1A5BA

Cryo-crystallography of a true substrate, indole-3-glycerol phosphate, bound to a mutant (alpha d60n) tryptophan synthase alpha2beta2 complex reveals the correct orientation of active site alpha glu 49
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
268
structure length
249
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLANGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE (ALPHA CHAIN)
publication title Cryo-crystallography of a true substrate, indole-3-glycerol phosphate, bound to a mutant (alphaD60N) tryptophan synthase alpha2beta2 complex reveals the correct orientation of active site alphaGlu49.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 91
structure length 249
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 1998-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1a5bA00
3L21A 2WO5A 2X2GA 1RD5A 5AHFA 2UV8G 3LCFA 2PURA 2DP3A 3WK1A 4MJZA 1PIIA 3NPVA 2ZRUA 5BMWA 4K8EA 4TR9A 2YX0A 2P10A 3EWXA 1GJPA 3SGUA 3G1HA 4EOUA 1TTIA 3BLEA 2WNZA 1A50A 1H1ZA 1QNVA 5KINA 1Q45A 3GR7A 3L66A 3VI2A 3W1PA 3W2NA 1JCMP 2FDSA 1GTHA 4TIMA 1LROA 4OBTA 3TV8A 3HG4A 3SECA 5BNKA 4QQ3A 1XL9A 5E0KA 3L68A 4C1KA 1SPQA 3EWZA 4NU7A 3PSWA 2GUUA 4MIMA 2B7OA 4K7YA 4R7JA 3T4CA 3T55A 3S5YA 4N6FA 3UY8A 2CLFA 3IIPA 1GYNA 1HTIA 1JRBA 1KFLA 1W37A 3BW3A 1IGSA 1FDJA 3NQ8A 3Q94A 3NNTA 1SZNA 3BLIA 3MUXA 1OFDA 2EAWA 4ZL1A 1OX4A 1IIGA 2JGYA 1KTBA 2QF7A 4Z1DA 4A3UA 3TC6A 3LHZA 1DQWA 2QUVA 4JXCA 4RCXA 4I7WA 2O7SA 3W83A 1G4TA 4Q4KA 5HWJA 3LLFA 5TIMA 1KLYA 2A85A 4O19A 2B7NA 3W7IA 2C1HA 2EHHA 3MP5A 3M5YA 3LHYA 2G96A 4IGHA 3W7JA 2ZZ6A 2CZFA 3NQFA 1VPXA 1MEIA 2C13A 3P62A 1UUMA 1GG0A 4WD0A 3WJXA 4OU1A 3OG3A 1TYGA 5G5IA 4O12A 1KM1A 3HGSA 3N9RA 4ADSA 2YPIA 3UNDA 3G1FA 1VHCA 4MYAA 5EMUA 1YDVA 4FEZA 3UWUA 3W22A 3HGOA 1LRQA 3W2KA 1F5ZA 3QMSA 5C5YA 3MI2A 2H8ZA 1PHQA 1SZGA 1JQVA 1FQ0A 3IGUA 3PY2A 5FF2A 4O4VA 2X1TA 3LI0A 4JTLA 1Q3NA 4LTSA 2VFDA 5LGXA 2DJXA 5F1VA 5HR6A 2YGYA 3TJLA 1YLVA 3W2UA 4PC8A 3HOJA 2QCHA 3E0IA 5TBOA 3G18A 3OHIA 5F2LA 2FJKA 3Q58A 3WJWA 2VEKA 3BPWA 1G69A 3GKAA 2PCQA 4DXVA 3USBA 3PS7A 3W84A 3QMTA 3W3OA 4BFAA 1PS9A 5EL1A 1JCLA 4RR4A 4Y96A 3A5FA 2V2CA 4JDYA 4OV4A 2FB2A 3P84A 3UD6A 3A5VA 3W6YA 1KM4A 3GDMA 3KVMA 1V7YA 2YFNA 1BKSA 1HG3A 1W1ZA 2Z0IA 2A5HA 3LM7A 2PRLA 5HWNA 2NX9A 5C6MA 1OK6A 2TPSA 3NL2A 5LHFA 1NVMA 3GIYA 5D09A 1TPVA 4OE7A 5FEWA 3JS3A 2V2HA 3M5VA 2VEIA 3NL6A 1I2RA 4M7SA 3W1XA 2Z2UA 1FXQA 3MP3A 4E2DA 4I7VA 3C0JA 1KM5A 5D05A 2E09A 1TPB1 4JGDA 4JTKA 1EWEA 4LRSA 3CC1A 2Y63A 1M7OA 5GVJA 1UB3A 4IMEA 5BMXA 4UTKA 3FJ6A 2AAMA 4FX8A 4MUZA 1JUBA 5LNSA 3ZWTA 2Y7EA 1FWWA 4FNPA 3CLMA 1K7FA 3A9IA 1OFQA 3L0NA 3BW2A 2FPTA 3NZRA 4LVGA 4LC8A 1N8FA 4UTJA 3EWYA 1QPOA 1GQNA 3C8FA 1WA3A 3NOEA 4UTWC 1H60A 2V5BA 4MY1A 4CNNA 4JX6A 3C2OA 4PFMA 3WJZA 1XDMA 3SZ8A 4ALDA 5D02A 5K4XA 1LOLA 1TPDA 1AW2A 1AW5A 1HO4A 4O0ZA 3W23A 4W9TA 4DO4A 4FB7A 2YSWA 5L6UA 3LV5A 4AEOA 3C6CA 2G95A 4XKYA 2WSRA 4ZQCA 3NAVA 2CLIA 3NZ1A 1SUXA 2E6AA 1QO2A 3W1LA 3EX2A 2RKXA 2WSYA 2A0NA 5LZLA 4S2CA 3DFQA 5DCDA 4UCGA 2GJNA 1KA9F 4X22A 2CLLA 1EP1A 1GVRA 3QFEA 3S1VA 5H2ZA 2X1RA 4AB4A 3G0XA 3RU6A 1K8YA 3NQMA 3NQ7A 4XWUA 3EX4A 1TPC1 1S5TA 4QNEA 1JUKA 3S5OA 4HHPA 1QPRA 3CPRA 3LCWA 4MZYA 3TUUA 5A5WA 3A21A 3I65A 4BR1A 5D32A 5D03A 1LZOA 1EA0A 1Q6RA 3L2IA 1Q6OA 3GYEA 5DELA 1DBTA 4WUIA 4Y9AA 3QMRA 4X9SA 5CG7A 1FCUA 6TIMA 1O5XA 3P5ZA 2DJLA 5LNUA 1VHNA 4LV9A 4RKAA 3N73A 2F7FA 3SIZA 1W8SA 3A22A 1XBXA 3R13A 2QCMA 3LX9A 2V30A 1ZAHA 5DBTA 4RV8A 4E0CA 3P61A 3SW6A 4AVFA 1C29A 2A6NA 1TV5A 2NXHA 1VS1A 3ZFHA 4A21A 5DY2A 2DZSA 1ZENA 1TQJA 3QZEA 4UMBA 5AYZA 3SY5A 3LXBA 1X1ZA 3HF3A 3MBDA 3L5LA 3TH6A 3P8JA 1AW1A 4UMAA 5EKYA 4GC4A 3EKZA 1NF7A 1XCFA 2BXVA 3TDFA 1ZJIA 2JKAA 2YCEA 3UWYA 3NXFA 3BG9A 2VC6A 4LVAA 4IMDA 3VE9A 3MI6A 3STGA 4AHPA 2ZRYA 2JGQA 4MZ1A 5AHIA 4RJEA 4LT9A 4M6PA 3W1TA 3NQDA 2QAFA 4FO4A 5K7JA 4D2JA 2E5BA 1SU5A 2J6XA 1BTMA 3NVTA 1TPWA 1TO3A 1PHWA 3B04A 2RDTA 3TC7A 2ZZ5A 5IBXC 5I3IA 1S5WA 2GJLA 1TV8A 1MEHA 2P0OA 4HNUA 2FFCA 5FEPA 3FYPA 4GXMA 1CW2A 3RNDA 2IQTA 3VCRA 4UUIA 2V81A 4Y90A 2XFWA 4YWIA 2GQ9A 4IMCA 1XI3A 2Q3OA 5I3FA 3MI3A 3OVPA 2JBMA 3B4UA 4NQ1A 3KX6A 4FX7A 2ZZ4A 1TJPA 1UASA 4WY0A 2OT1A 4Q32A 1W56A 4IQLA 1KM6A 4UTMA 3KRUA 5G2HA 4BI7A 3QJAA 1J4EA 1SSDA 1P5BA 2BX7A 3DXIA 4XBSA 2KZHA 1W54A 2XN1A 1GVQA 2HS6A 2FIQA 4WY0F 1MO0A 3PWAA 3TA6A 2ZFAA 3C2VA 3NQVA 3QSRA 5FF4A 1XBYA 1OYCA 2J9XA 4MVAA 3M9YA 3UWVA 2WOQA 1ZAIA 1BEUA 3P5YA 1W5QA 1LM1A 1SR9A 1OABA 3EX1A 1NF0A 1Z44A 2FQIA 4LW7A 2XN0A 4LWWA 3W1QA 4IMGA 1RR2A 3P81A 1RQHA 2I9EA 1IXNA 1R46A 1X8FA 4XUGA 1TRDA 4DO6A 1QPNA 4HNNA 1VCVA 2C14A 1W5PA 1PV8A 4JTTA 2QCCA 4WOZA 1TPFA 3N2MA 1DOSA 4S2BA 1KTNA 5D2WA 4HSNA 3TFXA 2V2DA 2VKZG 5BRBA 5KZEA 1DJNA 5AHEA 4K39A 1JRCA 2ZRVA 2QCDB 3O63A 1H50A 2ZRZA 4RK8A 3LCLA 1H7NA 3GKFA 1QWGA 3EX3A 2QDHA 1O4UA 4K7VA 1A5AA 3DENA 2PRHA 3G3DA 5CSRA 3LERA 3EKLA 3M16A 3BG3A 1TV7A 4DPPA 3AO0A 4JICA 2BTMA 1QCWA 1OG0A 1I2PA 1XFBA 3NQ6A 4H3DA 3G24A 2HTMA 1O60A 1XDLA 4ZVJA 4NJGA 1O5KA 4O10A 5HULA 3TAOA 3QYQA 2AQWA 2Y70A 4KWWA 1OX6A 4LS2A 3INPA 1TB3A 4NNBA 1TMHA 2VENA 4ZQNA 1ADOA 1FDZA 2ZTKA 4UFIA 3W2JA 2WNNA 1F76A 1QAPA 3TR2A 1GVSA 4Z0SA 3G3MA 2FTPA 3PR2A 4JR5A 3M1ZA 2B7QA 3IIZA 1FY6A 1SZEA 5T26A 1JQXA 3G8RA 5DBUA 3HJZA 4PL1A 3NA8A 1BWKA 1OYAA 4JTUA 5J5RA 5DCEA 3M5XA 4Q33A 5F2IA 1YTEA 3O05A 2NX1A 3PUEA 4IPJA 1J2WA 4AHOA 2YW4A 5D37A 1OFEA 2WKJA 2DZVA 2X1UA 4N2YA 2CZ5A 3NQGA 4Z0JA 3A24A 2QR6A 5HINA 4DF2A 2Y62A 2QKFA 4DEFA 1GOXA 3GDLA 4E2BA 4TX9A 4NJHA 4CLMA 3SGZA 4IXXA 2B7PA 4OGZA 1UJPA 3GXPA 3HB9A 2J88A 2V0TA 2E5DA 2HS8A 3FJLA 2QUUA 4O4WA 3IVSA 2Y89A 4GJ1A 1LLZA 3QC3A 1WV2A 4MPQA 4TU1A 2O7QA 1EP2A 3LTSA 4DF1A 3DU0A 3G1YA 3L0KA 4IXHA 4U4MA 1LOQA 4O18A 4HNVA 3TCEA 2NV1A 3P67A 3I7RA 3QF0A 3LCGA 4ICNA 4EF8A 3L67A 3B0UX 1JUEA 1W0MA 4LVFA 1VCFA 4NXSA 5F1UA 1SQ7A 5G2WA 1GT8A 3G1XA 4YCPA 2NXGA 5D2XA 1VLWA 1LRTA 3VNDA 2C15A 1S3HA 2ZBTA 2WSQA 3FA5A 1OX4B 3NQCA 2NWSA 3QPYA 3IGXA 2GVLA 3CHVA 3OA3A 2NUYA 3E12A 1NFBA 1GTEA 2C6QA 3KRSA 4M5PA 4WX2A 3W7DA 2QDGA 4TMBA 1LLWA 4JD4A 5KITA 4LRTA 1G67A 2YZRA 4DELA 3G1SA 4UTLA 4JY9A 2A1YA 5E93A 3G1AA 1XUUA 3NM1A 3MBFA 2CLMA 5FESA 5HJLA 1K02A 5CGQA 1K03A 4O50A 3T40A 1CI1A 1VR6A 2E5CA 2VEMA 3WFAA 3TE9A 1OFPA 3LDVA 3TROA 1VH7A 1F73A 4O57A 1PCKA 4KFNA 4Z08A 3LI1A 3V1PA 1I4NA 1QFEA 4M7TA 3ZR4A 5I3KA 1TPH1 1L2UA 3ATYA 4FIQA 2B4GA 2B0MA 1HO1A 3FS2A 1GVOA 1KBJA 3CM4A 5FF0A 3ABOA 3TSDA 3OEXA 2A4AA 5HNRA 2H3BA 4UMCA 1QOQA 4PL2A 3UWWA 5D04C 4JYDA 3W88A 4OHQA 5LHEA 3PB0A 3IIOA 4IOTA 3BW4A 3W7OA 3W1MA 4LVDA 2A6LA 2Y7DA 5U7SA 1R47A 2TSYA 4GUFA 3P60A 4BF9A 4M19A 4Z1BA 1YPFA 3TXZA 2ZQ0A 5CZJA 1H62A 1XKYA 3SR7A 3U2OA 3TW6A 2C18A 1V5XA 1K7XA 4KFPA 1W5NA 4UXDA 3ELFA 3HPZA 1SO5A 1AK5A 3MMTA 3KFTA 4O17A 2YYTA 2I1OA 4PCFA 3GDTA 2A7RA 3IVTA 3P74A 4AAJA 4E38A 1C8VA 5D30A 1IXQA 4IPIA 1JCYA 3R12A 2Y6ZA 2FB3A 4UFHA 3NGJA 2Z6IA 5C55A 1KFCA 4BWLA 5F2MA 1XBVA 3UPWA 2H8XA 3N19B 4LS0A 3C3NA 1P0KA 1MEWA 2RH9A 1LOSA 1ICSA 1OYBA 2VFHA 3I6RA 1L6WA 3IGSA 5HUOA 1KV5A 4G1KA 4JTEA 3NR0A 3HGRA 1VC4A 1AG1O 4X3ZA 4Z1AA 4GNJA 2EGZA 4JTJA 5AB3A 3O1NA 2V9DA 3S0CA 1EPXA 4Z1CA 3LBMA 2RDWA 1FCQA 1RVGA 4AMAA 2ALDA 1W3NA 5K9CA 3I7SA 1FWTA 2X16A 3W70A 4Y8FA 4L4LA 5AHLA 3N2XA 1FCVA 3N9SA 4POCA 1LRNA 1DL3A 3GZ3A 4A2SA 2FPVA 2E6FA 3EXSA 1Q6LA 4JTIA 1OF6A 3O6DA 2CLHA 3TSMA 3W1AA 3TFCA 3W75A 4HSOA 1DQXA 4P2VA 1K8ZA 3BO9A 1HL2A 2QCEA 3LBCA 3VKJA 3DGRA 3LCXA 4WZHA 1P0NA 3QPZA 1A5BA 3CEPA 3TW7A 1F7BA 1UCWA 1EEPA 1KM2A 3UXDA 4JIPA 2H90A 3LGEA 4EIVA 1DHPA 3PULA 4GUHA 4O54A 4OT7A 3TU9A 2GQAA 3NPUA 4XKYB 1RV8A 3I68A 3ABSA 2OJPA 1C9DA 5AYYA 1SW0A 3W2MA 1KTCA 1TPUA 4QIUA 3TQKA 3NQEA 1JCXA 4Y6GA 3B8DA 1M5WA 2ZRWA 1EIXA 2Y7GA 3PC0A 3O6YX 5TQLA 1G6CA 2J9YA 1EX5A 1U83A 1LBFA 5C54A 1SO4A 3PVFA 4QJ1A 3STCA 1HUVA 4WXZA 3C2RA 4MY9A 4FXSA 4O28A 4P61A 1KM0A 4WJEA 2NUXA 5I3JA 3QEZA 1R2TA 3HO8A 2TRSA 4UFKA 1L6YA 3UQNA 2GVGA 3OVQA 2V8ZA 3S5NA 3TX9A 3W76A 3KXQA 3QQ0A 1MSSA 4FIRA 3S42A 4HIBA 1B3OA 3LHTA 4ORIA 3UZ5A 4A2RA 4CQ8A 1G4PA 1XXXA 3VFLA 1Z48A 3PAJA 4KWVA 3S1WA 3M44A 4FNSA 1AL7A 5FI8A 5G1TA 1DV7A 2X30A 4R53A 3W9ZA 5I3HA 2QJHA 3ABRA 2QUTA 3EWWA 3VE7A 3GVGA 4O53A 1D3GA 4N4PA 1WAUA 3W2LA 4B5NA 3HG5A 1QMLA 4O11A 4UNKA 4WOQA 4ADUA 4UTTA 3NQAA 3F03K 4AF0B 4H4IA 2Q8ZA 5AN7A 4O1CA 5FEXA 4MOZA 4UIOA 3O15A 4XQ6A 4C1LA 4DPQA 3RLUA 4N4QA 3MHGA 3MO7A 3KAOA 3E49A 3UZJA 1A53A 2ABBA 3GR8A 2JK2A 1G4EA 3LCIA 4XTIA 3B0PA 1QR7A 1TTPA 3N3MA 3W7GA 4BI5A 4JX5A 3C56A 1VZWA 3B06A 2VFEA 3THQA 1LP6A 3FYOA 4JY8A 4ZQOA 3BG5A 1OFBA 1FXPA 5U4NA 4PTNA 4UFJA 2ATSA 7TIMA 5CZSA 4JTFA 1OFAA 3U6WA 2GQ8A 3EEGA 5CPNA 3G1DA 3TQ0A 4WY0B 3CWNA 3KVJA 3OIXA 3Q37A 3LLDA 3F4NA 1LORA 3LHUA 3EX6A 2ZA1A 1FWSA 4FXRA 1TQXA 1XC4A 4K36A 2P1FA 2TMDA 4NVTA 4A29A 3UPBA 3LCHA 1X7FA 2HMCA 3LXAA 5F4WA 3DHDA 2JKEA 4GFSA 4IWWA 4LV4A 3RK8A 3W72A 3NM3A 1YPIA 3ATZA 4ADTA 1H7PA 1GYLA 4PODA 3LRMA 3HMJG 3FLUA 1F2JA 2I14A 4L4MA 2G5WA 1OX5A 3MWAA 4H6KA 4LS1A 1FDYA 3TMQA 3STFA 3WJSA 3E02A 4YL2A 1YXCA 3QH2A 3TK7A 4LUIA 2LLEA 3W7EA 4GUJA 1LYXA 4M6VA 2OT0A 1FX6A 3W7RA 2ZCGA 3NO5A 3HPXA 1EP3A 2VFFA 1Z41A 3LB0A 5KTLA 2VFGA 3IVUA 3BARA 2EF9A 4AHQA 4O1BA 1TPEA 3W74A 4NJKA 3CT7A 2Q8LA 5KMYA 3RFAA 1JCNA 1OJXA 3SFKA 3WJYA 2OCZA 3DAQA 5DXYA 1AL8A 1P4CA 4UC5A 5G4WA 2DZWA 3T44A 1IXPA 3S9YA 1LDCA 1ZAJA 4EVZA 3W7CA 1OK4A 2ISWA 3PBUA 3BLFA 3P82A 2C16A 3P7YA 4OWGA 2BSLA 5CSSA 3I7QA 1K7EA 2C19A 2RDUA 4JEQA 2WPBA 4RZ5A 4RX0A 1N7KA 2H3DA 4CQ9A 3IRDA 4GUGA 5D33A 4AWTA 1VCGA 1ZCOA 5AC8A 3GNDA 2PC4A 3P80A 3L65A 3NYZA 4UFLA 4YXGA 2ZA3A 1G7VA 2E77A 3F1QA 3FOKA 4O1DA 3W7PA 1WQ5A 3KRZA 4YMZA 1Q6QA 5L9FA 4K6AA 4JDBA 3W7HA 5DXXA 3O6CA 4YLWA 5HMSA 3SJ3A 3LRLA 3QW4B 4AXKA 1R2SA 4ZQRA 5D38A 3LTPA 3T78A 4BWLC 4WQ6A 1GEQA 2QJIA 4MJMA 1LBLA 1SSGA 1THFD 8TIMA 3TKFA 4CQAA 4LUJA 4AWUA 2W79A 5H91A 5A8GA 4LU0A 5C2XA 3MW7A 2A7PA 4QITA 3R8RA 2CLOA 4JTHA 5F4SA 5D2TA 1QDSA 3H55A 3R2GA 5AC7A 3OVRA 5FF7A 4GBUA 5DCBA 3NPXA 6ALDA 1D9EA 3W7MA 3NQ2A 4DQWA 2H6RA 5FF3A 5K9XA 2PE4A 5DLCA 2NV2A 1QOPA 1S5VA 1WYIA 5I3GA 3STEA 3C2EA 4MFEA 2WQPA 4JYEA 2QEZA 3DBPA 1GG1A 4K38A 3GAYA 1WDWA 1TTJA 2CLKA 2ISVA 2CFFA 3B05A 1ICPA 3KVLA 4N9DA 3G0UA 4N9BA 4TO8A 1P1XA 5LKYA 2NWRA 2QAPA 3KOFA 4OQVA 4RZ4A 1DORA 3BGJA 2YXGA 2CZEA 1E51A 4IX2A 3GDKA 4QNWA 2QCLA 3DHFA 4PEKA 1ZNNA 3O8AA 3MP4A 4N02A 3TMLA 1R2RA 1EB3A 2J24A 5AHNA 4AH7A 3C61A 2ABAA 3HGJA 1B4EA 1W31A 3LRKA 3RF9A 2CLEA 3WK2A 3HPSA 1YADA 4ORMA 2QCGA 3PBVA 1SFLA 1WOAA 1FWNA 3IV3A 4XZ9A 1UUOA 5CPMA 1T99A 3CTLA 4WXYA 3OBKA 1H5YA 3CU2A 4ML9A 4EWND 4CCEA 3FEMA 1F6KA 1OFRA 2R14A 3P8IA 5EYWA 1TIMA 2Q3RA 4FNRA 2GVJA 1JJKA 2WNQA 2CWNA 2D73A 3GDRA 1I45A 1FCBA 3QRHA 4KKXA 4EF9A 1H1YA 4NNAA 4UTUA 3M6YA 2ZZ2A 1VGAA 4BI6A 3PSVA 5FEZA 2V82A 2Y7FA 3UWQA 3L9CA 1A5CA 3B03A 2FLIA 4HT3A 2E6YA 1N55A 3C4UA 2VXNA 4YCOA 1DKWA 3TJXA 1MZHA 4QM1A 2C3ZA 4JYFA 1RQEA 3G22A 3EWBX 3E9AA 2RFGA 4ZMGA 4XTDA 4AWSA 2EPHA 1JCJA 1VYSX 3TXVA 5IM51 2QJGA 5LGZA 1W3TA 3NPWA 2Y61A 3NEVA 4CCDA 2CW6A 2ZZ3A 4NXKA 2TYSA 3K30A 1L9WA 1PVNA 5CZTA 3S8HA 3PG9A 4MKNA 4MZ8A 1W5MA 1KFEA 3MJYA 4O1AA 1A5SA 1F6PA 3IIXA 3L5MA 1OFOA 2YFOA 1D3HA 3GLCA 2BWGA 2VELA 4ZQMA 3ANYA 5K4ZA 1ME9A 3GX9A 1LBMA 1YTKA 1VLIA 3EXTA 4IUOA 4UTTC 4DBDA 3ZWSA 1IIHA 1DVJA 5ABTA 4RZ6A 3S1XA 1F05A 4K8HA 4PH6A 4IX0A 3O07A 4JTGA 3S5ZA 4OV9A 3PG8A 4MLJA 3S6DA 3R5EA 1TJRA 5AYXA 5E1QA 1T96A 4NT0A 4LOCA 2ZYFA 3HG3A 2CZDA 1GZGA 3DFNA 5SWUA 5DN1A 2QCFA 1H61A 4MYXA 1YXDA 3BGGA 4TMCA 1NAL1 5MHBA 3E96A 2NZLA 3PUDA 5KZMA 2A7NA 2OMAA 1WX0A 3MHUA 3YPIA 1VJIA 3GXNA 3LHWA 3QQ1A 1X1OA 1FWRA 4GRSA 2DU2A 3W86A 2YDAA 5DY3A 4JNMA 1JULA 2QCNA 2DZTA 1O95A 4R33A 3TQVA 4HKPA 2WV8A 1G7UA 1TSIA 3ZS4A 1H51A 1YXYA 5LNVA 2A21A 1Z42A 4GUIA 1GVFA 2E1DA 2OX1A 2BLEA 3T7VA 2GPTA 1RPXA 1B4KA 5HWMA 1AMKA 4ONVA 4FHAA 4JN6A 3TNOA 5K2ZA 2FPYA 1ALDA 4RXFA 1I2NA 5AC6A 5F4XA 3PBYA 2WJZA 5CPOA 3CEUA 4IJBA 1XUZA 4O52A 4DBEA 3O06A 2W0UA 1B9BA 1KW1A 3SI9A 1ML1A 3G1VA 3DH7A 1ZY9A 1YDNA 3DKLA 2E6DA 1SW7A 4U28A 1BWLA 1W5OA 4LY8A 5K3VA 1SW3A 3UY7A 1G4SA 3V75A 1K8XA 4I7UA 1CX9A 4CNPA 4J9JA 3C2FA 3W07A 3L0GA 1EUNA 3M5ZA 3QM3A 3QSTA 1VYPX 5BW6A 3GB6A 4O14A 1KFJA 5KZDA 3WK3A 2NX3A 2VFIA 4NNCA 1I2QA 3CIXA 3B0VC 2J27A 1XBZA 3PB2A 5D2VA 3Q2DA 1KV8A 5HR7A 3S1UA 1RZMA 2R8WA 1B57A 3CB8A 2ZDRA 3MYPA 2XN2A 1TREA 1ZFJA 5D2YA 1KM3A 3W71A 4DF0A 1R30A 4JTSA 4FNTA 1FUYA 4JIQA 1JVNA 2NXIA 2E68A 5G1YA 1OHLA 3LTYA 4UNLA 1VRDA 1LTDA 2DZPA 3WK0A 1H7RA 3GAKA 3DKJA 3W7QA 1ICQA 2DZXA 2YR1A 5EPDA 4AF0A 3W7NA 3FKRA 2V5LA 4X2RA 5CZ0A 2VOMA 5F2GA 1ZHAA 3BK0A 5LSMA 1WBJA 4HPXA 5AFDA 3N34A 4QSHA 3H54A 1SO3A 2GOUA 2R91A 1KLZA 4NJIA 5AHMA 4MFDA 3QW3A 1OF8A 3W1RA 4HPJA 4NZFA 4HN4A 3PUOA 3CWOX 1IF2A 3L5AA 3NG3A 1I8JA 1H7OA 1TRIA 2DORA 3DFSA 5KSWA 5BOOA 3DFOA 3TAKA 3M43A 4XBKA 4O0KA 1ME8A 5K9DA 2ISSA 3IIVA 1M7PA 5G2IA 3CQ0A 3RLVA 4I9AA 3M0ZA 4UTIA 2J9ZA 1X6UA 3LXCA 1XM3A 3HQ1A 1KBIA 4O15A 1KFKA 3D0CA 4QAIA 5CPLA 2X1SA 1JR1A 2A2IA 2CU0A 1YDOA 4S1FA 3PBWA 2ZA2A 4N6EA 4A22A 4M6QA 2Z1BA 4LC6A 3EWUA 4NZJA 2JKPA 4LNYA 1H7WA 4NX0A 4UTWA 4QISA 5G4EA 4LVBA 3ABQA 3W73A 2DZUA 2PRMA 3UWZA 4UFMA 3W7LA 3M41A 1PL9A 3UXAA 3UYCA 3HBLA 4KFOA 1WBHA 1ME7A 1WOBA 2G97A 3DFTA 1GWJA 3W85A 3W1NA 4BK9A 2ATMA 4CCCA 3IEBA 3KVKA 4RXGA 1H7XA 4CNOA 3THAA 1FBAA 1QO5A 4K37A 2NUWA 1NEYA 3U8GA 1UBSA 4MY8A 4R34A 1W3IA 3HG2A 3MHFA 1QPQA 3GNNA 2QCDA 4PA8A 1T0OA 3G8EA 4HNTA 1PCWA 2Y85A 4MLRA 1LCOA 1YYAA 3M7WA 5EY5A 5EBUA 3HIJA 3SSJA 1ONRA 1IXOA 3G0SA 4FX6M 4NJJA 1H63A 1L6SA 3FIGA 1MXSA 4NX5A 4O16A 4ZZ9A 3DFPA 3M47A 1PE1A 1NSJA 3LV6A 1O94A 3W7KA 4IMFA 4JS3A 1K3UA 3BV4A 2ZRXA 4UTHA 3CIWA 4UR8A 5LNWA 1WXJA 2C0AA 4N9EA 1EUAA 2VEPA 2ZZ1A 2ZZ7A 1TCDA 2Y88A 2AGKA 3DZ1A 3C52A 4ZQPA 1GPWA 3R89A 5HQEA 1RQBA 3JR2A 2F84A 1SFJA 4NUWA 4O8RA 2OZ0A 5HUPA 1J5TA 3NDOA 3GK0A 3NL3A 1ZALA 3FKKA 1SZFA 4GWEA 3RMJA 4N9CA 1HFBA 1SO6A 4JX4A 3DI1A 3JRKA 3PM6A 5LNRA 3AJXA 3F4WA 2W6RA 3O16A 2BZNA 1EWDA 1DJQA 5EA9A 5AOUA 4RLIA 4FNQA 1Y0EA 3MYOA 1T8XA 3TSBA 4DO5A 3LHVA 3BVJA 4O13A 2EKCA 2HSAA 1TTQA 3H53A 3NL5A 5CKSA 1I2OA 5J5DA 1YTDA 3PF3A 2NLIA 2RHGA 3FFSA 1OVDA 3LOTA 2YYUA 2ZTJA 3W1UA 4FNUA 2Z6JA 3GXTA 2YW3A 3EXRA 3W87A 2R94A 1VQTA 3KHJA 3DI0A 3N14A 4GE8A 4UR7A 3TIMA 4FF7A 1KFBA 3EB2A 1U5JA 1M6JA 1VYRA 1F74A 5IBXA 3A23A
chains in the Genus database with same CATH superfamily
3UG4A 1RALA 5AHFA 4M51A 3GS6A 3HFYA 3WK1A 2V5JA 4K8EA 4MJ4A 1OT2A 4TR9A 3LZ3A 1ZU8A 3V3WA 3AZRA 3G1HA 5JH2A 3G1RA 3LLXA 4QJ5B 1H1ZA 2VC9A 2OGJA 3ITYA 3GW0A 2GQ3A 1HJQA 2P76A 3VI2A 1B30A 1JCMP 2FDSA 4R85A 4ERGA 1XHGA 4R9XA 1UD2A 1XLGA 1VFFA 5E70A 5E0KA 4Q3MA 3L68A 4QJ3B 3PSWA 2GUUA 4I3GA 3M0JA 4R7JA 3T4CA 1H5VA 3T55A 3S5YA 3UY8A 1JRBA 3ZLHA 3FHQA 3NNTA 1XYZA 1SZNA 1VBJA 2EAWA 3SSZA 5BYWA 2JGYA 2DEPA 4Z1DA 3LHZA 3PUGA 1OCNA 4RCXA 4I7WA 4MB5A 1G4TA 1TWWA 1RY8A 4W84A 4AZCB 1GGOA 1KLYA 2A85A 3C5QA 1JGMA 3FHAA 1CXLA 2Z2AA 4MUPA 3M5YA 3LHYA 3CUHA 3NSNA 3W7JA 2ZZ6A 1PZ1A 2C13A 3T8QA 3WQEA 3BJTA 3HGSA 3UNDA 1IWAA 1ECQA 1C93A 1VHCA 1LRQA 1PUDA 2QQ6A 1EYEA 1I1WA 3MI2A 3AIQA 3SUWA 2H8ZA 1KXHA 4N42A 1DIDA 3FSTA 3G77A 3H4WA 1GOQA 5FF2A 4O4VA 2X1TA 2J7FA 4HJFA 9CGTA 4J1OA 2DJXA 3KTSA 2Z4GA 1S5NA 3WKZA 1ITXA 3NVDA 3UWEA 2QCHA 5F2LA 2GDUA 3BPWA 1ISVA 2YL9A 3GKAA 2PCQA 1PZ2A 4DXVA 3S9ZA 3QMTA 1PZ0A 1PS9A 1YNYA 4L7ZA 1CGWA 1PKNA 4OV4A 2FB2A 2JALA 3WNLA 3A5VA 4JEJA 1XSIA 3HJEA 3U5UA 5AYIA 1W3KA 3GUWA 1BKSA 4HHLA 2A5HA 3PJWA 2PRLA 5HWNA 4FLQA 1OK6A 1W3HA 4JQ2A 3NL2A 2PBGA 3PPCA 2AQVA 1NWRA 3NL6A 4J4KA 4M7SA 4LUYA 1RK5A 4NIRA 1R8LA 1CB2A 1EIBA 1XLIA 4JTKA 1KD0A 3FNDA 5GVJA 3K46A 4KESA 1R3VA 3BSGA 4UTKA 4WRHA 1E9LA 4MUZA 4D6GA 1Q8AA 2NQJA 4R27A 2CBIA 3GU1A 3UCDA 4US5D 3OG2A 2OEMA 4MWAC 3VIOA 1GQNA 4HVXA 2MNRA 1J10A 4Y9OA 3C2OA 4UQBA 2GVYA 4L65A 3ARRA 3MMDA 4ALDA 1EKOA 3W23A 4S3BA 3LV5A 4LB4A 4J3UA 2PWHA 4IZGA 4ZQCA 4S38A 3ITLA 5CLTA 2I5QA 1T40A 2WSYA 5LZLA 3DFQA 3PZOA 4O1FA 1QW7A 2D20A 1EP1A 1OY0A 3DC0A 3UF9A 3ITGA 4Z2HA 2PA6A 1HJSA 1Z32X 2GJRA 3FYYA 4AD2A 1JUKA 1Q4NX 4HHPA 1ISYA 1WDPA 2QPXA 3CPRA 3HQPA 4MZYA 5A5WA 3CL6A 1VBHA 5D32A 3NQBA 1LZOA 1M04A 1UD6A 1HIZA 1JD7A 1R3YA 4X9SA 1W1IE 4C6LA 1FCUA 4G1NA 3VINA 4ZEPA 1VHNA 3H23A 4W88A 3SIZA 2Y1HA 2Z28A 3R13A 1ZRQA 3LX9A 2PWVA 2Z1KA 5BXTA 1TV5A 2OEJA 1BWVA 2E67A 3ZFHA 4WDTA 3AYVA 4PZVA 2DZSA 3WBAA 5GNYA 3NZGA 3SY5A 2XIIA 3EKZA 2BXVA 1ZJIA 4XIAA 2YCEA 3UWYA 2ACSA 1OCBA 1R3QA 3BG9A 4LVAA 2NQ5A 3STGA 4DUVA 3KBNA 2ZRYA 4MZ1A 3WUGA 3M6DA 4RJEA 3WL1A 4M6PA 3B8TA 3T0TA 2ODOA 2ACQA 4Q8TA 3AAMA 3B04A 1QU4A 2PFHA 4YTUA 1H11A 5IBXC 5I3IA 2IKJA 1IT0A 4PTMA 5HATA 1YHTA 1S5WA 2GJLA 3BCFA 4LYQA 1V77A 2P0OA 2FFCA 4IL0A 4U2ZA 3PNZA 4O0QA 3HURA 1BYAA 3VCRA 1Q63A 2EPOA 9XIMA 4JKLA 2VZOA 1J2BA 1RP8A 2YZ5A 3MI3A 4C5ZA 3MVTA 5HMDA 1EF2A 1M01A 4FALA 3KX6A 2ZZ4A 1TJPA 1UASA 2OT1A 4IQLA 1ESWA 1KM6A 1BSLA 4BI7A 4DYJA 4XBSA 4DUWA 1YE4A 3VUPA 2KZHA 1EQCA 1W54A 1TR9A 4YTRA 5FJTA 4H2HA 5E9XA 1XH2A 4ZE5A 3C2VA 3NQVA 4JL2A 5FF4A 1TVPA 2WJDA 4KEUA 1R3TA 1VD6A 3M9YA 1KGWA 4PB3A 1LM1A 3TWBA 2W92A 4UWMA 3R0UA 3A64A 1PAMA 2QMKA 2HPMA 1OM0A 3P81A 4LYPA 1BRLB 1IXNA 4LYKA 3ITVA 5H8UA 4HZ8A 1TRDA 2C14A 2QCCA 2CHOA 4WOZA 1TPFA 2YDRA 3V1HA 3WQ8A 4HSNA 5H8MA 2XVPA 5EMLA 2VKZG 5BRBA 4EPDC 1V0LA 5AHEA 3BICA 4WSJA 4K39A 3P6LA 4A4AA 2CERA 1XSKA 3F5JA 1HL9A 2ZRZA 3LCLA 1H7NA 1QWGA 2P8BA 3CXOA 2PRHA 5IHSA 4QG6A 5CSRA 2D3NA 3NURA 4LXFA 2CHNA 1I2PA 1JPMA 2WMFA 4QQUA 4X9YA 4HN8A 2WHJA 5ABFB 4ZVJA 4O10A 5HULA 3CZGA 2Y70A 4LAMA 2B81A 5A6MA 3ARSA 1UR2A 4ZOAA 1ADOA 2EPMX 4KT2A 4QRNA 1ITCA 3GNOA 3WD2A 3FY1A 4KRUA 2GL5A 3G3MA 2Q8XA 3PR2A 2B7QA 4HQVA 1FY6A 3H7RA 4UCFA 3HJZA 4PL1A 6CGTA 5DMMA 1DJHA 1BWKA 1OYAA 2BXYA 4YU1A 4KCVA 2J8TA 3VU2A 1ONWA 2YXOA 4MDOA 4XZIA 3WQ6A 1DPMA 1XIDA 4DI9A 5CZKA 5DQPA 3WLHA 1J2WA 5GJPA 4AHOA 5JXQA 5D37A 1PPIA 5M5DA 2GYIA 1V6TA 1Z3NA 2WLZA 2ZX7A 2QR6A 3RO8A 1NDZA 4ZR8A 3B3DA 1GOXA 3G2GA 4KF1A 2F2HA 5TF0A 4CQBA 4TX9A 1C92A 1OCQA 1RBLA 2VEGA 4RUBA 3BC9A 1O1ZA 4GGBA 4DZIA 3HB9A 1SFTA 3GXPA 1GKPA 2J88A 2V0TA 4RNFA 3ZOAA 4V1YA 4GJ1A 1LQAA 1D7KA 1EP2A 2PDXA 3L0KA 1TX0A 1EJWC 2ZDSA 2WCAA 3GIPA 5ABEA 4UNIA 1NTHA 2X09A 3W29A 2WWCA 4G2DA 2FH6A 4B9YA 4ICNA 4GOAA 3E2QA 4S3FA 1EL3A 1W0MA 1J6OA 2HBXA 5F1UA 3K4WA 3WQFA 1YBQB 3DG6A 4YCPA 5D2XA 5GNXA 1XW8A 1LRTA 1ZBCA 2C1GA 2WCSA 3VNDA 1S3HA 1J6PA 2WSQA 2DT0A 4HU0A 3WDHA 3FA5A 4PUKA 1NJJA 4H6EA 1ELSA 1OX4B 4MWAD 3QPYA 4E4UA 2GVLA 3E12A 2ISFA 1NFBA 1XCXA 3PZGA 1NOFA 1E4NA 3L4ZA 1E5JA 4TMBA 1LLWA 3AICA 4JD4A 1G67A 2YZRA 1ZCCA 4DELA 1OD8A 4Q7BA 3H2NA 2I56A 4OKDA 5HJLA 2PDGA 1LL4A 2JEPA 1G94A 4O50A 1CI1A 3N3TA 1XKJA 2GGEA 5E09A 4RE3A 1FH7A 3ZR4A 2HXUA 3GTFA 4FIQA 1QOXA 1HO1A 3N2TA 4Y9NA 1KBJA 5D9OA 5FF0A 2H3BA 3WEOA 6REQB 3OZPA 1QOQA 5AZ1A 2MUCA 2O56A 4PL2A 3UWWA 4OHQA 3GVWA 5LHEA 3PB0A 3CT2A 4LVDA 4KEMA 4GUFA 4BF9A 1UR3M 1YPFA 1KXVA 1W9XA 3TXZA 5A3HA 4HMNA 1XKYA 4DZHA 3MV11 3CV2A 5BOFA 5IXEA 4C6QA 1SO5A 1AK5A 1RLCL 1BHGA 2YYTA 3ITCA 1VEPA 3SN1A 1GUVA 1JDAA 4PCPA 2W4XA 2B31A 3IVTA 2HNEA 5D30A 4NRSA 4IPIA 3R12A 4J2PA 1UZ1A 3MCMA 3PZUA 2WHMA 4BWLA 4QBXA 2NW0A 1YDYA 1JZ2A 1LT7A 1MEWA 1LOSA 2PDJA 4DRSA 1ICSA 3F5LA 3I6RA 4L4OA 3VD7A 5HUOA 2GGHA 1REQB 4ECLA 4JTEA 1WP6A 2PLCA 1TV2A 2D0HA 2XSAA 3HMCA 1DJXA 1BVNP 1RAKA 4NILA 5BWFA 4X3ZA 3BE7A 2HEJA 4GNJA 4JTJA 5GJMA 3O1NA 4JHOA 1M7JA 3KHDA 1SFSA 2OZTA 4GIEA 2IKIA 2HROA 4Y8FA 4L4LA 5AHLA 4IL2A 4Y9MA 4Q8QA 2VCCA 3EXSA 1Q6LA 2WMIB 3WMLA 1FH8A 3TFCA 1FRBA 2CLHA 5H6HA 3QOMA 3W75A 4HSOA 1JPIA 4P2VA 4AX7A 2E25A 1XH0A 2QCEA 4C7FA 1MQRA 4FLRA 2VZVA 9RUBA 2ZUSA 2FHCA 4WZHA 5A6LA 1A5BA 3CEPA 2ZX8A 1ADDA 3MB9A 5D9MA 3UESA 5I5RA 7XIMA 1CIUA 2XH7A 3LGEA 4KRZA 1DHPA 3SADA 3WNPA 1U22A 4J3SA 4OT7A 1QNRA 3VVGA 1W1PA 4XKYB 1FWGC 3N6QA 3I68A 3ABSA 1C9DA 1PTAA 2GSEA 4IMAA 5AYYA 3FVMA 3JUGA 1TIWA 1FHLA 4LH8A 3IJ9A 3VOGA 1TJ2A 1Y8BA 2YCLB 1EX5A 4M1RA 3VGDA 5HMEA 4YTQA 1KM0A 3R7MA 2NV9A 4LCRA 1JDEA 3PJXA 3QEZA 3K5XA 1R2TA 2G41A 2ZWYA 2TRSA 4UFKA 1L6YA 3UQNA 3DDMA 2V8ZA 4W4QA 2GJXA 1XYFA 3QOKA 4NZ5A 4ORIA 4CQ8A 3P0WA 4DLMA 1G4PA 1XXXA 4XIMA 4NG3A 2BY1A 3BGAA 3DN5A 3IJLA 2PGRA 4BQ4A 1EBGA 3WBXA 4L9YA 5RUBA 2Z1XA 3ABRA 1MYRA 1EJ7L 2CZVA 3W2LA 3RPDA 4ADUA 4GA8A 4UTTA 2QUNA 3G6LA 4QLLA 3VOFA 2Q8ZA 2VD8A 3GTHA 4NAEB 5AN7A 2J78A 2WHLA 4LAOA 5FEXA 2AL2B 3O15A 2RJGA 5DMYA 3TP4A 5HNTA 1UWIA 4C1LA 5DRIA 3MO7A 2DSVA 3E49A 3FK4A 2ZUTA 1A53A 3GR8A 4XTIA 2HPIA 2P50A 1VF8A 3F4DA 1WZLA 4ZQOA 1OFBA 1UD3A 1XRSA 3T4WA 4UFJA 4AD0A 3LY0A 4YIWA 3M0IA 3G1DA 3TQ0A 4A3YA 3CWNA 3LPGA 5CJNA 1DWJM 4REQA 3LLDA 1S2CA 3LHUA 4DVOA 3CWHA 2BP1A 4UTFA 4FXRA 1XC4A 2TMDA 4NZ4A 4A29A 3UPBA 4XZHA 4LAUA 4ZTYA 3DHDA 4LUTA 4GFSA 3B8VA 2INFA 1V7AA 1H09A 2VI0A 2OG9A 5DO8A 2XINA 4PODA 3MA8A 1ZL1A 3FLUA 4KGLA 4W85A 1R0MA 3MWAA 2ZXQA 1FDYA 1YE6A 3STFA 1IR1A 4YL2A 1XIFA 4WF7A 3QH2A 3AXXA 3HQOA 3W7EA 1LYXA 3R8HA 1ZB5A 2OT0A 3W7RA 1JPDX 4PMVA 2VFFA 3B8WA 5I24A 3R6IA 4PMQA 2PDQA 3BARA 2GLKA 1HJUA 2QGHA 4AVOA 3EDDA 3W74A 4NJKA 1E15A 1XISA 2Q8LA 4JFUA 1JCNA 4HCDA 4U3AA 3VNKA 1AL8A 2WZHA 3IAPA 1UC5A 4GZ7A 3IV8A 1XIHA 2DZWA 2PZNA 4J3VA 2VJXA 5I79A 1FWJC 3GFYA 2PU0A 1H1NA 4EXQA 2VZUA 4B5XA 3P82A 2VR5A 2Q71A 3T42A 1OGGA 4NL1A 3VZZA 1N7KA 1XLLA 4H9MA 1T7LA 4AWTA 5AC8A 3CMGA 3SBFA 1VBUA 3NYZA 4YVXA 4DX3A 3VXGA 3E38A 3I6TA 4O1DA 3MUCA 4V33A 5HMSA 5FAGA 5A8MA 3GC4A 4AXKA 4ZQRA 5D38A 4Z2IA 4DJDA 3LTPA 3T78A 2YKKA 4MJMA 8TIMA 4GACA 1BQGA 4US5A 3ME3A 4F0RA 7CGTA 5A8GA 1Q6GA 2YA2A 1XR2A 2CLOA 5HNNA 3FJ4A 1JAEA 1HW6A 3TTYA 4DN1A 1WZKA 1NWSA 1J11A 1BF2A 3DYOA 3HQNA 4DQWA 5FF3A 3FXGA 2QGYA 5FJUA 1UYQA 2PE4A 2BOFX 1TV4A 4G7EB 5I3GA 2PCEA 3DESA 1E9IA 4UBPC 4L6DA 1TTJA 2VD9A 2E8YA 1FFQA 1J8VA 4TO8A 5C0QA 3SCSA 4B3ZA 4OQVA 3GW3A 1M9HA 1W2PA 2VVNA 2CZEA 3M64A 1CBGA 1TZZA 1EOMA 1F9CA 2QCLA 4PEKA 1DXEA 3CQHA 4GYPA 2FGLA 1R2RA 4LYRA 2J24A 3PTDA 4G7FA 3IJ8A 4AH7A 3C61A 4BQ5A 3HGJA 1MUWA 4PBFA 1YIXA 2WZTA 1TZ9A 3RF9A 2G8ZA 3AYTA 2OXNA 2X2YA 4GZEA 1FWNA 1UH4A 5CQ1A 3OQ8A 1PEZA 1T99A 3CTLA 4QR6A 4WXYA 3UNTA 4DO7A 1K1DA 5ECUA 2G3NA 4I9JA 3WLIA 4BZYA 3P8IA 2VUYA 1PKMA 1TIMA 1JJKA 4R88A 1OIFA 2CWNA 1B5TA 5EFDA 3C0SA 1I45A 3SCVA 1FCBA 1H1YA 4UTUA 4V28A 1FOBA 1A5CA 4OJYA 3B03A 1E71M 1V0NA 1UKOA 1RJPA 4CEUC 1MZHA 2BS9A 4MADA 3E9AA 1UD4A 2BNJA 4IGNA 4AWSA 4WGXA 1VYSX 1XG4A 3NEVA 4CCDA 5I77A 1MDLA 1DIOA 2OZ3A 1CT5A 2TYSA 3MCNA 1L9WA 2QHAA 3S5SA 4C6IA 1US0A 5CZTA 4FK9A 1X1NA 2FZ8A 4MKNA 4MZ8A 4OZOA 5M1TA 3L5MA 5EBAA 1OFOA 1C8YA 1UQZA 2J8FA 3RM9A 4ZQMA 4PE8A 2ZC1A 5T91A 1YTKA 2PDHA 1UROA 4IUOA 1WAWA 2EBNA 4KIEA 3D5HA 3S1XA 1EHNA 4LB3A 4IIFA 4K8HA 2HK1A 4JTGA 1D2KA 3R1ZA 2GUBA 2IXVA 3QHMA 1A80A 3H2AA 4XUYA 3FVDA 3R5EA 1C3FA 4TV5A 5AYXA 2OODA 3EEZA 2DV0A 2R9RA 2ZXDA 2WANA 1R3RA 3SCQA 1V0KA 4I90A 5SWUA 1O66A 4GINA 1FWEC 3GG0A 4GVGA 4MYXA 1YXDA 3BGGA 4TMCA 5IOBA 2G50A 6A3HA 5MHBA 4A3QA 4UOQA 4JFTA 4ATWA 4KQNA 3H8AA 2A7NA 3ITTA 1WX0A 2PODA 3GO2A 3D6NA 3GXNA 4GRSA 5DY3A 3SN0A 3QZAA 1MUMA 1AJZA 1G01A 3T2QA 2WV8A 4C7DA 1TWSA 5B7ZA 3BOXA 3T05A 1GVFA 4GIYA 2BLEA 3T2OA 1B4KA 1HKVA 2FPYA 4B92A 3JVAA 5F4XA 2ZUUA 3Q65A 4IJBA 4AVNA 3O06A 2WC7A 3BDKA 2W0UA 5FSEC 1VRXA 2FZDA 4AZGA 2P3EA 3HPFA 3PZIA 1P43A 2E6DA 1WKEA 1EO5A 1SW3A 1IWBA 4KERA 4Z2KA 1XIIA 1KNWA 4I7UA 4IFKB 1XG3A 1S1RA 4J9JA 3L0GA 1EUNA 4KS0A 3M5ZA 3QM3A 5BW6A 4AZBA 1MQQA 4U3CA 1SM9A 5KZDA 3FW6A 2EO7A 2NX3A 4PUMA 1RPKA 3AXIA 2V3FA 4AC1X 1I2QA 2JEQA 3AALA 3SUTA 5D2VA 1NQ6A 2CCRA 4PR4A 5FJJA 1RZMA 2YIHA 3VD4A 2ZDRA 3UT0A 5FOOA 5FD0A 2F2KA 1ZFJA 3W71A 4ZTXA 4JIQA 1JVNA 2E68A 5LIKX 2W9MA 3M46A 3XIMA 1AH3A 3O6AA 2BGNE 3VNIA 4L6HA 1U5HA 3SRHA 3EOLA 3J7HA 1XGDA 1KCXA 2V6AA 3OYXA 3KLKA 2R1MA 2HE5A 1Q85A 3W7NA 3RUBL 1UP3A 2V5LA 5AKQA 4NASA 3VCCA 2REQB 3SY8A 3ZJKA 1BAGA 2VX7A 1R87A 1SO3A 1OB0A 4BY3A 1UA7A 4QROA 5AHMA 4MFDA 3SRFA 2ESCA 3NCOA 3W1RA 4QFUA 1IEWA 4GI8A 4NZFA 2OYKA 2X0YA 4QS6A 2X7WA 1RBAA 1TRIA 3OLIA 4KW2A 4ICMA 3TAKA 1ME8A 3PBMA 1DIEA 3IIVA 5G2IA 5DFAA 3CQ0A 3R11A 4UTIA 5CPQA 1EJUC 3GNRA 2GZXA 2J9ZA 1X6UA 3LXCA 1GZJA 1IR2A 1XM3A 4LPCA 1KFKA 3D0CA 1LL7A 3EMCA 3UVIA 5CPLA 2X1SA 2WB5A 1R86A 1PKLA 1TFVA 2IKHA 2Z1BA 4MWAA 1W9VA 5KETA 4F48A 1KR1A 3GFZA 1Y65A 4HOXA 1XLEA 2F6XA 1O5QA 4XX6A 4HD5A 2YOCA 3SAZA 2CBVA 1ITUA 1E0XA 1ME7A 1WOBA 4CNTA 2ATMA 1H0GA 1K8CA 3C0LA 5BXSA 3MY9A 1UBSA 1UWRA 3VTRA 4PA8A 1T0OA 4GHRA 2RAGA 4MLRA 4ZOEA 1LCOA 2WC4A 4AMCA 4XZLX 4X0VA 1IXOA 3HFTA 3G0SA 3NIYA 4RDZA 1FP9A 1H63A 3VGGA 1L6SA 2HQAA 3FIGA 1MXSA 4NX5A 4O16A 1SJBA 3WDRA 1V08A 1NSJA 3F2CA 4JS3A 3BV4A 2NT1A 3N2CA 2ZRXA 3GH7A 4UTHA 2XWEA 2C0AA 2EPKX 2HJPA 2Y88A 4KIRA 3C52A 3PFRA 4ZB5A 1RQBA 3VIKA 3GTXA 5KZ6A 3NDOA 2ZOXA 3GK0A 2I5GA 1UKSA 3WLNA 3CZEA 2Z27A 4AC7C 5LNRA 3QYSA 3VD9A 3AJXA 4RLIA 4FNQA 1PWMA 1Y0EA 1UPPA 3TSBA 5HNUA 4O13A 2V68A 1TTQA 4L80A 2UY3A 3FFSA 3PZVA 3AMDA 3BAXA 3W1UA 3EB4A 1ZP3A 2Z6JA 1P0DA 4PGLA 2R94A 3DI0A 3TIMA 4FF7A 1JFXA 2XIOA 5GJNA 3E0WA 3BLPX 5IBXA 4K6AA 3A23A 3UR5A 2WO5A 1RD5A 8XIMA 2D69A 3B40A 1MZRA 1PIIA 2OWXA 3NPVA 3W82A 3WELA 3RILA 3CHEA 1EEXA 2WMJA 3BLEA 4I6KA 5KINA 3KL3A 2EG7A 4G56A 3BAIA 4L6OA 4CUCA 3WQ4A 1DWGM 5EB8A 1SJCA 4XV0A 5BNKA 2DUXA 4TTUA 1XL9A 3GHRA 3POHA 3V36A 1VIZA 3BJFA 4QP0A 5REQB 2B7OA 4K7YA 4GKLA 4PMRA 3TQPA 3TOYA 4N6FA 1XGZA 3IIPA 1LT8A 3QQWA 3BW3A 3EPNA 3NQ8A 3UFYA 1W32A 1QI5A 3EOUA 1DJZA 3UERA 3KBMA 3TC6A 1PYFA 4D1JA 1GNXA 4F2UA 1EJSC 2WVVB 4A6GA 2O7SA 2VURA 1WNOA 5HWJA 3LLFA 5TIMA 1MNSA 2DSUA 4DBUA 4RE2A 4O19A 3QKEA 1JDFA 2P0IA 4XB3A 4E2VA 3WLOA 5CBBA 3THUA 3MP5A 1BG9A 4GQQA 2G96A 3MUIA 4IG2B 5LIYX 1VPXA 1MEIA 4IQJA 1GEHA 1UUMA 1XV8A 4WD0A 3WJXA 3SIMA 3WD4A 1VFUA 5G5IA 2Z29A 4S3DA 3UW6A 2J75A 1WDSA 2YPIA 3G1FA 3WFLA 4YTSA 4MYAA 5EMUA 5CC5A 1YDVA 4CN1A 1ZJHA 3HGOA 3H2EA 3LSBA 4N7QA 4M24A 3GHSA 3IJIA 1JQVA 1E6SM 1FQ0A 3DCPA 3CQKA 3IGUA 3PY2A 4W8LA 1RCQA 1DTNA 2NT0A 1IGWA 2NVDA 3VO0A 5LGXA 4QS5A 3TJLA 2VZTA 3G18A 1A47A 3MKCA 3OHIA 3Q58A 2VEKA 3B8SA 3BOLA 1G69A 5CAKA 4HNCA 2ZADA 3AMKA 1UOZA 4QCFA 3ORWA 4RR4A 1AH4A 1LG1A 3QC0A 3A5FA 3P84A 3UD6A 3TLQA 3W6YA 1WUFA 1V7YA 2A3AA 4NZCA 1W1ZA 4AIUA 2P8CA 1IE7C 2NX9A 3WUEA 2TPSA 3A4AA 1NVMA 5J04A 2QJJA 2VEIA 2OWCA 1I2RA 1CPUA 4M81A 1CGXA 3WBEA 1KWGA 2IMRA 5LYRA 4E2DA 1E6ZA 6PTDA 1BLIA 1V0MA 2RGMA 2Z1SA 2XZ7A 3N18A 5BMXA 3RPTA 3PHAA 3CV6A 1JEZA 4WLCA 1JUBA 2QJNA 4FNPA 3HZ3A 1F61A 3WUFA 2PLJA 3MC5A 3L0NA 4JFWA 2FPTA 4DAFA 4JQAA 3WH7A 1N8FA 3WMBA 3ARUA 3EWYA 1OZQA 1KRMA 1QHOA 1E1EA 3EOSA 4PCTA 4J7RA 3C8FA 1WA3A 3NOEA 2I57A 5CSUA 3VDAA 1H60A 3NSMA 4JX6A 3N25A 1LOLA 3H6OA 1HO4A 4FB7A 3N29A 2YSWA 4AEOA 1HX0A 2G95A 2R1NA 2WSRA 7ODCA 2CLIA 4DWSC 3NZ1A 3S2CA 4HPHA 2E6AA 1QO2A 3W1LA 2ZWZA 3ISIX 5CH9A 4B3LA 5AECA 4S2CA 3W38A 4B5TA 5DCDA 5C9ZA 3AUOA 2YJQA 3L4XA 2OVLA 1GVRA 3QFEA 2DSZA 1UJQA 1K8YA 4QNEA 1S5TA 1KRBC 3MUAA 1J18A 4H8NA 4WGHA 1MRQA 7REQB 1TCMA 1HQTA 3TJ4A 2F61A 3VKAA 3LMZA 3TUUA 3FX4A 4FAMA 4BR1A 5D03A 3QR1A 5HQLA 5GQBA 2J79A 3VIMA 1NH6A 5DELA 1DBTA 2W91A 4Y9AA 1P1MA 4UQEA 1KFWA 6TIMA 1O5XA 3P5ZA 3GM8A 4F2TA 2AMXA 2QMJA 1W8SA 3A22A 3WH6A 4J5NA 4LCQA 2ASHA 2W67A 4IPLA 4Z17A 4AVFA 4MNKA 1Q2RA 1VS1A 4A21A 1ZENA 3QZEA 1M68A 1RA5A 1PTDA 5EKYA 2FHBA 4GC4A 3TDFA 2E7FA 2OELA 3NXFA 4FI4A 2ISDA 4GCXA 3WMSA 4CD7A 1Q5MA 2VC6A 3VE9A 4PRRA 3M0XA 2BMBA 2JGQA 4F0HA 1LF1A 4NSBA 2I9UA 3T81A 1VPQA 3W1TA 4H1ZA 2CETA 1VJSA 4FO4A 1GOKA 5BCAA 4D2JA 4DI8A 1SU5A 2J6XA 1BTMA 3CHCA 3HN3A 3MSYA 4WDXA 2EPNA 3OA5A 2XGIA 1TV8A 3SRDA 1XLBA 4HNUA 1RJRA 3FYPA 1OT1A 4GXMA 3KLLA 1AQHA 3SUSA 2PF0A 5BXRA 1RHCA 4H6RA 1H2JA 2WJEA 1TWZA 2GQ9A 3A4JA 4HNOA 4IF2A 3B4UA 1MNZA 4WY0A 1W56A 3KRUA 4IP7A 3E2RA 1A3HA 3QJAA 1J4EA 1SSDA 4ROPA 3DUGA 1GVQA 2A3BA 5CBIA 5DT5A 1IZJA 1Y5XA 4CNUA 3NGFA 3TA6A 4PB4A 3SM0A 1TE6A 2FTYA 4HYRA 1XBYA 1OYCA 3RCNA 4MVAA 3SB0A 3A12A 1PIFA 3P5YA 3TEVA 1W5QA 3SO7A 1B54A 4H41A 1Z44A 2X40A 4P8XA 4H9XA 3C3UA 3QY8A 2KAUC 4LWWA 3W1QA 2QW5A 4IMGA 4YHGA 1QK0A 1X8FA 4TVUA 4XUGA 2UY5A 3CMFA 1A0DA 4JN8A 4ZO7A 4DO6A 4EPBC 1Q8JA 2PDYA 4PUEA 3VM7A 3VX0A 3N2MA 3AYRA 3NUKA 1C7SA 4XZNX 2ON3A 1EC8A 3QLLA 4J3XA 3TC3A 4ATLA 2IQDA 3D3FA 3I3DA 1JRCA 1UR4A 3O63A 4IFRA 1K9FA 4RK8A 3WH5A 3DYPA 2GUYA 3RLGA 2QDHA 3E6EA 3BG3A 1TV7A 4DPPA 3ZXWA 1EC7A 5H8PA 1KRCC 2PD5A 1OGBA 3NQ6A 1DEDA 1KR0A 4F8XA 2XISA 4H01A 4NJGA 1O5KA 4Q8UA 4FLOA 3TAOA 3S2JA 1GW9A 1B0IA 2FMOA 3FXYA 2XSXA 8RUCA 4ZQNA 2VENA 4W8AA 1TG7A 2XM2A 3LNMA 2WNNA 3VOJA 3EDFA 1QAPA 3TR2A 4GX9A 1GQIA 1UKTA 2FTPA 4QTGA 1UW9A 3TN3A 4W8BA 4WJXA 4B4HA 1XLMA 3ZZ1A 1AD4A 2WC3A 4AD4A 4I9MA 3E1F1 3VGBA 3NA8A 5C7VA 2Q02A 3E2VA 1EX1A 3W53A 5DCEA 4QE4A 4LEFA 3ID7A 4Q33A 1ZQ5A 3O05A 5EFFA 2DUZA 2NX1A 4ACZA 4PRWA 3AIEA 3PUEA 4L1GA 1YEYA 3ITXA 3A9BA 4AG0A 3N13A 2XHYA 2YW4A 3I4KA 1J0YA 2UZ9A 1KXTA 2DZVA 3NQGA 3ARQA 1W2VA 1QBBA 2Y62A 4DF2A 2PSNA 2QKFA 4DEFA 3FAWA 3LGDA 4PB5A 2NSOA 2FVKA 4E2BA 3AWOA 2PWDA 4IXXA 4OGZA 3V0UA 1O68A 2E5DA 3SY1A 2DPEA 2QUUA 1QXLA 4O4WA 1L2QA 2Y89A 3QC3A 1ZJAA 4MPQA 2O7QA 4WSKA 4NAFA 4DZ5A 5A6SA 4CQDA 3G1YA 3OBEA 3PTKA 4IXHA 4O18A 3NZPA 5BZAA 5HQMA 3L4WA 3THDA 2ZX6A 3LCGA 3IRSA 3VFCA 3L67A 1H3GA 5G1MA 4LVFA 1VCFA 1PYMA 2IUZA 3G5EA 5FSDC 4PMJA 4XK2A 2DVTA 4I5RA 4Q8OA 1UOKA 3A47A 3UZZA 1XWYA 5HPCA 1P7TA 5A6BD 2O9TA 3N1AA 3WLJA 1V79A 2FVMA 4IPPA 4H8VA 2XVKA 2ZX9A 3NQCA 3CHVA 3KRSA 2C6QA 4WX2A 1E56A 3W7DA 2D0FA 2ZUWA 2ACUA 4UTLA 2A1YA 3G1AA 3NM1A 4WKFA 2FJUB 3MBFA 2CLMA 2WKGA 1K02A 3S46A 3LDVA 1VH7A 3VOHA 4DWSD 1PCKA 1XLAA 4Z08A 4EPKA 3WQGA 1DTUA 1UKPA 3GC2A 1KQYA 4E4PA 5I3KA 4W89A 4S3GA 1IWPA 1GVOA 1JD9A 3D46A 2VR2A 3ABOA 3BCDA 1HGYA 5HNRA 4YS1A 2OYMA 4ZOCA 1W3JA 2WZEA 5LXXA 2QDEA 1X7IA 5D04C 4AU0A 4GY0A 3A13A 4WK9A 2A6LA 2Y7DA 1R47A 2CXEA 1E0VA 4GABA 3APGA 1UZ4A 1DQUA 3MO4A 1BFNA 4RPPA 3TVAA 5CZJA 1H62A 3SR7A 2BVTA 2C18A 1EOKA 2A3CA 1W5NA 2XGZA 3HPZA 2QXWA 4AUBA 3THCA 1QW8A 3MPGA 1OIMA 4E38A 1C8VA 5GPRA 1EHAA 2Y6ZA 2FB3A 4UFHA 5D4YA 3P2VA 1KKOA 4S39A 1A5OC 2BY2A 4LS0A 2D2OA 7PTDA 1L6WA 3IGSA 1KV5A 4FR6A 1XD0A 2XU2A 1FVPA 3DFHA 3HGRA 4GQGA 5I78A 1WKYA 2X42A 5AB3A 3B97A 1IZKA 3LBMA 2NQLA 4M56A 1FCQA 1RVGA 4NYYA 4AMAA 3EB3A 2PWGA 1LRNA 5I00A 4A2SA 3VUSA 2FPVA 3N11A 3VABA 3EPOA 1WZAA 3TSMA 2PP1A 3U48A 3M0KA 1K8ZA 3BO9A 4HBKA 1HL2A 2V38A 1V6UA 1KC7A 1L0PA 1XH1A 2PP0A 5I3DA 1B3VA 1P0NA 1UCWA 3W00A 1EEPA 1VFMA 1EBHA 4JIPA 4NI3A 3URAA 2C0HA 1V3IA 2ZIDA 4HHMA 4O54A 2GQAA 4E8CA 1A49A 3V0TA 2HVNA 4B3KA 4AIOA 1UPMB 1RV8A 1HVQA 3I10A 4ZXLA 4BS0A 1DJIA 2PWUA 1TPUA 1PSCA 3AS2A 3DG3A 3GVRA 4W86A 2XYLA 3DYMA 4I5UA 1M5WA 1XIMA 3ARXA 2OSYA 2Y7GA 3O6YX 1CWYA 3H26A 1XLCA 1U83A 4B4FA 4MY9A 1QNQA 4O28A 1WO2A 2NUXA 4HZ6A 5BU9A 3REQA 1XRTA 3VGFA 3OVQA 2YBUA 1XPGA 3QQ0A 1A3WA 1B31A 3ZJ8A 1JZ4A 3LPPA 3UP8A 3RR1A 3LHTA 3EZ4A 4A3HA 4A2RA 3CAWA 3M07A 3M4HA 2JIWA 4I8YA 5HAOA 4NI8A 1Z48A 3PAJA 2TODA 3ARYA 1ENUA 4BQ3A 3KBSA 1AL7A 4ZFMA 1XD1A 1MI3A 2CXGA 3CO4A 3ZT6A 9XIAA 4H9YA 1DV7A 4BHYA 2VR4A 4GVFA 3KM8A 3EWWA 3VE7A 3BWWA 4O53A 4O11A 3FN9A 1W9UA 4AF0B 2F9RA 4DZAA 2W63A 2DQXA 1S2UA 2IPFA 4Q8WA 4AZ6A 1RY0A 4O1CA 3N6HA 2D23A 4QDWA 1CGTA 4XQ6A 3R4IA 1PX8A 4PEEA 4DPQA 3RLUA 3TLLA 1HP5A 3KAOA 4AEFA 4A8IA 1G4EA 1I60A 2QJMA 3IUIA 3N3MA 3W7GA 3L2LA 3B06A 5PTDA 2YDSA 2PC8A 3THQA 5A8NA 4OOZA 1KCZA 5E6ZA 4F0SA 1XYAA 1FXPA 2VRQA 3OYZA 4M1BA 3WY1A 4QX4A 2ATSA 7TIMA 4JKMA 3U6WA 1E43A 3EBVA 3VC6A 3GWQA 2GQ8A 3KVJA 3Q37A 4JTDA 1LORA 3UG8A 3ZLGA 3CJPA 4OVXA 4K36A 2P1FA 2PP3A 4NVTA 2AL1A 3GNXA 4S3JA 2BHYA 2HMCA 3G6MA 4BQ2A 3H70A 2BBFA 2PDFA 3CK5A 4LV4A 3RK8A 1UH3A 3NM3A 1YPIA 3ATZA 4HTBA 5BRQA 3W6LA 4IHCA 4WR3A 2OTDA 1J0ZA 1F2JA 5G4HC 4CN4A 1AQMA 3WLLA 3TMQA 4D8LA 3WJSA 4QE1A 3TK7A 1UR9A 4GUJA 3VKDA 3BLLA 1UZHA 2RUSA 1VFTA 1EP3A 3DBNA 4PMDA 3DX5A 4GQRA 3M0VA 1V51A 4ZGYA 3TR9A 5D8ZA 3UZXA 1L8NA 4JTQA 3AHTA 4Q4RA 3DAQA 2YCIX 3QXBA 3WF1A 4UC5A 5G4WA 1MVYA 4ACYA 3V5CA 1CXIA 3T9PA 4IQEA 2C16A 3P7YA 4OWGA 5CSSA 2RDUA 2WPBA 2H3DA 2DW6A 4J35A 2PC4A 3KW3A 2ZA3A 1WXZA 2VUNA 3KTXA 1G7VA 1Q13A 3KOXA 2WBGA 3W7PA 1Q6QA 3AS3A 3O6CA 4YLWA 1NP0A 4ZSTA 2ZC8A 1R2SA 1VB9A 3W81A 1EPVA 2CBJA 1ZUAX 1GEQA 2QJIA 2Y0FA 4LUSA 4Z2GA 3ZQ9A 1U1HA 4AWUA 4S3EA 4RDWA 1AODA 2A7PA 5F4SA 3TTSA 3SURA 5AC7A 5FF7A 3WF4A 3NYDA 3R8GA 1D9EA 3TTEA 1CXEA 4H9ZA 3GBEA 5E9AA 5K9XA 1QOPA 4MSSA 2ZVRA 3C2EA 2XSBA 1V3KA 4GJJA 2WQPA 3GG8A 2C71A 3U9IA 3URNA 4XAZA 1ICPA 4GQBA 1MXDA 3G0UA 3RM8A 3H24A 1V6XA 6XIMA 1P1XA 3RAOA 3PPHA 1Q66A 3KTCA 2R1PA 4IX2A 3AXKA 3DHFA 1XLJA 3B9OA 3OZYA 1J0IA 2HV5A 3IACA 3O8AA 4H00A 3T09A 3TMLA 1EB3A 3COTA 2EXOA 4DM2A 1E3XA 2ABAA 4Q22A 3IAQA 3PZQA 3EDEA 4F4RA 1YADA 4ORMA 4LNCA 3VYLA 5ABGA 1WOAA 3IV3A 1UUOA 3OBKA 1I1XA 1H5YA 3CU2A 1F6KA 2XH0A 3FEMA 1OFRA 4FXFA 4L64A 4TTGA 2R14A 1V3JA 4C6EA 1E5NA 2Q3RA 2OZ8A 4FNRA 1W1YA 2BG5A 1EYWA 2WNQA 3U2EA 3WH9A 3E74A 3BQ5A 3QRHA 4KKXA 3OHMB 4EF9A 4B91A 1GQJA 2ZZ2A 4W87A 5FEZA 2V82A 1EGVA 3L9CA 4G8TA 4HT3A 1H49A 2E6YA 1NFGA 1N55A 3ALFA 2BGSA 4YCOA 4QM1A 2C3ZA 4UZSA 4PUWA 4E3TA 3EWBX 4XO7A 4ZMGA 4HPNA 2VGIA 3GH5A 4HSHA 5LGZA 3NPWA 2Y61A 3M7SA 2R6OA 4HPGA 1XYCA 4FOKA 2EJAA 5DX7A 2FDMA 3K30A 1GVYA 4GQ0A 3MJYA 1WDDA 4H9UA 3KBJA 4ZO9A 1A5SA 3IIXA 5LXEA 3U3HA 2YFOA 2BWGA 2VELA 3NEHA 5JH1A 5K4ZA 1LG2A 1LBMA 4A8LA 4PFHA 4HYWA 4DBDA 3WG6A 3T0CA 4PULA 1HZYA 2V3EA 4RZ6A 1F05A 1MDRA 3QFWA 4P7QA 3S5ZA 3PG8A 3LK6A 4Z1YA 5MKGA 1TJRA 3SN4A 2DVXA 4GFIA 4CU8A 4NT0A 1IEIA 2DZAA 2ZYFA 3AI0A 3HG3A 1TUXA 1GZGA 2QCFA 4H2CA 1F4HA 1H61A 4WHBA 5I6SA 1Q6DA 1MFVA 4PSPA 1ZP4A 2E9MA 4DJDD 2OMAA 3O0KA 1KGUA 5EMMA 1JPHA 5CJMA 2AKZA 1VPYA 3LHWA 1FWIC 2QIIA 2YDAA 3CGTA 1LQ2A 2BHZA 2QCNA 2DZTA 4HOWA 4R33A 4F2BA 1AJ0A 4A3RA 4X61A 4ZXOA 4C6BA 4F3HA 1H51A 1YXYA 2A21A 2HDJA 2OX1A 3T7VA 4CVUA 2GPTA 1RPXA 4D71A 3S3GA 1AMKA 2E0PA 3WL0A 1PKYA 4FHAA 2XIJA 5AC5A 2ZUMA 3MMUA 3LPFA 5AC6A 4MB3A 1MXGA 3LD5A 4BF5A 4GXWA 4DBEA 4KRTA 3DH7A 3GQYA 4C6NA 2GSHA 3D3AA 1JF6A 3DKLA 3SCNA 1BWLA 4LY8A 5K3VA 4CQCA 1HJXA 1G4SA 3V75A 1K8XA 5I02A 2EKGA 2G37A 4CEXC 5AZ0A 1RJQA 3W07A 2VDHA 3WD0A 1BYCA 2OSWA 4XKMA 1UWSA 4GH3A 3ONCA 1A0EA 3MTWA 2VFIA 4NY2A 3AHXA 2XPKA 3A3WA 3B0VC 3TWAA 2J27A 5HOSA 2HWGA 3U4FA 2J47A 5HR7A 3S1UA 2R8WA 4NZ1A 4IUGA 3IJQA 1W9PA 3GSMA 3MYPA 2DT2A 4L5ZA 4JTSA 4FNTA 1FUYA 5G1YA 2NXIA 3CB3A 1GW1A 1OHLA 2BY3A 3LTYA 2WVSA 2GJXB 1LTDA 1QVBA 1H7RA 3GAKA 3W7QA 1ICQA 3R94A 2VHLA 4V1XA 4AF0A 5A94A 1VEMA 1EC9A 3GR4A 2VGGA 4XSMA 5LSMA 1WBJA 4HPXA 4QCEA 4X0NA 3N34A 4QSHA 3LYEA 2GOUA 3EWDA 3FAXA 4J3ZA 1MQPA 1GPFA 1JXJA 1SMAA 3S4TA 2OQLA 3BLOA 4HPJA 4R3UA 1NM9A 5BWAA 4ZOBA 1UWTA 3FV9A 3EGJA 3ANVA 5KSWA 5LIUX 3QTGA 4I5XA 1M3UA 3MDWA 2J8GA 4IIDA 1NFPA 4O0KA 2AAAA 5K9DA 1UWAA 3OPSA 1M7PA 2FZBA 2OGYA 1M53A 3CV7A 3HQ1A 3JZUA 5A6BA 3VKKA 2FYMA 2A2IA 2FZ9A 1NELA 4TVDA 3ARZA 4M6QA 2W3ZA 3H7UA 2JE8A 5TD4A 4C65A 3OGSA 4LNYA 5C2CA 4QISA 5A2BA 3UWZA 2ADAA 3GG7A 1XLFA 3GIQA 1PL9A 3UXAA 5C9WA 2PF8A 1IEVA 1GJWA 1TMLA 2UBPC 1G9HA 3WENA 4REQB 3APYA 3QV6A 3W85A 5HPOA 3W1NA 4BK9A 4DWSA 1ISWA 4CNOA 1QO5A 4K37A 4OFCA 2GSJA 2WM1A 2QUMA 1TJ1A 4LUTB 3UJEA 4R34A 3KL5A 1W3IA 3HG2A 2CBUA 1QPQA 2PDCA 2QCDA 5EMJA 8CGTA 3G8EA 5CPTA 3PJUA 2YLAA 1J9YA 3HIJA 4E8DA 3N4AA 2OX4A 4HA1A 3QBUA 4FX6M 2DQWA 2YB4A 1PE1A 3W7KA 1GKRA 1C91A 1O94A 3CAQA 3DGBA 2FTWA 1RVKA 1SR0A 4IMFA 4W7WA 2DSKA 5LNWA 3FDGA 3LS9A 2VEPA 1EJRC 4MNLA 1TWIA 1CENA 3DZ1A 3LU2A 4ZQPA 3R89A 5HQEA 3JR2A 1JYXA 1SFJA 4NUWA 5HUPA 4B5VA 3B4YA 1ZALA 4O8AA 3GE7A 3VIIA 3DOPA 2OLAA 1KBKA 4JX4A 2AQOA 3DI1A 3JRKA 3PM6A 1B3ZA 4EANA 4WDUA 1DJQA 1U2YA 5EA9A 5AOUA 2VWSA 3KOZA 2Y24A 2DH3A 1P6WA 4UQAA 3KCJA 3NO1A 3BVJA 3UR7A 2HSAA 5J5DA 3PF3A 2NLIA 2RHGA 4CD8A 1OVDA 4YTTA 4NF7A 1JXKA 1TA3A 1JF5A 2EEXA 4GG9A 3CH9A 3WQPA 4GY7A 1OC6A 3N14A 4AY7A 4UR7A 1J0KA 2UY2A 3CPGA 1VYRA 1GHSA 4LF1A 1QNOA 4EX4A 3L21A 2X2GA 2UV8G 3LCFA 2PURA 4MJZA 2CEQA 2ZXBA 4IFOA 5BMWA 1R3SA 1SYTA 1CB7B 2P10A 3MU7A 1GJPA 1ONXA 3SGUA 5D9NA 1XQLA 1TTIA 2WNZA 1JI1A 1A50A 2D2JA 3B9DA 1HN1A 1Q45A 3GR7A 3L66A 3W1PA 3N9KA 3W2NA 4KGJA 1GTHA 1LROA 4C1NA 1O7AA 3TV8A 1ADSA 3UU0A 1LL6A 4Y9PA 1R9ZA 3SECA 1M65A 4KPLA 3OW1A 4QQ3A 2E40A 1OSEA 3IPWA 2FKPA 4C1KA 1SPQA 2XG9A 3V4BA 3KRBA 4I8DA 3AS0A 5C70A 3SCUA 1HTIA 1KFLA 1W37A 1UIPA 2BB0A 1IGSA 3Q94A 1GOMA 3BLIA 4P7LA 3MUXA 2EPLX 4P5UA 1OFDA 3ZVIA 1GK8A 1IIGA 3BURA 4JTRA 4GZIA 2OKOA 4A3UA 4HOZA 1KCKA 2ZICA 4EXBA 3OLEA 1E1CA 4JHMA 3W83A 4Q4KA 3BANA 3W25A 2B7NA 3W7IA 2EHHA 4DXXA 5CGMA 3ARVA 1V6VA 4F0KA 2J74A 3NQFA 1TV3A 3P62A 2YCJA 4OU1A 3OG3A 1J12A 1TYGA 4OBSA 4O12A 3VILA 4ADSA 3OLDA 4H83A 4FEZA 3W22A 3W2KA 3W24A 2O0TA 4IP4A 5C5YA 1US2A 8A3HA 4XD3A 2VDIA 3LI0A 4NZ3A 4JTLA 4JIIX 1AQFA 1Q3NA 4LTSA 2VFDA 2YGYA 3P0XA 1K6WA 4LEQA 1K4GA 3E0IA 5TBOA 1S5MA 2Y8UA 1E9ZB 1M41A 3GG1A 4IT1A 1EXBA 1SGJA 2J7GA 5EL1A 4Y96A 3UEQA 2V2CA 1BPLB 2NQZA 2V67A 1QI0A 3TYCA 3T0BA 5A6KA 2FZMA 2Z0IA 2J6VA 5EGRA 5I7GA 5C6MA 3ABXA 3UG5A 3GIYA 3LUTA 3E0LA 2ACRA 4L56A 5I0DA 1TPVA 5CGTA 4OE7A 3JS3A 4GYJA 2V2HA 3KCOA 5MF5A 3V7PA 5CG0A 3BV7A 2Z2UA 1FXQA 4XD4A 3MP3A 3K4AA 3C0JA 3C8NA 4E5TA 2D2GA 2VQTA 2E09A 1TPB1 3K1DA 2QNEA 3H2MA 4LRSA 3CC1A 2Y63A 5DMLA 1M7OA 2QVHA 4IMEA 3PTMA 6XIAA 2C7FA 4PMZA 4HB7A 4JQ1A 3FJ6A 4FX8A 4LANA 4LY4A 5LNSA 1R9YA 1W3LA 3ZWTA 2W66A 4LBUA 3QHNA 4UOZA 1DJWA 3A9IA 2FH8A 3BW2A 6TAAA 5C8BB 3NZRA 4LVGA 4RNJA 3NXLA 1IZCA 3S9IA 3OODA 1QPOA 2VO5A 1PZ3A 1HF6A 3T0AA 1Z7AA 3UXKA 4UTWC 4KMQA 4GVHA 1WXYA 2V5BA 2WZMA 4MY1A 2EJ1A 3WJZA 3LN3A 2PLMA 2CKSA 3SZ8A 2XIBA 5K4XA 3ZR6A 1AW5A 4O0ZA 3HV8A 2WNWA 4W9TA 3K1GA 4J3WA 5L6UA 1J5SA 3C6CA 5AVHA 1UKQA 3NAVA 2G3MA 3WMCA 3KWSA 1WDRA 2RKXA 2OQYA 4YYCA 1HL8A 4UCGA 1KA9F 2QT3A 3VM5A 1BD0A 4O1EA 5HA7A 3S1VA 4IIGA 3ZT7A 3G0XA 3NQMA 3LQLA 4KETA 4TX8A 5C9RA 1TPC1 3NSXA 3ZVHA 4ERIA 1V93A 4EP8C 3PZNA 4OUEA 2A79A 1QPRA 3LCWA 3I65A 2IS7A 1EA0A 1Q6RA 2GOKA 3BZGA 4AYSA 1BXBA 1Q6OA 3MKKA 3GYEA 1UG6A 1OWQA 1QHZA 3VZYA 5CG7A 2XTKA 3EDKA 3R0DA 4PYSA 2DJLA 3ANUA 3N73A 2F7FA 3PANA 4INFA 4KWOA 1XBXA 2QCMA 4TX6A 5DBTA 4E0CA 2NXHA 5CXPA 3WBYA 1CLKA 1FHVA 5FJIA 5E0CA 3CZLA 4J2MA 5AYZA 3LXBA 3PP7A 1X1ZA 3R25A 3L5LA 3TH6A 3P8JA 1AW1A 4UMAA 4DUOA 1XCFA 1Z9AA 4QG8A 3IUHA 2NQ9A 4B9ZA 3WF3A 4IMDA 4ES4A 1JDDA 3MI6A 4AHPA 2OWWA 5AHIA 5JIWA 2QPUA 1O1HA 3TCSA 1XSJA 4HJWA 2Z2BA 4RE4A 5K7JA 1GONA 1FP8A 4V15A 1K6AA 3BAYA 1XJBA 1TPWA 1TO3A 1PHWA 4QEHA 3TC7A 1T5AA 2ZZ5A 1U5VA 1GZ1A 1S1PA 2J7HA 1XINA 3OGVA 5FEPA 4J28A 1CW2A 3MVIA 1FWCC 2IQTA 5HJXA 1U30A 1WKFA 3CH0A 3WEZA 4UUIA 4Y90A 5CAHA 2XFWA 4YWIA 1XI3A 4YJ5A 2Q3OA 5I3FA 3B0XA 4PRTA 1P0EA 1B3WA 1I0BA 4NQ1A 1UC4A 2HCVA 4FX7A 1W1B1 4Q8VA 2W5FA 4UTMA 3CAKA 5G2HA 1P5BA 3DXIA 1CLXA 3KZSA 4GO9A 3JU2A 2YA0A 2XIMA 2FIQA 4WY0F 1MO0A 1UHVA 3GXIA 2YA1A 4LSBA 4D1IA 2O4MA 4Y8EA 2J9XA 1EZ2A 2DIKA 4MWAB 7ENLA 2EG8A 3TJIA 1CCWB 1UH2A 2WOQA 1ZAIA 3AIUA 3T8LA 1QK2A 1SR9A 4MPKA 4IICA 1OABA 3OZMA 5HDRA 2WYSA 1NF0A 1O6IA 2D1ZA 3ES8A 4LW7A 4DJFC 1EGMA 3PN8A 4GH1A 1RQHA 4JBRA 4Q7IA 1VCVA 3VDGA 1W5PA 1PV8A 4JTTA 4K68A 2PB1A 2XDFA 2V2DA 3F2DA 1J79A 1JYWA 1ZPTA 5KZEA 4D6IA 3AU6A 4QLJA 2ZRVA 1S2WA 1W91A 3UR8A 1H50A 3UA4A 1E40A 4D6JA 1POJA 3EX3A 1O4UA 3QPEA 1K4HA 1HP4A 3DECA 3B8UA 1DWIM 2VP8A 3LERA 3AO0A 4JICA 1QCWA 3LNPA 4F0LA 5A69A 3ARTA 1O60A 1XDLA 3MANA 3I4EA 4KWWA 1OX6A 3INPA 3ZO9A 1TB3A 2WWDA 1TMHA 2VYOA 5E0FA 3H22A 4UFIA 1F76A 1GVSA 4Z0SA 3O2LA 4HTYA 4AYGA 1J0HA 3IIZA 4MMWA 1SZEA 1JQXA 3G8RA 5DBUA 2WCGA 4GI9A 5E6YA 2YLLA 3SRKA 3H2CA 5J5RA 4WJ8A 3TZNA 3BAKA 4HU3A 5F2IA 2X8RA 3TN5A 5JQ9A 4IPJA 4L4PA 3UZYA 2D2HA 2PDWA 2YDQA 4GGHA 4N2YA 4Z0JA 5M17A 3A24A 4DWDA 2Z26A 2J7DA 2Z7KA 3ENLA 3EOEA 4CD5A 1CGVA 4PMYA 3SGZA 4MB1A 2OB3A 4MHBA 1RCXB 1UJPA 3O3RA 3SQSA 2HVOA 2AMGA 4N0RA 1PBGA 1HJVA 3FJLA 1R5YA 2PLKA 3NWRA 3S2NA 3IVSA 1GJUA 1U1JA 4TU1A 4A35A 2INEA 4DF1A 1MRAA 3KP1A 1MW1A 3A4XA 3W02A 4C7GA 3TN6A 3V18A 4AQLA 3ZSSA 2AKMA 3QF0A 5IFPA 3B0UX 1D8CA 1JUEA 3WX7A 4NXSA 1SQ7A 4ML4A 5G2WA 4EWJA 1GT8A 4ZCWA 2Z1WA 2OLHA 2X0SA 1K9DA 2C15A 3E5PA 4WKAA 1S39A 3RX2A 2ZBTA 1BQCA 1F3XA 3NO3A 3VDHA 2VT0A 3IGHX 1KXQA 1BYBA 4QG9A 4XAPA 4L9XA 3IGXA 1XQKA 3OA3A 3UXLA 1F8MA 2QDGA 3UG3A 1ODUA 4LRTA 2GK1A 5E93A 4KH2A 2PDNA 1E0WA 5FESA 2PU1A 1XLHA 2DIEA 5CGQA 1K03A 1AH0A 4GISA 3M0MA 2E5CA 3PAOA 1F73A 4O57A 4QLKA 4KFNA 3AXMA 3LI1A 2BV9A 4MG4A 3ATYA 2B4GA 2B0MA 1AQ0A 3FS2A 1RD6A 3CM4A 2FGBA 2NSXA 1UP2A 1NP2A 3OEXA 2A4AA 4ICCX 2PTYA 4JQ4A 4UMCA 4ZE4A 3W88A 5BU6A 5HXMA 2F6UA 4IOTA 3W7OA 2PMQA 3W1MA 4JKKA 1X6NA 5U7SA 3VNYA 1ITQA 2RDXA 2TSYA 5C9XA 4HP5A 4M19A 3H21A 1JYNA 2JFEX 2R1LA 2WKLA 1W9DM 3MV01 2UWFA 2YL5A 1K7XA 4PN2A 4KFPA 4UXDA 3AU2A 3MMTA 3KFTA 1S2TA 4J40A 5B7YA 3P74A 5CSYA 1JCYA 3QLDA 3NGJA 2Z6IA 5C55A 3RRXA 1J96A 1KFCA 5F2MA 2XWDA 3C3NA 4LX4A 1P0KA 2RH9A 5F7UA 3TOPA 3GTIA 3RX3A 3QY7A 2VFHA 3FEQA 3WFZA 3DHUA 3OB8A 2YL6A 3NR0A 4F9DA 1UP0A 3UPMA 1AG1O 4AD1A 4RPQA 4B5WA 2NVCA 4Z1AA 2EGZA 3EA3A 1BXNA 4P7NA 2OR2A 2V9DA 3S0CA 1EPXA 3H4GA 5JBEA 4Z1CA 2RDWA 4KEZA 1W9BM 1S38A 1CNVA 5CC3A 2QV4A 1W3NA 5K9CA 1GKQA 1PX3A 1UUQA 1WZMA 3N2XA 1PXGA 2NVAA 3E0FA 3O7UA 1DL3A 1LUCA 1YX1A 1B1YA 4C5YA 4JTIA 5FACA 2D0GA 4B15A 3O6DA 3GHTA 3W1AA 1A5KC 1DQXA 3UYIA 4Q8PA 3Q4DA 2POTA 1UMYA 4GMEA 3LCXA 4DM1A 1B2YA 1F7BA 1KM2A 4QE5A 2PTZA 3UXDA 2H90A 1BGAA 5A6JA 3TU9A 2GJPA 3NPUA 3BMXA 2OPJA 4XBJA 2OJPA