3CBWA

Crystal structure of the ydht protein from bacillus subtilis
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
336
structure length
336
Chain Sequence
HTVSPVNPNAQQTTKTVMNWLAHLPNRTENRVLSGAFGGYSHDTFSMAEADRIRSATGQSPAIYGCDYARGWLETANIEDSIDVSCNGDLMSYWKNGGIPQISLHLANPAFQSGHFKTPITNDQYKKILDSSTVEGKRLNAMLSKIADGLQELENQGVPVLFRPLHEMNGEWFWWGLTSYNQKDNERISLYKQLYKKIYHYMTDTRGLDHLIWVYSPDANRDFKTDFYPGASYVDIVGLDAYFQDAYSINGYDQLTALNKPFAFTEVGPQTANGSFDYSLFINAIKQKYPKTIYFLAWNDEWSAAVNKGASALYHDSWTLNKGEIWNGDSLTPIVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YdhT protein
publication title Crystal structure of the YdhT protein from Bacillus subtilis.
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 125
structure length 336
sequence length 336
chains with identical sequence B
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2008-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02156 Glyco_hydro_26 Glycosyl hydrolase family 26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3cbwA00
3KL3A 3WBEA 1HL9A 1QNRA 1R87A 1CIUA 1QHPA 1B3VA 4Z2HA 1HF6A 2XTKA 1GJUA 1QHZA 2EPKX 3KEHA 4ZFMA 1KR1A 3IJ7A 3VIIA 1CYGA 4MAVA 1NWSA 3WIJA 4X0NA 2WVTA 3OB8A 3NYDA 2DSZA 1A3HA 4GPNA 5D9OA 3VOCA 1WZLA 7A3HA 1SMDA 1MW0A 3WDHA 1US3A 3A4AA 5E09A 3WENA 4J7RA 4UQBA 5I3DA 4OBRA 4JKLA 1JYNA 5EBAA 2VX4A 1K9DA 1O6IA 1E6RA 2VUYA 1JZ7A 3MANA 4AEEA 4E8DA 4UFHA 4PBGA 1OD0A 3IAQA 3ZOAA 4ZEPA 2WNWA 1BF2A 3RJYA 1XRVA 4PN2A 4AZCA 4D71A 2YA1A 1J0HA 1FHDA 1L8NA 1B3YA 3PTMA 4URIA 5A2BA 3AHZA 1LWJA 2G4FA 1E15A 1V6XA 3GM8A 3VD4A 4DM2A 5KEZA 3WN6A 1V3KA 4D1IA 4DWSA 1W9BM 3VIPA 3OZOA 4D1JA 3W38A 1E1FA 1PZ2A 2WC3A 5EFDA 1ZBCA 2WVVB 3AHXA 2WHJA 1ZS2A 4JIEA 2UWFA 2BS9A 1FP9A 5DFAA 5A6BA 2E0PA 3NJ3A 4U3CA 1SYTA 1V0KA 3WQ4A 1BFNA 2YA2A 3CIVA 3LPGA 3POCA 2VX6A 4AEFA 3NUKA 4ZE4A 3J7HA 2VRKA 2ZWYA 1MW3A 1UQZA 2EEXA 3MV11 1TVPA 2CBIA 2QMJA 3B9EA 3WF4A 4F9DA 4RE4A 5JIWA 5CQ1A 4QP0A 1LQ0A 1GQJA 1O7AA 1U30A 2XIIA 1P6WA 1I75A 3CMGA 4U2ZA 3NCOA 4L4OA 3VM7A 4TVUA 4AIEA 4UQEA 5M17A 4AYSA 3AYRA 3CPUA 3OG2A 1UD6A 5FCZA 3ARRA 1EHAA 2CEQA 3BLKA 1H11A 4PTVA 4JFWA 3AMKA 5BRPA 2C7FA 1D7FA 4LYQA 5BXTA 3VKKA 1KFWA 2YLAA 1PIGA 3VMPA 4CKQA 3VGGA 1XV8A 5A6MA 4CN4A 2DGAA 4WKAA 5CSYA 1AQ0A 1PPIA 1U33A 2CHNA 2V5CA 3S2CA 1E43A 3N1AA 1CLXA 1W9VA 1DWHM 1TR1A 2J25A 3GNRA 1CTNA 1RP9A 5BRQA 3RPMA 1VJZA 2J62A 3WH7A 1QW8A 2WZIA 1JI1A 3A6OA 3PZ9A 3AIRA 5ABGA 1W1PA 4JKMA 4LYPA 3VU2A 1JD7A 1CDGA 4D72A 4AMCA 1LL7A 1EH9A 3WL0A 4D6DA 1GW1A 1DHKA 1HJWA 1UKQA 1W3HA 1B3WA 2W62A 2J7HA 1C8QA 4P8XA 1ITXA 2QPUA 3WEOA 2BVYA 1TUXA 1TZ7A 1WP6A 1U2YA 4CD6A 4EK7A 3O2LA 5ECUA 1W9UA 1BQCA 2JFEX 4LGXA 1M7XA 4M8UA 4CCDA 1V0LA 3DYOA 5ABEA 3RDKA 1HP4A 1B3ZA 2VX7A 4L4PA 1NM9A 2Z1KA 2CKRA 1M03A 1JZ8A 1G01A 4UOJA 1JDCA 1V3MA 5BROA 4BQ4A 3EDFA 2WM0A 1W2VA 1C8XA 2VTFA 3CMJA 3SEPA 1OB0A 4QFUA 3VUPA 1ISXA 4AD3A 3AOFA 1GJWA 3W6LA 3ZO9A 3UERA 3QHOA 2WSPA 3AS3A 2O9OA 1KCLA 4PTWA 4NSBA 4W5UA 2W91A 3WUBA 1EDQA 1OGBA 2XJ7A 2J7BA 3WUFA 1JIBA 2XVKA 2X2YA 2EXOA 1FH9A 3AIEA 2ZX8A 3UCQA 2CERA 2J47A 1J12A 1ZBVA 3AJ7A 3GH4A 1J18A 3MV01 3UESA 2ZXAA 3ARXA 3VD5A 2WPGA 2BHYA 1WZAA 5AYBA 1JF6A 1QI0A 4PMVA 1QNQA 1AVAA 2VCCA 1WDSA 4GZJA 4JFSA 4CD7A 5A6BD 3VX0A 1CECA 2WCGA 2WXDM 1OIFA 2WVVA 3BAWA 2DDXA 4JHZA 1CXKA 3NSMA 3N11A 3RM8A 1J0JA 1CGWA 4W8LA 3WD4A 1C7SA 1M04A 2VR5A 1QBAA 3OBAA 3GYCA 3WFZA 3SCUA 1HN1A 1OT2A 3NIYA 4AIOA 1HKMA 1M53A 3IJ8A 1E4NA 1NWRA 1HJXA 3ARUA 3WH9A 2VZSA 3QGVA 1KXVA 2X0HA 3WNLA 1BPLB 1ZU8A 3CO4A 1ECEA 2DIJA 5A6JA 4D6JA 1SFSA 4H7VA 1EGZA 1VEMA 3ZSTA 4ZE5A 4NRRA 2J4GA 2WMFA 1OWQA 1H0GA 1XYFA 1PZ3A 4P7LA 3ZR5A 1W32A 4IISA 1BVNP 4PTMA 1W3LA 1QI5A 3MMDA 4C7DA 3VX1A 1E4LA 2BY3A 1Q6DA 2DSVA 1HNYA 2CITA 3FHAA 2YOCA 2GUYA 2DEPA 3AS0A 1WZKA 1G0CA 3AS1A 2F8QA 1YHTA 4D6FA 2CETA 1B0IA 4AD2A 5HOSA 1VJSA 2WCAA 3AMLA 1JNEA 4X9YA 1WKYA 3CHFA 1E71M 3VIMA 1RPKA 4UR9A 1QNPA 1WAWA 4YN5A 2GFTA 2VOTA 1QNOA 2VI0A 4AZCB 1I1WA 1NQ6A 4DUWA 3CZEA 3MSDA 4HPHA 3EDEA 1MXGA 1UH2A 4W88A 3VGHA 4P7NA 4PEEA 1V03A 1CXLA 1MVYA 2PWDA 3MUIA 3W81A 2GK1B 2D23A 1C91A 4HP5A 1ZJBA 1HKIA 2V5DA 2BHZA 2D0FA 4WF7A 4DWSB 2CXGA 1BYAA 1R86A 4CU6A 4S3JA 2FDMA 1BTCA 4J28A 3L4WA 3VGFA 2YL9A 3CUGA 5DMYA 1XGZA 2QPSA 4TXEA 4UCFA 1ISYA 3WQ8A 1GZJA 2E4TA 3AXXA 4CU8A 4N0RA 1GQKA 1V3IA 2DSKA 3RILA 3MUZ1 2VQUA 1XCWA 1XH2A 1PEZA 2QHAA 4TX8A 1UR2A 4Q22A 4P8VA 3OA5A 2W4XA 4JCLA 4R5EA 1CEOA 2V3EA 3SCOA 2WLYA 2NW0A 2HVMA 1WB0A 3OLGA 4U31A 3CHDA 3KL0A 1J0ZA 5AC5A 1UG6A 1TA3A 4AZ6A 4MPKA 4IPNB 3TTQA 4PMZA 3OGSA 1DEDA 1GOWA 2WW5A 4TOQA 4H8HA 4WSJA 2YBTA 2CBUA 1AQMA 4TVCA 4FF5A 3PZNA 1MWOA 1V02E 1GUVA 3BSHA 2GJXA 1KWGA 3VGBA 1JFXA 1E70M 3NSXA 1BHGA 4E2OA 3W29A 5E6ZA 1HIZA 1VEOA 3SCQA 4EE9A 1GOIA 1W3JA 2VVNA 3WBAA 3HU7A 1UKOA 1EHNA 2CCRA 1HP5A 3DC0A 1E3ZA 1XH0A 2VVSA 1UD8A 1UWQA 3W53A 1VEPA 4UOZA 5M5DA 5M3WA 6CGTA 1EO7A 4JCMA 1GONA 4WLCA 5GPRA 1CLVA 1CENA 2W63A 4V27A 1NARA 3EMQA 2UY2A 2O92A 2VZOA 2EPMX 2FGLA 3T0BA 5JUVA 3THDA 2GJRA 2W67A 4Z2IA 4B3LA 1DP0A 1PBGA 2DQXA 4PRWA 3FW6A 3ZMRA 3B9AA 3L4XA 1BSIA 4U5IA 2G3MA 1VFFA 3TTOA 2X05A 2VL4A 3VDHA 1XHGA 3AHTA 3WQVA 1UOKA 1EDTA 3VNZA 3WNNA 3ZT7A 3BAYA 4OOZA 4UQDA 2A3AA 2J74A 1CGYA 4F8XA 2A3BA 4ATDA 2ZUSA 2X8RA 2PF0A 5ABFA 4PMDA 1CWYA 3T09A 5BCAA 3WSUA 3GBEA 3O9NA 1EXPA 2WVSA 1E6QM 4H2CA 4HA1A 3BC9A 1SR0A 4PTXA 4F9JA 2D20A 5DT5A 1VRXA 5CJ5A 3JUGA 2X09A 5DO8A 3ZJ6A 4P8WA 2YBUA 2J7CA 4OOUA 3WD1A 1E0VA 2PBOA 4CU7A 3I3EA 4MNLA 2WHLA 5GNYA 1JF5A 1UR9A 1FFRA 3GXDA 3WD0A 3L4UA 1MXDA 2UY5A 1KQYA 3DYMA 5A8MA 2C0HA 1OGSA 3LPFA 4M80A 2BXZA 2ZUVA 4UTFA 4W8BA 5JBFA 3ARVA 3O6AA 3PZVA 2PWGA 3K4DA 3VINA 3OLIA 5BXPA 3AIQA 4AZGA 1ZBWA 3AXHA 2UY3A 3ZQ9A 4B9YA 1C7TA 1BGGA 3WFLA 2GK1A 2Y24A 2BHUA 3GDBA 4Z2GA 4MB3A 2V3DA 2VNCA 1FH7A 1HVQA 6TAAA 3K46A 1W91A 2GSJA 3FY1A 1JDAA 1E0WA 4LXFA 2CBVA 3OGRA 1CBGA 4PMQA 3MUAA 4MDPA 3F4VA 5I0DA 4UNIA 4BQ3A 4IM4A 2YDQA 1B9ZA 2GDVA 1R85A 3ZT6A 3TTYA 3WMCA 3FXYA 3BAJA 1LF1A 3CZ8A 4ZXLA 2IUZA 3W26A 5F7UA 1UD2A 1B2YA 4KRTA 1JZ4A 1NP0A 1Q6FA 2JEQA 4AC1X 3GXFA 3PZOA 4E8CA 2EBNA 3AZTA 3U5YA 3FHQA 3WEZA 1NP2A 3CH9A 4W5ZA 5DF0A 2A3HA 6A3HA 1LJYA 4HZ6A 1JNDA 3UG4A 1V3HA 2VCAA 3I3BA 4LX4A 4AZIA 1UKTA 2YKKA 4E4PA 4TUFA 3SCRA 3AYSA 1DWJM 3VILA 1B3XA 4A3HA 1C90A 4HA3A 1J0YA 1ESWA 3L4TA 2WZHA 2WLZA 4PCSA 1FH8A 4MADA 1JGIA 4ATWA 4BS0A 1RH9A 1OT1A 4H41A 1PX8A 2ZX7A 4S3KA 2EQDA 1NOWA 1TMQA 1WE5A 2J77A 2XWEA 4P7QA 4J3XA 3AZRA 4Y7EA 1HVXA 4HTYA 4W93A 1HJQA 2XVGA 4TVDA 3A3HA 2E40A 3K8LA 3UG3A 2HISA 4HA4A 1V6UA 4AIUA 4NRSA 4J3SA 4P8UA 2DH3A 2YL8A 3IK2A 3ZR6A 5FIPA 2XVPA 4AD0A 1BAGA 1V08A 5LA1A 3E1F1 1PX3A 4YHGA 3UG5A 1FOBA 3WH8A 5CPSA 3U57A 2XVLA 4RL3A 4K68A 3BAKA 4QCFA 3WD3A 3W24A 3N15A 5AY7A 1UH3A 1PAMA 3F5LA 2PI6A 5E0CA 2D24A 2WMJA 1JYVA 2WKGA 4A4AA 4OBSA 1H49A 2J79A 3VIFA 2X1IA 1Q6GA 3OLEA 2NSXA 3EDDA 3WNOA 1EOMA 1WDQA 4JFVA 3U5UA 1E72M 3SCTA 4CD4A 3WQ5A 1S46A 1XSIA 3VIOA 3SIMA 1DWGM 5IHRA 5FKYA 4W8AA 1MFVA 5LA0A 2EJ1A 2WCSA 2ZE0A 2BY0A 2ESCA 4V28A 1BGAA 4H8VA 5CXPA 1VBRA 3G6LA 1HX0A 4MNJA 3UR7A 2G3IA 1KXQA 4HOWA 1TA3B 5JIPA 2IXVA 2CYGA 4KRUA 3BMVA 3GTNA 3WQWA 4PSRA 2YIHA 3CUFA 3CUJA 2JF7A 3CGTA 4RE2A 3QHNA 2OYMA 4AW7A 1QI2A 4AY1A 3CUHA 3VPLA 2GJXB 3WEMA 1UA7A 2B31A 1KQZA 1J01A 1E9LA 2FGZA 4WSKA 2EPOA 4CD8A 1JL8A 1PIFA 1UR4A 2WAGA 5FD0A 2OLHA 1OGGA 3POHA 4DM1A 4MTVA 3U7VA 2WZEA 4DWSD 1UKSA 2GDUA 4U3AA 3EBVA 3DHUA 4MAZA 1WCGA 1ITCA 4U33A 3ZJ8A 3WELA 1LWHA 5LA2A 1E4IA 4CCEA 1FA2A 3UR8A 3VM5A 2JE8A 5A8NA 2E3ZA 4MDOA 2WVUA 2Y5EA 2DSUA 2YJQA 2ZXQA 3SCVA 1VIWA 2DT1A 3AHVA 2WC7A 1XD1A 3QOMA 4OJYA 4KGLA 4A3YA 2WMKA 1VBUA 3GXMA 4BQ5A 5A6AA 4ZXOA 5HNNA 3N13A 4C7GA 1WDRA 1GNXA 4IPLA 1RD6A 5CG0A 1UWTA 1LG2A 1BG9A 4PMYA 1XSKA 1UZ1A 3VGEA 3WH5A 3ECQA 1UD5A 1TG7A 3VIGA 3GBDA 3RM9A 5BWFA 2W61A 4F66A 2UY4A 4UZUA 2ZXBA 4W85A 2VMFA 4TTUA 3OIHA 3PZQA 5JBEA 4V2XA 5EB8A 4CN6A 3WDIA 1GCYA 5ABFB 2DIEA 3B8SA 3VD7A 3AQUA 4FLOA 4AZBA 5AC4A 3D3AA 3W25A 1H3GA 1JXKA 5D8WA 3AHYA 2XIBA 3VIHA 1E6PA 3L4ZA 1IZJA 1CGVA 2JEPA 2G8ZA 4AXNA 5C71A 2VURA 1OINA 2VQTA 1MQQA 1R7OA 3PZGA 4XX6A 3NDZA 4HOZA 1EIBA 3U7BA 4AD4A 3BAXA 4YHEA 3OGVA 1A47A 2WMHA 4QLJA 1VFUA 1HJUA 1V6WA 3MSGA 1TCMA 3L4YA 4KH2A 2PWFA 4ATLA 1KGXA 3RMEA 1LL4A 2ZX5A 2PWHA 4PMNA 3SUTA 1B30A 1G9HA 5A8OA 3ARSA 5CLTA 1PX4A 3ALGA 1E0XA 4W89A 2CKSA 1NWTA 1V0NA 3CHCA 4RE3A 4UQCA 1IZKA 4B9ZA 4IUGA 1H5VA 4M81A 1CNVA 3WL1A 2E8ZA 3ARZA 1KGWA 2D0GA 2PB1A 1F4HA 1IV8A 2Z1SA 1E40A 3N04A 5A2AA 2F61A 5I77A 2CESA 4B16A 2DT2A 1ZB5A 4UQAA 4ACZA 4J27A 2V3FA 1V02A 5HXMA 2FHCA 3PN8A 3ARQA 3AIVA 3CZKA 4UFJA 2ZUTA 2ZX9A 3MU7A 4OKDA 1JDDA 4GINA 1ISWA 5LYRA 9CGTA 3T0DA 2QV4A 3W82A 1GHSA 1QVBA 1J11A 3M6DA 2E8YA 4W7WA 3T2OA 1H0IA 4GIAA 1E56A 5D4YA 1HL8A 4FLQA 2J8FA 4X0VA 2OSXA 3MS8A 1C8YA 4HZ8A 4B15A 2DT0A 2BXYA 2EPLX 3W27A 4JAWA 4H04A 5ABHA 4GXPA 1B1YA 4XZWA 5C8BB 1CPUA 2AAAA 4WJXA 4D6EA 2WHMA 2OYKA 3T2QA 2XPKA 2Y8KA 4FLSA 2XM1A 4QDMA 1MFUA 1UYQA 3F5KA 2VZTA 2JIEA 1B31A 2FHBA 4GO8A 4D6CA 5EMYA 3GNPA 4WKHA 7CGTA 3MKKA 4UFMA 3OLDA 1KR0A 4PUEA 1US2A 2VZUA 3K8MA 2E9MA 1OSEA 4MNMA 1JYXA 3PTKA 2VRJA 4AZ5A 1EQCA 3BSGA 1Z32X 4KGJA 5AYIA 5CGTA 2WB5A 1J10A 3AICA 1TE1A 3B9DA 1W2PA 1E6ZA 3SURA 1QPKA 3WDPP 5IXEA 3SUSA 1H41A 3PZUA 2BY2A 2BVTA 2J8GA 2AMGA 2ZUWA 4KMQA 1VENA 5CPQA 1JG9A 3AZSA 3SUWA 3QOKA 4UFLA 2W5FA 2A3EA 4JFUA 5A1AA 3ARYA 1W9XA 4JFTA 4GI8A 4Z2LA 1V6VA 1CXEA 2GVYA 5E70A 1QI3A 3N18A 3KL5A 3N17A 2ZICA 2WBKA 4J3WA 2D22A 1D3CA 5E6YA 1K9TA 2ZOXA 3VTRA 1UD3A 5HPOA 2D0HA 5TD4A 4DWSC 5HPCA 1JAKA 1LL6A 4ML4A 1VF8A 3GXIA 3HJEA 4GQQA 2WANA 3A4WA 5BXRA 5I6SA 4BQ2A 4LYRA 2WMIB 1CXIA 2YA0A 3WMSA 1C92A 3ZIZA 1W3KA 5I5RA 5M03A 1KWKA 3WNMA 1UR1A 1Q6EA 3BMWA 1UWUA 3AI0A 2YL5A 2G3NA 3G6MA 1VAHA 4C7FA 3RO8A 1LLOA 4B3KA 5A94A 1GQIA 4J3TA 1ZBKA 3WF0A 3WF1A 1K9EA 4EAMA 4PYSA 3FNDA 4MB1A 2YDSA 2PWEA 5CZKA 3IJ9A 2ZIDA 1HXJA 3ARTA 4AZ7A 1ODUA 1JZ3A 2QLYA 2Y2WA 5A8QA 1C93A 4GI9A 2WMGA 3VVGA 1E5JA 3AISA 5EFFA 3UEQA 3ARWA 3CUIA 2JIWA 2DH2A 2FH6A 3AS2A 1X6NA 2QMKA 1E55A 3M07A 2VR4A 3T08A 3WF3A 4DUVA 3ZJKA 4AISA 3WMBA 1JFHA 4HMEA 8A3HA 4NF7A 4PMUA 5I79A 4MNKA 3DECA 3K8KA 3BCDA 2D3LA 1EQPA 2XG9A 1N82A 4W84A 1X6LA 5GNXA 5A2CA 1PJ9A 1Q4NX 2MANA 2WK2A 4QLKA 1M01A 4U2YA 2ZWZA 1HJVA 4FK9A 4QCEA 1ZJAA 1E6XM 3TA9A 2IXUA 3W4RA 1QW9A 2XWDA 3FN9A 3M7SA 2DSWA 3LMYA 2F2HA 2J7EA 4TTGA 1EOKA 1IT0A 1WZMA 1UD4A 1VFMA 4MJ4A 4HU0A 2V38A 4M1RA 4JZ5A 3EYPA 2WWDA 3L2MA 1EO5A 1OM0A 3THCA 3MMUA 4JL2A 3CZLA 4AD1A 1E3XA 4F79A 1G5AA 2YL6A 3T0AA 1RP8A 1C3FA 3ZSSA 1TVNA 5I2UA 4BA0A 2ZX6A 3VDCA 2CNCA 4UFIA 1R8LA 1H4PA 2VCBA 5IFPA 4GZEA 2FH8A 1MQPA 1GPFA 2ZUUA 1H09A 1XSJA 1XH1A 2J7DA 3WF2A 1XC6A 1OD8A 3AMGA 3WNKA 1QOXA 1WO2A 1EA9C 4W7VA 1JZ6A 3BXWA 1JYWA 3VDAA 1XYZA 1TFVA 1NOFA 4UOQA 3S6TA 4M82A 4Q7NA 2DT3A 2V3GA 1HJSA 2YLLA 2BNJA 1SMAA 4GO9A 2RGMA 4QAWA 2ZXDA 5IHSA 1UR0A 5IFTA 2BV9A 5IDIA 3GH5A 4R27A 2AOSA 3HN3A 1HKKA 3TONA 4ACZB 1HKJA 4W86A 4JHOA 3RJXA 3VMNA 3VO0A 3AMCA 3WQ6A 2XFYA 3CTTA 7TAAA 2EPNA 2C8NA 4J3VA 3TP4A 1CXFA 3HMCA 1W9DM 1QBBA 1DTUA 3AFBA 1ZL1A 3WNPA 2OWCA 4UZSA 3SUUA 3GZAA 1X1NA 4ACYA 5BYWA 2XFRA 4AD5A 1V0MA 3AXIA 2J7GA 4TX6A 3APGA 1BVZA 3N9KA 3VNYA 2NT1A 3NSNA 3RIKA 4P7RA 2WMIA 2GJPA 1E73M 1XD0A 5JBDA 2YDRA 1UWIA 3I3DA 3W0KA 4OIFA 2D3NA 3ZT5A 1GORA 3W28A 1VB9A 4GQRA 3VDBA 1FP8A 3RCNA 2X0YA 2OWXA 2Y4SA 2WKLA 4Z2JA 2FHFA 1UUQA 1MQRA 2VT0A 4LPCA 2VC9A 1ODZA 3D5HA 1KBKA 2VX5A 5A95A 3A47A 4BF7A 3ARPA 5DT7A 3BGAA 2D1ZA 2WYSA 5C70A 1MW1A 3VMOA 4UFKA 2ZUNA 3PZIA 5DEZA 1QHOA 4MB4A 2PC8A 2DPEA 2OYLA 1AQHA 3CLWA 4WK9A 1B90A 1KXHA 4PMXA 2EO7A 1UZ4A 4KWUA 4AWEA 2PBGA 2XSBA 3TOPA 3DYPA 1E4MM 1E6NA 4GKLA 5HDRA 2O9RA 2WSKA 1CGXA 3GH7A 1UQYA 4P7OA 1KCKA 2TAAA 1K9FA 4OUEA 4CN1A 1NOUA 3IANA 3PHAA 2VO5A 3K1DA 1NWUA 3L4VA 1KXTA 5FL0A 1R7AA 2W66A 5I78A 1BG4A 4CCCA 4NI3A 3SCPA 4NZCA 1BYCA 3WH6A 3W6MA 2J75A 3VD9A 2QF8A 1G94A 1CXHA 2XM2A 2XHYA 3WD2A 1WDPA 2W92A 1GOOA 1DWIM 1K6AA 1W1TA 5A6SA 3BAIA 2BY1A 3VD3A 4BCEA 3IAPA 4PMRA 3CZGA 3LPPA 4CVWA 5FOOA 2VRQA 3L2LA 1JZ2A 1L0PA 3TTSA 1GOKA 3QHMA 3WDJA 4JKKA 1GHRA 3KZSA 3AROA 3W37A 1ISZA 5BXSA 3K4AA 4M56A 3DHPA 5CSUA 4GZIA 2BFGA 4FLRA 2WWCA 3OZPA 1J0IA 2D2OA 1ISVA 1JI2A 1I1XA 1V3JA 1HT6A 1MYRA 4OZOA 1KGUA 4HMCA 1GVIA 3RM4A 4ZENA 3MMWA 4N42A 1DWFM 8CGTA 3ALFA 1F4AA 4PSPA 3WUEA 1QI4A 3PBGA 1AMYA 4XUYA 5D9MA 3A4XA 3KE0A 3M46A 3WY1A 5CGMA 2J7FA 4CGTA 1J9YA 4M29A 1KBBA 1E1EA 1UH4A 3ZJ7A 3VIKA 5CLWA 3SCSA 1J0KA 5I23A 5D9PA 4J3UA 2XGBA 4HZ7A 4HPGA 4XZBA 1WPCA 3N12A 1CZ1A 1XCXA 2G3JA 4D6HA 3GNOA 4BZYA 1EDGA 2JALA 4H8UA 1GOQA 3BH4A 5D9NA 1LG1A 1MW2A 3WDQA 2E9LA 4DUXA 1WNOA 1FFQA 1FHLA 1OCQA 1Y7VA 2G41A 4CVUA 1JXJA 1H2JA 3AIWA 1UWSA 1W1VA 4D6IA 1G1YA 2RGLA 3PZTA 4PCTA 1OIMA 2VJXA 3EDJA 3SCWA 1Q6CA 1NH6A 1H1NA 4PMOA 2WHKA 4EKJA 2XVNA 1BYDA 3AIUA 4JL1A 2J78A 2JF6A 4MB5A 2Y8VA 4Z2KA 1GQLA 5FL1A 3MUY1 1W9PA 2E9BA 4M24A 4AZHA 5A6KA 4LQ1A 2CIPA 3QR3A 1JD9A 1JZ5A 2NT0A 5HBFA 4EANA 1BLIA 1E6SM 3CZJA 3WDRA 1VFOA 2CBJA 1UR8A 4GI6A 5CPTA 4HMDA 1GVYA 4PUDA 4MJ2A 3T2PA 3CHEA 4WIWA 1CGTA 4XV0A 2XFFA 3MO4A 2WBGA 1UHVA 5GNZA 3WUGA 1JAEA 1UA3A 4WKFA 5GQBA 1V3LA 3WKZA 3NDYA 1DWAM 4HU8A 3EMZA 3SCNA 1GOMA 3KWXA 3VIJA 5E0FA 4U5KA 3PZMA 1BYBA 3AIBA 3F5JA 2XYLA 3ZM8A 3EDKA 2XSAA 3II1A 4CUCA 4W7UA 3AMDA 1UKPA 5A6LA 3BCFA 5A3HA 1W1YA 4CD5A 2O9TA 2BVDA 3LPOA 2OSWA 1UWRA 4XB3A 5A69A 1QNSA 3PTQA 3CBWA 4W87A 2XGIA 1E5NA 4YPJA 2CPUA 2O9PA 3FAXA 3SUVA 3FAWA 1YQ2A 2Q8XA 5I24A 5D8ZA 3VGDA 1KB3A 5KZ6A 2OSYA 2VZVA 3EMCA 4HOXA 1CGUA 2CHOA 1D2KA 3BLPX 4FMVA 4QLLA 2ZUMA 2XUCA 2WC4A 5E9AA 5A8PA 4UQ9A 2A3CA 3UETA 2OWWA 4D6GA 1V6YA 1OBAA
chains in the Genus database with same CATH superfamily
4ZO6A 2H9AB 2Y88A 3KL3A 3R25A 1QHPA 4HSOA 1SFLA 4H7ZA 1JRBA 3PPCA 3UVIA 1KR1A 3IJ7A 3L0KA 4MAVA 3NURA 4IP5A 3GHTA 3NYDA 4ZA0A 3MP4A 1XIIA 5D9OA 1SMDA 2X7WA 4U10A 4J7RA 1I2PA 5I3DA 2HNEA 3LLFA 4FX8A 1E0UA 4L5ZA 3MY9A 2BASA 2Z27A 4FB7A 1OYCA 4LAZA 4LCSA 3TFCA 4E8DA 1OD0A 3IAQA 3ZOAA 4LC6A 3QPZA 4I5XA 1FDZA 4F0LA 8XIAA 1TPH1 1YDYA 3L0GA 1LBMA 3W7IA 1FHDA 3T8QA 1A5OC 4S3AA 1E15A 4HHLA 3S5YA 3DN5A 3VD4A 3PBYA 5KEZA 4O1AA 4HSNA 1RCOB 3L7RA 3CT7A 3EX3A 4D1IA 2WO5A 1YYAA 4DWSA 3CHVA 3VIPA 1AL7A 3OZOA 2ZRYA 4IGHA 4N4PA 3DHFA 2V63A 4FOUA 2WC3A 1ZBCA 3AHXA 2UWFA 4N6EA 5DFAA 4NKCA 3IGSA 1SYTA 1V0KA 3BJTA 3IV8A 1ZRQA 1DPMA 4AEFA 4ZE4A 3J7HA 2VRKA 4K1GA 1S3TC 3VCCA 3FGCA 1PO9A 2PEVA 2DZTA 2HDJA 1KFEA 1OADA 1F3XA 3D6NA 1XLGA 3CEPA 3VOGA 1W5NA 3LQGA 4YTRA 1P6WA 1I75A 3CMGA 3TQKA 1FRBA 1KFLA 4TVUA 3P5ZA 4AAJA 1IQ8A 2HBXA 3CPUA 2FPVA 1A4LA 4E3TA 1PUDA 2P88A 4ZOBA 1H11A 3KBSA 1UUMA 4LYQA 3SN4A 3Q67A 5C2XA 2ANUA 3BV7A 3W7JA 1ZFJA 4CKQA 3PANA 4QG8A 1XV8A 3HQOA 3KP1A 2DGAA 1R2SA 2HJPA 1YPFA 4GKTA 1IE7C 1PPIA 3LERA 1GG1A 3S2CA 3N1AA 1CLXA 3QFEA 1DWHM 2J25A 3EEGA 1CTNA 4ERGA 4AY7A 2DZWA 2TODA 2J62A 3RLGA 2IQ0A 3G1XA 4D72A 4LEFA 1LL7A 3W7DA 1LYXA 1GW1A 2P8BA 1HJWA 1W3HA 2FQIA 2W62A 2J7HA 1C8QA 1ITXA 2R91A 1TUXA 3ITLA 1ZQ5A 1WP6A 4MM1A 1H7WA 2H9AA 3O2LA 3DZ1A 3NL5A 5ECUA 5C2GA 1W9UA 2BOFX 5AN7A 5BRBA 4Y9OA 4CCDA 4HJWA 1V0LA 3MPGA 1L6WA 3NQFA 4US5A 1M65A 4O4WA 2Z1KA 4IICA 2CKRA 3E3HA 4BQ4A 4H01A 3U8GA 3S1XA 4HN4A 3GR8A 1VR6A 1KM4A 3SEPA 4AD3A 4G5DA 2OR2A 3VZZA 2ONEA 7ENLA 4PB4A 3SRDA 1KCLA 4JQ4A 4W4QA 3N9RA 3IACA 3SQLA 1X8CA 3LTPA 5LIUX 1GTEA 1VZWA 1JIBA 3LGEA 1B4KA 5CAHA 3QXBA 2J47A 3O8AA 3TIMA 2BOGX 1QOPA 1J18A 3G1HA 4K6AA 5EY5A 1WZAA 2FMOA 1GKQA 1GW9A 4BHYA 4PMVA 1QNQA 1LLZA 2VCCA 1WDSA 4GZJA 5JH1A 4LS0A 4JFSA 3S6OA 2GVGA 2WCGA 4GVGA 4LSBA 1OIFA 4JHZA 2DDXA 1V77A 4HZMA 2V5BA 3H2OA 3W70A 3W1UA 2VEGA 2VR5A 3EZ4A 5DRCA 4BF9A 4JY9A 1EZWA 4FI4A 3HPXA 3SCUA 3BZGA 1Z8AA 2NQZA 4HYRA 8TIMA 1JCLA 1FX6A 1L6GA 3WH9A 3QGVA 3UR5A 4WCJA 1ZU8A 3CO4A 4R34A 1HL2A 1SO5A 2WJFA 3PBUA 1NF0A 2XH0A 1F3WA 5BMXA 4V1XA 1OWQA 3ZXWA 4O1BA 5C0QA 4L6DA 1PZ3A 1EF2A 3MHFA 4PR4A 4XBJA 1BVNP 4BJHA 1QI5A 2VDHA 2I56A 2WSQA 1F7BA 3VX1A 3QZ6A 1X6UA 1Z44A 1ZP4A 3MYPA 2YOCA 5BU9A 2GUYA 1WZKA 2HPMA 2F8QA 1YHTA 1WDWA 4O11A 4D6FA 4AD2A 1H61A 3NO1A 3AMLA 3CHFA 3NDOA 1RPKA 3W1NA 1QNPA 1WAWA 3NYZA 2WNZA 2VI0A 1I1WA 1NQ6A 3CZEA 2RFGA 2FZNA 1YTKA 4HNLA 4O17A 5C5YA 3P93A 4HPHA 3LXAA 1MXGA 4CQBA 1UH2A 2E1WA 1CXLA 3MUIA 3IJLA 1FTXA 4XAGA 1ZJBA 1EA0A 4D8LA 4L64A 4WF7A 3IIZA 2YPIA 2Y7GA 4JTQA 2CLLA 4XO6A 1O5RA 5DLCA 1XRTA 1P7TA 3VGFA 1U1UA 2YL9A 5DMYA 1GTHA 4RDZA 1EUNA 1V4YA 2XZ7A 5G2WA 3U4FA 4US5D 3PAOA 2GPTA 1OY0A 3AXXA 1GQKA 3MUZ1 3DERA 3B40A 4RV3A 4ICCX 4Y8FA 3LLXA 4TX8A 1A0DA 2PRHA 1XXXA 3P84A 4NNAA 4Q22A 4P8VA 2YCLB 2W4XA 4JCLA 1CEOA 2V3EA 3SCOA 3K2GA 3OLGA 3KL0A 1J0ZA 5AC5A 3T1GA 1TA3A 3FXGA 3W75A 1TE6A 1DEDA 1GOWA 2WW5A 3WQCA 1AQMA 3AYVA 1LLWA 3PZNA 2WPBA 5AYZA 1KCZA 2GJXA 3W7KA 1KWGA 1YXYA 4L65A 1VBJA 2Z2UA 3H70A 4EX4A 5U7SA 1JFXA 3P61A 4PCFA 5C2CA 3TXVA 1W3NA 4BWLC 2C71A 3W29A 1EJ7L 3CAQA 4AY8A 3V36A 3VK5A 4EE9A 3HU7A 5D33A 3AU2A 2CCRA 3DC0A 5I03A 2IKHA 1VEPA 2VEMA 1TMHA 1K8CA 3EX6A 6CGTA 1TUFA 1TB3A 1TV5A 3NGJA 1EO7A 4JCMA 5GPRA 2VC5A 1CLVA 2G5WA 3T42A 2W63A 3UA4A 4S2CA 3EMQA 2UY2A 3B8DA 4XIMA 3WJZA 2EPMX 3OG3A 3T0BA 4J2PA 1Y8BA 2ZCGA 2Z7GA 3TJ4A 3TN4A 3HG4A 2DQXA 4PRWA 3B9AA 1QWKA 3GB6A 1XCFA 3VDHA 3UWYA 3WQVA 3STEA 1UOKA 1BKHA 1KRCC 4CEXC 4F3HA 4IQDA 2V2CA 1IXNA 4KIEA 3UXDA 4KW2A 2X1UA 4ATDA 3C52A 5BCAA 2JKEA 3O9NA 3UJEA 5C9WA 1XIHA 1EJSC 5F2MA 4F4RA 1NEYA 5CJ5A 3JUGA 1ONXA 2J7CA 4OOUA 5CZTA 2PBOA 4MNLA 3C0QA 5GNYA 4MWAC 1PCKA 4H7CA 1KQYA 2CHRA 1U1JA 4US6A 5JBFA 3P0WA 3O6AA 3PZVA 3SN0A 1DQXA 3OLIA 1B5TA 1GJPA 3C61A 1TREA 1X98A 3AXHA 3L2IA 3T07A 2BGQA 1C7TA 3D0CA 3ZLHA 3HV8A 1ML1A 2FTYA 1J96A 3KP0A 3P8JA 2V3DA 4CQ8A 3E5PA 5AFDA 1HVQA 1L6YA 2IKGA 2ZZ7A 5HA7A 1DTNA 3MUCA 1W91A 4TO8A 3DAQA 5D2YA 3PUDA 2Z6IA 1E0WA 3URNA 1TQJA 3MUAA 2FPYA 4BQ3A 4IM4A 2GDVA 3ZT6A 1AJ0A 4H9UA 1SFJA 3FXYA 3BAJA 1A5MC 2D2JA 3CZ8A 3W26A 1PSCA 3G1YA 1VIZA 1NP0A 4AC1X 1JZ4A 1KNWA 2EBNA 4RDWA 3COTA 4RZBA 1K3UA 4MJZA 3WEZA 2X1SA 3CH9A 2YCLA 1ZPTA 1ZP3A 3MWAA 1D3GA 2GGEA 4LX4A 1H60A 1EX1A 6ENLA 1N7KA 4GGBA 4ADSA 4AZIA 2CZDA 1VLWA 3FA5A 1YIXA 3AYSA 2B7QA 5FJPA 1S5VA 1GGOA 4LVGA 4PCSA 1FH8A 1H5YA 4MADA 1JGIA 4NZ3A 1RH9A 4H41A 1W5QA 4MWAE 3H22A 1KFKA 1N2VA 1E9YB 3C5QA 4GYFA 2XWEA 3UCCA 4MMWA 4Y7EA 4B4HA 4NJHA 1VYSX 4P5UA 4TVDA 4KS0A 1TTJA 4PTNA 4DO5A 4LUJA 4BI7A 4EPKA 3ZR6A 5FIPA 1P5BA 1BAGA 4Q8VA 1S38A 1IXOA 4YHGA 1K8XA 3BAKA 3BQ5A 4QCFA 3WD3A 3LCXA 3W24A 1UH3A 2V2HA 6PTDA 3OA3A 5E0CA 2D24A 1JYVA 4RE0A 2WKGA 3TYAA 1H49A 2J79A 1KO0A 5FA5A 4YJ5A 2NSXA 3EDDA 5D05A 4KWVA 1F8MA 4JFVA 4HNTA 1NFBA 1XSIA 3PS7A 3NQMA 3VIOA 5FKYA 4Y2WA 3AWOA 4PA8A 5LA0A 1DJYA 2FKPA 4V28A 1BGAA 5CXPA 1Y65A 3G6LA 1LTDA 1OX4B 4UTIA 3CM4A 1HX0A 1KM3A 4DO6A 3V5OA 3VUSA 1HKVA 3W2UA 3VOFA 4HYWA 3LHYA 4PSRA 3W7MA 2GLKA 3TQVA 4YXGA 2OYMA 5LGZA 4AY1A 3CUHA 2A21A 4UCGA 4C1NB 6XIMA 3O6YX 2VENA 2X40A 2Z00A 3QMRA 2FGZA 3TCSA 3P6LA 1ZJIA 3KCLA 3GUGA 4NJKA 3MJMA 3W7LA 2FVMA 5K2ZA 3LTSA 4DM1A 4MTVA 2Y5SA 1UKSA 3FDGA 2GDUA 2AL2A 3EBVA 4U33A 3D3FA 3W1TA 3HTWA 5LA2A 1R9YA 3VM5A 3UU0A 2E3ZA 1FWIC 4MDOA 2FPTA 4OE7A 3QPEA 1W1A1 2DSUA 2QKFA 3OBKA 2YJQA 2E5CA 1VIWA 2WC7A 3LB0A 1EIXA 1AUSL 3M0HA 5DN1A 5A6AA 4GUHA 1XFBA 3DI0A 4JNMA 4ZXOA 5HNNA 2PDUA 5J5DA 1XUZA 1OG0A 1LG2A 1BG9A 3VDGA 1UZ1A 3QBUA 3NZRA 2I17A 4GYPA 3RM9A 3BG3A 3LXCA 2UY4A 3U2ZA 2W79A 4UZUA 3W1RA 1NDVA 4PL1A 5AKQA 5HMSA 4YTQA 5C6MA 5TIMA 3PZQA 5EB8A 4WDTA 1GCYA 2ISFA 1Q6QA 1RSCA 3AQUA 2ACUA 3D3AA 3W25A 1H3GA 4IFRA 1JXKA 2PDJA 4C91A 2XIBA 2Z25A 3PP7A 1TPEA 4J5NA 2VURA 2HWGA 1MQQA 1PKYA 3PZGA 4PZVA 4XIAA 3QKZA 5FF2A 3NQAA 4XISA 2NVCA 2EJAA 3BAXA 1WYIA 3O06A 4XVEA 1VPXA 3L0NA 2O7SA 2WMHA 9XIAA 2J9ZA 3LCIA 4PGLA 1EFZA 4ZBCA 1LL4A 2ZX5A 1LUCA 3SUTA 4MGGA 5A8OA 4XD3A 1E1CB 3M41A 4DI8A 1E9IA 4W89A 1TJ1A 2YBVA 1ME9A 3N6JA 3NZPA 1ITUA 4IIGA 3GC4A 1UROA 3VXGA 4IQJA 3NQCA 3CTLA 1H5VA 1SZEA 3B0UX 1A49A 2PSNA 2EAWA 3V16A 3ARZA 1QAPA 1JCYA 3N04A 1XQLA 5FJJA 1ZB5A 4GH1A 2E68A 2V3FA 1V02A 4QITA 3NXFA 3PN8A 3ARQA 4MYXA 2YXGA 4UFJA 2ZX9A 2QJHA 4OKDA 3QLDA 1MO0A 1ISWA 3W87A 5LYRA 1O5KA 5I3HA 3CAVA 1GHSA 4Z42C 1J11A 3LQLA 4W7WA 4E8GA 4GIAA 1QATA 5LHFA 3TMLA 4X0VA 2GQ8A 2QCMA 3EA3A 2DT0A 3JR2A 1ZCCA 4GXPA 1DJHA 5EA9A 1TPDA 2WHMA 3GR7A 2OYKA 4C1NA 4FLSA 3WLKX 4S3DA 1IEWA 2OZTA 5D30A 3PFRA 1B31A 4DJFC 3PG8A 2FHBA 3BARA 4GO8A 1Q85A 4LWWA 5EMYA 7CGTA 3MKKA 1W8SA 3OLDA 5L6UA 4DN1A 1G67A 4DF0A 4A6GA 1LOQA 4DF2A 4S3FA 7XIMA 1S1PA 3FJLA 1UPMB 2BODX 1OSEA 3W2KA 3HQNA 3PTKA 3RX4A 1EQCA 2DVUA 4XAPA 3BSGA 1FCQA 5AHNA 2CZ5A 3BMXA 3C2YA 3AICA 1RA0A 2GQ9A 3GIQA 3B9DA 3RLVA 1KFBA 2ZA1A 5E5CA 2OQLA 1IEQA 3SURA 1QPKA 1YBQB 3WDPP 1D7KA 1SGJA 2BVTA 5EMJA 2AMGA 2ZUWA 3NQ7A 3SUWA 2A3EA 1RPXA 2QCHA 4JFUA 4WDUA 5A1AA 4ENLA 1H7OA 3NL6A 3V0TA 2FJKA 4LOCA 2V68A 5DMLA 2GWNA 3EPOA 2PGRA 3KL5A 3MBDA 3H2EA 3ITVA 5FSEC 3GHSA 5E6YA 3B8WA 4L7ZA 3VTRA 1IIHA 1XIFA 2PP1A 5DY3A 3CUXA 3LGDA 4BQ2A 3OVGA 3VOJA 3P8IA 1A0CA 1WBHA 1CXIA 1WXYA 1TYGA 3PB2A 2CLPA 9XIMA 4ERAA 1KWKA 3SQMA 4DLMA 3QSRA 2YL5A 4IQLA 4C7FA 1LLOA 4Q4OA 3MZNA 4ZQRA 1JRCA 2BSLA 3EXTA 2P50A 2WQPA 4PYSA 3RXZA 3DG6A 3BGJA 2JKPA 1DORA 1ODUA 4NJJA 1JZ3A 3MDUA 5H91A 2A7RA 2Y2WA 1C93A 4B5TA 4RR4A 4YCPA 4GI9A 1AH0A 1E5JA 3UEQA 4JQ2A 4YLWA 1FBAA 1SO6A 2QMKA 3CV1A 4ADUA 3ZJKA 3GLCA 4KWWA 8A3HA 2FZDA 2WNNA 2A4AA 1OFAA 4IX2A 3Q58A 3B4YA 4A8IA 3WYZA 3SGUA 5I07A 1QNVA 5EYWA 4O15A 1PJ9A 1Q4NX 2MANA 3BGGA 2ZTKA 3FOKA 4QLKA 4U2YA 4DJDA 4FK9A 1ZJAA 3PJUA 2OEKA 4O10A 1AQFA 3M7SA 3UXAA 1EOKA 1IT0A 1WZMA 5I3KA 1VFMA 4MJ4A 4HU0A 2V38A 3BO9A 4F40A 2WWDA 3L2MA 1UR3M 1EO5A 1VPYA 4JL2A 3OOQA 1X7FA 3RCYA 3FV9A 1WXZA 1C3FA 4Z1CA 2EG6A 4PFHA 3KRZA 2ZX6A 3VE7A 4L80A 3ENLA 1K02A 4OT7A 1GPFA 1XH1A 2KZHA 1OD8A 1X39A 3B0PA 2G50A 4AWUA 1QOXA 1JZ6A 3CB3A 2PAJA 3R6IA 1JYWA 1TFVA 4RNJA 3PC0A 1TZZA 4FNQA 4M82A 4GACA 1HJSA 2VC6A 1YBQA 2YLLA 4NL1A 4GNVA 1SMAA 4GO9A 2RGMA 2ZXDA 4NP7A 4WVXA 4L6OA 3MHGA 4A3QA 5IFTA 2BV9A 2VWTA 2ZZ4A 3GH5A 3P60A 4R27A 2AOSA 3OYZA 3TONA 3MP3A 7REQB 4ACZB 1DE5A 3UR2A 4I7WA 4JQ3A 1H1ZA 3VO0A 4J3VA 1CXFA 4UWMA 2PDMA 1W9DM 1QBBA 1DTUA 1ZL1A 1F61A 4FXSA 2R1MA 1M6JA 1V7YA 2FIQA 2POZA 1SR9A 3KWSA 5CC3A 3M0LA 4X2PA 4AD5A 3TR2A 2H3BA 2J7GA 1XYLA 4PMJA 3N9KA 3NPWA 2NT1A 4I7VA 4KEUA 1U5HA 4GI4A 4XVDA 3RRAA 4AC7C 3QC0A 4P7RA 1FUYA 4O18A 2FMNA 4F0RA 1PB0A 3R0DA 3W0KA 1TJ0A 1V51A 3CH0A 5B7ZA 2NV2A 3AC0A 4OIFA 2D3NA 2HXTA 2A3LA 3W7OA 1ZAHA 3W28A 5SWUA 4GQRA 3T05A 3OVRA 5C7HA 3GXPA 3U9IA 1I8JA 1Q2SA 3L65A 3GDMA 1R9ZA 5A95A 4DYEA 3UZWA 3ARPA 1PV8A 1TWZA 2D1ZA 5D09A 5H8UA 1MW1A 3VMOA 4UFKA 2ZUNA 1TWWA 5DEZA 1JCTA 3DKJA 2DPEA 2GJLA 1QCWA 3FEQA 2OYLA 1RXOB 4PMXA 3U2OA 4AWEA 3TOPA 1RZMA 2FJUB 4PC8A 4P7OA 3P67A 2QV5A 4QXIA 1QT1A 2PWUA 3E0VA 3IANA 3PHAA 3L4VA 3G5EA 3H23A 3T4WA 2W9MA 5AZ1A 1UIOA 4NI3A 4ORIA 1BYCA 3M7WA 2AAMA 4GUFA 3M0XA 3W6MA 2J75A 2QPXA 4XZNX 3KS5A 1G94A 4ROPA 4L6HA 4HMNA 3HQPA 1CXHA 4PTDA 1GOOA 1DWIM 1K6AA 1W1TA 5A6SA 1IF2A 3G22A 3VC6A 1EYEA 2MNRA 2Z24A 5FSDC 3EWWA 3FDKA 4KWOA 4CVWA 4DJDD 3L2LA 3RUBL 4Q8OA 1L0PA 4KERA 1GOKA 1MXSA 2R1PA 3DFQA 5AVNA 3WDJA 3LS9A 4GY1A 2OO6A 3HGSA 3W83A 4ZO8A 1XDMA 4PCPA 2BFGA 1A5LC 4FLRA 4HJFA 1EJTC 1I2NA 2D2OA 3BL3A 3M4HA 1JI2A 1V3JA 1MYRA 2YW3A 3IJQA 2WSRA 1GVIA 2Q09A 3MMWA 4CNPA 3L67A 4U28A 3ALFA 1F4AA 4QS5A 4MY9A 5D9MA 3AU6A 5CGMA 4M19A 3QGKC 4PBEA 2J7FA 4DYKA 3KOYA 4Z0JA 1KFJA 1WOBA 3RLHA 1Q66A 1UH4A 3TYCA 3VIKA 5CLWA 4X60A 4ZQCA 1RLCL 1PVNA 2VFDA 1OF6A 4HSHA 5CJMA 1TQXA 3N12A 4CNSA 4HQVA 1X1ZA 3GUWA 3MKVA 4MG4A 1S5NA 4QM1A 4BZYA 3M5XA 4YL2A 2OZ0A 3BJSA 4IPIA 4IIFA 1AODA 5D9NA 2Q02A 3C3UA 2XSXA 3WDQA 1WNOA 1NF7A 2HK0A 4QJ3B 5E93A 2D73A 3TN3A 1OC5A 1JXJA 1H2JA 1UWSA 5D38A 1SUXA 7REQA 4M51A 2Z2BA 3L5AA 3EDJA 3OVQA 1Q6CA 3G24A 4TQTA 3NQVA 3L66A 1VFTA 4QRNA 2J78A 2JF6A 1G4EA 2DW6A 3TN6A 2OZ3A 3KVJA 1D3HA 1GZGA 1YTDA 5A6KA 5HBFA 4LV4A 3S5ZA 3HG3A 2GGIA 1XP3A 3WDRA 4LF1A 1Z9AA 4NU7A 1UR8A 5FEZA 1W31A 1G7UA 3NM1A 4MJ2A 3GNNA 3T2PA 3CHEA 1TJ2A 3SI9A 5GJNA 4QEEA 2XFFA 2QGHA 3W73A 4Z17A 2YB4A 3ABOA 4NASA 3KHDA 4IXHA 3VIJA 1UP2A 5FEWA 1JCMP 1GG0A 1OFEA 1EC9A 3TSBA 3SM0A 3NTYA 3NGFA 1AA1B 3HJZA 3K30A 4YNGA 2Q8LA 4J4KA 4ZL1A 3NAVA 2BVDA 3LPOA 4QX4A 2OSWA 1UWRA 3CL7A 3CBWA 4S23A 3A23A 3B9NA 4JTEA 1E5NA 4FPSA 5HQLA 4BI5A 3L5LA 2O9PA 3W01A 2P3ZA 1MI3A 3VGDA 5KZ6A 1RBOB 2VZVA 3M0JA 5L9FA 4ML9A 3N6QA 3QZEA 1W3IA 1D2KA 4FMVA 2HS6A 1BXNA 3PPFA 1SW3A 2NSOA 2XUCA 2HE5A 5E9AA 1TIMA 3GKFA 1UOZA 4F2UA 1RJRA 2TPSA 1QNRA 5CPOA 2PLKA 4LBSA 2B7OA 3EOUA 1QR7A 1HF6A 4Z2HA 1B54A 3ZYZA 3GFZA 2AGKA 4ZFMA 2DZVA 2OLSA 4PUWA 3VIIA 1K77A 3MP5A 1S1RA 3WIJA 3HG5A 4X0NA 3G8RA 4FO4A 2DSZA 4DLFA 3WDHA 3EXSA 1US3A 4DUOA 5E09A 3W02A 4OBRA 3SRFA 3G18A 1JYNA 3QTPA 1TRIA 2EHHA 2DIKA 1AH4A 3W2LA 4G56A 2VUYA 3MANA 3AXKA 3JZEA 4PBGA 1US0A 3KBNA 2BTMA 4GABA 3UYCA 2I14A 4D71A 1B3YA 1O60A 5FF0A 2QJJA 5A2BA 3H4XA 4J1OA 2ADAA 1V6XA 1XLCA 3UY7A 4H1ZA 4NJGA 3TCEA 4DM2A 3ITGA 3N34A 3W72A 3G1FA 1S2WA 1V3KA 1MUCA 3KOWA 2VKZG 1W9BM 4IG2B 4Q7BA 3KLKA 1HFBA 4QR6A 2FZ9A 1THFD 4RX0A 1PZ2A 3USBA 2NXIA 3ID7A 3OODA 3R43A 1ZS2A 4JIEA 3OQEA 2BS9A 3GG0A 3RR4A 1FP9A 2JGYA 5A6BA 2E0PA 5G1MA 4A3UA 4JGDA 4QSHA 3CIVA 3LPGA 1QPRA 2Y7FA 3POCA 1JULA 3H6OA 4O1FA 4E5TA 4Q8QA 1F2JA 3MV11 5IOBA 1TVPA 4DAIA 2QMJA 3EB2A 3WF4A 3GWQA 1XLDA 1T41A 4RE4A 4QP0A 1LQ0A 2D2GA 4HD5A 3LN3A 3VFLA 1O4UA 1W17A 3NCOA 3NEHA 3LM3A 3AJXA 4UQEA 3AYRA 5T9CE 5F4WA 2R1LA 2OKOA 1UD6A 1FWEC 5DCEA 3SY1A 5FCZA 3ARRA 4GA8A 3B03A 2RDTA 3BLKA 3G1DA 4PTVA 3EXRA 5HUOA 3VYLA 2C7FA 1D7FA 5BXTA 3CV7A 1GEQA 4IIDA 2NQ5A 2AQWA 3EX4A 3W1XA 3ABZA 4WKAA 3U0HA 1TCDA 5CSYA 1TR9A 1GWJA 2V5CA 4B5VA 3RO6A 1TV2A 3NQGA 5LKYA 3R7MA 3N3MA 4P61A 1TR1A 4HCDA 3RPMA 5T91A 1XLLA 4R7OA 3T40A 4Q8NA 1GQNA 3A6OA 4Z08A 3AIRA 3IJ6A 5D03A 4LYPA 1CDGA 2XIJA 3RFAA 3WL0A 4O12A 1UKQA 1UZHA 4H9YA 5G4WA 4P8XA 3WLQA 1TZ7A 4ZB5A 4GFSA 1U2YA 4EK7A 2ZRUA 1BQCA 3FS2A 4WX2A 4O0KA 3FX4A 4LGXA 1YDNA 4M8UA 4FXJA 4XSLA 3DYOA 4MZ8A 1B3ZA 1VFLA 1VD6A 1M03A 3KBJA 1IEVA 2ZDRA 4UOJA 1JDCA 4O0ZA 1C8XA 4AXKA 3CMJA 8XIMA 1HUVA 5J04A 3VUPA 2Z4GA 5JVLA 1GJWA 3CEUA 4XZIA 3W6LA 4IMEA 1VGAA 2Y0FA 4GJIA 1A3XA 2B7NA 3AS3A 4JX6A 2ZZ2A 2GQAA 4W5UA 4UTHA 1DIKA 4NZ5A 3WUBA 1XIEA 2QGYA 1OGBA 2XJ7A 2O56A 3LCFA 2J7BA 2PD9A 4M6UA 2C0AA 4LUIA 1PYFA 1RVGA 3SRHA 2XVKA 3STCA 1OVDA 1CB7B 3HF3A 1K7FA 2CERA 4RW3A 4FNSA 3OJGA 1J12A 4J2MA 2UV8G 5CZ0A 3U6WA 3GH4A 4HNOA 4QE1A 4I3GA 3QV9A 2XH4A 1AVAA 1SSGA 3EKLA 2DZXA 4CD7A 2HSAA 5A6BD 2ZYFA 5FAJA 1CECA 1B4EA 1TTPA 2WXDM 3S2JA 3VNJA 5KTLA 4XZHA 3P2VA 1BXBA 1CXKA 3TTEA 3BQ6A 3RF9A 3V4BA 4DPPA 4GJJA 4W8LA 3S5SA 1C7SA 1M04A 1XGEA 4QTGA 1QBAA 1UP0A 5AHMA 3BW4A 1M9HA 3KS6A 3GYCA 3WFZA 3NIYA 1YDVA 1NWRA 1HJXA 3ARUA 3LA4A 1YPIA 4XUGA 2E67A 2X0HA 2IQDA 1BPLB 2DIJA 1IEIA 4F0SA 1SFSA 4H7VA 4Z0SA 3U48A 3ANVA 1VEMA 2Y61A 4NRRA 2WMFA 3XIMA 4P7LA 3VC5A 2C1IA 3FVDA 2C18A 3TYUA 1OCBA 3FKRA 1W3TA 3R12A 5AVHA 1GEHA 1E4LA 1Q8AA 2BY3A 2DSVA 3FHAA 4JTSA 1UBSA 3QYQA 4PE8A 4IJCA 2CLEA 2PFHA 2WOQA 4NILA 3ANYA 2WCAA 1JNEA 4X9YA 1WKYA 1E71M 3NPXA 1AW1A 4M6VA 3MHUA 5DBUA 4Q32A 3M0VA 4AZCB 3TYZA 1MNZA 3GNXA 4DUWA 5LIYX 4XKYB 3THAA 4DZ5A 3P0XA 1PHQA 3R10A 4W88A 4B2DA 5CEWA 1P0DA 1O1ZA 1TTIA 2OOGA 4MVAA 4Q8WA 2GK1B 4HP5A 1C91A 4Q4KA 4U4MA 3P82A 4QEHA 3M5ZA 1HKIA 2V5DA 3CUZA 1YRRA 2HXUA 1T40A 3NOYA 4CU6A 1NFGA 4S3JA 4WOQA 1A5UA 3DFPA 2FZBA 3WG6A 5KETA 3FCPA 1XGZA 4JICA 2Y89A 2A1YA 2R1NA 2Y1HA 3UXKA 4DXXA 4KFNA 4I9AA 4N0RA 1V3IA 1T5AA 2GOUA 2CLOA 2VQUA 1XCWA 1AMKA 3GVGA 2QHAA 1GYNA 1ELSA 4KKXA 3V1HA 2YFNA 1BWLA 4R5EA 1LCOA 1ZGDA 3M0ZA 2HVMA 5BOEA 1WKEA 1W56A 1ITQA 4QHRA 2EG7A 4MPKA 3S9IA 4PMZA 4HB7A 4ZB2A 3CL8A 2ZTJA 1OZMA 4TOQA 3EWXA 4WSJA 4FF5A 4CQ9A 1PWMA 2H8ZA 1U5JA 4R9OA 5CH9A 4C6IA 1GUVA 4G1KA 5DY2A 4C6DA 1R3QA 4A8RA 3C2OA 4XD4A 4E2OA 1XBVA 4AVNA 1PIIA 5BOOA 1K7XA 3TFXA 3NL2A 4PUJA 3B0XA 1W3JA 1MZHA 1XH0A 2VVSA 3W53A 4IIBA 1SO3A 2PLJA 4WLCA 3VKJA 3K13A 3TVAA 3GU1A 2QDHA 3OO2A 1NARA 2VZOA 4WY0A 1FDYA 5BMWA 5JUVA 4PCNA 4QS6A 3THDA 1KLYA 4A22A 5IRPA 2J27A 4HU3A 3VNLA 5AHEA 3B0YA 4U5IA 1VFFA 4N9BA 1QO2A 3AHTA 4XSMA 1EDTA 3N3TA 2YCEA 1P0EA 3ZT7A 4EXQA 3W9ZA 2OCZA 1XIDA 4XD5A 2A3AA 4GH3A 3HMJG 1CGYA 1XDLA 1ONRA 3B8IA 2FTPA 4P2VA 5ABFA 2I9EA 4PMDA 1CWYA 4C90A 2Y8UA 3WSUA 4IIEA 4H2CA 1S5WA 3BC9A 3GHUA 5FF7A 2D20A 1J79A 3LTYA 5DT5A 3B9OA 3ZJ6A 2A2IA 1BXCA 3CYJA 3FA4A 5MHBA 3UNTA 4CQAA 5BNKA 2WHLA 3IS4A 3EWYA 2AGTA 3WD0A 3GXDA 1MXDA 2UY5A 3DYMA 3R79A 4UTKA 2C0HA 4QBXA 3S0CA 3LPFA 2BXZA 1JUEA 4B2DD 1FCUA 2ZUVA 3O07A 1P6BA 3ARVA 2W3ZA 3OTRA 4XKYA 2PWGA 3K4DA 4GUGA 4XTIA 3AIQA 3HA1A 1ZBWA 4B91A 1PL9A 3C0LA 3UPWA 3FYOA 2OEJA 2WJEA 4YWIA 2GK1A 3WFLA 2PDCA 2Y24A 4IX0A 2PGFA 2NZLA 1QJWA 4FEZA 2VNCA 3A13A 1WX0A 3T78A 3FY1A 4C6OA 1JDAA 4XWUA 2PDKA 4AU0A 4CQDA 4GVFA 2CBVA 1CBGA 2PC4A 3S5NA 3MUXA 1FKWA 3F4VA 1DYSA 1E0TA 4JYEA 4XZ9A 2YDQA 1B9ZA 1R85A 3TTYA 4KRTA 4GD0A 1Q6FA 3CC1A 3GXFA 1DJWA 3THUA 2OELA 3MZ2A 1YNYA 3GNDA 3U5YA 3FHQA 1BSLA 2ZRXA 4KRZA 5DF0A 2A3HA 2HRWA 1JNDA 1Q3NA 2OOFA 2VCAA 1YE6A 4LUYA 4KFPA 3TNOA 4WDWA 1KM5A 4DWDA 3SCRA 1D8WA 2D69A 2FYMA 3S4TA 1RALA 3VILA 1B3XA 1C90A 4HA3A 4MY8A 4HBKA 3UJ2A 4M0XA 2JK2A 4X2RA 5K9CA 2WZHA 2WLZA 3TA6A 1TIWA 2DJLA 1M1BA 1TPWA 4LRSA 5HJYA 3KX6A 4S3KA 2OO0A 1TMQA 3UXLA 1EL3A 1TO3A 3H55A 3AZRA 4C1LA 3VZYA 4XZMX 3PPHA 1HJQA 3I6RA 2E40A 3K8LA 3UG3A 2P76A 1R3VA 3OP2A 1V6UA 2ZDSA 3IJIA 4AIUA 4J3SA 4DPQA 1XIGA 1A4MA 1NELA 3GAKA 4AF0B 2R9RA 3IK2A 1LDCA 5HWMA 2XVPA 2WJZA 4LCQA 3NVTA 5LA1A 1R46A 3PSWA 3F4DA 4JN7A 4UTMA 5CKSA 3QW3A 3UG5A 2RAGA 2HPIA 1POJA 1SM9A 5CPSA 4RL3A 1KTBA 4QJ1A 1EZ2A 2C1GA 4KEZA 1R3YA 3BLDA 3N15A 3F5LA 1WA3A 2GGHA 1BRLA 3LSCA 1LOLA 3VIFA 4C65A 3ITOA 1EOMA 1RCQA 1WDQA 4CD4A 2R94A 3F7JA 3WQ5A 3O05A 2F7FA 3SIMA 1C29A 1ADSA 1Q45A 1KFCA 4W8AA 1MFVA 2EGZA 4Z1DA 2ZE0A 3KRSA 3LG3A 1W1B1 1VBRA 2NUWA 3BZJA 2G3IA 3PPGA 1OFBA 4HOWA 5JIPA 1YLVA 3QZAA 4TV6A 3GTNA 3WQWA 3VCRA 1KBLA 3AUOA 2E28A 4RE2A 4XK2A 3LBOA 1CLKA 3RAOA 5AECA 3DFTA 4R53A 2OG9A 1UA7A 1VS1A 3MVIA 4JPGA 1YXDA 1E9LA 3M6YA 3T44A 1JL8A 3GDLA 4FSAA 2WAGA 4MF4A 5G1YA 1TV3A 2XIMA 2WZEA 3FJ6A 3CNYA 3TZNA 4U3AA 3DHUA 4MAZA 2V5LA 3H26A 3UWEA 1E4IA 4CCEA 3UR8A 4UNLA 3OQ8A 3NNTA 3LM7A 1YTEA 2WVUA 2VFGA 4NZFA 4KQNA 5F2IA 3O63A 3HFTA 5FAGA 3SCVA 2E6YA 2DT1A 1SFTA 3AHVA 1XD1A 2VD9A 2QF7A 1VCFA 4OJYA 3NZQA 4FXFA 2L5HA 2WMKA 1RJQA 4WDXA 3M1ZA 3PJXA 3WO8A 5LIXX 2VFHA 4C7GA 1RD6A 1KRBC 4K2SA 2Z6JA 5TF0A 3PY2A 3VGEA 3WH5A 3ECQA 3VIGA 5IBXC 5BWFA 4LAMA 4DIAA 3NQEA 4F66A 2ZVRA 5H1WA 2ZXBA 2VMFA 4TTUA 3OIHA 4V2XA 3YPIA 3UJFA 1C9WA 4EPEC 4TR9A 2PLCA 1SW7A 4AZBA 1BF6A 4YU1A 3B06A 4GC4A 3PNUA 3VIHA 1E6PA 3GDKA 3DBNA 3RX2A 3FJ4A 2HEJA 4AXNA 3JU2A 5EL1A 5C71A 5EGRA 4S1FA 1EIBA 3U7BA 1U83A 4AD4A 4YHEA 3VFCA 4AUBA 3OGVA 1A47A 1EKOA 1VFUA 1HJUA 1V6WA 5JMUA 2BG5A 4DI9A 2PWHA 2ISVA 1G9HA 5DX7A 4HCHA 4FR6A 2SFPA 5CLTA 2FZ8A 2PMQA 3ALGA 4AF0A 1V0NA 3CHCA 4POCA 2NWSA 3TOYA 2PE4A 4DYJA 3NZGA 4IIHA 4H9VA 3S46A 1IZKA 1P0KA 3M0YA 3QTGA 1GYLA 3C6CA 5HANA 4LY8A 1H7NA 2E8ZA 3LI0A 2PB1A 4F48A 1F4HA 1IV8A 3GTXA 5D04C 3EB4A 5A2AA 2F61A 5I77A 2FB2A 3KRBA 3HFYA 3BK0A 4UQAA 4QSFA 3VKAA 3OHMB 2C91A 4J27A 1B3OA 1Q7MA 2ZUTA 3MU7A 1X38A 4GINA 3BLLA 1WXJA 3T0DA 3W82A 5D4YA 2TSYA 1SZFA 4HNNA 2VEKA 3QY7A 4HZ8A 1GK8A 5CCZA 2G97A 2PS2A 2BGSA 4JAWA 3LYEA 5ABHA 3UW6A 5LXXA 1UC4A 1YKWA 1RAKA 4AVFA 5AOUA 1FY6A 4QDMA 3F5KA 4ZO7A 1DL3A 4F0MA 3A5FA 2CLMA 5FI8A 1K4GA 4IJRA 4D6CA 4WKHA 4L9ZA 3EOSA 4ZVJA 3WK1A 3U4AA 1KR0A 3CAWA 1A80A 1A5KC 3EOOA 4H9XA 2VZUA 4K3ZA 3IUIA 4AX7A 1JYXA 3LGGA 1OF8A 4GY7A 3TK7A 3MCNA 4MKNA 1YDOA 5EU9A 1RQHA 3PBVA 4FXRA 1Z32X 4LB4A 3RK8A 1AJ2A 1K03A 2WB5A 2G95A 3W86A 1TE1A 1W2PA 2X1TA 4GQGA 3TWAA 1SU5A 1KCXA 3GG1A 3VOHA 2X7VA 2R1KA 3EWZA 3BW2A 3M47A 4NG3A 5CPQA 5CSRA 4L1GA 3TNBA 4O4VA 3K1GA 4GI8A 2OJPA 4Z2LA 5DBTA 3QV7A 4RPPA 4KF1A 3N17A 1JUKA 2YFOA 1VBGA 2BZNA 2P0OA 2E09A 1FWBC 1UD3A 3N73A 1PKNA 4DWSC 3LD5A 4LVFA 1LL6A 3VKDA 1VF8A 3GXIA 3UZYA 2YXXA 5JXQA 1A3WA 3A4WA 2R14A 5I6SA 1AZ2A 3UPMA 4LYRA 5F2LA 2C16A 4RDVA 2GJNA 3HGOA 1FWNA 4L1WA 1C92A 3ZIZA 5M03A 1EJXC 2VWSA 3I68A 1Q6EA 2V5JA 2ZRZA 3GFXA 3BMWA 1XIJA 3AI0A 3ELFA 1QTWA 2PZ0A 1QW7A 3SDOA 1M7PA 2A5HA 1GQIA 3KOZA 2R6OA 5HULA 3OZYA 3WF1A 4ZFCA 4LBRA 1K9EA 2ACSA 4EAMA 2AKMA 3FNDA 3TEVA 1EC7A 4LV9A 3N19B 2PWEA 5CZKA 1H63A 3QMTA 1HXJA 3ARTA 4IH3A 2QLYA 3V5CA 3R4IA 4LUTA 4O0QA 3ZVIA 2O7QA 3ZS4A 4HGXA 2JIWA 5K9DA 1J4EA 3KBMA 1FWDC 3EEZA 1H7RA 4LTSA 4JTAA 3QH2A 3T08A 4BEUA 4HTBA 4IMFA 3WMBA 4HMEA 3VNIA 4ONVA 3BWWA 5IDZA 4MKSA 1ZJHA 2QDGA 4GIRA 4ZTYA 1EJRC 1JDEA 1H7XA 1EQPA 4WUIA 1DV7A 1X6LA 3A22A 3MJYA 1GVEA 3S1UA 4ORMA 3KRUA 3EA1A 1XISA 3RU6A 4K8EA 1JCNA 3HPFA 3QQ1A 3W4RA 9RUBA 3LMYA 4AH7A 2F2HA 4IJBA 4TTGA 4LVAA 5CC5A 5A5WA 1UD4A 4M1RA 3PULA 4Y9AA 2IKIA 1FXPA 4IMDA 4RUBA 1OM0A 3THCA 4AD1A 4MZYA 1G5AA 3OU8A 3T0AA 1FXQA 5MF5A 3GC5A 4JTJA 5I2UA 4BA0A 3VDCA 2CNCA 2VP8A 4UFIA 1R8LA 1WOAA 2OMAA 2J6VA 2QYGA 4E2VA 1XSJA 3SGGA 3VCNA 3KCJA 5BWAA 1N8IA 1ZAIA 3NZ1A 4NAEA 4UOQA 3MC5A 3LCGA 4H6KA 4CNNA 1WUEA 4Q7NA 2DT3A 1GVQA 4G1NA 2BNJA 4QAWA 3BOXA 1ZUAX 5IDIA 1DXEA 4S38A 1UJQA 4F0KA 1POKA 2CLKA 4J35A 4GK8A 2IPJA 1MSSA 4GYKA 2PDFA 3WQ6A 2XFYA 3CTTA 5DCDA 7TAAA 1KKOA 1XUUA 3UFYA 5E9XA 3TP4A 3FSTA 1R47A 1FCVA 3H7RA 1EXBA 3VE9A 2I57A 4C6JA 7TIMA 1V0MA 3W7RA 5D02A 4TX6A 5DXYA 3IK4A 3QEZA 3NSNA 4N4QA 5CG7A 1XINA 4AB4A 3EKZA 1RJPA 2HTMA 5JBDA 2YDRA 3DFHA 1UWIA 3G0SA 4GUIA 4WHBA 5I00A 3ZT5A 5D2VA 3VDBA 2X0YA 1HO4A 1IR2A 3PFMA 4IL0A 4WJEA 4YS1A 2VT0A 3UYIA 2QQ6A 1ODZA 1JR1A 3A47A 2QULA 4QNEA 5DT7A 2QJGA 1LRTA 3PZIA 4DJEA 5HUPA 3GZ3A 1VKFA 1W5OA 1CT5A 1PWLA 1KA9F 1NFPA 4WK9A 1B90A 2QDDA 2QCLA 4R9XA 4KWUA 4IWWA 4GKLA 1TZ9A 1E6NA 4Q4SA 5HDRA 2HE8A 2O9RA 2WSKA 1W54A 1CGXA 3GH7A 4UTWA 2BLEA 2I9UA 3SAZA 1LQ2A 4MOZA 4X9SA 4CN1A 1EYWA 4JHMA 1NWUA 1MNSA 4JTLA 2V81A 5REQB 3BCJA 1R7AA 5I78A 1LROA 1BG4A 4CCCA 3QGAC 4QISA 1QK0A 5B7YA 3GTIA 2W92A 2BY1A 3DFYA 3IVUA 2PZNA 3CZGA 1T0OA 3LPPA 2VRQA 3CYVA 1MDLA 5EPDA 3FEMA 1PXGA 4JKKA 3KZSA 1XG4A 1EGMA 1RBAA 1IHIA 4O50A 5CSUA 2NX9A 5D32A 1J0IA 1ISVA 1TELA 1I1XA 4JX4A 1HT6A 1KGUA 4QJ5B 4PL2A 4FOJA 4HMCA 3EWUA 3DC8A 1P4CA 2OT0A 3N2BA 5HJXA 3F1QA 3PG9A 3VNMA 2IS7A 3JVAA 3A4JA 1QI4A 3PBGA 1AMYA 2OQYA 3KFTA 3RNDA 3M46A 5K7JA 1L6SA 5KSWA 4M29A 4GZ7A 4I6KA 2BDQA 1KBBA 1KC7A 3GDRA 1J5SA 2RUSA 1JJKA 1XYBA 4JTHA 4JD4A 4I90A 4ZCWA 4Q6JA 3VNDA 5T26A 4L4LA 1CZ1A 3H2FA 1BQGA 1Y0EA 4B90A 3GNOA 3Q65A 2GSHA 3QR1A 1RV8A 4DZAA 3BH4A 3UWUA 3LLDA 3U2CA 1PE1A 4IP7A 2E9LA 1NDZA 1FHLA 1OCQA 1Y7VA 3AIWA 3WLLA 1PDYA 4D6IA 5HWNA 3TROA 1M3UA 3PZTA 2VJXA 5CPNA 1FHVA 1NH6A 3S8HA 4NAFB 2B81A 3SGZA 3DKLA 3FKKA 1JGMA 1UIPA 4LH8A 3AIUA 4JL1A 2GUUA 4IF2A 3KHJA 4Z2KA 2J9XA 3MSRA 1GQLA 1IWBA 4RV8A 1ZTVA 2DW7A 4M24A 4OGZA 4I8YA 1J2BA 4LQ1A 3QR3A 1JD9A 1F8IA 2DQWA 4EANA 7PTDA 1BLIA 4LS2A 1DJQA 4GI6A 4HMDA 1X7IA 3C8NA 3P62A 1MMFA 2PDGA 4IMGA 5HINA 3MO4A 3NQDA 2R8WA 4CCZA 1EJVC 5GNZA 3WUGA 1UA3A 4DJED 5GQBA 3EWBX 3WKZA 4C6NA 3DGBA 1DWAM 4HU8A 3EMZA 3SCNA 1XKJA 3KWXA 1NSJA 3PZMA 1XLBA 3CPGA 3F5JA 3ZM8A 3EDKA 4XBKA 1Z42A 2F84A 3II1A 3FK4A 3I7SA 3IJDA 1UKPA 1F9CA 2XN2A 3NR0A 3T4CA 5A3HA 3AWNA 2NLIA 4CEUC 1K7EA 4BFAA 4Y90A 5A69A 1DJIA 4W87A 3MMTA 1PZ0A 3URAA 3GD6A 4DF1A 3I10A 3P81A 5REQA 5HMEA 4AG0A 3SUVA 3FAWA 3E2QA 4UMBA 1EUAA 2OSYA 1A5CA 4YTTA 3EMCA 4HOXA 3BLPX 2X41A 2ISSA 5HQMA 5A8PA 3UWQA 5EMLA 2BGNE 5I3JA 4D6GA 1OBAA 3Q94A 3W2JA 2PWVA 3WBEA 4DRSA 1HL9A 3HB9A 1CIUA 1B3VA 3TR9A 1JQXA 2F6UA 2XTKA 1GJUA 2EPKX 2BWGA 3UZ5A 3GIPA 2RDUA 2XGZA 1CYGA 2RDWA 3L5MA 1NWSA 2DP3A 1L9WA 2WVTA 4GQ0A 3EOLA 5HR7A 2BXVA 4GPNA 3VOCA 1WZLA 1MW0A 1PYMA 5F1UA 3C2RA 1KV5A 4WGHA 3WENA 2PDNA 1VYPX 3KLLA 3NXLA 2OT1A 4HPXA 3UZJA 5EBAA 2VX4A 1K9DA 5AC6A 1DVJA 1O6IA 2C6QA 1JZ7A 4HKPA 3UXIA 3W1LA 3SJNA 4IT1A 3LHTA 3TWBA 4E4FA 2XIOA 1LT7A 2J9YA 1BF2A 1R38A 4A21A 1YE4A 4L9YA 2YA1A 1L8NA 3B04A 3PTMA 1LWJA 2G4FA 5FJTA 3UY8A 2F38A 1KV8A 3V1PA 1RY0A 4C60A 3WN6A 3BSMA 4AX6A 4Z1BA 5CZJA 3UP8A 3O7UA 2FTWA 1HQTA 1F6PA 3CASA 1AW5A 4DBEA 4LNYA 4PODA 3MA8A 2QUUA 4ZO9A 4GBUA 2MUCA 5EFDA 2WHJA 4C6FA 2HVNA 3NJ3A 1ZY9A 4AHQA 2YA2A 3NPUA 1T8XA 2VX6A 3URQA 1XYAA 2V67A 1OK6A 3M43A 2ZRVA 1JPKA 1MW3A 1UQZA 2EEXA 2Y63A 4G2DA 4F9DA 1F05A 5AHLA 1U30A 2XIIA 3P5YA 2X16A 5G4EA 4L4OA 3STPA 3VM7A 3THQA 1XL9A 1KM0A 2OVLA 5M17A 2Z0IA 4HN8A 3OG2A 1BWVA 2Z1XA 3E0LA 3PUEA 3KTXA 2C3ZA 3WCZA 3AMKA 4LAKA 3AAMA 2VR2A 1PHWA 4O16A 2YLAA 2OGYA 1PIGA 3VMPA 3VGGA 3A12A 4H9ZA 5A6MA 5JU6A 3WJSA 4CN4A 6REQB 4ZOEA 1XRSA 4XQ6A 1Q6OA 1U33A 2CHNA 3GW3A 3LRKA 1TWDA 5C7VA 4O52A 1E43A 1L8PA 1W9VA 5D37A 3GNRA 1RP9A 5BRQA 1N55A 3NG3A 3S6DA 4JTGA 1VJZA 3TMQA 1QU4A 2WZIA 4OV9A 3E9AA 4DHGA 3PZ9A 5ABGA 1W1PA 4JKMA 3AUJA 1TPC1 2QCGA 4AMCA 4YCOA 3S1VA 1EH9A 5HJLA 2X2GA 4D6DA 2QUTA 2YSWA 3REQB 1DHKA 2PTYA 1B3WA 4AMAA 1W1ZA 3LI1A 2BVYA 3B97A 3LU2A 4R3UA 4CD6A 3OYXA 5BZAA 3GFYA 2AMXA 4G8TA 3WMLA 1ME7A 3TC3A 4YYFA 2BOEX 3O15A 2JFEX 2XDFA 2FB3A 4OBTA 1M7XA 1HGWA 3RDKA 1HP4A 3GS6A 1FWJC 1NM9A 3WLPA 1O68A 1G01A 5BROA 2J24A 3EDFA 2VTFA 1H50A 4I7UA 2YGYA 1W8GA 2VEFA 4QFUA 1ISXA 4WR3A 3E02A 3ZO9A 3UGVA 3QHOA 4GYPC 4I8DA 4EXBA 4FP1A 1U1HA 2W91A 1R9XA 1J5TA 4RDYA 2XZ9A 1EDQA 3KOXA 1IR1A 2WNQA 2PURA 1OFRA 4N9DA 3IGXA 1FH9A 4YTSA 4LVDA 3T81A 1QASA 2P53A 1EEPA 1ZBVA 5H8PA 3AJ7A 2HROA 3UESA 2ZXAA 1NAL1 1DQUA 5DCBA 3VD5A 3IIPA 2BHYA 4K1WA 5AYBA 1JF6A 1QI0A 4H4IA 3USZA 1KLZA 2DUXA 2DZUA 1FCBA 4NUWA 3EAUA 3CXOA 5F1VA 2NVDA 2QCCA 3NSMA 3ITXA 1CGWA 4O57A 1OJXA 3CS2A 3ZLGA 1VLIA 4IGMA 3OBEA 3UJRA 3SFWA 4AIOA 4FALA 1HKMA 3IJ8A 1E4NA 1X96A 4ES4A 3WLHA 1ONEA 4NXSA 4D6JA 4ICNA 2FGBA 2NQHA 3T7VA 3ZSTA 4MLRA 3TYBA 1RVKA 4A29A 1W32A 4IISA 1W3LA 3LDVA 2YXOA 2EF9A 2DY3A 1WKFA 4JN6A 1Q6DA 3BOFA 1HNYA 2CITA 3CMFA 2VC7A 3AS0A 4D2JA 3QN3A 2AQOA 1B0IA 5HOSA 1VJSA 3EGJA 3GX9A 1SJBA 2GZXA 2Z26A 4LANA 3W74A 4KPLA 2GFTA 1PZ1A 3LHUA 3GU2A 2Y62A 1RR2A 3EDEA 4B5UA 3SR7A 5B80A 4LY4A 3V7PA 4P7NA 3VGHA 4PEEA 1MVYA 1TJPA 4NXKA 3W81A 3K4WA 4Q8TA 1G4SA 2XFWA 2D0FA 4DZHA 3PVFA 4DWSB 4UUIA 3T55A 2CXGA 1BYAA 3QVQA 4X63A 1QK2A 2ALRA 4OWGA 1R86A 3L12A 2QXWA 5AHFA 4DXKA 3REQA 4J28A 3GY1A 2ACQA 4EAYA 3L4WA 2DORA 3IEBA 4TXEA 4EIVA 4UCFA 4JR5A 1ISYA 1TVLA 4HHHA 4AWTA 3TJXA 1FWCC 3OVPA 3WQ8A 3CQHA 1GZJA 4CU8A 3N29A 1UPPA 2DSKA 2JKAA 3R94A 3RILA 2X42A 3MW7A 3FGCB 4RZ6A 1EP3A 1XH2A 1PEZA 3BVJA 4RZ4A 3H2MA 1UR2A 1C8VA 3OA5A 1EPVA 2WLYA 3N2TA 1OX4A 5HATA 4AZ6A 1LWIA 1NQKA 4IPNB 3NWRA 3F4CA 3OGSA 1G7VA 1Q5MA 3LUTA 2C79A 4WSHA 2CBUA 4K8GA 4Y9PA 1FWWA 2HNHA 3TJLA 4Y6GA 1KM2A 1V02E 4K39A 1EEXA 3HIJA 1D9EA 4GVIA 3TX9A 3NSXA 4KCVA 1Q4WA 3OEXA 3DOPA 4MZ1A 1YADA 3RPTA 1VEOA 3SCQA 2VVNA 1YNPA 1EHNA 3CWNA 5IM51 1E3ZA 2OQHA 2PD5A 3URBA 5M3WA 3G77A 3GXTA 3VOIA 3TU9A 1GONA 3AALA 2E5BA 1EP1A 4INFA 4B92A 2B7PA 1CENA 3MDWA 4V27A 2O92A 2ZADA 2FGLA 3DESA 2V82A 2CLHA 2GJRA 4Z2IA 1G4PA 3VA8A 5DQPA 4B3LA 3LSBA 1DP0A 4WD0A 1PBGA 4OTKA 3FW6A 3ZMRA 3R0KA 4JTUA 4Y9NA 2G3MA 2PPGA 2VL4A 5LNVA 1ADDA 3O6CA 3VNZA 3W2NA 3WNNA 3BAYA 5TBOA 4XAFA 1QOQA 3Q2DA 2GSEA 2VGFA 3P80A 4O28A 3QV6A 4F8XA 2PDQA 3MO7A 3VKBA 3T09A 2C15A 3GBEA 3W1PA 1EXPA 1E6QM 4HA1A 4HIBA 3ITCA 5AC7A 3ONCA 1GZ1A 4PTXA 4E2DA 2X09A 4HNCA 5DO8A 3WLRA 2YBUA 3R89A 2OU4A 3EWCA 3ZLFA 2Y7DA 4C5YA 3M0KA 3UBPC 4CU7A 4NNBA 1IIGA 3I3EA 3TZFA 4MY1A 1EGVA 4I9JA 2G96A 1UR9A 1FFRA 4QE4A 1DQWA 4EACA 1XLAA 2BMBA 1OGSA 4HYVA 2O0TA 3GC2A 2QR6A 3N25A 3RR1A 4UTFA 2ZRWA 4W8BA 1DHPA 5BU6A 1XYCA 3ABQA 4A3RA 1B9BA 5BXPA 3HURA 4AZGA 1KM6A 4GG9A 3W22A 4DJDC 3ZQ9A 2GYIA 4XBSA 2DV0A 1BGGA 4ZOAA 1E1CA 1Q65A 4LJ3A 2BHUA 4E4UA 2HV5A 4I9MA 2BP1A 4MB3A 4XD6A 1W1IE 1FH7A 6TAAA 3K46A 2Y70A 4MKVA 1L6FA 4IMCA 4ZQOA 2GSJA 4YTUA 3W85A 3I4KA 4JIHA 1QFEA 3DG7A 4HK7A 3RU8X 4JDBA 4PMQA 4MDPA 3I7RA 2H8XA 3QJAA 5I0DA 4UNIA 1P43A 4JEJA 3WMCA 1LF1A 1OC6A 4ZXLA 2IUZA 3N14A 5F7UA 1UD2A 1B2YA 3WBYA 2JEQA 1O66A 4I6VA 3DFOA 4WY0F 5LNRA 1S5MA 1JQVA 5C9XA 4GIEA 3BICA 1NP2A 2OZ8A 1WAUA 4PUNA 4W5ZA 1RQBA 1V8EA 3IUDA 4WZHA 3NO3A 1LJYA 4HZ6A 1JCJA 4FX6M 3WQEA 1V3HA 3I3BA 3U3HA 4OQVA 3O3RA 1UKTA 4E4PA 4K7YA 5I3GA 2ZE3A 1DWJM 3CV2A 4ZSTA 5FEXA 3UVAA 4A3HA 4EPDC 1J0YA 1G4TA 4KCTA 3E0WA 3L4TA 1OC7A 2WKJA 4DBDA 2HZGA 4BS0A 5CZSA 1PX8A 2X0SA 1DOSA 3TQPA 2J77A 3O0KA 4HTYA 5LXEA 4LFYA 3NEVA 2J88A 4YVPA 2XVGA 3PUGA 5JH2A 4HA4A 1XLKA 4NRSA 5CJNA 2CWXA 3TUUA 4AD0A 3T0CA 1V08A 4PFMA 1A5BA 1KM1A 1EBGA 1FOBA 5G4HC 2XVLA 3U57A 2V0TA 4K68A 1M5WA 1P7TB 4HA0A 2QJIA 5AY7A 2QT3A 4GHRA 3H21A 2WMJA 2V8ZA 4A4AA 1EPXA 3OLEA 1GVOA 4NZ4A 2ZBTA 3IWPA 3WNOA 1S5TA 2XN0A 3U5UA 1E72M 2VOMA 3SCTA 1S46A 5IHRA 3TYEA 4WQ6A 4EWND 2XU2A 2EJ1A 2WCSA 4M7SA 2ESCA 1TSIA 1VQTA 1A50A 1XPGA 2DU2A 1F73A 3W7PA 1KXQA 1TA3B 3N6HA 2Z7KA 4UMCA 1OCJA 4B4FA 3O0FA 1GPWA 2BX7A 3H2NA 3BMVA 3GXNA 3CUJA 3CGTA 3QHNA 5CBJA 1AZ1A 4AW7A 2V30A 2Z1WA 4LUSB 1TRDA 2PRLA 3VPLA 2GJXB 2CLFA 2B31A 4NVTA 1KQZA 1VPQA 4NNCA 1J01A 2R82A 4WSKA 5AZ0A 2EPOA 4AHOA 4CD8A 1PTAA 1L2QA 1VC4A 1UR4A 4CQCA 5FD0A 1OGGA 3POHA 4DXVA 2ZA2A 2D2HA 1F3TA 4DWSD 1OEPA 1MDRA 1T99A 1WCGA 1ITCA 3WELA 1OFOA 5CC7A 1ZHAA 2H90A 1FA2A 1GOXA 4ZR8A 4GX9A 5XIAA 4KEVA 1QWGA 4NI8A 2OLAA 4DEFA 3BPWA 4GWEA 1XLMA 3QOMA 2VM8A 2TMDA 4DBUA 4A3YA 2PTDA 3GXMA 3QMSA 3S2LA 4AHPA 3N13A 1WDRA 4IPLA 1DIDA 5CG0A 5G1TA 3R0UA 1XSKA 3QF0A 1TG7A 3QW4B 1R5YA 4JY8A 3QY8A 3H2AA 1OFQA 4W85A 4Q4MA 4QDPA 3SQSA 5HMFA 1UWAA 3NQ6A 5JBEA