3CBWA

Crystal structure of the ydht protein from bacillus subtilis
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
336
structure length
336
Chain Sequence
HTVSPVNPNAQQTTKTVMNWLAHLPNRTENRVLSGAFGGYSHDTFSMAEADRIRSATGQSPAIYGCDYARGWLETANIEDSIDVSCNGDLMSYWKNGGIPQISLHLANPAFQSGHFKTPITNDQYKKILDSSTVEGKRLNAMLSKIADGLQELENQGVPVLFRPLHEMNGEWFWWGLTSYNQKDNERISLYKQLYKKIYHYMTDTRGLDHLIWVYSPDANRDFKTDFYPGASYVDIVGLDAYFQDAYSINGYDQLTALNKPFAFTEVGPQTANGSFDYSLFINAIKQKYPKTIYFLAWNDEWSAAVNKGASALYHDSWTLNKGEIWNGDSLTPIVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the YdhT protein from Bacillus subtilis.
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
molecule keywords YdhT protein
total genus 125
structure length 336
sequence length 336
chains with identical sequence B
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2008-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02156 Glyco_hydro_26 Glycosyl hydrolase family 26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3cbwA00
1ZBKA 3HN3A 4ZFMA 2VZSA 1PPIA 3CHCA 3ZT5A 4P7RA 1WZKA 1XCWA 3WF0A 4A4AA 1EH9A 1OCQA 4MB5A 5EMYA 4WSJA 4XV0A 2CBUA 4GIAA 1BLIA 2WCAA 5DO8A 4JCMA 2VI0A 3VIKA 5BCAA 2DIJA 3GXIA 3AHVA 6A3HA 3O9NA 5LA1A 2X0HA 3GH7A 4PMRA 3ZQ9A 2WSKA 4PMXA 5JIPA 8CGTA 3UETA 2O9RA 3G6MA 3UESA 2V3EA 1W32A 3FW6A 3VGGA 4P8UA 4PTWA 5DF0A 3CUFA 3WF3A 1UA7A 2YJQA 1CXIA 5HDRA 4IPLA 2WHMA 2BFGA 4YPJA 5D8ZA 1NOUA 1G1YA 5CPSA 4TTGA 4CCDA 3FAWA 4W88A 4ZE5A 3CBWA 4CU6A 2XM2A 1VAHA 1J0KA 1MW2A 4LXFA 1US2A 4QLLA 3HMCA 4D6IA 1E71M 1H5VA 4FLOA 5LA0A 2W67A 1C8YA 3BSHA 4PUEA 1XD1A 3NSXA 1QNPA 1V6UA 4U33A 1GOQA 1V08A 2ZX7A 2FH8A 2J75A 1UWTA 2ESCA 1WPCA 1DWGM 3W0KA 1MQRA 4AD5A 4OOZA 2JIEA 1WCGA 1MFVA 5E9AA 4BA0A 1BGGA 1UD4A 8A3HA 3W38A 4OZOA 1TVNA 4HA1A 1WE5A 3DHUA 2ZXAA 3CUIA 3SCVA 3TA9A 3CZGA 2XSAA 3UG3A 4C7GA 1E5JA 4JL1A 2ZXBA 1UWUA 3I3EA 2VZOA 3A6OA 2WAGA 4QCFA 5EFFA 4ATDA 4XZBA 2A3CA 4NF7A 1LL6A 2GDVA 1QW8A 4FLRA 4U3AA 3BLPX 4BF7A 1CXFA 1V6VA 5BXTA 2ZUVA 1R86A 3W28A 5GPRA 1OD0A 2A3HA 3ZMRA 4GQQA 3AYSA 2VOTA 4PN2A 3WSUA 2D0HA 1VBUA 1BYCA 1GOWA 2VC9A 3LPPA 3WIJA 2DIEA 3FHQA 4JFTA 2WZEA 4Q7NA 3KEHA 4MJ4A 3MU7A 3CTTA 1TR1A 3VOCA 2XVPA 1Y7VA 4NRSA 4H04A 3WN6A 2WVTA 1W9UA 2EPNA 1HKJA 4U31A 1AQ0A 4MAZA 2OLHA 4JKMA 1N82A 2FHBA 2WYSA 4PSRA 1JYNA 2ZX6A 3PTQA 3WF1A 2BHYA 4GZEA 1NOWA 4PTVA 1F4AA 3UCQA 3VIJA 4EAMA 3EBVA 1ZL1A 1CGYA 1K9EA 2VRQA 3OLGA 3N17A 1J0HA 3SURA 2EO7A 3VGBA 1HP5A 4M1RA 2CKSA 1OGBA 2DT0A 3CHEA 1W1YA 2X05A 1JD9A 1HN1A 3CUGA 3AXHA 3U5YA 1G01A 4AD0A 1VEMA 5KZ6A 4PMDA 1UG6A 3SCTA 4XUYA 1CGVA 4J3VA 2BVTA 5I23A 4ATWA 4EK7A 2E9LA 1WDPA 2EEXA 3VD9A 1H09A 4AEFA 2WCSA 1CWYA 3A4XA 5CGTA 4WKAA 1LWJA 1UR0A 2VQTA 2A3AA 1KWKA 3WH9A 4AIOA 6CGTA 1UA3A 2QPSA 4CN6A 1BAGA 5M3WA 4JHOA 2EJ1A 2IXVA 2BHUA 3VO0A 1GPFA 3IK2A 5CLWA 2GK1A 1ISXA 3AHYA 4UZSA 1ZJBA 2W61A 3ZR5A 3WFLA 3OLEA 4GPNA 4E8CA 4HPHA 1JXJA 2VR4A 1GQIA 1MFUA 1XH0A 3VVGA 5A2CA 3PBGA 2AOSA 2X2YA 2DSUA 1E56A 2VURA 2ZWZA 4D6FA 5BROA 4BQ4A 4TVDA 1PAMA 1E6PA 4W85A 2FHFA 1XV8A 1PX3A 4UCFA 1UWIA 2CPUA 4CN4A 3ARRA 3EDFA 1CGTA 1B9ZA 1DWIM 3CUHA 4FLQA 1KQYA 3WD4A 2VMFA 1E0VA 3AMGA 2BS9A 3WFZA 3FY1A 3ALGA 1JYXA 1CGUA 4F9DA 3CH9A 1E6RA 1J0YA 4HMDA 4P8VA 1BG4A 1JD7A 1WB0A 2VTFA 3MANA 1PZ3A 2CKRA 3VUPA 1QI0A 2QMJA 3AZTA 5IHRA 2X8RA 2WMJA 4JFVA 4AZCA 1YHTA 2CITA 5HPCA 4DWSD 2Y24A 4W7VA 1ISYA 3N11A 2IXUA 1MYRA 1GJUA 1HT6A 2E8ZA 3WNLA 2E9BA 2XUCA 2C7FA 5LYRA 5A8NA 3K1DA 1X1NA 3T0DA 3IJ9A 1Q6CA 1XYZA 3U57A 1G9HA 2ZXDA 5A6SA 1HVQA 1ZU8A 4D6CA 1CENA 3AIQA 2OWWA 1JFHA 3WDHA 1K9FA 2J78A 1V02E 3EDEA 3CHFA 2ZX5A 1VEOA 2UY2A 3D3AA 2XWDA 3S6TA 5I3DA 2O9TA 3VIMA 5DT5A 2C8NA 1BSIA 1EXPA 4GXPA 4GZIA 4MB1A 3WNKA 1E15A 1YQ2A 4A3YA 2D22A 1W3HA 3ARXA 1BGAA 3L4YA 4AYSA 1R87A 1QHZA 2YBUA 1RH9A 2WMKA 5C71A 3AXIA 3QOMA 2XPKA 4MNLA 3ZOAA 1FFQA 3VMNA 4H41A 1LG2A 1BPLB 1US3A 1ZBCA 5A6KA 4ZXLA 3VDAA 3BAWA 1VEPA 4B15A 4BS0A 1V0KA 3IJ7A 3EMZA 1JG9A 4PCSA 3SCQA 1KGWA 4LX4A 5HBFA 1EDTA 4URIA 2J7EA 5ABGA 1E4MM 1KBKA 1RP9A 1V03A 2WVVB 4KWUA 1KCLA 3HU7A 3FXYA 2PB1A 3SIMA 4AY1A 4LQ1A 4UOJA 3AQUA 1V6WA 2VX6A 5IHSA 2WK2A 2CEQA 1NWTA 3SUSA 1RPKA 3OLDA 1V3HA 3OLIA 1TE1A 3SUTA 4PEEA 1EGZA 1WKYA 3AMCA 4PMOA 2Z1KA 2J7DA 1B30A 1ITCA 2O9OA 2XVKA 2PC8A 4MAVA 4MADA 5FCZA 1KXHA 3WEMA 3ZSTA 1HJSA 2WM0A 2JIWA 2JEQA 2WVSA 1WAWA 2B31A 4P7OA 4UFJA 5I78A 1XH2A 3RO8A 1PJ9A 2FGZA 1XSKA 2V3DA 2J25A 1FA2A 3M46A 3U5UA 2VUYA 2RGMA 3AZRA 4KGLA 1KWGA 1O7AA 2VRJA 4JCLA 4XX6A 5A6BD 3BAKA 2A3BA 4HPGA 4DUVA 4RE2A 3WNOA 3W82A 2WSPA 5I0DA 1XH1A 1VFUA 4D72A 2WW5A 1W9DM 2WBKA 2J7HA 1GOIA 2D0GA 3BXWA 3PHAA 1CECA 1JGIA 1C8XA 3BGAA 2BY1A 1FFRA 4U5KA 3AS3A 1EOMA 3BAIA 4RE4A 4PMNA 4IISA 3WDJA 1QHOA 4TOQA 4J3UA 1E6SM 3QHMA 4WSKA 5FL1A 3FNDA 3KWXA 4BQ5A 1V02A 3M6DA 4MB3A 1GHRA 1EHNA 1ISVA 3RIKA 3L4UA 1E1FA 5E70A 3VGHA 3WF2A 4GI9A 3WQ6A 4AMCA 5ABHA 1E4NA 3THDA 2V3FA 2E8YA 3SCWA 6TAAA 4W7UA 3BAJA 3TTQA 2D23A 1Q6EA 3CIVA 2WWDA 2DSWA 4EKJA 1BHGA 3W29A 1UKSA 5ECUA 1GOOA 1UKTA 3W24A 4M80A 4WKHA 2XFYA 2J8GA 5A1AA 5GNXA 4JHZA 4L4PA 1J10A 3GXFA 1WZLA 4H8UA 1KXQA 1MW3A 1UWRA 4WIWA 3W37A 4EANA 4D6EA 4CKQA 3AZSA 3BCDA 3BMWA 3ZJKA 3AIVA 3W81A 3D5HA 1IZKA 1UWSA 3VIOA 1KFWA 3VDHA 3RM9A 3WQ5A 1QNQA 4E4PA 2VVSA 2YA1A 4YN5A 2ZIDA 4JKKA 4U5IA 3WBAA 3ZR6A 4ZEPA 4M29A 4OBRA 4J28A 2FHCA 4H8HA 2UWFA 3N12A 3OBAA 3TP4A 1W9BM 2GUYA 3SUVA 1UD8A 1CLVA 1AVAA 2QMKA 2EPOA 1DWHM 2ZX9A 2VNCA 1ZS2A 1Q6DA 1SFSA 2PWHA 1K9DA 1ZJAA 1SMDA 4H2CA 4AXNA 1GOMA 4D6DA 5I24A 1G5AA 5GNZA 1D2KA 3AISA 2MANA 1C7SA 4CVWA 4UFMA 4TVCA 5BXRA 4PSPA 2WMFA 1SR0A 4F79A 4PBGA 3CZKA 1JI1A 4H8VA 1EDGA 2Y4SA 1FHLA 1E0XA 2J7GA 2VVNA 2CNCA 1J0ZA 1UYQA 1G94A 3APGA 2XVGA 4Z2KA 2CETA 3ZT6A 5CSUA 3AOFA 4NZCA 3VIGA 4JFUA 1GQLA 5FOOA 2W4XA 3N18A 2VO5A 3IAPA 2WC7A 2CCRA 5I6SA 2WNWA 1ZBWA 5F7UA 1W2PA 1H11A 3AXXA 2GJXA 4DM1A 4AD4A 3B9AA 1E3XA 2V5CA 3VD7A 1UZ1A 4U3CA 2G3MA 3RCNA 3PZQA 3EMCA 3RJYA 3AHXA 2F8QA 3OGRA 1C7TA 1OD8A 1W9VA 5JBDA 3MUIA 5A8PA 1E55A 3NDZA 4PTXA 4Z2LA 3UG4A 4Z2HA 2WMHA 5CLTA 1NH6A 3VKKA 1EO7A 3W6LA 4AZ5A 5DMYA 2DT3A 4ML4A 3VTRA 4NI3A 1KGXA 1JXKA 5E6YA 1ODUA 4WF7A 3PZMA 2OWXA 1GVIA 3CZEA 3UG5A 1GQKA 2AAAA 1V3KA 4HA3A 1HJVA 4B9ZA 3T2OA 1CNVA 4WK9A 1WO2A 2V38A 4CN1A 1TFVA 2WMGA 1UR4A 3OZPA 2V3GA 3EDDA 1MXGA 3GNRA 3VGDA 1GOKA 2DDXA 2IUZA 5D9OA 2ZUTA 7A3HA 3AS1A 3K8LA 2XWEA 1VJZA 1HL9A 4AZGA 3SCRA 4J3WA 1VFOA 2YDRA 1V3IA 3DYOA 4C7FA 2UY5A 5A95A 3W27A 2C0HA 1SYTA 1RP8A 2F2HA 2BVDA 1C92A 4PYSA 1TUXA 2ZUMA 4PTMA 1I1WA 2WWCA 1FH9A 1GUVA 1KCKA 3WH8A 1KBBA 4KH2A 4MB4A 3T08A 1V6XA 1C91A 4V27A 3KZSA 4UOQA 3AS0A 1GONA 1OIFA 1PBGA 3BAXA 2HVMA 2YKKA 1E0WA 4GZJA 1ESWA 4UTFA 3AI0A 4HU0A 3AYRA 3GNOA 3F5JA 4LPCA 3UERA 2J74A 2NT1A 3GXMA 5FL0A 3B9EA 4YHEA 5CGMA 3L4XA 2YA0A 2JE8A 1EA9C 1H0IA 4UQEA 4GO8A 3AIBA 1PIGA 1AMYA 3VD3A 4OJYA 2CBIA 5E6ZA 1KR1A 2WCGA 3CZJA 4N0RA 4JFWA 3RJXA 2XFFA 3CZLA 5IDIA 2WZHA 1LQ0A 3WD2A 2WVUA 3WQWA 5HXMA 1B3ZA 1U30A 3CMJA 1L8NA 2D0FA 1HKMA 4J3SA 2W62A 1XC6A 2Y8KA 1JYVA 3UR7A 1C93A 2QHAA 3PZIA 1VFFA 2VL4A 4AZHA 1GORA 4TXEA 2XTKA 3WUEA 2EBNA 5M5DA 4OIFA 1TVPA 3VNZA 1W3KA 2J47A 1PEZA 3WL1A 4D1JA 3PN8A 2YBTA 1DWFM 1E40A 1I1XA 1C3FA 3SCOA 1JYWA 3LPFA 4IPNB 1UR1A 1NWSA 3WEZA 2YOCA 1FH8A 3WNMA 3VIIA 1V3MA 1UD2A 4AISA 4MNJA 1JDDA 4X0VA 3TOPA 1V6YA 2WBGA 4BQ3A 1ECEA 1LL4A 1TA3B 2EPMX 1H41A 5A6MA 4OBSA 2WXDM 4M82A 3KL3A 2WC3A 4QDMA 1UH3A 4D6HA 3PZGA 3L2MA 3GXDA 3MSDA 2Y2WA 4JIEA 4K68A 4JFSA 4ACZA 3F5LA 3POHA 4UQ9A 2YLLA 3W4RA 3GNPA 2X09A 3GYCA 1GVYA 3AIWA 4ZE4A 3N04A 4CCEA 1H2JA 1QI5A 2GSJA 3BC9A 3GDBA 4KGJA 1J12A 4HMCA 2YL6A 4PMZA 3RPMA 2V5DA 3A47A 1WDSA 1XSJA 3VDBA 1EOKA 2CXGA 4KRUA 4BZYA 5EB8A 1Q6FA 1J18A 1KGUA 1BFNA 1GNXA 1TCMA 1BTCA 5M03A 2VJXA 4QLJA 4TX6A 1UD3A 4X9YA 5AYIA 1F4HA 5A94A 1BVZA 1M03A 3U7BA 3QHOA 1UR2A 2CERA 5A6BA 4OOUA 3B9DA 2UY4A 1M53A 1NQ6A 4C7DA 4MNKA 2J7FA 3WH5A 2X1IA 1JZ7A 3WUFA 4CU8A 1HJQA 9CGTA 3MO4A 4KMQA 4TTUA 2PWDA 1DWAM 3RMEA 2GJPA 3CHDA 1PX8A 3NYDA 1A47A 1CXHA 1QNSA 1H1NA 3WL0A 5I79A 4YHGA 1JZ2A 1TZ7A 5BRPA 3M7SA 4B3LA 5IFPA 2F61A 2QF8A 3WH6A 4W8BA 3W26A 3PZOA 1G0CA 3ARWA 2XIIA 3T2QA 3O6AA 2YDSA 3QGVA 3ZT7A 5CJ5A 1QPKA 3VMOA 4OUEA 2VZVA 2XYLA 3A4WA 3PZVA 3JUGA 1V3JA 2GK1B 3PZTA 4B16A 5AC5A 5BXSA 5CG0A 2ZOXA 3MKKA 1CBGA 1V0NA 1VENA 2J7CA 1K9TA 4R27A 3MMDA 5HOSA 1FHDA 1JZ3A 3VD4A 1WDQA 2CBJA 2XFRA 2W63A 3FN9A 1WZMA 4PMYA 3WMCA 2CYGA 4AZBA 2O9PA 1JAKA 2ZE0A 1AQMA 1Q4NX 1R7AA 2XSBA 4DM2A 2D3LA 4XB3A 5A3HA 1DEDA 3MV01 5I77A 4W8LA 1TG7A 2XVNA 2WHKA 1LLOA 4UFIA 1ISZA 3II1A 5A2AA 4AD1A 2Q8XA 3VGEA 3OGSA 3WDPP 3ZJ8A 3SCNA 5D4YA 1K6AA 5D9MA 5HNNA 2J8FA 4X0NA 4HZ8A 4HOXA 2JF6A 3K4DA 1FP8A 3K46A 4DUXA 2VX7A 3NDYA 1B3VA 4CD6A 4J7RA 1P6WA 2WVVA 1LG1A 4W93A 4BCEA 4D71A 3AHZA 4HOZA 1JNEA 1MXDA 3K8KA 2WMIA 2EPKX 1LF1A 1X6LA 3DYMA 1OM0A 2NW0A 4W5ZA 1JFXA 1W1PA 3GBDA 4D6JA 1HF6A 1EDQA 4B9YA 5AYBA 3AJ7A 1VBRA 1GW1A 2DT1A 1OB0A 1VRXA 4HP5A 3RM8A 1WP6A 1ISWA 1ITXA 4V28A 3ARQA 3WD3A 3OA5A 1QNOA 1QNRA 4W86A 3PZUA 3VINA 5IXEA 3L2LA 3UEQA 4CUCA 1W3JA 1ZBVA 3RDKA 3W53A 4Y7EA 3WDRA 3F5KA 2GVYA 4NRRA 1I75A 2JFEX 2GJRA 5LA2A 3U7VA 2Y8VA 4CU7A 4P7NA 5JUVA 5A69A 4M8UA 2DEPA 1OSEA 4ATLA 4S3KA 1XSIA 5JBEA 3AIRA 2J7BA 1R8LA 1UOKA 3OIHA 3KE0A 3L4VA 1S46A 5FD0A 4GQRA 1HVXA 2G3IA 2YA2A 5IFTA 1HJXA 1B3XA 5A6LA 3WBEA 4U2ZA 2D20A 3WNNA 1B31A 2E40A 2CESA 2VQUA 1X6NA 1HXJA 1BG9A 2DSVA 3ZJ6A 3WY1A 1R85A 2EPLX 2W66A 4QAWA 4DWSC 1CGWA 1QI3A 4ACYA 4J3TA 1EQCA 4LYQA 1J9YA 4F8XA 2YIHA 5I5RA 1UR8A 1PZ2A 1PIFA 3N9KA 3HJEA 4UQDA 4W8AA 3MUY1 2O92A 1W9XA 1D7FA 4UFHA 5TD4A 3T2PA 2WPGA 4AZCB 2NT0A 4L4OA 1OT1A 1CXKA 4Z2JA 4QLKA 2ZUWA 1EHAA 1B3YA 2CHNA 4A3HA 3TTSA 3T09A 3NCOA 5D9PA 3THCA 2FGLA 2PF0A 3GTNA 1E6XM 1NARA 4PMVA 3UR8A 1XD0A 3WQ4A 2DSKA 2E3ZA 2ZUUA 1IT0A 4TUFA 4R5EA 4E8DA 3GH5A 4J27A 2ZUSA 4GI8A 4AIUA 4P8WA 4Z2IA 3DC0A 2VCBA 4Z2GA 3S2CA 1E6ZA 1VFMA 2ZICA 1CTNA 1LWHA 4OKDA 4Q22A 2X0YA 1HL8A 3AMKA 3FAXA 4F9JA 1B3WA 5JBFA 2WHJA 4J3XA 2BY3A 1OWQA 4PCTA 2BVYA 5E09A 1EIBA 4P7LA 4ZENA 3J7HA 4GO9A 3K4AA 2WLZA 1QBAA 1CXEA 2YL8A 3AICA 1BYBA 3ARTA 2XGBA 5EBAA 1H4PA 3VILA 3VM5A 1V0LA 1OIMA 4HMEA 4F66A 1DTUA 2PWEA 3NIYA 3WKZA 5C70A 3VIPA 5I2UA 1UR9A 1E1EA 5CXPA 4U2YA 4UFKA 2WZIA 4IUGA 3BMVA 3BLKA 1J0IA 3NJ3A 2E9MA 1BVNP 5DEZA 2W91A 1W1TA 1E9LA 2TAAA 5E0FA 5JIWA 1VB9A 2ZX8A 5EFDA 4HOWA 2DH2A 3AIEA 1CEOA 2WANA 4UZUA 3RM4A 3IJ8A 3L4ZA 2WB5A 2VZTA 1JIBA 4HTYA 4AZ6A 3ARSA 1MW0A 1JAEA 4NSBA 1W2VA 1JNDA 3WELA 2E0PA 1SMAA 5FKYA 1JL8A 5A6AA 4AD3A 2ZXQA 4HA4A 1UQZA 5DFAA 1WDRA 1OT2A 1DP0A 4FF5A 3ARPA 3QHNA 1QVBA 1L0PA 3BAYA 1OGSA 1HIZA 4AD2A 2OSYA 2DT2A 2ZUNA 3A3HA 4MDPA 1UQYA 4H7VA 1UZ4A 2BV9A 3POCA 3LMYA 1DWJM 1E6NA 4CCCA 2WKLA 2YLAA 1GJWA 5M17A 3WQVA 3CLWA 3PZNA 1BF2A 5C8BB 2J4GA 1AQHA 3VMPA 3CMGA 3TONA 1XGZA 4CD8A 4FLSA 4WJXA 2VR5A 3N1AA 4ZXOA 1EO5A 2J79A 3BSGA 3N13A 1BQCA 3WQ8A 1CGXA 4P7QA 1GZJA 5ABEA 3G6LA 3IAQA 1H0GA 5D9NA 3MSGA 3ZO9A 3PTMA 2EXOA 2VRKA 3DHPA 4W89A 4JAWA 4MTVA 4M24A 3NUKA 3VX0A 4AEEA 1R7OA 1OINA 2VCAA 3BCFA 4W5UA 1FOBA 5A8OA 3L4WA 2PBGA 4CVUA 1J0JA 3WF4A 1W1VA 2YL5A 4BQ2A 4LYRA 1XYFA 4M56A 3K8MA 3ZJ7A 1JDCA 5BRQA 2DPEA 1FH7A 3WUGA 4QCEA 1UUQA 1W91A 3WDQA 1W3LA 5GNYA 1UH2A 3WEOA 5AY7A 1Q6GA 3CZ8A 1E3ZA 4HZ7A 3CGTA 3ARUA 3PTKA 4QFUA 1M04A 4QP0A 2YL9A 2GFTA 5A2BA 3OZOA 2W5FA 2AMGA 1B90A 2OYMA 3GZAA 1B0IA 2PBOA 2J77A 1M01A 4UQAA 4UNIA 1UD6A 5GQBA 1HNYA 1RD6A 3OB8A 2DH3A 3NSMA 4AWEA 5KEZA 2Y5EA 2GJXB 1XCXA 4TX8A 2PWFA 1PX4A 2PI6A 3ZSSA 5ABFB 3AFBA 3WH7A 3EDJA 3VX1A 3DECA 1E70M 4WLCA 1UHVA 1XRVA 1JZ4A 3ARYA 3QOKA 2QPUA 3MMUA 2XVLA 1QW9A 3B8SA 4S3JA 2G41A 4PRWA 1UD5A 4M81A 4JZ5A 2FH6A 3AMDA 4XZWA 2CIPA 3TTOA 1XHGA 4AIEA 1C90A 4CD7A 1QHPA 3MUZ1 1TMQA 4DWSA 2Z1SA 1JF5A 1MW1A 3SCUA 3ARZA 5CPQA 4CD4A 5FIPA 3VGFA 3CO4A 2OWCA 4TVUA 4EE9A 1WNOA 1CXLA 2J62A 2JEPA 5AC4A 4W7WA 2VZUA 1HKIA 2G3JA 3E1F1 1E4IA 3CPUA 3VDCA 4LGXA 1JZ6A 4LYPA 3EDKA 2D3NA 1QOXA 3ZIZA 2D1ZA 1QI2A 2CBVA 1UKPA 2DQXA 3MS8A 3VIHA 2D2OA 2BHZA 1BYDA 5CPTA 5DT7A 3RILA 4IM4A 4E2OA 5A8MA 2OSXA 1Z32X 1J01A 4WKFA 1E43A 3W25A 1IV8A 1QBBA 1ODZA 2XGIA 5CZKA 1VF8A 5E0CA 7CGTA 4PMUA 1NP2A 1LJYA 2XHYA 2FDMA 2UY3A 3A4AA 3I3DA 2BXZA 2QV4A 1TA3A 1OBAA 1VJSA 3SCSA 4AW7A 2A3EA 4W87A 5ABFA 1JZ5A 2DGAA 3F4VA 1E4LA 3ARVA 4FMVA 4AZIA 3AIUA 1GCYA 4ACZB 2G4FA 2BY2A 1HX0A 3SUUA 4N42A 3VU2A 1JI2A 2VCCA 1C8QA 3SEPA 2G8ZA 1U2YA 4DWSB 1J11A 5BXPA 3FHAA 2OYKA 4JKLA 1V0MA 1H3GA 3GH4A 2VT0A 3QR3A 1NWRA 4HU8A 5D8WA 2WKGA 1MWOA 1UWQA 1MQQA 4GKLA 3VD5A 3EMQA 4MPKA 5CQ1A 5BYWA 1KQZA 1ZB5A 1UKOA 2XIBA 2XG9A 1W9PA 1NM9A 3VNYA 2JALA 4W84A 1M7XA 1UH4A 2BNJA 4AZ7A 3NSNA 3GBEA 1GHSA 5CSYA 4UR9A 1WZAA 2QLYA 4HZ6A 1KR0A 2WMIB 1JDAA 4GI6A 2OSWA 3WDIA 2EQDA 4GINA 2WLYA 4UOZA 2CHOA 3WD1A 5A8QA 3VPLA 3MV11 4UQCA 3GM8A 2PWGA 2OYLA 3I3BA 2NSXA 1V3LA 1KXVA 3TTYA 5BWFA 1QI4A 1D3CA 2D24A 2YDQA 3SCPA 2XM1A 4D6GA 3KL5A 1MQPA 4CGTA 2BY0A 4V2XA 3T0AA 1JZ8A 4DUWA 4MNMA 2XJ7A 4JL2A 3AS2A 3OG2A 3SUWA 3L4TA 3AROA 2BXYA 3ALFA 3EYPA 2DSZA 1CYGA 1O6IA 1E72M 1HKKA 1NOFA 3ECQA 1KXTA 2WHLA 3ZM8A 3LPOA 1NP0A 3M07A 1BYAA 1CIUA 4UFLA 3WMSA 7TAAA 3IANA 2JF7A 3W6MA 4CD5A 1CZ1A 3CUJA 1IZJA 1EQPA 1VIWA 1DHKA 3WNPA 1CLXA 1E5NA 1HJUA 2E4TA 5HPOA 2VX4A 3MMWA 2VX5A 3MUAA 1B1YA 1NWUA 4KRTA 1U33A 4FK9A 1CPUA 3AHTA 3AMLA 1FP9A 1OGGA 3PZ9A 3WUBA 4AC1X 4B3KA 3LPGA 3O2LA 3N15A 3DYPA 1B2YA 3VIFA 1GQJA 4UQBA 3WMBA 1KB3A 3WENA 3WD0A 2G3NA 3BH4A 3T0BA 4RL3A 1HJWA 2W92A 2WC4A 2GDUA 1CDGA 4MDOA 1JF6A 3OGVA 4PUDA 3VM7A 1MVYA 4MJ2A 1HP4A 1E73M 1UKQA 2HISA 3KL0A 4D1IA 2RGLA 1E6QM 1H49A 2ZWYA 1A3HA 4PMQA 4RE3A 5A6JA 1LL7A 4P8XA
chains in the Genus database with same CATH superfamily
2ZA3A 1ZCCA 3JS3A 3H21A 1O60A 4O1FA 1YKWA 3CHCA 3ZT5A 4P7RA 3WF0A 4XKMA 1T7LA 1EH9A 4LUYA 1OCQA 3T40A 4MB5A 5EMYA 1H51A 1M7PA 4XV0A 4JCMA 4GGHA 2VI0A 3KHJA 3CAWA 2DIJA 3BQ5A 2RUSA 4H83A 2GQ8A 2WSKA 4MYXA 3UETA 2O9RA 2ZRYA 2V3EA 3NZRA 2BWGA 5C7HA 3E96A 3FEQA 4Z1BA 5AB3A 4FIRA 3SGGA 1WKEA 5HDRA 2VD9A 4IPLA 5HANA 3OQEA 2PCQA 1AZ1A 3M0VA 1PO9A 4YPJA 4OQVA 3D3FA 3EEGA 4TTGA 4CCDA 3FAWA 2I5IA 2XM2A 4UIOA 1NIUA 5FF2A 1US2A 3HMCA 4S39A 4XVEA 4D6IA 2EG7A 1FQ0A 1G7UA 2GZXA 5LA0A 3LTSA 1HKWA 2YPIA 4LC6A 3LI0A 2FTYA 4P2VA 4DLMA 1V6UA 4U33A 4KF1A 2FH8A 2C19A 4J4KA 1UWTA 2XZ9A 2H8XA 4NYYA 1WPCA 2W79A 2PDLA 1MQRA 1UPPA 3PJWA 4OOZA 1WCGA 3KOWA 1UD4A 5J5RA 4IHCA 4O53A 4QBXA 3DHUA 2Z26A 2ZXAA 2WSYA 3S1UA 3QZAA 5D38A 2OOGA 3JW7A 4LS1A 3PPHA 1EEPA 4C7GA 4HTBA 5KMYA 1E5JA 4QR6A 2VFEA 4B4HA 2VD8A 2VZOA 4Y90A 3R25A 3UFYA 3ABQA 5CSSA 5AVHA 3LHZA 4ATDA 1OC7A 4UTKA 2GPTA 4QJ3B 1V6VA 3W28A 2VWSA 4J35A 4DXKA 4L1WA 2FZMA 3TYUA 3ENLA 2VOTA 1BYCA 2VC9A 1LBFA 1REQA 4JFTA 2WZEA 1JDFA 1UJPA 5AN7A 3RLGA 4DX3A 3TFXA 3CTTA 3RLVA 1BRLB 1T8QA 2E6DA 1TWDA 1KM1A 5DX7A 4US5A 4FAMA 4MAZA 4JKMA 1N82A 2FHBA 1BSLA 5FI8A 4O18A 4B4FA 3REQA 1ZSXA 3IACA 5H8MA 1KTBA 1NQKA 1VBJA 2VRQA 4LBRA 1TJ2A 4LC8A 1U5JA 4GK8A 2HS6A 3N25A 4GE8A 3TWAA 4AD0A 1TPEA 1VEMA 4XUYA 1CGVA 2NLIA 4HYVA 1A80A 1TJ0A 3T4CA 5I23A 3U9IA 4N6EA 1VHNA 4EK7A 3VD9A 3KBSA 4AEFA 4LCRA 1CWYA 1PWMA 3EB4A 2QNEA 4WKAA 1P7TB 4XUGA 2A3AA 3GW3A 3WH9A 3V4BA 2Z2BA 4AHOA 4DEFA 2F6KA 3E02A 4AY8A 1W37A 5FF3A 3QV7A 5M3WA 1XRSA 4EX4A 4RPQA 3W84A 2BHUA 1A4MA 4PB4A 1GPFA 5FJOA 2GK1A 3AHYA 2W61A 3I6EA 3ZR5A 4GPNA 2FFCA 5AC8A 1I2RA 1UWAA 1MI3A 2VR4A 2YYTA 3VVGA 1XH0A 2ADAA 1FWDC 2YXXA 2XIJA 2X2YA 4GFSA 4AWSA 1NDZA 2VURA 1BXCA 4J1OA 1VPYA 2WJFA 1TPB1 5H1WA 4IIEA 4TVDA 1PAMA 1EP3A 3SB0A 1HL2A 4JQAA 2CPUA 3HA1A 3S1GA 3EXSA 1M5WA 2V81A 4FOUA 1A5MC 3S9YA 4LAMA 1QJWA 4O52A 2Q02A 1PSCA 3WD4A 3H2NA 2VMFA 3N29A 3R5EA 3UZJA 3UPMA 3H8AA 4DZAA 5CJMA 5LSMA 4PB3A 4CQBA 3U48A 5XIMA 1TV3A 3RPTA 4LEQA 4H6QA 1Z42A 1EP2A 4HMDA 5K9CA 4PULA 1YADA 1JD7A 3QKZA 2VTFA 3AZTA 1RCOB 1E51A 1JUEA 1KM2A 1YHTA 3R79A 2HTMA 3LY0A 4LCQA 1ISYA 1F61A 3N11A 4O0KA 2P0OA 5AHFA 2V9DA 1HT6A 3WNLA 4XO6A 3LGEA 2E9BA 4MY9A 4BI6A 2VC7A 2PDFA 3S9IA 1GKRA 3QC3A 5A8NA 3K1DA 3Q37A 5A6SA 2E6FA 2MUCA 1W56A 1CENA 3W7NA 1V02E 3EDEA 3CHFA 1KV5A 1VEOA 3D3AA 5I3DA 1KBLA 2O9TA 3VIMA 1FWCC 5DT5A 3KOYA 2C8NA 2OELA 4HT3A 3EEZA 3H2FA 3W7LA 1BSIA 3WNKA 3H7UA 3TYEA 1S2UA 1YQ2A 1ZQ5A 3ARXA 4O1AA 1BGAA 1XXXA 1RH9A 4IJBA 2WMKA 4PBEA 3QOMA 3ANVA 1WX0A 3PY2A 2GOKA 5T9BG 1ONRA 3UG8A 4H41A 4PA8A 1LG2A 3ONCA 1ZBCA 2QVNA 4JN8A 3UXAA 4KWWA 4ZXLA 4ADTA 3WJWA 1NTHA 4R53A 1JG9A 3SCQA 4LX4A 3SJ3A 1Q7MA 3GQYA 1Z9AA 1SR9A 2AQVA 4JNMA 5ABGA 1KBKA 4IWWA 3AAMA 3NO1A 2WVVB 1UC4A 3MDWA 4DRSA 3EWWA 3C3NA 2G50A 2PB1A 2FB2A 3I68A 4AY1A 5FSEC 1Q4WA 3BZGA 1XQLA 5IHSA 1LM1A 2CEQA 1K8XA 2UV8G 4B5WA 1V3HA 3CQJA 3OLIA 4QM1A 1TE1A 4PEEA 4AF0A 1EGZA 1WKYA 3FS2A 4PMOA 2Z1KA 3MA8A 2GGJA 2GSEA 4ORMA 2UBPC 3TNBA 3O0FA 4F3HA 4NYUA 3R10A 1AJ2A 1R3YA 1MRAA 4C60A 2P5NA 3W2UA 4GY7A 1KM5A 3C52A 1AH0A 4YU1A 2CZVA 3E5BA 2BTMA 3CYJA 1SW0A 1KM6A 2J13A 5D2WA 3IGUA 1JCMP 1AH4A 2JQXA 3QLLA 3P5YA 1FA2A 3U5UA 4IQLA 2RGMA 1D3HA 4KWSA 3AZRA 4KGLA 2OT0A 1AW1A 2Y70A 5A6BD 2A3BA 5G2WA 4KESA 3N73A 4DUVA 3GG8A 4RE2A 3DFPA 3E0FA 4NVTA 3H22A 3H7VA 1IYXA 4WY0F 1XH1A 1VFUA 4D72A 3C5QA 3OHMB 2WBKA 2IQTA 1CECA 1DJYA 1C8XA 4M1BA 3BGAA 2BY1A 3UD6A 2DW7A 1OHLA 1EOMA 1F7BA 2Q6ZA 4BKNA 4RE4A 2DZPA 1U22A 4RNJA 4WSKA 3FNDA 2VEKA 3SGUA 4O0ZA 3PUDA 1EHNA 4YXGA 1ISVA 3EZ4A 3L4UA 3VZYA 5I3GA 3WF2A 3WQ6A 4LUJA 1KFLA 5AKQA 9RUBA 1XLCA 2D23A 1Q6EA 3CIVA 2ALDA 1H1ZA 3W29A 2AL2A 5KETA 1GOOA 5A1AA 4RX0A 1DJHA 1POJA 2JKPA 4JHZA 4DJFC 4A3UA 4MJMA 1TRIA 1SO4A 4H8UA 3RF9A 1KXQA 3EWBX 4QITA 3W37A 1DOSA 3URQA 1KBIA 2C14A 3AZSA 3ZJKA 3AIVA 1VCVA 3KBVA 2IPGA 3ZVIA 3RM9A 5KTLA 3PFMA 2ZIDA 4JKKA 3WBAA 3GAYA 3ZR6A 4R88A 4AX7A 4M29A 3S9ZA 3V5OA 3QJAA 2J9XA 1XJBA 1W9BM 2GUYA 4LVGA 4IMDA 2OGJA 3WQDA 1CLVA 2QMKA 4ZO7A 1Q6DA 5C7VA 2ZYFA 1RQBA 2PWHA 3EWXA 1GOMA 3WLSA 3B8WA 3MUCA 5GNZA 3R7MA 3IS4A 3B04A 2MANA 4CVWA 4UFMA 2WZTA 1KKRA 2WMFA 4F79A 3CEUA 4PBGA 2QAFA 1IGWA 2BASA 1FHLA 1E0XA 1SW7A 1IEVA 2VVNA 1TX2A 4AVFA 1RK6A 2XVGA 4Z2KA 3EPNA 3MCNA 5CSUA 4DI9A 4NZCA 3UP8A 1UZDA 1EIXA 1GQLA 1CT5A 2W4XA 3CWOX 5LNUA 1LLZA 4HCHA 2P76A 1ZBWA 4UTHA 1H11A 5BU6A 4F48A 4AD4A 3BW4A 1IR2A 1UZ1A 2HZGA 3RCNA 3PZQA 2ISWA 3QMSA 4V1YA 2CLKA 3A5VA 1W31A 3AHXA 3OGRA 2JGQA 1C7TA 2X1RA 4HSNA 3B8VA 3MKVA 3MUIA 4MUZA 4JEJA 4PFHA 4YTRA 4YS1A 5SWUA 3UJFA 1EO7A 4AZ5A 5DMYA 2DT3A 5G1YA 5I3FA 1DJNA 4NI3A 3EOOA 3G5EA 3DHFA 3HB9A 3KRZA 1B57A 1ADSA 1V3KA 3WBYA 4B9ZA 4EPBC 2V38A 3NPVA 2WMGA 3LS9A 1UROA 3EDDA 3GNRA 3EOLA 2OOFA 2DDXA 1FWFC 3NM1A 3MYPA 4B5VA 2IUZA 2OT1A 2ZUTA 3AS1A 4LBUA 3H26A 4KCTA 3T78A 4AZGA 4LOCA 1TREA 3SCRA 4RLIA 1IT7A 2YDRA 1V3IA 4MYAA 1QWGA 2UY5A 3L65A 2HROA 4GX9A 4HPJA 4OV9A 4ASTA 2WWCA 3PM6A 3H12A 1I9CB 1ONEA 4KFPA 2ZKMX 1KBBA 1V6XA 4UOQA 4V27A 3UJ2A 1JPMA 4WDTA 4QS5A 2HVMA 3PBMA 3IGHX 1UR3M 1EPXA 3NG3A 3C2OA 4UTFA 3AI0A 4AF0B 1RLDA 2HRWA 2O0TA 2DW6A 3RK8A 4RXFA 3C2FA 1XLHA 2JE8A 1TX0A 1X8FA 3TDFA 5F4SA 2OR2A 3PJUA 1KKOA 3LYEA 4A3RA 4OJYA 3CASA 2CBIA 4Q8VA 1BD0A 5E6ZA 1KR1A 4G8TA 4U10A 4N0RA 3RJXA 2XFFA 1H7NA 1TV2A 3QV9A 3GVQA 5MKGA 1LQ0A 3IIVA 2WVUA 4CNUA 1B3ZA 1U30A 4Z42C 1L8NA 1XC6A 3KDNA 2BVWA 2QHAA 4YMZA 1AODA 3PZIA 5G2HA 1LLWA 2HDJA 8TIMA 4O13A 5D2TA 3WUEA 2IMRA 4BHYA 1WA3A 4MIMA 4JYDA 4S2CA 3DDMA 3EKLA 3OG3A 1HFBA 2VFDA 1W3KA 1OFPA 2E25A 2J47A 1C9WA 3CV6A 4D1JA 2WKJA 2CLMA 5I3JA 1DWFM 4Q32A 1VS1A 4JHMA 3WNMA 1THFD 1YPFA 3U4FA 2WBGA 1ECEA 4M7SA 2QUVA 1MEIA 3BW3A 2WC3A 3TTEA 1HTIA 1UH3A 5HATA 3PZGA 3RN6A 4ZQPA 2QKFA 3GXDA 4DNHA 3MSDA 4JIEA 3F5LA 1RR2A 3GNPA 4I9AA 4WOQA 3GYCA 1GVYA 1GVFA 3UZXA 1QI5A 2GSJA 3DOPA 4H1ZA 2P53A 4KGJA 1UUMA 2PDBA 5FJRA 4C6IA 2PP0A 2DZBA 5T91A 1GKPA 3UY8A 4H9YA 5TAOA 1EOKA 1FDJA 3WLTA 4BZYA 5EB8A 1Q6FA 1BFNA 1GNXA 1EPVA 4JTRA 2HJPA 1XUZA 2PLJA 1M03A 4LH8A 2TMDA 3U7BA 2CERA 3HPFA 3VXGA 1WUFA 1M53A 1O94A 4LB4A 2J7FA 1MZRA 3WUFA 1ZLPA 4EXBA 4KMQA 1JJKA 2CZFA 4TTUA 8XIAA 1C8VA 3GIYA 1R30A 5G2IA 3RMEA 1DWAM 3CHDA 2YR1A 3NYDA 2VM8A 3H2OA 3KAOA 1VZWA 3WL0A 3QPEA 1A5LC 1UCWA 3W85A 1TZ7A 4FX6M 4B3LA 4DO7A 2ISSA 2QF8A 3CS2A 4XAYA 3PZOA 4L9XA 3M0JA 1SSDA 5K3VA 2IQDA 2XH7A 1DIOA 3ZT7A 4AUBA 1QPKA 3WLPA 4OUEA 2C0AA 4S23A 2XYLA 4K8GA 3N2OA 1LT7A 1W54A 4A8IA 1XISA 3PZTA 3BE7A 4PRTA 2A85A 5CG0A 3MKKA 5FJPA 3RITA 1FWWA 2R24A 3QFEA 3O63A 1CB2A 4NJJA 4YCPA 3NL5A 1JZ3A 2XFRA 3WMCA 3FN9A 4J2MA 1M7OA 2PTYA 4H00A 2O9PA 1AQMA 3GXTA 3T1GA 2OQYA 4XB3A 5A3HA 4IMCA 5LXXA 1DEDA 3KVJA 2P8BA 4AD1A 4O54A 3VGEA 3GDRA 3DXIA 3SCNA 1BWLA 5D9MA 2J8FA 4HOXA 2W3ZA 1L8PA 3Q45A 2GJNA 3K4DA 1FP8A 4KEVA 3K46A 2OPJA 3FVDA 2VX7A 3KVKA 3G1DA 4J7RA 1PDYA 2WVVA 4W93A 5AHMA 3OOQA 1ONXA 1H7OA 3CAVA 2EPKX 1LF1A 2QCCA 1OM0A 4OECA 4L61A 1Z69A 2EKGA 3F2BA 4B9YA 2DORA 5AYBA 3NM3A 1ZP4A 4TIMA 5BMWA 3LMZA 4IIGA 2OZTA 4XISA 2DT1A 1VRXA 5CG7A 4HP5A 4OWGA 3RM8A 1OFDA 4F40A 1RHCA 3QVQA 3B8IA 4ZOAA 4EF8A 3DU0A 3NQEA 1H50A 3VINA 3W7EA 3UEQA 4CUCA 1Q6OA 1ZBVA 4Y7EA 3IV8A 3M0IA 2GJRA 5LA2A 2R8WA 4B5XA 1NEYA 4P7NA 3P74A 4M8UA 1OSEA 3C8FA 1OFAA 1UOKA 2WSRA 4Q4RA 5FD0A 2VP8A 2PDMA 2G3IA 2YA2A 3OHIA 3UWZA 3QC0A 4WXZA 5IFTA 5A6LA 3BSMA 1E1CA 2E40A 4KPLA 1X6NA 3KXQA 2DSVA 5DANA 4UR7A 3DFOA 3M6YA 2VFIA 4F0RA 2ZRUA 4LAUA 1FCBA 1F6KA 1EQCA 2YSWA 3GDLA 2E1DA 4UQDA 8XIMA 3F4DA 1XBXA 4O28A 4UFHA 1AFSA 3TIMA 1IXNA 4AZCB 2NT0A 3LCWA 1QATA 3IEBA 1KV8A 2PGFA 3HBLA 2DVUA 1EXBA 2Z27A 4GUFA 3BWWA 1UPMB 4A3HA 1XPGA 3OVGA 5M2FX 1I2NA 3GTNA 1NARA 1QPRA 3WQ4A 4R5EA 2NZLA 4MKSA 3GH5A 1DTNA 3W7KA 4GI8A 4P8WA 4Z2IA 1TYGA 4Z2GA 4NZ4A 1E6ZA 3NPXA 1P0NA 1QAPA 3PNZA 3AMKA 1W1IE 5J8LA 3TV8A 1GPWA 2WHJA 4J3XA 2BY3A 4HK7A 1OWQA 3FOKA 4PCTA 2BVYA 1Z44A 3GZ3A 4I9JA 1NFGA 3CL7A 2GGIA 1CXEA 3ARTA 2XGBA 3D47A 1FWSA 3VILA 3T0TA 1OIMA 3UZYA 1DTUA 1KCXA 1LQ2A 1VPXA 3WKZA 4JNYA 2I1OA 3TYCA 1UR9A 1TMHA 4BI7A 5XIAA 4H01A 1J0IA 3CV7A 3JVAA 3A12A 1E9LA 1ITQA 1VB9A 4O4VA 1XFBA 3A3WA 2DH2A 1ZALA 2WANA 2RJGA 4C1LA 3L4ZA 1JIBA 1JAEA 5C2XA 1JNDA 4RDVA 2E0PA 4I3GA 3F4CA 4NQ1A 4Y9NA 1JL8A 4WX2A 3G8RA 2I57A 5DFAA 1WDRA 3B0UX 5HJLA 2PDQA 1ML1A 1OGSA 3KCOA 3H2CA 4ZGYA 4MDPA 2BV9A 4QE4A 1R3TA 1E6NA 1SZRA 2PZ0A 2V67A 4IGSA 3B4YA 3H4XA 5TQLA 1RCQA 4HHHA 3U3HA 3PK7A 4HNVA 4FLSA 5KZDA 3IGSA 4UMBA 1EO5A 2J79A 2O7SA 3BSGA 3N13A 4NJGA 1ZP3A 4JQ1A 4O0QA 3U2EA 3WQ8A 2XISA 1GZJA 4C65A 5ABEA 1ZTVA 2O7QA 3LCLA 1U5HA 3NOYA 1WXYA 4N4PA 3VX0A 4GYKA 4K1GA 1GT8A 4A05A 4OBTA 3B0PA 3EXRA 5T8GA 3L4WA 2PBGA 3V16A 4O1DA 4GGBA 2NUXA 4X9SA 1W1VA 1KRBC 2ZVRA 2ZZ4A 3GS6A 1IXOA 3TYZA 1OX4B 3F03K 2X30A 4ZOCA 4I7WA 3WDQA 4LVFA 3PAJA 5BOFA 2TSYA 4GIEA 5AY7A 1PE1A 1A4LA 1L6YA 1Q6GA 4QG6A 4HZ7A 4L4MA 3W1QA 5L6UA 3N4AA 3L0NA 1OYAA 1W17A 5B80A 2Y7DA 3GZAA 4LSBA 3RR4A 1B0IA 2J77A 4UNIA 1W8GA 4B5NA 3UR5A 3HO8A 2Y5EA 5K7JA 1XCXA 4E3VA 2PWFA 4DF2A 2J6XA 3LM3A 1K77A 3TX9A 3LHWA 3ARYA 4R33A 3GE7A 1SM9A 2XVLA 1HO4A 1REQB 3ANYA 3B06A 4XZWA 3G1YA 4AIEA 4Y9AA 1QHPA 1TMQA 2PLMA 3STEA 1TQJA 2DJLA 4CD4A 5FIPA 3VGFA 1SFTA 4AWTA 1OK4A 3M5VA 5BZAA 2IPJA 2G3JA 4C90A 5HULA 3WQOA 4LGXA 3MDUA 1OCNA 2QULA 4C6CA 3W76A 4JTJA 3L2IA 3ZIZA 1UB3A 4XZMX 1RVKA 2D1ZA 2YZ5A 3MCMA 5EY5A 3GNDA 2XGZA 4DBSA 1EGVA 3DBPA 5CPTA 2DFAA 3RUBL 4E2OA 3CB3A 4HCDA 3W70A 2QEZA 4MFDA 5A8MA 5FESA 1Z32X 3OW1A 4XD4A 3SN1A 1QBBA 5E0CA 2CW6A 1SUXA 2QV4A 2ZVIA 1VJSA 4AW7A 4P5UA 4GY1A 4XD5A 2A3EA 1JZ5A 3OIXA 1E4LA 1AJZA 4AZIA 4O12A 5TBOA 2BY2A 1HX0A 3WQEA 1YE6A 4N42A 3VU2A 1F6PA 3LQLA 4YLWA 1T40A 2GLKA 2YX0A 1IWAA 1U2YA 3UF9A 4DWSB 4LVBA 4M51A 2Z00A 1W3NA 3GH4A 3QR3A 5D8WA 1MWOA 4GKLA 1K8CA 3E38A 7REQB 2XG9A 1W9PA 2JALA 2G3FA 4QSHA 1FWRA 4A21A 4LAOA 2BNJA 1P1XA 2CZ5A 4PRRA 1I2PA 1TIMA 1GGOA 1PTAA 5C9RA 3G1RA 4IJRA 2QIWA 1OYBA 1DVJA 4HZ6A 2OX1A 2WMIB 2OSWA 2EQDA 4IIFA 4GINA 2WLYA 4NX5A 3WD1A 3VPLA 3KBNA 1RJPA 2YXGA 1XYBA 3HV8A 1QW7A 2ZA1A 3TTYA 5LIUX 1QI4A 1IEWA 2D24A 3SCPA 2XM1A 3KL5A 3ERPA 3M5ZA 4V2XA 4DUWA 1S5WA 4JL2A 3VNJA 3PFRA 3SUWA 5LNRA 4ADUA 3L4TA 2Z7KA 3MC5A 3P3BA 1TZ9A 2GOUA 3CV2A 3EYPA 4CQ8A 3LERA 3ECQA 2EF9A 1KXTA 3LPOA 4MOZA 3XIMA 2XN1A 2PZNA 4UFLA 1Q45A 4LW7A 3WMSA 4GKTA 4C1NB 2JF7A 3LCHA 3W6MA 1CZ1A 3C2EA 2VEFA 3WNPA 4E0CA 1CLXA 2E4TA 1Z7AA 5CGQA 2GQAA 4RZ6A 1W1ZA 2VX5A 3W2NA 1B1YA 1WOBA 4RE0A 3E2VA 1TV4A 4FK9A 1CPUA 3AHTA 3GR8A 3TUUA 2V30A 3WUBA 3TCEA 3ZS4A 2TPSA 3DYPA 1B2YA 4XSMA 1LZOA 1A5UA 3WD0A 2ON3A 3GK0A 3ISIX 4Q6JA 4IJCA 3BH4A 1Q13A 2DVTA 1HJWA 2WC4A 3W71A 1CDGA 4MDOA 4UMCA 1JF6A 5K9DA 1SO6A 4PUDA 4JTLA 1A5BA 1MVYA 4LANA 2GDQA 2RGLA 1E6QM 2POZA 2CZEA 3L67A 1XCWA 2A7PA 1XIGA 3G0UA 2H3DA 1DBTA 3P80A 4GIAA 4LU0A 4MFEA 1VC4A 1KFEA 5BCAA 1TTPA 3GXIA 2XIMA 3SQLA 2X0HA 3UY7A 3GH7A 3ZQ9A 4HKPA 4FXFA 8CGTA 1PIIA 5HMDA 3G6MA 4PMJA 4MHBA 1O5XA 2OU4A 1TPH1 1OFBA 3VE9A 3CUFA 1U83A 3WX7A 1UA7A 1Q7ZA 1P1MA 2PDHA 2X42A 3KWSA 3CQ0A 1TO3A 2E5CA 5LNWA 1G1YA 3QSRA 4DN1A 2PDXA 4ZE5A 5KZMA 4JIRA 4CU6A 2X40A 1J6PA 3FYOA 1O5RA 4QLLA 4O11A 4NJIA 4REQB 1XG4A 1MZHA 1E71M 4F0KA 2W67A 1XIMA 3BSHA 3NZGA 5LIWX 4PUEA 3BLEA 4ES4A 3NSXA 2NSOA 1QNPA 3PUGA 4A3QA 3FSUA 2Y62A 3LM7A 1DWGM 4OT7A 3W0KA 4DVOA 4P61A 3CV1A 4QJ4B 3BMXA 4BA0A 3SO7A 1Z3NA 3M1ZA 2HPIA 2QJMA 4QJ1A 4OZOA 1KM0A 1WE5A 3CUIA 3TA9A 3CZGA 4GUHA 2IQ0A 3UG3A 1YNYA 4NAFB 1E0UA 4D2JA 1XYCA 3HIJA 4H9UA 4BEUA 3CL6A 4QG8A 1H7XA 4QCFA 1A3WA 4HGXA 2OKOA 1LOLA 1XWYA 3ITLA 2REQB 4XZBA 2A3CA 4JTSA 4OUIA 7PTDA 5H2ZA 2NUYA 2VOMA 1CXFA 1OD0A 2A3HA 1H1YA 3M0MA 4AFYA 2G37A 3TSBA 4PN2A 4ZTXA 3MB9A 3NQ2A 1VBUA 3D46A 4JBRA 3IIPA 3WIJA 3FHQA 4G7FA 2PTDA 1XIBA 1KLYA 3L5AA 3PNUA 5FF0A 4JTGA 4A2SA 1SQ7A 3VOCA 1Y7VA 2O4MA 4NRSA 4H04A 1LBLA 2B7QA 3GKAA 4KEMA 1W9UA 4IP5A 2NXGA 4GH3A 5C55A 3THAA 3WLHA 5CZSA 3SN0A 1FXPA 4IIHA 3NZ1A 3PTQA 2BHYA 4QE1A 4REQA 3EWZA 4ZQMA 3VIJA 2XIQA 3OP2A 3OO2A 3EBVA 1CGYA 1NY1A 3N17A 1J0HA 1VBGA 2EO7A 3UXIA 4A8LA 4DBDA 1HP5A 3ZWSA 1J96A 1OGBA 3CHEA 4O19A 5EMUA 3KX6A 1SGJA 4GUJA 4AVOA 1JD9A 3OEXA 4UMAA 1OF8A 3AXHA 4U28A 3TMQA 2AQWA 2HVOA 2BVTA 1R38A 2G5WA 2W0UA 2CFFA 2E9LA 2QCGA 1H09A 3NTYA 4MSSA 1LWJA 3D6NA 6CGTA 4I8DA 5CBBA 1FKWA 2ZTJA 3NVTA 4GRSA 3HTWA 5CLWA 4GJ1A 3PR2A 1ISXA 4UZSA 3WFLA 1EYWA 1GQIA 1MFUA 1ME9A 2DSUA 3LNMA 2GVLA 3ME3A 3K13A 3APTA 2ZWZA 4L4LA 4D6FA 1MDLA 2V68A 4UUIA 4W85A 1RA0A 1Z41A 3P7YA 4KQNA 1UWIA 4L56A 4IMAA 3C0QA 1KLZA 4J40A 1B9ZA 1AL8A 1DWIM 3CUHA 1KQYA 1NFBA 9XIMA 3S46A 1E0VA 3L7RA 1EJWC 3M16A 5HAOA 3STGA 1SZEA 4UTIA 3B9OA 3ALGA 1JYXA 4F9DA 1TWZA 1J0YA 3DI1A 4FXSA 1JGMA 3LDVA 3O05A 3HQ1A 4Q4KA 3LHYA 2CKRA 4LFYA 5IHRA 3VDGA 3MI6A 5CZTA 4JFVA 2CITA 5HPCA 1V93A 4KWOA 4W7VA 5KSWA 4L80A 3WQCA 1EGMA 1MYRA 1GJUA 2DZUA 1S1PA 3SBFA 4IFKA 4HIBA 3HGRA 2C7FA 5LYRA 1XKJA 3QFWA 2PTWA 3UT0A 3T0DA 2R9RA 4ZL1A 4ONVA 1ZENA 4KCUA 3LXAA 2RHGA 5EGRA 5PTDA 1HVQA 1ZU8A 4FR1A 4LV9A 3WDHA 2UY2A 1OC5A 2YZRA 5C2GA 4GXPA 4GZIA 2XINA 1OG6A 3DZ1A 3V0SA 4BK9A 3L4YA 4AYSA 1R87A 3APYA 1A5AA 5DQPA 3UJEA 4TO8A 5AFDA 4HPXA 1I4NA 2VFHA 2EKCA 4UR8A 4JPGA 3G0XA 1RK5A 3VMNA 3H4WA 2J6VA 2J9ZA 4ERIA 3L5MA 3BAWA 1VEPA 4B15A 3LN3A 3C2YA 3IJ7A 4PCSA 1LT8A 4URIA 2QUUA 4JDBA 4KWUA 3HU7A 3FXYA 4E38A 2ZCGA 5EL1A 4ZQOA 3K1GA 1IEXA 4G5DA 2NQLA 1W5PA 3SIMA 1DORA 2DQWA 3AQUA 1V6WA 2VX6A 5H6HA 1NWTA 3VKAA 4XZNX 3V18A 3GW0A 3TAOA 3W87A 4MZ1A 3MBFA 5H8UA 3P0XA 6ALDA 3SRKA 2XVKA 1E9IA 4XZLX 4MAVA 4D9PA 5FCZA 1HJSA 1QCWA 2JEQA 4M6PA 4DO5A 2WVSA 4P7OA 2VUNA 3VOGA 5DMLA 1JCNA 2ABAA 1A3XA 2VC5A 4UTWA 2FGZA 2J25A 3MSYA 4CLMA 5CC5A 3M46A 2VUYA 4K3ZA 3H2EA 1O4UA 2FZ9A 1KWGA 4XX6A 2I14A 3GNNA 3BAKA 4TU1A 2FIQA 4PUJA 4XD3A 4GVIA 3W82A 5CBJA 5I0DA 2EPHA 4HNTA 3QXBA 2PCEA 1W9DM 3VKJA 5LGXA 1VBHA 1JGIA 2VFGA 4OE7A 1FFRA 1YTEA 4U5KA 2VEPA 1VIZA 3AS3A 3ATYA 4PMNA 4IISA 3WDJA 1QHOA 4JTTA 2OXNA 1E6SM 1F5ZA 3GDTA 1K70A 4S3BA 4PUMA 3GHTA 3KOFA 3M6DA 4OV4A 3MHUA 1J5TA 3RIKA 3DI0A 2Y5JA 1DQXA 5ABHA 4A8NA 1TQXA 4G1NA 4Q8MA 2E8YA 3BW2A 5FA5A 3V1HA 4GJIA 2DSWA 1BHGA 4XD6A 3W24A 4XO7A 3TA6A 4M80A 4Z08A 3T05A 5FEZA 2HE5A 2QCNA 1MW3A 4JS3A 5D05A 5HNUA 3WO8A 1J5SA 4D6EA 5LHFA 2A2IA 4N4QA 3ZYZA 2R94A 3BMWA 2DV0A 3NPWA 2FZDA 1KNWA 1IZKA 2OKTA 4R9OA 4UTUA 1P0EA 3E0LA 1B54A 1KFWA 2F6XA 2H90A 4JTKA 4XKYA 4RPPA 4JTEA 5D33A 2VVSA 4YN5A 4ZEPA 4U5IA 3TLLA 4J28A 4C6NA 3W7OA 2FHCA 2QGYA 3LOTA 1TVLA 3A9BA 1WAUA 3OBAA 3TP4A 5BWAA 1CW2A 4M19A 4XG1A 2ZX9A 2VDGA 5AHEA 1K9DA 3VZZA 3M0HA 1SMDA 1IEIA 1PZ0A 4X2RA 1G5AA 2PDPA 4GCXA 4DIAA 4PSPA 1SR0A 2J66A 3A3XA 3VKDA 1JI1A 1EDGA 1S5MA 2Y4SA 4BEQA 2J7GA 3COTA 1N55A 1UYQA 3VZXA 1G94A 5IOBA 3ZT6A 4ZR8A 3T8QA 4BJHA 4NZ1A 3WK2A 1UC5A 3VIGA 5DCEA 5AVNA 3B40A 3SIZA 3GXPA 5FOOA 3IAPA 1IXQA 5C9ZA 1IIHA 1QK0A 2CCRA 2QQ6A 2WNWA 4GX8A 3WBWA 5BRBA 5F7UA 1W2PA 4Z1YA 4ERGA 2NXHA 3TR9A 4M6UA 2FTWA 2Z2AA 1G4TA 2J27A 4DM1A 4U3CA 2G3MA 4DJFA 5DXXA 2V2CA 1U1JA 3B0VC 3QBUA 3EMCA 1TWWA 2Z1BA 3RJYA 1I0BA 3SADA 2F8QA 4IXXA 1W9VA 3LG3A 1E55A 3NDZA 4FPSA 4FEZA 2QCFA 5HWMA 1UW9A 4IH3A 2WMHA 3W74A 2ATMA 1NH6A 3W6LA 4ZOEA 4B5UA 4GIYA 1XRFA 1D8WA 3NURA 4ML4A 4DYKA 3MWCA 1NFPA 1UASA 3H53A 5E6YA 3PPCA 1B4KA 4NY2A 5MF5A 2OWXA 1K1DA 2PFHA 3UG5A 2E6AA 1HJVA 1FWHC 2J24A 3OTRA 4WK9A 4B5TA 4UB9A 1UR4A 1MXGA 1RLCL 2QGHA 4JIHA 3FLUA 4TR9A 5D9OA 3LK6A 2XWEA 1DJIA 3N6HA 3HPSA 3GX9A 3WBXA 4GQGA 4IP4A 3OBKA 4E5TA 3S5NA 4C7FA 4HMNA 2OQLA 1SYTA 3NO3A 2F2HA 1OCBA 4PYSA 3IJIA 2C13A 3GIQA 1F3TA 1GUVA 1TIWA 4Z1DA 3P2VA 1KCKA 4KH2A 3T08A 1WDDA 1W6TA 1EEXA 2HK1A 3W7GA 3AS0A 1GONA 2RKXA 1PBGA 1RALA 3BAXA 3OJGA 2CLEA 3BVJA 3ITXA 2HBVA 3HG3A 1GVQA 3G3DA 3GNXA 3WLOA 2YW3A 2EAWA 4TMBA 4LPCA 3UERA 2J74A 3MI2A 4E2DA 4S3DA 5CGMA 1GOXA 3NQCA 4UQEA 4DZ5A 1CI1A 4INFA 1V79A 3W7PA 5H8PA 4HNLA 4EPEC 4JFWA 4YVVA 1DKWA 4RNIA 2PDUA 5IDIA 1PDZA 2YCEA 1Q6QA 4QNWA 1OQFA 5C5YA 2DZTA 5REQA 2W62A 3KLKA 1W8SA 1JYVA 2E68A 2HE8A 1S38A 2VL4A 3IJQA 4AZHA 5I07A 1TJPA 1AJ0A 2XTKA 4GYFA 1XLGA 1OX5A 2EGZA 4DAIA 2LLEA 2E6YA 3CAQA 6PTDA 3FSTA 5HA7A 1T5AA 3GC5A 1QUMA 1JPHA 3AU2A 2ZADA 3T9PA 1PEZA 3WL1A 4PR4A 3PN8A 2YBTA 4KFNA 3BLOA 1E40A 3KCJA 5FJJA 4O15A 1YXDA 1FH8A 3TW9A 3VIIA 4IMFA 5JH2A 1FBAA 1UD2A 3UWVA 3TOPA 1IEQA 1V6YA 1OFRA 3BG3A 3EX1A 3BJSA 4BQ3A 1LL4A 1H41A 2YYUA 2PGWA 5A6MA 5DCDA 3KL3A 4IL0A 3SDOA 3C0LA 3RCYA 3EWYA 1S2WA 1WKFA 4D8LA 1EBHA 1OZMA 3RXZA 2VDHA 1S39A 4GXMA 4JFSA 4ACZA 5D02A 3POHA 3I6TA 1DL3A 5GVJA 4KCWA 4WD0A 4C6BA 4ZE4A 1UMYA 3Q65A 4IGNA 3N04A 2QZRA 3BC9A 3N34A 4IGHA 5DBUA 5TIMA 3LV6A 1QWKA 4PMZA 3RPMA 4C5YA 3LZ3A 3A47A 4K7VA 3M5XA 4IMEA 2CU0A 2CXGA 4IFOA 4FA3A 3G77A 5CAKA 1TCMA 4ZO6A 3I4EA 3LHUA 4TX6A 1F4HA 4IICA 1LYXA 3C4UA 3CK5A 5A6BA 2BOEX 3B9DA 2UY4A 4XIAA 1NQ6A 4C7DA 4MNKA 3WH5A 5EKYA 2X1IA 2C91A 1H7RA 3MO4A 2VXNA 2PWDA 3ZR4A 5I02A 3V36A 3R8HA 3EPMA 4WCJA 5I79A 2Z24A 1JZ2A 3MW7A 1DJXA 1XLKA 3M7SA 1JRCA 3KUMA 2F61A 4QX4A 1G0CA 1GJPA 1LUCA 3QGVA 2AGTA 3IUIA 1F2JA 3A4WA 3PZVA 3EAUA 1EC9A 5K4ZA 3HG2A 2X1TA 2GK1B 4JTIA 3NZQA 3SQMA 2IKIA 5BXSA 1NAL1 1PS9A 3JRKA 1VENA 3WJSA 2J7CA 3SSZA 1K9TA 5HOSA 3LHVA 1YNPA 2V69A 3QR0A 4ICNA 1U1HA 2CBJA 4AZBA 2ZE0A 1Q4NX 1R7AA 3GVGA 3MHGA 1P0DA 1R3RA 3FJLA 1RXOB 1RQHA 2ZDRA 4XKYB 2AGKA 2ZQ0A 3G1VA 3R6IA 4KFOA 3SAZA 4HJFA 4KEUA 4B2DA 4NKCA 4B5SA 1T0OA 1TG7A 4UFIA 3II1A 4AX6A 3GDMA 5A2AA 3ITYA 1KTCA 3OGSA 3WDPP 2V5KA 1R47A 1K6AA 5D4YA 4OHQA 2G95A 4HSOA 1VFSA 4FX7A 4DUXA 1B3VA 5XINA 4DJEC 1LG1A 3K2GA 4X3ZA 1A5CA 1MXDA 4L9ZA 2NW0A 4W5ZA 3GBDA 4D6JA 5DRIA 4GISA 1CX9A 1VKFA 4QAIA 4H4IA 3N2CA 2C1HA 3JZUA 3OA3A 4ROQA 1GW1A 3AJXA 4UTJA 4Q7IA 1M6JA 3WK0A 2Z29A 5BOOA 3O8AA 1ISWA 2DUAA 3GD6A 1TPVA 1QNOA 1B9BA 1YLVA 3L2LA 2V2DA 3BLFA 3EPOA 2GVYA 4NRRA 4KWVA 4R85A 5DMNA 3AUJA 3U7VA 2V5JA 2ISDA 3LA4A 5JUVA 1T99A 3A23A 3E74A 1FWJC 1RSCA 4S3KA 4RR4A 3AIRA 3VA8A 4RCXA 3KE0A 3EA1A 3QW4B 1HVXA 3GC4A 1FX6A 1OY0A 2QUNA 2BGQA 4N9CA 1YBQA 1HJXA 1B3XA 3WQFA 4U2ZA 2D20A 3KS6A 4Q8OA 4NNBA 2CESA 4Q33A 2PURA 3ZJ6A 2QXWA 3WY1A 2XN0A 4UTMA 4DWSC 1X39A 3TH6A 1CGWA 1O5QA 4GVFA 4K7YA 1ZJIA 3KBWA 4LYQA 2P88A 1QTWA 1PZ2A 2VGBA 3HJEA 2OLAA 3W1NA 3MUY1 2O92A 4FNPA 2E28A 2HNHA 1P7TA 5HK4A 1D7FA 3T2PA 4FI4A 4N9EA 4PL2A 3A21A 3RGTA 2YCIX 3RU6A 2INZA 4R34A 1CXKA 1EA0A 3DFQA 2CHNA 5CKSA 3W7QA 5EMKA 3TTSA 3NCOA 1MMFA 3PG8A 2V2HA 4GNJA 4QRNA 2ZC1A 1XD0A 3L66A 2DSKA 4PUKA 2ZUUA 3LNPA 2V6AA 4O8AA 5AOUA 4JTFA 1CCWB 1YRRA 3L0GA 4DJED 3CTLA 4S3AA 2ZICA 1CTNA 3TQPA 4Q22A 1HL8A 3FAXA 4H9TA 3E2SA 3ABOA 1EIBA 4MY1A 1K8ZA 4E2VA 3K4AA 3UVIA 2WLZA 4I7UA 4MWAE 5C9UA 4XAPA 3LSCA 1H4PA 4S3GA 4W4QA 3Q4DA 2NX9A 4DF1A 1V0LA 4F66A 4M7TA 3NIYA 3LGGA 1R5YA 3W00A 4L9YA 1XDJA 1OCJA 5I2UA 3LGDA 1LRQA 3S1VA 5CXPA 2WZIA 1QK2A 4LYKA 1BVNP 4K6AA 5DEZA 2W91A 3LBMA 2TAAA 5JIWA 1OEPA 1V6TA 2FVKA 5EFDA 4HOWA 5LIXX 1CEOA 4UZUA 2IPWA 4DF0A 3GTIA 4AZ6A 3ARSA 1MW0A 1YYAA 3EWUA 4JQ2A 4WGHA 4NAEB 4NSBA 1W2VA 3WELA 3F1QA 1TTIA 4MKVA 4KIRA 4A29A 2ONEA 2GVGA 1DP0A 4FF5A 3BAYA 1VFHA 4AD2A 2ZUNA 3A3HA 4UTTA 1UQYA 4H7VA 3B0XA 3POCA 3F2CA 4Q3MA 3KZPA 4C6EA 2YLAA 1TUFA 4FXJA 1GJWA 5M17A 4HU3A 3NDOA 3W02A 3PZNA 1Q5MA 2Y88A 1BF2A 1G69A 2HPMA 3VOHA 2R1NA 5TF0A 3ANUA 2B7NA 4WJXA 3WZ0E 2E5DA 2GUBA 1QPOA 5K4XA 1BQCA 3QPZA 3IUDA 1JUBA 5EMLA 5D9NA 3MSGA 1GW9A 3R1ZA 4GCAA 1ZAJA 4DXXA 1RY8A 3FJ4A 2EXOA 3HG5A 1Y5WA 1Q2SA 1P0KA 4MTVA 3V1PA 3KFTA 1R7OA 3BCFA 5A8OA 1O1ZA 1A49A 1KO0A 3L5LA 3WF4A 1S2TA 2YL5A 2R91A 4M56A 1ADOA 3ZJ7A 4BWLC 2H6RA 5BRQA 3HFTA 1J6OA 5D2XA 4LRSA 4UCGA 1UUQA 1SZGA 1W91A 1UH2A 3PTDA 3W75A 2QCMA 2I16A 1XFCA 1GKQA 4EOUA 1S5NA 3ARUA 3OYXA 3FCPA 4QFUA 5BNKA 3NPUA 1I2OA 2IKHA 3VABA 3OZOA 1H62A 2AMGA 1B90A 2OYMA 3W2LA 3CPRA 3W6YA 4UQAA 3SSJA 3FX4A 1TCDA 5GQBA 3RNDA 1YXCA 1WV2A 3OB8A 2AL2B 1DQWA 3NSMA 3N4FA 3DBNA 4FP1A 1PX4A 2PI6A 3ZSSA 3O1NA 3AFBA 3WH7A 1MNSA 1EJRC 5CEWA 4XVDA 2HEJA 3QOKA 2QPUA 1JCLA 3MMUA 3N3MA 3B8SA 2XZ7A 3P14A 2G41A 3W1UA 4RNHA 1MRQA 4DLFA 4M81A 4NNCA 2FH6A 4G56A 3AMDA 3PB2A 4CNPA 1XHGA 2G0WA 3MUZ1 4DWSA 1GVOA 5CC3A 1JF5A 2EG8A 3SCUA 1ICQA 3ARZA 1S5TA 1QT1A 3CMFA 4DPQA 2OWCA 2Q3OA 4TVUA 1WNOA 1CXLA 2J62A 2JEPA 5AC4A 2VZUA 4GACA 3HQPA 3BG5A 1H63A 3IUHA 3L9CA 3URNA 4O14A 3N6JA 1TSIA 4O50A 1PCWA 3H2MA 2D3NA 2RDWA 4FNRA 2ZDSA 2Z0IA 4XK2A 2CBVA 3FVMA 1QO5A 4LNYA 1MEHA 1BYDA 2Q8LA 5DT7A 4IM4A 4LBSA 3D0CA 1TRDA 2OSXA 2HWGA 3ZLFA 2NV2A 4WQ6A 1E43A 4JY9A 1VYSX 2XGIA 5CZKA 7CGTA 3R43A 4QISA 2FDMA 1GTHA 3INPA 3A4AA 2BGSA 2FDSA 2Q09A 3IRSA 2BXZA 2VWTA 1TA3A 1L9WA 3I6RA 4W87A 4DJEA 1XBZA 2DGAA 1H5YA 3T7VA 4X63A 4U4MA 4FMVA 3CYVA 1JRBA 1XLEA 4C6PA 4ACZB 2ZZ3A 1DPMA 3SUUA 2BDQA 1CLKA 1JI2A 3SEPA 2FQIA 2G8ZA 3B03A 3IJ6A 2C71A 3KTSA 3EKGA 1V0MA 1UIPA 1R2RA 2DY3A 2VT0A 1NWRA 4HU8A 4HA0A 2X1SA 1DJWA 3VD5A 4O16A 5BYWA 1BRLA 1ZB5A 4WZHA 1KA9F 1YW1A 5HQEA 3VNYA 3W1XA 2WPBA 1SJBA 3MO7A 2R1PA 4XSLA 1M68A 3NSNA 3GHRA 1TPFA 4JICA 1S2AA 5EA9A 4TQTA 3O7UA 4MUPA 1WZAA 3JU2A 3R2GA 3VFLA 4NJKA 4GI6A 4DBUA 2VGFA 4GABA 1XIHA 2I9EA 4K38A 3UGRA 3MV11 4XZ9A 3PWIA 1KXVA 3ZWTA 5BWFA 3CAKA 2YDQA 4D6GA 4GI4A 4CGTA 3GO2A 3IIOA 3UA3A 3T0AA 1TB3A 2W6RA 3NO5A 4HVXA 4IQEA 2XJ7A 4MLJA 1O95A 3ALFA 4GFIA 3WLLA 2YCLB 5F2GA 2BODX 3DFTA 2D69A 1NOFA 1PVNA 2QCHA 1X98A 1NP0A 4LY4A 3M07A 1CIUA 1ZAIA 3QV8A 4GYPA 3IANA 3QMTA 2FLIA 3PG9A 4CD5A 1XIDA 3CUJA 1EQPA 4Y9OA 1DHKA 1E5NA 4DYJA 1HZYA 3R8RA 3W7DA 2I5QA 1NWUA 5H91A 2KZHA 4G6CA 1UBSA 3AMLA 4ZSUA 1IGSA 1W3IA 1XYLA 2G96A 1LQAA 3LPGA 3MHFA 3VIFA 4UQBA 3USZA 2A1YA 3BCJA 1I6NA 5DY3A 5EYWA 1EX1A 5FJUA 4WDUA 3NR0A 1KTNA 2AL1A 1JUKA 1LRNA 2VGIA 1K3UA 1AL7A 1PXGA 3KDOA 4RE3A 1A3HA 1SO5A 4I6VA 1TV8A 3IIZA 2YGYA 3HN3A 4ZFMA 1IF2A 4DO4A 3VKCA 3S5OA 1PPIA 1WZKA 4NIRA 4IG2B 3G2GA 1PCKA 4GIRA 1S3TC 2CBUA 2VGGA 1TR9A 2FVLA 1UIOA 2RDTA 5JMUA 3VIKA 4DYEA 2VEMA 3HZ3A 1Q85A 2CLFA 3O9NA 4BWLA 2OZ8A 3EA2A 1EJUC 2FZ8A 4XBKA 4P8UA 4PTWA 5DF0A 3S83A 1ZUAX 3WF3A 1W5OA 3UCDA 1CXIA 2J88A 5F1UA 2A7NA 5U4NA 1RUSA 1F07A 4KRZA 3AUOA 1G4PA 2TRSA 5RUBA 1WXJA 2NQZA 5F4WA 5D8ZA 1NOUA 3C8NA 3CBWA 1VAHA 1J0KA 4LXFA 1FDZA 1CB7B 2X16A 5DBTA 3MKCA 3M44A 2DJXA 4IXHA 4FLOA 4JR5A 4I9TA 2BSLA 9XIAA 2CC0A 3WK3A 1XD1A 1AZ2A 1FWAC 1GOQA 2ZX7A 2J75A 3CUZA 2ZBTA 4HYRA 2H8ZA 2CLHA 2Z25A 3BOLA 1VR6A 3M5YA 2JIEA 2G4JA 5E9AA 1M1BA 1BGGA 4MZYA 8A3HA 3RX2A 3W38A 1TVNA 2IPFA 3SCVA 2XSAA 1K7FA 3RR1A 3LTYA 2ZXBA 3W9ZA 3I3EA 1F76A 1IQ8A 3A6OA 2NX3A 2WAGA 4RK8A 3TN4A 5EFFA 3P61A 4NF7A 1P0BA 4LAZA 3CWHA 1OABA 4S2BA 1FWGC 1QW8A 4FLRA 4U3AA 3BLPX 3HPAA 1XI3A 5GPRA 4QS6A 1RVGA 3ZMRA 4LJ3A 4GQQA 1R3SA 3AYSA 3N2XA 3EOUA 1GOWA 2DIEA 4BFAA 4HB7A 3QTGA 3T6CA 3KTXA 3I7SA 4X22A 2PDWA 6REQB 3NA8A 3PSWA 2YXOA 3UWQA 4LV4A 2P50A 3W2KA 3WN6A 3E9AA 5FJIA 3EWDA 4I8YA 3WJXA 4DB7A 4U31A 3T4WA 1AQ0A 1FXQA 2OLHA 1XIEA 4LALA 2PF8A 2WYSA 4PSRA 2Y61A 1JYNA 4X61A 4GMEA 2ZX6A 4US5D 4UNKA 4JIQA 3GTXA 3OODA 3RYSA 1Z8AA 4ERAA 1K9EA 3MWAA 1C29A 3OLGA 4BF5A 3SURA 1BVWA 4M1RA 2CKSA 2ACSA 1JEZA 1ZRQA 2DT0A 2NQ9A 1W1YA 1QO2A 3DCPA 2X05A 3CUGA 3U5YA 1G01A 5KZ6A 4PMDA 5G1MA 3AALA 1R3QA 2R6OA 4J3VA 4ATWA 2ACRA 3RAOA 5AC7A 2EEXA 2WCSA 3A4XA 4Q4PA 5CGTA 4JTAA 1KWKA 4IPJA 3MCOA 1UA3A 2Y89A 3TLQA 3N2MA 4GY0A 5AYZA 4CN6A 1BAGA 3NZPA 3W1PA 4IPIA 4DY1A 3IK2A 4HPNA 4MM1A 1P43A 1HUVA 4IX2A 1LWIA 1VLIA 3S42A 4E8CA 3NNTA 4HPHA 1JXJA 5FJTA 1FHUA 1E56A 3NVDA 1YDVA 2Y5SA 1SZFA 1E6PA 4QHRA 4O8RA 4F0SA 5AC6A 3MBDA 1FTXA 1R9XA 1PX3A 4ALDA 4UCFA 4WVXA 4RDZA 3LLFA 3C0JA 4CN4A 4GD0A 3EDFA 4J5NA 3BK0A 3UWYA 1H7WA 1V51A 4HCLA 3LRMA 1WXZA 2QDGA 5IBXC 3ZLHA 4PH6A 2BS9A 1ZPTA 2L5HA 1TV5A 4Y9PA 3MY9A 1CGUA 5HUOA 4PFMA 2ZFAA 1E6RA 2PC4A 3PPFA 4P8VA 4O10A 2KX9A 3K30A 3WLRA 4I5RA 4C6QA 3VUPA 1M7JA 1OG0A 2Y8UA 2X8RA 3STPA 1Y5VA 5JH1A 3TWBA 2D2GA 5K9XA 2Y24A 4KT2A 1QPNA 3SI9A 4QSFA 2POTA 1PKLA 2XUCA 2RJHA 3MT1A 2V63A 5DMMA 4IG2A 2ZZ5A 3U57A 1G9HA 1W1B1 1K9FA 3L68A 2ZX5A 1OC6A 3QW3A 4M5PA 3NQGA 4GUIA 4A3YA 3LSBA 4A8RA 1XLAA 2QV5A 2YBUA 4NU7A 2DP3A 1DE5A 3FYYA 4DAFA 3HFYA 5C71A 4MF4A 2XPKA 3RG6A 3FV9A 1S2CA 2RDUA 5LXEA 1W3TA 1FFQA 3LB0A 4C91A 3CB8A 3NL6A 3IJLA 1BWKA 3SY8A 4PUWA 3R0KA 3W22A 2BZNA 3V5FA 1SVDA 5AECA 3VDAA 2H9AA 1V0KA 3DIPA 3EMZA 3WLKX 3DGRA 3OYZA 4FALA 2V5BA 2HK0A 5DN1A 1GYLA 4YTUA 3AXMA 1RP9A 1V03A 1GQNA 3DG3A 3WQGA 6TIMA 3O07A 1UP0A 2HV5A 5G4WA 1E9ZB 3NQ6A 1XIFA 5GJMA 2OZ3A 5C54A 5FEPA 4LQ1A 4I6KA 4TX9A 2DZAA 4UOJA 1KD0A 1NDWA 1R46A 3GC2A 2HXUA 4XZIA 1O5KA 3DENA 3SUTA 1V7AA 3AMCA 4YJ5A 3EX2A 4CEXC 1R9YA 1ME7A 1YEYA 1G6CA 4Q4MA 1KRMA 2PC8A 4H9MA 2FB3A 1KXHA 3WEMA 3E0IA 3ZSTA 2WM0A 2JIWA 3F4NA 3T8LA 3UYCA 1WAWA 1US0A 2B31A 3RO8A 3RX4A 3R58A 1HG3A 2OO6A 1PJ9A 1XSKA 3HJZA 4Y2WA 3CL8A 3VK5A 3FK4A 4JEQA 5J5DA 1A0CA 2HMCA 3WK1A 1O7AA 2VRJA 4JCLA 1E1CB 1KC7A 4FB7A 4HPGA 3WNOA 3GIPA 2WSPA 5ECVA 1IR1A 3H7RA 1BQGA 2PP3A 2J7HA 1GOIA 3T07A 3IJDA 4AG0A 4DBEA 3BXWA 3M64A 3PHAA 4EAYA 2PDIA 2XU2A 5D32A 4HHPA 3R8GA 2PAJA 1TPC1 1P6CA 3BAIA 3NQBA 3CQHA 4RV8A 4TOQA 4AXKA 3A5FA 4JX5A 7XIMA 3QHMA 3CIXA 4HHLA 4BQ5A 1V02A 1GHRA 4HD5A 3H2AA 3TW6A 2CLPA 1IIGA 1A5OC 1XRTA 2YB4A 3THDA 2V3FA 5A6TC 1R9ZA 3SECA 3SCWA 3BAJA 2WWDA 1EJTC 5ECUA 2NLYA 3NGFA 2QR6A 2XFYA 2J8GA 1OX6A 3M0ZA 5CC7A 3GR4A 4JTHA 3VNDA 2F84A 4L4PA 4OU1A 4EPDC 3E49A 3PF3A 5BMXA 3UXKA 1WZLA 3STFA 5CCZA 4H8NA 4PCPA 1UWRA 3AC0A 4WIWA 1KFJA 3ONBA 4TV6A 4CKQA 4KEZA 5C2CA 3GVRA 4OFCA 3GB6A 3D5HA 1UWSA 3VIOA 5FAGA 3VDHA 3PUOA 1EF3A 3WQ5A 3A64A 1FKXA 1QNQA 4E4PA 1B4EA 2I56A 1PHWA 3G0SA 4QIUA 4A6GA 4H8HA 2UWFA 3N12A 5AYXA 4MVAA 3SUVA 1UD8A 3LHTA 4JTDA 1OJXA 2A7RA 4YTSA 1DWHM 2VNCA 1ZS2A 1EP1A 1SFSA 4JYFA 3IPWA 2OODA 1ZJAA 3LZ5A 3DUGA 5FAJA 1NVMA 5CBIA 2PP1A 1GVRA 2X41A 3LRKA 5I24A 3KVMA 4N7QA 4A22A 2A6LA 1C7SA 3E2RA 3NGJA 1SSGA 5BXRA 2X0SA 1R2SA 1K03A 4H8VA 2V0TA 2NXIA 2F7FA 2CNCA 2CETA 2P3EA 2NV1A 5D03A 3P6LA 1EYEA 3RPDA 2NWRA 4NAEA 2D2JA 2ABBA 2VO5A 3WLJA 5I6SA 3KBMA 4DELA 3IGXA 1OK6A 1PV8A 3AXXA 2GJXA 4JIPA 3MP5A 2V5CA 2NV9A 2J8TA 2WZMA 2ALRA 3VD7A 5KINA 3PWAA 1EB3A 1F3XA 1UUOA 1GK8A 1P4CA 3SZ8A 3G1AA 4PGLA 1OD8A 5JBDA 1XC4A 4RDYA 2BOGX 4QG9A 6REQA 1S2VA 3FXGA 2DIKA 4Z2LA 4Z2HA 5CLTA 3S2JA 4Z0JA 3UWEA 3VTRA 3NQAA 1JXKA 2H9AB 1JCYA 3QQ1A 2AAAA 4HA3A 5JU6A 3FA5A 5LHEA 3T2OA 1CNVA 1WO2A 2YB1A 4CN1A 1TFVA 2C3ZA 4FNSA 2V3GA 1FRBA 1RBOB 2Z6JA 1GVSA 1NSJA 1XP3A 3EOEA 4GBDA 5DLCA 2O55A 3VGDA 1GOKA 4GNKB 4XTIA 3SFKA 2ANUA 3IRDA 1LOSA 3BV4A 1B3OA 4B91A 3K8LA 8RUCA 2AMXA 5CC6A 2Y63A 4GLEA 5AZ1A 1HKVA 5A95A 3UZ5A 3W27A 2C0HA 1N8FA 3V5CA 1RP8A 2O4QA 1TUXA 3KHDA 1R3VA 2Y7EA 4PTMA 1P5BA 1I1WA 4O1CA 2RH9A 3BG9A 3HGOA 3P62A 3WH8A 4IT1A 2DUZA 3GXNA 3KZSA 1YIXA 3U6WA 4R3UA 4C6FA 3DESA 3UNTA 1E0WA 1AW2A 4GZJA 4F2UA 4HU0A 3AYRA 3GNOA 1F8IA 1YPXA 3S3GA 2VR2A 3GXMA 4H6KA 3B9EA 4YHEA 4KERA 3L4XA 2YA0A 4NX0A 1EA9C 3PVFA 1Y0EA 3M43A 4GO8A 3V7PA 2C1GA 1AMYA 3OVPA 1PHQA 1HW6A 2QCDB 2AQOA 2WCGA 2EHHA 3CZJA 3S8HA 4HNUA 4L6DA 3IIXA 2FFIA 3WG6A 2QCDA 4IOTA 2WZHA 2OZ0A 3WD2A 5HXMA 3SQSA 3UPBA 3PBVA 1HKMA 1BEUA 2XH2A 3HGJA 3UR7A 1WOAA 1F8MA 4MPQA 2A4AA 3P60A 1GORA 4ECLA 4ADSA 3FJNA 4C1KA 1AK5A 1IZCA 5M5DA 1DXFA 3NYZA 3GHSA 3VNZA 2Y0FA 1ITUA 4LNCA 1LROA 3GU1A 1I1XA 1JYWA 1QPQA 4IPNB 2DUXA 2YOCA 2I17A 3IK4A 3N14A 4PE8A 1R0MA 2YBVA 3TK7A 4AISA 4HNOA 1JDDA 3QM3A 2EPMX 3BDKA 4OBSA 4M82A 4UWMA 4D6HA 3L2MA 1XW8A 3PBUA 3W73A 4AQLA 3EWCA 4K68A 3VFCA 4H7ZA 2F38A 3W4RA 1XDMA 2BP1A 1ZHAA 2GJLA 1XIJA 4CCEA 1H2JA 3Q58A 3GDBA 2GGGA 1J12A 2WQDA 3TNOA 1EBGA 1KM4A 3BOFA 3BLDA 4H9ZA 1WDSA 3GWQA 3VDBA 4QE5A 2OCZA 3QGAC 3LI1A 5BOEA 1KGUA 1DQUA 1BTCA 5M03A 2BLEA 3B8UA 1X1OA 5AYIA 4YL2A 3ZVHA 1BVZA 1JQXA 1R6WA 4H6EA 1JPIA 2RDXA 2WV8A 5MKGB 4PTDA 4FNQA 3TJLA 3BPWA 1JZ7A 2OEKA 4HN4A 4CU8A 1HJQA 3W7CA 3L12A 2A3LA 3MZNA 3UBPC 2GJPA