3CBWA

Crystal structure of the ydht protein from bacillus subtilis
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
336
structure length
336
Chain Sequence
b'HTVSPVNPNAQQTTKTVMNWLAHLPNRTENRVLSGAFGGYSHDTFSMAEADRIRSATGQSPAIYGCDYARGWLETANIEDSIDVSCNGDLMSYWKNGGIPQISLHLANPAFQSGHFKTPITNDQYKKILDSSTVEGKRLNAMLSKIADGLQELENQGVPVLFRPLHEMNGEWFWWGLTSYNQKDNERISLYKQLYKKIYHYMTDTRGLDHLIWVYSPDANRDFKTDFYPGASYVDIVGLDAYFQDAYSINGYDQLTALNKPFAFTEVGPQTANGSFDYSLFINAIKQKYPKTIYFLAWNDEWSAAVNKGASALYHDSWTLNKGEIWNGDSLTPIVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YdhT protein
publication title Crystal structure of the YdhT protein from Bacillus subtilis.
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 125
structure length 336
sequence length 336
chains with identical sequence B
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2008-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02156 Glyco_hydro_26 Glycosyl hydrolase family 26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3cbwA00
1GHSA 4W85A 2W4XA 4BCEA 1CENA 5JUVA 3A4WA 1CIUA 1Q6FA 1CGTA 3AMLA 5M17A 1OD0A 4CD7A 1UYQA 3VNYA 5BROA 1VBRA 1R7OA 1TFVA 3ARTA 2UY3A 5HOSA 1B9ZA 1CBGA 3ZT5A 3MANA 1W91A 4H41A 2W66A 3WY1A 4U2ZA 2VR5A 1V6YA 3VGEA 4AZ5A 8A3HA 4CKQA 5BCAA 3OG2A 4OKDA 4NZCA 1B31A 4HMEA 3VIPA 5E0CA 4Z2IA 3ARPA 4UQ9A 3A6OA 2J79A 5I2UA 4AIOA 1YQ2A 1F4AA 1W3JA 3ARXA 1ISWA 4J7RA 4TX8A 4GI8A 1G94A 2VQUA 3NYDA 3RO8A 3VDHA 3K1DA 3K8LA 4GXPA 1C3FA 5HPCA 4KRUA 3AHXA 2YBUA 1C91A 1UR2A 2GFTA 4J3SA 1BQCA 2Y8KA 4HP5A 2GK1A 2E40A 2WSKA 1UD4A 3U5YA 2EEXA 4D1JA 4JFSA 4Z2JA 1C8XA 2J74A 5ABFA 2ZUUA 5A6BD 4D6CA 3I3BA 3RDKA 2ZXDA 3THDA 4F9DA 2WHJA 2W92A 5M3WA 3K46A 2ZXBA 4PMVA 1D7FA 2FGLA 3S2CA 1JNEA 1Y7VA 1RD6A 1OCQA 3NUKA 2YA0A 1DWFM 2XVNA 1PX4A 2O9OA 1B3WA 3ARRA 4HA3A 5I0DA 3NDYA 1W9BM 2WW5A 2J7EA 3T0AA 5FIPA 2XHYA 3GBEA 1W1TA 4ACZB 1GJWA 4ATLA 1H0GA 5EB8A 3FXYA 5CJ5A 3WUEA 2BHZA 4UR9A 1DWHM 1H2JA 1KXHA 1ZBKA 4CVUA 4XUYA 1XYZA 2XSBA 3WDJA 1FOBA 4A3HA 4AISA 1OSEA 2ZUVA 4CU6A 1E3XA 3WDHA 1GOWA 4UQAA 1C8QA 2ZOXA 3AZTA 5HNNA 1I1WA 1WDQA 1QI2A 2J4GA 2BY3A 3ECQA 1CGUA 4PCSA 4PMUA 2EPMX 1A47A 1V3KA 3O2LA 4WIWA 4CGTA 2E8ZA 4HZ8A 4GZEA 4WSJA 5HDRA 3DHPA 4M56A 2Q8XA 2VT0A 4QAWA 2CPUA 3TOPA 9CGTA 1BVNP 3PZ9A 4AW7A 1NP0A 1OM0A 5CLTA 1MFVA 1KGWA 4OOZA 3PTQA 1BF2A 1NM9A 3AIRA 3NSMA 3GH7A 1F4HA 3L2MA 3WF0A 3BAYA 4HMDA 3VUPA 3OGRA 3AIBA 1J0JA 3ZIZA 1VFOA 1WAWA 4JKMA 4BF7A 4YN5A 1CXFA 2B31A 4LX4A 4W5UA 2XVGA 4GQQA 1VBUA 1FH7A 2PWHA 4L4OA 4W88A 2BHUA 5A1AA 3SCNA 1U2YA 1HNYA 1ITXA 2Z1SA 4S3KA 1TVNA 1JDCA 2WYSA 4EE9A 1LWJA 4CD6A 1W9DM 1BHGA 1JFXA 1FFQA 5GPRA 3CLWA 4UOQA 2PBGA 4UNIA 1UD5A 3AXHA 3TTOA 3ARSA 5JBEA 2XM1A 1C90A 2WMIA 1FA2A 3WL1A 1WDRA 2WLZA 1QW8A 3LPOA 4JFWA 1CXIA 3AHTA 2AAAA 4H2CA 3UCQA 1X1NA 5A2AA 3GXIA 3PZQA 3SUVA 2WVUA 4ZXOA 5GNYA 1WPCA 4J3UA 1VFFA 2W91A 2VRKA 1CGXA 2VZOA 3OLGA 1W9XA 1UQYA 1XHGA 2YBTA 2J7HA 3BAKA 5A8OA 1Z32X 2VX5A 3GBDA 3OLIA 3WL0A 2XPKA 2DSKA 4JIEA 2OWCA 3OLEA 1XV8A 1MFUA 4P7NA 1GUVA 1GOIA 1JZ2A 3BMWA 1KGUA 3VGFA 1PIFA 3G6MA 1BYCA 1K9EA 1QBBA 3SCQA 3AS3A 5ABEA 4AYSA 1GZJA 2O9TA 4P7OA 4TOQA 4NSBA 5BXRA 3A47A 2D3LA 2UY4A 1H3GA 5DF0A 4M1RA 2DEPA 1ISYA 4ACZA 4HOWA 1QPKA 2QHAA 5CPTA 3CMJA 1E5NA 2XM2A 3VIFA 2YLAA 2CERA 4U5KA 4V27A 2OLHA 1UD2A 4FK9A 2C8NA 2WMHA 1WB0A 4MB1A 3WUFA 3WNKA 1ITCA 1VJZA 2WHLA 1BYBA 4UFMA 4MNKA 2WSPA 3CMGA 4EAMA 1TMQA 4B3KA 1B30A 5AYBA 1E0VA 2VTFA 3MMWA 1EH9A 2ZWYA 4GZJA 4HZ6A 2YL8A 3B9AA 3VIHA 3CUHA 4B16A 5LA0A 1SR0A 3AICA 1OWQA 4FF5A 3BLPX 4MB5A 3DHUA 3RJYA 4BQ5A 4D6HA 1BG9A 1OT1A 4A3YA 1IV8A 2ZWZA 4C7DA 4C7GA 3CUJA 1MVYA 1QBAA 3CHCA 1V0MA 2EPKX 2X0HA 3K8KA 5EFFA 3UR7A 3AROA 5F7UA 3VGDA 2UWFA 2VRQA 2GDVA 1TVPA 2G41A 4PTMA 3RM4A 4AEFA 3RIKA 1DEDA 1OT2A 4CCDA 1UZ4A 1WO2A 2J7CA 3WFZA 4UFIA 3NSNA 3AIUA 4IM4A 1BTCA 1GOKA 4MNLA 2FH8A 1P6WA 1GCYA 3VO0A 1WP6A 3WD1A 1Q6CA 3WEMA 3M46A 3WH7A 1C8YA 4W7VA 4YHGA 3SIMA 3AOFA 1JZ5A 5TD4A 2W61A 5FKYA 4DUWA 1KCLA 2VQTA 1J0YA 1XCWA 1EHNA 2F8QA 1GQLA 1K9DA 4JFVA 4OBRA 3S6TA 1KR0A 1O7AA 3OBAA 3ZOAA 2YL6A 3L4XA 4J3VA 4JL2A 1BLIA 1E9LA 5DFAA 2DSUA 2VUYA 4M81A 1OGSA 5LA1A 1KXTA 4LPCA 3AJ7A 2XFRA 4AIUA 2OSYA 2J7BA 2E3ZA 3AS0A 1LL4A 2X8RA 2E9LA 1KXQA 2EPOA 2JIEA 4CCCA 1V3MA 5FL1A 2GJRA 5ABGA 1JAKA 3WMBA 5CGTA 2UY5A 4ATWA 1FP9A 5A3HA 4QLLA 4DM2A 1EO7A 4U33A 4DM1A 3N1AA 2BY2A 1JD7A 1NOFA 3BCFA 3WD2A 4NRSA 1OINA 3NIYA 1TG7A 4WF7A 4ZXLA 1FHDA 5EBAA 1SMDA 2NT1A 2ZIDA 1J9YA 3O9NA 4BQ3A 3AZSA 3W6MA 2V3GA 4AZGA 2VVSA 1B3XA 3UEQA 2VCBA 3EDJA 5HPOA 2RGMA 1PX3A 1UKTA 3N11A 7A3HA 1SMAA 4U31A 2GUYA 1V0KA 1NWRA 3N13A 3DYPA 3L4VA 1XC6A 2QPUA 3ZJKA 4UCFA 3PN8A 1BG4A 3AHZA 2BXZA 4X0VA 3WNLA 2XWDA 4HPHA 5ABHA 3F5LA 2VNCA 1HJUA 2E8YA 4PRWA 4MB4A 1VAHA 1ZJBA 3WMSA 3RILA 3MUZ1 1EDQA 1LLOA 4ML4A 3BAJA 3RJXA 2DQXA 3HMCA 1OIFA 2V38A 4P7LA 4J28A 1QHOA 2WC4A 2ZUSA 1VFMA 2J25A 4QCFA 3KL0A 4PTVA 3A4XA 1V08A 2VO5A 3N12A 4JCLA 3W28A 1BAGA 2PWEA 2CHNA 1IZKA 1YHTA 2ZXQA 1L8NA 2D0HA 3FW6A 4TVDA 2JEPA 2G3IA 2J7FA 2EPLX 3BXWA 3KL5A 3CZKA 1E6XM 3M6DA 2D24A 3VILA 1OGBA 1UH4A 4FLQA 4BQ4A 1HJVA 5FOOA 3ZJ7A 3CUGA 1CLXA 3VIJA 3WKZA 3UG5A 1W3HA 1UR0A 1TCMA 1BVZA 4W84A 2J8FA 1E4MM 1JNDA 4PTWA 1M01A 4J3TA 3ALFA 1JF6A 1CLVA 3BSHA 3IJ8A 1UZ1A 2WLYA 2W63A 2WMFA 1R86A 1H5VA 2Z1KA 3GXDA 3PBGA 3ZQ9A 1PX8A 1HKKA 3WQ5A 1ZS2A 1E4IA 4LYQA 1GNXA 2WBGA 3POCA 1PZ2A 5FL0A 3AXIA 4ZE4A 2X2YA 1ISZA 1Q6EA 5A8NA 5I78A 1WZKA 2YDSA 1ISVA 4Q7NA 2AMGA 2WVVA 4HOXA 3EMCA 1UR8A 3ZJ8A 4AD1A 2PC8A 4D71A 4W89A 3WNOA 5AYIA 2V3EA 3VMPA 2BNJA 1UOKA 3HJEA 5E6YA 1JZ4A 1E6PA 2QMJA 1MQQA 4JAWA 3ZR5A 3FY1A 1JXKA 2ZX7A 2DT1A 1JGIA 4HA1A 4IPNB 2WZIA 2Y8VA 2Y5EA 1GPFA 1UD3A 5CSUA 4BA0A 3K4DA 4V28A 3W27A 1W1YA 4W7WA 1B1YA 3TP4A 4AC1X 1DWGM 1ZB5A 1B3VA 1MW3A 3EDDA 2WMKA 4CU7A 2GJPA 4AXNA 4DWSA 3KE0A 3WNPA 1G01A 1TZ7A 3VKKA 4GZIA 1K6AA 3THCA 3RMEA 1G5AA 1EDGA 1RP8A 2Y24A 4MJ2A 2DDXA 5A6JA 4GO8A 4PTXA 3ZSTA 3QOKA 1JYWA 3WD3A 1JZ7A 3WD4A 3W26A 5BXPA 2O9RA 1EXPA 2GJXB 2ZUNA 3MMUA 5FD0A 3OZPA 2CKRA 2W67A 1R87A 4W86A 1J0HA 4MB3A 1VEOA 2C7FA 3BMVA 4V2XA 3WQVA 2V3FA 4AZ6A 1GOQA 1HJQA 3VD3A 4HMCA 3ARVA 3TTSA 2WBKA 4W8LA 3WDQA 3T2QA 4AEEA 3CO4A 4UQBA 2ZUMA 3UERA 3WELA 1XCXA 2EBNA 4WSKA 3GXFA 3W6LA 1LWHA 2YOCA 4J27A 1HIZA 4UFJA 1E72M 5I77A 1UH3A 2VZVA 4JZ5A 3VTRA 1UKPA 5DEZA 3PZIA 1QI5A 2G3NA 4JL1A 1OBAA 3EDKA 4AD4A 4KRTA 1V02A 3N9KA 3EDEA 4H04A 1EGZA 1NARA 3M07A 5E70A 4TX6A 2DT0A 3T08A 4HU0A 3PZOA 3WDRA 2ZX9A 3KZSA 3CIVA 4FLRA 4TTGA 1W32A 1HL8A 1Q6GA 3HU7A 1VRXA 1ESWA 3AQUA 5IFPA 1J0ZA 1B2YA 1JDAA 5A8PA 1AVAA 1CWYA 1BSIA 4D6DA 4HTYA 3ZM8A 4J3WA 2J77A 1B3YA 1G0CA 4GI9A 2CHOA 1QI4A 1W1PA 3FHAA 3MMDA 1WNOA 1UR4A 1CXEA 3ZMRA 5CLWA 1HVQA 2YJQA 5AC4A 2BVDA 2QPSA 1CNVA 1QHPA 1CZ1A 2CKSA 3CHEA 4XX6A 4JKKA 2F61A 2G8ZA 3WF1A 2XVPA 2X0YA 4QP0A 1V0LA 4XZBA 3WSUA 4M8UA 3DYMA 2VCCA 5CQ1A 3CZLA 2CBUA 2CETA 3MO4A 4AD5A 1VEPA 1EOMA 1JFHA 1DP0A 3AIVA 5I3DA 3GDBA 1JYNA 3W37A 3T09A 2WB5A 1J18A 3SCRA 2ZUWA 1E71M 5BXSA 1V3LA 3RCNA 2XGIA 5D8WA 4W93A 3W4RA 2VCAA 4QFUA 2AOSA 1K9TA 2E9MA 3CHDA 4HU8A 1C93A 1DHKA 2DIEA 2A3AA 1E0WA 3LMYA 3DECA 4LXFA 4F66A 2QV4A 3UETA 2BS9A 4CD5A 4MAVA 2DT2A 2BFGA 4UQEA 8CGTA 1IT0A 2GJXA 2OYLA 2CBIA 4U5IA 3L2LA 1DWJM 1KBKA 1J10A 3ZO9A 2PB1A 3FAXA 1UD6A 1UKQA 3GNPA 1MXGA 3CGTA 4W8AA 4AZBA 3MUAA 3SCTA 1XSJA 1H11A 1HX0A 1UHVA 1NWTA 5A6MA 4OUEA 2UY2A 4H7VA 4D6FA 5GQBA 4KMQA 3PZVA 1HT6A 3B8SA 5JBDA 2JE8A 1JD9A 3PZGA 2VVNA 1LJYA 3W0KA 3VX1A 1W9UA 2D22A 1UKSA 4OBSA 4AD2A 1QNRA 3BAIA 4CUCA 3CUIA 4PUDA 1E40A 1NWSA 1R8LA 4PUEA 3IJ7A 2DSZA 3OB8A 2QMKA 3W25A 1ODZA 2OYKA 3VVGA 4CU8A 1UUQA 4M82A 1GQJA 1LG2A 1G9HA 4ZE5A 4AZCB 2PWDA 3QHNA 1ZU8A 4CN6A 1W2PA 2X05A 4WLCA 5AC5A 2J47A 4WKHA 5KEZA 2VZUA 1JG9A 1LL6A 1KWKA 4M80A 3OGSA 4BZYA 1BGGA 1JF5A 3QHMA 2J7GA 2XTKA 1RPKA 3IANA 5KZ6A 1V03A 5GNZA 1K9FA 3UG4A 1PAMA 4RE3A 4RE4A 3MU7A 4PMOA 1U30A 5JBFA 4OZOA 1US2A 3VGGA 1XH0A 1W2VA 3SCUA 3VINA 5A6SA 5ECUA 3GH5A 1GW1A 2CYGA 2VX4A 1UWQA 4OIFA 4FMVA 3ARYA 2EQDA 2NSXA 1CXKA 4MNJA 3W82A 1JXJA 4Y7EA 3UR8A 4LQ1A 3PZTA 1E6ZA 1PZ3A 4E4PA 1E73M 3DYOA 1UR1A 3ZT7A 3CZGA 4KGJA 4KGLA 2YL9A 4P7QA 2WCAA 3W81A 4E8DA 1J12A 4D1IA 4X0NA 1CXHA 3UG3A 5A6KA 1CEOA 5LYRA 3O6AA 3L4TA 1E5JA 4KH2A 4P8VA 2YA2A 3AIQA 2XVLA 5DT5A 3T0BA 4D6IA 3SUSA 2YA1A 1JL8A 3WQ6A 2WCSA 2WKLA 4JFTA 4ZENA 2F2HA 3WF4A 4MADA 1WZAA 1PBGA 2G3JA 5I79A 3RM9A 1GJUA 1HF6A 3WIJA 1VF8A 1HJWA 1I75A 2EPNA 3MS8A 4MJ4A 2J75A 4ZFMA 3WQ8A 5I23A 3QHOA 2BXYA 4HOZA 4UFLA 4U3AA 1KCKA 1TA3B 2G4FA 1E6QM 3FNDA 6TAAA 3CBWA 2ZX6A 1US3A 4S3JA 3EMZA 3L4WA 3W53A 3HN3A 3VIKA 1CTNA 1WDPA 2MANA 1OGGA 2CNCA 2BY0A 3SCOA 2DIJA 3SUWA 1J01A 1MWOA 4Z2KA 1JIBA 5DO8A 2BY1A 1UWSA 3OA5A 3WH6A 5A2BA 4UTFA 3I3EA 2W5FA 1EHAA 2ZXAA 3WNMA 2XFFA 4AY1A 1H4PA 5BYWA 1W3KA 2JF7A 3GYCA 2BV9A 1HL9A 2GK1B 5A8MA 3WUBA 3WDPP 3CZJA 4AZCA 1QVBA 1WDSA 3BAXA 1GORA 3AHYA 1MXDA 2V5CA 2QLYA 3VD7A 4QDMA 3G6LA 3AZRA 1QI0A 1LQ0A 1C7SA 4HPGA 4PEEA 3AXXA 4N0RA 4IISA 1M03A 4W5ZA 4B3LA 2FHFA 3T2PA 1KQYA 2JFEX 3BCDA 1JYXA 2CEQA 2WZEA 1GQKA 1NQ6A 2OWWA 2FHCA 3GH4A 4RL3A 3WH8A 5BXTA 4URIA 3SUUA 3OGVA 2BHYA 3AS2A 2D3NA 4A4AA 1FHLA 1H09A 3VDCA 3WF3A 3ZSSA 4DWSD 1QNOA 2GDUA 2J62A 2VI0A 4R5EA 2W62A 1E6SM 1HXJA 1WE5A 4UOZA 2WXDM 2XGBA 4FLOA 2X09A 1JYVA 1HKIA 2VJXA 1M04A 1FH9A 2DGAA 4NF7A 2O9PA 4MPKA 5E6ZA 3CZEA 1QI3A 1HKMA 1W9PA 3E1F1 3WUGA 3FN9A 1X6LA 4AD3A 3AYSA 4YHEA 1V0NA 3GM8A 2XJ7A 1BYDA 2FH6A 3F4VA 3VM5A 3N04A 1XD0A 4ATDA 5IFTA 3SURA 2VZTA 2Y4SA 3K8MA 1VFUA 5DMYA 4ACYA 3AYRA 1E15A 4TUFA 2V3DA 5D9PA 2IXVA 1GONA 1M7XA 1E56A 5BWFA 5I6SA 2WZHA 4OOUA 1TR1A 5BRPA 1JI2A 1LF1A 2VL4A 4E8CA 4QLJA 3PHAA 1O6IA 3VDAA 4U3CA 3RPMA 1RP9A 2WANA 1UWTA 1CGYA 4PYSA 2YDRA 1QOXA 3JUGA 2CITA 4PN2A 2EO7A 1C92A 2DH3A 3M7SA 2D1ZA 3U57A 5A2CA 4AWEA 5A6LA 3VIIA 1TA3A 4IUGA 2ESCA 1UG6A 4PSPA 2OSXA 3AHVA 1JAEA 1VJSA 2WMIB 3T2OA 4GI6A 1QNQA 1E55A 1MW2A 1J0KA 1V3IA 3IJ9A 3NJ3A 3EBVA 4MNMA 4TXEA 4F9JA 3W29A 3EYPA 4W8BA 4PMYA 3WBEA 4GPNA 1DTUA 4LGXA 1X6NA 3VIMA 2TAAA 3TTYA 1ZBCA 2XVKA 1C7TA 1XGZA 3SCWA 2HVMA 2BVYA 1UWRA 1SYTA 3VU2A 2D0FA 5LA2A 3OIHA 4P8WA 4P8UA 2OSWA 2CCRA 2YDQA 1FH8A 1UD8A 1WKYA 1MQPA 2V5DA 1EOKA 4U2YA 3U7BA 1BPLB 3WNNA 1GVYA 4AMCA 2A3BA 2WAGA 4K68A 4GQRA 1XSIA 4PMXA 3AIEA 2BVTA 1M53A 1HKJA 3PZNA 4UQCA 4LYRA 5EFDA 2XG9A 1JI1A 3ZJ6A 1QHZA 4EANA 1PIGA 2DSVA 5CXPA 5A8QA 1VEMA 1QNPA 3WD0A 1PPIA 1WZMA 1EIBA 3QOMA 4JHOA 4WK9A 3ZT6A 4PMQA 2WMJA 5M5DA 4JFUA 3BH4A 2ZUTA 4Q22A 2WK2A 3AMKA 2G3MA 1KR1A 1E3ZA 3A4AA 1UWIA 3N17A 3J7HA 4PBGA 4D6EA 2IXUA 1MQRA 3GNOA 3MV01 3U7VA 1KXVA 3QGVA 1EA9C 1HN1A 3WFLA 4PMZA 1VB9A 4DUXA 3WH9A 4GO9A 3POHA 2FGZA 1W1VA 3ARQA 4PMDA 2GSJA 4OJYA 2VURA 3W24A 1KGXA 6A3HA 4F79A 2YLLA 3BC9A 2E4TA 1S46A 1CPUA 3PZUA 5A6BA 1D2KA 5IXEA 2X1IA 3TA9A 3N15A 4MTVA 3AI0A 4UZSA 2WKGA 1CECA 2QF8A 4NRRA 3KEHA 4D6JA 2WHMA 3MUIA 4B15A 3VD4A 3SCVA 2DSWA 1LG1A 1HJXA 1KWGA 1VENA 4GIAA 7TAAA 3MKKA 2VC9A 4UFKA 1Q4NX 2YKKA 4N42A 1DWIM 3MV11 3WN6A 5IHSA 4NI3A 2A3EA 1E6NA 2WHKA 3VM7A 1ZBVA 5CSYA 4UZUA 2VRJA 3F5KA 1CGWA 3BAWA 3N18A 4DWSC 1OD8A 4Z2HA 2FDMA 2A3CA 4RE2A 4J3XA 1ISXA 1NOUA 2J8GA 2NW0A 4H8UA 1A3HA 4Z2LA 2HISA 3EDFA 4UOJA 2JALA 2VR4A 3WF2A 1ODUA 1KBBA 1V6XA 4MAZA 2PWFA 3VGHA 4MDPA 2WVSA 1PJ9A 4XV0A 3KWXA 1KFWA 1B90A 2ZICA 2ZX8A 5CZKA 5C70A 4QLKA 3A3HA 3VDBA 2OYMA 3AMCA 1JDDA 2WC3A 1J11A 3L4UA 2XYLA 1U33A 4Z2GA 5D9MA 1CDGA 1B0IA 3CHFA 1XSKA 3II1A 2ZX5A 4WJXA 1GOMA 4JKLA 5JIPA 3VGBA 1AQ0A 1I1XA 3APGA 3VPLA 1E4NA 3L4YA 1HJSA 1H49A 3D3AA 2YIHA 2WCGA 2ZE0A 1TE1A 1H41A 1RH9A 1OB0A 3NCOA 2D23A 1XYFA 5JIWA 4B9YA 5GNXA 4F8XA 2O92A 3CUFA 1XD1A 1ZBWA 1E6RA 3VMOA 1EQPA 3VX0A 3CTTA 1NH6A 3PZMA 1H1NA 2DT3A 2VX6A 1TUXA 5CPQA 2PWGA 5CPSA 2J7DA 4ZEPA 4TTUA 1XH1A 3FHQA 1V6WA 1PEZA 2FHBA 4BQ2A 1W3LA 4WKFA 1IZJA 4EK7A 3K4AA 4KWUA 3AMDA 4JCMA 1XH2A 2WMGA 5D9OA 2A3HA 1VIWA 4CCEA 4EKJA 2WWCA 1ECEA 1UR9A 3AMGA 1UH2A 5BRQA 3WH5A 4AZ7A 5C71A 1GVIA 3NSXA 2DH2A 3VOCA 2PF0A 3SCSA 2WWDA 3AS1A 2WPGA 4UFHA 1AQHA 3TONA 4AD0A 4P8XA 3WQ4A 4R27A 3WENA 3MUY1 2JEQA 1L0PA 1ZJAA 3PTKA 1D3CA 5DT7A 5HBFA 5FCZA 4CN1A 1ZL1A 3VMNA 5CG0A 2XUCA 4TVUA 1E4LA 3DC0A 2CESA 2D2OA 3GXMA 3LPFA 1AQMA 5HXMA 4PMRA 4UQDA 3WQWA 1MW1A 2JIWA 1E1EA 1E0XA 3GTNA 1EQCA 3BLKA 2XFYA 3WMCA 1NOWA 2XIIA 5D8ZA 1FFRA 5A6AA 3VD5A 6CGTA 1OIMA 2EXOA 3SUTA 3BSGA 1J0IA 4GINA 1CXLA 4FLSA 3GNRA 3IAQA 2YL5A 2C0HA 1EDTA 1V3JA 4B9ZA 1UA3A 3ARUA 5IHRA 2EJ1A 3ARZA 1R85A 2WM0A 2CIPA 1GOOA 2WC7A 3UESA 1WZLA 5E09A 3L4ZA 1Q6DA 4C7FA 2DPEA 4CN4A 4DUVA 1JZ8A 1KQZA 1G1YA 5D4YA 2NT0A 2WVVB 1DWAM 3BGAA 2CBVA 4MDOA 3D5HA 1H0IA 1EO5A 3CH9A 5A94A 4CD8A 4CD4A 3W38A 1N82A 2GVYA 1XRVA 3RM8A 5AY7A 4AZHA 3IAPA 4D72A 4YPJA 5A95A 1BFNA 1NWUA 2D0GA 4P7RA 5EMYA 3I3DA 1E1FA 5IDIA 4GKLA 2Y2WA 1WCGA 2E0PA 3AFBA 4QCEA 3IK2A 4IPLA 2PI6A 4E2OA 4M29A 2XWEA 1W9VA 4DWSB 3WBAA 2VOTA 3VIOA 1MW0A 3QR3A 1MYRA 5I24A 1E70M 3PTMA 4JHZA 4WKAA 3CPUA 2IUZA 3WEZA 3FAWA 5C8BB 5ABFB 5M03A 2E9BA 1JZ3A 1QNSA 3AISA 2JF6A 3T0DA 4AZIA 5E9AA 3NDZA 4PCTA 4L4PA 3F5JA 4X9YA 4AIEA 1NP2A 5D9NA 3OLDA 1GQIA 1V6VA 2XSAA 3ARWA 2PBOA 2OWXA 5I5RA 3MSDA 1HP5A 4H8VA 2VMFA 3EMQA 3GZAA 1UA7A 3OZOA 4PSRA 1CYGA 3WDIA 3U5UA 2VZSA 3CZ8A 5CGMA 1HVXA 1E43A 1R7AA 4PMNA 3ZR6A 2XIBA 3TTQA 5E0FA 3SCPA 2CXGA 2VX7A 1QW9A 2J78A 4W7UA 3LPGA 3VIGA 2WVTA 4HZ7A 1UWUA 4HA4A 4LYPA 1GHRA 3KL3A 1AMYA 1HP4A 1V6UA 7CGTA 1CGVA 2D20A 3AIWA 2CBJA 4W87A 4H8HA 1V3HA 3LPPA 1SFSA 1UQZA 4BS0A 3VD9A 5A69A 4XZWA 1FP8A 1BYAA 1JZ6A 1KB3A 3B9EA 2WNWA 3SEPA 3ALGA 1UKOA 1BGAA 2RGLA 4M24A 4CVWA 4D6GA 1LL7A 3VNZA 3B9DA 3MSGA 1B3ZA 4XB3A 1V02E 3WEOA 4TVCA
chains in the Genus database with same CATH superfamily
1GHSA 1FWRA 2W4XA 1CIUA 3AMLA 2YB1A 1Z6KA 1XUUA 1G67A 4JY8A 5BROA 2XH4A 3E0WA 2UY3A 3MANA 4K1GA 4EXAA 3WY1A 2VR5A 3KDOA 3DFHA 4XKYA 4EPDC 1RVKA 4HMEA 2QUNA 3ARPA 4LB4A 2A7PA 3A6OA 2PEVA 3USZA 1YQ2A 1W3JA 1A5KC 3ARXA 3ES7A 1ISWA 2HTMA 3WQCA 1I9CB 4ZO6A 3EB3A 3E49A 3LEPA 2Y85A 2DJLA 3UYCA 4O1CA 3S5OA 4WOZA 1AUSL 2GFTA 2L5HA 2PD9A 4J35A 3DZ1A 2GK1A 2WSKA 3U5YA 3FGCB 4D1JA 1XLMA 1UROA 3BURA 2J74A 1OFDA 5A6BD 3RDKA 1NAL1 2QZRA 4GYFA 1Q4WA 4I8YA 2WHJA 5M3WA 2ISWA 4XAFA 1D7FA 2FGLA 1JNEA 5K4XA 3AWNA 4Q4QA 1OCQA 3UBPC 2OZ3A 2F6XA 2X16A 2A85A 3ZYZA 1TPEA 3KHJA 3TW7A 3PBWA 3SY8A 3CWNA 3GC5A 4UMCA 4GWEA 2WW5A 4ZR8A 2J7EA 3T0AA 3QY6A 5FIPA 1GJWA 4AVFA 4BEQA 2VYOA 2NX1A 4UR9A 1THFD 1ZBKA 4CVUA 4XUYA 4C1NA 5MHBA 3H2MA 4AISA 4Y2WA 2DUZA 4Z1BA 1GOWA 3DEQA 1RAKA 2ZOXA 3AZTA 3UXAA 1VD6A 1GVOA 2BY3A 3A5FA 1TPH1 4PCSA 3W2KA 4ZQCA 4CGTA 2G50A 3MWCA 2Q8XA 3URNA 1W5QA 3LRMA 2CPUA 3W00A 1OM0A 5CLTA 1MFVA 1S2WA 1GTHA 3PTQA 1BF2A 2EF9A 1YRRA 5D05A 3AIRA 3GZ3A 1EGMA 3GH7A 1J93A 3WF0A 1PIIA 3QM3A 3CLMA 1Q6LA 4HNNA 3WJWA 3W88A 4IMAA 1CXFA 4D8ZA 1GGOA 4ZB2A 1XPGA 2JQXA 3IJQA 4GKTA 1GWJA 3P6LA 3A13A 4GQQA 2P76A 4L4OA 3R13A 1KFBA 3PVFA 4W88A 4E4UA 2QQ6A 1IIHA 2BHUA 5A1AA 2YCIX 4MY1A 1ITXA 4U4MA 4DJDA 4S3KA 3G1VA 4E4FA 3LLFA 2WNQA 2GL5A 1SVDA 2VEFA 1W17A 1K3UA 3IGHX 1BHGA 1ZY9A 4UOQA 5HQEA 2PZ0A 1C9DA 2XM1A 1EJTC 4WDTA 1FCUA 1ZQ5A 4GUGA 3MCNA 1SSGA 1WKDA 4JFWA 2EKCA 3E2QA 2E6YA 3UWEA 5A2AA 2Z0IA 2CLEA 3SUVA 2YR1A 2WVUA 3IARA 3RGTA 1ECQA 1CGXA 3OLGA 1K8ZA 1S5MA 5FF3A 4H3DA 1L2QA 2YBTA 5A8OA 3N2XA 4GIYA 3CL6A 2DSKA 3UJSA 1XV8A 3AO0A 4KFOA 4IXHA 4O57A 1MFUA 3K2GA 1I0DA 4IL2A 4AY8A 3VDGA 1MNZA 1P0KA 3MY9A 5ABEA 4AYSA 2PGFA 1HTIA 4P7OA 4TOQA 4AVNA 5BXRA 1Y65A 4DXKA 3RPTA 5SWUA 2UY4A 3V35A 5DF0A 1M7OA 3C52A 2DEPA 3LZ3A 3KTSA 4GNKB 1OCNA 4HOWA 4BY3A 4O1BA 1DIOA 1QPKA 2WOQA 3WX7A 4NKCA 3ZR4A 1E5NA 4V27A 2OLHA 1UD2A 4FXJA 4FK9A 2C8NA 1WB0A 3HURA 3DFTA 4KESA 1ITCA 1LBLA 4UFMA 3CMGA 3OP2A 1XRTA 2YCLA 3MMWA 5FA5A 3QZEA 2HXTA 2CWNA 2IMRA 1F73A 1AW1A 2YCJA 4Z0SA 3M0JA 3AICA 1TWWA 1XKYA 4MB5A 1JPDX 2OX1A 3RJYA 4E6MA 2QPXA 4RV3A 1IV8A 3HPFA 4UTMA 2B4GA 1S2AA 2H90A 3CUJA 3LBCA 3DH7A 3W2LA 3UR7A 2QJJA 1OK6A 2VRQA 3GU1A 2GDVA 2Y7GA 4PTMA 3HGJA 1DEDA 4QITA 4FNSA 3GDMA 5TIMA 2GOKA 4IM4A 2FH8A 2XIMA 3SRHA 4EWJA 4N7QA 2BG5A 3WD1A 1LWIA 2OODA 3WH7A 1C8YA 3OTRA 3VNKA 5D30A 3AOFA 3QC0A 1F3XA 1EXBA 2QIIA 1L9WA 1XCWA 3LTPA 1VBJA 3H4WA 4DXXA 2GJLA 2V67A 2OELA 3OBAA 4JIHA 2Q6ZA 3DG3A 3I6EA 3W75A 4O12A 1FHUA 4RX0A 3L4XA 3PPFA 1SW0A 3CQIA 1PVNA 5LHFA 3NQDA 5DFAA 2NQ5A 1OGSA 4XSMA 2WJDA 4NU7A 4LPCA 1YLVA 2VELA 1S38A 4AIUA 3RAOA 3S1WA 2E3ZA 3AS0A 1LL4A 1KXQA 2JIEA 3LI0A 4L6DA 3QKZA 5HJLA 5ABGA 4MIMA 5HWMA 2AL2B 3CUXA 6REQB 4ZVJA 3WMBA 2UY5A 4ICMA 3SRFA 5HR7A 4ZOBA 2I7GA 1ICPA 4QLLA 4O1EA 5CC3A 4U33A 1XBXA 1NOFA 2NVCA 1DPMA 2GGIA 4NRSA 3Q37A 2F6UA 3CV2A 3N2BA 1A50A 2Z4GA 1FHDA 3TNOA 3RNDA 3EXSA 1PDYA 3NZPA 4S2BA 2HE5A 5HWJA 7A3HA 3N11A 1SMAA 4YL2A 2GUYA 1V0KA 3NNTA 1NWRA 3N13A 4XD6A 3DYPA 3L4VA 1REQB 4UCFA 3CC1A 4JTAA 1BG4A 1WA3A 4U10A 3KRZA 2O0TA 3KLLA 3S46A 3I7RA 3F5LA 4AUBA 4QE5A 2PWUA 4WSHA 4MB4A 1VAHA 2PTDA 3WMSA 3RILA 1EDQA 3OHIA 1WOAA 2V38A 2ZBTA 3E3HA 3SDOA 4UUIA 4J28A 2QKFA 2FVLA 1U1HA 2ZUSA 3RMJA 3G8EA 3KL0A 3PUEA 7REQB 3W7HA 1FWHC 2QYGA 3N12A 4DZIA 3TEVA 3MSRA 2YCKX 2ZXQA 2BZNA 3KL5A 3BK0A 4ILSA 3W73A 1K7XA 3AAMA 1SZGA 3APYA 2GSHA 3LHUA 2I9EA 3H7UA 1MUMA 4IH3A 3UG5A 1TCMA 5KETA 4PTDA 4PTWA 8XIAA 3V36A 1JCTA 3CS2A 4FZIA 1YXYA 2HZGA 1GEQA 1FCVA 3IJ8A 4HCLA 2PTZA 4EWND 2WLYA 2WMFA 1GG1A 1X39A 1GYNA 3M5ZA 1XP3A 1XYAA 5C0QA 1SPQA 2F9RA 3LRKA 3ZQ9A 1PX8A 3LU2A 4P5UA 3EX2A 3W86A 4LCRA 2PDCA 3H2NA 2WBGA 3POCA 4ZE4A 1R2TA 3HG4A 3ITGA 4LY8A 5I78A 4M3PA 5U4NA 4TIMA 5LXEA 2ZKMX 1ISVA 4N6EA 2AMGA 4MGGA 4I7VA 4XQ6A 3W72A 3KFTA 4HPNA 3EMCA 1UR3M 2PC8A 2XZ7A 3WNOA 5AYIA 3VMPA 4DI8A 1NFBA 1UOKA 4I8DA 1JZ4A 1E6PA 4JAWA 5I02A 3THAA 3N2CA 3MZ2A 2DT1A 4GISA 5EKYA 1GPFA 3IPWA 1UD3A 3DGRA 2C3ZA 1JPKA 3BMXA 1LCOA 3K4DA 3TSMA 4ZO8A 4FA3A 4W7WA 3TC3A 2PGWA 3TP4A 1DWGM 1ZB5A 1B3VA 3NTYA 3EDDA 2WMKA 4CU7A 2ACUA 4QSFA 5G5IA 2HV5A 3EXRA 1R9YA 2POTA 4I9AA 4GZIA 3TW6A 3W1MA 4F0HA 3WLIA 3RMEA 4DZAA 1EDGA 2Y24A 2DDXA 3LD5A 3NO3A 4GO8A 3A9IA 3ZSTA 4HB7A 2ASHA 3ZZ1A 3V0TA 3MMUA 3S9YA 3L23A 1ADDA 4XAYA 4YYCA 2CKRA 2W67A 1R87A 4IQJA 1SR9A 4LC6A 3VNJA 2ATMA 4RZ4A 2V3FA 3W7RA 1GOQA 3VD3A 3ARVA 2WBKA 3MCMA 3WDQA 3QPEA 4AEEA 5B80A 2GPTA 1Q6QA 2V0TA 3EB2A 1B5TA 1L6FA 3BTNA 5HK4A 4YTUA 3ANYA 1J2WA 3PBMA 2ICSA 4IICA 1BVWA 1FRBA 5F1VA 1LYXA 5C54A 2PZNA 4JZ5A 1MEIA 4L4MA 1UKPA 4JL1A 2PTXA 5KINA 2ZZ3A 4UMAA 1NARA 4HU4A 3L0KA 2DT0A 3FKKA 1EEPA 4HU0A 4UCGA 3CIVA 4QIUA 4EX4A 1XBYA 3DG7A 4TTGA 4RLIA 1HL8A 1Q6GA 3HU7A 3AQUA 1J0ZA 3CWHA 4IMGA 3LSBA 1VJIA 1CWYA 3C2OA 2Q8LA 4R7JA 4NASA 4J3WA 1G0CA 4HSHA 4GI9A 1W1PA 2J6XA 3L0NA 1YDYA 2DW7A 4AWTA 4JBRA 1TIWA 1HVQA 5AC4A 2BVDA 3QR1A 2E1DA 4XBJA 3T07A 3HFTA 4JKKA 4IG2A 2E09A 4JX4A 1V0LA 2IPWA 4ICNA 4FIQA 2CETA 3MO4A 4AD5A 3TLQA 5FAJA 3V7PA 1VEPA 3VOFA 1EOMA 4A29A 1HGWA 1F05A 4GYPC 3LSCA 1Q6RA 4L9YA 4AWUA 3GFZA 3Q58A 1J18A 4GVFA 2IPFA 3R43A 3W4RA 2AOSA 1K9TA 2E9MA 1J5TA 4DLFA 2DIEA 1DHKA 1TB3A 3T1GA 2QV4A 2BS9A 3PBUA 3FYPA 4FIRA 2DT2A 2BFGA 3L66A 4UQEA 1IT7A 2KZHA 4U5IA 3WBXA 3RXZA 4RDWA 1KBKA 1J10A 5EU9A 3VOHA 5FACA 4M0XA 3HM7A 4GE8A 3OVRA 4W8AA 2NV1A 1UPMB 1XSJA 3W02A 1H11A 1UHVA 2ATSA 5A5WA 1L6YA 3UWYA 5CAHA 4WXZA 4KMQA 3VC5A 3FXGA 4QTGA 1QR7A 4HNOA 1JD9A 4UIOA 3PZGA 2VVNA 1LJYA 3N14A 1Q8AA 2C79A 1W9UA 2V2HA 1UKSA 3THUA 5C2CA 4AD2A 1PKLA 3M0LA 4PUDA 4IPJA 2P53A 3HB9A 1NWSA 3IJ7A 2DSZA 2QMKA 3JW7A 3W25A 3REQB 2OYKA 3S5ZA 1LUCA 3W1QA 3CJPA 4C6CA 2IW0A 2DUAA 3N4FA 3GXPA 1G9HA 5I7GA 3TU9A 1ZU8A 1A5AA 3DI0A 1DQUA 2OVLA 4CN6A 2X05A 2A21A 3VKJA 2J47A 1UZDA 1PUDA 5KEZA 1LL6A 1BGGA 2XTKA 2YXOA 2GDQA 4EPEC 1V03A 3MDUA 3N34A 3UG4A 1PAMA 4ROPA 1Q13A 4PMOA 4I9TA 5BW6A 3VGGA 1XH0A 1W2VA 3SCUA 2R9RA 5ECUA 4L80A 4OIFA 1R2RA 1KCZA 3A24A 3GNDA 4MY9A 1NEYA 5B7YA 2EQDA 4AX6A 1CXKA 4DI9A 4MNJA 3W82A 1JXJA 1LOSA 3NQ8A 1E6ZA 3MO7A 4E4PA 3UWQA 3ZT7A 2CLKA 2Y7DA 4FX8A 1IXOA 2YL9A 4JN6A 2FLIA 4H9ZA 3LXBA 1OC5A 3LGGA 3P80A 4X0NA 3SIZA 4CQ9A 5I3JA 2ACQA 3WLMA 4IFRA 3UZJA 3TNBA 2Z24A 3SUSA 3M64A 4J4KA 2E77A 1CLKA 5GJNA 4ZBCA 1AJZA 5L6UA 1G4EA 5HR6A 4GJ1A 3MW7A 1HJWA 2PLCA 4ZFMA 1QK2A 2RH9A 1DKWA 4MVAA 3RLUA 1DBTA 3W7IA 4U3AA 4LSBA 2I56A 1JVNA 1E6QM 3FNDA 3CH0A 1RD5A 1TV8A 3HN3A 5AHIA 1OGGA 3LOTA 4LUYA 3KOYA 3W7EA 2DIJA 3SUWA 3I10A 1RALA 2G4JA 4Z2KA 1R6WA 3W1RA 5D03A 4HHLA 3WH6A 3OBEA 4HN4A 3I3EA 1UMYA 2XFFA 3BSMA 3STGA 5AZ0A 1TPWA 1EUNA 2GK1B 4FAMA 3WDPP 2XZ9A 4K39A 4AZCA 3C61A 4IGMA 4C6BA 1T8QA 5DX7A 1FCQA 3G6LA 1QI0A 5BMXA 2A5HA 2A0NA 2TSYA 4HNTA 4HPGA 3GAYA 2OEJA 4B3LA 3SR7A 2C0AA 3BCDA 3NQVA 1R3YA 4HA0A 1MDLA 1GQKA 1Z48A 2G0WA 3GH4A 4RL3A 4URIA 3SUUA 2Y63A 1JCYA 3QYSA 2HNHA 3MZNA 4V1YA 2BHYA 3OGVA 2D3NA 2OGJA 1H09A 4FNUA 2J62A 2VFDA 3QGAC 2E6AA 2X09A 1JYVA 3KS5A 4CQ8A 1XUZA 1KV8A 2VJXA 1EKOA 1OG0A 3APTA 3MKCA 2O9PA 5E6ZA 3NL5A 4OTKA 3WUGA 3GUGA 3ZLHA 4JIIX 3LCIA 1WYIA 4KERA 4INFA 4JPGA 1IXQA 3F4VA 4E3VA 5M2FX 3WJYA 1P48A 4ATDA 3SURA 2Y4SA 1EYEA 1VFUA 2HSAA 1OHLA 3BLLA 3L7RA 4FXFA 2V3DA 1D9EA 2Y88A 2IXVA 2QCHA 1TO3A 5DMLA 1F6YA 1CX9A 2WZHA 5I6SA 3JS3A 4Q8WA 3B97A 4AVOA 1SGJA 2NWRA 2VDHA 3HTWA 4UTTA 1LF1A 4E8CA 3PHAA 2NZLA 4WZHA 4U3CA 2WANA 4PYSA 1S2UA 1QOXA 3JUGA 3W1NA 3C0LA 2GZXA 1XIHA 2WQPA 1CI1A 1YYAA 2X41A 5A2CA 4A3UA 3GQYA 5A6LA 1TA3A 1YNQA 4O13A 1EF3A 4PSPA 2E1WA 2WO5A 1QNQA 3SFKA 4MWAC 1JUEA 4GLEA 3DX5A 3IJ9A 4C1LA 3NJ3A 4MNMA 3TQVA 3EYPA 3QPYA 3WBEA 1TV7A 1Q6OA 2A7NA 2W3ZA 1X6NA 3VIMA 4ZSUA 1YADA 1U1JA 4LUTA 1I8JA 2QCFA 4GA8A 2BVYA 1S2CA 1SYTA 3VU2A 2Z2AA 4MF4A 4L9ZA 5C9XA 4P8UA 3QZ6A 3P67A 1P0NA 1UD8A 1WKYA 2V5DA 3TOYA 3TYAA 1Q65A 4FR1A 1GVYA 3W2JA 2VC7A 2A3BA 3WFAA 1J2BA 3EKGA 1WKFA 2ZA1A 4K1WA 1M53A 2X1UA 3URBA 4LYRA 1P7TB 5EFDA 5KTLA 4I9JA 3W87A 4EANA 3MTWA 4IIEA 2DSVA 5CXPA 1H7WA 5A8QA 3CEUA 1Z42A 1ALDA 1XIMA 2E25A 4WDUA 3UJ2A 2WMJA 2R1MA 4LB3A 5M5DA 3KCLA 3BH4A 2ZUTA 3ZVIA 2GVGA 3AMKA 2G3MA 1UWIA 3N17A 3J7HA 4C60A 4UTWA 1AL8A 1FWTA 1MQRA 3MV01 1MUCA 3CEPA 1Q2SA 3U7VA 1KXVA 4EVZA 3QGVA 1HN1A 3WFLA 2FTYA 4PMZA 4BI6A 4DUXA 5FSEC 2JKPA 5IDZA 1SFTA 2INFA 2XFWA 1E1CA 1W1VA 4GACA 1B3OA 3C2FA 4RDZA 3YPIA 5DY3A 5E0KA 3W24A 4S38A 3BC9A 4Y9OA 1CPUA 2OMAA 5DMMA 5A6BA 5E9XA 4V33A 2QAFA 4YIWA 4K3ZA 1V6TA 3TA9A 3AI0A 4UZSA 2WKGA 4KETA 2QF8A 1JGMA 3NQ2A 2G95A 3EPOA 1N8IA 2WSQA 3H55A 4GG9A 2A4AA 3KCOA 4LVBA 1HJXA 1KWGA 1QO5A 4GIAA 1BRLB 3SSJA 3PAOA 3W7OA 3DGBA 4UFKA 3MV11 4UBPC 5CPLA 9XIMA 3VM7A 1OYCA 3B0XA 3F5KA 1CGWA 3BZGA 2FDMA 2A3CA 4RE2A 1ISXA 3R0KA 1AG1O 4E5TA 5BU9A 2NW0A 1RSCA 5AVHA 1QOPA 3UJFA 4HCHA 4NAFB 5AYXA 3HMJG 3B05A 2JALA 3FYYA 4GYKA 1ODUA 3HF3A 3PTDA 1W6TA 1ONRA 3SGGA 3W2NA 5DRIA 1B90A 2ZICA 2ZX8A 5CZKA 3A3HA 1JDDA 2B7OA 1OADA 5FJTA 1XISA 3CHFA 3WQOA 3OQ8A 3II1A 2ZX5A 4WJXA 5H8UA 5HAOA 1W3NA 1I1XA 1G7VA 3JR2A 3SQSA 2Y61A 3BLDA 1RH9A 2EAWA 4KRZA 4ZCWA 4B9YA 2O92A 2XISA 3GTXA 1DXIA 1J5SA 3VX0A 3CTTA 2UV8G 5CEWA 1QWGA 3B8TA 1RQHA 1H1NA 3HJZA 1TUXA 2BOFX 3S47A 5CPQA 2OPJA 2PWGA 5CPSA 3FJ6A 3HBLA 3FHQA 1V6WA 3M0ZA 4F0LA 4BQ2A 1AL7A 3VAVA 5CC6A 1WBJA 4EK7A 4JTKA 4KWUA 3AMDA 1XLLA 1TQXA 4DQWA 2ANUA 1VIWA 4EKJA 3NPXA 3KP1A 3UVIA 1UH2A 5IOBA 5BRQA 3TYDA 3TKFA 2KX9A 4NAEA 3WH5A 4AZ7A 4JTUA 5C71A 3FSTA 1K1DA 3W3OA 1KNWA 2WWDA 3AS1A 1AQHA 3FDKA 1P1XA 3UR5A 9RUBA 3WQ4A 3WENA 3M5XA 4RZ5A 3MDWA 5HBFA 5GVJA 4WUIA 3GXMA 4MOZA 4NZ4A 3CAKA 4PMRA 3WQWA 3EA3A 2JIWA 4ORMA 3GTNA 4FOUA 2XDFA 5HMSA 2XFYA 1QRQA 3WMCA 5LNWA 1U22A 5D8ZA 4C6FA 4H19A 3VD5A 4Z1CA 1CXLA 3KDNA 3KP0A 3V5OA 2I5GA 1ZGDA 3MC5A 4XIAA 3W23A 2WM0A 3WQEA 5D33A 1QPOA 4NX0A 2WC7A 3UESA 1XLEA 2Q8ZA 1Q6DA 3SO7A 1JZ8A 5DXXA 2DZVA 3QEZA 2RDWA 5HATA 4J5NA 2QV5A 4NZFA 4MDOA 3UYIA 4CD4A 4CQCA 2OGYA 4MKVA 4AZHA 4D72A 1GKRA 3CIXA 1BFNA 2D0GA 4P7RA 4J9JA 3NQBA 2Y2WA 5F1UA 3UPWA 2C6QA 3GTHA 3L65A 2EJAA 2PI6A 4GUHA 3I65A 3VIOA 1G69A 1MW0A 1MYRA 4MHBA 4WKAA 4WOQA 5M03A 2E9BA 2FKPA 1RK6A 3PJXA 4AZIA 1QK0A 4PCTA 4BFAA 4XSLA 3GDLA 1F8MA 3NWRA 1RJPA 4AIEA 2FVMA 3GDTA 4GY7A 2PBOA 3W7KA 1PCKA 2OWXA 2VP8A 3MSDA 1HP5A 4HCDA 7ODCA 3O15A 3KHDA 2VMFA 3EMQA 1FXQA 1TWZA 1KLZA 1D8CA 5JQ9A 5CH9A 4UR8A 3G0UA 3O6DA 3U5UA 2VEGA 3QV6A 3H2AA 3PFMA 1SO5A 1A0EA 5EYWA 3SN1A 5BOOA 1OFEA 2I5QA 4HA4A 1OYBA 3M0IA 1UJPA 2D2HA 1V6UA 3S5YA 2D20A 1ONXA 4HD5A 4W87A 4H8NA 1UQZA 2CLHA 3MHFA 2V9DA 4C6OA 5LIXX 5A69A 2P0OA 3CYJA 1BYAA 3B9EA 1TV4A 1VHNA 3CPRA 2C1IA 3VNZA 3VZXA 1ZZMA 3BW4A 3W83A 1H7PA 4CD7A 5T8GA 1UYQA 1P5BA 3HPZA 4RNIA 1CBGA 3ZT5A 1VKFA 4IGSA 1W91A 4U2ZA 2X1RA 3CQ0A 1V6YA 4FNRA 4DAFA 4AZ5A 3GVVA 2RFGA 5BCAA 1A5NC 3TIMA 4IG2B 1ZAIA 1SW3A 3P14A 2J79A 1MDRA 4AIOA 1F4AA 3TK7A 1LQAA 5KMYA 4GI8A 3G77A 2VQUA 5CZ0A 1K8YA 3ABZA 2ALDA 3RO8A 2B7PA 1GZGA 4GC4A 3IUHA 1C3FA 3TC6A 4KRUA 1J96A 5HPCA 1YPFA 3W7LA 2YBUA 1C91A 1FKWA 5DMNA 4MZ1A 1BKHA 1W56A 3UCDA 4TV5A 5ABFA 5DBUA 3CL8A 2ZXDA 1RA5A 2WV8A 1Y7VA 2GGGA 5I06A 2XU2A 1ZLPA 3NEVA 4HVXA 2O9OA 3O05A 3ARRA 4GOAA 3QN3A 5I0DA 4Q4PA 2KAUC 1VZWA 1VHCA 4ACZB 3H7VA 3GBEA 3F4WA 2VKZG 4WHBA 2FFIA 5CJ5A 1YE6A 4FR6A 4TV6A 5G1MA 4QG6A 3N2TA 3TXZA 4IP7A 3WDJA 4ES4A 3C8FA 3H8AA 2ZUVA 1E3XA 3WDHA 1C8QA 3ZLGA 3CAVA 2PDUA 4LVDA 2J4GA 1G7UA 5JMUA 1CGUA 4PMUA 1A47A 1V3KA 1EPXA 5F2IA 2Q3OA 2OQHA 4GZEA 4WSJA 3DHPA 5HDRA 4M56A 3GTFA 1R46A 2O4QA 1BVNP 4LH8A 1AJ2A 5C2XA 3KVMA 4DZ5A 3MQTA 4MUZA 5G1YA 1JRCA 2FVKA 3VUPA 4MM1A 1ME8A 1VFOA 4BF7A 4JQ1A 1OF6A 3R8HA 3M0VA 1SZFA 1TVLA 1O5QA 4CQBA 1GPWA 4I5XA 5LGZA 4RK8A 1JCXA 1X7IA 3QXBA 3SCNA 4J2PA 5MKGB 1HNYA 2Z1SA 4J40A 3TV8A 1JDCA 2WYSA 1NIUA 1KTBA 1LWJA 4CD6A 1W9DM 1RVGA 4KF1A 3VZZA 1JFXA 1FFQA 1MO0A 5GPRA 1TUFA 3ABSA 2PBGA 3H53A 2NUXA 3TYZA 3PK7A 1C90A 4DO4A 2IS7A 2OTDA 3AXKA 3WL1A 4I6KA 2A1YA 2XH7A 2WLZA 1QW8A 1OZQA 3T6CA 8RUCA 2Q01A 3AHTA 4B4HA 3UCQA 5D38A 4U28A 2BDQA 3N19B 3PZQA 1O95A 4ZXOA 1H1YA 2Y0FA 4J3UA 1DJYA 4UTHA 1IXPA 3CT2A 4BHYA 1VPYA 1W9XA 1H7RA 4BF5A 3FGCA 1UQYA 3BAKA 3OLIA 3GBDA 3WL0A 2XPKA 1XLAA 4H01A 4ZQRA 5A8GA 4P7NA 4IPIA 3S5NA 4PZVA 4QEEA 1GUVA 3I6RA 1GOIA 1JZ2A 2J27A 3DDMA 1KGUA 3U4AA 3VGFA 3LHYA 1BYCA 3SCQA 5CG7A 4XZNX 3K30A 4NSBA 1BXNA 1HO4A 5D37A 2GUUA 3NQGA 3HQ1A 4C6KA 3LXCA 4LEQA 4JOMA 3RN6A 1UCWA 3LTYA 4DYEA 3CYVA 5D02A 1ZP3A 1BWLA 5CPTA 3CMJA 2YLAA 3UJEA 4A21A 3HQPA 3UU0A 2WMHA 3R7MA 3VA8A 4ZO7A 1MRQA 3DKJA 1KD0A 1BYBA 3FK4A 4NUWA 4XAGA 3FDGA 4O17A 3LN3A 4EAMA 1TMQA 1FWFC 5AYBA 4C6MA 2Y62A 2XINA 4KWVA 4NG3A 2ZWYA 4GZJA 1WXJA 2YL8A 4GNVA 3HGOA 2BOEX 3VIHA 3ABQA 1O5XA 4B16A 4LAOA 2P5NA 3LS9A 3BLPX 4BQ5A 3W1TA 1OT1A 1NTHA 2ZWZA 8TIMA 1EEXA 1MVYA 1QBAA 3CHCA 2EPKX 4JTRA 1EJUC 5F7UA 3C2RA 2JKAA 2DP3A 2J8TA 2G41A 3RM4A 3LHWA 1UZ4A 1WO2A 2J7CA 1RBAA 3AYTA 5T26A 2VGIA 4G2DA 3RU6A 3AIUA 1BTCA 4GX9A 1FXPA 3S42A 4MNLA 3O63A 1P6WA 2PRLA 4KCUA 4XAPA 1Z8AA 3VO0A 1WP6A 4W7VA 1I2RA 3BLEA 2QS8A 3C2VA 3O0FA 1JZ5A 2TMDA 1JEZA 2W61A 2DUXA 3P93A 3OU8A 1P0BA 5HQMA 3AWOA 5IRPA 3VNIA 1E9ZB 4IFKB 4FNPA 3JRKA 1WBHA 2F8QA 1K9DA 5MF5A 4M5PA 3NPUA 2ZRVA 3P8IA 4BEUA 4J3VA 1PV8A 1EBHA 2RUSA 3EXTA 1D3GA 1BWKA 5LA1A 4YCOA 3G3MA 2XFRA 4ZOEA 4WGXA 2X8RA 1D3HA 2VDIA 2GJRA 1LBFA 4R7OA 1XQLA 3BG3A 5CGTA 3GSMA 3GIPA 5AVNA 1EO7A 4GD0A 4GIRA 1AH0A 3N1AA 2BY2A 5HUOA 3BCFA 3WD2A 4ZGYA 3CNYA 2C15A 4XBSA 1TG7A 4ZXLA 5EBAA 2CU0A 3WLKX 4BQ3A 3O9NA 1XIEA 4PE8A 2HK0A 2PFHA 1BKSA 3W6MA 4AZGA 4GVHA 2VCBA 3EDJA 3H26A 2RGMA 1TJ2A 1CB7B 3WMLA 4PRRA 4S3AA 3ZJKA 3KM8A 1ZTVA 4O18A 2HWGA 1FDJA 4X0VA 2C14A 1PE1A 3WNLA 4HPHA 1AODA 3NGJA 1GJPA 3CV7A 2VNCA 1K03A 4A6GA 3KUMA 1F3WA 5EL1A 3GR8A 4G56A 1ZJBA 2E6FA 5EMLA 1LLOA 3BAJA 3RHGA 4P7LA 3E74A 4Y9AA 3NFUA 1XYLA 2WSYA 4JTHA 1RZMA 2J25A 2F6KA 3A4XA 4UTIA 1OK4A 3QV8A 1V08A 3FX4A 1IIGA 4DBDA 1G4SA 4LRTA 2IPJA 3WQDA 4M6VA 1IZKA 1IWPA 1TWIA 3FW6A 4CNNA 1QWKA 1NDYA 2QAPA 4H9YA 3NQFA 4O0ZA 2J7FA 3BXWA 3E9AA 4DYJA 1E6XM 3M6DA 3ZVHB 4PTNA 3VILA 4D2JA 3S5SA 1YTEA 2BX7A 3BGGA 3ZJ7A 3ES8A 2REQB 1CLXA 3VIJA 3CXOA 1UR0A 5D2XA 2J8FA 1E4MM 4A22A 1S3TC 3JU2A 4FNQA 4GJJA 1PHWA 1TQJA 2AL1A 1AFSA 1RXOB 1GQNA 1VP5A 3B06A 5G2HA 3GXDA 4RKAA 3DIPA 2A7RA 4KWOA 4LYQA 2HBXA 5EMJA 1GNXA 3QC3A 2WJFA 5FL0A 3AXIA 3M1ZA 4Q4KA 3LCGA 5A8NA 1WZKA 3SAZA 2VC6A 3NPWA 1ICQA 4AD1A 2Y5SA 4D71A 4W89A 1F6KA 2AL2A 1EGVA 6REQA 1ITUA 2BNJA 3HJEA 5E6YA 1H7OA 1KO0A 3ZR5A 1LTDA 4EXQA 4ECLA 5HJXA 1JGIA 4HK6A 4JIRA 2Y5EA 3L5MA 5CBJA 3GIQA 4LBUA 3LGEA 4DJFD 1VGAA 3GWQA 1EL3A 2OQYA 1V51A 4LF1A 4LEFA 1MW3A 4WDWA 3N29A 1GEHA 4LUIA 4AXNA 2VWSA 3BOFA 2H9AB 1POJA 1JRBA 3N2OA 3WNPA 2PDKA 1REQA 1K6AA 4WEVX 3THCA 4C5YA 1L8PA 2X7WA 1W5MA 2QDGA 1F74A 4PTXA 3QOKA 3TZFA 3QF0A 1IEXA 1FWIC 3W26A 3G1XA 3EKZA 4PBEA 4YVVA 3DFOA 3QVQA 1M7PA 2ZUNA 2Y7FA 3BG9A 3DBPA 4DUOA 3M7WA 2V5JA 3BMVA 4V2XA 1L6WA 1ZP4A 7REQA 3MT1A 4HMCA 4PCPA 4W8LA 2XIOA 2CLIA 3G1AA 4PODA 1QMLA 1YIXA 3CO4A 4UQBA 3UERA 5KZDA 4YYFA 4AMAA 3WELA 1XCXA 4QG9A 2EBNA 4WSKA 4JNMA 4YXGA 1RCQA 2YOCA 2VWTA 4J27A 3CPGA 5HINA 1UH3A 3E6EA 3QJAA 4R34A 2G3NA 2FMNA 1V02A 3N9KA 4X22A 3PG9A 4H04A 2ISDA 1FDZA 4OFCA 4TX6A 4KFNA 3LTSA 3RLGA 2Z1XA 1Q7QA 1RJQA 3F7JA 2ZYFA 3O0KA 1YTKA 2V5KA 4LF2A 3EX4A 3DC8A 3ITXA 1JDAA 1AVAA 4JY9A 4D6DA 4EF9A 4F40A 4DNHA 2J77A 2CHOA 1QI4A 1ML1A 5LNUA 3FHAA 3R89A 3TA6A 2FB2A 1VCGA 3TXVA 4S23A 1UR4A 3EWDA 3IUDA 1SQ7A 3QLLA 4I5RA 3GC2A 1CNVA 1QHPA 2HQAA 2CKSA 3UZWA 3IRSA 2F61A 3W7DA 3TQKA 3W71A 1MRAA 2BODX 2QDDA 4M8UA 1K4HA 1EBGA 5FEPA 3CZLA 3D46A 2CBUA 4FB7A 3S0CA 4KIEA 3VNLA 1TELA 4JDBA 1DP0A 3GDBA 1N8WA 3IJIA 5DN1A 5C9RA 2R1PA 3W37A 2PU0A 3T09A 3RG6A 4PMJA 3LV6A 5IBXA 4C6NA 3GKFA 3Q94A 5D8WA 2G5WA 1R0MA 4W93A 4TO8A 6TIMA 3ITCA 5EMUA 4HU8A 4YLWA 3TYBA 4JTDA 1E0WA 3LMYA 4M7TA 1H7XA 4N9BA 3UETA 4CD5A 3W7MA 5K2ZA 1MSSA 8CGTA 1IT0A 2H3DA 4QBXA 2OYLA 2WQDA 3I7SA 5AYZA 3DENA 2QIWA 1NQKA 5J8LA 1MXGA 4REQA 3LMZA 4AZBA 3H24A 3FA4A 2HEJA 1R3QA 2UY2A 6ALDA 4GJIA 1AD1A 2OZ0A 1KM1A 4ADUA 3OZYA 1HT6A 3Q67A 3B8SA 4R9OA 4Q4SA 3VX1A 4B2DD 2HBVA 3DBNA 3R8GA 1QNRA 4CUCA 1R8LA 3K1GA 3OB8A 2OFJA 1UUQA 3V3WA 2HVNA 4M82A 2XN0A 4B5WA 2O7QA 4UTWC 4S3DA 3QHNA 2J6VA 3FA3A 1DVJA 5HULA 1KBLA 1Z9AA 5DBTA 2CLOA 3BDKA 3G1YA 5G2IA 3OGSA 1IE7C 4DBEA 2FQIA 3DN5A 3QHMA 3UJRA 2J7GA 3RRXA 2CXEA 3Q2DA 1YDOA 4GNJA 3ZWSA 2XGZA 2V63A 4MWAD 1W3IA 3MU7A 5FSDC 1U30A 3DAQA 5C55A 3CHVA 3LX9A 4RDYA 1ZJIA 4OV4A 2FZDA 2OEMA 3K4WA 4Y7EA 4LQ1A 3UW6A 3WJZA 3DYOA 1QCWA 1XLBA 4KGJA 4P7QA 3W81A 1FWGC 1XFBA 1J12A 3LHVA 3SZ8A 4D1IA 3UG3A 1YPIA 1ENUA 1CEOA 4HQVA 3L4TA 4IMCA 2QUVA 4QDWA 2XVLA 5DT5A 2Z7GA 4O1DA 4DAIA 4D6IA 2XH0A 4KBXA 2NUWA 2F38A 2WCSA 3LHZA 3TROA 1WV2A 4JFTA 1H62A 6PTDA 2F2HA 1V8EA 3N6JA 1PBGA 2G3JA 3B3DA 3BV4A 4Q6JA 4AQLA 2HPIA 1S1RA 1KFKA 3W74A 1I75A 3MS8A 3WQ8A 3MUXA 5I23A 4BWLA 2BXYA 4DBUA 3AUJA 4UFLA 4DY1A 1T5AA 4K8GA 1DJWA 5JU6A 6TAAA 3BVJA 3M4HA 4O52A 4M1BA 3EMZA 2FMOA 2ZZ7A 2MANA 1RLCL 5CAKA 4LALA 3LY0A 3OVQA 1EUAA 2ODOA 4QNEA 2O4MA 1K6WA 1SFJA 1FTXA 4AY7A 2FJKA 4ZOAA 4XKMA 2EG8A 2YB4A 4UTFA 4QS5A 4DEFA 3PNZA 3RK8A 3IIVA 5BYWA 4JTJA 3REQA 4XD4A 1YBQB 4YWIA 1UC4A 2BV9A 5KITA 1ZUAX 4L1XA 4NP7A 1ZJHA 1XICA 4KEUA 3BAXA 3UF9A 1GORA 3CMFA 5CPOA 2V5CA 2QLYA 3C3UA 3IVUA 5BMWA 4Z0JA 2CLPA 4AG0A 1LQ0A 2TODA 2ZDRA 1C7SA 4PEEA 4N0RA 4IISA 2VC5A 2QUMA 3KOXA 4ZZ9A 2FHFA 1KQYA 2FHCA 4DF2A 2FDSA 3SN0A 3A3WA 3RYSA 3OIXA 4TMBA 1DJQA 1KM0A 1TIMA 2QCEA 3P60A 3WF3A 1QNOA 4H9UA 2VI0A 2W62A 2PURA 4UOZA 2WXDM 1M5WA 2Z1VA 4FLOA 3BPWA 3E02A 2DGAA 3CB8A 4NF7A 4CNPA 1Z89A 1R38A 3CZEA 3MVTA 5FEXA 4LS2A 3MMTA 3CU2A 3ABRA 1L6GA 3FN9A 4NHVA 1TZZA 3AYSA 2AQOA 1PZ1A 2JGQA 4K6AA 2BSLA 1XRSA 5D2VA 3CQHA 3K8MA 1IGWA 2V5BA 2J9YA 2OX4A 5DMYA 2PDWA 4NI8A 1IR1A 3P61A 3T0TA 4ACYA 2ZZ1A 4TUFA 5D9PA 2R91A 1GONA 2EPHA 1E56A 1W31A 4K37A 2VL4A 3VDAA 3LNPA 3RPMA 1RP9A 1XPYA 1CGYA 4X2PA 2YDRA 4PH6A 4PN2A 5HANA 4WXYA 3GHSA 2QVHA 3NVTA 3W7NA 4AWEA 3VIIA 1UG6A 4L65A 2OSXA 4FF7A 3QSRA 3PWAA 3W7CA 1JAEA 1VJSA 3H2CA 4JICA 3B0PA 3DUGA 1Z3NA 1F07A 2X2GA 3EBVA 2J9ZA 1M7JA 4W8BA 1I45A 3NQ6A 3LUTA 3U8GA 2C1HA 4Q33A 1R2SA 4AB4A 1MZHA 3UD6A 1Q5MA 4JTCA 4LGXA 4O1AA 2XVKA 1I4NA 1QO2A 2W79A 3SCWA 4MUPA 2HNEA 1I6NA 3LV5A 2NX3A 3AC0A 3NQMA 1UWRA 1JCJA 3G5EA 2W6RA 5LA2A 3T44A 3SW6A 1DYSA 4AHQA 1Q7MA 4LAUA 4P8WA 4GBDA 4M7SA 3KTXA 2OSWA 2YDQA 1KKRA 1Z69A 4U2YA 4DN1A 2IPGA 2DVXA 1A49A 3SSZA 2YPIA 3TCSA 4YU1A 5K9DA 3DFYA 3BLIA 5TNVA 3UWUA 4XAZA 1ONWA 3NZQA 5H91A 2BGQA 3PZNA 4UQCA 3SJNA 4WY0B 4MY8A 1VFHA 5CCZA 4X60A 4O8RA 1PIGA 3IVSA 4HNCA 2IQTA 3T05A 1WZMA 3QOMA 1EIBA 1GW9A 2OLSA 4WK9A 3STFA 1M3UA 5AKQA 2HDJA 3IUIA 2DV0A 4Q22A 1XINA 3A4AA 4NJKA 4PBGA 2IXUA 3L5LA 3KS6A 4MG4A 2OKOA 3WZ0E 2A3LA 1EA9C 3KBWA 3W22A 4DF1A 3NQAA 4E2BA 1UUOA 4PMDA 3ARQA 2YCEA 1UW9A 1NF7A 3ICJA 2VURA 3M44A 4QE1A 1ZHAA 2E4TA 1S46A 3RLVA 3BQ6A 3PZUA 4NYYA 4CNUA 2X1IA 4HJFA 3V1HA 1JPMA 1JUKA 3N15A 3IIPA 3UCCA 5TF0A 1LP6A 5AC6A 1PXGA 3KEHA 3N3TA 3N6HA 1EX5A 3MUIA 2D73A 3SCVA 1LG1A 1TREA 5AC7A 1XDJA 2QCDA 2ABAA 3UT0A 3GR4A 3BE7A 1IWAA 8XIMA 4GQBA 2VC9A 1OJXA 5C2GA 3WN6A 1YDNA 4GH3A 3IIXA 2YZRA 1E6NA 3VZYA 3BOXA 4NZ5A 5E5CA 4UZUA 3NL6A 4DWSC 3O7UA 4Z2HA 1XQKA 4C5ZA 2J8GA 3ORWA 4H8UA 2EHHA 5LZLA 4IX2A 1XIBA 1V6XA 1EC7A 3PJUA 3N73A 1KFLA 1PJ9A 4O11A 4LRSA 3V75A 4F0MA 3NL3A 1J11A 4JYDA 3W01A 1U33A 5D9MA 1CDGA 2ON3A 3OPSA 5PTDA 3L9CA 4JKLA 2R24A 3PY2A 3VGBA 3R5EA 4F2BA 1E51A 2BMBA 3VPLA 1E4NA 4NZ1A 1TE6A 3H12A 3O6YX 4Z17A 1KBIA 5LIKX 1P7TA 1TE1A 2AGKA 1H41A 5DELA 4DJED 4Z42C 1XYFA 5JIWA 4EAYA 4F8XA 1XD1A 1F61A 1E6RA 3QH2A 4L6HA 2CLMA 1FWBC 5K9CA 4OECA 3HIJA 4PUNA 4C6IA 2VX6A 2ADAA 3V4BA 2J7DA 4JTEA 1J8VA 3KOZA 4GCAA 1XH1A 4DZHA 2YX0A 2V2CA 4IHCA 3L21A 2Z7KA 2R8WA 3VCNA 3GR7A 5TBOA 3E2SA 5D9OA 1TTPA 3KRBA 2WSRA 4GH1A 2GVEA 4CCEA 1A5OC 1ECEA 3M0MA 1B4EA 3NSXA 4UTJA 3OJGA 3SCSA 5D09A 4GUIA 4DYKA 4NZ3A 1CB2A 1XW8A 4IQEA 1CT5A 4BKNA 4R27A 1FWAC 3CTLA 3WJSA 3W2MA 5CJMA 4BI5A 5LNRA 1UC5A 3SECA 1JULA 1TRIA 1ZL1A 3VMNA 3SFWA 4OUIA 2XUCA 2H6RA 3LPFA 1AQMA 5HXMA 3QFWA 1BRLA 4YWSA 3UA3A 1E0XA 3AU2A 3I6TA 3WCZA 1RR2A 4JR5A 4O8AA 3TN3A 2E67A 5A6AA 4A2SA 3VE7A 3I7QA 2VEKA 1J0IA 1OG6A 3KWSA 3GNRA 3IAQA 2YL5A 2C0HA 1GVEA 4R85A 3CK5A 3ARZA 5HJYA 4NAFA 1UIPA 3L4ZA 3HPSA 4FI4A 3SI9A 1HGYA 4IGHA 4C6JA 3RUBL 2DPEA 1PTDA 1RK5A 3GVRA 3QYQA 1G1YA 2QDEA 3XINA 3HQOA 1XBVA 1LRTA 3CL7A 3BGAA 4IQLA 4L1GA 2CBVA 3TFXA 1TX2A 2VFFA 3ANVA 3ATZA 3GFYA 3CH9A 3WLSA 2DFAA 2NXHA 1OF8A 3TMQA 4CD8A 2RKXA 1XRFA 3NQEA 1XLFA 3W38A 3S1UA 3OEXA 6XIAA 3IAPA 4H9TA 1T7LA 4RZBA 1ME9A 1KRAC 5IDIA 3WK2A 2DY3A 4IMDA 4IPLA 3OBKA 3MKVA 1W9VA 3T8LA 4Q8UA 1VR6A 4JHZA 1OCJA 2CZFA 2IUZA 4QJ4B 4E2VA 3SBFA 4GQ0A 1RUSA 1VYPX 3T0DA 1Q45A 5E9AA 3F5JA 4X9YA 1WX0A 1PTGA 3N9RA 3MHGA 1EP2A 2XSAA 5LXXA 4H8VA 1VBGA 1ZNNA 3H2EA 2PDQA 3QKEA 5HNUA 1U5JA 3ERPA 5IM51 1US0A 2ZCGA 1TRDA 2VZSA 3CZ8A 5CGMA 4FOKA 1SZRA 2WZMA 1E43A 4PMNA 3LCLA 4Q8PA 1DOSA 1TV3A 3TTQA 2DQWA 3TCEA 1QW9A 4W7UA 3ID7A 1A5UA 1VCVA 4S2CA 2Z6IA 4KEZA 3LERA 1UWUA 4RDVA 3GVWA 2IQ0A 3FA5A 3H70A 2ZZ6A 4LYPA 3MP5A 2PDPA 4CCZA 2XIQA 1CGVA 3KOFA 3MB9A 4H9XA 1DORA 2PTWA 3FVMA 4E2DA 2PWVA 3LM7A 2GGHA 1FUYA 3HG5A 1YTDA 3P5YA 1FKXA 3ITVA 1JZ6A 1KB3A 2WNWA 3SEPA 1SFLA 3ALGA 4UB9A 4Q4OA 3W1UA 3B0VC 4OT7A 4G7EB 1RJRA 5H2ZA 2HK1A 5JUVA 4BCEA 1CENA 1E9YB 3TSBA 3A4WA 1EJ7L 5M17A 1DIEA 1AD4A 1QXLA 2VEIA 1EZWA 4FPSA 2PDIA 1VBRA 1R7OA 1TFVA 1XLKA 4ZB0A 5HOSA 4Q4RA 1B9ZA 2AKZA 3NO5A 4H41A 2PDXA 4YCPA 3VGEA 1GG0A 4Z1DA 4CKQA 3HO8A 3OG2A 3FV9A 4OKDA 3ZFHA 2POZA 1I0BA 1B31A 4QHRA 5E0CA 5I2UA 1LT7A 2EG7A 4CQDA 4NT0A 3PPGA 2QJMA 3R6IA 3KVLA 3S2NA 3P8JA 1G94A 3NYDA 4G1NA 1XIFA 4JEQA 5JH1A 4ERAA 3G24A 3K8LA 5JXQA 3AHXA 1BQCA 1EC9A 1LM1A 2E40A 2A79A 4MZ8A 4D6CA 3THDA 4F9DA 3H2OA 4R53A 3K46A 3S2CA 2FFCA 4KEMA 2AKMA 2YA0A 1DWFM 3EB4A 3PF3A 4FEZA 4C91A 3FVDA 3E0VA 2F7FA 5DCBA 5I3IA 1W9BM 2XHYA 4HPXA 4O14A 4REQB 1H0GA 5EB8A 3BCJA 3WUEA 1DWHM 1H2JA 4XD3A 3KZPA 2XSBA 2Y8UA 1FOBA 4A3HA 1KC7A 4CU6A 3H22A 1FBAA 1R9ZA 3NPVA 4N4PA 4N9EA 4UQAA 2YFNA 3WK1A 1XGEA 5HNNA 1I1WA 1HL2A 1QI2A 4Y90A 3ECQA 5CJNA 2VXNA 2EPMX 4C90A 5ABTA 2E8ZA 4HZ8A 3VABA 3ME3A 1V79A 1LQ2A 2OT0A 4LCSA 3TOPA 4DJFA 3PZ9A 4AW7A 1NP0A 2R14A 4E8GA 4OOZA 2PC4A 3ITTA 1PO9A 3JZEA 1NM9A 3WLNA 3V5FA 3L2MA 4HMDA 1OZMA 3AIBA 3NZGA 3WG6A 1XF0A 4KCTA 1WAWA 4JKMA 4YN5A 1RY8A 4LX4A 4HT3A 3KVKA 6XIMA 2XVGA 4F48A 3PBYA 4P2VA 2NQJA 3N2MA 5FEWA 1FH7A 3NZ1A 3T4WA 1AZ1A 1U2YA 1FWNA 1TVNA 1W1A1 3P82A 3UXKA 4EE9A 4K2SA 1QT1A 4V1XA 4YTSA 3CLWA 4Y9MA 3E5PA 1UD5A 2BOGX 3TTOA 1LROA 3ARSA 5JBEA 1R3RA 1DJGA 4X63A 1Z44A 4A8NA 1FA2A 4EP8C 3MI6A 1ZENA 3SGUA 1WDRA 1CXIA 1KBJA 2AAAA 5E1QA 4KKXA 2P0IA 1K8CA 1X1NA 1CW2A 1VRDA 1A5LC 2NUYA 4WDXA 5JH2A 4AAJA 2ISVA 4BF9A 2QGHA 2VX5A 3W1XA 4JIEA 2OWCA 4GBUA 3H4XA 5CBBA 1IEIA 1MUWA 4PB4A 3GVQA 3AS3A 1XDLA 1IEVA 1GZJA 4LT9A 3A47A 2D3LA 5I07A 3RR1A 4M1RA 1ISYA 4ACZA 5CZTA 2DJXA 4Q8VA 3VKDA 4XWUA 2XM2A 3VIFA 2CERA 4U5KA 3A3XA 4AYGA 1DJIA 1MEHA 2YXXA 2VHLA 4KCWA 2OT1A 4MNKA 2WSPA 1B30A 4TMCA 1OYAA 1HFBA 1XX1A 1EH9A 3URAA 4HZ6A 4RW5A 3B9AA 3H6OA 1OFQA 3LCXA 4O16A 3NM1A 4LY4A 5LA0A 3NDOA 1BQGA 1E0UA 1XGDA 4I7WA 3EWUA 4FF5A 3UZXA 1AW2A 3DHUA 4ZTXA 2QEZA 3ABOA 1BG9A 3MYOA 4A3YA 4D8LA 1WQ5A 4C7DA 3E12A 4C7GA 2OKTA 3G22A 3HPAA 4ERGA 1V0MA 3PANA 4LYKA 1SJDA 4NX5A 3VGDA 2UWFA 2GOUA 1TVPA 4AEFA 4GY0A 3S6OA 1OT2A 4CCDA 1H63A 1XLDA 4F0RA 3OG3A 3WFZA 3G0XA 3TMLA 3IVTA 2MNRA 3NSNA 1GOKA 5MKGA 4LNCA 4O4VA 3GU2A 1EFZA 3WEMA 3M0HA 1ADSA 3FOKA 3DXIA 4YHGA 4O28A 1O4UA 2B0MA 3T81A 1GTEA 3UPBA 4JQ3A 5FKYA 2YW4A 1M9HA 1KCLA 2VQTA 1J0YA 1EHNA 1GQLA 4JFVA 3E5BA 4XZLX 3S6TA 4LUJA 3GS6A 1NJJA 4NY2A 1PZ0A 5C9ZA 3ZOAA 4HPJA 2YL6A 1VCFA 4JL2A 5IBXC 4B2DA 1AH3A 2ZADA 2VUYA 4X9SA 3KBJA 4AC7C 3LNMA 2NXIA 1YE4A 1I2NA 3HV8A 1KXTA 3IJ6A 2OSYA 3TVAA 2E9LA 2CFFA 2EPOA 3M0XA 5J5RA 4CCCA 1TWDA 1S5WA 5FL1A 3EX6A 1JAKA 3HG2A 4ATWA 3RCMA 1F3TA 4IIBA 3IK4A 3VKAA 4LVAA 4QGCA 4B5UA 1PYFA 4HSOA 4AU0A 4DM1A 2D69A 2P8BA 2V2DA 1XIIA 1OINA 4G1KA 3NIYA 5D2TA 5EY5A 3RO6A 4EXBA 1SMDA 2NT1A 4GVGA 1RV8A 5CZSA 1TPC1 2GWGA 2G96A 4O53A 3LA4A 3VCRA 4YTTA 1SJBA 2VVSA 1B3XA 5HPOA 1UKTA 4OWGA 2FZ9A 2PTYA 4QRNA 2GYIA 2RDTA 1XC6A 3MPGA 2QPUA 5I3HA 3GLCA 3PN8A 3AHZA 1YNPA 4R3UA 1HZYA 5ABHA 4JNYA 1NFPA 4O15A 2R1KA 1HJUA 2E8YA 3WO8A 3TJIA 4ML4A 3UPMA 3RJXA 3HMCA 1OIFA 4PUJA 4Q4MA 2WC4A 1VFMA 4AFYA 3HV9A 4PTVA 4JYEA 3U48A 5AHFA 1FCBA 2XN2A 4JCLA 4J2MA 4MKSA 3W28A 1EA0A 1BAGA 2PWEA 1Q85A 3WLJA 4QE4A 2CHNA 1L8NA 2JEPA 4IWWA 2EPLX 4OQVA 5BNKA 4RR4A 2Z00A 4FLQA 1RBOB 4BQ4A 3CUGA 2QJHA 1XFCA 4QX4A 1T96A 4IFKA 4YVXA 7TIMA 3OA3A 4B4FA 1M01A 1SO6A 4IFOA 1GYMA 1CLVA 3BSHA 3RF9A 1SW7A 1UZ1A 2W63A 1UIOA 3BO9A 1XLGA 5LGXA 3PBGA 3DESA 3WQ5A 2PLJA 3SM0A 2Z1BA 1PZ2A 1C9WA 4DBSA 3RRAA 2X2YA 4AF0B 1ISZA 2P88A 1Q6EA 1B9BA 2QUTA 5BOEA 4Q7NA 2WVVA 4LNYA 3W70A 2FPVA 1UR8A 1PS9A 4KFPA 2ZTKA 1X8CA 4BWLC 3EOUA 1MQQA 4C6EA 1O66A 2PP3A 1JXKA 2X1SA 2ZX7A 4ENLA 3G2GA 2FYMA 2NSOA 1TPFA 3ITOA 2Y8VA 3VNMA 2NV2A 1KM3A 5FJOA 4NIRA 1W5OA 5CSUA 3N9SA 5F2MA 2QCDB 1FHVA 2FTPA 4BA0A 3LQGA 1UASA 4G6CA 5D04C 3BUVA 3W27A 1TPDA 3CIWA 1B1YA 4AC1X 1F6PA 1IWBA 3CAQA 3TUUA 4L64A 2QVNA 1IYXA 4RJEA 2GJPA 3DU0A 1H50A 1FX6A 3KE0A 2PCEA 1G4TA 1G01A 2GGJA 3VKKA 4A2RA 2AMXA 4HBKA 1G5AA 1RP8A 4MJ2A 1OVDA 3M41A 4IX0A 2J9XA 3HOJA 4H6QA 2ZRZA 3WD3A 4S3GA 5REQB 1JZ7A 3WD4A 2HS6A 5BXPA 1EXPA 2GJXB 3QBUA 5FD0A 2DZPA 1ZCOA 3OZPA 3RLHA 1QPQA 3PC0A 3JVAA 4MB3A 1VEOA 3GVGA 3R10A 3SADA 1DXEA 3BW2A 3C86A 4M51A 3NGFA 1RHCA 1XLIA 1X98A 1ADOA 1R3VA 3GG1A 4DBWA 1O5RA 4UNLA 4DO7A 3W6LA 1LWHA 3BARA 3ZVHA 1S5NA 3LLDA 2Q3RA 4UFJA 1E72M 4JTIA 3VTRA 3KW3A 3EOLA 3H54A 5DEZA 2REQA 3CUZA 4TQTA 1QI5A 1G6CA 1OBAA 3A21A 4AD4A 2V81A 2RAGA 3EDEA 1EGZA 1ONEA 5T9BG 1KFEA 3L67A 4I9MA 5E70A 2C71A 4JTGA 3RU8X 5I3FA 3WDRA 4QAIA 3KZSA 2CWXA 4ZB5A 1I2PA 2V30A 1GK8A 1VRXA 1ESWA 4YTRA 3NL2A 3BQ5A 5IFPA 2DZSA 5A8PA 4DWDA 1PYMA 1W5NA 1BSIA 1TTIA 3ZM8A 4DHGA 1B3YA 2GQ3A 5CGQA 4N02A 4CNOA 3QZAA 1K7FA 4R88A 5CLWA 5AECA 2YJQA 2BTMA 1ELSA 4ROQA 2C91A 2EKGA 2QJNA 3LCHA 1L2UA 3W84A 2G8ZA 3WF1A 1ZRQA 2XVPA 2I57A 4XZBA 3WSUA 1U5HA 4FOJA 3DYMA 5CQ1A 1F8IA 3UWVA 1LOQA 1GVRA 1JFHA 1GVFA 3KX6A 3AIVA 5AOUA 3VYLA 1JYNA 3KCJA 4MYAA 2H9AA 1LRNA 3EWXA 3SCRA 3UQNA 1E71M 4US6A 1V3LA 5BXSA 5LKYA 3N4AA 3RCNA 3LRLA 4ZO9A 4QFUA 2QULA 3PFRA 5FI8A 1C93A 4UMBA 3DECA 5G4HC 3PUDA 2QR6A 5FAGA 3N6QA 3OHMB 5CSRA 3CV6A 3F03K 1LRQA 4BR1A 4PRTA 2PB1A 1DJXA 3PUGA 1UKQA 4N2YA 1DIKA 2VGFA 4PC8A 2NX9A 1HX0A 5A6MA 5XINA 1EJWC 4OUEA 3DHFA 4WVXA 4D6FA 5GQBA 1ZCCA 3A23A 2A6NA 1QASA 1KKOA 5TQLA 5JBDA 2DVUA 3GE7A 1FDYA 3W0KA 3PB2A 5FF4A 3GFXA 2IKIA 4L61A 3GTIA 5D32A 1M65A 3BAIA 3HGRA 3CUIA 3HG3A 3GRIA 3B03A 1E40A 1X97A 4Y9NA 3QMTA 2DORA 1ODZA 3KBMA 3VVGA 4F4RA 3KOWA 1XXXA 4FALA 5FF2A 1GQJA 5H1WA 1NDVA 2NLYA 3B4UA 1AJ0A 4A05A 1IHIA 4IJBA 3IACA 7ENLA 3WLTA 1BTMA 4O4WA 1IXNA 1W2PA 2ZFAA 2NQHA 4WLCA 5AC5A 2HXUA 2W9MA 1JG9A 4M80A 1RLDA 3T7VA 1RQEA 3BZJA 3KAOA 3P7YA 5KZ6A 3CAWA 4IQDA 3WQPA 1IZCA 4DVOA 1ZSXA 3O3RA 1P0DA 2INEA 4L1WA 4OZOA 3UP8A 3D6NA 4LV4A 5C5YA 1DHPA 3O06A 4DJDC 3STPA 5A6SA 2Y5JA 1TV2A 3GH5A 2Z6JA 2CYGA 2VX4A 2RHGA 1TSIA 3KVJA 3ARYA 3R79A 2V8ZA 3LBMA 3UR8A 2CLFA 3PZTA 1OX4B 2ZTJA 1E73M 4QS6A 4QQ3A 4KGLA 4D8AA 4E8DA 1CXHA 4DJEA 5A6KA 5LYRA 4GGHA 3O6AA 3R94A 2FZ8A 1E5JA 4P8VA 3W76A 3AIQA 3T0BA 2HCVA 5DLCA 3T9PA 3E0IA 3LM3A 2QGYA 2IKJA 3WF4A 4MADA 2HVOA 1HF6A 1TYGA 1Z41A 4QM1A 5CC7A 2OCZA 1W1ZA 1Q63A 4KT2A 2YXGA 4Z08A 1W8GA 1X38A 3QHOA 4Q32A 4WJ8A 3SRKA 1GKPA 4QR6A 5D2YA 3C6CA 3GUWA 4S3JA 1OC7A 3W53A 3GD6A 3VIKA 4JNZA 3S2LA 3CQKA 3SCOA 1J01A 4K7YA 3BLOA 3MI2A