1A5BA

Cryo-crystallography of a true substrate, indole-3-glycerol phosphate, bound to a mutant (alpha d60n) tryptophan synthase alpha2beta2 complex reveals the correct orientation of active site alpha glu 49
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
268
structure length
249
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLANGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-crystallography of a true substrate, indole-3-glycerol phosphate, bound to a mutant (alphaD60N) tryptophan synthase alpha2beta2 complex reveals the correct orientation of active site alphaGlu49.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
molecule keywords TRYPTOPHAN SYNTHASE (ALPHA CHAIN)
total genus 91
structure length 249
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 1998-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1a5bA00
1XFBA 2ZZ4A 1JVNA 5HQEA 3IVSA 1OG0A 1QO2A 3P84A 4LNYA 4O1AA 5IBXA 2HTMA 3BK0A 2QCCA 2P1FA 3DZ1A 4JIPA 4E2DA 4HNNA 1KW1A 3GZ3A 5HNRA 2ZYFA 2A1YA 1WQ5A 4LUIA 1RVGA 4CCCA 2VFIA 1YXCA 3QPYA 2J9XA 3W71A 1KLYA 5DCEA 3W84A 2PE4A 3G0SA 5LNRA 3G8EA 3NQGA 3NQAA 3PSVA 5F1VA 2RFGA 1N7KA 1MEWA 3FA5A 3H53A 3IGXA 4Y90A 1TTPA 1Z48A 2I1OA 1SO4A 3DH7A 3SW6A 1TV5A 4UTMA 3C4UA 4M6PA 3W7EA 5G5IA 5D2XA 3TR2A 2UV8G 1MEIA 3OG3A 3WK2A 1OK6A 4M7TA 3LHVA 5DBUA 2V8ZA 1UASA 1SO3A 2OX1A 3GDTA 1DQXA 1W5MA 1THFD 4AEOA 2C15A 4JDYA 3NDOA 2VELA 3GKFA 1QMLA 3CLMA 5AHFA 2WNZA 3C3NA 1FCUA 4WQ6A 3CQ0A 1LLZA 2RHGA 1RPXA 3TXVA 5KINA 3LV6A 1JUKA 1TMHA 1OHLA 3HGSA 3RNDA 4LTSA 5IBXC 2BZNA 2IQTA 1L6SA 3WJXA 1XL9A 1I2OA 3LHZA 5D33A 4LY8A 1VHCA 3MYPA 4UFKA 1EPXA 3W87A 4BWLC 3L0KA 5BRBA 1TV7A 1YDOA 3BPWA 1JQVA 4XWUA 3WK3A 2A21A 3G3MA 4JEQA 2QR6A 5LGXA 4UCGA 2ZZ3A 4W9TA 3QYQA 2E6FA 3TV8A 2YDAA 3LCWA 2V5LA 3STFA 1L2UA 4UXDA 1DVJA 2WSRA 4IXXA 2H90A 1VR6A 4AWUA 1H7WA 1TPVA 2V9DA 1QR7A 3UY7A 3LLDA 1R2SA 1B57A 4NVTA 2QJHA 3G1YA 3KXQA 2A5HA 2GVLA 1M5WA 5EY5A 3CT7A 3HF3A 5FF3A 3QMTA 3S6DA 2DZVA 3GVGA 4CCEA 3UXAA 3STGA 5CZTA 5F2IA 2YFOA 4QNEA 2FIQA 4LOCA 2ZRYA 4O4VA 3W1PA 3KRSA 2B7NA 2J88A 3BVJA 4HNUA 4TU1A 3OVQA 1OFQA 4OE7A 1T99A 3W76A 4UTWA 1BWKA 3GDRA 3S5NA 4UFLA 1JCMP 1A53A 4XBKA 1JR1A 4MY8A 1R2TA 1FXQA 3LCGA 3GB6A 3M1ZA 2ZRUA 3LRKA 3OA3A 4IQLA 3BW4A 4AF0A 1BEUA 2EHHA 2GVJA 3HPZA 3B4UA 5CKSA 2CLIA 3UD6A 1LBMA 2HS8A 4PA8A 4LVFA 2B7QA 1H1YA 3AJXA 3BARA 3W83A 1BKSA 2NV1A 5FEPA 3SY5A 1W3NA 3P61A 3TSMA 1QPQA 2F7FA 2W79A 4MOZA 3ZS4A 5KZEA 3PM6A 3MP3A 3DENA 5KZDA 2CLKA 5DCDA 2HS6A 1OFPA 2ALDA 3EWBX 3USBA 4DF0A 4Y6GA 4O54A 4BI6A 4D2JA 2E5CA 3UWUA 5EKYA 3IGUA 4XZ9A 1G67A 5BMWA 2VFFA 4A3UA 4UTWC 3LRMA 1ZAIA 1KTNA 1VPXA 3L65A 4HN4A 1H51A 1KTBA 3QC3A 4IMGA 3O6CA 4BK9A 5AFDA 1W3IA 2VEPA 2J24A 5CZSA 3DFPA 3L5MA 4O1DA 5LNVA 1VC4A 1LDCA 3TK7A 3L9CA 1SW3A 3W1TA 5HUPA 2QAFA 2QCLA 4NJKA 2QAPA 3W85A 2GUUA 3IIOA 3RLUA 1KFBA 3UWYA 3MYOA 3NQCA 3MI2A 3QFEA 4EIVA 1UJPA 1SW0A 3DFOA 4RZ4A 3TC7A 2C1HA 1DHPA 3HG3A 3TW7A 1LTDA 1SUXA 4CCDA 2Z1BA 1HL2A 1FUYA 2Y7DA 2NUYA 2QCNA 1I8JA 3DGRA 2E6YA 3AO0A 1IF2A 1GYNA 1V7YA 3HPSA 2W6RA 4RXFA 3EWUA 1L6WA 5BW6A 2C6QA 3LOTA 1K7FA 2LLEA 4UTLA 1KBIA 1OX4B 2R8WA 3O63A 3NGJA 2YXGA 3SSJA 1VYPX 1GTHA 4S2CA 4GUFA 1EX5A 3LXCA 3EXRA 2Z6IA 3GR7A 2G97A 3I7RA 4LV4A 2CLMA 3RF9A 2E6DA 3EEGA 3T40A 1G4EA 3LHUA 5AOUA 3W70A 2H8ZA 4JY9A 3L66A 1K8XA 3GK0A 4X9SA 1Q6LA 2YZRA 5LSMA 3PB0A 4E2BA 1TRIA 4GRSA 2NUWA 4XTDA 3MWAA 1K7EA 3OIXA 4OWGA 4H4IA 1VS1A 1XBXA 1ZJIA 3N9SA 4O14A 4O28A 1HO1A 3A22A 4JTKA 1MXSA 5BMXA 2BSLA 1SR9A 1SU5A 1YADA 3QW4B 2QEZA 2A7RA 1VYRA 4A2SA 3LCLA 1XKYA 3WK0A 4DBDA 3NG3A 2FFCA 3W7OA 3VI2A 4FNTA 2YX0A 3W22A 4I7VA 5F4WA 4O50A 4DO6A 1LOQA 1KM6A 1KLZA 4RXGA 4AMAA 4NNBA 2CLOA 1GVSA 4GUJA 3Q2DA 3G24A 3FIGA 5D38A 2VFHA 4A29A 1FWNA 1KFLA 3R2GA 4GNJA 1LORA 3TFCA 7TIMA 3BG9A 3L5AA 5HR6A 2H8XA 4MVAA 2GVGA 2ZQ0A 4R7JA 1LCOA 5L9FA 5KSWA 1Z44A 3BGGA 3TAOA 4YMZA 5EA9A 2CWNA 1F05A 3GXTA 3PUOA 3M9YA 1GYLA 1IIGA 3G1XA 2ZRVA 4PC8A 4WUIA 4CLMA 2CZEA 3CB8A 4LRTA 3W7CA 1J4EA 4N9DA 5HWJA 3B8DA 3W7LA 3S1WA 1DOSA 3LTSA 3P8JA 1I45A 1IIHA 3HMJG 5I3FA 1HO4A 4R34A 3V1PA 1K8ZA 2ATMA 4WJEA 4LRSA 1A5CA 1W56A 1DORA 1N8FA 4MLJA 2WOQA 3BLIA 3CIXA 4UFHA 4JTHA 3IIVA 1FDZA 3SFKA 4QQ3A 2PRMA 1CW2A 5CPOA 1NVMA 3IIXA 4EOUA 1JUEA 1X7FA 5DXXA 3VE7A 2ZA3A 2B4GA 1YXDA 4ZQPA 3U2OA 4OT7A 3SR7A 3TC6A 3S42A 3W7QA 4O18A 5K4XA 2E5BA 1N55A 1DV7A 3G1SA 4ZQMA 5CGQA 5G1YA 3M5YA 1S5WA 1EWDA 3EWZA 5FEXA 2CZDA 4O16A 2Q3OA 2DU2A 4TMBA 4ADUA 3KRUA 3ABRA 2FPTA 3V75A 2JBMA 3FYOA 3GNNA 2H3DA 4JTFA 4JTLA 3W2KA 1B3OA 2NX9A 4UTTC 4X2RA 4XBSA 4AVFA 1EA0A 1GPWA 3FJ6A 4PCFA 3F1QA 3Q58A 3SGZA 2X2GA 3G1AA 3P80A 2ZTKA 3UQNA 1H60A 1K7XA 4JXCA 1C29A 4H3DA 4H6KA 3QF0A 3B04A 4HIBA 3FLUA 2E1DA 4C1KA 1TPFA 2J9ZA 4JTTA 4XQ6A 3HG2A 1TQJA 4L4LA 3T78A 3IGSA 1J5TA 2ISVA 2WSYA 1VGAA 3ABOA 1DBTA 3B06A 1LP6A 3LTYA 3PR2A 2DZXA 1H50A 5I3KA 2I14A 3B05A 1S5TA 3TA6A 1GEQA 1Q3NA 5LHFA 4UTKA 4K39A 2YCEA 4FX8A 4MZ8A 5E93A 1O94A 4JTIA 5CSSA 4BR1A 2NX1A 1P0KA 3CWOX 4NX5A 4HT3A 3E96A 1QCWA 3HOJA 2XN2A 1QO5A 5A8GA 1JJKA 3NM3A 4IMFA 3W3OA 4WY0F 1FCBA 1A5AA 1YTEA 5FEZA 2PURA 2OJPA 5T26A 2CFFA 4RKAA 1LROA 4DO5A 4XKYA 4K8HA 1VHNA 1TJPA 5I3IA 2A7PA 1F74A 1KFKA 3RLVA 2A4AA 5H2ZA 3JRKA 3KAOA 1RV8A 4GUIA 4AWSA 1ICPA 2PC4A 3H54A 3I6RA 3EKLA 4B5NA 4GUGA 4Q4KA 1ZALA 1ZY9A 2C13A 1DJQA 5HMSA 2Y6ZA 1U83A 3W2JA 2DZSA 3KX6A 3G0UA 1CX9A 1A50A 4Q33A 1YYAA 2CZ5A 3FS2A 5I3HA 3NA8A 5FESA 3EX3A 1AG1O 2QDGA 3LM7A 4YLWA 1H1ZA 1OFOA 3YPIA 4MFEA 1WA3A 3CU2A 3VKJA 2J9YA 3W7HA 3L67A 2BTMA 3UYCA 4LS2A 3P5ZA 4WOQA 4R53A 4RLIA 1R30A 3LCXA 3SI9A 2C14A 3GR8A 1PCWA 4UNLA 1E51A 3EWXA 1PHWA 3TJLA 4UTHA 4UFJA 1QPNA 4O0KA 1P1XA 3PUEA 3GXNA 4K37A 2V0TA 1SO5A 2D73A 5FF7A 1I2PA 3E49A 4NZJA 5C55A 3L0GA 2P0OA 4O17A 3RU6A 2VXNA 2EKCA 1F6PA 4P2VA 2YPIA 3RMJA 5AYXA 1FQ0A 3OVRA 4IMEA 4UR8A 1KM2A 1VLWA 3UZJA 4E38A 3CIWA 1PL9A 3CEPA 2FTPA 3K30A 3TMQA 2QCMA 4K38A 3NVTA 4LWWA 1IXOA 1KM0A 3W7KA 3TE9A 3VNDA 4PL1A 5AC8A 4XTIA 5DXYA 3KHJA 2QUUA 5HR7A 2QF7A 4QISA 4RK8A 2R14A 1I2RA 4AHOA 3NZ1A 1A5SA 4UIOA 1XUUA 4UR7A 5TIMA 1BWLA 4GFSA 2QCGA 1VCGA 2GQ8A 3GDKA 4Z1BA 4NU7A 1KM4A 2TSYA 1SFLA 3IV3A 3MW7A 5AYZA 2A6NA 1D3GA 4OV9A 4RR4A 2KZHA 3UWZA 4LS1A 1JULA 1RQBA 3MBFA 3G22A 1VCVA 4O10A 4N2YA 4JIQA 4O53A 1OFEA 2JKEA 4EWND 3EWYA 4QAIA 4MKNA 3NPXA 3EXSA 1LRTA 4ADSA 1K03A 3C2OA 2JK2A 3PS7A 3MHUA 2DZWA 1F2JA 1JCJA 4OHQA 1TPEA 1XUZA 2ZRXA 3TIMA 5D30A 3ZFHA 1B4EA 5D2TA 2X1TA 4ZZ9A 3SJ3A 3BLFA 3U8GA 1NF0A 3EX4A 3I68A 1T0OA 3GYEA 3M5XA 4M6QA 3O1NA 1Q6OA 2NXHA 3LI1A 1QDSA 3PBVA 4WX2A 1XCFA 1VZWA 3R8RA 4KFNA 2PRHA 1MSSA 2YYTA 2RDUA 4G1KA 5LHEA 3NL6A 4DELA 3TROA 3R5EA 4NXSA 1DL3A 3TKFA 2G95A 4PTNA 2GQ9A 2VEKA 2PCQA 4Z1AA 2JGYA 5FEWA 1SW7A 3W1LA 4MIMA 1R46A 3NNTA 2DJLA 5AC7A 1WOBA 3S0CA 5D2VA 4N9CA 1WXJA 3LXBA 1QOQA 1XXXA 5DY2A 4LC6A 3IVUA 4MY9A 4IX2A 4GXMA 2BXVA 3N34A 3QZEA 5LZLA 1JQXA 4PH6A 2WQPA 1C8VA 1Z41A 4K6AA 5LNSA 2Z0IA 1ZAJA 1RQHA 4LVGA 3P81A 4C1LA 5AHMA 2QUTA 2VEIA 3M43A 1FDJA 5CPLA 1SZEA 1SZGA 3E12A 1HTIA 1P5BA 5AN7A 4YL2A 1IGSA 1X1ZA 4ZQCA 1SFJA 3ZWSA 2E6AA 2E77A 3W7PA 5KTLA 1IXPA 4FXSA 3M16A 1VCFA 4Y8FA 4QM1A 4FF7A 2QCEA 2H3BA 5AHIA 3KRZA 4IGHA 3FEMA 1ZENA 2X1UA 3TX9A 1FWRA 2NV2A 2HMCA 1AW5A 4IWWA 3OHIA 3L21A 1QWGA 3S8HA 1H63A 1J2WA 1BTMA 4ALDA 1PCKA 3S1VA 4LVAA 5F4XA 2OT0A 2E68A 3ABSA 4ORIA 4GBUA 2V2DA 4X22A 4HSNA 3W1NA 2B0MA 3DFSA 4IOTA 3NQFA 5CZJA 3EX6A 5U7SA 1RD5A 3T7VA 1JCXA 3G1HA 5I3JA 2FJKA 3W73A 3RK8A 4BI5A 4CNNA 3NQ2A 1S3HA 2WV8A 2VFEA 4FNRA 3NQDA 5EL1A 1SSDA 3E9AA 2JKPA 3P7YA 1YDVA 2PRLA 4MFDA 4FB7A 1P4CA 1A5BA 3PWAA 1ADOA 4DF2A 3G3DA 2YW3A 4HPJA 3NOEA 4NUWA 2V81A 3PULA 3UWWA 4ORMA 5C5YA 1G4PA 3IIZA 1K02A 2Y63A 3GXPA 2YSWA 1KM3A 4UUIA 2FQIA 3LCIA 3CC1A 4TO8A 3LDVA 4ZMGA 1I2NA 3THQA 4Z1DA 2VC6A 1NAL1 4GC4A 3DU0A 5CG7A 5LNUA 3NQMA 4JX4A 5CPMA 5J5DA 3R12A 2C3ZA 1OYAA 3MI6A 1GVRA 2ZTJA 3PBYA 4P61A 5D05A 1Q45A 1GOXA 1WX0A 5TBOA 4NT0A 2ZZ6A 1H5YA 4O0ZA 1T8XA 1YLVA 4QITA 3P5YA 1VRDA 2E5DA 1PHQA 3CEUA 1QPRA 2NUXA 1IXQA 4CQ8A 3W1XA 5G4WA 3WK1A 5AB3A 2Y7EA 3WFAA 4MYAA 3BV4A 3GNDA 3ATYA 3QMSA 5KZMA 3SECA 1LZOA 1F5ZA 2ISSA 4X3ZA 2TPSA 3KVMA 5D2YA 3INPA 1FCQA 3CWNA 2DZUA 4M7SA 3R89A 3UNDA 1LRQA 4Y9AA 1LOSA 2NWSA 4RJEA 3SIZA 4FO4A 2H6RA 4AF0B 2ZFAA 4MJZA 3W7MA 5GVJA 4S1FA 1UBSA 4I9AA 3W88A 3HO8A 3LV5A 4IJBA 2Y85A 3W23A 4A21A 3L2IA 3QQ1A 4Y96A 3P62A 4FX6M 4TIMA 1IXNA 4IUOA 2ZCGA 4QIUA 3PBUA 2JGQA 1Y0EA 4L4MA 2Y62A 1M7OA 2XN0A 1LYXA 4FHAA 2YGYA 1EP3A 3BW2A 1EUNA 3KVKA 1HFBA 4K7YA 4HNTA 4NJIA 2ATSA 1W54A 1X1OA 3W1AA 2RH9A 3L0NA 4QNWA 1LLWA 2QCFA 3JS3A 1GG1A 2Y7GA 3A9IA 3N9RA 2DZTA 2VEMA 2WJZA 4M6VA 1TYGA 4J9JA 4O1BA 3UPBA 3HGRA 2Y88A 4AAJA 3WJSA 4POCA 3C52A 5FF2A 5KMYA 2CLHA 3G1FA 4AWTA 3VCRA 4ML9A 1D3HA 1YDNA 6ALDA 3G8RA 3T4CA 4RZ6A 3FFSA 2NX3A 2WNQA 2XN1A 1O95A 3DFTA 2B7OA 4MUZA 3U6WA 4JTGA 3QW3A 3W6YA 4DO4A 1JRCA 1EP2A 4CNPA 1Z42A 4DPQA 1C9DA 1H7PA 5K9CA 1ZAHA 2B7PA 3Q94A 4JTUA 3VFLA 4GUHA 1TTIA 5C2XA 1W31A 4XUGA 1H62A 5IM51 1R2RA 4PL2A 2V2HA 4ICNA 4N6EA 4N02A 4MPQA 1OABA 4JX6A 2AGKA 3BG5A 3BO9A 2CLEA 3O06A 4N6FA 3C2EA 4PODA 1QAPA 3C8FA 1D9EA 4UMCA 4UMAA 1FY6A 2QDHA 1OF8A 4AXKA 1TQXA 5DN1A 3GAKA 1I2QA 4NX0A 4DPPA 1M6JA 4M19A 1WDWA 3TW6A 1G4TA 3ZR4A 5DY3A 3C56A 2DP3A 3G0XA 1PE1A 1B9BA 5G2HA 1OFAA 2A7NA 4K36A 3W2MA 2TYSA 1OYBA 4UMBA 1XDLA 3PAJA 3TAKA 5D2WA 3W1QA 3NL5A 3JR2A 2QKFA 1ICSA 3EX1A 4JNMA 8TIMA 3HIJA 4MLRA 2X30A 2Z6JA 2V30A 5DELA 4JYDA 1FX6A 1GVFA 3C0JA 3P8IA 2RDTA 1TO3A 3IVTA 2QCDA 5K9DA 4N4PA 1ME7A 4FIRA 1XBVA 3DBPA 2NZLA 3THAA 3HQ1A 4O19A 3MP5A 4ZQRA 3DFNA 3GAYA 1H61A 3UY8A 3N19B 2FB2A 4NJHA 1TV8A 1L6YA 2VENA 1XM3A 2Q8LA 4IX0A 3M47A 3P74A 3QH2A 4MY1A 3W74A 3QJAA 3DI0A 1WOAA 3M6YA 4JGDA 5K4ZA 1WV2A 5TQLA 5F2MA 1FCVA 3LCFA 2G96A 1X6UA 2OZ0A 4TX9A 1UUOA 4DXVA 3RFAA 1DJNA 2ZA1A 3H55A 2C18A 1FBAA 1WAUA 2Z2UA 3M5VA 3A5FA 4DEFA 2V5BA 4IPIA 5AYYA 1O4UA 3TNOA 3NPUA 4HSOA 4EF9A 4Z0JA 3LCHA 5F4SA 3TXZA 4E0CA 5HUOA 3CHVA 2V82A 3ATZA 1AW2A 3DFQA 3UPWA 3HJZA 1OYCA 5F2GA 5D32A 1EP1A 3W2LA 3KOFA 3W7GA 3TU9A 4NXKA 2CW6A 4FX7A 5HWNA 3TUUA 3FOKA 5FI8A 5G1TA 3N73A 1MEHA 3BLEA 3BW3A 1WBHA 1Q6QA 4HNVA 1F7BA 3A24A 1I4NA 4IPJA 3MP4A 3T55A 2X1SA 2CLFA 3O6DA 3QPZA 2ABBA 2EF9A 1RR2A 4KWWA 2WSQA 2ZZ1A 3QMRA 4K8EA 3TJXA 4NNCA 4O15A 2YYUA 5EBUA 2GJNA 2FB3A 2ZA2A 5FF0A 1KTCA 1QFEA 3GDLA 2FLIA 1O60A 3E0IA 3R13A 4PEKA 3S9YA 4QSHA 1EB3A 3M44A 1QOPA 1ZCOA 3NM1A 3NL3A 4ZQOA 4N9EA 1GVQA 3CTLA 3IRDA 4BFAA 4R33A 3M0ZA 2YW4A 1X8FA 2VOMA 3MUXA 2QCHA 4EF8A 2NXIA 4M5PA 3PG8A 1MO0A 2QJGA 3G18A 1TSIA 3LHTA 2WNNA 4JR5A 2FPVA 4N9BA 1EUAA 1DKWA 4WOZA 5AHLA 3NQ8A 5DLCA 4DBEA 2W0UA 5EYWA 5ABTA 2YFNA 1QNVA 1RZMA 1W5QA 5H91A 3PSWA 4HPXA 3UWVA 4FNPA 5CPNA 2AAMA 3UXDA 3WJYA 2X16A 4JDBA 3TSBA 3O07A 1T96A 3LBCA 1AL7A 5G4EA 3PY2A 4ADTA 3SGUA 5HULA 1TTQA 4JD4A 4FNUA 2XFWA 4JS3A 1KFJA 4CQ9A 4FNQA 1YTKA 2A85A 3E02A 3LBMA 3TDFA 1AMKA 3CPRA 4WD0A 1GZGA 4RV8A 1OFDA 5D37A 2OT1A 1GVOA 4LV9A 3DKLA 2R94A 2WPBA 1XDMA 1G6CA 3NO5A 1W0MA 1ICQA 1SPQA 1TPB1 1XI3A 3MO7A 4A2RA 4DQWA 3W86A 4WZHA 3MMTA 4YXGA 3LXAA 3C2FA 2C19A 3M7WA 4FNSA 2C16A 2O7SA 3BG3A 3LTPA 3QSTA 2RDWA 4IXHA 3W75A 2VFGA 1NF7A 1JUBA 1OX5A 3TQ0A 3NXFA 1ML1A 5AC6A 3NPVA 4FIQA 1LRNA 3GIYA 4LU0A 5F2LA 1O5KA 5D02A 3G1VA 1H7NA 3B03A 4LT9A 3O15A 2Q8ZA 3UWQA 3LHWA 1TCDA 3M5ZA 4PFMA 2OMAA 1AK5A 3EB2A 5G2WA 4RX0A 4O12A 3QSRA 2F84A 2VKZG 3I7SA 1H7RA 2CU0A 2ZZ5A 3QQ0A 3W7DA 5LGZA 3PUDA 4O1CA 3TH6A 4ZL1A 3F03K 4FEZA 3GX9A 4OU1A 3W7RA 4Z08A 1JRBA 3S5ZA 1R47A 1PIIA 1TJRA 1GG0A 3P60A 2ISWA 1W8SA 4U4MA 1GT8A 3C61A 3LLFA 1OX6A 1S5VA 4Z1CA 3LGEA 4WXZA 3HBLA 3LERA 4NJGA 2TMDA 1G69A 3FKKA 3IIPA 4I7WA 1XBZA 3CM4A 4AB4A 3W07A 2BX7A 5MHBA 4ZQNA 4HHPA 2ZRWA 2CLLA 1P0NA 3PG9A 3B0VC 1EEPA 3VE9A 1VLIA 3LB0A 2DORA 1JCNA 2FPYA 1UUMA 2ZRZA 1GTEA 3NQVA 1K8YA 5BOOA 3GDMA 1WBJA 3A5VA 3O05A 4ONVA 1OFRA 1ONRA 4GE8A 4O11A 3B0UX 1UCWA 3MHFA 3TFXA 4IMCA 3BGJA 4LS0A 4MYXA 1W37A 5HJLA 1W5OA 2QCDB 1W5NA 1M7PA 3KVJA 3S1UA 4WXYA 4JTEA 4UTIA 4QJ1A 3P82A 1NEYA 2ABAA 2P10A 4I7UA 3DKJA 1F76A 3W9ZA 1GWJA 1GJPA 4BF9A 2CZFA 3LI0A 3STCA 3EKZA 3DHDA 3KFTA 4KWVA 5KITA 2R91A 3I65A 1SO6A 3IEBA 1AW1A 1ZFJA 1HG3A 3F4WA 3FJLA 4UC5A 2GQAA 4O8RA 1OFBA 1MZHA 1UB3A 1VYSX 3NQ7A 1PVNA 2A0NA 1Q6RA 3ELFA 5CSRA 1KA9F 5HINA 3TSDA 2OCZA 3W7JA 1TIMA 3DI1A 1TPUA 2C0AA 2E09A 3TQKA 4BWLA 1OF6A 3W7NA 3WJZA 1SZNA 2A2IA 4CQAA 5J5RA 3W7IA 3NQ6A 4S2BA 1RQEA 1EIXA 4UTUA 1VJIA 3LRLA 1ZHAA 3PF3A 3SZ8A 1EWEA 1ZNNA 3PC0A 4O52A 3P67A 3LX9A 5I3GA 4JX5A 3A23A 4LUJA 3STEA 5E0KA 1KV8A 3A21A 1U5JA 1KFEA 4WY0B 2NXGA 3W72A 2GJLA 1YTDA 1JCYA 1KBJA 3HG4A 4UTTA 3W1UA 3ANYA 3NZRA 1TTJA 4FXRA 1OX4A 3OVPA 5EPDA 5U4NA 5D03A 4UTJA 3NL2A 1FWWA 3PBWA 5BNKA 3WJWA 2G5WA 2BWGA 1B4KA 3EXTA 2ZZ2A 1G4SA 5LNWA 1PS9A 5D09A 2Y89A 5K2ZA 1TPWA 3S5OA 1FDYA 3QRHA 4NJJA 1ALDA 3S5YA 3TCEA 3S1XA 3HGJA 1YPIA 3C2RA 3F4NA 1OJXA 2RKXA 5CZ0A 2EAWA 1KM1A 1XBYA 2NLIA 3N14A 5SWUA 6TIMA 1FWSA 4O13A 3C2VA 5K7JA 3TQVA 4TMCA 4YCOA 4MZ1A 4UFIA 1H7OA 1ME9A 3OBKA 4JN6A 4JTSA 1JCLA 1K3UA 3EX2A 1LM1A 5E1QA 2TRSA 5L6UA 1W1ZA 1F73A 3O8AA 4ZVJA 3D0CA 2J27A 3KVLA 1G7VA 4AH7A 2QUVA 3DXIA 5HWMA 3NEVA 3MHGA 4MZYA 1OVDA 4HKPA 1O5XA 4JICA 1KFCA 1SSGA 2WO5A 1W5PA 1QPOA 3OEXA 5DBTA 2VFDA 4O57A 3W2UA 1L9WA 2ZDRA 4JTJA 1TPH1 3N2MA 3G1DA 3B0PA 3MJYA 1ME8A 2AQWA 1LBLA 3HGOA 5FF4A 3O6YX 4JYEA 1KM5A 2HSAA 4NNAA 2EPHA 2O7QA 2V2CA 3UZ5A 2GOUA 2DJXA 3ABQA 4LW7A 4LC8A 2NWRA 3HB9A 5D04C 1W3TA 4LVBA 1VQTA 1WYIA 2ZZ7A 3DHFA 2J6XA 5AHNA 5A5WA 2DZPA 2WKJA 4NQ1A 2I9EA 4GJ1A 1YPFA 3NAVA 3LHYA 4RZ5A 3W1MA 3W1RA 4IMDA 1TPC1 4Z0SA 3FKRA 1TB3A 4K7VA 5C54A 1V5XA 3NPWA 4CNOA 4TR9A 4A22A 3L68A 4UNKA 1XC4A 1NFBA 2EGZA 4OV4A 3NQEA 3GLCA 3QEZA 5C6MA 3EWWA 4GWEA 1NSJA 4U28A 3N3MA 3L5LA 2Q3RA 2Y70A 3TMLA 3I7QA 4AHPA 1HUVA 3PB2A 3ZWTA 2GPTA 4BI7A 2QJIA 1KV5A 4Q32A 1TRDA 5K3VA 1CI1A 1PV8A 3MI3A 1FXPA 5EMUA 2Y61A 2BLEA 3HG5A 2ZBTA 3M41A 5K9XA 3W2NA 3HPXA 5LKYA 1LBFA 4AHQA 3Q37A 4N4QA 2YR1A 4UFMA 2X1RA 4YCPA 4JY8A 4JYFA 1G7UA 1TREA 3N2XA 4NZFA 1F6KA 3MBDA 4OQVA 1TPDA 4MJMA 2JKAA 4DF1A 4EVZA 4WY0A 1YXYA 1DQWA 1SQ7A 5G2IA 4OGZA 3FYPA 4LVDA 4KFOA 3GKAA 4KKXA 1LOLA 5F1UA 1OK4A 1SZFA 4KFPA 4OBTA 3O16A 2Y7FA 2FDSA 4YWIA 1VH7A 1H7XA 3T44A 3PVFA 3DAQA 4XKYB 4O4WA 1GQNA 5DCBA 4RCXA 1AL8A 3QM3A 2A6LA 1FWTA 3NR0A 3NYZA 5AHEA 3C6CA
chains in the Genus database with same CATH superfamily
3ECQA 1EPVA 2FKPA 3IVSA 3VUPA 1OG0A 3EPOA 4P7OA 4CGTA 4I9MA 4O1AA 4GCAA 1ZJAA 4H7ZA 1LUCB 2P1FA 3DZ1A 4HYVA 3HPFA 3EPMA 5BU6A 3CUIA 5AKQA 1XYAA 3VCNA 5IXEA 2J9XA 3QZAA 1KLYA 3W84A 3ITGA 2PE4A 2VCBA 3G0SA 3B0YA 3VFCA 5F1VA 1LQ0A 1MEWA 3FA5A 3H53A 3T8LA 1Z48A 3SW6A 1TV5A 4UTMA 4M6PA 3FEQA 4WDUA 3TR2A 1JG9A 4QE4A 3KOXA 2OQHA 3ZQ9A 4CU6A 1OK6A 1GCYA 1UUQA 2V8ZA 2GWNA 4GI4A 4IFKA 1GW9A 3G77A 3WDJA 3UCQA 3WQGA 1W5MA 4AEOA 3E38A 4JDYA 3F4DA 1FCUA 4H2CA 4A3YA 3WBXA 2PDJA 5KINA 3N2BA 5CXPA 3SGGA 3RNDA 4LTSA 3RMEA 2J79A 1A47A 1AQFA 2X7VA 3ZLFA 1WZAA 4UFKA 4M6UA 3W87A 4LUTA 3KS6A 5BRBA 4LB4A 3BPWA 3WK3A 5LGXA 4UCGA 5IFPA 3QYQA 2E6FA 1QI3A 2V5LA 5E9XA 2YCJA 1L2UA 4H7VA 4A8NA 2UWFA 5BYWA 1H7WA 4ZO8A 2V9DA 2P53A 3UY7A 2YXXA 3KXQA 1ELSA 4CEXC 5EY5A 5FF3A 4XZIA 4D72A 3UETA 4QNEA 2ZRYA 4O4VA 2YBTA 3W1PA 1VPYA 3ARXA 2YA1A 3H8AA 1OFQA 4OE7A 2VRJA 2VMFA 3DC0A 3CT2A 5CJNA 4GK8A 1HNYA 3BLOA 4ZOEA 4UFLA 3QY7A 4HA1A 1TWZA 1UIOA 1NWTA 4OZOA 4IQLA 3GB6A 4PMYA 3AWOA 4BY3A 5AC4A 2TAAA 2CLIA 3SCNA 1LBMA 4MKSA 4GGHA 3AJXA 3WMBA 2GDQA 3W00A 3SY5A 3CV2A 5FEPA 5H8MA 3TSMA 4FR1A 2W79A 1X96A 3POCA 4PMQA 3USBA 4KIEA 2E5CA 3T42A 3VGBA 5DMMA 1JPHA 3N6JA 2VFFA 4A3UA 4UTWC 1PZ1A 4F2BA 1H51A 1KTBA 4BJHA 1W3IA 5EMYA 2XSXA 3DFPA 2QGHA 3CK5A 5HUPA 5LIUX 3IIOA 5H1WA 3RAOA 3TQPA 3E5BA 1XLBA 2CNCA 1ODZA 3GQYA 3NQCA 2J74A 3OHMB 4HSHA 3L2LA 1K4HA 3TC7A 4XVDA 1DHPA 5BROA 1DWJM 1LTDA 1SUXA 3WH6A 2HK0A 2NUYA 3E1F1 1W9BM 3DGRA 3R6IA 4NL1A 4HTBA 1ECQA 1IF2A 1GYNA 3HPSA 2OODA 4NKCA 4TVCA 5BW6A 5A94A 3M7SA 1IWAA 4F66A 2ZXBA 1JYWA 3VA8A 2RJHA 2GJPA 2YXGA 2WLYA 4EWJA 3UG3A 1GTHA 4GUFA 2W91A 3EXRA 1JGIA 2WWCA 4WR3A 3EEGA 3S1GA 4LQ1A 3W70A 1XYCA 3BJTA 1EJTC 4B5XA 3KS5A 2XIBA 4PTDA 1UOKA 2MNRA 1M7JA 4G7FA 1Q6LA 2WZEA 2WPGA 4E2BA 5BU9A 4GQ0A 4XTDA 1K1DA 1PO9A 4CD8A 2PEVA 1Q7ZA 1VS1A 3N9SA 5I03A 4IL2A 3SAZA 1HO1A 2GGGA 3WLQA 3ZVIA 5BMXA 2BSLA 4PSRA 1A3HA 1SR9A 4J3ZA 1HF6A 1SU5A 2PZ0A 3JW7A 4DBDA 1JD7A 4UCFA 2FFCA 3AI0A 2YX0A 4WDWA 4AZIA 4M1RA 3TYEA 2E40A 4DO6A 1LOQA 1KM6A 2PU0A 4PYSA 2QMKA 2G41A 3VAVA 4FOJA 3G24A 5D38A 3WDRA 2VFHA 3R2GA 3L5AA 5HR6A 3CL6A 2GVGA 1R5YA 2ZQ0A 4R7JA 1VBGA 1NM9A 1LCOA 4B92A 4WSJA 5EA9A 2GL5A 3PUOA 3NSMA 4YYCA 4P8UA 1IIGA 4PC8A 2GSHA 1EJSC 3MCNA 4REQB 3SRKA 1GZ1A 4LRTA 3W7CA 3ES8A 2R82A 3LTSA 1Z7AA 2BY1A 4GQRA 2FZBA 4MLJA 3MMDA 3CIXA 4WLCA 2V5CA 2WZIA 3SFKA 2IPJA 4QQ3A 2AQOA 1ODUA 3LQLA 4D8LA 3GXDA 2ZA3A 3LGGA 4WK9A 4OT7A 3D47A 3SR7A 3S83A 3TC6A 3HFTA 3UW6A 2NW0A 1N55A 3WSUA 1QJWA 4KGJA 5JH1A 2OYKA 1VRXA 1EWDA 3ORWA 5BRQA 2DSUA 2Q3OA 2DU2A 3KRUA 3ABRA 3DBNA 2JE8A 3A6OA 2OO6A 1PKNA 3FYOA 2WM1A 4XISA 3ZJ7A 3NYDA 1MDRA 4UTTC 2AL2B 3FJ6A 4PCFA 3M0IA 2WMIA 4L1WA 3Q58A 3KOWA 2PBOA 1J93A 3DC8A 4UQDA 4AUBA 2I9UA 1C29A 1M7XA 4H6KA 2W9MA 1E72M 3B04A 4HHHA 3FLUA 4KMQA 2E1DA 2OQYA 3KBJA 1POJA 3QTPA 3QOMA 1TQJA 3WG6A 1DJIA 1UP3A 3IGSA 5D9OA 1WP6A 5GNZA 9XIAA 4AU0A 1UR3M 3SUWA 4FA3A 2I14A 3B05A 3CNYA 5LHFA 4ZB5A 1QPKA 4UTKA 4K39A 3T4WA 4AZCA 4N42A 4MZ8A 4BR1A 2NX1A 1P0KA 2BVYA 1J12A 1DXIA 5CQ1A 1VFTA 3VM5A 1S39A 4CVUA 3GXFA 5A8GA 3NM3A 4IMFA 3W3OA 5AYBA 2JEPA 5JBFA 4LBSA 5HAOA 4CKQA 2OJPA 2CFFA 2HVMA 3TR9A 2VT0A 1LROA 4DO5A 1BRLB 4LAUA 5I3IA 3SUTA 1QW8A 2E4TA 1OIMA 4XD5A 1WZLA 5H2ZA 3KAOA 3ALGA 3H54A 2PC4A 1MW1A 4Q4KA 4B9YA 1ZJHA 1DJQA 5HMSA 1TWDA 1U83A 4K1GA 3GG7A 3TCSA 1XP3A 3VD4A 1MZRA 4Q4OA 1CX9A 2C79A 2XH4A 4Q33A 3FS2A 4TXEA 5I3HA 3F7JA 3VC5A 2QDGA 4YLWA 1H1ZA 2J7DA 3WD1A 4JKKA 3W7HA 1WA3A 3QPEA 1UMYA 3RCYA 4ACZA 3LCXA 1S2UA 3OYZA 3AUJA 4JL1A 4UFJA 5FAGA 4AYGA 4C5ZA 3GXNA 1GOIA 2YL9A 5XIMA 3MU7A 4QG8A 3BSGA 1I2PA 5ECVA 3GWQA 3M4HA 5AZ1A 2GVEA 3AS2A 2VXNA 2EKCA 2X09A 3L4TA 2YPIA 4P2VA 5G4HC 2FZMA 3OVRA 1NP2A 3UZJA 2YB1A 2XH2A 2QCMA 3PP7A 1IXOA 1TZ7A 1Z69A 3KHJA 1FWHC 4W7VA 2R14A 4A4AA 1I2RA 1XUUA 5TIMA 3GC5A 3LEPA 4M1BA 2Y8VA 2GQ8A 3DCPA 3FVDA 2DSVA 4Z1BA 4NU7A 5DMNA 3MW7A 2HISA 1JULA 3Q67A 5CZKA 3G22A 1VCVA 4UNIA 4MWAE 4JIQA 1IT8A 4KETA 6A3HA 1OFEA 2JKEA 4QAIA 1MDLA 4MKNA 3EXSA 3H2OA 4S23A 3VNZA 2VR2A 1FP9A 2WCGA 3N4EA 2HRWA 1XLCA 1JCJA 4XBJA 4KF1A 1TPEA 1XUZA 3S9IA 3WFZA 5D9PA 2X1TA 3HV9A 4XZBA 5CSUA 3U8GA 3ZJKA 1NF0A 1T0OA 4DZ5A 2PUZA 4UOQA 3GYEA 4M6QA 4NRRA 4DNHA 4TVDA 1T40A 5I24A 1PTDA 2YCLA 1AJ2A 3R8RA 1XH1A 1TE1A 2YYTA 1ZQ5A 3M64A 1LL7A 4DZIA 3R5EA 1DL3A 2GSEA 4AY7A 3NIYA 2GQ9A 1TWWA 4F3HA 3SB0A 3UWEA 2PTZA 3S0CA 1WXJA 4KQNA 5CLWA 2D2JA 4P7LA 1A5KC 2ZUSA 3VKDA 2D2OA 4C6LA 3WLKX 4LC6A 3URBA 1WZMA 4GD0A 4GXPA 3LNPA 1AD4A 2GGIA 4D71A 4DBWA 2PGRA 1PX8A 1R3YA 2D22A 3ZJ8A 4K6AA 2Z0IA 4LVGA 5JQ9A 3R7MA 4CU7A 1P0BA 1FDJA 1VFOA 3APTA 3E12A 4MGGA 2VZVA 5A3HA 4YL2A 3AOFA 4EACA 1GQJA 3NZPA 1X1ZA 4ZQCA 1SFJA 3NJ3A 5TD4A 2E77A 5A8QA 5KTLA 1VCFA 4Y8FA 4NYYA 2E28A 3VDCA 5AHIA 3KRZA 3FEMA 2X1UA 4B5VA 5C7VA 2Z29A 3F4CA 4CQBA 5JXQA 2INFA 1GVEA 4I3GA 5HOSA 3ZM8A 3S8HA 3GTHA 3IJLA 4LVAA 3ABSA 4ORIA 1LUCA 3GNRA 1AZ2A 2B0MA 2VL4A 4IOTA 1JXKA 3NQFA 1RD5A 3T7VA 1E4LA 2HDJA 3WLSA 5CC6A 3G1HA 1AVAA 3UZWA 4B4HA 1NDYA 4MHBA 2FJKA 3MQTA 3BOXA 3WQWA 3RK8A 3IK4A 1W1PA 3NQ2A 4F8XA 1T5AA 5EL1A 2CBVA 1SSDA 1U33A 3P7YA 4QS5A 1YDVA 2IKHA 4MFDA 4FB7A 2PI6A 4GKTA 1P4CA 4DB7A 6TAAA 3PWAA 2XVLA 4HPJA 4F0HA 1DIOA 1G0CA 2A3HA 5C5YA 1QT1A 1NU5A 3HMCA 3LDVA 3KDNA 4FLQA 4GC4A 3TYUA 1R3QA 3TNBA 5CG7A 4I6VA 2V38A 3NQMA 1GEHA 1CLVA 5FL1A 3R12A 4B90A 1OYAA 3MI6A 3FCPA 2DVTA 3PBYA 4DM1A 2YB4A 4P61A 1GOXA 5BRPA 2ZZ6A 1IEXA 1UZDA 4QITA 3KEHA 3P5YA 3RR4A 1BRLA 3CEUA 1QPRA 1IXQA 2FDMA 1HVQA 4DYKA 2JFEX 2E9MA 3VGHA 1X8CA 2VX5A 2PF0A 3BV4A 5KZMA 3SECA 1LZOA 5HNNA 1XYFA 2AOSA 4X3ZA 2TPSA 5D2YA 2IW0A 3LZ5A 1ONXA 3VDGA 1QASA 3WDPP 2VQTA 4AZGA 2WVVA 1WKEA 1RY8A 1YW1A 2GK1A 3UNDA 3HFYA 3WDHA 4IICA 3QVQA 2WKGA 1M65A 4FO4A 4AF0B 3SCTA 1PXGA 4PTXA 3W88A 3HO8A 4Z42C 2J7FA 3MCOA 2XIQA 4Y96A 1CGVA 3QQ1A 3R10A 3R25A 3KBSA 2HE8A 1T41A 4QIUA 2QVHA 1K70A 3GH4A 4EXBA 1ITUA 1EFZA 4J1OA 3W53A 3SQSA 4JPGA 4XD4A 1OC7A 3OZMA 2WMIB 4FHAA 4AW7A 3BW2A 4D8ZA 4K7YA 3OVGA 1WXYA 4QNWA 2GSJA 2Y7GA 3N9RA 2VEMA 1W8GA 2EJAA 4AAJA 2QDDA 4C7GA 1V02E 4POCA 4A35A 3MKCA 1GKPA 5FF2A 3E0FA 1QATA 1XRVA 1A5LC 3VCRA 1UWRA 4G7EA 1AODA 2PDNA 1WKDA 5DO8A 2XN1A 1I75A 1CGWA 1O95A 3AIWA 2B7OA 5B7YA 5MKGA 1W3LA 4AVNA 3WQDA 3QW3A 2BY3A 3RR1A 3CZEA 1HX0A 1C9DA 5K9CA 1BWVA 4GUHA 1TTIA 1KB3A 1W31A 3R0KA 4PL2A 5CBIA 1BGAA 4MPQA 4JX6A 4IFKB 4NZ4A 3BG5A 4ECLA 1I1WA 2YJQA 2WK2A 3VNKA 3C8FA 3L2MA 3OQ8A 5FJUA 1OF8A 2YKKA 4AXKA 1BYDA 5DN1A 4E6MA 4LX4A 1EXPA 4IHCA 2BGNE 5CLTA 3N2TA 1Q7QA 3GC4A 3TW6A 2VC7A 3ZR4A 1H11A 3QR1A 4JCMA 5C9UA 4MNKA 2TYSA 3CZLA 1HKMA 4V27A 1U2YA 3PAJA 3W1QA 3JR2A 5HQLA 3AFBA 2DT1A 8TIMA 1V0LA 1UP2A 4GX9A 5TAOA 2QF8A 3S6TA 4JYDA 1FX6A 3ARZA 4H83A 3TOPA 4QQUA 3DBPA 1J6OA 2VZSA 3RXZA 4ENLA 3HQ1A 3DFNA 3GAYA 3N19B 3MZ2A 3SCWA 4FK9A 1ESWA 1L6YA 2XU2A 3RJXA 3EWCA 2BVTA 1FCVA 3CHCA 5LYRA 1PJ9A 1UUOA 2VZOA 4B16A 2ZA1A 2AAAA 1WAUA 2Z2UA 4OVXA 4DEFA 3O3RA 4IPIA 4ZGYA 1O4UA 1OT1A 1U5HA 4EF9A 5F4SA 3UU0A 1PEZA 5E9AA 4ML4A 2V82A 3WNLA 4Y8EA 3BJSA 5F2GA 3TU9A 1X6LA 1TIWA 1NH6A 3BC9A 3FOKA 4GIAA 5G1TA 2R9RA 4C1NB 7ODCA 4HNVA 3BURA 2PD5A 5CPSA 4ROPA 2J4GA 4KWWA 2YYUA 5EBUA 3T0AA 2FB3A 2ZA2A 5FF0A 4ZOAA 2CBIA 3KP1A 4WDTA 4KERA 3E0IA 1LQ2A 1DE6A 2ZXAA 3S9YA 1C7TA 4V15A 3N29A 1NARA 3ITYA 1YKWA 5M3WA 4BFAA 3MSDA 1WCGA 4R33A 1P43A 3SRFA 2VOMA 4WSHA 1GQLA 1JAEA 1KWKA 2PDCA 2BXYA 4HPNA 1UR4A 1EUAA 1DKWA 4QG9A 3PAOA 4YS1A 2ADAA 2DIKA 4XZHA 4DBEA 4BZYA 3QV9A 5ABTA 2YFNA 2QIIA 4WDXA 1QI4A 2PDXA 3PSWA 2YLLA 3UWVA 3ABXA 3UXDA 1KO0A 4JDBA 3O07A 1T96A 1NDVA 2MUCA 1AL7A 1ZPTA 3B3DA 4MNLA 5G4EA 2O9TA 1TV2A 3MB9A 1SMAA 3GTNA 4IPLA 5HJYA 2HZGA 1HJWA 1EIBA 5C0QA 3LBMA 4X63A 4ERAA 1B90A 5HQMA 3RRXA 4C6OA 4LGXA 1NFPA 1C8YA 5CJMA 2OT1A 1GVOA 5C9RA 2V3DA 4QTGA 2WNWA 4H19A 5DRCA 4H9MA 1G6CA 3NO5A 2XVGA 3CBWA 5JMUA 3W86A 4F2TA 2P8CA 3GXMA 4AG0A 7TAAA 5C2CA 3MMTA 4AD3A 3EKGA 5LIYX 3C2FA 1TX2A 3MSRA 3BG3A 3H2CA 3W75A 2VFGA 1W1TA 4IUGA 1LRNA 5F2LA 2VUYA 5D02A 2PS2A 1JDDA 1H7NA 3B03A 2XHYA 3Q4DA 5ENLA 1JPKA 3UWQA 4PFMA 1LL4A 3KE0A 2OMAA 3EB2A 4GQQA 2E8YA 4O12A 2DDXA 2VKZG 3SN1A 1E70M 3QR0A 2CU0A 3DX5A 5HMDA 4UQCA 3W7DA 4O1CA 2G3MA 4L80A 3T1GA 3M0VA 4FEZA 3GX9A 1F3WA 5CSYA 1MUWA 1KC7A 1JRBA 2OFJA 1NOFA 4XSLA 2JQXA 2OWWA 2RAGA 1DQUA 3AXMA 2GZXA 2YA2A 3T05A 5BOEA 3HBLA 3MPGA 4DJEA 1KRAC 1OT2A 1Q8AA 2Z1KA 3CM4A 3VKBA 3DDMA 3W07A 5MHBA 3ARSA 3SQLA 4ZQNA 4HHPA 4Z2IA 3B0VC 4P8WA 3PUGA 1VLIA 3LB0A 1IYXA 2WQDA 2ODOA 4LAKA 1W32A 5AVHA 1GTEA 2FZDA 3A5VA 4D6JA 1EJXC 3RITA 4Q7IA 3BSHA 1OCQA 3TFXA 1CBGA 3BGJA 4ZSUA 4MYXA 2XM2A 1Q85A 5HJLA 1W5OA 2QCDB 2W62A 3KVJA 2IS7A 2FMNA 4CN6A 4WXYA 4XZMX 4CNTA 4R5EA 1BG9A 1EYWA 2BS9A 3VPLA 4I7UA 3DKJA 1F76A 4AWEA 3STCA 1V3KA 3WLOA 2VHLA 3I65A 5FACA 1ONWA 1SO6A 1F8IA 3ARQA 3AU2A 1GOMA 4J7RA 1HJXA 2FZ9A 2GQAA 2J13A 3NQ7A 2WC3A 3OB8A 3CV7A 3T2PA 4AIUA 4IG2A 4JIEA 3W28A 2P0IA 2HNHA 2PDUA 5E0FA 2XG9A 2D3LA 3NWRA 3O0KA 3WJZA 1JDEA 2A2IA 4CQAA 2BNJA 5J5RA 2CYGA 1KKRA 3NQ6A 1TZZA 4UTUA 3LRLA 3PN8A 1HJQA 4TUFA 3SZ8A 3PC0A 3VOJA 3P67A 3LYEA 5I3GA 2VP8A 1OINA 3IUIA 1S1RA 3LN3A 2EG6A 1KV8A 3RU8X 1XG4A 3W72A 1W3KA 1FWJC 1KBJA 3HG4A 5BOFA 1GOKA 4YIWA 3ANYA 3NZRA 1OX4A 4FXRA 4UTJA 3COTA 1YBQA 1CEOA 3PPCA 3PBWA 3P93A 2HWGA 2BWGA 4C6BA 1B4KA 2OLSA 1PAMA 1UZ1A 1G4SA 1YEYA 5LNWA 1PS9A 1XIMA 3EA2A 3H23A 5B7ZA 5EGRA 3RG6A 3S5OA 1FDYA 2NQ9A 1O6IA 2QJNA 3TCEA 1PWLA 6XIMA 3W29A 4DWSB 5A8OA 1OJXA 5CZ0A 2EAWA 3EMCA 2CXEA 3USZA 3WBYA 5SWUA 3UG8A 4MKVA 4RPQA 2YL5A 4UFIA 1ME9A 4JTSA 5D8ZA 3OBKA 4NAEB 4HU3A 3CL8A 1RLCL 3SCRA 1OG6A 3KVLA 3DECA 1G7VA 5HPCA 3HA1A 5IHSA 5HWMA 3ZZ1A 1F3EA 2FGZA 1EL3A 4MZYA 4YVPA 1P7TA 2DIJA 3ZT5A 1AMYA 3UYIA 1QPOA 4RNHA 5DBTA 4MWAC 2VFDA 2FTWA 4JTRA 4HJWA 3IUHA 3RPTA 3HGOA 2CZVA 4EANA 3U7BA 3O6YX 2HSAA 3DYPA 1RHCA 2O7QA 2V2CA 2X8RA 3L23A 4D1IA 3S5SA 3QGKC 1W3TA 4GI6A 2O4QA 4LVBA 2EBNA 3SCQA 3BV7A 1WYIA 2ZZ7A 2HJPA 3DHFA 3BICA 2ZIDA 3OTRA 2DZPA 2PBGA 2WKJA 4GJ1A 1PKYA 3WEZA 4RZ5A 3W1MA 4AIOA 4DWDA 2CIPA 2VOTA 4QRNA 4JZ5A 4IJCA 3QYSA 2WCAA 3B9NA 3H21A 3IJDA 1TB3A 5C54A 1HT6A 4QE5A 4TR9A 1XC4A 4IP5A 4OV4A 3GIQA 3QEZA 2D0HA 3EWWA 4GWEA 1NSJA 1J18A 2PDKA 3N3MA 1WKYA 2Q3RA 4HU8A 4ZOBA 3I7QA 3BZJA 1HUVA 4W7UA 4BI7A 3R1ZA 5K3VA 3WUBA 5CGMA 3KL0A 1XPGA 3TVAA 2GDUA 3CO4A 3HPXA 1LBFA 3AROA 3FVMA 3Q37A 2X1RA 2I5IA 3UZZA 2VDGA 3N2XA 1Q2RA 4NZFA 4ZBCA 1UD6A 4MJMA 4QS6A 3FA4A 2DVUA 2JKAA 4H41A 4WY0A 1ITXA 1SQ7A 2GYIA 3HQOA 2NQ5A 4OGZA 3FYPA 4LVDA 3LM3A 3H7VA 1CTNA 3OW1A 3GKAA 1A80A 2L5HA 4KFPA 1OB0A 2NVDA 3O16A 2Y7FA 2CESA 1NQ6A 4JQ4A 2XVPA 4U2ZA 1XLDA 2PP3A 5IOBA 3MSYA 2PDFA 4BEQA 1H7XA 2NLYA 1Q8JA 4XKYB 4KRZA 4O4WA 3WBWA 4RCXA 4GJJA 2OYLA 1W9UA 1FWTA 3URAA 1XLFA 1IE7C 4RPPA 1XFBA 1RBLA 4XK2A 5KEZA 1PTAA 3SCVA 2DPEA 5FSDC 2GDVA 2Z7KA 1GKQA 2HTMA 3RRAA 4JIPA 1RH9A 5HNRA 1EJUC 3CPGA 1CB7B 1WQ5A 4LUIA 1RCXB 3QPYA 1W17A 2GJXB 3W71A 2ESCA 2XVNA 3VU2A 1AFSA 2DH2A 7XIMA 3G8EA 4C6MA 5A6BD 1J10A 4KESA 2I56A 3S2JA 3W7EA 5D2XA 2UV8G 3MVIA 4PZVA 4Q6JA 3OG3A 4W89A 3CV6A 4L9YA 3CGTA 5KETA 4XAZA 3LHVA 3ERPA 1UWUA 2J78A 1SO3A 4AXNA 4D1JA 3GDTA 1ZL1A 3GIPA 5IFTA 4NIRA 2JEQA 2VELA 3QQWA 3ID7A 2A3AA 4S39A 5AHFA 1RA5A 2WNZA 2BDQA 3CQ0A 2RHGA 2I5QA 4LAMA 3LV6A 3P2VA 1OHLA 2ZKMX 1EQCA 4LEQA 3THUA 5IDZA 3WJXA 1XL9A 1I2OA 4I8DA 5D33A 4GY7A 4LY8A 3VK5A 3PTKA 5C9XA 1YDOA 1TCMA 3LK6A 2Y8KA 1VJZA 1NQKA 5A8PA 4W9TA 2F2KA 1XLAA 3OLGA 4DJEC 4Q8VA 3TV8A 2YDAA 3STFA 2WBGA 2Q02A 3U2CA 2HXTA 4KRTA 2OTDA 4MWAA 1TPVA 1QR7A 3D3AA 4NVTA 5A6SA 2QJHA 2G0WA 2PFHA 1M5WA 4F40A 5M03A 4GCXA 2DZVA 3VDHA 4CCEA 1UKSA 4U3AA 3QN3A 1CB2A 3ABZA 2FIQA 2Z1XA 2V3FA 3OZPA 4RDVA 2BY0A 3BVJA 1M53A 3OVQA 1KRCC 1VBRA 1T99A 3W76A 8XIAA 1BWKA 3H2NA 1B3YA 4C90A 1OBAA 3K8KA 4XBKA 1XSIA 4J2MA 4XIMA 3ARTA 4X9YA 3CUGA 3LCGA 3FN9A 4J3SA 3B8UA 7PTDA 3B4UA 1HKWA 5CKSA 2HS8A 2B7QA 1H1YA 1XYMA 1ZTVA 1AJ0A 4KEVA 1MVYA 4WKHA 2F7FA 4UR9A 3MP3A 4ZR8A 1X1NA 1E6RA 2WHJA 1LWJA 4O54A 4PCNA 4GZ7A 4D2JA 3WQFA 1CGYA 1ISZA 5IRPA 1G67A 4JIIX 5BMWA 1R8LA 1VPXA 1KR0A 3O6CA 3LD5A 4BK9A 2B31A 4L5ZA 7ENLA 4FXFA 4EKJA 1ZP3A 2QGYA 1B3XA 3L5MA 1Y8BA 4O1DA 1GOWA 2ZX7A 1LDCA 1MI3A 3CPUA 3L9CA 3N3TA 4KWSA 1SW3A 3W1TA 2QCLA 3DFHA 3RLUA 3CIVA 4QFUA 3AISA 2OO0A 5GNYA 4F48A 3GS6A 1XINA 4FR6A 4QHRA 1W9XA 2BGSA 2QCNA 3WLNA 1I8JA 3E6EA 3BAYA 4BHYA 2E6YA 3AO0A 2OKOA 3LOTA 2LLEA 1PKLA 4L4PA 1FTXA 5G1MA 1RY0A 1VYPX 2FZ8A 4S2CA 1EX5A 3WQPA 1R9YA 2Z6IA 3I7RA 2CLMA 1ADDA 4CEUC 1OCBA 3WNPA 3LHUA 3DYMA 1XHGA 3CHEA 5AOUA 1GORA 2H8ZA 4HZ7A 1SFTA 1K8XA 4LUSA 3QY8A 2ZC8A 1W2PA 3OQEA 3H2AA 3S2NA 4C6DA 4H8VA 2XH0A 1GVIA 1UKQA 1TRIA 1V6VA 1Z89A 3TW9A 4MSSA 3KDOA 4MMWA 4W88A 4HBKA 4O28A 2PA6A 3CS2A 3LS9A 1QHPA 3R4IA 4JTKA 1MXSA 2J6VA 3IJQA 2DQXA 4XZNX 3UR7A 1VYRA 4A2SA 2WCSA 6CGTA 3LSCA 1Q6CA 3WQOA 3W22A 2BODX 5F4WA 1YIXA 4NNBA 1GVSA 2VR4A 1A4LA 2W27A 1GK8A 1CCWB 2F2HA 1KFLA 4LUTB 4R88A 7TIMA 4IIDA 4H6EA 1US3A 2GGHA 5HBFA 5L9FA 3BGGA 1R3TA 5ABHA 1FA2A 3EOUA 2ZRVA 3T08A 4CLMA 3CZKA 2CZEA 1WDQA 1EJRC 4N9DA 4Z17A 3PZVA 2E67A 3W7LA 1E6QM 3S1WA 2DUZA 1DOSA 1I45A 2YCLB 3G5EA 4I6KA 4Q4QA 1DORA 4F0SA 5I2UA 3T2OA 4Q8MA 2WOQA 4EAMA 3CAVA 3QLLA 2D23A 4UFHA 3XISA 1M9HA 2FFIA 4DO7A 1JUEA 1B2YA 3M0JA 1YXDA 3U2OA 4B9ZA 4YHGA 1VPQA 3U2EA 3SM0A 4KT2A 1GQKA 2E5BA 1DV7A 5DRIA 4D8AA 1CIUA 1R85A 5G1YA 1S5WA 3WD0A 5FEXA 2ZUNA 2OWXA 4TMBA 1Q5MA 2P76A 2FPTA 1XLEA 3GNNA 1JYXA 2EJ1A 2H3DA 4JBRA 3URQA 2NX9A 4X2RA 1JZ7A 4XBSA 1A5MC 4AVFA 1GPWA 1OGBA 2DY3A 4UQAA 1P48A 3SGZA 1C8XA 5EB8A 1V0NA 4JXCA 3QF0A 1UHVA 4PRRA 4AMCA 1GVYA 3SFWA 4JTTA 4JFVA 3HG2A 1KBLA 2AL1A 4BQ5A 4L4LA 1D8CA 4K3ZA 2YBVA 4S3JA 2ISVA 5CC7A 3ABOA 3FHQA 1R0MA 1PX3A 5E0CA 3GTFA 3LTYA 3AYVA 4HCLA 4J3TA 1W1VA 2J7GA 2VM8A 5I3KA 4ZSTA 3N17A 2REQA 2BBFA 2ZUTA 3ALFA 5HNTA 4HCHA 4FX8A 1ZS2A 3EWDA 1O94A 4JTDA 1IGWA 3H4GA 5LA0A 1S1PA 4DJED 1T7LA 3V0SA 4RZBA 3GDBA 4NZ5A 3M0HA 3CAKA 1FCBA 1YTEA 3C5QA 4WGHA 4QCEA 3K46A 1L0PA 4XSMA 5GJMA 3EDJA 4XKYA 4K8HA 1VHNA 1TJPA 1HXJA 2QIWA 3M0KA 1XKJA 1E1FA 1KFKA 1I0BA 3RM9A 4I8YA 1RV8A 4DVOA 3IRSA 1J0YA 4AWSA 2OLHA 3MA8A 4GX8A 4F9JA 3VD9A 4HU0A 5FJRA 2Y6ZA 3VDBA 1UJQA 2C8NA 3KX6A 1RCOB 1F9CA 3VOIA 2CZ5A 1XCWA 1A49A 3EX3A 4M8UA 4RE0A 3YPIA 3VKJA 2J9YA 3ISIX 4TV5A 3S3GA 2BTMA 3UYCA 3ZR6A 2HE5A 4LS2A 4C5YA 4R53A 4RLIA 1R30A 3SI9A 2X7WA 4H2HA 2C14A 3GR8A 4UNLA 1P7TB 4LJ3A 1UR8A 1KQYA 1GGOA 3K1DA 1HVXA 4K37A 3PANA 7REQB 2D73A 5FF7A 3E49A 5C55A 3L0GA 4O17A 4B5SA 1F6PA 4BCEA 3KW3A 3I10A 3QZ6A 1SMDA 1KM2A 1XIIA 5D4YA 1QBAA 3F2BA 5LA2A 4XAFA 3CEPA 2FTPA 3K30A 3TMQA 4L61A 1I6NA 4LWWA 1KM0A 1ONEA 1ITCA 4EXQA 3WQ4A 5AC8A 5GPRA 2QF7A 4QISA 4RK8A 1O7AA 1DP0A 1V6TA 4JNYA 4FOKA 1LQAA 3REQB 1A5SA 1XS2A 2AL2A 3V4BA 2NT1A 3P0XA 2QCGA 1KM4A 1GNXA 3E2RA 1JPMA 2IXVA 2KZHA 3KTXA 2R1MA 3QV6A 4O10A 4N2YA 3NGFA 2BP1A 5IHRA 3WNMA 2Y2WA 4O53A 4ACYA 4EWND 1K9TA 1QNPA 3EWYA 4OOZA 4DWSD 4ZXLA 1PZ3A 1LRTA 4FLRA 4QDWA 2JK2A 1TVPA 1TFVA 4PR4A 1MW3A 1F2JA 1XIHA 1D2KA 3G6LA 4IIBA 3BANA 4Y9MA 2WW5A 3TIMA 5D30A 3UBPC 1HN1A 2G3FA 5D2TA 1H5VA 4L1XA 3VNMA 4ZZ9A 1KXTA 4Q8WA 1GOOA 3SN0A 1B31A 1X7IA 1KXQA 3B8WA 1Q6OA 2INEA 4WX2A 1B30A 4GZJA 4C65A 1VZWA 4AFYA 4KFNA 1UWIA 1R7AA 4DNMA 1TWIA 4DELA 6XIAA 2OZ3A 4D9PA 2DT0A 4E8CA 4HD5A 2JGYA 3QHMA 4PUWA 2W3ZA 2J8TA 4HMCA 1BYBA 1R3VA 3OBAA 1R46A 1CXIA 4CD5A 5C8BB 5D2VA 3SSZA 2HV5A 4EPEC 1XD1A 1AQ0A 3AYRA 4C7FA 5DY2A 3HZ3A 5BXTA 3T6CA 2GJRA 3A47A 3W38A 1BTCA 3RO8A 2FHCA 2ZVRA 5LZLA 5ABEA 3RYSA 4F79A 1DJWA 1C8VA 4UZUA 1Z41A 5CEWA 3ZVHB 5AHMA 4CQDA 2VEIA 5CPLA 5BZAA 4GMEA 1SZGA 1P5BA 1H0GA 5DT5A 1BAGA 1GJUA 4DXXA 1VEPA 3HU7A 3RIKA 3LGDA 2E7FA 3KL3A 3WBEA 1IXPA 1EOMA 2QPSA 3ANVA 4FXSA 1TA3A 2WMHA 3K13A 4FF7A 3V7PA 4DLMA 4X60A 4GH3A 4IGHA 1ZENA 2V3EA 3OG2A 2NV2A 4LF2A 1J0KA 3SCSA 8CGTA 1KXHA 4LYQA 3RX3A 2PWUA 4IWWA 3L21A 1R6WA 1QWKA 2VGBA 1W1A1 1FH9A 1H63A 2BHUA 2FVMA 4ALDA 4G7EB 3W82A 3S1VA 2J47A 1RP8A 2E68A 2BOFX 4GBUA 4GLEA 2V2DA 2IQ0A 2PDLA 3DFSA 3N4FA 2R1NA 5CZJA 4YTRA 2C91A 1KBKA 1HJVA 3GW0A 4MB1A 1DXFA 1FWEC 2PWFA 5DQPA 2GUBA 1VFMA 4Y9OA 3W73A 4BI5A 1V6XA 2VFEA 2RJGA 1JGMA 1PWMA 3NQDA 3VC6A 1A0EA 4TQTA 2JKPA 1M3UA 5ABFB 3NXLA 3BLLA 1ADOA 3G3DA 5BWFA 4JAWA 4GVFA 1JZ3A 5M17A 4JOMA 4ORMA 1G4PA 3IIZA 3IJIA 1RXOB 1MRAA 1K02A 4UUIA 3LCIA 3CC1A 3WH8A 1ZSXA 5LXEA 3THQA 1TMQA 2FZNA 4B15A 3VGFA 1SVDA 1V6YA 4GACA 1E9LA 4JX4A 5CPMA 2DW7A 1GVRA 3WX7A 5C70A 3HN3A 1Q45A 5TBOA 1FWAC 1YHTA 4US5D 1H5YA 4O0ZA 2PWHA 1XFCA 4B2DD 2E5DA 3VXGA 5A8MA 5G4WA 1J11A 4XAPA 3RILA 2Y7EA 4UWMA 3WFAA 3BAKA 2W5FA 2VR5A 3LLXA 4HJFA 2XIIA 3GNDA 1S2AA 3KBNA 3ARWA 4X0NA 1F5ZA 3VINA 3ONCA 2ISSA 3UR5A 3KVMA 3VMPA 3W37A 1DTNA 3WEOA 2PTYA 1KBBA 1JPDX 2J25A 4QG6A 2BXZA 1N8IA 4J27A 5JIWA 4XIAA 3CWNA 1Y7VA 2GLKA 4C6FA 4L7ZA 4Y9AA 1EC7A 4W4QA 3SIZA 1QUMA 1FFRA 2PP0A 2ZFAA 3W7MA 4PUNA 4S1FA 2Y0FA 5GVJA 3V18A 3AMDA 4IJBA 4HK7A 2HBVA 2Y85A 2WJEA 4DAFA 4V33A 3E0LA 3P62A 2R1LA 1IXNA 1HJUA 1W9PA 2ZCGA 4ZXOA 1Y0EA 4NAEA 1OCJA 1RJPA 4HYWA 5CBJA 4Q8QA 2I16A 1R7OA 2ZXDA 2XN0A 1G9HA 4HMDA 4HNTA 3DERA 1QNSA 1LLWA 2QCFA 4BF5A 5ABFA 4NZ3A 2DZTA 4YYFA 1XC6A 1EC8A 4O1BA 2D24A 1S2CA 3WJSA 4KH2A 4PB3A 3TZFA 2DT2A 3VIKA 5EMLA 2CLHA 2Q6ZA 3G1FA 3I3BA 3LG3A 4AWTA 3W02A 1ZCCA 1YBQB 3T4CA 1IEQA 2ZX6A 4KS0A 4RZ6A 2XWEA 5REQA 1Q6FA 3M6DA 2ZUVA 8XIMA 3VKAA 3EB3A 3U3HA 5I07A 1JYVA 3EA3A 3BE7A 2QUMA 1EO7A 1JAKA 1GYMA 4CNPA 3ZO9A 1Z42A 4DPQA 4GIEA 3U57A 1O12A 3Q94A 3CZGA 4JTUA 2EPLX 3VFLA 4PBFA 5C2XA 4XUGA 1H62A 3MWCA 2V2HA 3AICA 4MB3A 4N6EA 2OSXA 4EPDC 1GPFA 2AGKA 3BO9A 2C1GA 2CLEA 3TWAA 3C2EA 3WL1A 1QAPA 1D9EA 4UMCA 4UMAA 1TQXA 3GAKA 1N2VA 1M6JA 1QHZA 1VBUA 1RPKA 1MNZA 5FCZA 1KR1A 2DP3A 3G0XA 3G2GA 4GYPA 4KCTA 1Q66A 4K36A 2A7NA 1OGGA 5A6MA 1OYBA 4DZHA 4UMBA 4JN7A 3LY0A 1ISXA 3TAKA 1BF6A 4KPLA 3VABA 1E71M 3O6AA 1ICSA 3I6TA 1Q2SA 4XUYA 1HP4A 2Z6JA 1XDJA 4HZ8A 3ITOA 3IVTA 2QCDA 1FWFC 3OIHA 3VIMA 1F4AA 4FIRA 1XBVA 2NZLA 5RUBA 3W6LA 1FWBC 1H61A 3UY8A 4D6DA 4XB3A 3UVIA 4ZTXA 4NJHA 3J7HA 1EQPA 4DUXA 1TV8A 3CQJA 2VENA 1XM3A 4W8AA 3MSGA 3M47A 3QH2A 4Q8NA 3DI0A 1WOAA 1WAWA 3C8NA 5K4ZA 3EOSA 3UR8A 3LCFA 2YDSA 2P5NA 3THCA 4TX9A 1QI5A 4DXVA 2UY4A 2Z7GA 3RFAA 3H55A 1XIFA 4FXJA 3SCUA 3A5FA 3SO7A 3VGDA 1GOQA 1Y5VA 4HSOA 3LCHA 1DJXA 4PTMA 3TXZA 3DFQA 1J8VA 2E9LA 3WENA 3HJZA 1OYCA 1XLKA 5D32A 2UY3A 3KOFA 1WDPA 2YDRA 4OUIA 2FH6A 3W7GA 4NXKA 1BQCA 3VD7A 2PTDA 5FI8A 1KNWA 4CNSA 2ACRA 2XGZA 3N73A 1MEHA 3VX1A 3N15A 3N11A 1FH7A 3A24A 3L4XA 3TEVA 4AQLA 1WO2A 1YE4A 1XIDA 3FAXA 3GYCA 3PZTA 4GY0A 3L4UA 3W01A 3WF1A 2ABBA 4LEFA 3B9DA 3REQA 2Z2BA 3WFLA 1UPMB 2ZZ1A 3QMRA 4IGNA 4W87A 4NNCA 4M29A 4I5UA 2GJNA 1KTCA 1NOUA 1O60A 4AX6A 4PEKA 1LWHA 4AY1A 3B8VA 4QSHA 1S2TA 1FP8A 4EPBC 3M44A 1QOPA 3U7VA 3RM4A 1GVQA 1VBHA 3IRDA 3PWIA 4XX6A 4D6CA 2QCHA 5CC5A 1EGVA 3V0UA 3MUZ1 1TSIA 3LHTA 4N9BA 5I7GA 3H6OA 3EZ4A 3KM8A 3NQ8A 4JCLA 2W0UA 5EYWA 1Q6GA 3L4YA 4GISA 3RCNA 2CC0A 3IJ9A 3IAQA 4YTSA 5H91A 3QY6A 3TSBA 3OYXA 3K1GA 3EA1A 5HULA 4GINA 1WNOA 1TTQA 3VGGA 1KFJA 3FSUA 4CQ9A 4FNQA 4DBUA 3E02A 4I9TA 2Z24A 5CGTA 3GHRA 3QXBA 2PLJA 3UP8A 5D37A 3PJWA 2EQDA 1SPQA 1RAKA 1PYFA 2UY5A 4A2RA 4DQWA 1UH3A 5HNUA 4FLSA 2XIMA 4JTCA 4W85A 5B80A 3GHSA 2C19A 4PULA 2O7SA 3LTPA 3H7UA 3GU9A 4IXHA 1MWOA 1PYMA 4NZ1A 1ML1A 4L1GA 3A4WA 5AC6A 4FIQA 3GIYA 4LU0A 4LF1A 4HHMA 1O5KA 4H7CA 4TX6A 3WQCA 1AK5A 3BMWA 3G6MA 4RX0A 1CGXA 1YDYA 5CH9A 4OJYA 3GSMA 1CXKA 4MB4A 5LGZA 3TH6A 2XFRA 4FLOA 4Z08A 2WMGA 1PIIA 4U31A 4GYJA 3H24A 2XSAA 1GT8A 1OX6A 3IANA 4Z1CA 3H22A 1CZ1A 1G69A 3TJIA 3IIPA 3WQ6A 2WAGA 1XBZA 3UF9A 2DGAA 3BJFA 1F6YA 4AB4A 3EDEA 3WQVA 2CLLA 1P0NA 2PLCA 3PG9A 4IIGA 3F4VA 2QS8A 2BVDA 4HOWA 2DORA 2FPYA 3BXWA 4A8RA 1XQLA 3N13A 5BOOA 3GDMA 3O05A 2CEQA 3SUVA 3MS8A 4B3LA 1ISVA 3MHFA 4ZO6A 1A3WA 1EC9A 2D1ZA 4LS0A 3NQBA 5J04A 5JVLA 4JTEA 4UTIA 4QJ1A 4ZCWA 4P7QA 1EO5A 3RHGA 1GWJA 1GJPA 2O92A 3EKZA 3KFTA 2R91A 2HXUA 2BHZA 1BSLA 3IEBA 1AW1A 3MJMA 2J8FA 4O8RA 3ANUA 4MAZA 3SJNA 3AU6A 3MUAA 4R85A 1PVNA 2E9BA 3MY9A 1EDQA 1KA9F 1B0IA 5HINA 1TPUA 4H04A 1PX4A 1UR2A 1FRBA 1V79A 1S2VA 3SRDA 3TQKA 3WCZA 3W7NA 5HK4A 1EOKA 3EGJA 3PZQA 5XIAA 4AIEA 4H6RA 4S2BA 4ICCX 2W61A 1GKRA 3TTSA 1E5JA 2QUNA 2E25A 1ZHAA 3PF3A 4JN8A 1J79A 1ZNNA 1H3GA 2YOCA 3KBWA 1ZBWA 1W91A 3LX9A 1PIGA 1E0VA 1A3XA 4NY2A 4WY0B 2NXGA 4HZMA 3W25A 1JCYA 2RGMA 3W1UA 1DPMA 4CCZA 3VYLA 1R9ZA 1JPIA 3OVPA 5EPDA 1FWWA 4GGBA 2G5WA 4TV6A 1BQGA 3BOFA 3EXTA 3FY1A 2ZZ2A 5A6LA 3QFWA 5D09A 2DH3A 3EBVA 2NQJA 4DAIA 1Z9AA 5K2ZA 1UBPC 1TPWA 3WD2A 3N04A 4NJJA 2DSWA 4AD2A 3HGJA 1E56A 3F4NA 2RKXA 4Y9NA 1BF2A 3WUEA 1CENA 3A4JA 4O13A 3C2VA 4ILSA 2FMOA 3TQVA 4MZ1A 3W27A 1H7OA 3KUMA 3MC5A 3P14A 3KTSA 1K3UA 2C1IA 3A4XA 3WMLA 2Y5SA 2J27A 4C6JA 2PDGA 4AZ6A 1DIEA 4A6GA 3MHGA 5GJPA 2WO5A 1W5PA 2GGEA 2NQHA 4UOZA 3WIJA 4Z1YA 2PAJA 3MKKA 3W2UA 2ZDRA 4JTJA 1TPH1 3S46A 3N2MA 3G1DA 1W2VA 1BXBA 4IQJA 3ONBA 4EE9A 1OSEA 5FF4A 4BF7A 4JYEA 1KM5A 2GOUA 2NWRA 3B97A 4TOQA 5D04C 3A13A 5PTDA 3OJGA 1VQTA 3TTQA 5AHNA 2DV0A 5FJOA 1J0HA 4BKNA 1YPFA 1C8QA 3H7RA 3NAVA 3LHYA 4LBUA 5T91A 1UKOA 5HANA 1ZBVA 3E2SA 3FKRA 3CMGA 3WF0A 1V5XA 3NPWA 2EGZA 4PMRA 3GLCA 3BZGA 2AGTA 3UESA 4GI9A 1LF1A 3PZGA 3L5LA 2DFAA 3WMSA 3QTGA 1EXBA 3JZUA 4DWSA 1CI1A 2HROA 1VFLA 1PV8A 1EJVC 1FXPA 5EMUA 4HQVA 2WLZA 3WLLA 4YTTA 3M41A 3MUIA 4ACZB 3URNA 3UA3A 2YR1A 4UFMA 3H2FA 2YLAA 2IUZA 2DIEA 1G7UA 1TREA 1MQRA 2Z1SA 4OQVA 1JI1A 2B81A 3GW3A 2PDYA 1DQWA 1PIFA 3TN4A 1AH3A 2OZ8A 1XX1A 4V1YA 2V63A 2FGBA 4MDPA 3EMQA 1SZFA 3B8TA 2WHLA 4OBTA 4C1NA 2FDSA 2CKSA 3ITCA 3MDUA 4YWIA 3KZPA 4IT1A 1DYSA 4KBXA 1UMLA 1EKOA 3AHTA 3WQ5A 3BQ6A 2PTWA 1G01A 3LSBA 4ATLA 3AXIA 1AL8A 4IIEA 3QM3A 3T0CA 3H4XA 4DM2A 3WDQA 3NYZA 5AHEA 1C7SA 5A69A 5FJIA 2ZZ4A 4IIHA 3N25A 2JALA 2PMQA 1V0KA 1QU4A 1KCZA 2YCIX 1VD6A 1QO2A 4LNYA 4PUUA 2WB5A 4DJDA 5IBXA 2I57A 2J7BA 4AYSA 1XG3A 4XAYA 2D20A 4E2DA 4HOZA 4HNNA 1KW1A 4CCCA 1RVGA 4U33A 5DCEA 4LYPA 4KEZA 5LNRA 3WH9A 3PSVA 2BMBA 3TYBA 3IGXA 3CJPA 2XGIA 3DH7A 3XIMA 3C4UA 1KFWA 1P6BA 1J6PA 1X39A 4DJDC 5I78A 1MEIA 1E55A 3GRIA 4M7TA 4Y9PA 5DBUA 2E3ZA 1VJSA 1HW6A 3FDKA 1UH4A 2OX1A 1V8EA 5BCAA 3P0WA 1DQXA 1THFD 5LIXX 3IJ6A 2NQLA 3NDOA 3GKFA 1QMLA 1XR2A 2VGFA 3C3NA 2Y1HA 3AMLA 4GY1A 4PB5A 1RPXA 3TXVA 3NFUA 3ZYZA 1JUKA 2VD9A 1TMHA 3BLKA 3WBAA 1YNPA 3KBVA 2IQTA 2VI0A 1POKA 1L6SA 4X2PA 4J4KA 4MJ2A 3PPGA 3LHZA 3MYPA 1CGUA 4BWLC 4I5XA 4N0RA 1NWSA 1TV7A 1XIBA 5CC3A 2TODA 3D46A 4XWUA 1PUDA 1JL8A 4JEQA 4PUMA 2ZZ3A 2WHKA 3EOLA 4JKMA 4UXDA 1DVJA 4DJDD 4IXXA 2H90A 1FOBA 1XYBA 3GU2A 1UC4A 1K8CA 1KD0A 1B57A 3WLRA 3G1YA 2IMRA 1V7AA 2GVLA 4DUOA 1DWIM 3HF3A 3S6DA 3QMTA 2BHYA 3APYA 3EPNA 3GVGA 4GPNA 3EDDA 3UXAA 3STGA 3BL3A 3U4FA 2YFOA 2BG5A 4UB9A 4LOCA 1UW9A 3PPFA 5T9CE 2J88A 2R24A 2NVAA 4HNUA 3OGSA 3WH5A 1E6XM 4UTWA 2CETA 1OWQA 3GDRA 5DX7A 3T0BA 1A53A 3WNKA 2GGJA 4MY8A 1QXLA 1FXQA 3LRKA 3OA3A 4AF0A 1BEUA 2EHHA 3HPZA 3VNIA 4GVHA 2WHMA 2PLMA 4EXAA 1UOZA 3G1RA 4C6IA 3WF2A 3CUHA 4LVFA 4OOUA 3BARA 2QV4A 3UCDA 4CN1A 5D9NA 3OU8A 1BKSA 3ME3A 4MOZA 3ZS4A 6REQB 5KZDA 1H4PA 1BGGA 1OFPA 3SEPA 4AEEA 4Y6GA 4ZE4A 1PZ2A 4BI6A 3SADA 3TLLA 1NOWA 4RE4A 1H49A 2RGLA 3UWUA 5EU9A 4N7QA 3IGUA 1IR1A 4XZ9A 1VFFA 3AMGA 3LRMA 1KTNA 2QULA 3L65A 4HN4A 3TYAA 4WVXA 4QJ3B 4E4FA 3CWHA 4NP7A 2VRKA 1O1ZA 2J24A 4J5NA 1BLIA 3FW6A 4ZTYA 2OOFA 5CZSA 1J01A 3C2YA 2XWDA 4B5WA 1VC4A 2CCRA 3OOQA 1JFXA 3WLIA 3W81A 1OC5A 4NJKA 3W85A 2VGGA 1KFBA 3UWYA 3MYOA 3MI2A 3QFEA 2PDPA 4EIVA 1SW0A 4GC3A 4O0QA 2C1HA 3STPA 4DJFD 3TW7A 3ITTA 2QMJA 4CCDA 1HL2A 1FUYA 3BWWA 1IWBA 1U1UA 2W6RA 3EWUA 1L6WA 2C6QA 5E09A 1CWYA 2FVKA 3RO6A 3TYDA 1BXCA 4UTLA 2ZICA 1MNSA 1OX4B 3AAMA 2R8WA 2V67A 1XPYA 1AQHA 2EKGA 3SSJA 3UFYA 4L9XA 1C3FA 3WKZA 3LXCA 4HP5A 1SJBA 3VOCA 3GR7A 4LV4A 3RF9A 2E6DA 1F8MA 2VX4A 1G4EA 1ECEA 4O1EA 2O55A 1DWHM 3U0HA 4DWSC 4WHBA 4JY9A 4OTKA 4XZLX 1ZBCA 2WC7A 1V08A 1J2BA 2YZRA 1WUFA 3PB0A 2PGEA 3PBMA 2OX4A 3MWAA 1CLXA 1K7EA 4M0XA 2PDBA 3GH7A 3SDOA 4H4IA 3MVTA 3PTMA 4O14A 4ROQA 3A22A 1ZJBA 1S2WA 3F2CA 4FSAA 1IEIA 4HCDA 1YADA 1O1HA 2BASA 4Q8PA 1XKYA 3WK0A 2ZVIA 1XIEA 2BY2A 6REQA 3W7OA 4ERGA 1EA9C 2OGYA 4I7VA 4O50A 3LA4A 4AMAA 2OR2A 1CNVA 4E2VA 1XLLA 2G50A 1A5OC 3EYPA 1UZHA 3Q2DA 3VILA 1L8NA 3WLMA 3C0LA 4B5TA 3I3DA 2WXDM 4YU1A 2H8XA 4P7RA 3THDA 4TTGA 5ABGA 3IACA 3VO0A 1Z44A 3TAOA 3AQUA 4YMZA 3GXTA 3M9YA 4A8LA 3WNNA 3O7UA 3OPSA 4WUIA 2D3NA 4AY8A 3ITLA 2G37A 4JTQA 1E5NA 4ZENA 1YNQA 1J4EA 2GQ3A 3L4WA 1IIHA 3HMJG 4R34A 4F9DA 1K8ZA 4C6KA 2G8ZA 2ATMA 4QX4A 4LRSA 1A5CA 5I5RA 3PTQA 4LNCA 3BLIA 4JTHA 3IIVA 1E4NA 2PRMA 3U9IA 1NVMA 3IIXA 4ZO7A 5DXXA 5A2CA 3ZVHA 3VE7A 2W4XA 4ZQPA 4CUCA 1RVKA 3MV11 3S42A 4O18A 1REQB 3GHTA 3IJ8A 4XO6A 1DJHA 7CGTA 3W4RA 1B54A 3G1SA 1W3HA 4ZQMA 5CGQA 1VKFA 4J35A 3EWZA 4O16A 4J3XA 4ADUA 4HPGA 3AS0A 4WIWA 3LENA 2JBMA 4JTFA 3W2KA 4UQ9A 1EA0A 4JNZA 4XO7A 2D2HA 4H00A 4PN2A 1GQIA 3G1AA 4FS9A 3P80A 5M5DA 2ZTKA 5D8WA 4AZHA 4DIAA 4U2YA 4H3DA 4E4PA 4HGXA 1WKFA 1LLOA 4HIBA 4L6OA 4C1KA 1ZB5A 2QXWA 3R0UA 1WUEA 2WSYA 1E3ZA 3T0DA 4EPKA 1ZU8A 7REQA 1LP6A 4PUJA 1EGZA 3AALA 1T8QA 3PR2A 3FAWA 2WZHA 4JQ3A 1S5TA 3TA6A 4LALA 5LIWX 1GEQA 1C9WA 4LAOA 2IKJA 5I3DA 5CSSA 3PZNA 2X1IA 3R58A 4HT3A 3AHVA 3HOJA 3TA9A 2XN2A 4U3CA 2VX6A 2EG8A 4Z2LA 5FKYA 5FEZA 2PGFA 3A3WA 3KWXA 2BFGA 5T26A 4GO9A 4RKAA 1BFNA 2ZX8A 4UBPC 2PC8A 1KWGA 1O68A 2AKZA 1KGXA 1Y5WA 2INZA 3FJNA 2A7PA 4HNCA 1F74A 3RLVA 2A4AA 2Z27A 3JRKA 4GUIA 4QDPA 3I6RA 3EKLA 4B5NA 3VTRA 3CLWA 1ZY9A 2C13A 4A3HA 2OOGA 3W2JA 2PTXA 3MMWA 2EPMX 4RE2A 2J8GA 4MUPA 3GR4A 3G0UA 1A50A 1YYAA 4NASA 4E5TA 2XM1A 1JZ6A 3CZJA 3NA8A 1ISYA 4HMEA 3LM7A 1OFOA 2P3ZA 2QW5A 4MFEA 3CU2A 4GJIA 1NDWA 4DHGA 9XIMA 4WOQA 4B5UA 6PTDA 1XQKA 3SY1A 3RCMA 1PCWA 3EWXA 2ASHA 3TN3A 1PHWA 4FPSA 3TJLA 4UTHA 2NSXA 3OODA 4A05A 1SO5A 1FH8A 3B40A 3IARA 3E3HA 2P0OA 3RU6A 1WE5A 2V69A 3RMJA 2GWGA 4IMEA 4UR8A 4LH8A 4M3PA 4E38A 4UQBA 1JI2A 1DTUA 4MM1A 2PDQA 1TVNA 3W7KA 3N2OA 3TE9A 3ITVA 3VNDA 5CG0A 4XTIA 5HR7A 2CLPA 4HK5A 2ANUA 3GHUA 4L6DA 4JIHA 3NZ1A 3GZAA 3N9KA 4UR7A 3BUVA 1BWLA 3OBEA 2ZE0A 2JF7A 3GDKA 3UA4A 4GNKB 3TONA 1S46A 1SZRA 1RSCA 3QC0A 2XGBA 1SJAA 4PCTA 1D3GA 4RR4A 1E6PA 4OV9A 3UWZA 4L56A 1VENA 1RQBA 5CAHA 3FJ4A 3GO2A 3NUKA 4Y2WA 3NPXA 4ADSA 1UKTA 1K03A 3B8IA 7A3HA 1XGEA 2DZWA 4ES4A 3B4YA 1K9EA 1XYZA 1B3WA 4OHQA 1W9VA 2ZRXA 1Q7MA 2F9RA 2WKLA 5CCZA 5I23A 1JXJA 3P3BA 4U5KA 3BLDA 3SJ3A 1JF5A 3PZIA 2NXHA 3LI1A 3PBVA 4UTFA 1KXVA 1G1YA 2PRHA 1MSSA 3E74A 3GNOA 1QI0A 5LHEA 3NL6A 3CHDA 2J66A 3OZOA 1TWSA 5A8NA 3T81A 2G95A 3APGA 2QQ6A 4PTNA 2VEKA 3GG8A 2PCQA 4Z1AA 1MW2A 1FKWA 3W1LA 4AX7A 2VO5A 1V93A 3NNTA 3V5CA 2DJLA 3CQIA 5AC7A 1QOXA 1WOBA 4IP4A 1CXLA 2XTKA 3GVQA 3LXBA 2R1PA 3DEQA 4DLFA 3LU2A 1XXXA 1AD1A 4M81A 4IM4A 4B3KA 2ZWZA 3F5KA 1BD0A 2D0FA 4MY9A 4H6QA 4OKDA 1ISWA 1PBGA 4NILA 4GXMA 3N34A 1W6TA 1JQXA 4PH6A 2AMXA 2WQPA 2W63A 2Q09A 1GJWA 4J3V