3CBWA

Crystal structure of the ydht protein from bacillus subtilis
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
336
structure length
336
Chain Sequence
HTVSPVNPNAQQTTKTVMNWLAHLPNRTENRVLSGAFGGYSHDTFSMAEADRIRSATGQSPAIYGCDYARGWLETANIEDSIDVSCNGDLMSYWKNGGIPQISLHLANPAFQSGHFKTPITNDQYKKILDSSTVEGKRLNAMLSKIADGLQELENQGVPVLFRPLHEMNGEWFWWGLTSYNQKDNERISLYKQLYKKIYHYMTDTRGLDHLIWVYSPDANRDFKTDFYPGASYVDIVGLDAYFQDAYSINGYDQLTALNKPFAFTEVGPQTANGSFDYSLFINAIKQKYPKTIYFLAWNDEWSAAVNKGASALYHDSWTLNKGEIWNGDSLTPIVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords YdhT protein
publication title Crystal structure of the YdhT protein from Bacillus subtilis.
rcsb
source organism Bacillus subtilis
total genus 125
structure length 336
sequence length 336
chains with identical sequence B
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2008-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02156 Glyco_hydro_26 Glycosyl hydrolase family 26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3cbwA00
2BS9A 8CGTA 1CXHA 3SUTA 2FHBA 4EK7A 4ZFMA 5M3WA 2PWEA 4MAZA 1WZLA 4MB3A 1CDGA 1KQZA 5I77A 2CIPA 5A6MA 2WKGA 5C8BB 1AQHA 1H5VA 1NWTA 1E3ZA 3GBDA 5FOOA 2VCAA 5CLTA 3ZT6A 1QHPA 3BAXA 3EDDA 3WDQA 3AS2A 3TOPA 1CWYA 1VF8A 3CUFA 3ZT7A 2A3AA 3SUUA 4HA4A 2C8NA 2XM2A 2WSPA 1HKIA 4GI6A 3CZGA 1GNXA 1ISVA 5BYWA 5A8OA 4H41A 2XM1A 3VGEA 4B3LA 1BG4A 4J27A 1XD0A 2WMGA 3AIEA 1KXTA 2DDXA 3SUSA 3WD1A 1HP4A 2VZSA 1PZ2A 1EDTA 1X6LA 4UQEA 1XGZA 2DQXA 4PMRA 3VGFA 3MSDA 1JF6A 4AZ5A 2W67A 1J0IA 4Y7EA 1DWIM 1EQPA 3APGA 1PJ9A 4P7NA 4JFUA 4NF7A 3GXMA 3PZVA 1UG6A 3CZKA 3CZLA 3QOMA 1NWSA 1JDAA 5EB8A 1GQIA 1W9VA 3G6MA 2VX4A 1FP8A 3VIIA 3NCOA 5E0FA 3VDHA 4TXEA 2V3FA 3WQ6A 1LJYA 1CZ1A 1BVNP 1UQZA 1VBUA 3ARQA 4ML4A 2Y4SA 2VOTA 2BHZA 1HJXA 2XFYA 4GZJA 4P7LA 1UKPA 4E8DA 2WZHA 3NDZA 4AD2A 2YDSA 1XD1A 1B1YA 4F66A 1DEDA 5DEZA 2QMJA 2D0HA 1SMDA 1RH9A 3OA5A 4AC1X 1IZJA 3VGBA 3SCVA 3DYPA 3DYMA 4WKHA 1JYXA 2IUZA 1VFFA 1WE5A 4W7UA 3WUGA 4HU8A 2Y5EA 1MYRA 1JZ7A 3K1DA 3MUZ1 1K6AA 1O6IA 1JD9A 4WKFA 2FGZA 3WNKA 5A8NA 4EE9A 1US2A 2HISA 3OLDA 1FH7A 4M1RA 4JFSA 1K9EA 2X05A 1E70M 1QNQA 4UFLA 1QPKA 2X2YA 5BRPA 4JKKA 3CGTA 1DWGM 5E6ZA 1EXPA 3W0KA 2VMFA 1ISYA 3CMJA 2EPOA 1UKQA 3N04A 5D9NA 1LL6A 3F5KA 1J12A 1UD4A 3WD3A 4C7DA 4PSPA 2WBKA 1JDDA 3PZ9A 3RILA 2VJXA 3TTSA 3VIKA 3GNRA 3N13A 1UKTA 1V0LA 4PRWA 3RCNA 3VNZA 2XWEA 4FMVA 5M17A 1I1WA 4W89A 4QAWA 3PZTA 2CBUA 3OZPA 1E0XA 1GQLA 1X1NA 1JNEA 6A3HA 4TVUA 2GSJA 4L4PA 2W91A 1PIFA 3F5JA 5E09A 1QHOA 5A6JA 3UESA 2EO7A 1DP0A 2BXYA 2XVPA 3NJ3A 1HVQA 2F61A 3VIHA 1ITCA 2XYLA 4UFIA 3ZM8A 2XG9A 3NSMA 3B8SA 3GH7A 5GPRA 3U5UA 3ZIZA 5I79A 1V03A 3OZOA 1CXLA 2DIJA 3OGSA 4TTGA 2VT0A 3ZT5A 2FDMA 2D22A 1UD5A 2DT3A 1UR1A 2VL4A 4D72A 2JIEA 3RM4A 2WW5A 3OB8A 1UUQA 2D0GA 3W6MA 3AS1A 1KXVA 4P7QA 1G01A 2WMJA 3NSXA 3A47A 4DM1A 4MJ4A 4QLJA 3FNDA 1W9XA 3L4XA 4UCFA 2D20A 1UKSA 4BF7A 2VZUA 3GTNA 4W5ZA 1Q6FA 1S46A 2UY2A 1TA3A 2YDQA 3AI0A 4AXNA 2WXDM 1PX4A 3WUFA 2YJQA 1VBRA 1H11A 4BQ4A 2XTKA 3UG5A 1PIGA 1XH0A 5JIWA 1UD8A 4IISA 1H0IA 3GBEA 3WD4A 3PZIA 1UWTA 5A6LA 4H7VA 4D6HA 2J78A 1E71M 1VIWA 3CLWA 3WUEA 2BHUA 1V3MA 1E6XM 2G3JA 2WVUA 1CTNA 2J77A 3ZOAA 4TX6A 5BXTA 3HU7A 3ZJKA 2YA2A 2GJRA 1XYFA 2PB1A 4UNIA 2XWDA 1EHNA 4LGXA 1KCKA 3N11A 4BQ5A 2W62A 3OLIA 5ECUA 1W3KA 3VD3A 5I6SA 3BSHA 4H8UA 4GI9A 1D2KA 3SCWA 4AYSA 5ABGA 1JZ2A 3AXIA 2D3NA 1US3A 4GIAA 2DT0A 2CBJA 2WHMA 4DWSC 3CZEA 2ZX8A 2UY5A 3VD9A 1FP9A 3KL5A 3S6TA 2EBNA 3ARPA 5AYBA 1G94A 4J3SA 2XFRA 2YBUA 5IXEA 1UH3A 3FAXA 4GZIA 2WSKA 3CPUA 4Z2GA 2E9LA 3N15A 4KGJA 1OD8A 1E73M 1CIUA 3M7SA 2ZE0A 2J8GA 4JFWA 3THDA 2BY2A 1LF1A 4AIUA 1CENA 3AHXA 4KWUA 2O92A 1E6QM 3VPLA 3MKKA 3NSNA 4TX8A 3IAQA 4D6FA 2VRJA 5EFFA 4K68A 1UA3A 3ZSSA 2WNWA 1UQYA 1CGUA 2BY3A 1KGWA 3ALGA 3K8LA 4MB4A 4QCEA 1MFVA 2J25A 3BAWA 1V3KA 3QR3A 2YL8A 3VM7A 1M53A 1MQPA 3T0DA 2C7FA 2WPGA 2WVTA 4OBRA 1Q6EA 2ZUWA 5IFTA 3VD7A 3AXHA 2WC3A 1FFQA 1NARA 2YBTA 3ARYA 5I2UA 2XFFA 4XZBA 4EAMA 4W7WA 1JAEA 5GQBA 4TTUA 4W88A 1CNVA 5IFPA 3WMSA 1BAGA 1CLVA 5I5RA 4CVUA 2XGBA 3T2OA 3AZTA 4NRSA 1UR2A 1QI5A 2ZX6A 4CN6A 1VAHA 1PX8A 4DM2A 2G3IA 2RGMA 3AQUA 1J11A 1DWAM 2VX6A 4WLCA 2WANA 1MVYA 2JIWA 3WQ5A 1UKOA 1OD0A 3VGHA 4OUEA 3TONA 2PI6A 1CXIA 2CITA 4DUVA 1B31A 4FF5A 1JI2A 3WFLA 1NOWA 4XZWA 3MV11 1KBBA 3UERA 1WO2A 1CECA 4H8VA 1OT1A 1J0YA 5BWFA 5DO8A 3ALFA 3UETA 4WSJA 2CKSA 2CHNA 2TAAA 3WKZA 1PX3A 3AIUA 3W6LA 3MO4A 3SUWA 1CXEA 3RJXA 5LA1A 4Q22A 2DH2A 3SIMA 2VURA 3UCQA 4B9ZA 1DWFM 1E0VA 5A94A 5A6SA 1EQCA 1TUXA 1QBAA 3GNOA 4H8HA 1EDGA 4N0RA 1J18A 1CBGA 3WH6A 5DMYA 4LYRA 1OSEA 3WF2A 3WEMA 2ZXDA 1DWHM 1JG9A 3BAIA 3MMDA 1GW1A 3MSGA 2D24A 2V38A 2OYKA 1PEZA 3AMCA 4OZOA 3J7HA 1VFMA 3DHPA 3DHUA 4D1JA 3N17A 3ARXA 3OLGA 1JFXA 2FHFA 4AZ7A 1TMQA 5DFAA 4P7OA 3VMNA 1UWQA 2QLYA 3WSUA 2FGLA 3OBAA 4MNMA 4E8CA 2GFTA 2OLHA 3OLEA 3AS3A 4R27A 1E43A 4D71A 2F2HA 5LYRA 2FH6A 3WH9A 4RE4A 3WNPA 3U7VA 4P8VA 3WDJA 1E6NA 4PYSA 5A3HA 3SCSA 1CEOA 5I0DA 3W28A 3SCTA 2YDRA 1UR8A 1UWRA 2A3CA 4ATLA 5CSUA 4AIOA 3II1A 1AMYA 4J3XA 3WH7A 4XV0A 2ZUVA 4U33A 2ZIDA 3ZMRA 1EDQA 1TFVA 3AIVA 3MV01 1GOWA 2J7HA 4B16A 1YQ2A 5A6AA 4ATWA 1H09A 4J3UA 2GDVA 4PMQA 5EFDA 3CTTA 4PCSA 4AW7A 4GQRA 2CCRA 3WQVA 1WDPA 3UG3A 3N12A 1FOBA 3ARVA 3FY1A 2WMIA 1ZJAA 3LPOA 1E5NA 3KL0A 1GOMA 1UWUA 1SR0A 1B9ZA 1E55A 1J9YA 2QV4A 2ZXQA 3A4AA 3QHNA 1LWHA 2DSUA 4UQ9A 4U2YA 1EH9A 2BFGA 1QW8A 3NYDA 1JGIA 3VUPA 3CH9A 1E4MM 4U3AA 3MUIA 1WZMA 2A3HA 4JCLA 4MNLA 5CLWA 3L4VA 1N82A 2CXGA 2E9BA 5A6BD 4W93A 1UH4A 2J62A 1KFWA 4JHZA 2VRKA 1KWKA 2X09A 1E6PA 3TTQA 2WMIB 4BS0A 3MS8A 3PTKA 3WL1A 3VM5A 1HF6A 3UR7A 1V08A 1QI3A 1UH2A 2O9PA 3GXFA 1GJWA 4LYPA 4WKAA 4W8LA 1HKKA 3KL3A 5E9AA 4PMZA 4AZCA 3RIKA 5A6BA 2WHKA 3W29A 4URIA 1GONA 2Y24A 3AISA 2BXZA 3L4WA 4D6CA 2WZEA 4TOQA 3AFBA 4IPNB 2JFEX 1FHDA 2B31A 1GORA 1BFNA 1D3CA 3CHCA 1XSKA 3WDPP 3ZQ9A 2X0YA 5GNYA 5ABHA 5JBEA 4FK9A 3WN6A 3VIMA 3EDJA 1E1EA 2CPUA 2YL9A 3TP4A 4M56A 4UR9A 4BZYA 3I3BA 2GJXA 4AZCB 4AD0A 1JIBA 1H3GA 1VEPA 2WCAA 4HPGA 2VR4A 3FHQA 1QI0A 1GHSA 2E4TA 3WUBA 3VGDA 2OYLA 2OWWA 3WY1A 1G1YA 1J0ZA 3F5LA 5LA0A 2XIIA 2X1IA 3VIGA 1VRXA 5C71A 3IANA 1E40A 1K9DA 1Z32X 2JE8A 3WMCA 2PWGA 1R87A 4PUDA 2D0FA 4HA1A 3MMUA 3SCUA 4BA0A 1XSIA 7A3HA 3TTOA 1K9TA 2GJXB 2GJPA 4W5UA 1HL8A 2YKKA 5JBDA 4HMDA 2J8FA 4KMQA 2ZX7A 2VUYA 3L2MA 1MW2A 4BQ3A 2J75A 1ODUA 1ZBVA 1R85A 1Y7VA 1ZBCA 2Y8VA 3FAWA 5CG0A 2NT1A 2JF7A 4AZGA 5FD0A 1CGWA 1F4HA 5D4YA 1CGYA 3AIQA 3EBVA 2YIHA 1F4AA 3KWXA 3CMGA 1EA9C 2E40A 4CD7A 2PF0A 1K9FA 3WNNA 3JUGA 2PWFA 2E0PA 3AROA 2NSXA 1VFOA 2WYSA 4TVCA 4ZXOA 2EEXA 1W1TA 1HJQA 1E5JA 4EKJA 4WIWA 2YLLA 1W9BM 3ZJ7A 2YA1A 1OIFA 4MPKA 4YN5A 4V2XA 3BLPX 1ISWA 1E1FA 5CGMA 3WBEA 2G3NA 1PPIA 3SURA 2GUYA 1G9HA 1E6RA 1ZL1A 4GINA 3IJ9A 3WNLA 3CBWA 1BTCA 4QP0A 3MUAA 1V3LA 1BGAA 1A47A 2DEPA 4ZXLA 1CGVA 2VX7A 4PMOA 4B3KA 2VZVA 3B9DA 2UY3A 2BY1A 4AZ6A 2ZICA 1B0IA 4WJXA 4IPLA 3SCQA 3MANA 1FH8A 3VDBA 1L8NA 1KQYA 2WBGA 3MMWA 1E6ZA 4KRTA 3VIPA 2J7BA 2ZUNA 5D8WA 5JUVA 8A3HA 4QCFA 3VDCA 1GQJA 4CGTA 4A4AA 3N18A 4AD4A 1BYAA 3O9NA 5AY7A 1V6VA 3T0AA 4C7GA 1EGZA 1UA7A 2VVNA 2D2OA 2W66A 4CU6A 3GYCA 2OSXA 1GOKA 1JL8A 1MQRA 1VJSA 4WK9A 3EMQA 1W1PA 4HA3A 5D9MA 4MNKA 3RDKA 3TA9A 1W3LA 1V6XA 4Z2JA 2J4GA 3PZUA 3BMWA 5F7UA 1EOMA 1CGXA 1I75A 1B90A 4D1IA 1GOQA 4HTYA 5I23A 2WMHA 4R5EA 1NWRA 1KXQA 2BNJA 3WEOA 3BC9A 4WF7A 1V02E 3BSGA 1UYQA 4W86A 2WVSA 2VVSA 5CPQA 1R86A 1UZ4A 3WNOA 1QHZA 3K4AA 5GNZA 1A3HA 3EDKA 4J3WA 2CETA 2X8RA 2NT0A 2IXUA 4UTFA 3AMKA 5A8QA 3VD5A 2JALA 5BCAA 4E2OA 2C0HA 5FIPA 4AZIA 4M24A 1NH6A 1KGUA 4Z2LA 2E9MA 3S2CA 2UWFA 2ZWZA 1LLOA 1B3YA 4UFMA 5D8ZA 4HZ7A 4LYQA 1WNOA 5I78A 2NW0A 2YA0A 5I24A 3A4XA 3ARSA 3T0BA 5HNNA 2V3EA 4CD8A 1WKYA 4FLOA 4LQ1A 1XV8A 4M29A 5BROA 2J7GA 1GQKA 3WD2A 1FH9A 1IV8A 1JF5A 1OGGA 3VVGA 1JDCA 5EMYA 1GCYA 1M04A 4CU8A 1OT2A 3CZJA 3I3DA 1W91A 4P8XA 3RM8A 2G3MA 1BYCA 1LL7A 1UD6A 1R7OA 3VMOA 4CD4A 3VO0A 5A6KA 4XX6A 4AEEA 4UQBA 2DIEA 3EMZA 3POCA 2VCCA 4PN2A 4PTXA 1JZ8A 1V0MA 1Q4NX 3ECQA 1SMAA 4C7FA 2YOCA 2WM0A 1AVAA 3CHFA 4U2ZA 3UEQA 1U30A 1NQ6A 2FHCA 4U5IA 5CZKA 4CD6A 1PZ3A 1NP2A 3W82A 1W2PA 1KXHA 1W2VA 1JFHA 2G8ZA 2XSBA 1QOXA 4UFKA 1V3JA 3WDIA 3WENA 3VU2A 2ZOXA 2V5DA 1NOFA 1HJSA 2EXOA 4B15A 3T09A 2VQUA 1JZ5A 3AJ7A 2XJ7A 2X0HA 1E56A 3POHA 3K46A 1OGBA 2WMKA 4JFVA 1E9LA 2ZXBA 1LG2A 3N1AA 2UY4A 3GM8A 4GQQA 4Z2HA 1BHGA 3DC0A 2ZX5A 3RM9A 3E1F1 1E15A 1J01A 4V27A 2XGIA 3QHOA 1BPLB 1UR0A 1RD6A 3PN8A 3BAKA 3PZGA 3VGGA 4OKDA 3CUJA 4AMCA 1ITXA 1B3WA 3KEHA 4OOUA 3B9AA 5ABFB 5FKYA 2EJ1A 1O7AA 1WB0A 4QDMA 3WL0A 2YL5A 1GZJA 2J7DA 4F9DA 5CJ5A 3AOFA 2CNCA 1NM9A 1ZU8A 3M46A 2XVNA 3AHTA 1XHGA 2WLYA 3WQ8A 1HXJA 5FCZA 3CHDA 3CZ8A 1H41A 1BQCA 1P6WA 1HP5A 3SCNA 4TUFA 1DHKA 1V0NA 3L4UA 3VDAA 3PZNA 1GVIA 2WHLA 4LPCA 1XRVA 1OINA 3WIJA 5I3DA 5D9OA 5DT7A 1GPFA 1XSJA 4YHGA 3WFZA 2ZUTA 3SEPA 4N42A 4LXFA 1ZS2A 1QW9A 4PSRA 4J28A 1C8XA 1W3JA 1HJVA 4CCDA 1JYWA 3PTMA 3CUHA 1J10A 1JAKA 3WELA 1E4IA 2A3BA 2CBVA 3D5HA 3PZQA 1WDRA 3U57A 3EDEA 5A8PA 2O9OA 7TAAA 4ZE5A 4ATDA 1GOIA 3WDHA 1CXFA 4HOWA 4MNJA 4S3JA 1GHRA 4TVDA 2W92A 1I1XA 1OCQA 1GJUA 1CYGA 4AD1A 4PTMA 1TR1A 4OJYA 2XUCA 3AZSA 3FXYA 4FLQA 1FFRA 3AS0A 3UG4A 1WZKA 4CCEA 3ZO9A 3WDRA 4QFUA 1M01A 6CGTA 3PZMA 5HDRA 3NUKA 1H49A 1LQ0A 2DSVA 1BVZA 6TAAA 2WB5A 3A6OA 1IT0A 2V5CA 4X0NA 5CPSA 3K8KA 1KGXA 3K4DA 1TE1A 3AYSA 2J7FA 3GH4A 3PZOA 2GDUA 3W25A 2XSAA 3WMBA 1V02A 3OGRA 2WLZA 1VFUA 1MFUA 1JYVA 4ZE4A 2MANA 1UWSA 2VNCA 4W8BA 2PWDA 5A8MA 1MQQA 2JEPA 4HMEA 4DUWA 2V3GA 2VR5A 4P7RA 1B30A 3AIRA 1UD2A 3EMCA 3LPPA 3SCRA 4ZEPA 3PBGA 4CN4A 4W87A 4JAWA 2DSWA 2HVMA 1NOUA 3BLKA 9CGTA 1W9PA 1D7FA 1UHVA 1XC6A 1HJUA 5D9PA 3WEZA 3WH5A 2VX5A 4PMVA 4A3YA 3MUY1 3BCFA 3VX1A 3QGVA 3W27A 1HKJA 3IJ7A 5HPOA 2EQDA 4RL3A 4AEFA 1GVYA 1VEMA 3OG2A 4M80A 3IAPA 5IHSA 4MADA 3T08A 4PMYA 3L4TA 3AIWA 1YHTA 5BXPA 1WAWA 2PC8A 3GXDA 4GXPA 4JHOA 3ZR6A 1QVBA 1W9DM 2PBOA 1JYNA 1E6SM 3BCDA 4JKMA 2WZIA 4JIEA 3ARRA 1KB3A 1HT6A 3VNYA 5A2AA 3ARWA 2ZUUA 4B9YA 2CEQA 3RJYA 1B3XA 1M03A 2A3EA 2AOSA 1C90A 2J7EA 2WK2A 3T2PA 1MXDA 4UZSA 2Z1SA 4QLKA 4UQCA 1JD7A 3W81A 2OSWA 4D6IA 1JNDA 1HVXA 3AHZA 4FLRA 4CCCA 3DYOA 3IJ8A 3WNMA 2BY0A 3M07A 1H2JA 2W4XA 3AHYA 5C70A 1MW0A 2QPUA 1AQMA 4NRRA 5IDIA 1ISZA 2YL6A 3ARUA 3VMPA 2CBIA 4CN1A 1V0KA 2DT1A 4U5KA 2WCSA 4CD5A 2QMKA 5ABEA 4AY1A 1VEOA 1HIZA 1PAMA 1E4NA 5TD4A 2WHJA 4F8XA 1SFSA 1ZBWA 3GDBA 4Z2KA 1MW1A 4HPHA 4MB1A 5A2BA 1UWIA 2VZTA 3NDYA 5M5DA 4OOZA 4AD5A 2BHYA 3IK2A 3UR8A 4GI8A 1V6UA 3BGAA 3AICA 1XCWA 3AMDA 3THCA 1ECEA 1C8YA 2ZXAA 2CYGA 4KH2A 2CESA 1BGGA 1MXGA 3A4WA 3WQ4A 2Y8KA 1QNSA 4YPJA 1W1YA 1OB0A 5JIPA 4M8UA 2GVYA 1TVPA 1WCGA 3GH5A 3KE0A 2OSYA 3RO8A 3WF4A 1JI1A 3ZJ8A 3BH4A 2FH8A 1XH2A 3G6LA 4UOJA 5A69A 4S3KA 4ZENA 3LPFA 4CU7A 4W85A 5HXMA 4HP5A 2E8ZA 4UQAA 5GNXA 4W84A 2VRQA 4F9JA 3SCPA 1TZ7A 2W61A 1W32A 4W7VA 3VOCA 4P8UA 4NSBA 4OBSA 1E0WA 2WC4A 1FA2A 3SUVA 4HOZA 1QI2A 1ISXA 5AC4A 4XUYA 2OYMA 1J0HA 3BAJA 3AHVA 1W1VA 3GNPA 1X6NA 4QLLA 5A95A 2DSZA 5JBFA 3DECA 4UQDA 1NP0A 3AZRA 1QNPA 2CHOA 1JXKA 1VENA 2YLAA 4M82A 3AIBA 5AC5A 2XHYA 4PTWA 3LMYA 4UOQA 2WKLA 1B2YA 2BVDA 4GO8A 2RGLA 1XCXA 4GO9A 4GPNA 2G4FA 4DUXA 4J7RA 5LA2A 2WMFA 4AIEA 5A1AA 1OM0A 4HMCA 3AMLA 2O9TA 1GOOA 3RMEA 2VI0A 3VILA 1IZKA 1JXJA 3I3EA 1C7SA 1BLIA 1BF2A 3OIHA 4JCMA 4AISA 4CVWA 2QPSA 4PMUA 2J79A 3U7BA 1U2YA 1EO5A 4E4PA 3L2LA 1NWUA 1JZ6A 4HZ8A 1TVNA 2J7CA 3GZAA 3W4RA 1E3XA 3HN3A 2DPEA 1TA3B 4FLSA 1CGTA 3U5YA 2E8YA 1AQ0A 2Q8XA 4U3CA 3BXWA 1G5AA 1HKMA 3L4YA 3CO4A 1EHAA 4DWSD 4IUGA 1R7AA 5E70A 3QOKA 3BAYA 4MTVA 3ZR5A 2BVTA 4MDOA 1JZ3A 1BSIA 1HNYA 5FL1A 1FHLA 2W63A 1SYTA 3M6DA 4H2CA 5E0CA 4LX4A 4RE2A 1E72M 3TTYA 2ZUMA 4JZ5A 1ZJBA 1C92A 3EYPA 2EPNA 4F79A 2PBGA 4U31A 3WH8A 2CKRA 1C7TA 2D3LA 2VTFA 1V3IA 1L0PA 3LPGA 1MW3A 1W3HA 3AXXA 1LG1A 2Y2WA 3VIOA 2D23A 2ESCA 1HX0A 1ESWA 4DWSA 1OBAA 4OIFA 1B3VA 2D1ZA 1UZ1A 2BV9A 3OGVA 2XPKA 4AWEA 4HZ6A 4EANA 4A3HA 3AYRA 1ZBKA 1J0KA 3D3AA 3CIVA 3ZJ6A 3CUGA 3VINA 5KZ6A 1KBKA 2DSKA 4PMXA 1QBBA 1EOKA 4MDPA 4XB3A 1HN1A 4J3TA 2V3DA 2WAGA 4DWSB 1V6WA 4JL1A 2JEQA 1ZB5A 4JFTA 5FL0A 1H0GA 2GK1A 1CXKA 2ZWYA 3WF0A 2VZOA 4J3VA 3W53A 4GZEA 1UR4A 4L4OA 2J47A 3MU7A 1J0JA 1TG7A 1ODZA 2ZUSA 4D6DA 4AD3A 5CXPA 3VKKA 1KWGA 3NIYA 5EBAA 7CGTA 2W5FA 3W26A 5A2CA 3AMGA 3ARZA 5HPCA 1C91A 1WPCA 4D6JA 1GUVA 4Q7NA 4JL2A 4BQ2A 3W38A 5BRQA 1V3HA 3WQWA 2AAAA 5HOSA 3K8MA 3ARTA 2DH3A 3VIFA 1RP9A 1G0CA 2Z1KA 2DT2A 1VJZA 1UD3A 5ABFA 2GK1B 2XIBA 5DF0A 2VC9A 2WWCA 1TCMA 4PCTA 3ZSTA 4X0VA 1WDQA 1OWQA 2VCBA 4YHEA 1UR9A 3QHMA 2EPMX 3O2LA 4MAVA 5KEZA 1LL4A 3N9KA 4PEEA 1VB9A 1EIBA 3FHAA 2XVKA 4KRUA 5HBFA 1RPKA 3WF1A 5CPTA 1H4PA 2WC7A 1C93A 4ACYA 4JKLA 2XVGA 1B3ZA 2XVLA 1WZAA 4CUCA 5CSYA 3L4ZA 1EO7A 1M7XA 1U33A 3F4VA 1UOKA 1JZ4A 4CKQA 1QI4A 1V6YA 2EPLX 4BCEA 1LWJA 4UFHA 1KCLA 1C8QA 1Q6DA 1KR0A 4PMDA 3SCOA 1BYBA 1BG9A 2F8QA 4UOZA 2AMGA 2WVVA 3WBAA 2QF8A 5CQ1A 3HJEA 4IM4A 4HOXA 1WDSA 2G41A 1WP6A 2E3ZA 4PTVA 4D6GA 1Q6CA 1MWOA 1KR1A 3WF3A 3KZSA 1RP8A 3VIJA 3RPMA 2WWDA 2EPKX 4H04A 4MB5A 1CLXA 4D6EA 4UFJA 1CPUA 4ACZA 1HL9A 4Z2IA 2BVYA 4M81A 4MJ2A 4PBGA 4NZCA 5BXSA 3FN9A 2OWCA 1E4LA 2VO5A 3W37A 2J74A 4PMNA 1C3FA 5BXRA 3GXIA 2WVVB 2DGAA 5DT5A 2JF6A 3HMCA 3VX0A 3WD0A 1OGSA 5AYIA 2VQTA 3PTQA 2IXVA 3W24A 5E6YA 3EDFA 4W8AA 4AZHA 4NI3A 4X9YA 5IHRA 1PBGA 1Q6GA 4P8WA 2CERA 3VD4A 1H1NA 1DTUA 2WCGA 4AZBA 1HJWA 1QNRA 1DWJM 4ACZB 4KGLA 2ZX9A 3A3HA 4PUEA 3PHAA 2OWXA 1R8LA 5CGTA 1OIMA 3FW6A 1XH1A 2QHAA 1W9UA 4RE3A 4WSKA 1XYZA 1BYDA 1QNOA 3B9EA 3VTRA 2O9RA 3O6AA 3CUIA 4GKLA 3BMVA 3CHEA 4HU0A 2PWHA 4V28A 4UZUA 3T2QA 5M03A
chains in the Genus database with same CATH superfamily
1M7PA 1EA0A 3SUTA 2FHBA 1JCXA 1S2CA 1XG3A 4IF2A 4ZFMA 1BXBA 5M3WA 1GG0A 2CIPA 1QPOA 2NLIA 4TQTA 1H5VA 1DXEA 5FOOA 3QVQA 1K7EA 3KBJA 3CYVA 4LVGA 3NO3A 3UWYA 5FJRA 3SW6A 1UP0A 5EMKA 3SADA 3CUFA 3ZT7A 2GL5A 3G3DA 2NVDA 1I2PA 3SUUA 2O7SA 2OX4A 5C9WA 4GI6A 1S5TA 1GNXA 3STPA 3LUTA 5BYWA 2GJLA 5A8OA 2EF9A 3FA4A 4B3LA 3RR4A 2Z26A 4C5ZA 4IX0A 1B3OA 3AIEA 4F3HA 2Z0IA 1KXTA 3SQSA 4R7WA 3E96A 4Y9AA 4C6KA 5HANA 4O15A 4LFYA 3HOJA 4YCOA 3S8HA 2DQXA 1VCVA 3A5FA 4C6MA 1J0IA 2BP1A 1PJ9A 4P7NA 2EKCA 4QHRA 2INEA 3MJYA 1UG6A 2ZBTA 3CZLA 1GKQA 1GQIA 5I09A 1W1IE 3U2OA 1P1XA 3VIIA 3NCOA 1FWJC 3VK5A 1U1HA 3TKFA 1CZ1A 1VBUA 2B4GA 3CT2A 2PU0A 3DBPA 2ZZ5A 2XFYA 4R9OA 4P7LA 4F0MA 2D69A 3LTSA 1B4EA 4QGCA 1DEDA 4OUIA 4IH3A 5DEZA 2DVTA 3RMJA 3KP1A 1SMDA 4GC4A 4UTLA 5FF3A 4JICA 1PTDA 3B3DA 3DYMA 3NGFA 3C2EA 4HU8A 2Y5EA 3I6RA 4H19A 4LB4A 1JZ7A 3MUZ1 4EX4A 1JPHA 1O6IA 1XIBA 1YBQA 3G1FA 3UG8A 2ZVRA 1K8ZA 4JFSA 1S2UA 4H83A 2PWUA 3IUHA 3RPDA 1GW9A 4L6OA 3VOFA 5CJMA 2FZDA 1DWGM 4RLIA 1ISYA 3CMJA 4IMGA 4IP5A 5BU9A 1LL6A 3L0GA 3F5KA 1J12A 4US6A 4C7DA 3DESA 1JDDA 1KM1A 2Z2UA 4Z1CA 1QNVA 5H8PA 3W01A 2Y62A 4H9MA 4DZIA 5M17A 2VEKA 1A5AA 3OZPA 4L56A 3GKFA 1E0XA 1GQLA 1G6CA 5AZ1A 4TVUA 2GSJA 1PIFA 3F5JA 5E09A 3TH6A 4LCQA 3HV8A 1Q7ZA 2BXYA 4S3CA 1KTBA 3FFSA 5LIYX 1ITCA 1E1CA 4XO6A 2XG9A 2BSLA 3GH7A 3L7RA 1V03A 4TTGA 1EZ2A 3KXQA 3RN6A 2YCLB 4E4FA 2E67A 2DORA 2WW5A 3OB8A 3GDLA 3D3FA 4MWAA 5AZ0A 2D0GA 4BKNA 3AS1A 1KXVA 1G01A 2PRLA 1W5MA 4DM1A 2Z2BA 3L4XA 1FWEC 3L68A 2VZUA 3H24A 2UY2A 4JTIA 3GKAA 3T6CA 3AI0A 3LEPA 4ZSTA 2W9MA 2YJQA 3RNDA 1VBRA 4DF1A 1L6YA 1PIGA 5FESA 5JIWA 2DVXA 3JW7A 1XWYA 2NXGA 3W2UA 3A22A 4D6HA 1N55A 2ZA3A 1RSCA 2V5LA 3F1QA 1E6XM 2L5HA 4POCA 4TX6A 5BXTA 2ZC1A 4GUGA 1QASA 3AWOA 1NDWA 1VBJA 3FA5A 1XINA 3N11A 1QMLA 4KFPA 5ECUA 5LIWX 3E5BA 4N6FA 3UXKA 4O1EA 2B7PA 2BB0A 1RCOB 4GIAA 4WRHA 1Q6RA 4DWSC 3KVKA 3VD9A 3S9ZA 3ARPA 1XRTA 1REQA 2QUMA 3NM3A 2R6OA 2D2HA 2XFRA 1PYFA 1UH3A 3IEBA 3CPUA 4GH3A 2NUXA 4Z2GA 3MVIA 1OD8A 4MLJA 2ZE0A 2J8GA 2CHRA 1O95A 4PB5A 2NX3A 1OZMA 4JFWA 1KRAC 1LF1A 3RX4A 4YTUA 1AH4A 4KWUA 1LOLA 3RYSA 3KOWA 1E6QM 3WQOA 3P93A 4K37A 1PKLA 1U83A 2REQA 2A7RA 1OG6A 2B0MA 2VRJA 1H62A 2HVNA 4GZ7A 3CHVA 3ZSSA 4XD5A 2EHHA 3W7DA 2ZDRA 4O0KA 3K8LA 6REQB 1AZ1A 3KLLA 4WCJA 4XTIA 3TUUA 4M6PA 7REQB 2DP3A 4HK5A 4IG2B 2WC3A 1O1ZA 3BE7A 3MWCA 3ARYA 5I2UA 1WXZA 4EAMA 3N2TA 2QAFA 3LBCA 4TTUA 1CNVA 3UZJA 3FEMA 1YMYA 3N2XA 1VCFA 4KFNA 4CVUA 3A3XA 5LKYA 1UR2A 5T9CE 4CN6A 2ZX6A 1R46A 2G3IA 2NV2A 4H9XA 1EC8A 3UCDA 1W1ZA 3LCHA 2BLEA 1OVDA 4UBPC 3WQ5A 3VGHA 3RO6A 3VE9A 3TONA 4H1ZA 3GTXA 1U22A 3U4FA 1L9WA 1J5SA 2CITA 5LXEA 3WLIA 1B31A 3T44A 3DFTA 5IM51 3ORWA 1XLEA 3UERA 1KW1A 4H8VA 3C2RA 3WBWA 4AWTA 1O12A 4WSJA 1DJQA 3WKZA 2XINA 1PX3A 3WJXA 4X22A 3WLTA 3MO4A 2QJHA 1CXEA 3TSDA 1XLHA 4EIVA 4Q22A 3GIPA 1KM5A 2VURA 4Q7IA 1AQFA 3GSMA 5A94A 5J04A 3O6YX 5A6SA 2IKGA 3QV9A 1CBGA 2P53A 2GGHA 4KFOA 3V0UA 1ZJHA 2ZXDA 3PB2A 2O56A 4O1AA 2OFJA 2V38A 3AMCA 5HULA 3WLSA 3DHPA 4NXKA 1LRNA 1LDCA 4DJFC 4F2BA 4A3RA 3LSBA 4D1JA 4GY0A 4LALA 2FHFA 3ES8A 1TMQA 4S2BA 3GW0A 2GQ3A 2DUZA 1JCMP 2FZMA 1EYEA 3OBAA 1ELSA 2E6AA 5D2WA 4DBWA 5LYRA 1H50A 4RE4A 2OPJA 3GU9A 6TIMA 3U7VA 5DQPA 4GOAA 4PYSA 1FWDC 1X97A 3FYYA 5I0DA 5AVNA 2ZC8A 2H90A 3NEVA 2A3CA 4ATLA 3G1HA 3M0LA 3RK8A 3WH7A 2QULA 3TV8A 1NJJA 2J24A 1UR3M 4PCPA 5HK4A 3CQ0A 4ATWA 3NVDA 4J3UA 4PCSA 1UMLA 1DJIA 1BXNA 1TV2A 3WQVA 1FOBA 4C6BA 2VFHA 3LPOA 1UPMB 1GOMA 1SR0A 2QV4A 1SZGA 3A4AA 5CPOA 3LCFA 3QHNA 4I7UA 4MVAA 2BMBA 3NPWA 1AUSL 1F6PA 4BY3A 9RUBA 8XIAA 4DO7A 3OW1A 1JGIA 1EJWC 2XH2A 3CH9A 1E4MM 4BF5A 4HB7A 3K5XA 1FWTA 2Y1HA 5CZJA 4LC8A 1WZMA 2AMXA 4JCLA 4MNLA 3MO7A 5A6TC 3H23A 1N82A 2CXGA 4NNBA 4JHZA 2VRKA 3N2CA 1KWKA 1E6PA 2YGYA 4UNLA 2WMIB 4BS0A 3RLVA 3WL1A 3A9BA 3FV9A 3UR7A 1KTNA 4MG4A 2ZE3A 3QSRA 1UH2A 4NASA 1VR6A 4UTUA 2RHGA 1GJWA 1EEPA 4RJEA 1W1A1 4WKAA 1DIOA 1HKKA 3AJXA 4O50A 4C65A 3W7JA 5E9AA 4IT1A 4PMZA 3QZEA 4FXSA 3RIKA 5A6BA 2C14A 3CO8A 3QEZA 3KCLA 1MNZA 3L4WA 3TLQA 2BDQA 4O14A 3H4WA 2JFEX 1FHDA 1B4KA 3WQDA 2B31A 3C52A 4RZ4A 2CWXA 1JPDX 1BFNA 4XAYA 4HSOA 3W74A 3WDPP 2X0YA 5DRCA 2J6VA 1TVLA 5GNYA 3ERPA 1VPXA 3H2CA 1E1EA 2CPUA 1G7VA 5EMJA 3TYZA 4UR9A 1MXSA 2PLJA 1VEPA 3W1LA 2V68A 4CNOA 2O4QA 1IWAA 4EVZA 5JU6A 1LOQA 1T40A 2VR4A 1RJRA 1QATA 1GHSA 1VRDA 2E4TA 3WUBA 3VGDA 3WY1A 1OJXA 5AKQA 3F5LA 1EF2A 1XKYA 1VRXA 4S23A 4C6FA 1K9DA 4RNFA 2P1FA 5HQMA 1R87A 3R25A 3NQ7A 4YJ5A 1IXOA 1W5QA 1CB7B 3CUXA 2D0FA 3SCUA 4BA0A 3TJXA 1XSIA 1VS1A 1K9TA 3IACA 3VC6A 4I8YA 2PRMA 3PUGA 4HMDA 4GIRA 1ZPTA 1K6WA 5HQLA 2FPYA 2J75A 1SVDA 4XAFA 1R85A 3S47A 2Y8VA 2OB3A 1KFKA 1BQGA 2WM1A 2JF7A 4PEKA 1CGWA 5D4YA 3AIQA 3EBVA 3EXTA 1Q3NA 3CMGA 2G4JA 1K9FA 1VFOA 2WYSA 3IJDA 2EEXA 1W1TA 2D2GA 1JJKA 1LUCB 1W9BM 2IQTA 4V2XA 3NFUA 3SR7A 3BLPX 1XUUA 4DJEC 3C61A 1A80A 3L9CA 4H9VA 1PPIA 1UP2A 2GZXA 1FTXA 2YYUA 1ZL1A 3KBWA 5F2IA 3FDKA 5LNWA 4ZQCA 3N4AA 3M1ZA 2RFGA 4IGNA 3E38A 3WLRA 5G4WA 2VZVA 2W6RA 4YIWA 3HZ3A 3MTWA 2FZ9A 4ICMA 4IPLA 2OU4A 4EAYA 3O3RA 3VDBA 1KQYA 1G4PA 3QZAA 3HFTA 3FOKA 2V0TA 4NAFA 4DBSA 2ZUNA 1T6MA 1WKDA 3MQTA 1XJBA 1Z69A 1VIZA 2J9XA 5CEWA 3THAA 1KD0A 1RY8A 1A3WA 1UZHA 4ZB0A 3MCMA 1LROA 4C7GA 2D2OA 2XSXA 5M1TA 4CU6A 3GYCA 4FF7A 3EB2A 1H7WA 5D9MA 1JUKA 1V6XA 2J4GA 5LHEA 5CBIA 3PZUA 4WY0B 5F7UA 1EOMA 1DJGA 1I75A 3NQAA 4ADTA 4CNPA 1RPXA 3GS6A 4JBRA 2VDIA 4D1IA 4HTYA 2WMHA 4R5EA 5JQ9A 4IIGA 1ZRQA 2BNJA 4GH1A 4WF7A 1V02E 2TODA 1AMKA 1XICA 3BG9A 2VVSA 1R86A 4O1BA 3K4AA 2ZRXA 2G96A 1IEVA 4ZBCA 3UNDA 2HMCA 2CETA 2X8RA 3B8IA 4AB4A 4UTFA 3VD5A 3L5LA 4OHQA 3TWBA 2C0HA 4LVDA 4I3GA 1NTHA 1GEHA 5XIMA 4ERAA 4LAUA 1KGUA 1FHUA 3TEVA 2RH9A 1O5XA 3FCPA 4ICNA 3W1MA 3ZS4A 5CPNA 1TPWA 4HZ7A 1WNOA 4C6CA 2NW0A 2YA0A 3W1QA 2IKIA 3T0BA 1A5MC 2ZRYA 3NQFA 2A0NA 4FALA 1EWEA 5BROA 2J7GA 1GQKA 1K77A 3ICJA 5HATA 1AJZA 1JDCA 1YRRA 4ZO9A 5EMLA 3H7VA 4JTUA 3ZFHA 3VKDA 4MFDA 3BTNA 3CZJA 4IGSA 3RM8A 2G3MA 1UD6A 3BLIA 3VMOA 3IWPA 3VO0A 4XX6A 4RNIA 4UQBA 2DIEA 3KCJA 4Y6GA 4U28A 3WQEA 2OJPA 3CL8A 5C7VA 4MY9A 4E4UA 1EJTC 4PTXA 5LHFA 4HSHA 4MYXA 1Q4NX 2WQPA 1WQ5A 2PCEA 3M16A 1P5BA 1MRQA 3O15A 4NZ3A 5AECA 3S4TA 3H2NA 3CHFA 1YNPA 1DPMA 4GJ1A 3W1TA 1UIOA 2HPMA 4S3DA 4CD6A 1UUOA 4FNSA 1PZ3A 2G3FA 1NP2A 3BARA 3W82A 1H1ZA 3DU0A 4E2BA 2G8ZA 3CJPA 3PFRA 4NQ1A 3W2LA 1TZZA 3WENA 1LORA 4N9DA 2OZ3A 1GYNA 2ZYFA 4L7ZA 1H1YA 1HUVA 1ONRA 2I57A 1N7KA 1XIJA 2JKPA 1GVEA 1LG2A 3SGGA 1YDYA 1PKYA 3N1AA 4WR3A 2PP0A 1FCUA 3PBMA 4GQQA 5FSEC 4Z2HA 1BHGA 1Q45A 4RV8A 5EPDA 2ZX5A 3PBUA 1BTMA 1E15A 3MKCA 4V27A 3QHOA 1BPLB 1UR0A 4RCXA 3BAKA 3VGGA 4C6JA 1ITXA 1KFJA 2PDJA 1DIKA 5ABFB 3ZZ1A 2VC6A 4XZIA 2QR6A 2EJ1A 4R85A 3WL0A 1OFOA 3GTHA 2HVOA 1XIIA 4GX8A 5AYYA 1ZU8A 3AHTA 3I7QA 4ZQOA 2HQAA 1GQNA 1IE7C 3WQ8A 4DO5A 2GGEA 1BQCA 3GAKA 4JPGA 2X1RA 3TN6A 3CS2A 2YB1A 3ITGA 3L4UA 3VDAA 2AKMA 3PZNA 4ZL1A 4IQJA 3W70A 1VLIA 2FKPA 3NQMA 2Y88A 3P0XA 4OT7A 5DT7A 3GC2A 3SIZA 2ZRWA 4Y8EA 2FZ8A 3WFZA 3P6LA 3PSWA 4N42A 3MZNA 4LUSB 1ZS2A 3O05A 4J28A 1MUCA 3KP0A 1OK6A 2J8TA 4CCDA 4PFHA 1JYWA 3PTMA 3CUHA 1YYAA 4M6UA 4NZJA 4PMJA 3WELA 4WZHA 2CBVA 3U48A 2ACRA 3MWAA 5A8PA 4LTSA 3B0PA 1O66A 4ATDA 1CLKA 4I5UA 4HOWA 4JHMA 2FPTA 3KRUA 3QRHA 2P50A 1CYGA 4NAEA 2GYIA 3Q2DA 4QJ5B 4OJYA 3R8HA 2H3DA 3CV2A 1L2QA 4RZ6A 2PUZA 3SAZA 1RJPA 3I65A 6CGTA 3PZMA 5HDRA 3GVWA 1TJ0A 1BVZA 2DSVA 4JQ1A 1IT0A 2VELA 1IT8A 4GA8A 3GY1A 3IVSA 3D46A 5F2GA 1XYAA 5KZEA 2J7FA 3GR8A 3GH4A 4YS1A 2Z6JA 4GYPA 5FF4A 2CZ5A 2XSAA 4UTMA 5D2TA 4ZE4A 3SJ3A 1H7XA 5B7ZA 2PWDA 4AHOA 1N8WA 3CQHA 3Q4DA 2TYSA 3OA3A 4AWUA 1YE6A 3W85A 2XH0A 4DUWA 1DJYA 4IFKB 2Y7FA 4I90A 4AAJA 1WDDA 2OVLA 3SCRA 5JXQA 3W2JA 4RDWA 3W7GA 4GY7A 3DFPA 4XVDA 1W9PA 1HJUA 3VXGA 3R0UA 1FUYA 2VX5A 4A3YA 4Q4OA 1WBJA 4UR7A 3DG3A 2VDGA 3W27A 1YDNA 3DN5A 4NU7A 3GXTA 1YHTA 4AX6A 2HCVA 3GXDA 3TX9A 5CC5A 3F4NA 1W9DM 2PBOA 2BXVA 2AQWA 1IHIA 3ARRA 3W7EA 5D32A 4O11A 5F2MA 3L67A 1HT6A 1ADOA 4NT0A 2CEQA 2OKTA 1B3XA 4Q32A 5JMUA 2A3EA 3EXSA 4XUGA 2J7EA 2WK2A 3T2PA 4UZSA 3JRKA 1V5XA 1YNQA 4PL2A 4UQCA 1ADDA 1AD1A 1JNDA 3H26A 3VNMA 4FLRA 2P88A 4AG0A 3LNPA 4LAZA 2W4XA 2QPUA 2YL6A 1JCNA 1EJUC 3PUDA 3QY7A 1V0KA 4U5KA 1X38A 5ABEA 1VEOA 3O8AA 5TD4A 3P61A 5C9UA 3UPWA 3BG5A 4F8XA 3BSMA 3GE7A 5TF0A 3DFQA 3E0IA 3NDYA 2VZTA 1EXBA 4EXBA 2QCEA 2ZKMX 1V6UA 1VBGA 4REQB 3A24A 3AICA 4MMWA 4US5D 3THCA 2ISDA 2Y5JA 1C8YA 1PV8A 2ZXAA 4GHRA 5C2GA 1BGGA 3KRZA 1MZHA 3A4WA 3NZQA 3WQ4A 4AIBA 1GT8A 4F2UA 1QNSA 2A21A 4FX7A 2A7PA 3TYCA 4CQCA 1K7XA 1RJQA 1WCGA 4HK7A 5HR6A 1TE6A 2Y0FA 1JI1A 1QT1A 4NJKA 2ZQ0A 3AYTA 3ZJ8A 2FH8A 2I5IA 4GQGA 2VDHA 5A69A 2OG9A 4CU7A 1KBLA 2QJGA 3COTA 5G2WA 2QDDA 1BKHA 2GVGA 4GFSA 4C6QA 1OFQA 3EA1A 3M6YA 1QI2A 1ISXA 1DBTA 3NQBA 2HV5A 1A0CA 3U9IA 3FA3A 3BAJA 4ZQMA 4ZB2A 3WK0A 3ZVIA 4QLLA 4ILSA 1MDLA 3CPRA 3QW4B 5LNRA 1E1CB 4M82A 1X7FA 5AC5A 3LMYA 2XZ7A 2WKLA 1UMYA 3EWBX 5EU9A 1O5RA 4DUXA 4WUIA 4YWIA 3TCSA 3GO2A 4AIEA 5A1AA 4LS0A 3WK2A 1OM0A 4ZCWA 4F0LA 1OYAA 4KCVA 3S6OA 3DC8A 1YDOA 3GIQA 6ALDA 4DZHA 3OIHA 4CVWA 2QPSA 1W5NA 2Z29A 4K7YA 3L2LA 1R9YA 3NG3A 1C29A 3W4RA 1ZZMA 4FLSA 1CGTA 1K8YA 3APYA 2QF7A 3BGGA 4QR6A 4NX0A 3T4WA 1SJDA 4IMDA 1EHAA 4DWSD 1RBLA 3ZR5A 1GPWA 2BVTA 1JZ3A 2OO6A 4D2JA 4O8RA 2A5HA 4HHHA 5E0CA 4EPBC 4XZLX 5IBXA 3W1AA 3LCLA 4PR4A 5A8GA 2OXNA 4JQ4A 4LVFA 3EYPA 2YZRA 3WH8A 3LK6A 3NZPA 1V3IA 2FTWA 2P5NA 1L0PA 3VIOA 2Y2WA 1LG1A 4HYRA 4K7VA 1HX0A 3FJ6A 1ESWA 3V5CA 4L80A 4G1KA 4XBSA 2BV9A 2OEMA 4AWEA 4IMCA 4HZ6A 4B90A 3E0VA 1O5KA 1XIMA 4JX4A 3CIVA 3VINA 3W7IA 4GUJA 4N4QA 3QMTA 4IFOA 1SUXA 4MDPA 3HO8A 4J3TA 1XQLA 4Q6JA 4DWSB 1XI3A 1PB0A 4O16A 4DUOA 4FIRA 3CL6A 4JL1A 5FL0A 1CXKA 2VZOA 1XGDA 5G2HA 3BWWA 2J47A 3HMJG 3MU7A 4D6DA 7CGTA 1KBIA 3AMGA 2OX1A 4IPJA 3RLGA 3B8DA 1GUVA 3TYBA 2CFFA 3W38A 1VFTA 4JTLA 1V3HA 3M0ZA 3WQWA 3H7UA 3PG9A 5HOSA 4LCRA 5FJUA 1RP9A 3QY8A 1G0CA 2X30A 2Y89A 2Z27A 3G1XA 2GGGA 2TPSA 3MT1A 1D7KA 4HNVA 3ZSTA 1IF2A 4HD5A 2OCZA 4ZO6A 4LV4A 1UR9A 4NXSA 3VNJA 4PTDA 5HBFA 4KRUA 4E38A 3UW6A 2WC7A 2Y5SA 2ISVA 2VD8A 2OZTA 1DJWA 1B5TA 2GVJA 4MSSA 4Y96A 1OADA 5MHBA 1RY0A 3RPTA 3BLFA 3CTLA 5CSYA 5RUBA 5I07A 2WJDA 4QM1A 4N6EA 4EP8C 2FYMA 3VCRA 4BCEA 3PG8A 5MKGB 4MOZA 3W73A 1GVSA 4C6EA 4PMDA 1U5JA 1QXLA 3FLUA 2V2DA 1BG9A 1TCDA 3A21A 1X8CA 1TKKA 2RJHA 2AMGA 3VNDA 4IQLA 5CQ1A 3P3BA 4HOXA 1YXCA 3HA1A 3FDGA 2D73A 1WP6A 3C0LA 3CQIA 4D6GA 1Q6CA 1DJHA 3KZSA 4DJFD 1RP8A 3VIJA 4A3UA 2WWDA 2EPKX 4NNCA 3M5ZA 3NQDA 4LCSA 3QMSA 5KITA 4R7JA 4D6EA 1CPUA 1HL9A 2P8CA 4Q3MA 4M81A 4UB9A 3JR2A 3C2VA 5BXSA 2OWCA 4Y2WA 3WJWA 3W37A 3MHUA 4Q8QA 1TWZA 3ENLA 5BXRA 1EBHA 1WOBA 3UXAA 5DT5A 1HL2A 1EC9A 2JF6A 3VX0A 1OGSA 2OOGA 3BGJA 3C3UA 1FXPA 3LERA 2I14A 5JVLA 5TBOA 3EDFA 3VI2A 4W8AA 1OC5A 5IHRA 1PBGA 3M0YA 4UXDA 4YL2A 4P8WA 2P76A 4LAOA 4A2RA 2CERA 3VD4A 1YPFA 1H1NA 1HJWA 1QNRA 5K9XA 3RCMA 3PWGA 5KMYA 4KGLA 4V1YA 2C15A 3KRSA 2OWXA 5CGTA 1OIMA 3SRDA 9XIMA 2QXWA 2QHAA 4RE3A 2OTDA 4WSKA 1XDLA 1QNOA 3B9EA 4M7SA 1XXXA 3CUIA 1IIGA 2H8ZA 2V2CA 3G1VA 1XYBA 5CBBA 2PSNA 3W7LA 4DO4A 2ZZ1A 3GG8A 3S1UA 4V28A 3G0XA 1AJ2A 5M03A 2QQ6A 4L9XA 4EK7A 2VM8A 1JEZA 2PWEA 3DXIA 3QQ1A 4O4WA 4MB3A 2PWVA 3OTRA 3R7MA 1XDMA 4UMBA 3PBYA 5GJNA 3WQCA 3IVTA 3GBDA 5CLTA 1QHPA 3EDDA 4S3FA 4PL1A 2BOGX 4HNUA 3W2MA 1CWYA 2QUTA 3M0VA 2ZZ2A 5ABTA 3G0UA 3TFCA 1F8MA 1EUAA 2RKXA 2WSPA 3S2JA 4NIRA 3UU0A 2AL1A 1BWLA 3ITYA 4E8GA 4R7OA 4J27A 4ADUA 3B9NA 1IR2A 1K4HA 2WMGA 4L64A 1R9ZA 2DDXA 4A8NA 3WD1A 5TIMA 1X6LA 3KS6A 4NJHA 2A85A 3MSDA 1JF6A 4AZ5A 2W67A 1DWIM 3PZVA 3CZKA 3QOMA 5I3KA 1JDAA 3CL7A 3G6MA 1W9VA 4MY1A 4FNUA 2VX4A 2V69A 4JNYA 1TELA 5E0FA 3W7OA 1SO4A 4BFAA 2QCNA 3R89A 5LXXA 1LJYA 4RW5A 2CLHA 4ML4A 5EMMA 2Y4SA 4EPKA 4IJCA 3MDWA 1HJXA 3RLUA 4GZJA 4B4FA 2WZHA 3NDZA 3REQB 4F66A 2NQZA 3W71A 2IMRA 2QMJA 2OGJA 4BI7A 5C5YA 2WNZA 1JULA 4GC3A 3DYPA 1JYXA 1KTCA 2DW6A 3VCCA 4BWLC 3WUGA 4L4MA 1MYRA 2UZ9A 1EL3A 1K6AA 4WKFA 3W1UA 3S2MA 5A8NA 4EE9A 2CWNA 4R33A 1G4TA 1ZJIA 2GUUA 1FH7A 2A6NA 2ACSA 2GOUA 2ZADA 2FPVA 2EGZA 2X05A 1P0DA 1E70M 3H53A 1LQAA 3IGUA 3DI1A 4GVGA 5DMMA 1QNQA 4UFLA 4NVTA 4HHMA 5HJXA 4A8IA 4WOZA 4LWWA 2VGGA 3CGTA 1PHWA 2QJJA 5F4WA 2VMFA 4IIHA 3S0CA 3N04A 1SJBA 3WQFA 3R11A 4GVIA 4Z1BA 2YW4A 3TTSA 1K70A 4EF8A 3RCNA 1MMFA 2IPFA 2R9RA 2XWEA 2YCLA 4LVAA 4LS2A 1VHNA 4GYFA 1YPXA 2Q71A 1JNEA 3VCNA 3WCZA 2W91A 3DCPA 5A6JA 4XKYB 3AU2A 3UESA 4J1OA 2EO7A 4FXJA 4JXCA 1TJ1A 3NJ3A 1FWHC 2VENA 5FI8A 1VFSA 2V5BA 3MVTA 4MZ8A 2XYLA 4XO7A 1LZOA 3BK0A 3NSMA 3B8SA 1FRBA 4AUBA 3U5UA 3ZIZA 4DJED 2DIJA 2VT0A 3ZT5A 3NNTA 1W3IA 3FYPA 4NNAA 2G95A 1RCXB 4RXGA 2DT3A 1R2SA 2PGRA 4M0XA 3B0VC 3W88A 3E2RA 1UUQA 1BWVA 1N8IA 3W6MA 1PCKA 1F6KA 2WMJA 3W3OA 4XTDA 1SM9A 3Q58A 4DBDA 5BOFA 3FNDA 1WBHA 1EFZA 2QIWA 4UCFA 2D20A 4BF7A 1VC4A 4MKVA 3U3HA 4JN6A 3GVGA 3UJSA 2YDQA 2WXDM 4UTTC 1JUEA 1S2WA 2OODA 2P8BA 2XTKA 3STGA 2WO5A 4GNJA 4PB3A 3NXFA 1J4EA 4IISA 3CC1A 3EKLA 3GBEA 2A2IA 5A6LA 1TREA 3CLWA 1I2RA 1OEPA 3QR1A 1V3MA 1IGSA 5DCDA 3EX1A 2IKHA 4Z0SA 5LNSA 3HU7A 1R38A 3LCIA 1VYPX 2PB1A 5EBUA 4JTFA 1A5SA 2HSAA 4Y9OA 5ECVA 2V6AA 3OP2A 4DYEA 3AXKA 3VD3A 5I6SA 1WOAA 4H8UA 5ABGA 2D3NA 1DXIA 3B9OA 1ICQA 1KRBC 2PDKA 2ZZ7A 2WV8A 1DQWA 1Z89A 4DBUA 4Z17A 1I0DA 2ZRVA 2WHMA 4QG8A 1FP9A 2HK0A 1SFLA 1ECQA 2EBNA 3OEXA 5K4XA 3IVUA 1RVGA 3MY9A 3BJSA 4GZIA 4V33A 2WSKA 2QUUA 4X60A 3CYJA 3N15A 3S3GA 4DF0A 6REQA 2PDFA 4U10A 3DGRA 3M7SA 3H12A 3I68A 3R8GA 1XLKA 3DX5A 3W1XA 4DY1A 5I06A 2BY2A 3AHXA 7REQA 3KOFA 4MYAA 2QDEA 5HJYA 2O92A 4IG2A 4I9JA 3VPLA 1PO9A 2C71A 3EA3A 3MKKA 3NSNA 2PGWA 4YTQA 2Z1BA 4D6FA 3TYEA 5EFFA 1WUFA 2GJNA 1UA3A 2WNWA 3HG4A 3WMLA 3RG6A 4HPJA 4QCEA 1MFVA 1Y5XA 3WK3A 1FHVA 1J2WA 5DCEA 4O54A 3VM7A 1M53A 1ZCOA 1Z9AA 1R3QA 3QYQA 3FVDA 3T0DA 2A1YA 1S3HA 3E9AA 3AXHA 4GE8A 4O4VA 4F0HA 1LTDA 5CAHA 1SW7A 2YBTA 2XGZA 2XFFA 2UV8G 1F3WA 4TR9A 3P67A 5CJNA 4IOTA 1OY0A 1XR2A 3OZYA 2CLMA 1CLVA 3I6TA 4TV5A 5I5RA 3NYZA 3EZ4A 4S38A 1TZ9A 3EWWA 1A5OC 1BSLA 1XLGA 5HWJA 2RGMA 4KIRA 1DWAM 1SJCA 2WANA 1GKPA 4XKMA 1MVYA 1OD0A 4CLMA 5T26A 2HEJA 4PUKA 3P84A 4UCGA 4I9TA 1JI2A 3WLHA 3MV11 1MUWA 3WX7A 1CECA 1XBXA 3B0XA 2RUSA 1OK4A 5DO8A 3UETA 3GNDA 1XPYA 3W9ZA 4HU3A 3UJ2A 4B4HA 1DIEA 4IMEA 3SUWA 5BMXA 3OBEA 3KOZA 3SIMA 1UB3A 2NUYA 1K8XA 1DWFM 3K30A 1MSSA 4HU4A 3LENA 3O16A 4N0RA 3EPOA 2D2JA 2IW0A 1FDYA 2ZA1A 3KBVA 3UWVA 4RDZA 3QN3A 1JG9A 4F4RA 3CNYA 1GW1A 2HDJA 1PUDA 4UTKA 2D24A 3M5VA 1PEZA 1W5OA 3SGZA 3CWOX 2WOQA 1VFMA 3VOIA 3GVQA 1RK5A 1NF0A 3ARXA 3NQCA 4OWGA 4P7OA 2YZ5A 3PWAA 1UWQA 3WSUA 2FGLA 4C6PA 4MNMA 3N4FA 2OLHA 3OLEA 3AS3A 4I6VA 1Y65A 3NPUA 4R27A 1Q8JA 5E5CA 4KS0A 1LOSA 3WH9A 3VOHA 4K8EA 3C2YA 1VPYA 4B92A 3SCSA 5F4SA 3NPXA 3ITOA 3U2EA 4AIOA 4KWVA 3W1NA 4XV0A 2ZUVA 5E0KA 3ZMRA 2OLAA 3S1GA 3H2AA 1W8GA 3MV01 1GOWA 2J7HA 3CAKA 3MSYA 4B16A 8TIMA 3TROA 3LI0A 2GDVA 3I4EA 4PA8A 4GQRA 2CCRA 3RX3A 4BEQA 4LS1A 3FY1A 2WMIA 3W1PA 4KWOA 3U2ZA 3KL0A 2YCEA 2ZXQA 1BVWA 3INPA 1LWHA 2DSUA 3WBYA 4QJ3B 2ACUA 4U2YA 1OCBA 2BFGA 1F05A 2ON3A 3NYDA 4QISA 3VUPA 4QE4A 3PPFA 1SZFA 3MUIA 1DORA 5CLWA 1TO3A 3IK4A 1Q2SA 5I3GA 4RZ5A 4ZA0A 3STEA 1IEQA 1M9HA 3TTQA 4LAMA 3RXZA 2G50A 1SFTA 1XLAA 5CPLA 1V08A 1MEHA 1AZ2A 1D8WA 3GXFA 1IWPA 3KL3A 3SY8A 1CX9A 1Z44A 4CNTA 2J9ZA 1FWBC 2BOEX 3Q65A 1R6WA 3R0KA 4ZR8A 3AISA 3NZ1A 4F0SA 4D6CA 4M5PA 4TOQA 3B4YA 3EOUA 4JTQA 3AFBA 3RX2A 3G18A 1TV4A 2DU2A 5DCBA 3CHCA 4XBJA 5AYXA 3GFYA 4IFRA 4JN7A 3ZQ9A 3WLJA 3SFWA 1RXOB 4HSNA 1BD0A 5AHEA 1ZFJA 3VIMA 2XH7A 2YL9A 4M56A 4BZYA 3I3BA 4AZCB 4AD0A 2BASA 4ZTXA 3S46A 1VKFA 3V5FA 4H7CA 1YTEA 4GUHA 2E1WA 4QBXA 3R79A 3G3MA 3VIGA 4AFYA 1VCGA 5CBJA 2PDHA 1KKRA 4ZQRA 3IANA 1Z32X 3WMCA 4WDTA 4HA0A 5AC8A 2HWGA 2BGSA 4FZIA 1O4UA 1AW5A 1XF0A 2GJPA 4YVPA 4Y9PA 3G0SA 5JBDA 2J8FA 4KMQA 1LUCA 4TU1A 4PFMA 3LM3A 3LA4A 2XDFA 3FAWA 5LZLA 2NT1A 3H2FA 4ML9A 1I2OA 4F48A 4YNGA 1CGYA 2YIHA 1GVQA 3ITCA 1MDRA 4WX2A 2E40A 4RUBA 1QW7A 4CD7A 2FZNA 3HIJA 3TR9A 3V0TA 2E0PA 1OCJA 3AROA 4UTWA 1TJPA 5KTLA 1HJQA 2PTYA 1E5JA 1SQ7A 4IXHA 3S5YA 1OIFA 4K1GA 1RLCL 1XX1A 3MUCA 4YN5A 4JGDA 2GQ8A 2IPWA 4LUJA 4AYGA 1ISWA 4H00A 1E1FA 4HCDA 3EX4A 3LG3A 2GUYA 3USZA 3QJAA 1G9HA 3ONBA 3IJ9A 3WNLA 5EY5A 2E5DA 2NV1A 1CW2A 3S5ZA 5D03A 4C91A 3T1GA 4ZXLA 1M5WA 2Q09A 1CGVA 1QDSA 2WSYA 3B9DA 2BY1A 2R82A 1KM0A 4J5NA 3SCQA 3MANA 1FH8A 1J2BA 1L6FA 3F4DA 1TPH1 3QTPA 4Q6XA 4JTJA 5DLCA 2QGYA 1J93A 5D8WA 3WLKX 3LHZA 8A3HA 5LNVA 4QCFA 4CGTA 4CNSA 1QK2A 3S1XA 4AU0A 3TZNA 5AHMA 4A4AA 4B5WA 4AD4A 3O9NA 3T0AA 2E28A 5F2LA 2VFGA 2VVNA 4W4QA 4XAGA 1QFEA 2W66A 5IBXC 1GOKA 1JL8A 1MQRA 3LBOA 1VJSA 1W1PA 1XS2A 4HA3A 4ZZ9A 1PTAA 1AFSA 4MNKA 3RDKA 2PDXA 3BLOA 5HUPA 3WBXA 5D33A 2GGJA 1B90A 1NWRA 1KXQA 4QQUA 4N7QA 1UYQA 3KBNA 4J2MA 1S3TC 2KX9A 2MUCA 5G4EA 2ZZ3A 3PBWA 2R1NA 1FWNA 4LY4A 5CC7A 3EDKA 3EXRA 1TPUA 1TWIA 8XIMA 2ICSA 3STCA 1S38A 4ZOEA 3ELFA 5A8QA 1WA3A 1A53A 3TZFA 4GI4A 4AZIA 1A50A 3MDUA 2E9MA 3LLDA 5HINA 3NQVA 2ZWZA 1I8JA 5D37A 2E6FA 5D38A 5D8ZA 4LYQA 2A79A 1SO6A 4NYYA 4HNOA 2OOFA 4RZBA 5HNNA 4DWDA 2CLFA 2PURA 3PULA 4FSAA 1WKYA 4Q33A 3S42A 1H61A 1XV8A 3DI0A 1KV5A 3DBNA 3S2LA 3VZZA 2X7VA 4DIAA 1FH9A 3V7PA 4AF0A 5H8UA 1GCYA 3PTDA 1OT2A 4HTBA 4P8XA 3FXGA 1BYCA 3CK5A 1LL7A 2GVLA 4CD4A 1QPNA 5A6KA 5CC6A 3GDTA 3EMZA 2VCCA 4PN2A 4ERIA 3GTIA 4QSFA 5AC6A 4GFIA 5G1MA 3UY8A 2DJLA 2OR2A 3WZ0E 4KF1A 4BR1A 4U5IA 3EOSA 5HR7A 4CQ9A 5CZKA 4XAZA 4IWWA 3U8GA 2E5BA 3QTGA 3N19B 1K02A 4M51A 2F6UA 2XSBA 2HNHA 1WUEA 4UFKA 1V3JA 1HZYA 4FNQA 3IPWA 4QS6A 3ABZA 2V5DA 2FJKA 2RAGA 4B15A 2FTYA 2ABBA 2W0UA 3C86A 3N29A 2VQUA 4IHCA 1JZ5A 4JS3A 3POHA 2ZXBA 2UY4A 5BW6A 1S2AA 1XW8A 1VD6A 1TWDA 3H2OA 4AVOA 4CQBA 2NQ9A 3PZGA 4B5TA 3RGTA 4OOUA 3KEHA 3B9AA 1G4SA 2P0IA 3KVLA 1Q13A 5KETA 4NJJA 1WB0A 4ENLA 4PUWA 3TYAA 1WYIA 4GY1A 1YE4A 4F9DA 4ROPA 2CNCA 3M46A 4F0RA 4DAIA 1XHGA 1ZGDA 3SSZA 1ZTVA 3VZYA 3CHDA 2BZNA 2BGQA 3L0NA 3EWXA 2I9UA 4TUFA 2V5JA 3H6OA 5DXYA 4MPQA 4FR6A 2QEZA 2WHLA 3N2OA 4LPCA 1XRVA 3WIJA 3GB6A 3CB3A 1GPFA 1XSJA 3WK1A 2ZUTA 5TAOA 4A35A 4TIMA 4LXFA 4AMAA 1TRIA 4BJHA 4PSRA 4EWJA 3HQ1A 4IJRA 1W3JA 1XLFA 3FYOA 3QW3A 1OF6A 4H8NA 2NVCA 4GJJA 2QCFA 3GXPA 1J10A 3T40A 5G1YA 5C55A 5D2YA 1Q8AA 3H54A 3QGAC 4S3JA 3TN3A 3TYUA 3WYZA 1FKWA 3IGSA 4TVDA 4FNPA 2QV5A 4AD1A 4ASTA 4DB7A 2IPGA 3IIVA 3GFZA 3LNMA 4BEUA 3JZUA 2OQYA 1FX6A 3UG4A 3F7JA 1KV8A 4O17A 4CCEA 3ZO9A 3WDRA 3GG1A 4IFKA 2V5CA 2XIOA 4X0NA 4JIIX 5HMFA 4PUMA 2Z1WA 1TE1A 3AYSA 2QS8A 3GYEA 3PSVA 3B8UA 6ENLA 3H21A 4RW3A 1HO1A 2C91A 4HVXA 5BRBA 1CB2A 2MANA 2GLKA 1R2TA 5A8MA 3QFWA 3C0JA 1IQ8A 2JEPA 2QCLA 1GG1A 4HMEA 3R8RA 3ES7A 2C6QA 1B30A 2ZRUA 1R30A 2YPIA 4A8LA 3DZ1A 3E3HA 4CN4A 5DXXA 2DSWA 4QDPA 3BLKA 4Z42C 9CGTA 3TWAA 3P8JA 1UHVA 4HJFA 3LHYA 5D9PA 1B54A 3QH2A 4XD3A 1V51A 2X1TA 3MUY1 1AODA 2GWGA 3QGVA 1GWJA 1HKJA 3M9YA 4AEFA 4RKAA 5KZMA 3IAPA 2CZEA 5IHSA 3UCCA 1PSCA 4PMYA 3AIWA 4FOKA 4N4PA 3EEGA 1US0A 4GXPA 2PTWA 1F7BA 2QCCA 3PUEA 1E6SM 3BCDA 4JKMA 1PZ1A 3V1PA 4DRSA 3HGRA 1KB3A 3VNYA 5A2AA 1AW2A 1ME9A 2ZUUA 3K2GA 4WJ8A 4MM1A 4DN1A 3OO2A 2AOSA 5EKYA 1MXDA 4M6VA 3EB4A 4QLKA 4F40A 3FJ4A 2OSWA 1GEQA 4ICCX 2FJUB 4CCCA 1A5UA 4REQA 4ZFCA 2FLIA 1H2JA 4OV9A 3AHYA 2FGBA 5IDIA 1ISZA 1W54A 1K3UA 3JS3A 4CN1A 2Y63A 4GIEA 2DT1A 4HK6A 3QF0A 2YCIX 5LSMA 3LGEA 3SN4A 1X6UA 4HPHA 3DH7A 4E3VA 1DIDA 4B5VA 4Z0JA 2P3ZA 3GIYA 4I7WA 3BICA 1M65A 3AMDA 3W7KA 1UWAA 2PGEA 4AWSA 5KINA 3HB9A 5EMUA 2HS6A 4JQ3A 1G7UA 4KH2A 4CNNA 1MXGA 3O1NA 4AY8A 4OQVA 3V1HA 1Y5WA 1EJVC 4M8UA 5IDZA 3I10A 2GVYA 5BNKA 3KE0A 2OSYA 1Y0EA 2R8WA 4KW2A 4YYCA 5AOUA 4HQVA 4P2VA 3WLLA 3GUGA 1XH2A 1XYLA 4US5A 4S3KA 3UZYA 3LPFA 2Y6ZA 2R1KA 5HXMA 3EPMA 4F9JA 3SCPA 2W61A 3NAVA 4FI4A 4NSBA 1E0WA 1YDVA 2WC4A 1OZQA 3PNZA 4IPIA 4C6IA 4FEZA 1OABA 3QPYA 3AHVA 3LN3A 1X6NA 5A95A 3W7CA 4IJBA 4UQDA 2RJGA 1JXKA 2YLAA 3AIBA 5CGQA 4EXQA 5A5WA 4UOQA 3AO0A 4YTSA 3DHFA 4FR1A 1B2YA 2BVDA 3HQPA 4ALDA 1H7PA 2G4FA 3IV3A 3E6EA 4J7RA 4O52A 5E1QA 1KM3A 3CEPA 4J35A 3N73A 2WMFA 3AU6A 3NXLA 3WFAA 3DIPA 4DBEA 3AMLA 2GWNA 3O6DA 4TO8A 3FSTA 3VILA 3I3EA 4PRRA 1C7SA 2DZPA 3CASA 3OQ8A 2NXIA 1U5VA 2DZAA 2H6RA 1FWIC 1EO5A 1SPQA 4E4PA 3B0UX 1JZ6A 1WV2A 2PC4A 4HZ8A 1TVNA 2EG6A 3GZAA 3HN3A 3FGCA 4NY2A 4UTIA 3H4XA 1Z42A 2E8YA 2Q8XA 1G5AA 1HKMA 3H22A 1TPDA 4ZOAA 3U6WA 3M0MA 4NHVA 1SFJA 1R7AA 3BAYA 3QOKA 6PTDA 1JR1A 4MDOA 4FX8A 4L1GA 4TV6A 2XIMA 3CWNA 1HNYA 5FL1A 1JCLA 3M6DA 3VNKA 4V1XA 1QR7A 3HPFA 3T42A 5T9BG 4LX4A 1QCWA 1E72M 2HE8A 4JZ5A 1DJNA 4HHPA 2F2KA 1C92A 1KFBA 1POJA 3HPAA 2PBGA 4U31A 5FSDC 3MC5A 2CKRA 2V2HA 3ZLHA 4PC8A 3OG3A 1OG0A 2PP1A 1W3HA 1T8XA 4A22A 4DWSA 1OBAA 2D1ZA 4A21A 1XUZA 4TX9A 2XPKA 4EANA 4QSHA 2OO0A 1LP6A 4A3HA 4BI5A 2Z4GA 4V15A 1ZQ5A 1SU5A 1KBKA 4PMXA 4E2DA 1QBBA 1GK8A 2FFCA 1EOKA 4C90A 3APTA 1V93A 1DKWA 2WAGA 2Z1VA 3B05A 3QV7A 2QAPA 1LRTA 3NQGA 4IIFA 3WF0A 1UZDA 1RR2A 4J3VA 3GX9A 4PTNA 5D2XA 1OCNA 1J0JA 1ODZA 2ZUSA 4AD3A 3PVFA 3VKKA 1KWGA 3O0KA 3W07A 1TYGA 3ARZA 2AL2B 2VOMA 5CSSA 3M0HA 1C91A 3P5YA 4D6JA 1Z7AA 4KEVA 2VEMA 4JL2A 3EWDA 2ANUA 3M7WA 4DLFA 3K8MA 5MF5A 3ARTA 4YTRA 3WLNA 4ZQNA 2GK1B 2VC9A 3IIZA 1GJPA 5MKGA 1RQBA 3BV4A 1P6CA 4MAVA 1LL4A 4PEEA 3TMQA 1P0EA 2XVKA 1T41A 1RPKA 4JQ2A 3LGGA 4JNMA 3VNLA 1C93A 5GJPA 2WSQA 4RK8A 3PF3A 2PDPA 4QROA 1B3ZA 2XVLA 5FEXA 4CNUA 1GTHA 1NFGA 1WZAA 1A5NC 3L4ZA 3ABSA 1EO7A 2VFFA 5HMSA 3V4BA 3PANA 1M7XA 1VJIA 5BU6A 5T8GA 1NIUA 4WDXA 1KM2A 1V6YA 3B06A 1LWJA 1OC6A 3T0TA 1KCLA 1EJXC 1Q6DA 5E93A 3ZR4A 1BYBA 3OJGA 3QKEA 4K3ZA 4HNNA 4MFEA 1FWAC 3LX9A 1OFDA 3WBAA 4IM4A 2ZTKA 1OX5A 3NQ6A 1FWRA 4C5YA 2E3ZA 5I03A 2OT0A 4Q4MA 3ZLGA 4O57A 2PLMA 3SZ8A 4ZOBA 1T5AA 1KR1A 1AL8A 4H01A 1J6PA 2FDSA 4UFJA 3MJMA 4MWAE 3OYXA 2BVYA 2I1OA 4PBGA 4NZCA 2JGYA 1GYMA 2VO5A 4JTSA 2AKZA 3GXIA 3WQPA 1TPC1 2WVVB 4GBUA 1MZRA 3KBSA 1PZ0A 2J9YA 3WD0A 3NWRA 5AYIA 3E12A 4DJFA 4LRTA 4Q4RA 4X9YA 1Q6GA 1K8CA 2PDCA 1IXNA 4AZBA 4O12A 4ACZB 3BURA 2ZX9A 4N2YA 3SB0A 3PHAA 1XLBA 1R8LA 5TQLA 4O1CA 4PUJA 3AALA 1W9UA 1M3UA 4M3PA 3VTRA 4DPQA 3TNOA 3IUDA 1FY6A 3BMVA 3VYLA 4HGXA 1Q65A 4HU0A 2RDWA 1RA0A 3HG2A 4H6QA 1MI3A 5B7YA 4HNCA 4WQ6A 2E7FA 3BDKA 3B0YA 3EAUA 1WZLA 1CDGA 1KQZA 2XZ9A 5I77A 4FOJA 3TW6A 5A6MA 5C8BB 1AQHA 4OBTA 3U4AA 1NWTA 1B57A 4KEZA 2VCAA 3BAXA 1EIXA 1RALA 4IP4A 3SI9A 3IS4A 3GHTA 4FO4A 1VF8A 2F6XA 4ZSUA 1TTPA 3BW3A 1TV7A 4R34A 4HA4A 3DFOA 2I17A 2XM2A 3ANUA 3CZGA 3W00A 5J8LA 1ISVA 4H41A 1DVJA 2XM1A 5U4NA 3GC5A 2X1UA 2VEIA 5FJPA 4Y9NA 1XD0A 1P0KA 3IIPA 3RUBL 1HP4A 3REQA 1EDTA 4I9MA 4UQEA 1XGZA 1F9CA 3C2OA 4PMRA 3LM7A 2QDHA 1FCVA 4Y7EA 4XD4A 4JFUA 2E77A 2C1IA 5DBTA 5ENLA 2VFDA 1FCBA 3W75A 4TXEA 3AWNA 2O7QA 2C3ZA 3WQ6A 3UA3A 4ZOCA 2BHZA 1W56A 1E0TA 1UJQA 2R91A 3TE9A 3E0LA 3GR4A 1UKPA 3PS7A 2I16A 5LGXA 2YDSA 2DZXA 4KWWA 3G22A 4GABA 1XCFA 1N2VA 1RH9A 3OA5A 4AC1X 3R1ZA 1IZJA 1QJWA 3SCVA 1VFFA 1WE5A 4DF2A 4Q4QA 4Y90A 2I56A 3GDRA 2OQLA 3HTWA 1PHQA 1Q4WA 3GHRA 3G2GA 1JD9A 2FGZA 3WJYA 3OLDA 2NUWA 1EEXA 4GUFA 1Y5VA 2Y7GA 3QR0A 4EWND 2VWSA 4M19A 3TSMA 5I7GA 4XKYA 2X2YA 4JKKA 1PDYA 3W0KA 4DYJA 2EPOA 1UKQA 1SO5A 5D9NA 3NQ2A 2QCMA 4PSPA 2WBKA 2ISFA 2VJXA 1M1BA 1AG1O 2DFAA 3VIKA 3GNRA 3N13A 1V0LA 5HMDA 4HHLA 4FMVA 3CB8A 1AH3A 4W89A 2Z6IA 4LSBA 1X39A 1P6BA 3PZTA 3VA8A 1TJRA 3SY1A 4Q8NA 4O0QA 3BLLA 4L4PA 1QHOA 4NX5A 4IMAA 4DJDC 2NQHA 1JUBA 1I2NA 3PPCA 1DP0A 1OX6A 1HVQA 2F61A 1QOQA 5AFDA 1RQEA 4HNTA 2GSHA 3W2NA 4GLEA 1XIHA 2V81A 3VFLA 5I79A 3OZOA 1CXLA 3R5EA 1RBAA 2D22A 1Q5MA 5DMLA 4JY8A 3NM1A 4AX7A 4GXMA 1UD5A 1I9CB 2VL4A 2JIEA 1JDFA 2HK1A 3RM4A 3EWUA 3QBUA 2HPIA 1W3NA 3LTPA 3NSXA 3A47A 4MJ4A 3O63A 4QLJA 3H4GA 1W9XA 4NILA 5BOOA 4DJEA 3IUIA 3PPHA 1LBLA 4JNZA 1PX4A 3WUFA 4BQ4A 1P0NA 1MRAA 3UG5A 4EPEC 3E2QA 5DX7A 3DG7A 2FB3A 1TV3A 3TNBA 5PTDA 5FEWA 3CMFA 1UD8A 3AYVA 3KRBA 3UVIA 2YW3A 3PPGA 4JR5A 3KTXA 1E71M 1VIWA 3TVAA 3BJTA 3TAKA 3AXMA 2J88A 3WUEA 1RV8A 2BHUA 3GR7A 3LCGA 2G3JA 2E1DA 1CTNA 3ZOAA 3ZJKA 4CQDA 5L9FA 4D8LA 4UNIA 2DZVA 5K2ZA 2PDBA 2PA6A 1TMHA 1SW0A 3BSHA 3BJFA 1A5CA 3BZJA 4GI9A 3SCWA 4AYSA 4E2VA 3AXIA 3QV6A 3T55A 1POKA 4DX3A 3MA8A 4DI8A 4IXXA 3W23A 3UWZA 1VGAA 2DT0A 3CZEA 3A3WA 2W3ZA 3KL5A 4JTCA 3B8TA 3PBVA 2ZFAA 1W5PA 5AYBA 1G94A 1P48A 4J3SA 1YKWA 1CI1A 4IPPA 3NPVA 3UJRA 4Q8OA 3OVRA 1I2QA 3BOFA 2E9LA 1OHLA 4KGJA 3C2FA 1A4MA 3BW2A 1E73M 2W79A 5FEPA 2OMAA 3VKCA 1ITQA 3T9PA 4MF4A 3THDA 3TIMA 3KAOA 1DQXA 3KDNA 1MEWA 1LQ2A 4NJIA 4OTKA 3CWHA 4TX8A 3IAQA 3E02A 3CUZA 3ABXA 4RE0A 2AQOA 3KTCA 1SSGA 2VKZG 3CAWA 4KQNA 2BY3A 3HQNA 1KGWA 3ALGA 2NX9A 4MB4A 1FVPA 1V3KA 3CV1A 3QR3A 4JTDA 1TX0A 4WGHA 2C7FA 2WPGA 4N9BA 2YFNA 4ERGA 4OBRA 1Q6EA 2VGBA 4JTTA 3BG3A 5IFTA 3VD7A 5REQB 3L2IA 4Y9MA 4WOQA 1FFQA 3HGSA 4A6GA 4AVNA 4ZTYA 3N25A 3K13A 1XBVA 1A0EA 1KFEA 1FCQA 2ZDSA 1BAGA 2FTPA 2Z00A 2DW7A 4HPNA 4OGZA 4X2PA 2Z1XA 2XGBA 3G24A 2JK2A 4NRSA 4AF0B 1QI5A 1VH7A 1PX8A 2G97A 4DM2A 1KCXA 3WLOA 3G77A 4P5UA 4FNRA 3DFSA 2XN2A 2JIWA 1OFPA 1UOZA 4NUWA 3UR5A 2PI6A 4DUVA 1XBZA 4PBFA 3WFLA 1NOWA 4D8ZA 4FX6M 4GBDA 4Y8FA 2PDNA 3ALFA 2CHNA 2TAAA 1VQTA 3AIUA 1C9DA 3W6LA 1S5NA 3BCJA 3RJXA 2DH2A 4JYFA 4G7EA 3UCQA 5DANA 3OU8A 4B9ZA 2QW5A 3CQJA 1JPIA 3MUXA 2TRSA 3NGJA 4H8HA 1QBAA 5DMYA 1OC7A 4LYRA 4M1BA 1E9ZB 2AGTA 3BUVA 1IEXA 5DBUA 1YPIA 3MSGA 2OYKA 1E0UA 4OZOA 4GRSA 4M6QA 3J7HA 5KZDA 3DHUA 3A64A 1DTNA 1WKFA 3OLGA 3G1SA 4H9YA 4AZ7A 3QMRA 1AJ0A 1O5QA 2V67A 3KZPA 3VMNA 4RNJA 4GG9A 4E8CA 3VNIA 2PDQA 3MKVA 4HYWA 3W83A 4K2SA 2SFPA 1E43A 4D71A 2F2HA 2FH6A 4XSMA 3NURA 5D02A 1V7YA 3WNPA 1HGWA 3KLKA 1KA9F 3WLQA 1E6NA 2CZVA 1XLIA 3W28A 2I9EA 3CAVA 3SCTA 2YDRA 1UR8A 2DUAA 3II1A 3LYEA 2CLKA 4U33A 2ZIDA 3DEQA 4HNLA 4Q8VA 4AY7A 1EP2A 2EKGA 5A6AA 2ZZ4A 1Y8BA 3MBFA 4AW7A 4JOMA 1WDPA 3UG3A 4IGHA 3ARVA 3VOGA 2CLLA 1UWUA 1B9ZA 1LBMA 4G5DA 1OFBA 1QOPA 1ENUA 4UQ9A 3UXLA 1PWLA 1EH9A 3LV6A 3HJZA 1QW8A 4C1LA 2A3HA 2Y70A 1AH0A 3L4VA 5HA7A 1LLWA 2E9BA 1KFWA 3MI3A 3LXCA 1HF6A 4L1WA 1YX1A 1H60A 1LCOA 1ZAIA 4KKXA 3TQPA 2X40A 2O9PA 3NOEA 4LYPA 3LCWA 4QEHA 2CC0A 4W8LA 4ES4A 4ZMGA 4AZCA 5M2FX 4JTEA 2UBPC 3E49A 3TR2A 1F3TA 2WZEA 3O7UA 4BI6A 4DNMA 3T8QA 4LVBA 4H9ZA 4QS5A 3ANYA 1NQKA 1H7OA 1GORA 3FKRA 4C6LA 1D3CA 1XSKA 1F6YA 4MJZA 4ECLA 4LBSA 4TMCA 5JBEA 4FK9A 3WN6A 5TNVA 4PODA 3EDJA 2PDMA 3XINA 3F2BA 4DVOA 1A3XA 2WCAA 1QI0A 5H2ZA 1PWMA 4YVXA 2OYLA 2PRHA 2OWWA 5K9DA 3A23A 1J0ZA 3GHSA 5LA0A 1JDEA 4M7TA 3TQVA 1V79A 3EB3A 3ZLFA 3NQEA 1Z3NA 2JE8A 2PWGA 4O8AA 1TPB1 3IRDA 3T81A 2VEFA 3URBA 3MYPA 3TJLA 1W8SA 1W6TA 3RRAA 7A3HA 3TTOA 2PD5A 2GJXB 3V5OA 3IARA 1HL8A 2YKKA 3QPEA 3FKKA 1JCYA 4DYKA 2ZX7A 4NZ1A 3V36A 3L2MA 1A5KC 4BQ3A 2F6KA 1ZBVA 1ZAJA 5K9CA 4QE1A 5CG0A 4HCHA 3F4CA 3XIMA 4K8HA 4AZGA 3LHVA 4A05A 3PP7A 1F76A 2PGFA 1F4AA 4GGBA 1MEIA 2X41A 4NZ5A 4N9CA 2IPJA 3RITA 2HNEA 3WNNA 3JUGA 4DQWA 4ZXOA 4MWAC 2J27A 2GGIA 1TUFA 5K4ZA 1EWDA 4O13A 3VZXA 4WIWA 2YLLA 4MPKA 5G4HC 2PEVA 3EOEA 5AYZA 1MO0A 5CGMA 3N6JA 2CLEA 3WBEA 5AN7A 4F2TA 1E6RA 3NL3A 4QP0A 1BTCA 4PBEA 1BGAA 1A47A 2DEPA 3OODA 5G2IA 1Q85A 2VX7A 4PMOA 4B3KA 2YCKX 4MKNA 2QJMA 5HWNA 4AZ6A 2ZICA 1QO2A 2R1LA 1F73A 3NZGA 3SSJA 1L8NA 3EEZA 2WBGA 2QT3A 4KRTA 1YEYA 1RZMA 3VDCA 1ZP4A 1GQJA 5D2VA 1W37A 1BYAA 3UNTA 1UBSA 1A5LC 3RFAA 4HN8A 4PGLA 3P14A 3LDVA 2X7WA 5CSRA 3R13A 3UGVA 1WDWA 1CGXA 1D9EA 2CXEA 4GXWA 2VP8A 1TV8A 1GOQA 1GVOA 1QU4A 1UBPC 3LRMA 2XH4A 5F1UA 3WEOA 4GUIA 3V3WA 3BSGA 1GTEA 1YW1A 5CPQA 3RAOA 1UZ4A 3MYOA 3WNOA 3L12A 1A3HA 4J3WA 4R3UA 2IXUA 3UXDA 2PE4A 4E2OA 1KKOA 3UD6A 1TWSA 3BQ5A 4R88A 3FGCB 1NH6A 2JGQA 3KW3A 4RV3A 4Z2LA 1EZWA 3M0XA 4MUZA 1LLOA 2VHLA 2GDQA 2H3BA 3F2CA 1VYRA 4K6AA 5I78A 3TJIA 5I24A 3A4XA 3ARSA 4JTAA 4PZVA 1UCWA 5C0QA 4LQ1A 4M29A 3WQGA 5KSWA 4X2RA 3WD2A 1IV8A 5LGZA 3M0IA 1JF5A 1OGGA 3VVGA 2J6XA 4CQAA 1SZRA 1UC5A 3S1VA 3I3DA 1W91A 2FMOA