HHXA 3DOLA 1C0TB 1AW0A 3D68A 1CULB 2RH6A 3LP2B 5K4PA 3Q8UA 1XIQA 1U1OA 4J9KA 3HT0A 3FMWA 5RUBA 3CJ8A 2XR9A 3HD1A 3GMGA 3BSOA 4RLEA 2IRXA 2BRKA 3OR1B 1ITPA 2PA3A 5GAHU 2JRSA 3WIVA 4JOUA 1HW9A 2EVZA 1FERA 4MFBA 3CC7S 1C0UA 5JJBA 3H5SA 1H74A 5DO2A 3NMRA 2JEGA 4L75A 2ZNZA 4LF6J 1SV5A 3LANA 5HO4A 3N4WA 3DLKB 4XO0A 3BGOP 4FZVA 4XTTA 3RB3A 3U7JA 2IAJB 2YPZA 1NH8A 3C19A 5CCLA 9ATCB 1ELYA 2W7OA 2C2EA 4ZP9A 3HVWA 2AKWB 3OFFA 1N48A 3DDIA 1U2FA 1T8EA 3IWNC 2XYGB 2G13A 2GJFA 3AHPA 3JSRA 2R2SA 2M52A 4WTOB 1ZAVA 2HBZB 3G8SA 1S1TA 4ZP8A 1P27B 3D6TB 3AXKA 3N28A 3SSSA 3OL9A 2VB6A 1DHMA 2DO4A 4J9NA 1ZM4A 1RKIA 4DR6F 1BQMA 1U02A 4Q2MA 1YTYA 3KLFB
chains in the Genus database with same CATH topology
3TG0A 3IGYB 1ANIA 2XR9A 3BDHA 4LRAA 5TJ3A 2W5TA 3UO0A 4LRFA 5EGEA 4B56A 4LR7A 1E2SP 4NWXA 2W5QA 4CXSA 1KHLA 4GTZA 5EGHA 4CYSA 1KHNA 1ED9A 4UORA 1E1ZP 3KD8A 4KJGA 5DLTA 4ZG9A 3TWZA 3BDFA 4LR2A 1EJJA 2W5SA 1SHQA 3WAXA 3E2DA 2X98A 3Q3QA 1KH7A 1ALHA 1ZEBA 4GTXA 3TX0A 4GTYA 2XRGA 4FDIA 1ELZA 4NWJA 4UPIA 4ZG7A 4LREA 2W5WA 1EW8A 1O99A 2GSOA 4GTWA 1ZEDA 1FSUA 4MIVA 3WBHA 3B5QA 3M8YA 3NKRA 3UN2A 3BDGA 3NVLA 1KH5A 1EW2A 3OT9A 3IDDA 2W8SA 4LRBA 3NKQA 4KJDA 5KXAA 1HQAA 5LIAA 1B8JA 5IJQA 4LR8A 3NKPA 3T01A 1KH9A 1EQJA 1N2LA 1ANJA 1Y6VA 3UN5A 5LRMA 1ALJA 1N2KA 1P49A 4UPHA 3MK1A 1Y7AA 1KHKA 1ALIA 2W5RA 3M8WA 1K7HA 1O98A 1AJCA 4CYRA 1ALKA 5GRRA 2IUCB 1ELYA 5IJSA 1URAA 4CXUA 1AJDA 2W8DA 1SHNA 4KAVA 5L0EA 4LRCA 4KM4A 2QZUA 4UPKA 3M8ZA 4ZG6A 3IGZB 1ZEFA 5AJ9A 5L0BA 1E33P 3WAVA 1HDHA 4MY4A 4TN0A 5HRTA 4LRDA 3UNYA 2GSUA 1ELXA 3MK2A 3SZYA 3DPCA 5LRNA 5LQQA 5INHA 4LQYA 3WAWA 3UN3A 5GOVA 2VQRA 1AJBA 2GSNA 2GLQA 1EW9A 3MK0A 1AUKA 1ED8A 3CMRA 1EI6A 1E3CP 2D1GA 5DLVA 4CXKA 4UOPA 3DYCA 2ZKTA 3M7VA 3NKNA 1URBA 2W5XA 1KH4A 3ED4A 4ZGAA 5C66A 2ANHA 2GA3A 1HJKA 4KAYA 2G9YA 2RH6A 2W5VA 4YR1A 5K4PA 3WAYA 2IUCA 5DLWA 1AJAA 4QAXA 4UPLA 3T00A 5L0KA 3A52A 3NKOA 4LR9A 3NKMA 2IFYA 1KHJA 3LXQA 3BDGB 4MHXA 3T02A 3SZZA 4UOOA 4N7TA 4FDJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TG0 A;  3IGY B;  1ANI A;  2XR9 A;  3BDH A;  4LRA A;  5TJ3 A;  2W5T A;  3UO0 A;  4LRF A;  5EGE A;  4B56 A;  4LR7 A;  1E2S P;  4NWX A;  2W5Q A;  4CXS A;  1KHL A;  4GTZ A;  5EGH A;  4CYS A;  1KHN A;  1ED9 A;  4UOR A;  1E1Z P;  3KD8 A;  4KJG A;  5DLT A;  4ZG9 A;  3TWZ A;  3BDF A;  4LR2 A;  1EJJ A;  2W5S A;  1SHQ A;  3WAX A;  3E2D A;  2X98 A;  3Q3Q A;  1KH7 A;  1ALH A;  1ZEB A;  4GTX A;  3TX0 A;  4GTY A;  2XRG A;  4FDI A;  1ELZ A;  4NWJ A;  4UPI A;  4ZG7 A;  4LRE A;  2W5W A;  1EW8 A;  1O99 A;  2GSO A;  4GTW A;  1ZED A;  1FSU A;  4MIV A;  3WBH A;  3B5Q A;  3M8Y A;  3NKR A;  3UN2 A;  3BDG A;  3NVL A;  1KH5 A;  1EW2 A;  3OT9 A;  3IDD A;  2W8S A;  4LRB A;  3NKQ A;  4KJD A;  5KXA A;  1HQA A;  5LIA A;  1B8J A;  5IJQ A;  4LR8 A;  3NKP A;  3T01 A;  1KH9 A;  1EQJ A;  1N2L A;  1ANJ A;  1Y6V A;  3UN5 A;  5LRM A;  1ALJ A;  1N2K A;  1P49 A;  4UPH A;  3MK1 A;  1Y7A A;  1KHK A;  1ALI A;  2W5R A;  3M8W A;  1K7H A;  1O98 A;  1AJC A;  4CYR A;  1ALK A;  5GRR A;  2IUC B;  1ELY A;  5IJS A;  1URA A;  4CXU A;  1AJD A;  2W8D A;  1SHN A;  4KAV A;  5L0E A;  4LRC A;  4KM4 A;  2QZU A;  4UPK A;  3M8Z A;  4ZG6 A;  3IGZ B;  1ZEF A;  5AJ9 A;  5L0B A;  1E33 P;  3WAV A;  1HDH A;  4MY4 A;  4TN0 A;  5HRT A;  4LRD A;  3UNY A;  2GSU A;  1ELX A;  3MK2 A;  3SZY A;  3DPC A;  5LRN A;  5LQQ A;  5INH A;  4LQY A;  3WAW A;  3UN3 A;  5GOV A;  2VQR A;  1AJB A;  2GSN A;  2GLQ A;  1EW9 A;  3MK0 A;  1AUK A;  1ED8 A;  3CMR A;  1EI6 A;  1E3C P;  2D1G A;  5DLV A;  4CXK A;  4UOP A;  3DYC A;  2ZKT A;  3M7V A;  3NKN A;  1URB A;  2W5X A;  1KH4 A;  3ED4 A;  4ZGA A;  5C66 A;  2ANH A;  2GA3 A;  1HJK A;  4KAY A;  2G9Y A;  2RH6 A;  2W5V A;  4YR1 A;  5K4P A;  3WAY A;  2IUC A;  5DLW A;  1AJA A;  4QAX A;  4UPL A;  3T00 A;  5L0K A;  3A52 A;  3NKO A;  4LR9 A;  3NKM A;  2IFY A;  1KHJ A;  3LXQ A;  3BDG B;  4MHX A;  3T02 A;  3SZZ A;  4UOO A;  4N7T A;  4FDJ A; 
#chains in the Genus database with same CATH topology
 1WI8 A;  4NX9 A;  3JSB A;  1KHN A;  4F0K A;  4DSL A;  3R5J B;  3D6H B;  4KHR A;  1NDC A;  4EK2 A;  1RTJ B;  1OWX A;  1EET A;  4I2Q B;  2PSZ A;  2XLJ A;  3H59 A;  3KDN A;  1S76 D;  2QL9 B;  2MLX A;  3ET6 A;  2Z8Q A;  3M8Y A;  4OI6 A;  4F3O A;  2HZV A;  1BGX T;  4WYW A;  3K17 A;  3TRG A;  4OMF G;  3SQG A;  3C6U A;  3SYZ A;  4DUY F;  2CZV C;  1VLO A;  3CME S;  3G2X A;  3TUZ C;  1YIT S;  1H2T Z;  2CJX B;  5KT5 A;  3BZQ A;  3VVT A;  3QGP A;  4TN0 A;  4P72 A;  1MMN A;  2VPW B;  3V81 A;  2UVR A;  4LF4 J;  4JI3 J;  4TU8 A;  2Q6C A;  4H4K C;  2MKH A;  4LF8 J;  4B9M A;  1JNZ B;  3O6Q A;  4KGZ B;  3DXS X;  4ZK7 M;  1TKZ B;  2GNK A;  2P9G A;  1JLB B;  4C3K A;  4QWD A;  1YBA A;  2JSX A;  4Q5V A;  5LJ3 Y;  1MN9 A;  1GXL A;  2E1P A;  2ILY A;  4USM A;  2HIY A;  3DLG B;  1IBC B;  4A8K A;  5DLT A;  4JI4 F;  2ZDP A;  1SHQ A;  3SCK E;  4YHH F;  1NDP A;  4ZOS A;  2VA2 A;  2V4J B;  1HR0 J;  3GV7 B;  1P1L A;  4ZA1 A;  2BVZ A;  2J9D A;  1LWC B;  5CD4 H;  2FQQ B;  2PDA A;  3D54 A;  3PDN A;  1TKD A;  4WKY A;  5LM7 E;  1JKH A;  3VQS A;  1RHU B;  2AYG A;  2FDN A;  5E33 A;  3KLH B;  5DJB A;  4UOF A;  5KFI A;  4USU A;  4ZIV A;  3W60 A;  4C8N A;  1RTH A;  2VPZ B;  4YY3 J;  2RUS A;  1PAE X;  4PG5 A;  2RS8 A;  2XMU A;  1N5S A;  4YDD B;  4ELV A;  4RW7 A;  4DV2 F;  1Y4Z B;  5J1E A;  1Z2Z A;  5HAT A;  3CJ2 A;  1KHJ A;  4I2P A;  1N52 B;  4B3O B;  2ZE2 B;  4LQ3 A;  1VHI A;  5J2N B;  5LMU F;  4XIU A;  2Z2M A;  1WUU A;  4NLQ A;  3HZG A;  2UUA J;  8AT1 B;  2BAN A;  3AAW B;  2BRL A;  1S7H A;  4OYI A;  3NKR A;  5E3R A;  2R3V A;  4DL3 A;  2BX6 A;  2IJF A;  1HBU A;  3J81 U;  2EFP A;  3OPK A;  3DRP B;  1G1X A;  2H48 B;  1SJ3 P;  3KUH A;  3H5X A;  1CG2 A;  4RW8 B;  2XSF A;  5KFE A;  2NXE A;  5B0G A;  2XY5 A;  3AT1 B;  2FZG B;  5ETN A;  1YWX A;  3FC9 A;  5D4O A;  4DEZ A;  2DHS A;  3OR2 A;  2DGV A;  1RHR B;  3RAM A;  4DR2 F;  2OGU A;  3KDO A;  1KS2 A;  3JQJ A;  3W65 A;  4OQJ A;  5M2U A;  2OSQ A;  3HVT B;  3ZO7 A;  1UVJ A;  3I32 A;  1A6L A;  2YKN A;  4OYW A;  3ZZT A;  3PO5 A;  1I94 F;  5C7P A;  5I3Q A;  2PI4 A;  1JMT A;  2WW8 A;  4LSN B;  4Z2X A;  1R8B A;  2R7O A;  4QW8 A;  5CYQ A;  2DRA A;  5BR8 J;  4I69 A;  5KFH A;  4X64 F;  3K7R A;  4HH1 A;  2J0Q D;  3QAU A;  2E9Z A;  3HX9 A;  1TL3 B;  3UDV A;  1S0O A;  4GC6 A;  4DFP A;  3UDL A;  2UP1 A;  1VC5 A;  1B0P A;  1WOS A;  2EW9 A;  1UVI A;  3L4B C;  4LRE A;  4V19 J;  2CJA A;  3KJN B;  3DM2 B;  4MK7 A;  3MM9 B;  5LIA A;  3IBC B;  4NPO A;  2E7X A;  3A3N B;  1WC1 A;  3IAM 9;  4CXU A;  2V67 A;  5DDQ C;  1OSD A;  4C8L A;  3M8P B;  4IO1 A;  5KFV A;  4A48 A;  1OY6 A;  1FTR A;  4Q44 A;  2W9A A;  3J7Y I;  5IC4 B;  1HQE A;  3TAR A;  1KHW A;  5A8K B;  2R7S A;  1TZ0 A;  4JI5 F;  2G2Z A;  4A8W A;  2GHW A;  1LQ9 A;  1VQ7 S;  4DS4 A;  3NS6 A;  4DR6 J;  1LFP A;  4KGM A;  2LA4 A;  3IM9 A;  3BJY A;  1EQM A;  3LW5 C;  2LEB A;  2HNY A;  1X0P A;  3GIL A;  4C3M A;  1WD6 A;  2DPJ A;  4LBI A;  4JI1 F;  2DNR A;  2XS2 A;  1CUL A;  3LP2 A;  2HKE A;  2CRL A;  1PYS B;  1K1S A;  2XS7 A;  2IVF B;  2DH7 A;  5KFQ A;  4J9S A;  4J7C A;  1WEY A;  4B9V A;  2ILZ A;  1DJ0 A;  3OR1 A;  5KFP A;  2IC3 B;  1UW9 A;  4G1I A;  1IUJ A;  3NCQ A;  4DFM A;  2DVI A;  2X3D A;  2FJA B;  4NCA A;  1RP5 A;  5J2M B;  2ZZT A;  2IBO A;  2DEJ A;  4USK A;  4X2B A;  2AJ2 A;  2UVV A;  2XGP A;  4RKU C;  5JMN A;  5EX3 A;  2GSN A;  4ID8 A;  2KZM A;  2FVQ A;  1FEE A;  3DLK A;  2IJN A;  2QSW A;  3IN5 A;  2H1Y A;  2JNJ A;  2YKM B;  5LXR A;  4CH1 A;  2HQ3 A;  2IAJ A;  2QLF B;  3A52 A;  1Q78 A;  2VFR A;  3VCD A;  4YQW A;  2VDH A;  2DRD A;  2EFQ A;  3ZTP A;  4OJ3 A;  4WTY A;  4C8Z A;  3MGJ A;  1RT6 B;  4CXS A;  3QAT A;  3I4P A;  4NLY A;  4JP8 A;  2F9J A;  4QBU A;  2BZ2 A;  3AB2 B;  3ITH B;  5E0O A;  3HK2 A;  1S1W B;  2V8V A;  2YWF A;  1RWP B;  3KJF B;  3EXY A;  3UCZ P;  3VAJ A;  5KT6 A;  3VV2 B;  2HVE A;  2V2Q A;  3W2V B;  3KLF A;  3CIM A;  3OVB A;  4OYA A;  2CNN B;  3H0P A;  2E1A A;  2VFV A;  4WFB Q;  4IFV B;  2VG5 B;  1RYR A;  1Q8L A;  3IWX A;  1YBT A;  3FJ2 A;  2HVZ A;  1RHM B;  1RTJ A;  4I2Q A;  2RQM A;  4OYX A;  1WC5 A;  2HQC A;  4DR7 J;  4FXW A;  1F5C A;  4UUX A;  2ZH7 A;  3THV A;  3H2L A;  4BBY A;  1J5E F;  2UUW A;  1QSS A;  1SKR A;  1RUS A;  1Y00 A;  2ZFH A;  5A8R B;  1V5V A;  5KG7 A;  1FX4 A;  4Q2L A;  4DV2 J;  4QZV B;  1LV5 A;  2H4W B;  3P96 A;  4KFB B;  3CCU S;  1F2H A;  4D3H A;  1ZPW X;  4O0I A;  3KNG A;  1GAO A;  3FMB A;  2KJV A;  5F8G A;  5HAO A;  1TKZ A;  4CO3 A;  4MYU A;  1JLB A;  4C8M A;  3DHX A;  2V2K A;  1D1U A;  3AXM A;  1UZD A;  1X5T A;  4UQG A;  3IXQ A;  1ICE B;  4OYB A;  2DHH A;  2GHV C;  3NS7 B;  2M70 A;  2GX8 A;  3DLG A;  4EO6 A;  3ENA A;  4IRD A;  4DWI A;  3DLB A;  5GAD I;  2AD9 A;  3M2V B;  2C2Z B;  1U25 A;  1M5K C;  3E2E A;  1N36 F;  2VIH A;  2EBE A;  4LF1 A;  3RR8 A;  2DBB A;  4JI8 J;  2V4J A;  4MY4 A;  2R7U A;  4KO0 B;  1M5V C;  1KBR A;  1LWC A;  2L9N A;  3OJS A;  3H4B A;  1EAR A;  1VRQ C;  2HFO A;  2XUL A;  4L76 A;  2BJD A;  3MED B;  1H2U X;  4UUW A;  1XEZ A;  5CH7 B;  2UXB J;  1APS A;  4NXM F;  3WAY A;  3H2V E;  2RAQ A;  3KLH A;  1H6K X;  3H5U A;  4Y0F A;  4M5K A;  2DHA A;  4DJB A;  1KHV A;  3F56 A;  2HRY A;  4TKT A;  2OLW A;  2CWX A;  4E0D A;  1PJ6 A;  3VAG A;  3G6Y A;  1WNE A;  2RF2 B;  1G3O A;  2DYA A;  1EJ7 L;  2BJ3 A;  2WVD A;  2CG4 A;  4RJV A;  3LF0 A;  1RWV B;  2J0X A;  1WHY A;  1RGV A;  4JV0 A;  2M3D A;  1ZA1 B;  1YG0 A;  3M8R A;  5KG1 A;  1L5U A;  1F0X A;  5IFM A;  3VAH A;  4QJV A;  3TAM B;  4B3O A;  2ZE2 A;  3MTK A;  2ASD A;  5J2N A;  2HLU A;  2QL5 B;  1K0T A;  4ED2 A;  2ZKU A;  4J9P A;  3K8V A;  2AZ3 A;  3KG4 A;  2XWY A;  4OJ1 A;  2KVI A;  3AD9 C;  4LFB J;  2DNP A;  3CUN A;  3DLL Q;  2MQQ A;  3DPC A;  2LMI A;  2GGP B;  4ZIW A;  4ED7 A;  3PCO B;  3G9C A;  2KG1 A;  1VHF A;  3DRP A;  5KFX A;  3NAI A;  2PI5 A;  1TAU A;  2DO0 A;  2ZH1 A;  1Y3K A;  1KDN A;  2BM1 A;  2CPF A;  2F1F A;  3H40 A;  4RW8 A;  2CPJ A;  4Y3C A;  3BKU A;  3OW2 R;  2M2B A;  2DEI A;  2DR5 A;  1YVF A;  4N7T A;  1T95 A;  3IGY B;  2C42 A;  4C48 A;  4JI5 J;  3P5B P;  3M6U A;  1H38 A;  4AL5 A;  2YH0 A;  3G6E S;  3VF0 B;  4I1T A;  1SL2 A;  2MKK A;  2ZBI A;  1PO6 A;  2BV3 A;  1K8A T;  2J8A A;  3HVT A;  1U1M A;  3Q3Q A;  1FWL A;  4QPX A;  1FSU A;  2AHO B;  1W26 A;  1VFJ A;  5KAK A;  4LSN A;  4OLP A;  5CA5 A;  4N8N A;  2IFX A;  2KXH A;  3QT5 A;  5FJ4 A;  4ZJQ A;  3V6D B;  1ALI A;  1LFW A;  2VQE F;  3BH7 B;  5DG7 A;  1TL3 A;  3CPW R;  3NNH A;  1RWO B;  3HT3 A;  5LRN A;  4Q0B B;  3DM2 A;  4A47 A;  1FRI A;  3TZX A;  4CWB A;  3MM9 A;  2BJ8 A;  1WOR A;  3ETO A;  2KH9 A;  1IN0 A;  3P45 B;  1SUQ B;  2EFV A;  1RA7 A;  3TA1 A;  4XK8 C;  2Z2Z A;  1KVK A;  3VGU A;  3M8P A;  2CJK A;  2W5Q A;  2ASJ A;  4GMK A;  1HNI B;  2GFF A;  4PZV A;  4KJG A;  2IRY A;  2VD3 A;  2NS1 B;  1SIZ A;  3PM9 A;  2XMK A;  1ELZ A;  3MUT P;  5A8K A;  5HBM B;  3HJF A;  2BOA A;  2XG8 A;  2ZBQ A;  3JQK A;  2HHH J;  1LEO A;  4FVC A;  3UPF A;  3BSN A;  2YY3 A;  1ZZN A;  1PIL A;  2AYM A;  4NLR A;  2P8I A;  4DCP B;  1P49 A;  2CUY A;  3PRB A;  2DH9 A;  1Y7P A;  3K5L A;  1CJT B;  5B0D A;  1HDH A;  3GFZ A;  4F3M A;  3GTY X;  4KPC A;  2DIU A;  1Y10 A;  1SH3 A;  2Z56 B;  3M30 B;  3QFW A;  1NJZ A;  3EUN A;  4K50 A;  4J9O A;  1F60 B;  2M88 A;  4QOT A;  2ATC B;  5D6G A;  2ACY A;  2YQ0 A;  2LKZ A;  2IC3 A;  3LGN A;  1J5E J;  2JL9 A;  1SXL A;  2N3O A;  3GPA A;  3O1L A;  5HSP A;  4O44 B;  4HT7 A;  4PG6 A;  5J2M A;  2XO6 A;  1CQM A;  2BXJ A;  3BH6 B;  3TYT A;  2KHD A;  3OUY B;  5DGA A;  4F2R A;  3VR1 A;  3FQK A;  3J7A 1;  3KKF A;  1FT8 A;  1N32 J;  4ES1 A;  2Y1I A;  2WCX A;  3EVW A;  1IR1 A;  1ALH A;  4W90 B;  4YR2 A;  3D1O A;  2JZ5 A;  2NLW A;  1C1C B;  2KT2 A;  1GEH A;  1T9Y A;  3W66 A;  3WBH A;  3D4J A;  2VFS A;  2HG4 A;  3WHI A;  4R0J A;  3I9V 9;  2VQF F;  3LA0 A;  2LU1 A;  4DPW A;  1TU0 B;  1RT6 A;  2Y1L B;  2XTJ P;  4YME A;  2UVU A;  2OKQ A;  3JB9 k;  4U7U D;  5M2R A;  3SSQ A;  2FVR A;  2EI5 A;  3SIP B;  1MN7 A;  1S1W A;  3D0H E;  2RS2 A;  4CI0 B;  3B4D A;  3FKB A;  3M9O B;  5GAG I;  4KR0 B;  3W2V A;  2UUC F;  2FLL A;  2RH3 A;  3MMA B;  5HI7 A;  3M9N B;  1HNX J;  1N56 A;  1UFK A;  1NHV A;  4X66 F;  1WF1 A;  4IFV A;  2VG5 A;  1E6Y B;  2D9O A;  2N82 B;  4A8S A;  3CJ3 A;  1QAX A;  2VL1 A;  2LQB A;  4MHX A;  3O44 A;  4DPO A;  5C25 B;  3CWJ A;  3PIO Q;  3FBF A;  4OX9 J;  2B4O A;  5KG0 A;  4R5P B;  2K7J A;  3C16 B;  2ZVS A;  1U1L A;  5C5J A;  1YIJ S;  5A8R A;  1FRL A;  1R31 A;  4GKK F;  4WXO A;  4KFB A;  4JYA J;  4NEY A;  3OT9 A;  2KXF A;  1NAQ A;  3P8B B;  4P2S A;  1X9W A;  4QW9 A;  3S8S A;  4TXS A;  3HSJ A;  1ULR A;  3WQP A;  3EPI A;  4EEY A;  1NM2 A;  3MM7 B;  5BXI A;  1FDB A;  3RBZ A;  5CHC B;  2W4D A;  4LIR A;  4N76 A;  5HRT A;  3L9Z A;  1JXV A;  3KLV A;  1R0A B;  5KFG A;  5M2P A;  1P6T A;  3ZZ0 A;  3PJX A;  3CCE S;  1K1Q A;  3H8Y A;  1MRO B;  3F73 A;  3PW5 A;  2ZZN A;  3POT B;  1D9F A;  4FN5 A;  1OPI A;  3M2V A;  4QIV A;  2EK6 A;  1QLN A;  2IFY A;  5T7L B;  4CLU A;  1RWK B;  3FEZ A;  4KO0 A;  1W25 A;  1OS5 A;  2J7K A;  4IH5 A;  2G0C A;  4IG0 B;  5AXM A;  2OEM A;  2FJW A;  4CYS A;  2HND B;  2VPY B;  2EKY A;  3FCV A;  2DGO A;  3MED A;  3PYG A;  4ZDN A;  4WFY A;  1QSL A;  3JYT B;  1ZM9 A;  1A9N B;  1MML A;  4W92 B;  1N0U A;  2DGT A;  5KT7 A;  4KHP F;  3SV3 A;  1KH9 A;  1N2L A;  3PTW A;  5AT1 B;  1FRX A;  2RF2 A;  4F36 A;  2AMC B;  4P6Q A;  1FJ7 A;  2AEJ A;  2QE5 A;  3ZC4 A;  3NMA A;  3GFH A;  2QZU A;  4FPR A;  2YNG B;  5IWA F;  3LTO A;  3TAM A;  4IH7 A;  2DNZ A;  1Q82 T;  4CO4 A;  2MLZ A;  2XEX A;  1GK8 A;  4LVO P;  4RUA A;  3HFV A;  1CSJ A;  5IZH A;  4DCO B;  1X4B A;  2DR8 A;  3ULH A;  2BAB A;  2DRB A;  4ILL A;  4P2F A;  2I38 A;  2VBX A;  5TJ3 A;  1LOU A;  5A2Q U;  1DQ9 A;  2ALZ A;  2GGP A;  1LNQ A;  1KP6 A;  3EDR B;  1QTM A;  4U8Y A;  2F8M A;  2HBQ B;  2MY8 A;  3CJK B;  3R6G B;  3IFE A;  1Q4R A;  3NRB A;  4UST A;  5EHH A;  3AJ1 A;  3OL6 A;  2HSE B;  1K44 A;  3C14 B;  3EGN A;  3TUP A;  3N0V A;  4UW2 A;  1D8Y A;  3OXG A;  3MPV A;  3D1H A;  3AOC A;  4OJH A;  2KDO A;  2BQR A;  4NLX A;  2I6W A;  2OEK A;  4OYZ A;  3MTJ A;  2EC2 A;  4B9N A;  2V9W A;  1NK9 A;  4QIG A;  4ECX A;  2UU9 F;  5F9N A;  4N8O A;  4DDF A;  2DNK A;  5INH A;  2VQR A;  3W8G A;  2F9D A;  2KZZ A;  4WFZ A;  3QQC D;  3IBW A;  1XK8 A;  1RAH B;  3PRV A;  2E5L F;  1N5Y B;  3HMJ G;  3V6D A;  1J5O B;  1O6X A;  3HFK A;  1HHS A;  1ZZF A;  1T11 A;  5H9F K;  1NK0 A;  1DRZ A;  2RB7 A;  1SJF A;  1IJF B;  2CXE A;  4RL1 A;  3LQV A;  4NLT A;  4Q0B A;  5KG5 A;  1WTB A;  3FVY A;  3MM6 A;  1CJU B;  3IRX B;  2OSR A;  4RU2 A;  3MXH P;  2HPU A;  4PKD B;  3PW2 A;  1SUQ A;  1CVJ A;  4UY8 5;  1E6V B;  3AJ2 A;  3VAL A;  2L9D A;  1TL4 A;  1EX8 A;  4ZVO B;  4NOH A;  3FNN A;  1ROF A;  4DR1 J;  2B7C B;  4DR4 F;  4DL0 C;  1HNI A;  5GMK a;  3ZZZ A;  4AL7 A;  4PRF A;  2J7W A;  3GJQ B;  2QT7 A;  4ZLL A;  2MYF A;  3J7Y U;  1FEH A;  3QFH A;  5HBM A;  1RAB B;  3KK2 B;  3OTE A;  1V6H A;  5JUM A;  3M9M B;  1NPP A;  2OPP B;  2H5J B;  3ELH A;  5HMX A;  1U0H B;  1CJT A;  1DAR A;  3D9B A;  4JI0 F;  3GIM A;  1EP4 B;  1B64 A;  1J27 A;  4DV4 J;  2IPO B;  5A6W A;  3M30 A;  5G0R B;  4QCL A;  1UJ5 A;  3CB4 A;  4F02 A;  1RIS A;  1SVD A;  1BXN A;  3V2U C;  2R7W A;  5KFF A;  1N54 B;  3GJR B;  4O44 A;  3UWT A;  1UVL A;  3MEK A;  4EBD A;  4GKK J;  3PW7 A;  4P52 A;  4KJD A;  4ZPD A;  4URQ U;  1VLY A;  4KQZ A;  3SCL E;  3OUY A;  2RIL A;  5LRM A;  1HAR A;  4FBU A;  5ETR A;  3HVA A;  3D7S B;  4M63 A;  5DDR C;  4M95 A;  4OZ3 A;  1VC6 A;  1SKW A;  4IH6 A;  2MQM A;  5L0B A;  3W3S A;  1C1C A;  3ILI A;  2I2Y A;  5GME A;  2N3L A;  1ZYQ A;  2IJR A;  3RTV A;  2V69 A;  1FDD A;  1L3V A;  2GVD B;  4EZ9 A;  4LBH A;  1REG X;  2AYE A;  2MKS A;  5BYQ A;  3G82 B;  1GH8 A;  5I42 B;  2RRA A;  1KFD A;  1TL7 B;  5KFR A;  3W1Y C;  1TMJ A;  1SCJ B;  4DZD A;  3VQT A;  2ZZM A;  4UOR A;  1VQY A;  3C8Y A;  3MMA A;  2P5V A;  3MPU B;  3FSX A;  3S1T A;  1YDL A;  4X84 A;  1E6Y A;  8ATC B;  2OH2 A;  2Q1L A;  2B56 A;  4DU8 A;  3A8J A;  1NJX A;  1V3Z A;  4LRB A;  1WSR A;  5HQL A;  2DCU B;  5C25 A;  1TUG B;  4MK8 A;  3BN7 A;  1KNZ A;  4QU7 A;  1NPK A;  1JJH A;  1J2V A;  4R5P A;  1V3R A;  4FNI A;  1UEK A;  4YS2 A;  5J2Q B;  3C16 A;  3CCT A;  3IRW P;  3HHL D;  4Y00 A;  3MK2 A;  2KHC A;  3CCM S;  4K4Y A;  3IG1 B;  2MQP A;  4A8O A;  4ZCK A;  4KGV B;  1HHT P;  4FYX B;  4F2S A;  3TVK A;  2ADC A;  1GQE A;  2LQJ A;  4K0K J;  1V3S A;  2KYX A;  3C3L A;  3R7S B;  1HWU A;  2V63 A;  1ANI A;  2B0G A;  1UET A;  1SH2 A;  4OV6 A;  3T5J A;  1R0A A;  3LPE A;  3R6L B;  3KD8 A;  3AQP A;  1UFL A;  3MR5 A;  4CNY A;  1MRO A;  3POT A;  5HN0 A;  2W5W A;  4PXE A;  2V4R A;  1ZED A;  5GAD U;  1VIX A;  3QJL A;  5T7L A;  4HTJ A;  1SIW B;  4LR8 A;  3I6P A;  1VI7 A;  4IUF A;  3KG1 A;  4IG0 A;  3W5Y A;  2HND A;  4M5I A;  2WSC C;  2CDR B;  4N5S A;  2M7S A;  2ZIT A;  1WG4 A;  1TL1 B;  1VBX A;  3JYT A;  1R0C B;  3GB0 A;  3ENW A;  2WK4 A;  4PG4 A;  2HRT A;  4C8Y A;  4F4W A;  1CC8 A;  2OD6 A;  3G8Q A;  1S1X A;  2U2F A;  2ZUG A;  2WOM B;  3MWB A;  3UR3 C;  2DTJ A;  1H3D A;  4KRW A;  2FJB B;  1HFE L;  4E2F B;  2A2C A;  4NZ0 A;  3OXF A;  4NXN F;  3RJM B;  2YNG A;  2W5T A;  3BO3 A;  3JTO A;  3BKT A;  1L3K A;  3PZP A;  2VHG A;  2FHK A;  2E1C A;  3IGV A;  2OPQ B;  3GZ7 A;  5H9F J;  4Q8E A;  4LJM A;  2LEA A;  3PG9 A;  3HSD A;  2ADB A;  2XS5 A;  1DTT B;  3T5L A;  4AXI A;  3NKP A;  2PC6 A;  1MLA A;  2FLO A;  1PSD A;  4B17 A;  2WVC A;  3VAK A;  4B08 A;  2VG6 B;  3CJK A;  2RU3 A;  1N33 J;  4C0H A;  2HHQ A;  1P9Q C;  4NMX A;  2HAI A;  2K2P A;  3C14 A;  4CP5 A;  5K14 B;  2KN4 A;  2RJZ A;  5DZ6 A;  2N4D A;  2QX0 A;  1BWE A;  2C2N A;  2JX2 A;  1XMQ F;  5L9X A;  2ZKT A;  2YQ1 A;  5ADZ A;  3EYZ A;  2RHS B;  1OY8 A;  3MPD A;  3ZTO A;  4F25 A;  2C2R A;  2GQ2 A;  3CSK A;  2ZD1 A;  4I56 A;  4QIW D;  1JJ2 R;  1YGY A;  3QJP A;  3PEJ A;  2IMO A;  1IJE B;  1U8W A;  4F7V A;  2IVY A;  2M4M A;  4DUZ F;  1A7G E;  3BDF A;  4RZR A;  1FXR A;  3VWS A;  2VJU A;  1EHW A;  1KC8 T;  1N5Y A;  3HFZ B;  2XRG A;  2R8I A;  2H65 B;  1J5O A;  5D3G B;  1URN A;  3UE2 A;  4GTW A;  4P73 A;  1HL6 A;  2DT9 A;  2LYV A;  3MFH A;  1Q5Y A;  2QG9 B;  1SJ4 P;  4RW9 B;  1FHT A;  4DF4 A;  2AU0 A;  1CJU A;  2HNZ B;  3IRX A;  4DQI A;  2MMY A;  2B7B B;  3N01 A;  4DV1 J;  1S12 A;  3GP9 A;  5ITH A;  3HPO A;  3OV7 A;  5A0Y B;  4L3K A;  1E6V A;  3DDN A;  2Q43 A;  1S1U B;  4KV8 B;  4MIW A;  1RXO B;  2ACM A;  3ED4 A;  2L9W A;  2QMU B;  1OIA A;  2HFS A;  2ANH A;  2KI2 A;  1PBA A;  4JBC A;  4DU7 A;  3RB4 A;  1IBM F;  3UNG C;  1M1H A;  3BQ2 A;  2FGC A;  3KK2 A;  3DN9 A;  4HDG A;  1S72 S;  3D28 A;  2FVC A;  1NO8 A;  3TI0 A;  3DKD A;  2OPP A;  4X4T A;  1C1B B;  2V6A A;  4KBI A;  1U0H A;  1WG5 A;  2WSF C;  1RB0 A;  4IFY B;  2I1R A;  1ZAW A;  3TUI C;  1TVR B;  1EP4 A;  2ASY A;  4C6A A;  2KM8 C;  4ANE A;  3T1Y J;  1Y6V A;  5G0R A;  4ZVG A;  4EBC A;  2JFD A;  1DTQ B;  4G1P A;  5GAE U;  4MFB B;  5ETL A;  2OD4 A;  3KJQ B;  1XMB A;  2X1B A;  1NPR A;  2HHW A;  5HP1 B;  3DRR B;  3T3F A;  2MJU A;  4OZ2 A;  3M1V B;  2NYI A;  3B8H A;  1I5O B;  3AY0 A;  4NEZ A;  4QQB A;  1NCL A;  3W2W B;  1S57 A;  2YBV A;  4AD6 A;  3CCV S;  3KK3 B;  3N6M A;  2J0S D;  2LQ5 A;  3MMC B;  4JI7 J;  5D8H B;  4WFA Q;  4BS2 A;  5B0A A;  5HMZ A;  3NNC A;  2XYP B;  4ZP7 A;  5K9F A;  2CQC A;  3A4T A;  1OSC A;  4K4T A;  5F8M A;  2YKA A;  2LEP A;  3FK4 A;  2B9X A;  4LFA J;  2IIH A;  4Y2C A;  2XLI A;  3CJR A;  3DRS B;  2GIR A;  1K0V A;  3MR7 A;  3ZNJ 1;  4HKQ A;  2GVD A;  2H5I B;  3KOA A;  1F3V A;  5LXY A;  1R6Y A;  2HVD A;  3G82 A;  4ZLJ A;  2KFZ A;  4ES3 A;  1L3S A;  5I42 A;  1TL7 A;  4EMD A;  2HK3 A;  2BW7 A;  3SDE B;  4X62 J;  4LF7 F;  1U45 A;  3C66 A;  3GYX B;  1CS4 B;  2J0W A;  2H54 B;  4OIX A;  1VC0 A;  4ZCL A;  1RU1 A;  3FDS A;  2OO4 A;  3W5Z A;  3R1H A;  3A13 A;  1VBK A;  3FSY A;  5ETQ A;  1NK6 A;  4K8R A;  2VH7 A;  2MHE A;  3C6U B;  2ZH4 A;  4PXD A;  3EM1 A;  5AXN A;  3U02 A;  3MUM P;  1SC1 B;  4J9V A;  4MIA A;  2UV8 A;  1UWB B;  2DNY A;  4LF6 F;  5J2Q A;  1VS3 A;  1XQI A;  5AXK A;  4R25 A;  5HQM A;  2XGQ A;  4LRA A;  3V81 B;  4F0H A;  2OPS B;  2JFK A;  2GQC A;  1E2S P;  4O23 A;  1HLW A;  1WHV A;  4NZ7 A;  3IG1 A;  3MAA B;  1RAF B;  4ZPB A;  3GLJ A;  1MWQ A;  2I8E A;  1AB8 A;  3BGR B;  1RA6 A;  2GC8 A;  2GO8 A;  2A10 A;  2LXI A;  4PWD A;  4GVB B;  4UOH A;  3OQ2 A;  2QTW A;  4P71 A;  3EX7 B;  1YRU A;  1HW8 A;  2V68 A;  2HRU A;  4ECQ A;  3ENV A;  4FKY A;  5L39 A;  2UXD J;  4IDK B;  1LKZ A;  5T14 A;  1F3F A;  1HNZ F;  2VG7 B;  4BDP A;  1VIO A;  5KFY A;  4DZ6 A;  4LQY A;  3BQ1 A;  1FDN A;  2YWG A;  5JVH Q;  7FD1 A;  2E5J A;  4C11 B;  3G4S S;  2R7T A;  1YZ7 A;  2B4P A;  5IT0 A;  1YSJ A;  1T9X A;  1Z1Z A;  2PN6 A;  3PW4 A;  1S9F A;  4F8R A;  1T9T A;  3PW0 A;  1FE4 A;  2IHR 1;  5KFA A;  4X4N A;  2G0J A;  3VGV A;  1KEK A;  1TL1 A;  1TMM A;  5I3U B;  1VQM S;  2R2T A;  4RWX A;  3ZZY A;  2HUR A;  1NB2 A;  1WG1 A;  2QMW A;  2E5H A;  1E1Z P;  1NHK L;  3M6W A;  4DUZ J;  3KMQ A;  3K58 A;  2WOM A;  2XMM A;  1ZH5 A;  2MB0 B;  2AV5 A;  1GXU A;  3VZH A;  2ABY A;  1HWL A;  4OV1 A;  1RHQ B;  2HVH A;  1EW8 A;  4KJI A;  4MMO A;  2DNN A;  1X5S A;  5F9L A;  3G6X A;  3MD3 A;  5D4P A;  2F40 A;  3RAQ A;  4LF4 F;  4JI3 F;  4LF8 F;  2V94 A;  1HWK A;  1HHQ A;  5IJQ A;  2XNQ A;  3T1A A;  3I56 S;  2D1C A;  3ICL A;  2B51 A;  2LEC A;  1U1N A;  3CF5 Q;  2FY1 A;  3BBF A;  1QAJ A;  4EO8 A;  2OPQ A;  4MKB A;  2ZJQ Q;  4M5M A;  2Q3P A;  1BLU A;  4PWU A;  4CLF A;  5A6P A;  2HIQ A;  3W9I A;  2RUG A;  3UN3 A;  1M5S A;  1DTT A;  2JWN A;  3FRZ A;  3BYP A;  2RVJ A;  2XMW A;  3D0G E;  4JV5 J;  2UUB J;  2VG6 A;  4O3R A;  1HR0 F;  2XI2 A;  3L3C A;  2CJQ A;  4ZLN A;  2VKZ G;  1KQF B;  2RQC A;  4NWX A;  3SV4 A;  1EZZ B;  4GTZ A;  5I3P A;  1LK5 A;  1VQ9 S;  1GMU A;  2HHS A;  2DPI A;  1WC0 A;  1FNX H;  1FXD A;  2X98 A;  1PIE A;  2VA3 A;  3BO4 A;  2A6M A;  3UD3 P;  2ZH5 A;  2LQ9 A;  2ZHO A;  3JSM B;  5G4D A;  4YFU A;  2MY7 A;  1X4G A;  2GVZ B;  4AXJ A;  1KLN A;  1X5O A;  2N4C A;  1EQJ A;  4YY3 F;  4QYR A;  1GTE A;  4PPZ A;  3U1N A;  2RRN A;  3RW6 A;  4LF2 A;  3KUG A;  3BQ0 A;  2MTL A;  5D3G A;  1D9D A;  4A8F A;  3NGT A;  4MYT A;  2ZH9 A;  1XBW A;  3PHE A;  2NCK L;  4RW9 A;  1VQP S;  1X9M A;  2GIF A;  2CVE A;  4MK9 A;  5F8J A;  2HNZ A;  3T5H A;  2UUA F;  3PX0 A;  1Y0H A;  3TR5 A;  2E7V A;  1X9S A;  2JLE A;  5DM7 Q;  3RG6 A;  3QIP B;  4X4R A;  4CIO A;  5A0Y A;  3PJW A;  4Z37 A;  5D0G A;  4LVN P;  2BE7 D;  5FDL B;  1S1U A;  3QWU A;  1WI6 A;  4KV8 A;  5ETT A;  3EZO A;  1N34 J;  2ZOM A;  3DYA B;  1VQ8 S;  3OJU A;  4TLR A;  1NRK A;  4LMZ A;  4R8U B;  1QUV A;  2V50 A;  5K8N A;  2FY8 A;  3JTP A;  5HAN A;  4DUT A;  3N9U C;  1QJH A;  4ETZ A;  4UOC A;  3TEG A;  3WC0 A;  1C1B A;  5GAH I;  2L41 A;  4YP3 A;  4ILM A;  2AZ1 A;  1IBK J;  4IFY A;  3NL0 A;  5HMW A;  1PJ7 A;  5E3C A;  4QPT A;  1TVR A;  3MK0 A;  5BR8 F;  1RT2 B;  2HWH A;  4A8M P;  3G86 A;  1DTQ A;  4ZIT A;  2F8E X;  1ZS6 A;  2AJ0 A;  3ETM A;  5HP1 A;  3DRR A;  1R27 B;  1FCA A;  3MD1 A;  2CQG A;  4Y2A A;  1YHQ S;  3TG0 A;  3M1V A;  1Z2L A;  4ZPA A;  4J9M A;  3Q8V A;  3W2W A;  1TV6 B;  2E9R X;  1NKC A;  3KK3 A;  3MMC A;  3HUL A;  2OML A;  3IO1 A;  3KHL A;  1Q7Y T;  4DSK A;  3I4H X;  2GJ2 A;  4BLG A;  3NCP A;  1FX2 A;  2VBZ A;  1NSQ A;  4TN2 A;  2QL7 B;  3PKY A;  3H90 A;  3RAX A;  4TY8 A;  5H9E K;  2IM2 A;  2XHW A;  3D5M A;  1OPZ A;  2H9Z A;  5D0E A;  4GKJ J;  1ANJ A;  4N56 A;  3DRS A;  3T6B A;  3SFU A;  2X1F A;  3PKM A;  5GRR A;  4YEA A;  1AJD A;  5E3P A;  5E2Q A;  2AJ1 A;  3U27 A;  1PYT A;  5DM6 Q;  3GG0 A;  1HNZ J;  1R8C A;  2GML A;  1BY9 A;  1H7W A;  4FF3 A;  1U1P A;  3SDE A;  1EKS A;  2FPH X;  1M90 T;  1UEV A;  4A8X A;  5E3Q A;  1FK9 B;  3R2C J;  5A76 A;  4TU7 A;  1M1K T;  1AJA A;  4GC7 A;  2HS0 A;  1CS4 A;  2ZC4 A;  2HW3 A;  4UOO A;  2XMA A;  3GV8 B;  1T94 A;  4TY9 A;  4B56 A;  1NH7 A;  2B3T B;  1WAC A;  1SJ1 A;  3MM5 A;  1BE4 A;  2Z2L A;  2MDA A;  1T9W A;  2UZA A;  2AGO A;  1UWB A;  5ETO A;  2ZWP A;  1KH5 A;  4ICL B;  3ZFV A;  2HFU A;  1XR7 A;  3W61 A;  4DV6 J;  3HHL C;  1IWG A;  2OPS A;  3TNV A;  2YNH B;  3MAA A;  3QT8 A;  3M8W A;  4OHX A;  3CJ0 A;  1NK4 A;  3CDE A;  2LDI A;  4AYB D;  4ECZ A;  2DNH A;  2ZOF A;  3BGR A;  3CTR A;  1QM9 A;  4Q7A A;  4CQ1 A;  3ZZO A;  4DBQ A;  1U09 A;  3OFG A;  2QGF B;  1RWM B;  1XJW B;  1Q0N A;  3Q24 A;  2J6U A;  1RDR A;  1T05 B;  4BWM A;  1CQN A;  4GVB A;  4HLB A;  4DX7 A;  1JLA B;  2YQ3 A;  1WC6 A;  4IDK A;  2WAQ D;  4DV7 J;  3T5K A;  3B78 A;  2D7S A;  4ES2 A;  1KTQ A;  2VG7 A;  2DGQ A;  5KFT A;  4PWW A;  3QZ8 A;  2M8D B;  2POK A;  5I4M A;  4I4B A;  4BWJ A;  1HI0 P;  4TYA A;  4C11 A;  2IBK A;  4J9U E;  2KVQ E;  4P9S A;  2WW4 A;  1P9Y A;  3TX0 A;  4TLQ A;  2F7V A;  1VDH A;  3CCJ S;  2WHO A;  3QNW B;  2JVO A;  3MF5 A;  2BAC A;  4DR7 F;  2PD1 A;  3UVJ B;  2FC8 A;  2XNR A;  1FFW B;  3D6F B;  2A0F B;  4B3M J;  1PJ5 A;  5L38 A;  3HDS A;  5I3U A;  1AFJ A;  4KE5 A;  2DGS A;  1YRX A;  2DK2 A;  2IMW P;  3MOJ B;  1KHK A;  2AWZ A;  5KFD A;  4TQS A;  3R9L A;  3GSD A;  2R7V A;  4OZL A;  3PIP Q;  4RUH A;  2CQD A;  3O3L A;  1W2I A;  4OI1 A;  3SBM A;  1X4A A;  1DLO B;  1KOO A;  1F1B B;  1UCN A;  2YX7 A;  4FS2 A;  4I6Y A;  1GX6 A;  4K4S A;  2BYC A;  4RUB A;  3TJ8 A;  3TX8 A;  4FKX A;  1LWF B;  4B3T J;  8RUC A;  2XZD B;  1HPZ B;  5E41 A;  1WOP A;  3G6V A;  1GT8 A;  2Y9H A;  2KT3 A;  2ZWO A;  1YKW A;  3WX8 A;  4WKR A;  4F4A A;  2MZT A;  3KG0 A;  4NYP A;  3EIC A;  3EZU A;  3DRX A;  1RAA B;  2KRB A;  4U9R A;  4WII A;  1SBR A;  4DSE A;  4JI8 F;  1B70 B;  4DL2 A;  3B5Q A;  1VQ5 S;  1QTN B;  4C98 A;  2NSB A;  4PR6 A;  3MEE B;  5EX0 A;  5L1L A;  5LSR A;  4P7T A;  4X65 J;  3L09 A;  2QFI A;  2XM3 A;  2HYI B;  3KLE B;  4IR9 A;  2IA6 A;  1L3U A;  2UV8 G;  3Q8R B;  2B6A B;  2JEJ A;  2UXB F;  2W8D A;  3F0N A;  1QUP A;  2X7I A;  2CFX A;  4J90 A;  2A18 A;  1PG5 B;  4X4S A;  2GSU A;  3NLC A;  5IM0 B;  3JSM A;  2GQQ A;  1RTZ A;  2B8P A;  4WCE Q;  1NJI T;  2GVZ A;  2HHP A;  4QYZ J;  1VQK S;  4HI2 A;  1IKX B;  2CDQ A;  1S1V B;  3FUY A;  4M94 A;  5IT9 U;  2C22 A;  3QAE A;  5L0K A;  4K5R A;  3Q8P B;  4NL5 A;  3GQC A;  5IOL A;  1IKW B;  4DQS A;  1JIH A;  1X31 C;  1PCA A;  1DBD A;  2YKP A;  1PYO B;  2LQ8 A;  1KVI A;  2KU7 A;  1TAQ A;  4KB7 A;  1I6J A;  1KLM B;  4CLW A;  4EGL A;  3KWM A;  4ETX A;  1T03 B;  2NXJ A;  2XYH B;  4LFB F;  2ZBC A;  2OTL S;  4F4X A;  2EWH A;  1T3N A;  3QIP A;  2B5J B;  4RU9 A;  3IS9 B;  4NAS A;  4ED0 A;  3CDW A;  5FDL A;  3I5B A;  1SI9 A;  1R8A A;  2IDE A;  3QPI A;  5DS7 A;  4A8Q A;  5H9E J;  4YR0 A;  3R27 A;  4G65 A;  1B3T A;  2CPZ A;  5AJ9 A;  4V19 X;  3B82 A;  1NLK L;  1HWI A;  3DYA A;  3FCH A;  4C97 A;  4NLV A;  4I6A A;  2AYB A;  2W9B B;  2QFJ A;  1SL1 A;  4HVZ A;  3CD0 A;  4R8U A;  2CZ9 A;  4P7V A;  4GRS A;  1TQL A;  1UP1 A;  2HGL A;  1NU4 A;  2VOD A;  1HJK A;  3BV8 A;  2W5V A;  5JXS A;  2DHX A;  2K8G A;  1FVQ A;  2ZBR A;  1WF2 A;  1EKR A;  3FBC A;  4NML A;  2N7C A;  4ZVP B;  3J7A N;  2RHQ B;  2AX1 A;  2GS8 A;  3GYG A;  4J9R A;  4I67 A;  1X0F A;  3JAM U;  4FXV A;  4ECT A;  1RT2 A;  5IQ6 A;  1U6B A;  2JC1 A;  2UXC J;  3J81 Y;  2QRR A;  3TVY A;  2QIF A;  2RML A;  1FKO B;  2Z30 B;  4F50 A;  2HWI A;  3DLJ A;  1RCX B;  1XNR F;  1SH0 A;  2G2O A;  5IV4 A;  1HQA A;  1MG7 A;  4ELT A;  1PC4 A;  2D3U A;  4YB7 A;  4Q8F A;  3M6X A;  1RTD B;  3LGM A;  4XPC A;  3MCM A;  1TV6 A;  2AT1 B;  2Z58 B;  2MPU A;  2W5R A;  3OFE A;  3JTN A;  4DXL A;  3BBB A;  2MST A;  4I7F A;  4CM2 A;  1IBL J;  2K06 A;  5BYS A;  2Y3Y A;  3GV5 B;  1G7C B;  3R5B A;  2CIM A;  3ZZU A;  1UL3 A;  1IQT A;  3R5D A;  1NME B;  3GU0 A;  1EAY C;  2VJV A;  2J9C A;  2C2M B;  1JLG B;  2HHH F;  3IR6 B;  2K1R B;  5EUH A;  1NSK L;  4O4G B;  1KTV A;  3C2P A;  2DB1 A;  4LR7 A;  3BBC A;  4FYW B;  3ISN D;  2IM0 A;  3FZ2 A;  2LA6 A;  1Q5V A;  2AIR B;  4IRK A;  3GJS B;  1K9M T;  1XNQ J;  2DIS A;  3ONQ A;  3GJT B;  5KFW A;  2B9W A;  4RW6 B;  1FK9 A;  1KOH A;  3MPY A;  2RKI B;  1O99 A;  3SXL A;  4RO0 A;  1UTA A;  1IM6 A;  3V5R A;  4AT1 B;  2EG1 A;  2Z57 B;  1S9G B;  1NUE A;  1QY7 A;  4DOZ A;  4IO9 Q;  2HAF A;  1HBN B;  3O5T B;  1NDK A;  5LJ5 Y;  2GIQ A;  2QO3 A;  2BKO A;  5B0E A;  2R8G A;  2NXC A;  2BUN A;  2FC9 A;  3EJM A;  3M8Z A;  4QR0 A;  3S7R A;  5ETV A;  3CIZ A;  4UQT A;  3UNY A;  3IR5 B;  4RNF A;  2UUT A;  3RBX A;  1HNV B;  3MOZ A;  3E01 A;  4X4O A;  3DLE B;  2ZNY A;  4ICL A;  4NCG B;  1M0S A;  3FCW A;  3QID A;  3TA0 A;  1IR2 A;  4NRU A;  1VGY A;  1N32 F;  4DV0 J;  1JJC B;  3W9H A;  3OTO J;  2VON A;  1NEE A;  4LT6 A;  2YNH A;  4ZN3 A;  1U48 A;  4CLL A;  2FGO A;  2DY1 A;  4FPI A;  2V4Q A;  2RNE A;  2GAH C;  1YJR A;  4RW4 B;  4RNH A;  4IOB A;  4YB1 P;  2FZC B;  4A46 A;  3WDO A;  3NG8 A;  2XMJ A;  2W24 A;  1T05 A;  1N6Q B;  1VQL S;  2W2Q P;  1WF0 A;  1JLA A;  2M9K A;  3JAM Y;  4K7Q A;  2MLY A;  2V9K A;  3TVZ A;  5D78 A;  3TP2 A;  1JLQ B;  2O67 A;  5DLF A;  1HNX F;  4DL5 A;  3VAF A;  5CQG A;  3A1Y G;  2V0N A;  3CC4 S;  3QSY B;  5GMD A;  5KG4 A;  1RAE B;  4QIF A;  1VJW A;  3RRG A;  5F3Z A;  4ZJO A;  1SJQ A;  1FTC A;  2BQ3 A;  4C8O A;  2E1R A;  3UVJ A;  1NJY A;  5DQI A;  1XC9 A;  5J2P B;  4OX9 F;  4WXW A;  3R8Y A;  3RU0 A;  4PYD A;  1EI6 A;  1UVN A;  1U1Q A;  1Q16 B;  4X4P A;  5B09 A;  1NXI A;  1OMS A;  4LR9 A;  2R8K A;  4RPF A;  5KFZ A;  1FRH A;  3BF4 A;  1NND A;  1FRM A;  4JYA F;  3HSZ A;  4PAB A;  1RAD B;  3MDF A;  1DLO A;  1WKL A;  3L95 X;  4BC7 A;  5KT2 A;  5LMN J;  1S77 D;  1GTH A;  2HHU A;  1NJW A;  2KT5 A;  1NK7 A;  3D67 A;  4F04 B;  4FDI A;  4LFC J;  6AT1 B;  2LVW A;  1LWF A;  4FXD A;  1R8P A;  1HPZ A;  2XC9 A;  4C7Q A;  4FNH A;  4MKY A;  2LXF A;  3NOG A;  2JHE A;  3DOK B;  4YN3 B;  3Q0A A;  4A8Y A;  4DV5 F;  2HHV A;  1D9A A;  2JLF A;  1Q8K A;  1TFY A;  4XPE A;  4FF1 A;  1K7H A;  5FD1 A;  1F5A A;  4HEA 9;  1FRJ A;  1GNK A;  5LQQ A;  4UY8 T;  1M1G A;  2AJ4 A;  2VKR A;  3MEE A;  3TO8 A;  3AA8 A;  1BQX A;  5F41 A;  2D41 A;  3KLE A;  1B99 A;  1U4B A;  5DQH A;  5CYM A;  1HNW J;  1KVJ A;  1Y5L B;  4HHH A;  2PMZ D;  2B6A A;  3KLG B;  4O3S A;  4K4U A;  4FDJ A;  3NGD A;  2HWT A;  5IM0 A;  3VAI A;  5MLC V;  5B7W A;  3EDQ B;  1IKX A;  4H54 A;  2DR6 A;  1S1V A;  3HKW A;  2JEI A;  2QC3 A;  3UDC A;  3HJV A;  4NLW A;  5C42 B;  2ROP A;  4OHZ A;  1XMO J;  1FJC A;  2HLT A;  1MMD A;  5KFB A;  3NBP A;  7AT1 B;  2VOO A;  2AEM A;  5CZV A;  5KG6 A;  1XNR J;  5AJ3 J;  1IKW A;  2YX1 A;  4UT4 A;  3MM6 B;  3FSI A;  3RB0 A;  1URR A;  1B7Y B;  1OJ4 A;  3KHH A;  4HH0 A;  3RRH A;  1M5H A;  2G1D A;  1KLM A;  4CO1 A;  1T03 A;  1V9O A;  4Z7Y A;  3WAV A;  3T1H J;  1ELX A;  4P74 A;  3H98 A;  5E5N A;  5IS2 A;  2GAG C;  3CD5 A;  1Y5N B;  2EBG A;  4NLO A;  1P1T A;  2B5J A;  4KGK A;  3IS9 A;  1FVS A;  1UKU A;  2FTR A;  2B4U A;  1YJV A;  3N6L A;  2GA3 A;  2V8P A;  1VK3 A;  3DU6 A;  4KY3 A;  1TEL A;  2DNO A;  3GR1 A;  2R4F A;  9RUB A;  3H4D A;  4M5D B;  4F26 A;  1RWU A;  2CNO B;  2V8H A;  3QLH B;  4PPD A;  1FA0 A;  2BJ9 A;  3TZY A;  2C3U A;  1UVM A;  4Q45 A;  5KFL A;  2IYG A;  1FJG J;  4DV3 J;  2W9B A;  2HQF A;  2MZJ A;  2V2V A;  2WTF A;  4U95 A;  2W25 A;  4HR2 A;  2GO9 A;  3LP0 B;  2JJ4 D;  3J7Z 5;  3SCI E;  1VQ6 S;  3K59 A;  4ECS A;  2ZVI A;  2OEJ A;  1B0V A;  2MEW A;  4CM0 A;  5EWG A;  5ETK A;  3W7B A;  2HVI A;  5F8N A;  4ECR A;  3UD4 P;  2W8L A;  4CLT A;  5L0E A;  4ZG6 A;  1F9H A;  1FKO A;  2BKN A;  3BR8 A;  3T19 A;  1AJB A;  4JI6 J;  4ZPT R;  3LAL A;  5D77 A;  4LQ9 A;  3CMR A;  2XQC A;  1S0M A;  1TUW A;  4CXK A;  2QLB B;  2M5Y A;  3DYC A;  1HI8 A;  1RTD A;  2E66 A;  3K5O A;  4UTG A;  4KAY A;  2VBW A;  2HK2 A;  1FKP B;  5GVQ A;  2J9D E;  2ALY B;  3RZA A;  3VAM A;  2ASL A;  3NKM A;  2XSJ B;  1QDU B;  2X51 A;  3G87 A;  2AQ4 A;  5BJR A;  5F0U A;  1SL0 A;  4RNM A;  3CJQ A;  3H5Y A;  3K2Y A;  4DR1 F;  3NCR A;  4DN0 A;  2FHJ A;  4L72 B;  2W5S A;  5B0C A;  2G2Y A;  4OI2 A;  3RGI A;  2RQ4 A;  3LPY A;  2PMW A;  2DNQ A;  4X4U A;  4B3S J;  2F63 A;  3QGI A;  1JLG A;  4F4K A;  2K1R A;  4DSJ A;  4O4G A;  2Z4P A;  2QLW A;  3A8K A;  2C2K B;  5IC6 B;  2OFH X;  2I5J B;  1N8R T;  4CRJ A;  3EPG A;  2R2U A;  1AUD A;  1W7W A;  2MZR A;  2KJW A;  2OPR B;  4RW6 A;  1IM4 A;  4ZPW R;  1E33 P;  2RKI A;  1VOM A;  4B3R J;  4LF9 J;  4DV4 F;  2GLQ A;  1S9G A;  2O01 C;  4WE1 B;  5FLX U;  1IQZ A;  2Y0S D;  1RK8 A;  2V8D A;  2XLK A;  3I0S B;  2MQ8 A;  1HBN A;  1RLC L;  4LF5 J;  3CO0 P;  3GWC A;  3D2W A;  5KTQ A;  1S49 A;  1X7V A;  3ZTR A;  1IKV B;  1GMW A;  4K5S A;  3MMB B;  3CD7 A;  3Q8Q B;  1HNV A;  3UO0 A;  3DLE A;  4EI2 A;  1WSV A;  4NCG A;  3SEO A;  1WC3 A;  2DXE A;  3AH6 A;  3U1L A;  2QN6 B;  1TK8 A;  3CMQ A;  3P6Y C;  3D66 A;  3EGZ A;  1VJQ A;  1RHK B;  3EGV A;  3JS9 A;  3ZZP A;  3ZTQ A;  3LH2 S;  1HI1 A;  4HL9 A;  2FUG 9;  3EE3 A;  3MCO A;  1YJN S;  4RW4 A;  1HIY A;  2DCL A;  3DDK A;  4DR5 J;  2C2D A;  5CD4 A;  2D9P A;  4DV5 J;  1Y7A A;  5B0B A;  1N6Q A;  1G2E A;  2WVB A;  5IJS A;  3L7U A;  1Q86 T;  2W1B A;  3CVK A;  3PR5 B;  2MKI A;  5CYJ A;  2W2P P;  3BSA A;  4K59 A;  5L9N A;  2GMJ A;  3J81 j;  4QR1 A;  2DJW A;  2O3D A;  2FZK B;  1JLQ A;  4ID5 B;  4QWA A;  1E3C P;  1X60 A;  4IQM A;  4WFX A;  5KOW A;  2Y1R I;  1S4E A;  3Q86 A;  3OL7 A;  2MZQ A;  3Q8Y A;  5J1P A;  1RBO B;  1BC6 A;  5KFO A;  2OHD A;  4N47 A;  4Y2M A;  3R7N B;  1CLF A;  3C46 A;  1S6Q B;  2F4V F;  2EPI A;  5J2P A;  3FRY A;  1KR4 A;  3T41 A;  1Q95 G;  1AA1 B;  1S1X B;  3IM8 A;  3HHE A;  2NXU A;  3HM9 A;  1ZPV A;  2VAS A;  2ZDO A;  2RD5 C;  1NK5 A;  2CJ9 A;  4B9L A;  4CO5 A;  3PY8 A;  1YJ7 A;  3M8S A;  4Z7C A;  1OO0 B;  1QE1 A;  4CLZ A;  2RSQ A;  3TJA A;  3D3C J;  1H72 C;  2EK1 A;  1ZTW A;  2GZO A;  2C1E B;  4YUD A;  4K0K F;  2WBM A;  5DRK A;  2X3G A;  4WK3 A;  1N0V C;  1PKU A;  4DR3 J;  4IOA Q;  3NY0 A;  1RLD A;  2ZOG A;  2YWK A;  1R7I A;  3DOK A;  3MCN A;  2UVW A;  1PBU A;  3EZ5 A;  3WX4 A;  3BPS P;  3ISZ A;  5FLX Y;  2VC1 A;  1T02 A;  1F2G A;  3LXQ A;  1CEZ A;  2NSC A;  4AQY J;  1OQ3 A;  2G9O A;  2J9E A;  2YWW A;  1JLC B;  3I5A A;  2C3M A;  3PX6 A;  4Y65 A;  2V5H G;  2OFG X;  3QBC A;  4CLS A;  4I0W A;  2DHG A;  2JEF A;  3KK1 B;  2RIJ A;  2CPI A;  2F3J A;  2B4V A;  2OEL A;  3AA9 A;  3BR9 A;  3AB4 B;  2HBY B;  2K7K A;  3KLG A;  2ZD1 B;  2QMX A;  2PEH A;  3UN2 A;  3NVL A;  2EFG A;  4B9S A;  1XR5 A;  5L1K A;  2BMB A;  2HEK A;  1FD2 A;  4G1Q B;  4MKA A;  3P5T L;  4E98 A;  1ALK A;  4R0E A;  1RWN B;  4WP3 A;  4LRC A;  5C42 A;  5H1S V;  3GE9 A;  2DGW A;  4J9Q A;  3H42 A;  4GVL A;  3GON A;  1ED8 A;  2HQD A;  3HHL A;  5DG8 A;  5C66 A;  4H4K A;  4DQP A;  1CBK A;  1U24 A;  1S0N A;  4YR1 A;  1MSW D;  3IP0 A;  4FS1 A;  3MM8 B;  4XDD A;  3NNA A;  4K2J A;  1LXN A;  4CZC A;  1DQ8 A;  4LIW A;  5HMY A;  3OHA A;  4OZN A;  1N33 F;  1WWH A;  4URS A;  2O66 A;  2D69 A;  3NWR A;  2HZC A;  1SB6 A;  4M5D A;  3RBE A;  1T3O A;  2HGN A;  3QLH A;  3UD5 A;  3H25 A;  5C2G A;  3M2R A;  3UN5 A;  3MK1 A;  3HHK A;  4HAC B;  4PG8 A;  1C0T A;  1R43 A;  1AJC A;  1NBE B;  2AGP A;  2J5A A;  3TQ1 A;  1LWX A;  2RE1 A;  2F5G A;  1FXL A;  4DPY A;  4ZVF A;  3LP0 A;  4NRT A;  4A4J A;  3O8W A;  2E5I A;  5GOV A;  2HBR B;  1NKB A;  3EVM A;  5DLV A;  3BDP A;  4DUY J;  4U8V A;  3NKN A;  1N4L A;  5DET A;  1JWW A;  3N6N A;  4U7C A;  2KYZ A;  1S0V A;  5A2Q Y;  1ZM3 A;  2BDP A;  4Y2K A;  5KFM A;  3BDG B;  4CTA B;  1U2C A;  4DX6 A;  4OI0 A;  3SCJ E;  4CH7 A;  4HI1 A;  1WKK A;  4J5O A;  2SXL A;  2K3K A;  4GTX A;  1BHN A;  2CPY A;  1RT3 B;  2IM3 A;  4DV1 F;  2XZT B;  1FKP A;  3A8E A;  4YR3 A;  2GSO A;  1Q81 T;  1JX4 A;  2C2O B;  3B54 A;  2FVP A;  5LT5 A;  2XSJ A;  5HVF A;  4ZN1 A;  2CG8 A;  3IWL A;  5KFC A;  3T01 A;  4PQU B;  1KD1 T;  4CLK A;  2A6O A;  1Y5I B;  2YVS A;  4ZVS B;  4JI4 J;  1IXK A;  2FJV A;  2AW0 A;  4ZVT B;  2HFV A;  3IMQ J;  2ZH6 A;  4YHH J;  1F5B A;  1KQS R;  2D74 B;  4PCQ A;  2O1P A;  1W2B R;  3F44 A;  3OTC A;  1PC5 A;  3RUB L;  3QZ7 A;  1TK5 A;  1UFW A;  1D3W A;  4WU2 A;  5DG9 A;  4ERD A;  4NLD A;  2R2R A;  2YX4 A;  1RT4 B;  5F8I A;  1VCT A;  2I5J A;  2G9Y A;  3SZ2 A;  2CPE A;  3ISN C;  1EIY B;  4UF4 A;  4UPL A;  2WRM A;  1T0T V;  2CA9 A;  2OPR A;  2Q6B A;  1S6P B;  5A8W B;  3ILL A;  2AX0 A;  4G6V B;  3KYL A;  4ENO A;  2MKY A;  4UZC A;  3T1Y F;  3D0I E;  4WE1 A;  1GXT A;  1DFD A;  1Q1K A;  2F65 A;  3ILJ A;  3I0S A;  2F4V J;  3J80 U;  3W64 A;  1S7I A;  3GSI A;  4K4V A;  4ZG7 A;  2L08 A;  2NPI A;  3RB6 A;  4FP9 A;  2APO A;  3W62 A;  2DGU A;  2MXY A;  1IKV A;  3MMB A;  5LMU J;  3UDE A;  1OQ6 A;  4USW A;  5EWE A;  2JVR A;  1UMJ A;  5AE1 A;  3MFI A;  2X1A A;  2NPF A;  4JI7 F;  1NKE A;  3OFH A;  3MUV P;  4OHV A;  2IUC B;  4XDC A;  5CCM A;  4UPK A;  1SQG A;  3OBI A;  4LRD A;  4O0N A;  1Q7L B;  3JQM A;  5EN1 A;  3GCW P;  3P3D A;  4WPA A;  4FYY B;  4LFA F;  4FDF A;  4PWD B;  2MKC A;  4UOP A;  3NS5 A;  4J9L A;  1K47 A;  1Y3J A;  4QWC A;  1FD8 A;  5L1J A;  5SZT A;  1VRT B;  1HBO B;  1YLX A;  2FJD B;  3SI8 A;  3KTQ A;  1RZM A;  3N79 A;  1UA1 A;  3MZI A;  4DR2 J;  4TNO A;  4X62 F;  1U47 A;  1VK8 A;  3HLU A;  1RBA A;  4PUO B;  2HHT A;  3KHG A;  4ID5 A;  5DZ7 A;  4WF9 Q;  1VYA A;  5D0R A;  3LWM A;  4WIQ A;  1U1R A;  1FE0 A;  3Q8S B;  1H98 A;  2CQ1 A;  1I94 J;  3DC2 A;  3RR7 A;  1TUV A;  3A3P B;  4B9U A;  3K5P A;  4ELU A;  4U67 Q;  3LAM A;  1T9U A;  3DMJ B;  4X64 J;  5HVG A;  5F0W A;  5T41 A;  2BE2 B;  4QWB A;  1S6Q A;  4IKA A;  4WZQ A;  2XY7 A;  3M05 A;  2DNG A;  4J37 A;  1VRU B;  3I55 S;  5KFU A;  1M5P C;  2ZJP Q;  1Y9O A;  4OX7 A;  1ZEF A;  1MW7 A;  3AOA A;  2Y8W A;  2NR0 A;  1K73 T;  1HYS B;  3FBB A;  4DSI A;  1AUK A;  1JLF B;  1RJJ A;  1REV B;  2FVS A;  4ANC A;  3Q22 A;  2W2N P;  4M5N A;  2L48 A;  2FJX A;  4BHQ A;  2OMO A;  3HO1 A;  2YPY A;  4OHW A;  3FEX B;  4NLG A;  2ZUA A;  4OI3 A;  3BS9 A;  5L8R C;  1S9E B;  2UXD F;  1LW2 B;  2QA4 G;  2ZHA A;  1Q8B A;  4ED8 A;  3CJT A;  4KAI A;  3US5 A;  3M4X A;  4ECY A;  3RW7 A;  2GMH A;  4I6W A;  3J80 Y;  3EVO A;  1OYE A;  2ZJR Q;  3TZZ A;  1RBL A;  1G6B A;  3UQS A;  4QU6 A;  2J76 E;  1R6V A;  3DRY A;  2WB1 D;  2Y0B B;  1JLC A;  1NSA A;  2KB2 A;  1A0O B;  3AJD A;  4OX6 A;  1FI4 A;  1JJ4 A;  4M1K A;  4RR5 A;  2PFF B;  4CYR A;  4JB8 B;  4JI1 J;  3PYD A;  3BRE A;  1RT1 B;  1DY3 A;  4KAV A;  2QA1 A;  3KK1 A;  1U6F A;  3K57 A;  4P10 A;  2BR0 A;  2R7R A;  4ER8 A;  4YDX A;  4E8U A;  1NZ8 A;  3UI3 A;  2ZH8 A;  4O4R A;  3CC2 S;  2WB4 A;  4G1Q A;  1U1K A;  1S6O A;  2QJ3 A;  2RQK A;  4DX8 H;  3L7P A;  2QLX A;  5FII A;  1ZM2 A;  1YX2 A;  3PYF A;  5LOQ A;  5AE2 A;  3DOM B;  2LXU A;  3WBZ A;  2EEY A;  2KXN B;  4DF8 A;  4AND A;  2XZW A;  4ZVQ B;  2VDI A;  3UFC X;  1ED9 A;  3DU5 A;  4ECV A;  1UEU A;  1LWE B;  4O3N A;  4LR2 A;  4YOE A;  1RTI B;  1ZEB A;  4IQX A;  3IR7 B;  4GTY A;  4RWW A;  1U2R A;  2QZ8 A;  1UWA A;  3QT6 A;  1RYS A;  4ZMM A;  1EW2 A;  3CE8 A;  3MM8 A;  3R5G A;  1UW4 A;  2GJI A;  3IA0 A;  3W8P A;  2W4P A;  3I31 A;  1X4D A;  3Q89 A;  4JV5 F;  2UUB F;  2AJQ A;  2ROE A;  3ZZR A;  3IGZ B;  1X4H A;  2CQI A;  2MKJ A;  4AE5 A;  1BD6 A;  1AXQ A;  4TYB A;  2V2Z A;  2QLJ B;  2KKH A;  5L46 A;  5D0H A;  3K5M A;  1S10 A;  4DCJ B;  4HAC A;  3I87 A;  4NLS A;  2R42 A;  4DG1 B;  1F9E B;  1YQH A;  4ITS A;  1WJ9 A;  4ED3 A;  4IYQ A;  2CYY A;  4KC5 A;  5CZX A;  2KTQ A;  2NXN A;  4RBT A;  3OLB A;  5GAE I;  3NOC A;  4FBT A;  2G4B A;  1S5Z A;  2KFY A;  2XI3 A;  4TU9 A;  2VV5 A;  1QVF R;  5DDP C;  2OAU A;  2ZBP A;  3WAX A;  3E2D A;  1KKH A;  4O3P A;  3MR2 A;  2WBR A;  3X1L B;  2EFN A;  2FLN A;  4H4M B;  4EFA C;  3NP5 A;  5DQG A;  4B9T A;  3BDG A;  1WDD A;  1HBM B;  3NKQ A;  5KXA A;  2XCP A;  4CTA A;  2QA2 A;  2Q79 A;  1X4E A;  1X5P A;  4PEO A;  2DR7 A;  2YKM A;  3THT A;  5JVG Q;  3NGU A;  1C2P A;  2OP5 A;  3VGS A;  4DQR A;  2B9Y A;  3WC2 A;  2JOQ A;  3E51 A;  1RT3 A;  1RAI B;  3E8O A;  4FYD A;  1SKS A;  1YK9 A;  3CT9 A;  1BUX A;  3WAW A;  3LGH A;  3TUJ C;  4TY8 B;  5HVH A;  2BA9 A;  3THP A;  2WSE C;  3ITH A;  3CCS S;  3UW1 A;  5HLF B;  4PQU A;  2RRB A;  1UAW A;  4OYM A;  2VU5 A;  5K8M A;  4V1A k;  3CDU A;  3BGL A;  1N36 J;  1N34 F;  3LAK A;  3BDE A;  3NKO A;  2C3P A;  3EXC X;  3BM7 A;  2X1G A;  3QJJ A;  3A8I A;  1WEL A;  4P2M A;  4F0M A;  2HMI B;  3C6T B;  2OUG A;  3W63 A;  1KHL A;  3D1Q A;  5IXU A;  1Q53 A;  3HKZ D;  3TWZ A;  1LW0 B;  1RT4 A;  4QIE A;  2CKW A;  4YB5 A;  1ZOT A;  4WBF A;  1XTZ A;  4NXM J;  4ECW A;  1VQO S;  5GAG U;  4HDH A;  2VZ9 A;  1IBK F;  2P6T A;  3OLA A;  2PGC A;  1TKT B;  1S6P A;  5A8W A;  1JXE A;  1VBZ A;  2YTC A;  3OTD A;  4ATN A;  3FZB A;  4KTQ A;  3VHQ A;  3HSG A;  1Q79 A;  3MM5 B;  4IG3 B;  3NGS A;  1Z4U A;  1B4S A;  1HQU B;  2Q66 A;  2QEX S;  2CPH A;  3PO4 A;  2MJN A;  3WZ0 A;  3IBF B;  3SZY A;  2JH3 A;  3DNC A;  4AL6 A;  3C15 B;  1ZA2 B;  3TAQ A;  3JXO A;  5EDW A;  2PEB A;  4WYL A;  3OXL A;  4ZHR B;  2W7A A;  2AEF A;  2IUC A;  4CCH A;  2E5G A;  2ZEJ A;  4M5H A;  2M8H A;  1C4A A;  2H4Y B;  1RAG B;  4ZPC A;  1H2V Z;  1WKJ A;  3K0J A;  4GKJ F;  2HS3 A;  5BYR A;  2MHN A;  4QWE A;  1FRK A;  2XHC A;  4D3G A;  1S4F A;  4L74 A;  2NZ4 A;  2NYH A;  1CJK B;  4ED4 A;  3BGU A;  2FIU A;  2RU9 A;  1KQG B;  1VRT A;  3PR4 A;  1HBO A;  4ZVU B;  2DIV A;  4DLG A;  1KQK A;  3DI6 B;  1VQ4 S;  1X8D A;  4PG7 A;  3ZXW A;  1PAU B;  2VBY A;  5THW A;  2W7P A;  4DSF A;  4PUO A;  1FFS B;  3VGT A;  2CQH A;  2KFN A;  4RX6 A;  2LCW A;  2Z2Y B;  4LBP A;  5LL6 d;  2NZC A;  4P2X A;  2WVE A;  4RNN A;  2R8H A;  4MTP A;  4KSE B;  3IGN A;  2CQP A;  1GFW B;  3FEY B;  3R2D J;  2GW8 A;  3DMJ A;  3GR0 A;  1BMQ B;  1RT5 B;  5LSO A;  2LFV A;  2BE2 A;  2VQE J;  4DPT A;  2WZ1 A;  5K5M A;  4Q43 A;  1VRU A;  4LSL B;  1DUR A;  3QRQ A;  3HI9 A;  3T6J A;  1O0P A;  3LP1 B;  3PAC A;  2HFN A;  4DV6 F;  2PFD A;  4CT8 A;  3MI7 X;  2FJE B;  1HYS A;  2AJF E;  4M5G A;  2J6T A;  1JLF A;  2B43 A;  1WEX A;  3MEG B;  1RHJ B;  1REV A;  3KFW X;  2FHJ D;  3P49 B;  3V6J A;  3ZTS A;  3A3O B;  3QO9 B;  1ZBT A;  2JDJ A;  3CJS A;  1S48 A;  5HJY A;  5CXT A;  3EGW B;  3CW2 C;  3IDD A;  3LUY A;  1FO1 A;  4EBE A;  3CD6 S;  3MUR P;  3FQL A;  3G71 S;  1S9E A;  4ZPV R;  1LW2 A;  3HHN B;  4DV7 F;  3ZNU A;  1FNM A;  3I0R B;  5D4L A;  3G96 A;  1EW9 A;  1SC4 B;  4FF2 A;  1RAO A;  1S79 A;  1FFG B;  2CQ4 A;  2D3O R;  2BJ1 A;  2LLZ A;  3MR3 A;  2IM1 A;  1S97 A;  1AUS L;  4IR1 A;  1RT1 A;  2DNL A;  3CCZ A;  2RT3 A;  4CNZ A;  3CJ5 A;  1SKU B;  4NCB A;  2YNF B;  2F8H A;  1GMW D;  4B3M F;  3BDH A;  4WK1 A;  2NQP A;  4PXB A;  2CPD A;  4BCA A;  3BN4 A;  3W9J A;  3I82 A;  1BQN B;  3BB5 A;  2E7W A;  4DS5 A;  4FYV B;  1B7F A;  3DOM A;  2VIC A;  4MT1 A;  1S59 A;  2MZ1 A;  3TJ9 A;  4M8L A;  2I0X A;  3QRP A;  2Y1J A;  3N5B A;  3U1M A;  5CAB A;  5IT4 A;  3I9Z A;  1UZH A;  3CED A;  4NA2 A;  4K4X A;  1O5J A;  1LWE A;  1IKY B;  3QGH A;  1RTI A;  1MNE A;  5ETS A;  4B3T F;  4KM4 A;  1C4C A;  4K4W A;  2J6S A;  4CO2 A;  1S99 A;  4NZ6 A;  2KO1 A;  2P9E A;  2E29 A;  2VQF J;  3QMQ A;  4WU3 A;  3R1L A;  2CAD A;  2R7X A;  4ZVE A;  1JLE B;  2RDI A;  1H7X A;  2WON B;  2YNI B;  1KH4 A;  1QD1 A;  3TA2 A;  2CJB A;  2A3J A;  3GIJ A;  2RDJ A;  2ERR A;  1FWP A;  3CDA A;  2DNM A;  2A2D A;  2HQG A;  3CO9 A;  4KYZ A;  3VVU A;  3MCS A;  4OHY A;  4DFK A;  2UUC J;  4X65 F;  2E44 A;  2VF3 A;  1S6U A;  4X66 J;  4LSZ B;  2W9C B;  3B4M A;  2NUH A;  3HVR A;  4L3N A;  1XR6 A;  4DG1 A;  3DGP B;  5HL7 Q;  2PO4 A;  2HGM A;  1X4F A;  3BGF A;  2B9E A;  1RWX B;  2CNK B;  3OL8 A;  2DKO B;  3QSI A;  4MH8 A;  4RBV A;  2IDL A;  4DI6 A;  2MQL A;  4X4V A;  1U7L A;  5DGB A;  4ZVR B;  3T9N A;  5HRO B;  6FDR A;  4GO5 X;  4IRC A;  4KIA A;  4JI2 F;  1SHN A;  2VOP A;  2CZ4 A;  3HF5 A;  4OZ5 A;  3KHR A;  2KL8 A;  4N41 A;  3CJ4 A;  2K3I A;  3PJ9 A;  4ZS6 A;  4H4M A;  5F8L A;  3UCG A;  2ZHB A;  3TAN A;  1HBM A;  1YRT A;  2PE8 A;  2JLG A;  1URB A;  4IOC Q;  4NLP A;  1NDL A;  2CJY B;  5ETP A;  2MSS A;  7FDR A;  4EYI B;  5K8O A;  2YWH A;  4I7F B;  3B6B A;  1NSP A;  2ZM6 F;  2BJ7 A;  3KUE A;  5EWF A;  2P6S A;  3OVS A;  2BEF A;  4C0O C;  1KSP A;  1UPM B;  4LUB A;  1G4C A;  2KRR A;  5HLF A;  2FD2 A;  1HMV B;  1KH7 A;  4RNO A;  1F6T A;  1YJW S;  3F41 A;  3RYL A;  1AT1 B;  5F8H A;  2EKN A;  3AD7 C;  1TKX B;  5HQ8 A;  2XBP A;  5LSL A;  1DQA A;  1YBU A;  4J91 A;  2R7Q A;  3GFY A;  4DLE A;  4CDI A;  2HMI A;  3CMA S;  3C6T A;  2IA0 A;  4HHU A;  4ZCM A;  5DLG A;  4JUZ A;  1LW0 A;  5L1I A;  4MIB A;  4BC9 A;  3RRK A;  2YKQ A;  4EWT A;  2YH1 A;  1TKT A;  4KHP J;  5C24 B;  3I96 A;  2Y8Y A;  3AOD A;  2V8G A;  3MAQ A;  4ILR A;  5K8P A;  4DL4 A;  4OLO A;  4IG3 A;  5KT4 A;  4C3L A;  2UXC F;  1HQU A;  4ED5 A;  1D8Z A;  1TTH B;  5B08 A;  2VC0 A;  3KLI B;  4EU0 A;  3VZI A;  5IWA J;  1TL5 A;  1CJV B;  3E01 B;  3VTI A;  3V4I B;  1L3T A;  4G3I A;  3C15 A;  4UOG A;  1Y11 A;  2ZC3 A;  4ZG9 A;  1I3O B;  3O2I A;  2Z0G A;  3MM7 A;  3OD2 A;  1H73 A;  4ZHR A;  2CAJ A;  2DD8 S;  3BYR A;  3V4M A;  1RAJ A;  1IBL F;  1DZ5 A;  1SQF A;  3KJV B;  1FDA A;  4N77 A;  4OZJ A;  5F3T A;  3NGR A;  2DR9 A;  1FES A;  3TZW A;  3PRD A;  3QGG A;  2CQ0 A;  4USH A;  2P9C A;  4OZ0 A;  1RCO B;  2HQI A;  5EGY A;  3R5A A;  4EYH B;  4OI4 A;  2CPX A;  4M5J A;  5AXL A;  2GA7 A;  2W2O P;  3GFX A;  4NA3 A;  1CJK A;  1H0H B;  4Y28 C;  4MJK A;  2RDD A;  4ED1 A;  1VQN S;  3JSY A;  3SMZ A;  3BKF A;  1WC4 A;  4EZ6 A;  1UJ6 A;  3DI6 A;  2DXD A;  3RBD A;  3EMT A;  5AE3 A;  3K5N A;  3BEG B;  1MU2 B;  1XNQ F;  1T9V A;  5K20 B;  3DHW C;  4MKV A;  1JB0 C;  4NI2 B;  2UU9 J;  3OHB A;  2XMT A;  1TK0 A;  1WTF A;  5D4N A;  4F67 A;  4FF4 A;  1IWA A;  1AZS B;  3AFG A;  5J1N A;  3Q2T C;  2J8S A;  2HS4 A;  4ZJL A;  4WWS A;  4MAK A;  3CUL A;  2E5L J;  1RT5 A;  2KM8 B;  3GYN A;  4O3O A;  4P75 A;  2LDY A;  2C3Y A;  4ED6 A;  4LSL A;  3I5C A;  1HQ2 A;  3PFE A;  1SC3 B;  5IV3 A;  2C28 A;  1RE1 B;  3M32 B;  3LP1 A;  2D3O 1;  4X4Q A;  2MGZ B;  1AYE A;  2YXL A;  4DX5 A;  4DN9 A;  1TP7 A;  1JXL A;  2O5D A;  3KNA A;  2XMV A;  4DV0 F;  1YJ9 S;  3OTO F;  3AOB A;  4WFN Q;  2XCA A;  3MEG A;  4HT5 A;  3MEC B;  4ZKA A;  1QAY A;  4ALZ A;  1ZAX A;  3QO9 A;  2F4F A;  3K89 A;  2HZA A;  1RU2 A;  4O3Q A;  4KHM A;  2MZS A;  2N7Y A;  4DR4 J;  3M7V A;  2GHP A;  2W5X A;  1Q8I A;  2OI2 A;  2EC0 A;  4WP8 A;  1WEZ A;  4W4M A;  1U49 A;  2E1M C;  5SUH A;  4H4O B;  4CT9 A;  3SFG A;  3PEH A;  1N88 A;  3NEK A;  1GX5 A;  3I0R A;  3OVA A;  3CDB A;  2W2M P;  3BSC A;  3PFO A;  4NYO A;  3GG1 A;  5MAO A;  2ZH2 A;  1RAC B;  1XER A;  1HA1 A;  2BW2 A;  5CYM B;  3DLH A;  4JI0 J;  2AP6 A;  2YNF A;  4ECU A;  5KG2 A;  1R0B G;  1B8J A;  1MWY A;  2CQ3 A;  5E3A A;  2IY5 B;  2W8K A;  2W4C A;  3H2U B;  5IQQ A;  1ZTT A;  4UPH A;  3HZE A;  4HYK A;  3H20 A;  1JQG A;  4CLP A;  2CQB A;  3PVX A;  1R8H A;  1BQN A;  2E9T A;  4JI2 J;  4KPY A;  4WJB A;  4K2X A;  3NBP B;  4L73 A;  3J7Z T;  4DL6 A;  2NRE A;  1NZA A;  1RT7 B;  1NB7 A;  5LMN F;  3S6E A;  4OYO A;  3CXC R;  3FFI B;  4F4Y A;  3LOU A;  1IKY A;  1SJR A;  4EUV A;  2U1A A;  4LFC F;  3L7O A;  1ARO P;  4Y2I A;  2NUU G;  1VMB A;  1KFS A;  4PYA A;  4U7U K;  4LRF A;  4CYU B;  3M8Q B;  1TR0 A;  2ZM6 J;  2BJE A;  4KKO B;  4HTI A;  5KFK A;  1JLE A;  1KN6 A;  2WON A;  2YNI A;  4ZLP A;  3PHT A;  3QRR A;  1RKJ A;  4UPI A;  5HK4 A;  3PNI A;  1FF2 A;  3M2U B;  3E3X A;  2L3M A;  3FGV A;  4RBU A;  1IR0 A;  1GMV A;  1HWJ A;  1LK7 A;  2BQU A;  4KGX B;  5B0F A;  3DOL B;  3TEH B;  3AQO A;  4ZCI A;  1N5Q A;  2W9C A;  3BO2 A;  1HNW F;  4AFF A;  3TAP A;  2VUG A;  3DGP A;  1UVK A;  4USI A;  1XN9 A;  2ZH3 A;  1NHU A;  3MHY A;  3NKY A;  4CO0 A;  4OX8 A;  2MQO A;  2QYG A;  3PYE A;  1YI2 S;  2VFT A;  1BWV A;  1C0U B;  2FHM A;  3S01 A;  3EWG A;  4AUK A;  1WOO A;  3K8W A;  5HRO A;  1SV5 B;  3H7H B;  3MPW A;  4TVA B;  1XWL A;  3NGK A;  1U6Z A;  1XMO F;  3OTB A;  3GCX P;  3T02 A;  5U47 A;  3TW0 A;  5AJ3 F;  1UA0 A;  2HFZ A;  4M5L A;  3PXG a;  3TQE A;  3IAS 9;  1AFI A;  1D0E A;  3MAH A;  1OYD A;  2EFO A;  4C4W A;  2GCF A;  2B8Q A;  4DQQ A;  5ETM A;  4ZVH A;  3CCQ S;  3T1H F;  2PT0 A;  4OFZ A;  5KFJ A;  3GII A;  5C2C A;  1S1T B;  5KFS A;  4XAK A;  3D6M B;  1ALJ A;  2AF6 A;  4WP9 A;  3HD2 A;  4W98 A;  1LXJ A;  1KWM A;  1HMV A;  1BQM B;  3ILO A;  3KMS A;  5E7O B;  5IT9 Y;  1TKX A;  2ATL A;  2BKP A;  1FJG F;  4DV3 F;  1U8S A;  2W01 A;  4F3Q A;  2OTJ S;  4DHV A;  1EET B;  3AD8 C;  1D09 B;  3SQO P;  2AGQ A;  4I68 A;  3ET6 B;  4QAX A;  2H5E A;  1WDT A;  4GO7 X;  3R5C A;  3IC1 A;  2IRU A;  2YWE A;  3HXM A;  3R97 A;  4DPX A;  3SQG B;  4Y34 A;  1MWZ A;  1P8G A;  5C24 A;  3G8T A;  6FD1 A;  3LWL A;  4PQA A;  1IVZ A;  1EJJ A;  3NWG A;  2BM0 A;  3PV8 A;  3DXB A;  2CQ2 A;  1RSC A;  4NYZ A;  4NXN J;  5D15 A;  2P2C B;  3W5X A;  2CWK A;  3KLI A;  2LP4 A;  3V6H A;  4JI6 F;  1V5I B;  2BOP A;  1CJV A;  4B02 A;  3V4I A;  4UZB A;  1N2K A;  3MR6 A;  1DAX A;  3WIU A;  2VFU A;  4OZ1 A;  1KRP A;  4USJ C;  2H51 B;  3KJV A;  3QT7 A;  1SQE A;  1N5T A;  2G1H A;  4Y6I A;  1PGZ A;  4DFJ A;  3QWP A;  2R8J A;  2QA4 S;  3OSN A;  3R3T A;  4ZGA A;  3A12 A;  2QSF A;  1F9F A;  1YZ6 A;  5DLW A;  3MMJ A;  2C3O A;  2V34 A;  4B3S F;  3SZZ A;  3DCA A;  4DPU A;  1EQ0 A;  4CH0 S;  5EGE A;  3Q83 A;  3HCX A;  2FLP A;  1XMQ J;  2QYC A;  4URG A;  4C8K A;  4L6V 3;  1JKH B;  2XO7 A;  1HKA A;  1MU2 A;  2OJ3 A;  3T9Z A;  1U26 A;  3D3B J;  2VPX B;  4NWJ A;  4NI2 A;  2IYI A;  4KH1 B;  1RI7 A;  1RTH B;  4B3R F;  4LF9 F;  4WZM A;  4I64 A;  4FVM A;  2G0I A;  1AZS A;  3HP6 A;  1ACM B;  2FB0 A;  1B0T A;  1JNR B;  2QV6 A;  4RW7 B;  1VQS A;  4LF5 F;  1QAI A;  3R7B B;  4RUC A;  2PA8 D;  5J1E B;  1QSY A;  1URA A;  2FHO B;  3HHD A;  2A1B A;  4DMZ A;  4I2P B;  2XB2 D;  1OY9 A;  4F4Z A;  4KT0 C;  1O8B A;  1SC6 A;  2IVM A;  2DH8 A;  3M32 A;  3LO3 A;  3P4U B;  2KG0 A;  4KH0 B;  2MGZ A;  1QE1 B;  1TFW A;  2XY6 A;  3NXZ A;  4NWB A;  2OIH A;  2EG2 A;  1I1G A;  2M0G B;  4C2M A;  1SPB P;  2BAN B;  1U0S A;  3FBE A;  3MEC A;  4JV1 A;  2GV1 A;  4C9D A;  1HBU B;  1FWK A;  3UR0 A;  3PX4 A;  4DR5 F;  2I9S A;  2DIT A;  3BPD A;  5EGH A;  3ADA C;  2XWX A;  1I51 B;  2DGX A;  2COL A;  3Q2S C;  3X3U A;  5CAA A;  2DXF A;  1WHX A;  3OSP A;  1EB0 A;  1IBM J;  3OR2 B;  1ELO A;  3GIR A;  3GIK A;  5K14 A;  3CCR S;  1X4C A;  4H4O A;  1VBY A;  3KXD A;  3UCU P;  3M6V A;  3N5F A;  1ZET A;  4OL8 A;  2DY9 A;  4NE9 C;  4U6P A;  2YKN B;  2D3Z A;  3CCW A;  5KOX A;  1VR6 A;  1HD0 A;  1YJT A;  4K4Z A;  1NK8 A;  2BE9 B;  5DDO C;  3V6K A;  3NAH A;  5CYQ B;  1O51 A;  5KG3 A;  1CPZ A;  2YKO A;  2JC0 A;  2D1G A;  1RWW B;  1M5O C;  1FNO A;  5HJX A;  2WVF A;  1YJU A;  2H3E B;  1WHW A;  3T00 A;  4ZP6 A;  3TOQ A;  3ENQ A;  2CVI A;  1KON A;  1R3N A;  4PXC A;  4NA1 A;  4USV A;  3CCL S;  4PAA A;  3CGI A;  1VIS A;  3CNQ P;  1FJE B;  4C0B A;  3DFE A;  3DGV A;  3Q23 A;  1QVG R;  1RT7 A;  4CLY A;  4HHJ A;  1HD1 A;  4JV2 A;  3HHL B;  1T7P A;  3QYY A;  3FFI A;  2PMH A;  4DL7 A;  4S0M A;  5KT3 A;  4MIV A;  2MQN A;  4OJG A;  1CC7 A;  4U96 A;  4DR3 F;  2W8S A;  1UJ4 A;  4CYU A;  2EXU A;  1HQE B;  2R9L A;  3M8Q A;  2ROG A;  5KFN A;  4KKO A;  2FYX A;  1R89 A;  1O98 A;  1JK9 B;  2J7U A;  4NLU A;  1UPP A;  4OYP A;  3SSR A;  4AQY F;  2CNL B;  3M2U A;  4LF7 J;  2PII A;  2HNY B;  4YB6 A;  4QR2 A;  4TQR A;  4QYZ K;  2LU2 A;  1FKA F;  1RQ0 A;  3M2R B;  1N5V A;  2BBE A;  2HHX A;  3DOL A;  1C0T B;  1AW0 A;  3D68 A;  1CUL B;  2RH6 A;  3LP2 B;  5K4P A;  3Q8U A;  1XIQ A;  1U1O A;  4J9K A;  3HT0 A;  3FMW A;  5RUB A;  3CJ8 A;  2XR9 A;  3HD1 A;  3GMG A;  3BSO A;  4RLE A;  2IRX A;  2BRK A;  3OR1 B;  1ITP A;  2PA3 A;  5GAH U;  2JRS A;  3WIV A;  4JOU A;  1HW9 A;  2EVZ A;  1FER A;  4MFB A;  3CC7 S;  1C0U A;  5JJB A;  3H5S A;  1H74 A;  5DO2 A;  3NMR A;  2JEG A;  4L75 A;  2ZNZ A;  4LF6 J;  1SV5 A;  3LAN A;  5HO4 A;  3N4W A;  3DLK B;  4XO0 A;  3BGO P;  4FZV A;  4XTT A;  3RB3 A;  3U7J A;  2IAJ B;  2YPZ A;  1NH8 A;  3C19 A;  5CCL A;  9ATC B;  1ELY A;  2W7O A;  2C2E A;  4ZP9 A;  3HVW A;  2AKW B;  3OFF A;  1N48 A;  3DDI A;  1U2F A;  1T8E A;  3IWN C;  2XYG B;  2G13 A;  2GJF A;  3AHP A;  3JSR A;  2R2S A;  2M52 A;  4WTO B;  1ZAV A;  2HBZ B;  3G8S A;  1S1T A;  4ZP8 A;  1P27 B;  3D6T B;  3AXK A;  3N28 A;  3SSS A;  3OL9 A;  2VB6 A;  1DHM A;  2DO4 A;  4J9N A;  1ZM4 A;  1RKI A;  4DR6 F;  1BQM A;  1U02 A;  4Q2M A;  1YTY A;  3KLF B; 
#chains in the Genus database with same CATH homology
 3TG0 A;  3IGY B;  1ANI A;  2XR9 A;  3BDH A;  4LRA A;  5TJ3 A;  2W5T A;  3UO0 A;  4LRF A;  5EGE A;  4B56 A;  4LR7 A;  1E2S P;  4NWX A;  2W5Q A;  4CXS A;  1KHL A;  4GTZ A;  5EGH A;  4CYS A;  1KHN A;  1ED9 A;  4UOR A;  1E1Z P;  3KD8 A;  4KJG A;  5DLT A;  4ZG9 A;  3TWZ A;  3BDF A;  4LR2 A;  1EJJ A;  2W5S A;  1SHQ A;  3WAX A;  3E2D A;  2X98 A;  3Q3Q A;  1KH7 A;  1ALH A;  1ZEB A;  4GTX A;  3TX0 A;  4GTY A;  2XRG A;  4FDI A;  1ELZ A;  4NWJ A;  4UPI A;  4ZG7 A;  4LRE A;  2W5W A;  1EW8 A;  1O99 A;  2GSO A;  4GTW A;  1ZED A;  1FSU A;  4MIV A;  3WBH A;  3B5Q A;  3M8Y A;  3NKR A;  3UN2 A;  3BDG A;  3NVL A;  1KH5 A;  1EW2 A;  3OT9 A;  3IDD A;  2W8S A;  4LRB A;  3NKQ A;  4KJD A;  5KXA A;  1HQA A;  5LIA A;  1B8J A;  5IJQ A;  4LR8 A;  3NKP A;  3T01 A;  1KH9 A;  1EQJ A;  1N2L A;  1ANJ A;  1Y6V A;  3UN5 A;  5LRM A;  1ALJ A;  1N2K A;  1P49 A;  4UPH A;  3MK1 A;  1Y7A A;  1KHK A;  1ALI A;  2W5R A;  3M8W A;  1K7H A;  1O98 A;  1AJC A;  4CYR A;  1ALK A;  5GRR A;  2IUC B;  1ELY A;  5IJS A;  1URA A;  4CXU A;  1AJD A;  2W8D A;  1SHN A;  4KAV A;  5L0E A;  4LRC A;  4KM4 A;  2QZU A;  4UPK A;  3M8Z A;  4ZG6 A;  3IGZ B;  1ZEF A;  5AJ9 A;  5L0B A;  1E33 P;  3WAV A;  1HDH A;  4MY4 A;  4TN0 A;  5HRT A;  4LRD A;  3UNY A;  2GSU A;  1ELX A;  3MK2 A;  3SZY A;  3DPC A;  5LRN A;  5LQQ A;  5INH A;  4LQY A;  3WAW A;  3UN3 A;  5GOV A;  2VQR A;  1AJB A;  2GSN A;  2GLQ A;  1EW9 A;  3MK0 A;  1AUK A;  1ED8 A;  3CMR A;  1EI6 A;  1E3C P;  2D1G A;  5DLV A;  4CXK A;  4UOP A;  3DYC A;  2ZKT A;  3M7V A;  3NKN A;  1URB A;  2W5X A;  1KH4 A;  3ED4 A;  4ZGA A;  5C66 A;  2ANH A;  2GA3 A;  1HJK A;  4KAY A;  2G9Y A;  2RH6 A;  2W5V A;  4YR1 A;  5K4P A;  3WAY A;  2IUC A;  5DLW A;  1AJA A;  4QAX A;  4UPL A;  3T00 A;  5L0K A;  3A52 A;  3NKO A;  4LR9 A;  3NKM A;  2IFY A;  1KHJ A;  3LXQ A;  3BDG B;  4MHX A;  3T02 A;  3SZZ A;  4UOO A;  4N7T A;  4FDJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...