1A5BA

Cryo-crystallography of a true substrate, indole-3-glycerol phosphate, bound to a mutant (alpha d60n) tryptophan synthase alpha2beta2 complex reveals the correct orientation of active site alpha glu 49
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
268
structure length
249
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLANGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-crystallography of a true substrate, indole-3-glycerol phosphate, bound to a mutant (alphaD60N) tryptophan synthase alpha2beta2 complex reveals the correct orientation of active site alphaGlu49.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
molecule keywords TRYPTOPHAN SYNTHASE (ALPHA CHAIN)
total genus 91
structure length 249
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 1998-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1a5bA00
4ZL1A 1Q6RA 3B8DA 1MEWA 1NF7A 1OABA 4JYEA 2XFWA 1I8JA 4Y9AA 4S1FA 1LOQA 1JCLA 1U5JA 4JYDA 3B06A 2C15A 4P61A 4NNBA 3LXBA 3L5MA 3S42A 3GLCA 3FFSA 1SW7A 3HG2A 2G96A 4TR9A 3TC6A 1SPQA 3W1PA 1BWLA 5IM51 4JTGA 5CKSA 3PB0A 4ZZ9A 1T99A 2CZ5A 1TMHA 2GOUA 4O18A 4O1AA 4O15A 3TW6A 1R2TA 4HT3A 1PHQA 3W2MA 2QJGA 1BTMA 4PODA 1SFJA 4IOTA 4CNNA 1TV7A 2PRMA 2PRHA 3ANYA 4PL1A 2Y62A 3LHUA 3QW4B 2DZXA 2F84A 3B05A 1W0MA 3UWZA 2Z6IA 1TPWA 4M6PA 3E12A 3G1FA 3P82A 4IGHA 4XBSA 3N34A 2ZTKA 3FKKA 1VR6A 3N2XA 3R2GA 3C2EA 1G4PA 1H7WA 3HPSA 3SY5A 4UFJA 1F76A 1H7OA 4YCOA 5LGXA 1P1XA 4YMZA 5G2WA 5AC6A 4A2SA 4IMCA 3NEVA 3IIVA 2DU2A 1K7FA 2DZTA 1VH7A 2FPTA 2AAMA 3CIXA 2HTMA 3W7KA 3LBCA 1TV5A 4J9JA 1WX0A 4LVDA 3W1AA 1VHNA 3PM6A 2YSWA 1FY6A 1K7XA 1AMKA 1SZGA 4DXVA 1VCFA 4CQ9A 2P10A 2OCZA 1JRCA 2WSQA 3EB2A 3CHVA 1JCXA 3CWOX 2FB2A 1GTEA 4XZ9A 3SSJA 3QQ0A 4TMBA 3VE7A 1XBYA 2CFFA 1H5YA 2WV8A 2XN2A 3E49A 1TRIA 1KV5A 1JUBA 1OK6A 1PE1A 4QAIA 3NL5A 3DGRA 3SJ3A 1KBIA 3G18A 5J5RA 2RDWA 4QM1A 3LDVA 4BI5A 1L6WA 1L6SA 1SQ7A 3CB8A 4ICNA 3DFSA 1TB3A 5EY5A 4GC4A 1OFEA 1WYIA 2X1TA 2OZ0A 3BARA 5K9DA 4MIMA 1VRDA 1WXJA 1H60A 2R8WA 4QSHA 1IIHA 3WJYA 1G4EA 1OYCA 2QR6A 4MYXA 1OK4A 3W7EA 3STFA 5HMSA 4MKNA 4LC8A 5G2HA 1YTKA 4DF0A 4X22A 1OX5A 4DF1A 3W1LA 1OYAA 1LRNA 4ZQCA 2NWSA 3MMTA 3M5ZA 3JR2A 1WBJA 3PBUA 1F5ZA 1O60A 4IPIA 3VKJA 3NL2A 1PCKA 2ZRVA 2H3BA 3EX2A 3BV4A 4LV9A 2QKFA 2E1DA 3MHFA 1OFBA 1M7OA 2VFDA 1SU5A 1GG0A 3FJ6A 4LW7A 3EX4A 1KFJA 3MBFA 2V2CA 2BXVA 3NPUA 1M7PA 1SW0A 5D05A 4LVBA 4HNTA 3NNTA 1KA9F 4BFAA 1UB3A 5FESA 1DOSA 4Y8FA 2JKPA 4PFMA 3KOFA 2FLIA 1C9DA 3GZ3A 4G1KA 3A24A 3GXNA 2CLEA 2YZRA 3SIZA 3G22A 3SFKA 3W2LA 1VPXA 5L9FA 2YYUA 4NJGA 1EEPA 2V82A 1ICSA 3S0CA 3FYPA 4GUFA 1QPOA 3W83A 4NX0A 3SECA 1QMLA 1GWJA 3G0SA 3N9RA 1X1ZA 3W2JA 1IXNA 5AHNA 3MI6A 1TCDA 3RF9A 1JQVA 4K7YA 3DFPA 2BWGA 5I3HA 4Y6GA 4UTWC 1ZJIA 4JTKA 4S2CA 2QCFA 1YLVA 3CC1A 4OQVA 2C1HA 1JCMP 4AHPA 2DZWA 1KFKA 1BEUA 2EPHA 3P60A 1LBMA 4WXZA 3W7DA 1EA0A 4UTHA 2ATMA 2G95A 4NNCA 3JRKA 3I7QA 4GUGA 1LLZA 2VFGA 3PBYA 4UTJA 1F73A 5LNUA 3G3MA 4JTJA 3O63A 4K8EA 1LYXA 4O54A 4A29A 4N9EA 5AYYA 8TIMA 2AQWA 2VOMA 4TMCA 1P5BA 1OFQA 2ISWA 3CIWA 3TMLA 4DEFA 5K9CA 4NXSA 5I3JA 2YDAA 1N8FA 2VFEA 3QFEA 4R7JA 3TQKA 5H91A 4LY8A 4OV9A 5HULA 2C19A 5BOOA 5EYWA 2NXGA 3F1QA 4NJIA 3HPZA 3DKLA 5DCDA 2ZYFA 5AFDA 4Z1BA 3S5ZA 5G1TA 1TTJA 1Z41A 1GPWA 4MJZA 4NVTA 2VEPA 4LU0A 3FS2A 3S1UA 3NQVA 2H6RA 4H6KA 2J9XA 5FEXA 5CPOA 1OX4A 4A3UA 1LDCA 1R46A 5DY2A 1KTCA 2I9EA 1Z44A 1B4EA 1TPUA 3TR2A 5DCBA 4O28A 4AHOA 1TPB1 5F2MA 2QCEA 1KW1A 3CQ0A 1PIIA 3PG9A 1EP2A 3M44A 2ZA3A 2ZRZA 3W84A 1JULA 4XWUA 3B03A 3D0CA 1VHCA 2A0NA 4ML9A 4RJEA 1GVSA 3TH6A 4GFSA 5E93A 3GAYA 1KV8A 2Q8ZA 5D2TA 1L6YA 4JTFA 2Y85A 2JKEA 3THAA 3PY2A 2B7NA 3CWNA 1QO2A 2CLOA 2TYSA 3ZS4A 3LRLA 1JCYA 1CX9A 1VLWA 2NXHA 3FOKA 1RVGA 3NQAA 1G4TA 1SR9A 1K8ZA 4MFDA 4PC8A 4CQ8A 1FBAA 2Z6JA 1TQXA 1RQHA 3OHIA 3SZ8A 4I9AA 5C55A 4NQ1A 1R2RA 3PUDA 3SW6A 3M41A 3QYQA 4IJBA 2WOQA 3S1VA 2DZVA 3C4UA 1I45A 2ZZ1A 1F05A 4PH6A 3G1VA 2A21A 4FB7A 1LORA 1M6JA 2X30A 4N9BA 3JS3A 2OT0A 1GTHA 1YTDA 3FLUA 3H55A 1M5WA 3ATYA 4FHAA 1ALDA 3MYPA 4X2RA 5IBXC 2BLEA 3R8RA 1R2SA 4IMGA 4NNAA 3STCA 1EPXA 1A5BA 3DBPA 1JUEA 4CLMA 1YPIA 2QCDA 4BWLA 3TSDA 4AWTA 1I2PA 4TU1A 3PAJA 3O05A 1W5NA 4XBKA 3OVPA 2Y7DA 3ZWTA 3W75A 1SZFA 2GQ9A 4GUIA 1KM5A 4KFNA 4D2JA 5D2YA 2C16A 2NX9A 1I2QA 1GG1A 1WQ5A 4MOZA 4QNEA 3B0VC 3LGEA 4MZ1A 3LHWA 2EHHA 3TMQA 4WJEA 3A5VA 1XUZA 1RD5A 4LRTA 3W73A 5FF7A 3W85A 5FF2A 2EGZA 3C61A 3INPA 5K4ZA 4QJ1A 3KAOA 4FNRA 2QJIA 4IUOA 1QWGA 5G1YA 1NF0A 4AMAA 3NPXA 2J24A 3UQNA 4O19A 4N6EA 4FIQA 5KTLA 3W9ZA 5K4XA 3O07A 4MUZA 3TA6A 1W5OA 4U28A 3G24A 1DORA 3L5LA 1SZNA 3OG3A 3TFXA 4JTHA 3UWUA 3GKAA 2FPYA 1MO0A 5AN7A 4M7SA 3WK3A 1VZWA 4POCA 1UCWA 3LTPA 4GUJA 4MY9A 1H7XA 2OX1A 2ZFAA 1IXOA 2JGQA 1QOQA 3MWAA 1QPQA 3LERA 5DBUA 5EBUA 1FCUA 3QEZA 3CPRA 2VENA 2QAPA 3C56A 3B04A 1GVQA 4JR5A 2A2IA 2WPBA 1XCFA 5FF4A 5F1UA 1AG1O 1F2JA 1TTIA 3IVTA 4DO6A 1KLZA 1AL7A 2FTPA 1S5WA 3GB6A 1OF8A 2A6LA 3NZ1A 3P81A 4IMEA 3RU6A 6TIMA 1HFBA 1A53A 3PG8A 5I3FA 3OA3A 1NFBA 1QOPA 3A5FA 5CSSA 4BWLC 2G97A 3SI9A 1U83A 3M5XA 2JK2A 1VS1A 5EA9A 1G7VA 4R34A 2NV1A 3EXRA 3HIJA 2NLIA 3L5AA 3RNDA 5AOUA 4BI7A 1G7UA 4I7VA 3RMJA 2ZCGA 4N9CA 3HGSA 4AWUA 4ZQPA 3UD6A 3Q37A 4ORIA 4GUHA 2E68A 3PVFA 3TSMA 2E6FA 4FX8A 2WO5A 1V7YA 3NDOA 2Y7EA 3DHFA 3STEA 3O1NA 1HG3A 5BMXA 1P4CA 5T26A 3HO8A 2QUVA 3PC0A 1CW2A 1YTEA 5DCEA 2NX1A 3N9SA 3H53A 1KBJA 2Y63A 3A22A 1F6KA 1XL9A 3LX9A 4L4LA 4DELA 4YXGA 1OX4B 1R30A 3QSTA 2W79A 4AB4A 1ZFJA 3NO5A 3M9YA 3L67A 4JDBA 4JTSA 2Y89A 4WY0F 4UR7A 3MI3A 4O8RA 1EWDA 3LTSA 3QMTA 4MY8A 3M5VA 5DXXA 3BK0A 3KRUA 3OEXA 2V5BA 3PS7A 5K3VA 2B0MA 3W7JA 4RZ4A 3TROA 3AJXA 4BI6A 3EWZA 5HUPA 1UBSA 2VXNA 3V1PA 1IIGA 1S5TA 2CLIA 3KRSA 2YW4A 4JEQA 2E5CA 3BLEA 2BX7A 5KMYA 1JCJA 1OJXA 2B4GA 3FKRA 3M47A 3W71A 1KFLA 2Y7FA 1VLIA 5J5DA 3DFTA 3NR0A 3PB2A 1TPH1 3KHJA 3L66A 3RFAA 1QO5A 5DLCA 3LRMA 3DI0A 1T0OA 3MBDA 2DZSA 3W7HA 1MZHA 4UTKA 5HWJA 3GKFA 4IX0A 3LCIA 3R12A 2ZRXA 2H8XA 2WJZA 3NQEA 1JVNA 1H51A 3AO0A 4I7UA 3W7QA 4U4MA 3BO9A 4FNPA 3LOTA 4UMAA 3TUUA 4TIMA 1DQXA 5BNKA 1K7EA 3NAVA 5F4XA 3ZWSA 1NEYA 1QFEA 5FEPA 3MJYA 1TPVA 2V8ZA 5F2IA 3C6CA 2A85A 1I2NA 3K30A 2A5HA 5D04C 4FNUA 3UPBA 3TX9A 1FDJA 3IEBA 3IGUA 3IV3A 3BG9A 4YLWA 4FF7A 2E5DA 3HGRA 4AHQA 3LB0A 3LLFA 4UTIA 4JDYA 1W1ZA 5D02A 4PCFA 3W7PA 4BK9A 3G1XA 1LOLA 3NZRA 2A6NA 1FXQA 4FXSA 3PUOA 1XI3A 2RDTA 2GVJA 5AHIA 4P2VA 1TPEA 3QJAA 4DPQA 3HPXA 2A7NA 2R94A 4RR4A 3BW4A 3I6RA 3F03K 4JX6A 1GYLA 1W5QA 3TV8A 3UWYA 1LCOA 3TC7A 1XKYA 1VYRA 1XUUA 3TAOA 4WUIA 5AHFA 1ZAJA 3IIOA 3NGJA 1QPRA 2Q8LA 5K9XA 3CEUA 3HG4A 5CPMA 1DVJA 5D03A 2CZFA 3R89A 2H8ZA 2RH9A 1KFCA 4UMBA 4N6FA 2ZBTA 4FEZA 3T78A 4GE8A 3TXZA 5LHEA 2GJNA 3NL3A 1P0KA 3ABQA 5AHMA 2VKZG 1A5AA 4C1KA 1KFEA 4PL2A 1OF6A 2ZZ6A 3A9IA 3EX1A 5GVJA 1QR7A 4O12A 2C18A 3NQFA 4GJ1A 3LCGA 4EVZA 3CEPA 3L68A 3W70A 3L0KA 1O95A 4QISA 1RR2A 4UCGA 4Y96A 1WOBA 4L4MA 1TPDA 3NPWA 5LHFA 1VC4A 1O5KA 2WQPA 2B7QA 2VELA 5HR6A 3IGXA 2Y61A 3TW7A 2V81A 5D30A 1JRBA 1FWWA 1RZMA 5EPDA 3M5YA 5FEZA 1QDSA 3O6CA 3QM3A 3IIPA 3LHYA 4GXMA 2EF9A 4K37A 4WD0A 1W37A 3O6YX 1YPFA 5F4SA 3S5NA 1VJIA 3UY8A 1TJRA 1ZALA 4O11A 4UFHA 1EP1A 2GPTA 1ZY9A 3MHUA 3G1DA 2Y88A 4HNVA 1O5XA 2GVGA 4LTSA 5TIMA 1KTNA 4HHPA 3QC3A 3MYOA 1KM3A 4NU7A 2DORA 4CNOA 3LHZA 5HUOA 4M6VA 3VE9A 2C0AA 2PC4A 1THFD 1XDMA 2NUWA 1AW1A 4FO4A 4UR8A 5CPNA 4X3ZA 1VYPX 1D3HA 3LI1A 1T8XA 4K39A 3LHVA 4UTTC 3S1XA 5LNSA 3LI0A 3W6YA 4O57A 2VEMA 3M1ZA 4UTWA 3R13A 3BLIA 3EX6A 1F7BA 3E9AA 3L9CA 2QJHA 2FB3A 5D2VA 4KKXA 3U8GA 1ME7A 4RV8A 1XBXA 3W7OA 2F7FA 1P0NA 4M5PA 2GJLA 4JX5A 1VYSX 3NQGA 1IF2A 2YXGA 5F2LA 4OBTA 2O7SA 4QQ3A 4C1LA 4DF2A 4MLRA 4AWSA 1SO6A 5SWUA 4JN6A 5E1QA 3W1UA 3MO7A 1SO3A 3ABOA 5IBXA 4WY0B 2R91A 5L6UA 1W5MA 4O0ZA 3RLVA 1X6UA 4IXHA 1S3HA 4YL2A 1TREA 2ZQ0A 3W7RA 1DBTA 2CU0A 2QUUA 5HJLA 4ZQNA 5EL1A 3LHTA 3PWAA 4OV4A 3GXPA 4DPPA 1SSGA 1PV8A 3MI2A 3VFLA 5D2WA 5AHLA 3NXFA 3BLFA 3CM4A 1FCBA 1QAPA 3QF0A 2DP3A 3BGJA 4WQ6A 5TQLA 3DFNA 1FX6A 3E02A 1DKWA 1G69A 2DJXA 2RFGA 2EAWA 3MP4A 3EWXA 5LNRA 4JIPA 5LZLA 3L2IA 2EKCA 5DXYA 4NZFA 3W88A 4E38A 2FPVA 2NUYA 3M16A 2V5LA 2P0OA 4YWIA 3S5YA 3P5YA 2OMAA 3BW3A 4LRSA 4K7VA 1W31A 1X1OA 1FCQA 3KRZA 4PEKA 3W1XA 5U7SA 3KXQA 5HQEA 4AH7A 3NA8A 4O1CA 3EWUA 2XN0A 3LV5A 1DQWA 1OFPA 1EP3A 1AL8A 4CCCA 3W1NA 1PVNA 3NM1A 1W54A 1YYAA 4EF8A 4UTLA 5ABTA 3IVUA 3VI2A 2WNZA 3EEGA 2QDHA 3DHDA 4KWWA 5KZMA 3DFOA 1OYBA 3UYCA 2FJKA 2X16A 4UIOA 3G8EA 2DZUA 3NOEA 4UTTA 3UXAA 2VEKA 5TBOA 1VCGA 4JYFA 4JGDA 1BWKA 3SGUA 3LBMA 4LUIA 1KFBA 4LVFA 3ABSA 2QUTA 2A1YA 2NUXA 3W7IA 4LC6A 5C2XA 2ISVA 3B0PA 1DJNA 2A7RA 3CT7A 3STGA 4Q4KA 1LBFA 2CW6A 2TMDA 2ZA2A 1ZHAA 1EX5A 2ATSA 4N2YA 3A21A 2YX0A 1ONRA 2V2DA 1PS9A 3WJXA 4NX5A 3M0ZA 4TO8A 4UXDA 2RDUA 1GEQA 5D32A 4MZYA 4JD4A 4GNJA 2HSAA 1OFRA 3GYEA 1LROA 1ICPA 1HTIA 4IMFA 4UC5A 4IQLA 3W1RA 3W7GA 4Z08A 3TDFA 1GJPA 1C29A 4HSOA 4RZ6A 3G8RA 5C6MA 5KSWA 2HMCA 3N14A 3PR2A 3GDLA 4GWEA 3TAKA 4MY1A 4KFOA 1OVDA 2RKXA 3G0UA 3PBVA 5HR7A 4Z1AA 4OU1A 4ZMGA 5DN1A 4HPXA 4N4QA 4NJKA 3UPWA 1TSIA 2NZLA 1YXDA 3EWWA 2ZZ7A 4UFKA 3OIXA 4NXKA 2J9ZA 2CLKA 2PURA 3NQDA 5D09A 1N55A 4O13A 4A22A 2ZZ2A 4RKAA 1LTDA 4W9TA 1JJKA 3QW3A 3C0JA 4ZVJA 4XTIA 1WV2A 3GDMA 3UZ5A 3HG5A 1OFOA 3FEMA 4H4IA 3UNDA 2ALDA 2JKAA 1YADA 2QAFA 4JTEA 1KM0A 3MP3A 5DY3A 1S5VA 3ATZA 3UXDA 1QNVA 2QCMA 3GIYA 4MZ8A 3PULA 5FI8A 1H1YA 3EXSA 4UTMA 4JIQA 4K8HA 4EOUA 4JTTA 5AB3A 4HKPA 1JUKA 1H50A 2IQTA 6ALDA 4A2RA 1J2WA 1NSJA 3W2KA 3Q2DA 3FJLA 4BR1A 4I7WA 2Y6ZA 2HS8A 2O7QA 2E6AA 3KVJA 1HUVA 1IGSA 3W2NA 3SGZA 4CCEA 3TXVA 2LLEA 2CLMA 3RK8A 5HWNA 4K36A 3NYZA 1PCWA 4LUJA 1T96A 3HBLA 1B57A 3W7LA 1WA3A 3I7RA 3C2OA 2Y70A 1SO5A 5C54A 1DJQA 3W86A 1ZAIA 2FFCA 1FQ0A 5DBTA 1Z48A 4H3DA 3VNDA 3WJSA 2CLFA 1V5XA 3N2MA 1XBVA 2WKJA 3GNNA 4K38A 3MUXA 4MVAA 2YFNA 3FYOA 3DI1A 5CPLA 5KITA 3LCLA 3GDTA 2CWNA 3QPZA 4XUGA 3LCHA 3G3DA 5I3KA 4Q33A 1K8XA 1I4NA 1Y0EA 1OFDA 2NX3A 5CZTA 3LLDA 4KFPA 1TPC1 5LNVA 3W72A 3VCRA 3W7NA 5LSMA 4IWWA 1UUMA 2WNQA 2V9DA 5AYZA 5AHEA 3UWQA 3O8AA 3NPVA 4IMDA 4Z1CA 3WK1A 1UUOA 1FCVA 5F2GA 2J6XA 3S1WA 3BGGA 4JTLA 3DENA 4OWGA 4GRSA 3BG3A 3W7CA 3IRDA 4LOCA 3MHGA 3G1AA 3S6DA 1XBZA 2I1OA 1MSSA 1G67A 1Q6QA 3PF3A 2B7OA 4A21A 4AXKA 1YDNA 5AC7A 3A23A 4Z0SA 4FNSA 4JXCA 4S2BA 1DL3A 1JCNA 2NV2A 3P61A 4UFLA 3P5ZA 4RX0A 2QCLA 1ML1A 1A5CA 3T44A 3W23A 1OFAA 3O16A 4N9DA 3W87A 4AAJA 3KVMA 3TSBA 1LZOA 4LWWA 1SSDA 3HGOA 3P84A 3P74A 2QF7A 4O10A 3S9YA 1G4SA 1I2RA 1QPNA 1TV8A 3HB9A 1OHLA 3DZ1A 4WZHA 3DKJA 4NJJA 2GVLA 1H7NA 1H7RA 3B4UA 1BKSA 2C13A 2W6RA 1EWEA 3PSVA 2ZRWA 1LOSA 2V2HA 4UTUA 4N02A 5D33A 3SR7A 3N73A 4NJHA 3BW2A 4QITA 4E2BA 4O53A 1L9WA 1GOXA 1YDOA 4FNQA 4LT9A 1DHPA 5K2ZA 2ZZ4A 2VFFA 2TPSA 3QPYA 5LKYA 2CLLA 2FIQA 4E0CA 1W3NA 1B9BA 3TCEA 3BPWA 3ZR4A 1TPFA 1MEHA 3UY7A 1KM1A 3QSRA 4JTIA 1LLWA 5EKYA 1AW2A 4M6QA 2WNNA 4OGZA 5BMWA 4EIVA 3W76A 4ADUA 1HL2A 2VFHA 3O06A 3PBWA 3I7SA 2QDGA 3P8JA 3HG3A 1YDVA 3WJZA 1LM1A 3F4WA 5BW6A 4LS1A 4UFMA 3E96A 3THQA 4ZQOA 3OVRA 2X1SA 4GBUA 5KZEA 1IXQA 1TTPA 1KM4A 5LGZA 2X2GA 1UJPA 3DH7A 1TRDA 4JY9A 3YPIA 1F74A 5FF0A 5U4NA 3DU0A 4JY8A 1XDLA 1GVRA 2E09A 2PE4A 4O1BA 2YFOA 1SO4A 3G0XA 4QNWA 3IVSA 2I14A 1H63A 1KTBA 3H54A 1QCWA 4BF9A 4AF0B 1XFBA 5C5YA 2FQIA 2KZHA 1E51A 1LRTA 3NQ7A 1TIMA 4HNNA 5D38A 3LV6A 1VGAA 1H7PA 4NUWA 1Q3NA 3P67A 3S8HA 1YXYA 4DO4A 1WOAA 4LV4A 3PUEA 3USBA 5EMUA 3HF3A 3T40A 1MEIA 3GXTA 4ADSA 2YGYA 3TQVA 3FA5A 4Z1DA 2YW3A 1O4UA 1NAL1 3HMJG 2Q3OA 1Z42A 1TTQA 2H3DA 3W22A 4JTUA 3UWVA 3TK7A 4DBEA 3L65A 1FUYA 4ZQMA 5FEWA 5D2XA 1O94A 4LS2A 2G5WA 1K02A 4TX9A 3LTYA 1JR1A 3QMRA 3W3OA 1A50A 1RPXA 4O16A 2ZZ5A 1MXSA 2CLHA 4YCPA 2VC6A 2QCCA 1XXXA 4RXFA 2W0UA 1GVOA 2OJPA 4LVGA 1GT8A 3W2UA 3I65A 1RQEA 3W74A 1AK5A 2V30A 1GZGA 2B7PA 4OHQA 3HQ1A 3M6YA 1PHWA 4WY0A 4R53A 5LNWA 2E6DA 1ME8A 3BVJA 4ZQRA 2GQAA 2J27A 2P1FA 3T4CA 3KFTA 4JNMA 1SUXA 4B5NA 3O15A 3Q58A 1UASA 1B4KA 5K7JA 1ZNNA 4HIBA 1ME9A 4UUIA 5KZDA 1FWSA 1ZCOA 2PRLA 3HGJA 4E2DA 2NWRA 4EF9A 4O50A 1D9EA 4CNPA 3I68A 3KX6A 2QCGA 1HO4A 3LCWA 4O14A 2BSLA 2JGYA 1AW5A 3N19B 1D3GA 3WK2A 5AYXA 1K03A 4MYAA 3LRKA 3U2OA 3C8FA 3DFQA 4RZ5A 3TJLA 4AEOA 3EWBX 1Q6LA 2HS6A 3U6WA 4Y90A 3W7MA 3HJZA 2Z2UA 4NT0A 1W56A 5CG7A 4IXXA 3W1QA 1EB3A 1VQTA 3BG5A 1L2UA 1Q45A 2CZDA 3IIZA 3P8IA 1JQXA 5AC8A 1KM2A 1TYGA 3M7WA 1ICQA 3NM3A 1W3IA 1XM3A 4X9SA 2GUUA 4RLIA 1Q6OA 1K3UA 1WAUA 3O6DA 3TQ0A 2OT1A 5HINA 2YYTA 3GVGA 3B0UX 3C2RA 3EXTA 1CI1A 2PCQA 3TKFA 3QRHA 1OG0A 5I3GA 1R47A 4UFIA 2ABAA 4MJMA 3NQ2A 4O17A 2WSRA 2QCNA 1LBLA 4M7TA 3UWWA 3WK0A 3P7YA 2VFIA 1EUNA 3C2FA 3CTLA 2ABBA 3EX3A 3ZFHA 3C2VA 2YCEA 3NG3A 5CZJA 2VEIA 3TU9A 1ZAHA 5F1VA 1W3TA 4MLJA 3T55A 4LNYA 4ONVA 4KWVA 2BTMA 1GVFA 2ZRUA 2X1UA 4RCXA 3CU2A 4HN4A 4Z0JA 1J5TA 2YR1A 3NQCA 5H2ZA 3QH2A 3Q94A 1EIXA 4O1DA 3L21A 3GK0A 4QIUA 3NQ6A 3QQ1A 2ISSA 3TE9A 1HO1A 4ORMA 4AF0A 3RLUA 1SFLA 1TQJA 1FWRA 3WJWA 5MHBA 1XC4A 1RQBA 2E5BA 3NQ8A 1WBHA 3FIGA 5BRBA 3S5OA 2JBMA 3NQMA 1FWTA 3C3NA 2Z1BA 2RHGA 3GDKA 3KVKA 4LS0A 2ZA1A 1W8SA 3N3MA 1I2OA 4HSNA 4HNUA 4OE7A 1H1ZA 1YXCA 1C8VA 4HPJA 3NL6A 3IGSA 2ZRYA 5CZSA 4AVFA 3QMSA 1FDZA 3G1SA 4RXGA 3LM7A 4ALDA 2GQ8A 2CZEA 7TIMA 1W5PA 4PTNA 4XQ6A 4NZJA 2C14A 5DELA 4DO5A 3GX9A 3OVQA 1K8YA 3IIXA 3LCXA 2E77A 3W1MA 1TO3A 2Z0IA 4WOZA 2J88A 4IX2A 4DBDA 3CLMA 5A8GA 5KINA 2V0TA 1J4EA 1ZENA 5A5WA 5CZ0A 1G6CA 2Y7GA 1RV8A 4XKYB 1N7KA 2QCDB 3GR7A 4JX4A 4LVAA 3W1TA 2C6QA 2BZNA 2ZDRA 5G4WA 2YPIA 3EWYA 1KLYA 3L0NA 4XTDA 5HWMA 1A5SA 4OT7A 3UZJA 2ZTJA 3MW7A 1EUAA 2D73A 2TSYA 3TFCA 3EKZA 4Q32A 2QCHA 3LXAA 4N4PA 3EKLA 4R33A 3MP5A 4CCDA 3TNOA 2DJLA 3DAQA 3V75A 3P80A 5CSRA 4JS3A 5FF3A 3TJXA 2A7PA 4O4VA 2WSYA 1X7FA 1ADOA 2R14A 4WXYA 5G5IA 1H62A 2TRSA 3G1YA 2UV8G 3HOJA 4WX2A 1H61A 3GNDA 3GR8A 3P62A 2XN1A 3ELFA 4UNLA 3GAKA 1FXPA 1PL9A 3PSWA 3LXCA 5D37A 1DV7A 3WFAA 2ZZ3A 2Q3RA 2A4AA 2DZPA 5HNRA 1FDYA 1SW3A 2J9YA 4JICA 2AGKA 4XKYA 1X8FA 4K6AA 1KM6A 4FX6M 1GQNA 2H90A 1F6PA 5I3IA 5CGQA 2FDSA 2X1RA 1NVMA 3KVLA 3GDRA 1B3OA 1TJPA 3W07A 4PA8A 4O0KA 3L0GA 4FX7A 3LCFA 4FXRA 3E0IA 3TIMA 1VCVA 3QZEA 4FIRA 4O52A 5G4EA 4CQAA 5F4WA 4EWND 1LRQA 3NVTA 1IXPA 3OBKA 4RK8A 3F4NA 4ADTA 2QEZA 1OX6A 2E6YA 5G2IA 3G1HA 3R5EA 4UMCA 3T7VA 3C52A 4MPQA 4WOQA 4UNKA 1FWNA 4FNTA 3M43A 1GYNA 4O4WA 2C3ZA 4DQWA 5E0KA 4MFEA 1WDWA 3ABRA 3DXIA 4IPJA 1SZEA 2NXIA 1LP6A 4M19A
chains in the Genus database with same CATH superfamily
3CAKA 4ZL1A 3B8DA 2V3FA 2Z2BA 2XFWA 2PDHA 4J2PA 1VFLA 3B06A 4WSHA 1BYCA 3L5MA 3S42A 2PLKA 3URBA 3BAYA 1SW7A 4LUYA 2YB1A 1SJCA 3DG7A 1SPQA 2F6UA 3W1PA 2CZ5A 2GGJA 1EJ7L 4W89A 4K1WA 3OHMB 4UQBA 3V35A 1XICA 4DLMA 1JZ8A 3E2SA 2GWNA 4PL1A 2PRHA 5A6LA 7TAAA 3UPMA 4QTGA 2Z6IA 4M6PA 3E12A 4XBSA 3LZ5A 3N34A 4JAWA 3T08A 1J12A 3N2XA 3R2GA 1VIZA 4KEZA 1P1XA 1WDPA 3RRXA 4A2SA 4IP7A 4KCTA 1VH7A 2AAMA 3QLLA 4F40A 3LN3A 3U3HA 4PUWA 4J9JA 1WX0A 3RCNA 3OZMA 1WCGA 4Q8NA 2OXNA 2TODA 2PBGA 4DXVA 4XISA 5A1AA 3BICA 2P10A 1JRCA 2HCVA 2WSQA 3EB2A 3CWOX 1GTEA 4QP0A 3VE7A 3NXLA 2CFFA 4FXJA 3L7RA 3E49A 2D0HA 1H2JA 1PE1A 1R3QA 4QAIA 2VCCA 4NSBA 3EDFA 1KCZA 2BY1A 3MSGA 1L6SA 4ICNA 1XQKA 4WHBA 5EY5A 2ZICA 2X1TA 4IIEA 3BARA 2G3FA 4OFCA 5K9DA 1VRDA 2I5IA 3AIWA 3BQ5A 1XIGA 2R8WA 2Z1XA 1TX0A 3CV2A 1MVYA 1SFSA 1OYCA 5MF5A 1X6LA 3S2CA 2PEVA 4ZO8A 4F2UA 1EXPA 3T09A 3T9PA 4DF0A 4X22A 5E0CA 4A3RA 4DRSA 3W1LA 2WPGA 1OYAA 3XINA 4GVIA 3LLXA 2NWSA 1J0YA 5CAHA 3M5ZA 4RPQA 2D22A 4W8AA 3MVIA 2VWSA 3EX2A 4B4HA 1OFBA 2VVSA 2IKGA 1KFJA 3NPUA 1M7PA 1SW0A 3S2LA 1S39A 3OLDA 4N7QA 4IICA 1EJWC 2VX4A 1FWCC 3KOFA 1C9DA 4G1KA 3UGRA 4DN1A 3GXNA 2YZRA 3VIOA 3WN6A 3SUUA 4J3SA 1QPOA 1ZB5A 4NX0A 3S6OA 1US0A 1GWJA 4JFTA 1MW3A 1TWSA 4PSPA 3O7UA 3W2JA 3MI6A 3AICA 5LIWX 3PJTA 3DFPA 2BWGA 3U57A 4Y6GA 1XIFA 3WQWA 2C1HA 1KFKA 1BEUA 1LLOA 1GW1A 1SJBA 4GK8A 4HTYA 1M65A 1GJWA 1EA0A 1TZ7A 1JL8A 5TAOA 4NNCA 4H04A 4AISA 3I7QA 2DSVA 4K68A 4JL1A 1L6FA 3PBYA 3G3MA 3B9EA 1F9CA 1OZQA 4U5IA 1EJUC 3VM7A 1MDLA 8TIMA 4TMCA 4KS0A 1DWAM 1OFQA 2ISWA 3AIVA 3KZSA 1UA3A 4DEFA 3BJFA 1XSIA 1IT8A 5HULA 3EWDA 3H26A 2BASA 1GZJA 5BOOA 1XLAA 2F8QA 5AZ1A 4QLLA 4C6EA 3DKLA 5DCDA 2ZYFA 3D3FA 5AFDA 3TYEA 4GXWA 3W29A 1Q13A 1X7IA 3PZQA 1TTJA 3KEHA 1GPWA 1CB7B 1S1PA 4MJZA 4PRWA 4LU0A 1QBAA 2HBXA 3NQVA 1E3ZA 2J7DA 4LUSA 3HM7A 5CPOA 3W01A 4A3UA 2GFTA 5DY2A 4PRRA 2BXYA 1TPUA 3E0WA 4IM4A 5F2MA 4RE4A 1KW1A 3E3HA 2ZRZA 3NZPA 3B03A 3WQEA 3D0CA 2A0NA 4RJEA 1V02E 5E93A 2GVYA 3AYSA 4CVUA 3KBVA 3TNBA 5D2TA 1ECQA 1L6YA 2OODA 3O0FA 4IGSA 4AC1X 3ME3A 1A80A 5CLTA 4MB3A 2VTFA 1CX9A 2NXHA 3W02A 2QVNA 1RVGA 4HJWA 1BG4A 1TV4A 3TR9A 3MKKA 1E70M 2CHNA 1UOZA 2Y5EA 3R11A 3IJLA 2Z27A 4K8GA 4X61A 4I9AA 3ZR6A 3GTNA 1SFTA 4E2VA 3PUDA 3SW6A 1IZKA 1XYFA 3M41A 3QYQA 4A8RA 3C4UA 3CUFA 1I45A 2ZZ1A 1DXIA 4PH6A 1F3TA 3ISIX 3T0CA 4XO6A 6XIAA 3WBYA 2OT0A 3H55A 1M5WA 5JVLA 3S3GA 3IK2A 1LT7A 1V02A 5CXPA 4PE8A 4DXKA 1TWWA 3REQB 2BLEA 3R8RA 2VCBA 3BUVA 3ZJ8A 1KXVA 1ISYA 3E2RA 4JL2A 3TZNA 4AWTA 4TU1A 2JALA 3WMSA 4PB4A 3LPOA 2DZBA 2VP8A 2X7WA 1QXLA 3K1GA 3P3BA 1B3WA 1GG1A 4MOZA 3UT0A 2FZDA 1CECA 4W4QA 2OYKA 3DHUA 2FYMA 3SCOA 1XUZA 4OZOA 4DZIA 2YOCA 2EGZA 3C61A 3MMWA 4PUMA 3INPA 5IDZA 5K4ZA 3R0UA 2QJIA 1MW0A 1UH4A 2E4TA 2WSKA 4XO7A 3NPXA 4O19A 3GR4A 3RYSA 4N6EA 1QI5A 5K4XA 4BEQA 6REQA 1AZ2A 3L5LA 1XJBA 3TFXA 2VZUA 2Z26A 1MXGA 3LTPA 3OJGA 1UPMB 3FW6A 1H7XA 4WGHA 4OOUA 3CIVA 2XIOA 2O4MA 1NELA 1FWHC 7ODCA 5DMYA 4M1RA 4M51A 3RPMA 4KF1A 3LERA 1JDAA 3N2CA 4IT1A 5EBUA 1FCUA 5JBDA 3F2BA 1E71M 3QEZA 3CPRA 2YCKX 3C56A 4JR5A 1XCFA 1TTIA 4R88A 3IVTA 1KLZA 1AL7A 1E6NA 1W9VA 1FHVA 1NWSA 1W2PA 2GYIA 3P81A 1EOKA 6TIMA 5I3FA 4GYKA 4L5ZA 3SDOA 1NFBA 4W8LA 3QGAC 1OIMA 2B31A 2JK2A 2VDIA 2NLIA 4WJ8A 3CPUA 1B31A 3MSDA 4I7VA 3VNJA 3BC9A 4AWUA 1UG6A 2OELA 3CAVA 3MWCA 4ORIA 1ISWA 1FFQA 5CG0A 1V7YA 2Y7EA 3DHFA 3TYAA 4Z17A 1AFSA 3HO8A 4ASTA 2PD5A 3S5SA 1HIZA 4HYVA 3RN6A 3WLPA 5IXEA 1ISZA 1RP8A 4LALA 1YTEA 5DCEA 4F66A 2NQ9A 3ONBA 4GQRA 4DELA 1XL9A 4L4LA 5GNZA 4YXGA 2W79A 1R3RA 3SCTA 1LWIA 5B7YA 1RBLA 1AJ2A 3M9YA 1VFOA 5BCAA 3QKZA 3TZFA 4UR7A 4O8RA 1EWDA 3Q65A 1A49A 3M5VA 5DXXA 3POCA 4X0NA 4H8VA 1Q2RA 1UZ1A 2V5BA 1XIDA 5K3VA 3T0DA 5HA7A 1GORA 4RZ4A 3AJXA 5CGMA 4GZEA 1JNDA 5HUPA 1UBSA 2NV9A 1IIGA 3UG3A 1S5TA 2HXTA 3KRSA 3ARZA 3QHOA 3CUGA 2QZRA 3T0BA 2E5CA 3VOIA 3BLEA 3FKRA 3M47A 4ILSA 1G5AA 1KFLA 4A3HA 4YS1A 4GIAA 5J5DA 3LMZA 4XIMA 1M9HA 1TPH1 3CZKA 2AAAA 1I75A 3VKKA 1T0OA 1NTHA 4LBRA 2PDCA 2YA2A 3TTOA 1JVNA 4FR6A 5A6AA 3OZOA 2OO6A 2QT3A 3BO9A 4FNPA 3LOTA 1WUFA 3ZWSA 3LPFA 3MJYA 1TPVA 2XIBA 3VGHA 3C6CA 4GZJA 2OEMA 5D04C 4FNUA 1KGXA 2DW7A 2PP3A 1W9XA 1FDJA 1UD5A 1XCXA 4Z2JA 4ZFMA 1JZ6A 3IEBA 3IV3A 5JH2A 4KIEA 4YLWA 4FF7A 2E5DA 3HGRA 5AC5A 3EOSA 1CYGA 3LLFA 4UTIA 1W1ZA 3SN0A 4GYPC 4WDXA 1HKVA 3W7PA 1DP0A 1LOLA 5FA5A 2I5QA 3RX2A 4J3VA 4DI8A 5AHIA 4A6GA 3HPXA 4RR4A 3ARXA 4L9XA 3F03K 2QLYA 1W5QA 3UWYA 3SURA 1XKYA 2H9AB 6CGTA 4WIWA 5B7ZA 3V16A 3SUTA 1S2AA 2CERA 2E9LA 5HMFA 5AHFA 5K9XA 3HG4A 5CPMA 1DVJA 1UKPA 2CZFA 3RX4A 2O0TA 2PZNA 2ZVRA 1JPDX 4JQ2A 3C3UA 3UG5A 4ERAA 2HPIA 3NL3A 3N25A 2VKZG 3IK4A 3GW0A 2G41A 1U30A 3WD4A 3FDGA 2PWVA 1KFEA 1Y5XA 2ZZ6A 3A9IA 1J6OA 2REQB 4GJ1A 3LCGA 1XWYA 4JOMA 1PZ0A 3RM4A 3VA8A 3L0KA 1KBLA 3FA4A 5C9UA 4Y96A 3VINA 1MMFA 1TG7A 1MUCA 1E1FA 2VELA 3IGXA 5IRPA 1JRBA 1QRQA 5EPDA 5FEZA 3MPGA 1JDDA 1HKIA 4NZ4A 2JEQA 4LJ3A 5BXTA 3S5NA 2Y5SA 1EGZA 3CZJA 4UFHA 3I3BA 2ISFA 1BF2A 2JE8A 3CBWA 3TTQA 2Y88A 3SCWA 1O5XA 2D23A 2GVGA 3MY9A 2L5HA 4J3ZA 2FHBA 2DORA 4RNHA 1RVKA 4CNOA 1ZBWA 5HUOA 4M6VA 1LG1A 2PC4A 1Q6DA 4IIDA 4URIA 3LMYA 1UP0A 1OZMA 2E9BA 3GTIA 3WNMA 3S1XA 4GQ0A 3VFCA 3EX6A 3BLIA 3R13A 4KIRA 3DFYA 4BA0A 5FJOA 2FGZA 4JKMA 4W88A 1JPIA 2HK1A 3ARSA 4RV8A 3U8GA 4JEJA 2ONEA 4EAYA 2DZAA 1P0NA 4M5PA 1A5KC 4NAFB 1VYSX 3UJFA 1FWDC 2GGGA 3BDKA 2O7SA 4AWSA 1SO6A 4TOQA 5E1QA 1Q6GA 5IBXA 1F8MA 5J8LA 1R3WA 3QTGA 3URAA 4A8LA 2Z1VA 4IXHA 2G8ZA 2J74A 1DBTA 5HJLA 4KRTA 5EL1A 2ZC1A 3NWRA 1R8LA 3VDCA 5BYWA 1F3XA 3WDRA 3MI2A 1P48A 5AHLA 3NXFA 3CM4A 3BGJA 4EKJA 3ANUA 1ZBVA 4WQ6A 5E5CA 3E02A 1DKWA 3LENA 2DJXA 4M8UA 3MP4A 3BSGA 1JZ3A 4K1GA 3IJIA 1V8EA 3L2IA 4ZA0A 5DXYA 4NZFA 3W88A 2XFRA 1GVYA 4E38A 4Q4RA 1CEOA 2PC8A 2V5LA 2E8YA 1U5HA 3P5YA 2OMAA 1Q8AA 4UQ9A 4K7VA 4AMCA 4LANA 3E38A 1FCQA 3PZNA 4AH7A 1DQWA 1FRBA 4AZCA 4H7VA 4DB7A 3CHEA 1WXZA 1FWAC 1LT8A 4Q4PA 3GG7A 3B8VA 5A8PA 4CCCA 1DWHM 4HB7A 4EF8A 1QK2A 3VI2A 4D1JA 3FA3A 2QDHA 1XYBA 1MUMA 2J62A 1NDYA 3MC5A 3S83A 1K6AA 5HOSA 3AMCA 2DZUA 4X2PA 9RUBA 3OG2A 4HOWA 4IP4A 3FJ4A 1K9TA 4JGDA 5C0QA 3LU2A 3LBMA 4DJFC 1KFBA 1UD3A 3MU7A 4JHMA 2NUXA 4DNMA 1PYFA 1WO2A 5C2XA 2INZA 3CT7A 5DMLA 3VDHA 1FH7A 3WMLA 1LBFA 2DPEA 2TMDA 2HPMA 4AYSA 1EX5A 1V3MA 3A21A 4MNLA 3SJNA 2BY3A 4AG0A 1ONRA 3GHTA 4H9TA 4R7WA 1NQKA 3T2OA 1RK6A 1GEQA 5D32A 2W61A 5I5RA 2DIEA 3Q4DA 5HNNA 4LPCA 4OBRA 1PIFA 2HSAA 3MUIA 1OFRA 5XIMA 1LROA 1X96A 3OPSA 3ERPA 5EMLA 3VIMA 2FJUB 3W1RA 1QU4A 5C9ZA 5EMMA 1UOKA 1E5NA 5EU9A 3TAKA 4KFOA 2JEPA 4RNIA 4Z1AA 2IXUA 5FD0A 4DM2A 1PDYA 5IHSA 4N4QA 3LPPA 4KRUA 5BXSA 1NDWA 2NZLA 3WCZA 2FFIA 4BS0A 3FY1A 3QZAA 1TUFA 4A22A 3UCCA 1EYEA 4GACA 4LAKA 4W9TA 2FDMA 3QW3A 2Z28A 1PUDA 3BCJA 1WV2A 3KDOA 3FEMA 3ZT6A 1B54A 2ALDA 2JKAA 4HU0A 4MJ4A 1XRFA 3L4WA 1YADA 3Q67A 4JTEA 1KM0A 3MP3A 4J2MA 5DY3A 2EJAA 4PMDA 2HZGA 3EXSA 2EPMX 4GINA 4JIQA 3WQ8A 5AB3A 7A3HA 3PN8A 2IQTA 3D47A 1NSJA 3FJLA 4I7WA 3VD9A 4IFOA 3SQSA 3KVJA 3E5PA 1HUVA 4W5UA 1NP2A 1GKPA 2LLEA 2ZX6A 3WDIA 3RK8A 5CBIA 4DO7A 3B8SA 3W7LA 1WA3A 2Y70A 1PWMA 5H8PA 3W6LA 2PTWA 5D9OA 1KRMA 1FQ0A 1KC7A 4H3DA 3VNDA 1TVNA 2CLFA 4R85A 4US6A 1XIIA 5I09A 3GNNA 4K38A 1NJJA 3LCLA 1VFUA 3LCHA 3G3DA 4Q33A 1J8VA 4QLJA 5CZTA 4UNIA 3N29A 3UETA 3UNTA 1DE6A 1TPC1 3W72A 4X0VA 3W7NA 2YIHA 2XIJA 5GQBA 2WNQA 1TCMA 3O8AA 2CESA 1X98A 5AC4A 1D2KA 1UUOA 1QNQA 4TX8A 4XAFA 3W7CA 4F2BA 3IRDA 1R38A 4DBUA 4D8LA 2AQVA 1NARA 4FR1A 2B7OA 1MZRA 1UD4A 4FXFA 3V7PA 5AC7A 3A23A 4Z0SA 4FNSA 3QN3A 4JXCA 1JZ2A 4D71A 4LAZA 2JIEA 1O6IA 2OGYA 3T44A 3TTYA 4N9DA 1J10A 1O5QA 1QOXA 3W87A 1P6CA 1LZOA 1TX2A 3GC4A 4DJED 2WHLA 4GY7A 3HGOA 3UR8A 2QF7A 4O10A 1I2RA 4WDTA 1QHOA 2CBIA 2J7HA 3II1A 3C5QA 2DQWA 1OHLA 2VUYA 3DZ1A 4WZHA 1XLIA 4G1NA 1BKSA 3UJSA 2VC9A 3LA4A 1E6XM 3WUGA 2ISDA 3HTWA 2ZRWA 3TYCA 4UTUA 2C91A 1I6NA 5D33A 5T91A 3SR7A 1M53A 1HP4A 1QTWA 1TIWA 4C1NA 4TTUA 4MM1A 2BVTA 4E2BA 1YDOA 4GI8A 2ZZ4A 3QPYA 4E0CA 2Z24A 1T7LA 3TCEA 4R9OA 3GUWA 1MEHA 3UY7A 4S23A 1UC5A 3QY6A 2WCGA 2YDQA 5BMWA 2O9PA 4EIVA 1W91A 1QT1A 3W76A 4H2HA 4RDZA 2PGEA 3CYJA 3CUHA 3MTWA 3HG3A 1YDVA 3IACA 3S4TA 2FZNA 5BW6A 2B81A 3WUFA 3E96A 3THQA 3OVRA 1MW2A 3ZMRA 3WBEA 1RHCA 5XIAA 2D3LA 1UJPA 1V0MA 5EMKA 5I3DA 2IQDA 5U4NA 1K77A 1UWTA 2PODA 4JY8A 1XDLA 4Q8WA 4AY7A 1V4YA 2BVYA 1B1YA 2XFFA 4PMQA 2YCLA 1G9HA 1H63A 4DAIA 3H54A 3UERA 2XH2A 4Y8EA 2KZHA 2BDQA 1LRTA 1RK5A 3W25A 1VGAA 2D20A 3DN5A 2CITA 4KWUA 3QOKA 3N15A 3P67A 1B90A 1Q5MA 1YXYA 4AD0A 4DO4A 2XH7A 2XDFA 2VDHA 5FJUA 3PUEA 1C93A 3USBA 3HF3A 3UWEA 2W27A 4ADSA 5A94A 4MMWA 1O1ZA 3AMKA 1IWBA 1V6VA 4JTUA 4EXAA 1YHTA 3ARPA 4C6QA 1KQYA 3EAUA 1O94A 4LS2A 4ZEPA 1QNRA 1ZL1A 1WUEA 3OQEA 4TX9A 4D8AA 2JIWA 3TOYA 1JR1A 3MCMA 3W3OA 3FVMA 1A3WA 2VC6A 4B3ZA 5GJNA 4XB3A 2W0UA 4YYFA 1GT8A 3I65A 3W74A 1YX1A 1MW1A 5AY7A 4WY0A 1CB2A 1P6BA 2CKRA 3BVJA 4YNGA 4Y7EA 1M03A 3A4JA 2J27A 4Y2WA 2PPGA 4H8UA 3EMZA 3KFTA 4U2YA 2R6OA 5DQPA 3NDYA 3UXLA 1EZ2A 2INFA 1WZAA 4BQ5A 4TQTA 3EBVA 1ME9A 3A13A 5KZDA 2Q09A 1T41A 2NQJA 1ZCOA 1V7AA 1AMYA 3VMPA 4O50A 5M17A 1S5MA 4GY1A 2QCGA 2PDLA 1F3EA 3WK2A 5JIPA 1K03A 2ZUTA 2ZUUA 3WFZA 3LRKA 3DFQA 3ARTA 4HA0A 4AEOA 1Q6LA 1DYSA 4NIRA 5A2CA 4IXXA 4NASA 3W1QA 1KRAC 1H0IA 4GMEA 3NZGA 2CZDA 3M7WA 1ICQA 4KT2A 1W3IA 4X9SA 4QG8A 3WNLA 3A64A 4GGHA 1WAUA 4DAFA 3TQ0A 2ZXAA 1RBAA 2OT1A 2YL5A 5HINA 3GVGA 5XINA 2DVXA 2PF8A 3B0UX 3ZSSA 2PCQA 1R47A 1ZSXA 4Q3MA 2ABAA 2GDVA 4U3AA 3NQ2A 1V3IA 3GNXA 2QCNA 3A3WA 4XD6A 4WDWA 3W00A 4I5UA 2J79A 3E6EA 3P7YA 4J28A 4Z2GA 2BS9A 1B5TA 2ABBA 3EX3A 4ZCWA 2Y24A 1XLDA 3BXWA 1QNOA 3TQPA 5F1VA 3WEZA 4MLJA 1CPUA 4ONVA 4KWVA 4MUPA 2VOTA 3CU2A 4Z0JA 5T9CE 1HJWA 1JEZA 4O1DA 3L21A 3GK0A 4QIUA 1XYLA 4M81A 3TE9A 3BTNA 3B4YA 4I9MA 2YCLB 1SFLA 5MHBA 4CNSA 1XC4A 1QVBA 1S3TC 1WBHA 4NKCA 1XQLA 2JBMA 3NQMA 1FWTA 2Z1BA 3WLSA 3KVKA 4HTBA 2ZA1A 1GQLA 1ZJAA 4H8NA 2PAJA 1XLMA 1YXCA 1C8VA 4HPJA 3IGSA 2ZRYA 4AVFA 3QMSA 4RXGA 4PEEA 3CZGA 7TIMA 4GXPA 1BVZA 1C8QA 3W82A 2E77A 3W1MA 1F07A 4HZ6A 5AYIA 1XYCA 4IX2A 4DBDA 4KRZA 5M03A 2ZUNA 4GHRA 1J4EA 2Z1SA 5A5WA 1G6CA 2Y7GA 2WC3A 2YBUA 1RV8A 3W1TA 3GR7A 4JX4A 4JQ3A 2BZNA 3EWYA 4Y9PA 1KLYA 1DJGA 5RUBA 5HWMA 3RHGA 4OT7A 1JZ7A 2ZTJA 4KCUA 2GK1B 2D73A 1F3WA 2TSYA 3EKZA 2QCHA 4N4PA 2PDUA 5FOOA 4DJFD 3MDUA 1V0LA 3A4AA 3OP2A 2DJLA 2A7PA 1M68A 1X7FA 1ADOA 1H62A 5JIWA 4BF5A 4P8VA 2Q71A 1JI2A 3L4VA 2E3ZA 2Q8XA 4WKFA 5JUVA 3GRIA 3GAKA 1FXPA 1TKKA 1E4NA 4Y9NA 1PZ3A 2W5FA 1BXCA 2X7VA 1DJWA 1DV7A 1D8CA 2I9UA 2A4AA 2DZPA 1SW3A 4P7QA 3KLKA 4JICA 4F0SA 4QBXA 2AGKA 2VUNA 1KM6A 4FX6M 4J3XA 5HMDA 4BHYA 5CBJA 2X1RA 1EC8A 1UZDA 5FJIA 3W07A 4ZBCA 4PA8A 2XIQA 4FX7A 2FMOA 4GC3A 1E3XA 1VCVA 3N9KA 1AH3A 4EWND 4MJ2A 2QEZA 1GGOA 2Y2WA 1OX6A 1TR1A 2Y8VA 3PZOA 5G2IA 3G1HA 4UMCA 1MRQA 1X1NA 3JVAA 3C52A 2RDXA 1XR2A 2AOSA 2MUCA 4UBPC 2C3ZA 3ABRA 3WG6A 4C6BA 1XYMA 4JYEA 1TWDA 3MUAA 4WF7A 1I8JA 4GO8A 4S1FA 1LOQA 1JCLA 1ZQ5A 2OLAA 3AHYA 3FFSA 4RPPA 2GUYA 2G96A 3TC6A 4R9XA 3TYUA 1BWLA 4XUYA 4Q8OA 4JTGA 1A5NC 2HRWA 1Q6EA 3KM8A 2Z2AA 4PBEA 1A5UA 4HT3A 3XIMA 1V08A 4GX9A 1PHQA 1VEMA 2ZIDA 1BTMA 1AJ0A 2AKMA 4IOTA 1IZJA 1TV7A 3ANYA 3KOYA 3RLGA 3QW4B 5JH1A 2DZXA 3TJIA 2P50A 1W0MA 4Q7NA 3P82A 4IGHA 1EFZA 1WDRA 3C2EA 1G4PA 3HPSA 3G6MA 1H7OA 1R3VA 1MYRA 5LGXA 5HQLA 4UTFA 1DPMA 8RUCA 2DU2A 2DZTA 4GIRA 1FP9A 2ON3A 3DUGA 3G5EA 3EOOA 2HTMA 4R5EA 5T9BG 1XYAA 3IAPA 3W1AA 4IPNB 3PM6A 5HNUA 1CXFA 2YSWA 1FY6A 3ZQ9A 1VCFA 4IQEA 4PCPA 4XZ9A 2PSNA 1TJ0A 2WV8A 2XN2A 1JUBA 1OK6A 1UA7A 5FSEC 4HN8A 3DGRA 1V0KA 4ZGYA 1J0HA 5J5RA 1HVXA 4ZB5A 4QM1A 3LDVA 2UY5A 4BI5A 1L6WA 4B2DD 1NH6A 3CB8A 3DFSA 1TB3A 1Q7MA 2OG9A 5CGTA 5CPTA 2OZ0A 5HXMA 5LA2A 2I7GA 1DXEA 2ZADA 1NDVA 2WJFA 4DVOA 1G4EA 2DFAA 2HNEA 1M04A 2J4GA 4MYXA 3TYDA 3ZVHB 4D6GA 3R4IA 4AZ5A 2QHAA 1LQAA 4QG6A 1J0JA 5G2HA 1OX5A 1A0CA 4DF1A 4IP5A 2FVMA 1LRNA 1D8WA 4HA1A 4F0RA 4JN8A 1WBJA 4IPIA 1V3LA 4EPEC 3VKJA 1QW9A 1U5VA 1PCKA 3DC8A 2H3BA 2C71A 3AHVA 3BV4A 3NFUA 4LV9A 2E1DA 1BKHA 1SU5A 3S2MA 1JI1A 1UD8A 3FJ6A 5JQ9A 1IT7A 1XINA 1JG9A 3EX4A 4WKHA 2V2CA 2BXVA 2VZOA 5CC3A 3NNTA 3B0XA 1E6RA 2OQYA 4KEMA 1KNWA 1Y65A 5FESA 3PZTA 2WBGA 1DOSA 2JKPA 3M7SA 4PFMA 4MB4A 3GM8A 3UZYA 4GYFA 4PCSA 3VZYA 3VTRA 1VPXA 2YYUA 4JFVA 1MNZA 1XDJA 1AH4A 3SECA 1QMLA 3G0SA 2YCIX 1YNPA 3WQPA 4WSJA 1IXNA 5FSDC 3RF9A 4TV6A 4JTQA 1JQVA 4GNVA 3SY1A 4K7YA 3RILA 1ZJIA 1YLVA 3CC1A 2OSXA 2PA6A 3MV01 1JCMP 4OQVA 2DZWA 1DJYA 4E2OA 2PTZA 3VD5A 1BAGA 5CC7A 3MCOA 4IZGA 4UTHA 3CQIA 4W87A 3MB9A 2V63A 2FH8A 2XM1A 1K70A 4UTJA 4C6OA 4JTJA 3O63A 5D9PA 4A29A 2RGLA 1GW9A 4CN1A 2AQWA 2ZXBA 1P5BA 4XAGA 1J01A 5LXXA 2GSHA 2UZ9A 5I3JA 1BLIA 2VFEA 3QFEA 2PGRA 3TQKA 3GVQA 2YDRA 1RD6A 2C19A 4FAMA 3ITTA 4RZBA 1XLJA 5EYWA 2NXGA 2VQTA 3EOEA 1DIEA 1HJSA 4AD2A 4NAFA 2ZUVA 1F4HA 4D9PA 3PPFA 3MKCA 2GQ3A 2VEPA 4G2DA 3WFLA 4WEVX 3TVAA 2WWCA 3BV7A 5HPCA 1LDCA 1Q6CA 1R46A 4H9UA 1Z44A 1I0DA 2OLHA 1H09A 4IPPA 4GO9A 4O28A 2P8CA 1TPB1 1NWRA 3PG9A 3M44A 2ZA3A 3E0LA 1JULA 3KUMA 2XIIA 4Q4SA 4EAMA 3CAQA 1FFRA 4ML9A 3KCLA 1KQZA 4JTFA 2CHRA 1FWFC 4Q7IA 4XVDA 5EB8A 1DJHA 5I2UA 1QO2A 2CLOA 5C71A 1JCYA 3FAXA 4FPSA 4B5WA 1SR9A 1K8ZA 4MFDA 3GVWA 1CGYA 4NQ1A 4J35A 1XP3A 1M41A 3ARYA 3H21A 3QV9A 4QJ4B 1JIBA 3S1VA 4H00A 1F05A 1IQ8A 2E0PA 3CO8A 4LYKA 1LORA 3G1RA 2EBNA 1YTDA 2PTXA 3FLUA 3CL8A 3WD3A 4X2RA 5FL0A 2XZ7A 5IBXC 3S6TA 4NAEB 1R3YA 4F0HA 2X05A 4IMGA 3CAWA 2PLCA 3STCA 3DBPA 2VR2A 4CLMA 2QCDA 4BWLA 2OYLA 1I2PA 1ISVA 1UHVA 1W8GA 1LQ0A 1W5NA 1HXJA 4J40A 1SZFA 5D2YA 2C16A 3CL7A 2PP0A 3EOLA 3LGEA 5BOEA 4MZ1A 1CGWA 3GU1A 1CIUA 2PP1A 4WJEA 2QMKA 5FF7A 3BAXA 4JHZA 4P7LA 2JF7A 5BXRA 2BGNE 4AD1A 3DESA 4PMVA 3UEQA 3GE7A 4FIQA 2QV4A 3TA6A 1W5OA 3E5BA 4U28A 3NEHA 1DORA 3OG3A 2RJHA 3TC3A 2E28A 3GXFA 3WH7A 1MO0A 5AN7A 3WK3A 4POCA 1FHLA 1HKJA 4GUJA 2ZFAA 1XFCA 2X1IA 3HURA 3W38A 5ABEA 3MWAA 5E6ZA 4WDUA 5E0FA 3OBEA 1Q63A 3WDJA 1SYTA 1CGVA 2VENA 2QAPA 4O8AA 3GW3A 1GVQA 2A2IA 5FF4A 5F1UA 1F2JA 3QVQA 3O6AA 3MA8A 3VKDA 3RPTA 1OF8A 4IMEA 3RU6A 2CWXA 3PG8A 4XX6A 4X9YA 1O66A 5CSSA 2V67A 4B5XA 3M5XA 1GQKA 4X60A 2QJJA 2Z7GA 4R34A 2NV1A 3VNMA 3WMBA 4PUUA 4TXEA 2J66A 3N11A 5AOUA 4M29A 4BI7A 4RDYA 2ZCGA 4N9CA 1W3LA 1DIKA 4ZQPA 4GUHA 2E6FA 4D6FA 2WO5A 1CXLA 2Y8UA 4HPHA 4S3FA 4PZVA 5HMEA 1CW2A 5E70A 2NX1A 1F6KA 2A3LA 1TUXA 3QSTA 4S3EA 3KS5A 4AB4A 4EWJA 4N42A 3VC6A 1OC7A 3NO5A 3QR3A 2DT3A 4JDBA 4AUBA 3BZJA 1J6PA 2Y89A 1KCKA 3HN3A 3WX7A 1MDRA 1Z7AA 1BRLA 4MY8A 4M80A 1W2VA 3KRUA 3OEXA 3UP8A 3PS7A 3PNZA 4QGCA 3TROA 2OKTA 1ZTVA 4U2ZA 3V1PA 2XINA 2VM8A 2CLIA 4S3GA 2P88A 1GOIA 5KMYA 2B4GA 5A6MA 2FMNA 3W71A 4W86A 1VLIA 3PB2A 3KHJA 3L66A 3GH7A 3SCRA 5DLCA 1S5NA 3LRMA 2OQHA 3JZUA 1CT5A 4UTKA 3I6EA 1GQJA 1P0DA 3LCIA 3R12A 2ZRXA 4PB3A 1L8PA 1JXKA 4IISA 2VZSA 2WMHA 4U4MA 1OQFA 4AZ7A 1E0WA 3WNOA 4TIMA 1K7EA 2YXOA 4DWDA 4DBWA 1J11A 1NEYA 4DX3A 2QGYA 2V8ZA 3PZUA 2GWGA 1VEOA 2DT1A 3W27A 2DGAA 4U33A 4UR9A 3UPBA 4L4PA 1ITQA 4LGXA 3DC0A 2J75A 2MANA 4QROA 4C6IA 5JBFA 4JDYA 5D02A 1YNQA 5HK4A 1WDDA 4WGXA 2VEGA 2W3ZA 4B92A 3H7UA 3T1GA 4D6IA 2PU0A 5D8WA 1K9EA 1XI3A 5CJMA 5A6BA 3DX5A 4DPQA 2XPKA 3NO1A 3WLKX 1UZ4A 3BW4A 3RDKA 2F9RA 4LCSA 4NI3A 4HGXA 1LCOA 4GI9A 3TC7A 2QUNA 1XSKA 3VNIA 2OU4A 4P5UA 4FSAA 5DO8A 3FHQA 4WUIA 5CPSA 1ZAJA 3NGJA 2YLAA 3GVVA 3CEUA 4XVEA 5D03A 4F9JA 5GJMA 2FHCA 3M07A 4B3KA 3HV8A 1CTNA 3OLIA 4N6FA 1WXYA 2ZBTA 4UMBA 3GBEA 3NZQA 1MUWA 2V3GA 4RNJA 2YDSA 1RA0A 3TXZA 2IKHA 4L80A 4TTGA 4H7CA 3ES8A 4H9XA 1ADDA 4CGTA 2G3JA 2O55A 3WO8A 3WLLA 4QXIA 2CNCA 3LY0A 3URQA 5D4YA 2C18A 3NQFA 3CEPA 1UR4A 3S9IA 1JFHA 1RXOB 3ITYA 1XD0A 5BU9A 3AZSA 5LHFA 1IHIA 5HR6A 2Y61A 3CYVA 3QGVA 1ZS2A 2W67A 1QDSA 3LHYA 4GYPA 4C91A 4GXMA 1CWYA 2I17A 3VMNA 5I78A 3R58A 2PDJA 2CLPA 1GOQA 3N1AA 3WBWA 1EHNA 3O6YX 1YPFA 2GJPA 3WLHA 5DFAA 3WQOA 3AIUA 1ZALA 4O11A 3UZWA 2ALRA 1EP1A 4XD4A 2ZX8A 3ZLGA 1JD7A 3L12A 4HNVA 2Z29A 1TWZA 1KM3A 3FCPA 1VBRA 5M5DA 1XGEA 3WH9A 3ITGA 2NUWA 3TTEA 1AW1A 4FO4A 5CPNA 5E9AA 1VYPX 2X0HA 1D3HA 3WF4A 4RE2A 3LI1A 1T8XA 4FMVA 3MUCA 4UTTC 5FAGA 2CETA 3CQHA 3LI0A 3M1ZA 3QQWA 1EEXA 1F7BA 1J79A 3L9CA 4LEQA 2WVSA 4LF2A 1PZ1A 5I6SA 5HAOA 2EPKX 4KKXA 4FLSA 1VFSA 1C8YA 1NM9A 2PWEA 3VGDA 2GJLA 1E6SM 1JYNA 4JX5A 1J0KA 2TAAA 2WAGA 4YYCA 4C1LA 1ZPTA 1WKDA 3UXIA 5SWUA 3KBMA 4QLKA 3ZJ7A 3MO7A 1SO3A 3ABOA 5CQ1A 2R82A 1MFVA 3ENLA 1W5MA 1Z3NA 3BCFA 3RLVA 2PWGA 1S3HA 1Q8JA 4YL2A 1TREA 1BXBA 3JU2A 3SCVA 1NFPA 2CU0A 2QUUA 1XGDA 4ZQNA 4FA3A 3PWAA 2W66A 2QYGA 5LIYX 3GXPA 3PTKA 2ZXDA 3BLFA 3T6CA 1NOFA 3QF0A 1FCBA 1QAPA 3CZLA 2I16A 3BMVA 4RE3A 3FN9A 3TTSA 1PXGA 5TQLA 3DFNA 1FX6A 4MWAA 4QCFA 4KETA 3V5FA 3TYBA 2EAWA 1Y5VA 3WDHA 3N3TA 1CZ1A 3OU8A 2FPVA 2NUYA 4HK6A 3MCNA 4G9PA 2P0OA 3CUZA 2HQAA 1YEYA 3S5YA 3ARRA 3BW3A 4LRSA 1VJSA 3KRZA 2A79A 3W1XA 4DYJA 5U7SA 3SCPA 3KXQA 5HQEA 3UJRA 3EWUA 2XN0A 4D8ZA 3LV5A 2XVKA 1OFPA 2QIIA 1C91A 3WELA 3FHAA 3FYYA 3NM1A 3SN1A 5C7VA 2WNZA 3PBGA 2VRQA 2HDJA 4KWWA 3VOCA 2DIKA 2VC5A 5KZMA 5T8GA 1OYBA 1Y8BA 4ERIA 3NOEA 4CQCA 3APGA 1A5MC 1CENA 2BP1A 1EKOA 4ZXLA 1VCGA 2Q02A 2QVHA 4JYFA 4ZOAA 1BWKA 3PTDA 4LUIA 4D6JA 4MSSA 2VGBA 2QUTA 4LC6A 1S38A 2ZE3A 2ISVA 1DJNA 4PBFA 1P7TB 1PKMA 1V6UA 3U2ZA 3GXDA 3H2MA 3AXIA 2CBVA 1U33A 4I8DA 4Q4KA 4DHGA 2EQDA 4CUCA 1UW9A 1V0NA 2CW6A 2GK1A 4ZB0A 1GOKA 2ZA2A 4FP1A 3SAZA 3PPCA 4AZGA 3KBWA 4B5TA 4N2YA 4PTDA 2J7CA 5E09A 1RALA 1IGWA 1LUCA 4JKKA 1K9DA 3WJXA 2RDUA 4MZYA 1E43A 3EDKA 1OIFA 3C0LA 3VD7A 4Q6JA 1GVEA 3ZJKA 3GYEA 4KCVA 1OSEA 3VNZA 1ICPA 1HTIA 1N8IA 4UC5A 3TDFA 1GJPA 3WH5A 3N14A 3W26A 3GDLA 1JDCA 2VD8A 4B5UA 4L56A 4H1ZA 1OVDA 3KE0A 3PBVA 5HR7A 2F38A 2V3DA 4J4KA 2ZUWA 4NJKA 1TSIA 2HE8A 4B15A 4PUEA 4QRNA 4UFKA 4NXKA 2E8ZA 2VGGA 3NQDA 1N55A 4EPDC 1I9CB 2GDUA 1O5RA 1WKFA 4RKAA 1BYDA 2NVCA 1EZWA 3CMFA 2IPJA 3BCDA 6PTDA 4XTIA 5ENLA 1US2A 3HG5A 3UNDA 1HQTA 5C2GA 3GH4A 1T6MA 2NVDA 3AZRA 3MSRA 3AMGA 3IJ7A 3STPA 3UXDA 2ACUA 1QNVA 3GIYA 3PULA 4S3AA 3B9OA 4K8HA 4EOUA 4JTTA 2VWTA 2WBKA 1JUKA 1K4GA 2YBTA 3BQ6A 3W2KA 3Q2DA 4BR1A 3QV8A 2HS8A 2O7QA 2PS2A 2E6AA 4YTSA 3W2NA 4QQUA 3TXVA 4EE9A 4K36A 1PCWA 1T96A 3HBLA 1B57A 1KGWA 3CH9A 3W86A 3CQKA 2DUAA 1AH0A 1Z48A 6REQB 3WJSA 1UR2A 1V5XA 3N2MA 3PHAA 1XBVA 1B9ZA 2WKJA 1UIPA 1F6YA 1RJQA 4DXXA 3MUXA 4MVAA 3GDTA 1TR9A 4IJRA 3K2GA 4I90A 1NFGA 2INEA 2R1PA 3GZAA 2NX3A 4PMZA 1WAWA 2BBFA 5LNVA 3T8LA 3GNOA 3AUJA 3R7MA 2E9MA 3WF1A 1UUMA 2GJXA 2V9DA 5AHEA 4E3VA 2CBUA 3WK1A 1W9BM 2J6XA 3BGGA 2NVAA 2DH3A 1R5YA 2G37A 4LOCA 3G1AA 4B9YA 2PGFA 3S6DA 2I1OA 3NYDA 4Z2HA 4LX4A 4A21A 5FKYA 3GQYA 3WQCA 2WC7A 3DYOA 4S2BA 3B8IA 3L4YA 1EGVA 2P0IA 3KOXA 4IF2A 2NV2A 4HCHA 4UFLA 3UW6A 4AIUA 1OFAA 3CT2A 4AAJA 1LL6A 4L6OA 4WK9A 4IIGA 3KVMA 5A6JA 2Z00A 4G7FA 1EBHA 3P84A 3S9YA 2XH4A 2G4FA 4S3KA 3KDNA 2RJGA 2DT2A 2D24A 4I3GA 4NJJA 1QNSA 2GVLA 1H7RA 2C13A 2W6RA 1Z32X 1MWOA 2DQXA 1EWEA 1JPMA 1E0UA 1LOSA 4NILA 1RCXB 3T05A 2QS8A 4J3WA 4N02A 1SGJA 1OD0A 2BHYA 3KL0A 4AX6A 3GVRA 1EYWA 3N6HA 1EO7A 2WKLA 1XX1A 3RXZA 3RMEA 1D7KA 3DFHA 4JCMA 2CLLA 4MHBA 2OOGA 4UQAA 5BRPA 1UP3A 4CKQA 2Z25A 1L2QA 3WEOA 3ZR4A 4R3UA 1TPFA 1AW2A 3AROA 4G6CA 4M6QA 2WNNA 2J77A 3P0XA 1HL2A 1ZZMA 2XWDA 2XHYA 3ZYZA 4TV5A 3PBWA 3SFWA 4UQCA 4ATWA 4ZENA 4MWAE 4XBJA 3F4WA 4LS1A 3AAMA 5BU6A 4LUTB 2X1SA 1TTPA 1CLVA 4H6QA 2XM2A 4OECA 5LGZA 2X2GA 3LD5A 4IJCA 4PN2A 3DH7A 5FF0A 1Z69A 1ONEA 3DU0A 3R6IA 4LAMA 2DIJA 1OCQA 5CSUA 2E09A 2I57A 4O1BA 1L8NA 4QNWA 1D3CA 2WMGA 1ZLPA 1XFBA 2WMKA 4PBGA 3EDEA 1E51A 1C7SA 3NQ7A 1IR1A 3V0TA 4HNNA 3M0JA 1Q3NA 3RUBL 3S8HA 2PDKA 3F5KA 1TZ9A 5B80A 6TAAA 4I9TA 3GXTA 4JKLA 5D8ZA 2YW3A 3EKGA 1O4UA 1OCBA 3HMJG 1E4LA 1NP0A 1XLKA 3W22A 3MZ2A 4V27A 3SQLA 1FUYA 1KXQA 3V3WA 2PB1A 6ENLA 3I4KA 1XSJA 3GC5A 3QMRA 1A50A 4O16A 2DW6A 2CLHA 2Y8KA 3QC0A 1JPHA 4KMQA 2OJPA 4LVGA 3NSXA 3BSMA 3RCMA 4FOKA 2V30A 3CJPA 3HQ1A 4ICCX 3GXMA 1PHWA 4GGBA 4AVNA 2OQLA 2BFGA 3CO4A 2E6DA 1ME8A 2GQAA 1SMAA 3K4DA 4RW5A 1E1CA 4DZAA 3VD3A 1YE4A 1XH0A 3Q58A 1UASA 4GH1A 4YWSA 1BRLB 1LL7A 2H9AA 3ZLHA 1YKWA 4HU3A 5TD4A 1XLHA 4JQ4A 1DQUA 3ITCA 2WCSA 3KX6A 2J8GA 3LCWA 2ZWYA 2BSLA 2JGYA 1AW5A 3N19B 4XAPA 2OWXA 4ZB2A 3WBAA 2BG5A 1E1CB 4RZ5A 1JGMA 1PTDA 3TJLA 3EWBX 4FALA 3U6WA 4QR6A 5IDIA 2Z2UA 4NT0A 1W56A 5CG7A 1VQTA 5HPOA 1UQYA 4GKTA 4YVXA 1Q45A 4L65A 4HK7A 1KM2A 1HZYA 3NM3A 3LS9A 4MF4A 1W17A 4RLIA 4EPBC 3WDPP 2CBJA 3EB4A 3NSMA 4K2SA 3GY1A 2EG8A 2VR4A 3BOLA 3QRHA 1ODUA 1OG0A 5I3GA 3A3HA 1VBGA 5CC5A 4MJMA 1XIJA 9CGTA 4O17A 4L64A 2WSRA 1C9WA 3AFBA 2O9OA 4MWAB 1PX3A 1FHDA 1XLBA 2ZXQA 3C2FA 3WL1A 1US3A 3ZFHA 3C2VA 1HX0A 1LL4A 3P93A 5CZJA 3TU9A 1ZAHA 3T55A 5J04A 3QTPA 2BTMA 1TELA 2ZRUA 2X1UA 3AI0A 4HN4A 3NQCA 1K6WA 3U5UA 5A6BD 2J13A 1RCQA 3R0KA 3Q94A 4Q22A 1EDQA 3QQ1A 2ISSA 1TE6A 4CD7A 4IFRA 3RLUA 1TE1A 3BZGA 2W9MA 3AHZA 2OZTA 4FLQA 3GDKA 4GJIA 4HMCA 2PWDA 1S2WA 3N3MA 4HNUA 4OE7A 3NO3A 4PTXA 2GJXB 4B90A 2VEFA 3CL6A 3LM7A 4CNTA 2CZEA 3EOUA 1ZU8A 1W5PA 1YIXA 2DY3A 1JAEA 2IQ0A 2C14A 5M2FX 2J7FA 3QY8A 2BOGX 1UMYA 4PMYA 2D3NA 3OLGA 2Z0IA 4WOZA 3QBUA 2WWDA 5H8MA 3DGBA 4E5TA 4DJEC 1ZENA 5CZ0A 4W7UA 4MWAD 3WD2A 1UC4A 4G5DA 2UY2A 2WC4A 3KOZA 4YU1A 2C6QA 3WD0A 4KERA 3IWPA 4XTDA 1A5SA 3H4XA 1EPVA 3QHMA 3MW7A 3M4HA 1OGGA 5LA1A 4Q32A 3ARUA 3EYPA 3WQDA 5ECUA 2WW5A 1V3KA 1AQFA 2QDEA 3T4WA 3WQ6A 3WNKA 2IKIA 3P80A 5MKGB 4JS3A 5FF3A 4EP8C 2ZWZA 4H9YA 3SRFA 2R14A 3BURA 5G5IA 3P14A 4QEEA 5LIXX 3G1YA 3HOJA 4S3DA 3ES7A 1Z9AA 2O9RA 4JQAA 4LNCA 1H61A 1H49A 3GNDA 4DJFA 1PSCA 3L2LA 3PTMA 1PL9A 3OQ8A 3PSWA 2UY3A 4XG1A 4EXQA 3PZ9A 1BHGA 3GDBA 5D37A 3KL3A 3ZR5A 5HNRA 4YN5A 3A4XA 2J9YA 4GY0A 3PBMA 1NDZA 3NVDA 3GFZA 4LCRA 2H90A 1Y7VA 5I3IA 5FL1A 1TWIA 2FDSA 3VNLA 1TJPA 3L0GA 3FDKA 4MNMA 4NZ1A 3E0IA 3KTCA 3QZEA 4CQAA 5F4WA 3FSUA 1XGZA 1LRQA 2Y1HA 1IXPA 4LUTA 3GD6A 3R5EA 1V51A 3GU9A 4MPQA 1A0DA 2YA0A 4Z2KA 4FNTA 4A3YA 5EFDA 3EZ4A 4DQWA 1J2BA 2QJMA 4AY1A 3DXIA 4IPJA 1LP6A 5A2AA 2PDGA 1Q6RA 3LK6A 1R3SA 4LYRA 2NSOA 1MEWA 3ZM8A 2WK2A 4WLCA 1X8CA 1DTNA 3LPGA 4JYDA 3JW7A 3QYSA 2C15A 4P61A 2QPUA 3LXBA 2NT0A 3GG1A 3GLCA 3TN3A 3HG2A 4TR9A 5I03A 3MUY1 2CXEA 5IM51 4F48A 2EXOA 4ZZ9A 3GYCA 4H2CA 1PBGA 3CNYA 1ZP3A 3NDZA 4O1AA 2WZTA 3N2TA 4O15A 3VU2A 1EC7A 4XZNX 2WMIA 4P7OA 1SFJA 4GA8A 2PRMA 3M0LA 2Y62A 1A5OC 4XZHA 2P53A 3B05A 3VKCA 4NHVA 1DHKA 1TPWA 1W32A 2ICSA 3FKKA 1VR6A 4RE0A 3SY5A 3JUGA 3N4FA 1F76A 5REQB 2NQHA 1SZRA 4GX8A 4YCOA 3CASA 1C7TA 2A3EA 5G2WA 3GHRA 3PJXA 4JPGA 3NEVA 2DUZA 3IIVA 5ABGA 1K7FA 4I9JA 3D46A 4C60A 4YPJA 1UD6A 3DOPA 2FPTA 3UESA 6A3HA 3W7KA 4C6CA 3LBCA 3I4EA 1VHNA 1AMKA 1SZGA 1HT6A 3SY8A 3ORWA 1HJVA 1YQ2A 2OCZA 1BSLA 1JCXA 2FB2A 3IJ6A 3QQ0A 4TMBA 1F4AA 1KV5A 3RITA 1EGMA 2D69A 1KBIA 5A6KA 4HZMA 3G18A 2WHJA 1SQ7A 5BRQA 2D0FA 4GC4A 3RAOA 1OFEA 3SRHA 1WYIA 3VILA 2DVTA 2X41A 1E56A 1WXJA 1H60A 4Q8PA 1VB9A 4QSHA 5CCZA 1RH9A 1IIHA 4P8UA 4Q8TA 3WJYA 4LAOA 4DUVA 5PTDA 2HROA 1OK4A 3STFA 3R8GA 3E1F1 3IUDA 1GUVA 2VD9A 4ZQCA 4E6MA 3MMTA 1F5ZA 1O60A 5JXQA 3CMGA 3AIQA 3NL2A 3BJSA 4UOQA 4MB5A 4KEUA 2ACSA 2QKFA 5JU6A 2BVDA 4QEHA 4UB9A 1ZBCA 4IQJA 3MBFA 4CU6A 3V5OA 5D05A 1DWFM 4HNTA 4BFAA 1Z89A 1UB3A 2WVVB 3SN4A 4Y8FA 3WQ5A 1WKEA 3A24A 1LQ2A 3QXBA 3WLQA 3G22A 3SFKA 5HATA 3W2LA 4DI9A 2AL2A 5FCZA 5DMNA 3GHSA 3WSUA 5L9FA 1EEPA 2V82A 2ZUSA 1TA3A 1H41A 4GUFA 3W83A 4JTAA 3PWGA 1X1ZA 3J7HA 3SO7A 3VZZA 3GBDA 1TCDA 9XIMA 3HMCA 5EBAA 1E4IA 1UKQA 4UTWC 4JTKA 1LJYA 1RLCL 1OBAA 3C0QA 1VFMA 4HVXA 3OODA 1TV2A 4AHPA 4J5NA 4A3QA 2EPHA 2YBVA 2WYSA 2JFEX 1LBMA 3W7DA 5DRCA 5IFTA 4GIEA 4RDVA 4XD5A 4ZOBA 2C8NA 4O0QA 2G3NA 2PUZA 1LLZA 2VL4A 2VFGA 2VYOA 3F5LA 1F73A 5LNUA 4ERGA 5TF0A 5M3WA 1R7OA 4K8EA 4O54A 3ARVA 3SUVA 4GZIA 4N9EA 3ZT5A 4Q7BA 3CIWA 1KFWA 2J25A 4NXSA 2YDAA 1N8FA 3LSCA 3SIMA 3IANA 3TN6A 2EKGA 1UKTA 3KCJA 3R94A 3U2EA 3F1QA 1RA5A 1SMDA 4NJIA 3GWQA 3HPZA 1CDGA 4GISA 1ELSA 3AZTA 3S5ZA 1G0CA 4L7ZA 1M1BA 4YTUA 1E1EA 3LUTA 1Z41A 1FWEC 4NVTA 4A8NA 3S1UA 2ASHA 3WUEA 4Q8VA 4H6KA 3WF2A 3VMOA 1OX4A 4E4UA 1KTCA 2I9EA 1CLKA 1B4EA 2R1MA 1XW8A 4HHLA 4AHOA 1C92A 2QCEA 3U5YA 2VDGA 1PIIA 2V68A 1AQMA 4A8IA 4XWUA 4B9ZA 4Y9OA 2G50A 3NGFA 2GGEA 1GVSA 3TH6A 3N12A 4GFSA 3WQFA 1XF0A 3GAYA 4WKAA 4C5YA 2OSYA 4GQGA 2DDXA 4UQDA 2JKEA 5EMJA 2PTDA 3BAKA 3CWNA 5HDRA 3PZVA 2TYSA 3LRLA 1VLWA 3FOKA 1G4TA 1KGUA 3H2EA 3E0VA 4PC8A 1TMQA 3EWCA 2Z6JA 1TQXA 1RQHA 4H9VA 3M0XA 3SZ8A 1R2RA 2VT0A 1M01A 3QV6A 4DNHA 2DZVA 1DJXA 2GOKA 3G1VA 2A21A 4QFUA 5FIPA 4BF7A 1E4MM 1IV8A 1M6JA 4N9BA 3JS3A 3UCQA 2O92A 1AZ1A 4LQ1A 4FHAA 3RLHA 1KO0A 1N2VA 3IJ8A 4CU8A 4HD5A 5E6YA 3WLOA 3M0KA 1JUEA 4HOXA 3UA3A 5LIKX 1VP5A 4G7EB 3T2PA 3U9IA 7REQB 4C6PA 3PAJA 3O05A 3BSHA 4XBKA 3OVPA 2X40A 4GUIA 1TMLA 4KFNA 4D2JA 2NX9A 1I2QA 1WQ5A 2GZXA 3B8WA 4QNEA 2DSKA 3LHWA 3NJ3A 2FVKA 2PF0A 4LRTA 1RD5A 4JNZA 3W85A 4J27A 3AU2A 5FF2A 5A8NA 1L6GA 1MFUA 3UR7A 5IHRA 3VGFA 4MTVA 1VBUA 3OB8A 5G1YA 2J24A 3UQNA 3K46A 3VO0A 5KTLA 3W9ZA 4LBUA 3O07A 4MUZA 4PB5A 1SR0A 1SZNA 3H6OA 1BWVA 3UWUA 3SRDA 2FPYA 4M7SA 1VZWA 3W6MA 3WQGA 1UCWA 4ZXOA 4MY9A 1MQPA 3DDMA 3M0HA 4JQ1A 2P3ZA 2YLLA 3APYA 4DM1A 1Q4NX 1QOQA 1KRBC 5DBUA 4F79A 4B2DA 3O3RA 3B04A 2WPBA 1GYMA 3WIJA 4HHHA 4DO6A 3W24A 1GONA 1GVIA 2P5NA 2A6LA 4HP5A 3DYMA 3OA3A 3TCSA 4BWLC 3GG8A 2G97A 4S3CA 2X0SA 2OZ3A 1Q6FA 3U2CA 1XLCA 3IPWA 3USZA 3EXRA 1R7AA 1UBPC 4HCDA 4W7WA 1GOOA 4GPNA 3RNDA 1HKWA 1WKYA 5CSYA 2IW0A 1DE5A 1G7UA 3RMJA 4CN6A 2VC7A 2WKGA 2E68A 3PVFA 4U10A 3TSMA 4FX8A 3UXKA 3VIGA 4WRHA 3ZVIA 4FK9A 4I6KA 5HNTA 4QSFA 3IUIA 4JTDA 2PDXA 1OGBA 1UR0A 3PC0A 2QDDA 5KEZA 3N9SA 3H53A 1KBJA 3A22A 1OX4B 1R30A 5I23A 1ZFJA 1KWGA 1A3HA 3M0MA 3L67A 4WY0F 3MI3A 3LTSA 2FH6A 2V3EA 1NWTA 3BK0A 2QIWA 3WEMA 4HK5A 4F9DA 2F2KA 3W7JA 1JZ4A 1PWLA 3LNMA 4BI6A 3EWZA 2XUCA 4CD8A 2VXNA 1VD6A 1REQB 4HBKA 3E2QA 2DUXA 2QGHA 5I00A 1VBJA 4NF7A 1OJXA 4B5VA 1HJXA 2Y7FA 2OPJA 3DERA 3OZPA 3RFAA 4ES4A 3GTXA 3MZNA 2DZSA 3W7HA 1MZHA 1S2UA 4KH2A 1LG2A 3VUSA 4IX0A 1B3ZA 4CQBA 4R7OA 1TJ1A 2P8BA 1OEPA 4J3UA 3S2JA 3MSYA 2P76A 5FEPA 4MWAC 3SRKA 5F2IA 3FK4A 3UFYA 5HJYA 3M64A 1UPPA 5DRIA 3PUGA 3BLPX 3P0WA 4DZ5A 3EMCA 1ADSA 1LWJA 3PTQA 1H0GA 3WH8A 1KCXA 3IGUA 3BMXA 1ZJBA 3THDA 3OO2A 1PZ2A 3ZT7A 4MGGA 2WZEA 4PCFA 4CEXC 4BK9A 3TOPA 3S2NA 1PKNA 2A6NA 2WVVA 1FXQA 3PUOA 2RDTA 3K4AA 3H7RA 4KWOA 4P2VA 2WLYA 3QJAA 1ODZA 4UZSA 3WNNA 4H8HA 4DYEA 3N4AA 2R94A 2BHUA 1YE6A 3GFYA 3PK7A 2Z1WA 1AQ0A 1XUUA 1NU5A 2OX4A 4XAYA 3CHFA 3IIOA 3CZ8A 4MDOA 3BLLA 1FHUA 2QPXA 1KFCA 1BG9A 4FEZA 2C0HA 1B3XA 4FOUA 1W1VA 2GJNA 5AHMA 1UWIA 4AVOA 5CJ5A 5G1MA 4C1KA 4MKSA 4GCAA 2IS7A 3OBAA 4UCFA 3EX1A 5GVJA 4O12A 1BGAA 2VVNA 3K13A 3L68A 4HCLA 3LBOA 3W70A 1O95A 2QMJA 1UYQA 4QISA 1RR2A 4UCGA 4L4MA 3ITXA 1EJXC 5CAKA 1VC4A 1HP5A 1WDSA 3R10A 3W0KA 3TW7A 1EF2A 5DT7A 2FGBA 1BQCA 4V15A 5D30A 4DWSC 2DSWA 4AW7A 3O6CA 3ITVA 3URNA 2REQA 4ZSUA 3A9BA 4GJJA 1MNSA 2EF9A 4HA3A 4WD0A 3VCNA 1W37A 3PFRA 5F4SA 1VJIA 3O9NA 2X42A 1ZY9A 3DHPA 3KL5