3CBWA

Crystal structure of the ydht protein from bacillus subtilis
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
336
structure length
336
Chain Sequence
HTVSPVNPNAQQTTKTVMNWLAHLPNRTENRVLSGAFGGYSHDTFSMAEADRIRSATGQSPAIYGCDYARGWLETANIEDSIDVSCNGDLMSYWKNGGIPQISLHLANPAFQSGHFKTPITNDQYKKILDSSTVEGKRLNAMLSKIADGLQELENQGVPVLFRPLHEMNGEWFWWGLTSYNQKDNERISLYKQLYKKIYHYMTDTRGLDHLIWVYSPDANRDFKTDFYPGASYVDIVGLDAYFQDAYSINGYDQLTALNKPFAFTEVGPQTANGSFDYSLFINAIKQKYPKTIYFLAWNDEWSAAVNKGASALYHDSWTLNKGEIWNGDSLTPIVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the YdhT protein from Bacillus subtilis.
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
molecule keywords YdhT protein
total genus 125
structure length 336
sequence length 336
chains with identical sequence B
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2008-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02156 Glyco_hydro_26 Glycosyl hydrolase family 26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3cbwA00
2YDQA 1CBGA 1OGGA 3WUFA 3PZMA 4CCEA 5CLTA 5LA2A 1BYCA 4Q22A 3W82A 1JDAA 3AMCA 1CEOA 1W3KA 3HJEA 1X6LA 3O6AA 3WDPP 1JAKA 4M29A 3SCRA 3ZO9A 5I6SA 4J3SA 5I3DA 3ZT7A 1V02E 5A6BA 3VGHA 1EH9A 3W0KA 1JAEA 3ARYA 1HP4A 3OGVA 3AICA 4B3KA 2FHBA 3L2LA 2ZOXA 2WVUA 4LYQA 2ZUNA 2DEPA 3I3EA 3WF4A 4WJXA 4QCEA 1OWQA 1HVQA 3WUEA 1VFMA 2BHYA 3WH5A 1VFOA 2EPOA 2WKGA 4B15A 3BCFA 1KWGA 1KCLA 4H2CA 2FH8A 4AZGA 3NJ3A 3NDZA 4D6EA 3AOFA 4V28A 2PC8A 1ITXA 1V3LA 3AMDA 3PTQA 2WMKA 4WF7A 3WUGA 2UWFA 1H4PA 1FHDA 4AZIA 5JUVA 1GNXA 2V3EA 2OWCA 1TR1A 3MMWA 3VGEA 3MMUA 4J3UA 1E0WA 1I1XA 5BYWA 1KB3A 3BH4A 1UR8A 2GJPA 3CZEA 3THDA 4WSJA 1DWAM 1B3YA 3W25A 1V6XA 2IUZA 4J7RA 3VIGA 2WWDA 2FHFA 1OGSA 2QPUA 4JFWA 3DYMA 1W3HA 2JFEX 3MUAA 1HF6A 1CGWA 2BVDA 4QDMA 4FLRA 1WB0A 1VF8A 5I2UA 2OWWA 4GZEA 1CGTA 1QHOA 2XSAA 4HMDA 1Y7VA 2J7HA 1QPKA 2BNJA 4PN2A 4WKAA 5CXPA 2WWCA 4CGTA 4ACYA 3AHYA 2WC7A 2BY3A 5AC4A 3CBWA 2D23A 2WXDM 4OIFA 2YA1A 1AQHA 3WDRA 4AIEA 1TVPA 5A3HA 3POCA 3TTOA 1MW1A 2WLZA 1E4IA 2D3NA 3N04A 3II1A 2YL9A 2WVVA 3PZUA 2YIHA 1RD6A 1K9FA 4ZENA 1E3XA 1ODZA 4UZUA 1J0JA 4Z2HA 2ZUSA 2QV4A 3WDHA 3ZIZA 3SCOA 3RM4A 3VIOA 5A6MA 1UWSA 3OB8A 4EANA 3W29A 1EXPA 3BC9A 3U5YA 1GQKA 4HMCA 4W87A 2DH2A 1QI0A 2D20A 3U7VA 1EQCA 1TE1A 2O9RA 1US2A 5BRQA 4GKLA 1DTUA 2VR4A 4DUXA 4B3LA 2GFTA 2BFGA 1W32A 1LL6A 1W9UA 3W4RA 1OD8A 3WH7A 3WNMA 1WZAA 3PZTA 4W7VA 3O2LA 4HU8A 4GI9A 4D6DA 3POHA 3KZSA 2EPKX 2CYGA 5HOSA 3RIKA 1EDGA 4F9DA 3A4WA 3AQUA 1ISVA 1W3JA 1EDTA 3N18A 4WK9A 3A47A 9CGTA 3L4UA 4JHOA 4AIUA 2VX6A 4LX4A 5LA1A 4LPCA 4AZBA 3N11A 1EO7A 5AYIA 3O9NA 5ECUA 3SUVA 1XH0A 3OLIA 4UFMA 1ZBKA 3AIVA 4MADA 2J75A 3AS0A 4S3KA 1BG4A 1V3HA 1BG9A 1G5AA 3U5UA 3PZOA 5CPTA 1WDPA 3CMGA 1HNYA 2ZICA 1QHZA 1V0MA 3F5LA 4Y7EA 3TTYA 4W84A 2E3ZA 3T0AA 1CNVA 4D71A 3TTQA 4UQBA 3SUSA 1HKIA 4CN4A 3EMZA 4F66A 1R8LA 1DWJM 4AZCB 1H09A 3FHAA 4HA3A 3W6MA 4ZE4A 5FD0A 3ZR6A 1M03A 2J7CA 1G94A 4R27A 3MV11 4GI8A 5IHSA 1TUXA 4ATLA 1VBRA 2YDRA 1LWJA 4BQ5A 1NP2A 3DC0A 4JHZA 2O9TA 1QW8A 5D9OA 4PTMA 2FHCA 3I3BA 3AISA 2PWGA 1JL8A 4MDPA 3WD0A 2X0HA 4KH2A 4LYPA 2DQXA 1SYTA 3S2CA 1UZ4A 1K9DA 3ZMRA 5M3WA 2V5DA 1EA9C 1WO2A 4YN5A 4E8DA 1LF1A 3AZSA 5FKYA 5ABGA 1O6IA 2YDSA 3ARXA 1EHNA 5JBEA 4MDOA 5D9NA 3WY1A 2YJQA 5CSYA 1B3WA 2J77A 3W53A 1JD9A 1GPFA 4D6JA 3CHDA 3GH7A 1VB9A 3KL0A 4DM1A 1Q6DA 3VIIA 4DWSD 3OG2A 1EGZA 1HN1A 3MV01 5IDIA 1JFXA 3VIMA 1V0KA 3CZLA 4GIAA 1KWKA 2J4GA 1LWHA 1JZ8A 1LQ0A 2X0YA 4PMQA 1DWFM 2VCBA 4PMRA 1BYDA 4V2XA 1R7AA 7A3HA 1JNDA 3L4VA 2PI6A 1NWRA 2WAGA 2XGIA 4AIOA 3PZ9A 2YL8A 3BLPX 1E1FA 4W85A 4UOJA 3PZNA 3WF2A 1FHLA 3VMPA 3AXIA 1HJXA 2YBUA 2DSUA 4TTGA 2DIJA 3VMNA 1HL8A 1J0KA 5I0DA 1ISXA 1UKTA 2V3FA 2WBKA 4AZCA 3CPUA 3ZSSA 2X05A 2GK1B 3WIJA 2PWEA 1HX0A 2PBOA 4UNIA 4H8VA 4OJYA 3FY1A 5AC5A 4U5IA 2F2HA 4PYSA 3M07A 5GPRA 1GOIA 3WSUA 3CGTA 1C90A 1E6ZA 3BAKA 1UR2A 5ABFB 4CD6A 3W38A 3AMKA 3AZRA 2NSXA 2D24A 3ARSA 4C7FA 3OLEA 2YBTA 3TA9A 2VVSA 1J18A 3QHMA 1HJQA 3AMGA 1H0IA 1JYNA 1TMQA 1TFVA 1UWRA 1UH4A 3IJ7A 1Q6GA 3CLWA 4GQQA 4PSPA 2J7EA 3OGSA 5HPCA 1Q6FA 1ESWA 1M7XA 3ZJ7A 1UYQA 1ZB5A 3BXWA 1JZ5A 5FL1A 2HVMA 1W9VA 5IXEA 1QNRA 2FH6A 5BRPA 4TOQA 4CUCA 1JFHA 3CHCA 1QI4A 8A3HA 3VX1A 3ARVA 3ALGA 4D6FA 5CLWA 4P7RA 1WDQA 2VJXA 1GUVA 5HBFA 2V5CA 3W27A 1NM9A 2X2YA 2GJRA 1C7SA 4EAMA 3FW6A 2FGLA 2E40A 3UERA 3W24A 4UOZA 4J28A 3CUHA 1J12A 3SCNA 1DWHM 4TUFA 4AD4A 4W7WA 5JBFA 3ZSTA 4GO9A 1OGBA 3HMCA 3SUTA 3WQ4A 3NCOA 2WMGA 3VD5A 3WDQA 4FMVA 5BXSA 3PTMA 4PTWA 4ATWA 5C8BB 4JFTA 5A6SA 1H3GA 4W7UA 5I78A 4B9YA 1OT1A 2D22A 3MANA 1P6WA 2G41A 3PHAA 4XZBA 1M04A 1E40A 4W5UA 2A3HA 5I5RA 2A3BA 1KGWA 3W81A 5CZKA 3CMJA 1B3ZA 4AMCA 4AD5A 4M82A 2XUCA 3L4XA 4W8LA 3WMBA 5A8NA 3VD4A 1G0CA 3WDJA 1E4NA 3WQVA 4PMXA 3AIQA 2CIPA 1PJ9A 1A3HA 1BGGA 4Z2IA 1FOBA 4DWSB 3WNKA 4D6HA 1KQZA 1VEOA 4XX6A 1MFVA 4BA0A 5A94A 3CUGA 4W5ZA 1K9TA 2OSXA 3AFBA 4XB3A 2ZXAA 4RE2A 2X09A 3MSDA 2CBVA 4U2ZA 5A1AA 1C93A 3WELA 4LXFA 4HZ6A 3W37A 2QF8A 3BGAA 4P7NA 1U33A 2JE8A 1MQPA 3T2OA 3APGA 2CBUA 3VIHA 5DEZA 1KGXA 2VRJA 3EDEA 1TG7A 3NDYA 3JUGA 2DPEA 3BMVA 3WF1A 3VDHA 1GONA 2JF6A 1JNEA 1XRVA 1W9BM 1WKYA 3QHOA 1EQPA 1UQYA 1WZKA 1W2VA 4X0NA 2E9LA 5FIPA 4J3XA 2EPMX 3QOMA 2J74A 3MO4A 3WL1A 1QBAA 1PBGA 1QHPA 2WW5A 5BXRA 5CSUA 2WNWA 2XFYA 1UWUA 2XSBA 1W9PA 1BGAA 1VENA 1UD8A 4CVUA 1GOOA 2VZUA 4MAVA 3MSGA 3RMEA 4QCFA 2ZX7A 2X8RA 1ODUA 2ZUVA 2DT0A 4U31A 2CXGA 1ZJAA 2BY0A 2A3CA 3DYPA 3WQWA 5E0FA 3VPLA 1J0YA 3M46A 5M03A 2J8GA 3KEHA 2WCGA 4GZJA 5D9MA 4W88A 2RGMA 5EB8A 2BS9A 1V6YA 2WHKA 1V0NA 4IUGA 2BVYA 2EEXA 1H41A 1LG2A 2VQUA 2VNCA 3GNPA 3QHNA 2Y5EA 1OM0A 1UKOA 1VJSA 5FL0A 3N17A 4PMDA 3ZT5A 3NSNA 5A2BA 2WCSA 3EDJA 2G3IA 3SURA 3WFLA 1NOUA 4JFUA 4AD2A 4W93A 3BAWA 3T2PA 3UG3A 3HN3A 3AHXA 1HJUA 3G6LA 4RE4A 2VQTA 3EDKA 1HT6A 4JKMA 2EPNA 2WZEA 4F8XA 1JZ2A 2FGZA 2F8QA 3AIUA 5GNXA 1GQJA 1WDSA 5EFDA 2ZIDA 2ZUWA 3D5HA 3K4DA 4PUDA 4KGLA 3A3HA 1W91A 3L4YA 3WBEA 3W28A 5CPSA 3T0BA 4GQRA 4H04A 2HISA 1J0IA 5M17A 1OIMA 4PSRA 3BLKA 5A95A 2G3JA 5A6LA 1MVYA 3BAIA 2DT1A 4UCFA 3WEZA 1LG1A 4QFUA 2VZVA 1W9XA 3ALFA 2UY3A 3FAXA 2AOSA 2CHOA 2QHAA 1O7AA 2CETA 5A2CA 3AXXA 1H49A 5I77A 2E0PA 1E6RA 5LA0A 5E09A 1CENA 2DH3A 1US3A 2VRKA 1B3VA 4MJ2A 6A3HA 3ARWA 1GOQA 3AZTA 2TAAA 1N82A 2VVNA 2EJ1A 2WHMA 1H1NA 1GJUA 4R5EA 1J0ZA 1MYRA 2F61A 2VURA 3UESA 2YL5A 2C0HA 4GO8A 4EE9A 4DWSA 5BCAA 1AMYA 3OA5A 1KXHA 3M6DA 3VM5A 5DT5A 4WSKA 1FH8A 3SCWA 1L0PA 1UOKA 3FXYA 1HVXA 3VIFA 2WMFA 4MNMA 3VVGA 3KE0A 1JYXA 1JDCA 1PIFA 5D8WA 4A3YA 3BSHA 7CGTA 1ITCA 2JF7A 3GNOA 2WMJA 2VCCA 1MFUA 1QNOA 1V0LA 1ZBWA 3A6OA 2VUYA 4TVDA 2W91A 1KBBA 5CPQA 3VGFA 4H41A 2ZXDA 1NWSA 1E6PA 1UR4A 3CHFA 2XHYA 3CZ8A 4QLJA 4CD4A 2VX5A 3WNPA 1K9EA 5AYBA 4UTFA 4OKDA 4MJ4A 2J47A 2WC4A 3DHPA 5JIWA 1YHTA 2YOCA 2ZXQA 4P8VA 1V02A 3GM8A 1W9DM 1JZ7A 1E43A 4Z2GA 1XYZA 3WDIA 2QLYA 1KR1A 1HJSA 4M1RA 3BAYA 1XSJA 3GXIA 4GINA 2XTKA 1CGUA 1J11A 2BHZA 5A2AA 1X6NA 3SCTA 4MPKA 3SUUA 3GYCA 2BHUA 2ZUTA 2GJXA 3ZR5A 1YQ2A 3ZJ8A 1QW9A 1KGUA 4U5KA 2W66A 2WPGA 1QI5A 2D2OA 2NW0A 5A6BD 4UFJA 1IZKA 1C91A 3VDBA 3IJ8A 1R85A 3N15A 6CGTA 4HMEA 4AZ6A 5BXTA 1KBKA 3OLDA 3WH6A 4GXPA 1JYWA 2CBJA 4H8UA 1GVIA 4A3HA 3S6TA 1HJVA 1GOWA 2DSZA 2E9MA 1VAHA 2GJXB 4CD7A 4NRSA 1JZ3A 1ISZA 1DWIM 4WIWA 3CZKA 4IM4A 1CZ1A 4P7OA 4XZWA 5ABFA 1H2JA 2E8YA 1M01A 3EMQA 3WMCA 1UZ1A 4TX6A 5CQ1A 2VO5A 3PN8A 4KRUA 2OSYA 2FDMA 4ATDA 1B3XA 1NOFA 5GNZA 2VX7A 3L4TA 5A8PA 3WQ8A 1B90A 3N12A 1E73M 3AS2A 3VNZA 2Z1KA 3LPFA 1E6SM 1CYGA 4P8XA 1SMAA 3OZPA 2GUYA 1OT2A 3ARRA 1UWQA 3A4AA 3PBGA 1E5JA 4LQ1A 4CU8A 4K68A 3PZIA 4D1IA 5FCZA 3FHQA 1KFWA 2XVKA 4OOUA 1BQCA 1W1VA 1I75A 4JFSA 2Y8VA 5I24A 1ZBVA 3ZM8A 2ZE0A 4YPJA 1IZJA 3UCQA 2XIBA 3TP4A 1UD3A 2E8ZA 3VO0A 1E15A 2OWXA 3GH5A 4CD8A 2X1IA 4AEEA 4JFVA 1HXJA 4NF7A 1MXGA 4PMVA 3VDAA 3BAXA 4EK7A 3WKZA 3NUKA 2ZX8A 1U30A 2GVYA 2PWDA 3WQ6A 1LLOA 1CXFA 3NSXA 4HPGA 1XH1A 1WZMA 3WUBA 1U2YA 2QMKA 1VRXA 1UD2A 4UFLA 3AYRA 2NT0A 3EDDA 4UQDA 4XV0A 5EFFA 3F4VA 4U2YA 3LMYA 4XUYA 3TONA 4ACZA 3QR3A 3MKKA 1FFQA 4UFIA 1CWYA 1XV8A 7TAAA 2PBGA 3WNLA 1JGIA 1ISYA 4W86A 4J3VA 1W2PA 2BVTA 3WN6A 2D1ZA 3MU7A 1NWTA 4W89A 3GXFA 2W92A 4D6IA 5E9AA 1Q4NX 1W3LA 2ZX5A 1ZJBA 4HOZA 2WZIA 1JXJA 4M24A 1J0HA 2ZXBA 1BYBA 1E4MM 4DM2A 1BYAA 2JIWA 1B31A 4BF7A 3SCUA 3VMOA 1JG9A 3VGBA 4E8CA 4NI3A 4ZXLA 4P7QA 1RPKA 1E3ZA 1CXLA 3WEOA 3VIJA 4CKQA 4JAWA 2VZTA 2WMIB 2VZOA 1CIUA 2XG9A 2E4TA 4URIA 3RCNA 1Q6EA 1HKJA 2J25A 1NOWA 2WLYA 1ZL1A 3VD3A 1Z32X 4MTVA 3AHZA 1C8QA 1MW3A 2XWDA 5D4YA 3DECA 2W5FA 4AY1A 1B0IA 3KWXA 4EKJA 3MS8A 1MQRA 1CGVA 4M80A 3A4XA 1BPLB 4NSBA 2OYMA 1PZ3A 4MB5A 2VC9A 3UR8A 1BLIA 4FLSA 3UR7A 3AS1A 2XJ7A 2ZWYA 1PPIA 3WL0A 3MMDA 1G1YA 3WD1A 4FLOA 3PZVA 2DIEA 3AS3A 1W1PA 2AMGA 4PBGA 4U3CA 3K8LA 4AYSA 2UY4A 4WKHA 1QOXA 1UKPA 2CCRA 2WYSA 2ZUUA 4OUEA 1TZ7A 3CTTA 2J7BA 3VOCA 2XGBA 4HU0A 1BAGA 2O9OA 1NARA 3CHEA 2CBIA 1E56A 2XFFA 3OZOA 3RILA 1V3KA 2CITA 4D6GA 3OGRA 1CLXA 1TCMA 4KMQA 1BHGA 2D0GA 3VUPA 3SCQA 3AIWA 2NT1A 3OLGA 2XFRA 2VMFA 3WF0A 1BVZA 1GHRA 1GQLA 1V6VA 4PMOA 1NP0A 4MB3A 3RJYA 2CESA 4BZYA 1QNQA 1CGYA 1WCGA 1UH3A 4RL3A 4Z2LA 5A6JA 4ACZB 1PZ2A 5CJ5A 1JZ4A 4IPLA 3E1F1 2WVVB 5FOOA 1OD0A 3ARQA 4PRWA 3WEMA 2WKLA 2XVPA 1NH6A 3ZJKA 1M53A 2BV9A 3N9KA 1FH7A 2PWHA 5D9PA 1PIGA 2WMHA 4UQAA 2VCAA 4ZEPA 5A6AA 2QPSA 4HZ8A 1E55A 3AHTA 2WM0A 3WBAA 2EBNA 4HP5A 4YHEA 1R7OA 1I1WA 3WF3A 4AZ7A 1V3MA 4OBSA 1FA2A 3WD3A 3NYDA 4P8WA 4NRRA 3FNDA 1KXQA 3GXDA 1HJWA 1KXVA 1QNPA 2BY2A 2OLHA 3L4WA 1V3JA 4CD5A 2B31A 1E0XA 1LJYA 1J9YA 2WZHA 1V3IA 3QOKA 4GPNA 1UD6A 2WC3A 3U57A 3K8KA 1CGXA 2PF0A 4AWEA 4HTYA 4UFHA 1XSIA 1FP8A 2G3MA 4FLQA 1GW1A 1Q6CA 1MQQA 1E72M 2CPUA 5E0CA 1B9ZA 1UD5A 1CTNA 1GOKA 1JIBA 1WNOA 5C70A 4DUWA 5EMYA 1XGZA 5DO8A 1C7TA 1E5NA 1VFUA 1L8NA 1E71M 4FF5A 1EHAA 4UR9A 2VI0A 5A6KA 2J8FA 2XVNA 2DDXA 3B8SA 4PMZA 4AZHA 1MW0A 2W67A 3KL3A 3VTRA 1GZJA 4AISA 3THCA 5M5DA 2ZX9A 1OIFA 3IANA 1OB0A 4BQ2A 2WSPA 1V6WA 2CEQA 4PTXA 4HZ7A 1JF5A 3BCDA 2ESCA 1IV8A 3VNYA 2V3DA 3MUY1 1CDGA 4AD3A 1DWGM 2Z1SA 1MWOA 1E0VA 4AW7A 3ZQ9A 2C7FA 1HL9A 4X0VA 4B9ZA 2CKRA 5F7UA 2Y4SA 2VX4A 3ARZA 1GQIA 4W8AA 3T09A 4C7DA 3LPOA 3N1AA 4HOWA 1F4HA 2G3NA 1E4LA 2C8NA 2Y8KA 4AEFA 4ZXOA 2VR5A 2VRQA 2WB5A 2YLLA 2JALA 3BMWA 4UQ9A 2XWEA 4CU6A 2WBGA 2VTFA 1WAWA 1B2YA 2GDVA 2DSVA 1XCXA 3K1DA 2MANA 4A4AA 2A3EA 4MAZA 4WKFA 3T08A 3WMSA 2EXOA 1PX3A 2VL4A 2GK1A 5GQBA 1UUQA 1PAMA 1WE5A 1D7FA 4BS0A 1VEPA 2JIEA 4ZFMA 4JKKA 1UA3A 1RP9A 3TTSA 2WHLA 1A47A 2Q8XA 1GJWA 1XC6A 3L4ZA 5GNYA 4CCDA 3K4AA 2EO7A 1PX4A 2O92A 1TA3B 3VD9A 2YA2A 1CLVA 4U3AA 3IJ9A 4AD1A 3QGVA 2XPKA 1TVNA 4U33A 5E6ZA 3KL5A 2QMJA 3ARTA 2RGLA 1UHVA 1MW2A 4UOQA 4F9JA 1BVNP 3EDFA 2WVSA 1UR0A 4J27A 4BQ4A 3SUWA 1E6QM 3VGDA 3VU2A 2G4FA 1HKMA 4AC1X 4CN1A 3WH8A 3AROA 2CERA 2DSWA 4JL1A 4Q7NA 2IXVA 1JD7A 2W61A 3AJ7A 4TVUA 1KCKA 5DMYA 3FAWA 4UQCA 4AD0A 1RH9A 2XM1A 4RE3A 3UEQA 1MXDA 3PZQA 4E2OA 3VD7A 1OINA 4DWSC 3U7BA 3J7HA 2WSKA 2WMIA 4TTUA 4QAWA 4OOZA 4CCCA 2W63A 5CGMA 4M81A 1QI3A 5IFPA 3CZGA 5KZ6A 5BROA 1V08A 1ECEA 1PEZA 5JIPA 1W1YA 3VX0A 3RJXA 3AXHA 4M8UA 2PB1A 1J01A 4CN6A 2J78A 3CUJA 1JDDA 4PMUA 2AAAA 1B1YA 1G01A 3DYOA 4D1JA 1VFFA 4N42A 1UR9A 1CXIA 2CNCA 4QLKA 4L4PA 2W4XA 1JF6A 2JEQA 5HNNA 1E1EA 3CIVA 4HA1A 1XHGA 5HXMA 2D3LA 2VOTA 3SEPA 1KQYA 5HPOA 2ZX6A 4BCEA 3G6MA 2WCAA 2D0FA 2EPLX 3VINA 4Z2KA 1HKKA 2D0HA 1AVAA 3PZGA 1BF2A 2W62A 3EYPA 1C8XA 5ABEA 2XVLA 3RM8A 2OYKA 1VJZA 3MUIA 3CUFA 1H5VA 4TVCA 1LL7A 1EO5A 3GNRA 3W26A 2DGAA 3WD4A 2CHNA 2J7DA 1UKSA 4OBRA 2BXZA 4H8HA 2VZSA 5AY7A 1JXKA 3OBAA 5E70A 5E6YA 1FFRA 3I3DA 4KWUA 3CZJA 8CGTA 4D72A 5TD4A 5DFAA 1UG6A 4MB4A 5DF0A 2ZUMA 3VIPA 4JIEA 1ZS2A 4UFKA 3WNOA 4BQ3A 3T2QA 2JEPA 1TA3A 4HA4A 4N0RA 3VDCA 2DT2A 1VBUA 3TOPA 1GVYA 3WENA 1IT0A 2GDUA 5CG0A 1CPUA 1E6XM 1X1NA 1E70M 1C3FA 1G9HA 5BWFA 4QLLA 3B9DA 5I79A 2YKKA 1V6UA 4JCMA 4OZOA 5JBDA 3WFZA 2DSKA 3IK2A 4M56A 2V38A 3ZOAA 3MUZ1 5D8ZA 1PX8A 3AYSA 2WK2A 3HU7A 1J10A 1ZU8A 2BXYA 1CXHA 3AMLA 4IPNB 2PWFA 4Z2JA 2UY2A 4JL2A 1UKQA 4JKLA 3GXMA 1GHSA 3VGGA 3WH9A 2ZWZA 1UWTA 1EDQA 2E9BA 1LL4A 3RO8A 3AHVA 1HP5A 4P7LA 2J7FA 5A8QA 4NZCA 3AIRA 4S3JA 3SCVA 3RDKA 3L2MA 2XIIA 4DUVA 3GH4A 1AQMA 4V27A 3ARUA 3IAPA 3K46A 1R87A 2WANA 3DHUA 3ZT6A 3ZJ6A 1CXEA 4E4PA 1OBAA 1XD0A 3RPMA 1D3CA 1SFSA 4UZSA 2O9PA 4PTVA 2GSJA 3EMCA 2XYLA 3AIBA 1GOMA 2VT0A 4MNLA 1OSEA 4LGXA 4AXNA 1EOMA 1XSKA 1VIWA 1UQZA 2A3AA 2J62A 2CKSA 1WZLA 1UH2A 1S46A 5BXPA 4D6CA 5LYRA 1JI2A 3K8MA 3EBVA 2DT3A 4GI6A 1H0GA 3LPPA 4PUEA 1JZ6A 1VEMA 2OYLA 3NSMA 3AI0A 1ISWA 4KGJA 4MB1A 2OSWA 3B9AA 1GCYA 1DEDA 4KRTA 1ZBCA 1C8YA 1XH2A 5EBAA 1QI2A 3NIYA 1K6AA 2WVTA 1WP6A 4F79A 1UR1A 1KR0A 4J3TA 5C71A 1QBBA 3WD2A 1KXTA 1UA7A 5IFTA 5ABHA 3SIMA 3OIHA 5KEZA 3UG5A 1W1TA 1JYVA 1SMDA 1CECA 3W6LA 3VILA 2G8ZA 2J7GA 1FH9A 1HIZA 4PMNA 3WNNA 4PEEA 4TXEA 1E6NA 4CVWA 1DP0A 1F4AA 1H11A 1JI1A 1QNSA 5A8OA 1AQ0A 2J79A 4HOXA 2YLAA 4W8BA 3GBDA 2YA0A 3D3AA 4UQEA 3ARPA 4PCSA 2YL6A 2EQDA 3B9EA 3VIKA 3IAQA 3VM7A 3BAJA 1D2KA 1WDRA 4L4OA 1SR0A 4ZE5A 4B16A 4X9YA 6TAAA 4CU7A 3CUIA 4LYRA 4AZ5A 4H7VA 3LPGA 5IHRA 2WHJA 1FP9A 2XM2A 2V3GA 3ECQA 1NQ6A 2UY5A 1BTCA 1CXKA 4HPHA 1V03A 5HDRA 2BY1A 3M7SA 4WLCA 1QVBA 5CGTA 3AIEA 4TX8A 1DHKA 4JZ5A 1RP8A 1NWUA 1R86A 3GZAA 4YHGA 1EOKA 3RM9A 4QP0A 3VKKA 1GORA 1OCQA 3SCPA 5A8MA 1XD1A 1EIBA 3BSGA 1BSIA 1B30A 1WPCA 2Y24A 3WQ5A 3GTNA 5A69A 4JCLA 4MNJA 2IXUA 2XVGA 3CO4A 1E9LA 1XCWA 3CH9A 4J3WA 4ML4A 3UETA 1UD4A 2Y2WA 4FK9A 4IISA 3N13A 4PCTA 1BFNA 3PTKA 4GZIA 4MNKA 3GDBA 4P8UA 4C7GA 1XYFA 5DT7A 3T0DA 3SCSA 3F5KA 3GBEA 1UWIA 3F5JA 4PMYA 1C92A 3FN9A 3UG4A 5I23A
chains in the Genus database with same CATH superfamily
2Y61A 1F2JA 3QMRA 4J5NA 2ONEA 4MYAA 1MDRA 4MZYA 1S5VA 5CPOA 3GC5A 1K02A 3TAOA 3W82A 3AMCA 3S1WA 3WDPP 1JAKA 3E2VA 1LP6A 5C5YA 4GYPC 3SCRA 4MLJA 3NQFA 1JAEA 1QOQA 3ARYA 2YCJA 3KCLA 1RA0A 4B3KA 3R6IA 3MBDA 5LXEA 4QCEA 3P5ZA 1HVQA 2DORA 1VFMA 1VFOA 3A24A 1KWGA 3M0YA 1KCLA 1NVMA 4PB3A 3M0VA 4D6EA 3VZXA 1ITXA 2UWFA 1DE6A 4V1XA 4AZIA 2PGFA 4MFEA 1GG1A 1GNXA 1OABA 3B8VA 3NL2A 4N9CA 3MMUA 3LN3A 3KOZA 3NQDA 5BW6A 3GNXA 3TSDA 5BMXA 3HPFA 2NX3A 1PIIA 1UR8A 2GJPA 5D03A 3CZEA 4RZ6A 3WLIA 4D8ZA 4L80A 4Z0SA 2YPIA 1TIMA 3TN3A 3HGJA 3CPGA 1I2QA 1OGSA 2QPUA 3MUAA 1DL3A 2IMRA 4B5WA 4QDMA 4FLRA 5I2UA 1VF8A 2OWWA 4GZEA 3CTLA 4A8IA 4UCGA 3OQ8A 4ZQRA 1RJQA 1HZYA 2GSHA 1LBMA 3AHYA 2WC7A 1XIDA 3OVRA 1IGSA 1QDSA 3CBWA 1ZHAA 4OIFA 2YA1A 1UP2A 3KBWA 1LWIA 3U9IA 5A3HA 1PCKA 1NFBA 2WLZA 1Q45A 3O6DA 4UTKA 1KM0A 4C6QA 4ZODA 1CCWB 2YL9A 3UQNA 4IHCA 2NVCA 2V63A 3HG4A 4YWIA 3BOXA 3WQGA 3WMLA 1X1ZA 1RD6A 3LZ3A 1YNQA 1E3XA 3TQPA 1MUCA 3EWXA 4PULA 4Z2HA 3NZRA 3WDHA 4BWLA 3RM4A 5A6MA 4OHQA 4LY4A 2Z6IA 1DJIA 3U5YA 4HMCA 1T8QA 3QV8A 1PHQA 4NX5A 2VR4A 2GFTA 1ZP4A 1HO4A 3QGKC 1LL6A 3O05A 2PURA 3WNMA 1WZAA 3PZTA 4W7VA 3RNDA 4HU8A 1VPQA 1H62A 2PP3A 3RX2A 4LB3A 2X1TA 3WLQA 3KZSA 4NJIA 1NIUA 3UP8A 2YZ5A 3B0VC 2PD5A 1EDGA 4F9DA 1ISVA 3L4UA 4YTRA 3UR2A 5D04C 1SVDA 2VX6A 3LERA 3MDWA 1UUMA 1W56A 1WKFA 2CLEA 4AZBA 1ZY9A 1AZ2A 2A6LA 2V68A 3G3MA 5CGQA 3OLIA 1YLVA 4ZOAA 1BG4A 1V3HA 1XLEA 1TE6A 1WDPA 1HNYA 1R47A 1V0MA 3QN3A 3PNUA 1VLWA 4DO4A 4W84A 5KZMA 2E3ZA 1PWMA 3T0AA 4D71A 3P67A 4U4MA 3PWIA 1G7VA 3TJXA 1DWJM 4AZCB 1H09A 2V69A 4ZQCA 2NZLA 4QQUA 4M7TA 1W5PA 3MSYA 4ZQMA 5FD0A 4RXGA 1M03A 4YLWA 4GI8A 3CO8A 1V6TA 3NQ2A 3FGCA 4XAFA 1H7WA 4ZCWA 2POTA 4BQ5A 2P1FA 4IF2A 1NP2A 4DF1A 2PDJA 4OQVA 1QW8A 3S5SA 4PTMA 4F2TA 3I3BA 2PWGA 5HMDA 1JL8A 1R6WA 2X0HA 4KH2A 2HXTA 1M1BA 3S2CA 4M51A 1MNSA 3V35A 3P61A 3E0IA 4YN5A 4E8DA 3BGGA 2PDMA 2R8WA 4CQ9A 2A6NA 4LC8A 4MDOA 4JYEA 3GG0A 4DO7A 5KTLA 3CLMA 4MGGA 2BZNA 4O15A 1JD9A 2F84A 3W1RA 3LGDA 1VB9A 4DM1A 1SO4A 1TELA 3MV01 5KZDA 4AEOA 1M41A 3VIMA 1F07A 3CZLA 3TX9A 4GIAA 5C7HA 1KM5A 2ISVA 2Z27A 1XLMA 1L6WA 3C56A 2PF8A 3TDFA 2VCBA 1BYDA 1DIKA 2Q8LA 1EEPA 1C29A 5EA9A 3S2JA 2BOEX 3I65A 4MOZA 3N29A 4GIRA 1AD4A 3PZ9A 1EX5A 2YL8A 5C0QA 1I2PA 1E1FA 3AXIA 2R82A 1VPYA 2OQHA 1HJXA 3FJLA 2YBUA 1TZ9A 2XN1A 2DSUA 4NYUA 2QUUA 1ISXA 4NT0A 2WBKA 4U28A 1O1HA 2WZMA 2GK1B 4UNIA 1RQBA 1OFBA 1XYBA 1VYRA 3BDKA 5K4XA 5GPRA 3Q67A 3BAKA 3BG3A 4XZMX 1XX1A 3AZRA 2NSXA 3ARSA 4FA3A 3OLEA 1OF6A 4A22A 5G4HC 1JYNA 1UH4A 1IYXA 3IJ7A 1Q6GA 5GJNA 4PSPA 2J7EA 4IP7A 5HPCA 3M41A 3BARA 6PTDA 1SZGA 4I6VA 1YDNA 3BXWA 4H3DA 1JZ5A 4EWJA 1W9VA 2FH6A 1HUVA 1JFHA 3LB0A 3W2NA 2BLEA 3M0KA 1QI4A 3VNKA 2Z24A 3EOUA 3VX1A 1A5LC 3ALGA 2DZWA 4D6FA 5CLWA 5FSDC 1XDJA 3W27A 4NAFB 1C7SA 4OWGA 2E40A 3UERA 4JTJA 3W24A 3G1XA 4UOZA 1DWHM 1XYCA 4R3UA 1ZTVA 2GUUA 2ZA3A 4O0KA 1FDJA 2OXNA 4LAZA 1SW7A 1D8CA 2VWSA 3HMCA 3UA3A 3RN6A 4F0LA 3VD5A 2G50A 3OYZA 3BSMA 2Z26A 4PEKA 1ME7A 2GVGA 1P6WA 4TO8A 3WLJA 2PLCA 2YGYA 3PG9A 1KGWA 4AMCA 2XH4A 4LCQA 2H6RA 3L4XA 3WMBA 1PKMA 1XIMA 2ZA2A 4WOQA 2G96A 4PMXA 2QR6A 3EKGA 2CIPA 3CASA 3L21A 1R5YA 3OA3A 1QATA 1CB2A 1WV2A 1AMKA 4XX6A 2FZNA 1MFVA 4BA0A 3AFBA 2TYSA 2ZXAA 3O0FA 3T05A 2XISA 1S5TA 3MSDA 4Q8TA 4YXGA 1C93A 4GBUA 1FX6A 2F38A 3SR7A 3VOIA 2ZDSA 3VIHA 1WBHA 3WLLA 2KX9A 4LVBA 4ALDA 4EPKA 1KBLA 4PR4A 1JNEA 1XRVA 2B81A 2NXGA 4AIBA 1UQYA 4X0NA 2DP3A 5FIPA 3QOMA 1ZRQA 3URQA 1PBGA 4LW7A 1FCQA 4JTKA 3I4EA 1AH3A 4HN8A 2XSBA 1D9EA 1X1OA 4R7OA 1XICA 3MZNA 5EPDA 3DBPA 4JN8A 3RMEA 3M7WA 2ZX7A 5JMUA 4O57A 5HWNA 3NO5A 1LOSA 1ZJAA 2CXGA 5J5DA 3F4DA 3O16A 2X1UA 3VPLA 4H7CA 1RPXA 5LHFA 5U4NA 3IWPA 1K3UA 3GXTA 3KEHA 3U4AA 4W88A 3LV6A 1V6YA 2J27A 1V0NA 4IUGA 3ABQA 3QTGA 2TRSA 4O1FA 3GNPA 1GVSA 1KLZA 1B5TA 1UKOA 3MUXA 3LNPA 3N17A 4PMDA 3ZT5A 5A2BA 1YTKA 2WCSA 3A21A 4X2RA 3QV7A 1TPFA 1LORA 2ISSA 3ATZA 3T2PA 4JD4A 4AVFA 3O07A 3VFCA 1ZSXA 1HT6A 3KLKA 2PDIA 1OYAA 3TC3A 5GNXA 3LHZA 3THAA 5EFDA 3E2QA 3KTXA 4G6CA 3N2CA 2ZUWA 4XUGA 3K4DA 1FUYA 4X9SA 1VLIA 4KGLA 4MY8A 3T0BA 1IXPA 3MW7A 1FWBC 2C19A 3KVKA 1AH4A 4QJ3B 3QQ0A 1QT1A 2ZZ7A 3P0WA 1MVYA 4UCFA 3WEZA 3HGRA 4QFUA 1MSSA 4UTHA 4K1GA 1AJ0A 1GTEA 1O7AA 3RG6A 1UUOA 3L65A 2E0PA 3TJLA 2DH3A 3H2OA 1XBVA 1US3A 3V0SA 2VRKA 1B3VA 2Z6JA 5F1UA 3EB4A 4C1NB 4ERAA 2H8XA 1H61A 3DERA 4GJIA 1MYRA 3QQWA 2I1OA 4DZ5A 3FVMA 2QDDA 3B05A 2X41A 4YMZA 1OK4A 1AL8A 4DWSA 4EWND 1W1A1 3UWVA 3M6DA 3VM5A 4GABA 1V79A 2YYUA 4WSKA 1FH8A 2OEKA 1L0PA 4E5TA 3EA2A 2WMFA 2VUNA 2Z1VA 4GD0A 2R91A 1JDCA 2NV2A 5D8WA 2G5WA 5K9XA 7CGTA 2OR2A 3VCRA 2FZ8A 3A6OA 4FXJA 3GDMA 1KBBA 2VFFA 3AU2A 1S1RA 1NDWA 4C5ZA 1VCGA 3CZ8A 4QLJA 4O53A 2VX5A 4EPDC 3M5YA 2Q3RA 1SSGA 4JTUA 3RU6A 5D38A 1YHTA 1FTXA 2YOCA 5CC7A 2GWNA 3GM8A 3HFTA 4M6PA 2FQIA 4PRTA 3TXVA 4M6UA 1KRAC 1EGMA 4GINA 5HA7A 1J11A 5IBXC 3SUUA 1H7XA 5K4ZA 4LUJA 1YQ2A 3P74A 1IEWA 2OLAA 4A2SA 3VDBA 1OFQA 5JQ9A 1DHPA 1GVFA 2NQJA 4I9AA 4AZ6A 3OLDA 3W7HA 1DBTA 2YR1A 1UIPA 4NG3A 2CBJA 2DY3A 3N25A 3KCJA 4XTIA 2DSZA 4IJCA 1VAHA 1FWTA 4Q4MA 4NRSA 2ALDA 3KWSA 5CKSA 1OFDA 3W22A 3B0YA 4WIWA 4QE1A 2YXGA 3QRHA 1CZ1A 4WD0A 2B7OA 5ABFA 4MHBA 2Z2UA 4DBUA 2A85A 3UU0A 4TX6A 1VBGA 1S5MA 3RGTA 4RW5A 3L4TA 3G1FA 4AC7C 3G1SA 3RPTA 1KV8A 1B90A 4C65A 1E73M 3AS2A 3GFYA 1XFCA 4A6GA 2GUYA 1OT2A 4EXAA 5C6MA 2CC0A 2Z1WA 4CU8A 2DZXA 1ZENA 2XVKA 3LRKA 2ISDA 5CAHA 1BQCA 1W1VA 3W02A 1TB3A 2Y8VA 1TMHA 5EKYA 4YPJA 1EJXC 3PJWA 3W2JA 2E8ZA 2E5CA 1E15A 3M0MA 5B7ZA 2OWXA 1HXJA 3CV6A 1DJGA 1MXGA 4PMVA 1P0DA 3BAXA 3WKZA 3NUKA 1REQA 1K8ZA 2OB3A 4W4QA 1WDDA 4ZO6A 4LV9A 1WZMA 2QMKA 1T6MA 3EDDA 3GAYA 4O17A 3N9RA 1XYAA 4GQGA 4U2YA 1SSDA 4BR1A 2PDUA 3WK3A 3N73A 3BOFA 1FFQA 3MKKA 3U6WA 1UW9A 4IL2A 4S3CA 1A4LA 1JPMA 2J8TA 1RLDA 4ONVA 4AX7A 4M5PA 4FEZA 1YTDA 1NWTA 4HU4A 3WCZA 5LIYX 2FPYA 4JIPA 4GE8A 1AZ1A 1L2QA 4M24A 1ADSA 4I8DA 1BYBA 1E4MM 3DI1A 3GU2A 4G5DA 4DM2A 1L6YA 3WYZA 1JG9A 3VGBA 4E8CA 2CHRA 1V5XA 1CXLA 3LX9A 4F3HA 2VZTA 4IOTA 3S46A 3Q2DA 2C71A 3CMFA 1NOWA 4DI9A 1MW3A 2ZKMX 3DECA 3GUWA 5HAOA 4LNYA 4ZOBA 1MQRA 3A4XA 4O14A 3H55A 4FXRA 4NSBA 2DUZA 4MB5A 3ES8A 3M16A 3QZAA 1BLIA 3IGXA 4ZO7A 2FFCA 1EUNA 2ZWYA 3MMDA 1TPWA 3BJSA 4BF9A 3NYZA 2AMGA 4PBGA 1R3WA 3K8LA 2EKCA 4CCZA 3KBVA 2IKIA 3MMTA 3CEPA 2CCRA 5E1QA 3D47A 3VOCA 2XGBA 1BAGA 2ICSA 3STGA 3PC0A 3W7IA 4W9TA 2C16A 3OZOA 3GHRA 3OGRA 1TCMA 3OO2A 3VUPA 3SCQA 3AIWA 3HQOA 4DYJA 1R3RA 2QCDB 1NFPA 5AOUA 3VNDA 4IMDA 1IEVA 4RNIA 4BZYA 3EWZA 3M5ZA 4A29A 4EP8C 4Z2LA 4ACZB 2OT1A 1N7KA 2WVVB 4E0CA 3BLOA 4L5ZA 4GC4A 1NH6A 2YCIX 4DEFA 1M53A 3A22A 3N9KA 2PWHA 1DOSA 2OFJA 2WMHA 4UQAA 1E55A 2WM0A 1ICQA 3GDLA 4HP5A 4C1KA 4KS0A 1R7OA 4JTIA 5I3JA 4UMCA 3VKCA 2HWGA 3LXAA 1REQB 5D02A 3GK0A 1KXQA 1HJWA 1KXVA 2BY2A 2Y6ZA 3T4CA 3NM1A 3MHUA 4FO4A 1W1ZA 4JY9A 4Z1DA 3C0LA 3LDVA 1CGXA 3AJXA 1PZ0A 2E77A 2Y8UA 3C0JA 2WPBA 3M6YA 4PUUA 2QEZA 1H63A 4ZVJA 1XGDA 5E0CA 1ONXA 1B9ZA 1UASA 1KBIA 1CTNA 4MIMA 1OHLA 2B7NA 3FKKA 5XIAA 3K30A 6REQA 4DUWA 2BP1A 1XGZA 4HSHA 1VFUA 3LRLA 1EHAA 4M6VA 4S3GA 2R9RA 5HK4A 1XLHA 4WDUA 3B8SA 2W67A 1ZP3A 1J5TA 2PWUA 4AISA 2FLIA 1SR9A 4HBKA 4BQ2A 2WSPA 1V6WA 2HBXA 4MWAC 2VP8A 1DVJA 3GFXA 3OEXA 1FKXA 3GVVA 4AD3A 4DZHA 1O1ZA 4Q4OA 2INEA 2W9MA 2Z1SA 1MWOA 1LT7A 2OEJA 1GOXA 2C7FA 1HL9A 1XLLA 5F7UA 4DNMA 4A8RA 1BTMA 1VCVA 3T09A 3BWWA 3LPOA 3IGHX 3N1AA 4HOWA 2G3NA 2E7FA 3EOEA 4XKMA 1AA1B 1AODA 2UBPC 2VTFA 3L0KA 4FR1A 1TTJA 5HWJA 4MAZA 3T08A 2PDBA 1PX3A 1IR1A 1W31A 1UUQA 1VPXA 1ZAIA 4BS0A 3N34A 1F6YA 3EXSA 2JIEA 4KBXA 9RUBA 1J93A 2I14A 3TTSA 4DPPA 4AH7A 1GJWA 2GOUA 4K37A 3R79A 3GNNA 3CJPA 4CCDA 3K4AA 4E3TA 3VD9A 3KCOA 4MWAA 4DZAA 4PODA 1CLVA 4U3AA 3KTSA 2OQYA 4HZMA 3EOSA 1TVNA 3KDOA 3ZZ1A 4AF0A 3AWNA 2YXXA 4MF4A 1I45A 1BKHA 4JQ3A 3EDFA 3BE7A 1BVNP 1SM9A 3V3WA 3SUWA 2PZNA 2YX0A 1HKMA 2C3ZA 4JTSA 4EF9A 3UZ5A 3G1HA 2ZDRA 3NQGA 3S5ZA 3NQEA 1UP0A 2IXVA 4L65A 2W61A 3EAUA 4UQCA 2ISWA 1MXDA 4HA0A 1R9YA 3ZLHA 3J7HA 2WMIA 4TTUA 4CCCA 1ZGDA 3BVJA 1W5QA 5CGMA 4M81A 1TTQA 5JIPA 1W1YA 2Y0FA 4JGDA 4B5UA 1YEYA 1RSCA 1UPMB 5AHIA 1RQHA 4L64A 1GYNA 2J78A 1G69A 2QAFA 1S3TC 1G01A 4O1CA 2OQLA 1VFFA 5K2ZA 1S38A 4QLKA 2OU4A 2YSWA 1JF6A 2Y7EA 4FIQA 5HNNA 5HQEA 3CIVA 1FWGC 1W17A 5H8PA 3BMXA 4HA1A 4JTDA 3G8RA 5HXMA 3E12A 4Y2WA 3HPAA 4BCEA 2PWVA 3NZPA 2NWRA 1G4EA 4IFKB 4JNZA 4PBEA 1K7FA 1C8XA 4A21A 5ABEA 2XVLA 3RM8A 4IMFA 1Y5VA 3MUIA 1IEIA 3USZA 3R5EA 4H9YA 4OBRA 2VZSA 1O60A 3LCLA 4Z1BA 2FKPA 1A53A 4NJKA 3OBAA 5E6YA 5IBXA 4EXBA 1KV5A 2YCEA 3CZJA 3NO1A 3SQLA 3MDUA 4LUTB 4C6MA 1Z8AA 5AHLA 2ZUMA 3GZ3A 3OIXA 3NNTA 4Q4QA 4HNTA 5I7GA 4GACA 4HA4A 4N0RA 1VBUA 3CHVA 1GVYA 5CJMA 2GDUA 4EAYA 4IJRA 1L6FA 2AKMA 3GUGA 3G0SA 4JYDA 4IMAA 5GJPA 3B9DA 5I79A 2PDFA 1M7PA 1V7YA 4KPLA 4M56A 3N3TA 3ZOAA 3MUZ1 4XQ6A 4AY7A 1LZOA 1JQXA 3BICA 2CLMA 1YPIA 3C61A 1ZU8A 3QMTA 5CCZA 2BXYA 1CXHA 4ORIA 4LVFA 2HDJA 2PWFA 3H2CA 5I3FA 2FB2A 3GVWA 3T07A 4R33A 3CQJA 4UTLA 2NSOA 1EC8A 1NFGA 1DIEA 3GU9A 4BKNA 4JTHA 4OECA 3MT1A 2OZ0A 3AIRA 3SCVA 3L2MA 1ICPA 1AQMA 2PUZA 3M9YA 4AMAA 3IAPA 3K46A 2BDQA 3HO8A 1ZLPA 1ENUA 3I6EA 2G4JA 1CXEA 1XD0A 4O12A 1Q7QA 3EMCA 2XYLA 4E4UA 4MNLA 3UT0A 3NVDA 1OSEA 2PODA 4P61A 4DBEA 2Q8ZA 2J62A 4ROPA 4FXFA 3NL5A 2CKSA 3PUGA 5BXPA 4D6CA 5LYRA 3K8MA 4BF5A 3IJLA 4GI6A 1H0GA 3LPPA 4I90A 4PUEA 1XL9A 4OTKA 3AI0A 1ISWA 3Q94A 3CB8A 1KM2A 1YXCA 3U3HA 3B9AA 1DEDA 4ADSA 4KRTA 3IGUA 1P48A 1QI2A 3NIYA 3OQEA 2ZZ1A 3F2CA 2WVTA 3EKZA 4LTSA 4YL2A 4XZNX 1UC5A 2AL1A 1XXXA 4MKSA 4XD5A 4LCSA 1CECA 4K6AA 4G56A 4QBXA 4IMEA 3TE9A 1FXPA 5CC3A 2GGHA 4TXEA 1E6NA 4ZGYA 4JTEA 1F4AA 5A8OA 3W1TA 1AQ0A 3T9PA 2PS2A 3L9CA 5C2GA 3D3AA 4IMGA 3TR2A 4B5XA 4KRZA 3IAQA 3VM7A 1GZ1A 1AD1A 1OADA 3HURA 3IEBA 1LCOA 1RALA 1X98A 1ZZMA 4H7VA 3LHTA 4JDYA 5LSMA 1XWYA 2V3GA 1F05A 3ECQA 1NQ6A 5EGRA 1S2TA 1R2TA 1JRBA 2AMXA 1KM3A 2BY1A 2QT3A 4DXKA 1W1IE 4TX8A 1EYWA 4C6DA 1NWUA 5H2ZA 4K7YA 3GZAA 3OZYA 3PPGA 7XIMA 3RM9A 4Z0JA 3NL3A 4QP0A 1GORA 1DQWA 3K2GA 4L1GA 5ECVA 2E09A 4DXVA 3FYOA 1EIBA 3MP3A 1BVWA 1XIEA 4NYYA 1FWIC 3P81A 1B30A 2XFWA 3GTNA 5A69A 4GQBA 1PTGA 1LDCA 4JTCA 3ZR4A 3ANUA 5HQMA 2GL5A 3KP1A 1UD4A 3ABZA 5CZJA 4H9MA 3FJ4A 4H7ZA 4MNKA 4YVPA 5KETA 4Y6GA 4P8UA 4C7GA 1XYFA 3T0DA 5H8MA 4OGZA 1UWIA 3F5JA 4PMYA 3V1HA 2DZTA 5A8GA 5F2MA 3FN9A 4ZSTA 5I23A 2PZ0A 4WR3A 1OGGA 1H1ZA 3WUFA 3C3NA 2GZXA 4CCEA 4JYFA 5CLTA 5LA2A 1PKYA 3M47A 1UWAA 3LHVA 1CEOA 5C55A 5CBJA 3NPVA 1THFD 5I6SA 5I3DA 3ZT7A 4AQLA 1HP4A 1XLAA 1YXYA 3WJYA 3ZWSA 3M1ZA 2V2HA 3AICA 2CW6A 1A5AA 2FHBA 3T44A 3L2LA 4Q8OA 2ZOXA 3DDMA 2WVUA 4LYQA 1POJA 5REQA 1NEYA 2DEPA 3I3EA 4LAUA 4B15A 4AZGA 5F1VA 3GAKA 4V28A 1BXBA 2PC8A 5CBBA 3AMDA 4XVEA 3P5YA 3WUGA 1NTHA 3VE9A 4PFMA 4A3QA 3PFRA 3EGJA 1TR1A 3MP5A 4J1OA 1L9WA 3E5PA 2JQXA 3BLEA 1W3IA 3WK1A 5BYWA 3W87A 3ANYA 1UPPA 2PP0A 3THDA 3BO9A 4WSJA 4ERGA 3GDTA 3FGCB 4A8LA 2IUZA 3VIGA 4HPJA 1L8PA 4R7WA 3DYMA 3OBKA 4QNWA 3N4AA 2BVDA 4UTIA 1OYBA 4NXSA 3CT2A 1GEQA 4HMDA 4KCTA 1BEUA 2IQDA 2ATMA 4WDXA 1WYIA 2BNJA 3CV2A 3D3FA 4WKAA 3T42A 5CXPA 3KDNA 2P76A 4CGTA 3TN6A 3GC4A 2BY3A 5BU9A 1O5RA 3D6NA 4QX4A 2PDYA 1AQHA 3WDRA 4AIEA 1TVPA 3EPNA 4C6OA 1WOBA 3W86A 4Q4SA 2YZRA 4GYJA 3SSZA 3L0NA 2BODX 4F2BA 4GUIA 4JQAA 4L56A 1K9FA 1FHVA 3DU0A 2ZUSA 2ZRXA 2IKGA 2QV4A 5TQLA 4NKCA 3ZIZA 4IMCA 3SCOA 3FX4A 3VIOA 1UWSA 3L5LA 3BC9A 1JPHA 1QI0A 2GGJA 2QCLA 2W27A 2I9UA 2OKTA 2CU0A 4HNNA 1EQCA 3QC0A 1TE1A 2O9RA 1US2A 5BRQA 2ATSA 3CAVA 4CQAA 1E51A 2XGZA 3ABRA 1BF6A 4DUXA 3UWUA 1W9UA 4MWAE 4F0MA 4E2BA 3O2LA 4YTTA 3POHA 3G22A 3MHGA 5HOSA 5AHMA 3S9YA 1PL9A 1KW1A 3KBMA 1FWFC 2CLPA 2OEMA 3A47A 4WK9A 1XLDA 4O19A 4LX4A 5LA1A 1I2NA 3C5QA 3N11A 4NJGA 5IDZA 1RCQA 4ADTA 4ORMA 3R8GA 2D69A 3SUVA 3PULA 4UFMA 3UW6A 3AIVA 1ZAHA 4MADA 2J75A 2Z7GA 2XH7A 4MZ1A 3ME3A 3LOTA 2RH9A 1W3TA 2V9DA 3TTYA 6TIMA 3TNBA 2I9EA 2PPGA 1BKSA 1JGMA 4EXQA 4JBRA 4UQBA 3SUSA 4CN4A 1KFBA 4JTGA 1R8LA 3EPMA 1PKNA 4HA3A 2F6UA 3PANA 3Q45A 3UYIA 2QCNA 3ITLA 3GR8A 2A1YA 4I6KA 3LEPA 1TO3A 3GLCA 4PC8A 5H8UA 1TJ2A 3PSVA 5IHSA 3VABA 2CZDA 4KW2A 1NY1A 1H7NA 3URBA 4JHZA 3W7RA 2PU1A 1XIIA 1ALDA 1EYEA 1OF8A 2A3LA 1TJ0A 3PAOA 1HL2A 3UXKA 1UZ4A 3T0TA 3V36A 3ZMRA 2V5DA 1EA9C 4LBSA 3UJEA 3AXKA 3ISIX 2PC4A 5FKYA 5ABGA 3DBNA 1EHNA 5JBEA 3H23A 2Y62A 4FNPA 4KKXA 3WJWA 2BB0A 5D9NA 3WY1A 1XUZA 2Z25A 4M7SA 3WQEA 4WY0F 5CSYA 1B3WA 4HPNA 5IM51 1GPFA 1IQ8A 2O55A 4D6JA 3N6HA 1J2WA 3GXPA 4REQB 3CHDA 4LVGA 4O18A 3KL0A 2C6QA 4G9PA 1JCTA 3PWGA 1EGZA 1LRQA 4MZ8A 4UUIA 1XBXA 1M9HA 3E2RA 2H9AA 3A12A 4YJ5A 1LWHA 2PCEA 2Y88A 1GYLA 3PK7A 4PMQA 4MG4A 3H7VA 2BTMA 3PBVA 2B0MA 3T0CA 6ALDA 3L4VA 1XJBA 5D2YA 4GCAA 4B3ZA 2BX7A 3S5YA 4EOUA 2WAGA 3HPXA 3UF9A 3D0CA 4UOJA 3WF2A 1PO9A 2NUWA 1WXYA 2DIJA 1BQGA 1K8YA 2V3FA 4LYKA 2VFEA 3U48A 4FF7A 3ZSSA 1VHNA 4KWVA 4B5VA 3WIJA 4BHYA 4QG9A 1HX0A 1WX0A 1FWCC 3FY1A 5AC5A 4U5IA 4PYSA 3OHMB 3CGTA 3RR1A 5I3IA 2D24A 2INZA 3FS2A 4NNBA 4B5SA 1I2OA 3XISA 3HB9A 3QHMA 3QQ1A 1Q7ZA 3N6JA 1HJQA 4UTUA 4H1ZA 1MUWA 1MRAA 1US0A 2EAWA 3RITA 2X7WA 3OGSA 1ESWA 3ZJ7A 3UD6A 4XAPA 3QLDA 4DJED 5T9BG 1ZFJA 5D2TA 4DWDA 2BOFX 3CHCA 1MRQA 3FEQA 1EIXA 8A3HA 3ARVA 1S2AA 1IXOA 3CV1A 3MA8A 2VJXA 4P7RA 3VKBA 3BW2A 5ABTA 2GJRA 4EAMA 4FNUA 1XW8A 4J28A 4HSOA 3CUHA 1SZFA 3QY8A 2ZBTA 4TUFA 3S4TA 4IG2B 4KETA 5AZ0A 2WMGA 3WDQA 3B8IA 4QTGA 2NV9A 3H70A 3NA8A 3C2YA 3PTMA 4IZGA 5C8BB 4JFTA 4LBUA 1X39A 3O06A 4ZTYA 1XRTA 3MANA 3MB9A 4PB5A 5DCBA 2A3BA 3B8DA 3PUOA 3LHUA 2PMQA 2J6XA 3LCHA 2DFAA 5LNWA 2XUCA 3NWRA 1WKDA 3W7NA 3VD4A 5EYWA 2GVEA 3NQ8A 3WDJA 3WQVA 1XQKA 3C2EA 5EMMA 4Z2IA 1FOBA 4D6HA 1VEOA 1RY8A 5A94A 3CUGA 4W5ZA 4KF1A 3OTRA 2OSXA 3G1AA 4H01A 5A1AA 3M0HA 3W37A 3BGAA 1U33A 2GWGA 1ME8A 2JE8A 3AO0A 1MQPA 3T2OA 3APGA 3ZLGA 2DZPA 1KCXA 1GVQA 4G7EB 1PKLA 5CJNA 3S9ZA 4JN6A 3QYQA 3NDYA 1N8WA 3BMVA 1JCJA 3IJDA 3UPBA 3WF1A 2VHLA 3PB0A 4O1AA 4XAYA 4KWOA 3QHOA 1WZKA 3AUOA 3HQNA 1QO5A 5TBOA 3W6YA 3W73A 3MCOA 4ZSUA 4LWWA 1IIGA 4P2VA 1HGYA 3NO3A 4F0KA 2WW5A 2QKFA 3KVMA 3IRDA 4S1FA 2G3FA 1W9PA 4HJFA 1UD8A 4C6PA 4MAVA 2HTMA 3BLLA 1V4YA 4QCFA 2HSAA 2WV8A 4FR6A 3VA8A 4QROA 2J13A 2FZMA 1JR1A 2OZ3A 3DYPA 3FDGA 3ICJA 4R7JA 2F7FA 3W76A 1UOZA 4IGMA 4RE0A 4O1EA 1X38A 8XIAA 2YW3A 2Z0IA 3QTPA 1DTNA 4GZJA 1F6KA 1OYCA 2RGMA 2VGFA 3SM0A 3DGBA 3H24A 3SAZA 2WHKA 1A5SA 3WBXA 3QHNA 4S39A 1ONEA 1VJSA 3XINA 1QPOA 1LQAA 2QDGA 5DANA 1W6TA 2G3IA 4JQ2A 3ONCA 4H9ZA 2GQ9A 1KO0A 1A5NC 3TW7A 2XDFA 3BAWA 3UG3A 3HN3A 3W71A 3AHXA 3S83A 4ICNA 1HJUA 8TIMA 1IF2A 4UTTC 2VQTA 2EPNA 2F8QA 4RDZA 3Q58A 3AIUA 3GC2A 4MPQA 4FOKA 2ZIDA 2A7RA 4PUDA 5EBUA 1W91A 3L4YA 1EJUC 1P7TB 3NTYA 4NZ3A 4GUFA 1J0IA 4O13A 3V75A 4PSRA 3BLKA 3BJFA 5GVJA 1JPDX 2H90A 5A6LA 2AKZA 2BMBA 1BXCA 1LG1A 3ALFA 3OOQA 3LLDA 3MYOA 2AOSA 4REQA 3LZ5A 4UBPC 4LJ3A 3A4JA 3B04A 1DORA 2CETA 2I5IA 1OY0A 4DHGA 1E6RA 2YB4A 3H4GA 4GY7A 1K8CA 2TAAA 1AL7A 3N2BA 2EJ1A 4R5EA 3IUHA 3IVUA 1YADA 4IX0A 4GO8A 5BCAA 4RLIA 3FFSA 4HTBA 5DT5A 5AB3A 4IICA 1UOKA 3HPZA 3M0IA 1VBJA 4MNMA 5FACA 2CLFA 1JYXA 1N8FA 4A3YA 4PA8A 1GEHA 2ZADA 2VCCA 1QNOA 4IQJA 2JKAA 1T40A 5HMEA 1YYAA 4JX5A 1H60A 2NQZA 2AL2A 3Q4DA 1NWSA 3WLNA 2OGYA 3P93A 5FSEC 3CHFA 4CD4A 4ZB2A 2Y7GA 5AYBA 2WC4A 3MKCA 1W5NA 3TSBA 2ZXQA 1P6CA 4LT9A 1JZ7A 1E43A 5C2XA 3GR4A 3KX6A 1XYZA 3WDIA 2REQA 1KR1A 4ZBCA 3TW6A 1XSJA 2QQ6A 4CNPA 1E1CA 1CGUA 5A2AA 5D2WA 3SCTA 3A13A 4MPKA 2BHUA 1XPGA 2GJXA 5FF7A 3ZR5A 4QEHA 5HJLA 1KGUA 4PL2A 1RBAA 2W66A 1Z41A 2D2HA 5G2IA 3WLTA 2D2OA 2NW0A 4B5NA 2FJUB 5A6BD 4B91A 1IZKA 5FI8A 2I16A 1EZ2A 2WSRA 1F73A 3IVSA 2OT0A 3H22A 4OUIA 4KFOA 3STPA 3KBSA 6CGTA 3L5MA 1B9BA 1O5XA 3IJ6A 4DJFA 4TMBA 1JYWA 4H8UA 4NZ1A 3SGUA 4ICCX 5FJPA 2ZVRA 1CW2A 5H91A 1GOWA 5BOFA 4CD7A 4WEVX 3DHFA 2CLIA 4BWLC 3CZKA 3L7RA 4IM4A 1XGEA 4XZWA 1H2JA 2E8YA 1TV8A 1UZ1A 5F2GA 2L5HA 1YXDA 5CQ1A 4WCJA 2Y7DA 1RBLA 2OSYA 2FDMA 4ATDA 5E93A 2VX7A 2HV5A 2VC7A 4IXXA 2PFHA 4X22A 3NPWA 5HANA 3CM4A 4DI8A 2FB3A 4F2UA 4QQ3A 3VNZA 2VFDA 2QYGA 4NI8A 1W8GA 4P8XA 3ZYZA 3W2KA 3ARRA 1UWQA 3A4AA 1T7LA 3OHIA 2I56A 4NZFA 2E6FA 2OPJA 1JUKA 1P0KA 3RPDA 1E5JA 1V77A 3PZIA 4PCPA 3JR2A 3SBFA 2HS8A 4M19A 1KFWA 3MI3A 4HNCA 4UNKA 4J2PA 3GQYA 4JFSA 5I24A 2BSLA 2GVJA 3ZWTA 4NNAA 2H9AB 1UD3A 2XH0A 1TPUA 5HATA 3QZ6A 4CD8A 2X1IA 4CNUA 4JFVA 4NF7A 1R3YA 2R1LA 4EK7A 2A4AA 1MZHA 2ZX8A 1S2UA 2PWDA 3WQ6A 1CXFA 4GHRA 4QXIA 3N9SA 4MFDA 1FWWA 4FSAA 3WUBA 1QW7A 1KFJA 1FWDC 1UD2A 4UFLA 2PDWA 4YNGA 2NT0A 2VWTA 4GH1A 3F4VA 1SZRA 1FDYA 4XUYA 5EL1A 3TONA 3KOYA 3QR3A 4MSSA 4A3UA 4XO7A 3N14A 3PBMA 1CWYA 1LUCA 7TAAA 4IP4A 4E4FA 2V0TA 4C1NA 2PBGA 2QF7A 2D1ZA 4FAMA 3MU7A 3SB0A 1NDZA 1W3LA 2ZX5A 4TV5A 5REQB 3KS5A 1JXJA 3SJ3A 3EEGA 1BYAA 3S42A 3V4BA 4Y9AA 1B31A 2ALRA 4BF7A 3SCUA 3VMOA 3FJNA 4ZXLA 3MWAA 2HS6A 4PH6A 1KFEA 3RHGA 3NXFA 1EPXA 4CKQA 4NQ1A 5J5RA 1P4CA 3L66A 1U22A 5KZEA 2E4TA 1Q6EA 2J25A 1AH0A 2WLYA 2D2GA 3K1GA 3VD3A 3MVIA 4AHOA 3O15A 3I7QA 2W5FA 5FEXA 2FZDA 3B06A 3B9NA 4EKJA 1CGVA 1A5CA 4M80A 3NOEA 2OYMA 4GNKB 4QS6A 1XDLA 2HE8A 3LRMA 3WQOA 5AN7A 2NQHA 4FLSA 3AS1A 1WOAA 2XJ7A 3QFWA 3T78A 3BLFA 3QC3A 5M1TA 4FLOA 3PZVA 3AS3A 4QDPA 4R34A 1R3TA 4B90A 4GWEA 4AYSA 2PDHA 2PDCA 4GGHA 3A64A 2QCMA 1M7JA 2WYSA 4IGSA 2O9OA 1NARA 3CHEA 3SIZA 1K70A 4NZ5A 2CWNA 1V3KA 4D6GA 3KVLA 1BHGA 5HNTA 2R14A 2XFRA 2P8BA 1Q6RA 1LOQA 2VMFA 3UR5A 3WF0A 1BVZA 4L9ZA 1GQLA 1V6VA 3NM3A 3YPIA 3CIWA 4NASA 3RJYA 1CGYA 1UH3A 4J3ZA 4H9UA 4GCXA 5A6JA 4ZB5A 4HNUA 3WLMA 4B5TA 1JZ4A 1RY0A 3VE7A 3ARQA 4CNOA 4HB7A 2WKLA 1YE6A 1WAUA 4RK8A 1PIGA 3CAWA 4ZEPA 5A6AA 4Q32A 2QPSA 4HZ8A 3WBAA 4GIEA 3QY7A 2EBNA 4JIIX 1F3EA 4OBSA 1UBSA 3NYDA 4WX2A 3A5VA 3FNDA 3HA1A 3GXDA 1QNPA 4Y90A 2NQLA 3QSTA 2FFIA 2QCGA 1A49A 3EWCA 2C1GA 1E0XA 1LJYA 4HMNA 3TZNA 2FJKA 1R9ZA 4H6RA 3QOKA 4GPNA 1UD6A 1WA3A 2PF0A 2ZYFA 1LM1A 1XSIA 1FP8A 1BWKA 1GW1A 2GUBA 3GDKA 3LV5A 4RDYA 5C70A 4UTJA 2OODA 5DO8A 4CQBA 1EUAA 1L8NA 1FVPA 4PUNA 2Z1BA 4FF5A 4NUWA 4GQ0A 5DXYA 2O7QA 2VI0A 5A6KA 2Z2BA 2XVNA 2DDXA 4PMZA 1G4PA 2DZSA 3QH2A 2OTDA 3PB2A 1QK0A 2DUAA 1LBFA 2ZX9A 1T8XA 2QIWA 3IANA 3VKJA 3VNMA 3OVPA 4HZ7A 1JF5A 3BCDA 4PTXA 3SQSA 3V5FA 1TJ1A 1K77A 3VNYA 3HQPA 1MEHA 2ZRYA 3BQ5A 1Q7MA 3LD5A 1A0CA 3S47A 1XRFA 5LIKX 4B2DA 3SECA 2EPHA 1OG6A 4H6EA 2ACUA 4X0VA 3BQ6A 2Y4SA 3ARZA 4N2YA 4L4LA 4C7DA 1E4LA 3R8HA 4ZXOA 3P0XA 1Q2SA 2VRQA 2WB5A 3N19B 2YLLA 3N2XA 2FMOA 1TRDA 5C9ZA 4UQ9A 4CU6A 1G7UA 2GQAA 4OVXA 4ZA0A 2GDVA 3DX5A 3K1DA 2MANA 5DX7A 3H12A 4GYPA 2EXOA 2VEIA 2GK1A 4PGLA 5GQBA 3THQA 1PAMA 3AWOA 3TROA 1EX1A 3M5VA 4JNYA 3EZ4A 3W83A 3IS4A 2GJNA 5FJUA 3RCMA 1A47A 5BOOA 3UXIA 3B03A 4B2DD 3KOFA 4NVTA 1B57A 2O56A 4C6NA 1PX4A 1R2SA 3EX3A 4NXKA 2XPKA 4U33A 4WJ8A 3VNJA 4DO6A 5E6ZA 2HROA 3RUBL 4AU0A 2QMJA 2RGLA 1UHVA 2WVSA 1LOLA 2CLHA 3TLLA 2DZAA 2G4FA 5FJJA 1Q6LA 4IP5A 4S3AA 1K4GA 3AROA 2C1IA 2CERA 2IPWA 1O12A 4KERA 1YDYA 4HHPA 4NJJA 1JD7A 1WQ5A 3ITCA 4TVUA 4S3DA 3OYXA 1ZJIA 3RR4A 3C86A 3ZXWA 4AD0A 5CBIA 3IIOA 4BI7A 3PR2A 2HEJA 1XKJA 4BJHA 3ITVA 4DWSC 3U7BA 3DKLA 4WY0A 3RFAA 1T0OA 1PYFA 3WQCA 1L6SA 4OOZA 2VDHA 4US5A 1S2WA 3RX3A 5BMWA 1Q3NA 4I9JA 5KZ6A 1ECEA 2LLEA 1G4SA 4M8UA 3E49A 3GKAA 3TTEA 4CN6A 3G3DA 3CUJA 4I3GA 5JVLA 1B1YA 4D1JA 1UR9A 3FDKA 2RFGA 2XIOA 3H54A 2PGRA 2VFGA 3TYAA 2D3LA 2VOTA 4NZ4A 1KQYA 5HPOA 3C2OA 2WCAA 3HG3A 5DY2A 2D0FA 2EPLX 1HKKA 3T1GA 3KAOA 2RKXA 2J24A 2V82A 4IQDA 4M1BA 3PZGA 2QPXA 2HCVA 2W62A 1A5UA 1VQTA 3EYPA 4EACA 4TVCA 1LL7A 1XF0A 5T8GA 4KIEA 3REQB 1F8MA 1I6NA 3GNRA 3WD4A 1HTIA 3M44A 2CHNA 2J7DA 5G2HA 1PTAA 1UKSA 3GG1A 3MY9A 1JXKA 3AAMA 3I68A 5E70A 4NILA 2FDSA 1ME9A 1F5ZA 3MHFA 1TJRA 1XINA 1DE5A 2HNEA 3GRIA 5AC6A 3BZJA 1R3QA 4MB4A 3VIPA 3FKRA 4FALA 1ZS2A 1TA3A 5CZTA 3VDCA 3LM7A 3UZJA 7REQA 3WENA 1IT0A 2O4QA 3NURA 2V81A 1CPUA 3CPRA 5CG0A 3CAKA 4X2PA 1EL3A 3ITXA 4LAMA 1X7IA 3V5CA 4Y9MA 4JCMA 3PVFA 4TIMA 3WBYA 3WFZA 2V38A 2TMDA 4HK6A 3DCPA 1S2VA 3EWDA 5CPMA 1DJWA 2WJFA 2WK2A 1ADDA 3DIPA 4HHHA 3GG7A 1J10A 3GNDA 1XIFA 4M6QA 2X40A 1F3XA 1UKQA 3V7PA 1C9DA 4GOAA 1EDQA 3IIXA 3I6TA 3W70A 3GG8A 3NEHA 3AHVA 2E6DA 2H8ZA 1HP5A 2J7FA 3LBOA 1YW1A 4DUVA 3UXAA 2BASA 4ASTA 3GH4A 1V93A 1Y5WA 1F3WA 4N4PA 3WJSA 3G5EA 2W0UA 3DHUA 2Z1XA 3VUSA 1OBAA 1TWDA 2DVUA 4UZSA 4PTVA 4XZLX 3AIBA 3SRKA 4LGXA 4YTSA 5JU6A 1EOMA 2AL2B 4LS0A 1VIWA 1UQZA 2A3AA 2HZGA 5LNRA 2DJLA 3G77A 1FKWA 3EBVA 2REQB 4C6JA 3FEMA 3PJTA 2X16A 4Y9NA 1XQLA 3WLOA 1EJSC 1JZ6A 3W84A 2OYLA 3NDOA 4KGJA 4MB1A 3ITGA 3QMSA 4ILSA 1OFAA 4QE4A 4I9TA 3QPZA 4YTQA 3DFOA 6XIMA 3ELFA 5CZ0A 1W8SA 4EVZA 1Q63A 1UR1A 1KR0A 5C71A 1QBBA 3LTPA 1KXTA 5IFTA 5ABHA 2QCFA 1Z9AA 3OIHA 2BWGA 2A2IA 4IIDA 7TIMA 4HNOA 3WNNA 2HK0A 4Y9OA 3FIGA 4I7VA 4BEQA 2P8CA 1TWZA 1BXNA 2F9RA 1DP0A 1H7PA 5DBUA 3O8AA 1H11A 3SRHA 1FBAA 5HUOA 1I0DA 2INFA 4LCRA 4PCSA 1Q4WA 2WSYA 2EG7A 3AXMA 1D2KA 4ZE5A 2PE4A 2RJGA 4WQ6A 4X9YA 2HNHA 3GWQA 3CUIA 2NQ5A 4C6KA 3LPGA 2OCZA 1FHUA 2JKEA 1FP9A 3ANVA 3JS3A 1TREA 4JPGA 2UY5A 2GDQA 1QFEA 4HPHA 2ACQA 1V03A 5HDRA 1X7FA 3M7SA 1QVBA 3DFNA 5CGTA 5CC5A 3AIEA 1SJAA 1M6JA 5FEZA 1WDWA 2IPJA 3SDOA 1R86A 4POCA 1U5HA 2ADAA 4A3RA 4V1YA 3VKKA 2B4GA 1OCQA 5A8MA 3IGSA 1K7XA 4AHQA 1OQFA 3BSGA 2OELA 4IJBA 1WPCA 3WQ5A 4C6LA 3H6OA 3EPOA 4JCLA 1YBQB 1YKWA 3KM8A 4FNTA 2XVGA 1QOPA 2VD9A 3CH9A 5AYYA 4WZHA 4J3WA 1TPB1 3PBUA 2WJZA 3M0LA 1BFNA 3PTKA 3CK5A 5AYXA 2FGBA 3U2CA 5DT7A 3SCSA 3W3OA 5K3VA 1I9CB 1Y8BA 1GKQA 1C92A 1Z69A 3UG4A 4HJWA 5AHFA 4DRSA 1CBGA 1YDOA 1U5VA 1YBQA 3L67A 4OV4A 5DN1A 1B4KA 1UBPC 5CPNA 4QSFA 2OLSA 1BYCA 3G1RA 4X3ZA 5L6UA 4Q22A 1JDAA 1W3KA 3HJEA 3O6AA 1GJPA 4M29A 1RUSA 3ABOA 4J3SA 4DIAA 1EF2A 3E38A 5A6BA 1LLZA 4KWSA 3W0KA 3M5XA 3WZ0E 2GLKA 1H1YA 5FJIA 2ANUA 3OGVA 3R89A 1NELA 2QZRA 2ZUNA 3EX2A 3N2MA 3AU6A 3WUEA 1JQVA 3WH5A 4GZ7A 2EPOA 3WQFA 2WKGA 3BCFA 1DQUA 3PY2A 2WKJA 2FH8A 1KKRA 3NDZA 3AOFA 5I00A 2WMKA 1RJRA 4WF7A 3NQMA 1H4PA 1FHDA 3AYVA 3E9AA 5JUVA 2V3EA 2OWCA 1J96A 4RCXA 4PUJA 4GNVA 1E0WA 1I1XA 3TWAA 7ENLA 2R1NA 1HGWA 2ODOA 5HINA 1DWAM 3W25A 1V6XA 3DGRA 2FHFA 1E9IA 1UZDA 1W3HA 3G1DA 4CQ8A 1F9CA 1HF6A 2A7NA 1W5OA 3IJQA 1P0BA 2O4MA 1QHOA 2XSAA 2SFPA 4O28A 5E5CA 1Y7VA 2J7HA 4ZTXA 1QPKA 4PN2A 2OO6A 3H53A 3ES7A 5H6HA 4JDBA 1A5OC 4ACYA 2VEMA 4XISA 1SUXA 2WXDM 3V1PA 1MZRA 2Q09A 2QS8A 3GTFA 1QCWA 3TTOA 4XVDA 1E4IA 3VCCA 3N04A 4Q8UA 3II1A 2FTYA 2W79A 5C9XA 2WVVA 5HNUA 4R9XA 2V8ZA 3QW4B 2HRWA 1TCDA 1J0JA 4S2BA 4UTWC 2NVDA 3W7PA 3GTHA 1TV3A 1XIBA 1W3NA 4MM1A 3N3MA 1IGWA 3OB8A 3ZLFA 5DCEA 3W29A 4V33A 1GQKA 3QPEA 1QRQA 4W87A 3MKVA 2DH2A 4TX9A 2D20A 4C6FA 3U7VA 4GKLA 2Y5JA 2AGTA 3BZGA 1DTUA 2BFGA 4QG8A 3HPSA 1TPH1 3W4RA 4FX8A 4QHRA 5G5IA 4Z17A 2DQWA 4GI9A 4DXXA 3LSCA 4LY8A 3R2GA 5HQLA 2JK2A 3TMQA 3DG7A 2CYGA 1TPC1 1UMYA 3C0SA 4XD4A 2ZZ4A 3AQUA 5FJRA 3N18A 3VFLA 4O11A 2Y63A 4AIUA 3CV7A 2ZZ3A 1IZCA 4O10A 1UZHA 1EO7A 3FOKA 3VXGA 1I2RA 1TUFA 3O9NA 4WGHA 3MJMA 1ZBKA 3HGOA 4ROQA 4CNSA 3AS0A 4S3KA 4CQDA 2DW6A 1BG9A 1G5AA 3PZOA 2OO0A 2ZICA 5I3KA 4H4IA 4Y7EA 1PSCA 1CNVA 1LRNA 1HG3A 4S38A 1IXNA 3BOLA 1HKIA 4LBRA 4GVIA 3BTNA 4F66A 1EZWA 3ZS4A 3S6DA 5F2LA 3L5AA 3W6MA 2QUTA 4WSHA 4EX4A 3LK6A 1G94A 5BZAA 2ZZ5A 4Z1AA 4ATLA 2YDRA 1LWJA 2ZZ6A 3DC0A 3I7SA 1RCOB 2FZ9A 3F2DA 3AISA 3WD0A 5DMMA 1K9DA 3TAKA 2ZRUA 1RV8A 1G6CA 3HG2A 3L23A 4ZB0A 2V5JA 2YDSA 4BI5A 2G0WA 3ARXA 4X60A 4IPPA 2B7PA 2YJQA 3HGSA 2PCQA 2J77A 4Q4RA 2QJGA 3FYPA 2DZUA 3AUJA 3TUUA 1IT7A 2NXIA 2ZA1A 3TYEA 3UBPC 1Q6DA 4DWSD 3OG2A 2JGYA 4DO5A 3W7MA 1HKVA 5IRPA 1IT8A 1JFXA 2OGJA 1V0KA 5HR7A 2VDIA 1KWKA 2GJLA 1JZ8A 5FEWA 2Y89A 5XINA 3TKFA 4IGNA 3KLLA 1PB0A 4V2XA 4F48A 3VNLA 7A3HA 1JNDA 4H6KA 1TMLA 4GIYA 1KM4A 1NWRA 4RX0A 2PLJA 5CG7A 4W85A 3PZNA 1FHLA 3VMPA 2FTWA 1JRCA 4TTGA 1GQNA 2Y85A 3RF9A 3IV8A 1J0KA 1Z42A 1UKTA 2GSEA 3JRKA 4L6HA 5HULA 2CLLA 4ZMGA 3SN1A 1I60A 2RDWA 3DZ1A 2PAJA 3QBUA 2X05A 2ZVIA 1PWLA 3N4EA 2PWEA 1ZCCA 1AK5A 3D46A 4E6MA 4PB4A 3B0PA 1PXGA 2PDLA 3M07A 3WSUA 1GOIA 3VDGA 1E6ZA 5ABFB 4CD6A 3W38A 2VEGA 4Q8NA 3W7KA 4C7FA 1L2UA 3TWBA 3TA9A 4GC3A 1FWHC 1H0IA 1LTDA 1TMQA 2PDGA 1TFVA 1UWRA 3CLWA 2C13A 3LXCA 4GMEA 1SJBA 1SPQA 1Q6FA 2G95A 2IQTA 4L1XA 3W1XA 4GFIA 2CZ5A 1ZB5A 5DY3A 4WRHA 5FF2A 5FL1A 3W7JA 2HVMA 3W75A 5IXEA 1OFOA 4XZIA 3NL6A 5BRPA 3BLDA 1TSIA 1IHIA 4I8YA 5EU9A 4LOCA 1CT5A 3WLPA 4DJDD 5C7VA 1Y65A 2C91A 3DFTA 3FK4A 3GE7A 3IIPA 5AKQA 1BWLA 1GUVA 5HBFA 1P43A 1NM9A 4EF8A 2WM1A 3FW6A 2FGLA 3L0GA 1MEIA 1J12A 3SCNA 3E3HA 1Z44A 4H83A 4AD4A 1E0TA 5BOEA 5F4XA 1VBHA 5D33A 4GO9A 1RR2A 1UCWA 3WQ4A 1R3VA 3TYDA 5TAOA 1VR6A 4FMVA 3B97A 1RHCA 3B8WA 3BW3A 4WOZA 4W7UA 1KBJA 4B9YA 2D22A 5FF3A 2G41A 1M04A 1SGJA 1E40A 1N2VA 3B0UX 2A3HA 4GXWA 1UMLA 2J9ZA 1WKEA 5ENLA 3VOJA 8XIMA 3RXZA 5DRIA 4M82A 5A8NA 4PZVA 4QEEA 5HMSA 1A3HA 1F7BA 1BGGA 3B0XA 3LU2A 3IACA 4DWSB 3WNKA 4QS5A 4LS1A 4XB3A 4RE2A 2X09A 1DYSA 2CBVA 3QEZA 1K1DA 3USBA 3WELA 3IJIA 4Q8VA 4LXFA 4HZ6A 2QF8A 3GVGA 1RVGA 1SZNA 2C18A 5DEZA 1KGXA 2VRJA 3SN4A 2JKPA 3LCWA 3URNA 1TG7A 4YTUA 3H8AA 2A7PA 1B4EA 3UGRA 1GONA 3L68A 3R25A 1W9BM 1WKYA 4JOMA 3HQ1A 1JDFA 3KFTA 4M0XA 1TV7A 4J3XA 5FEPA 2EPMX 2J74A 2ZZ2A 3LTSA 5I3GA 4CEUC 5D32A 1BWVA 1VZWA 1QHPA 3LNMA 4PCFA 4YS1A 1SFLA 5BXRA 3HTWA 5CSUA 1HFBA 1P0EA 2XFYA 3PTDA 4NIRA 4A8NA 1VENA 4K8EA 4CVUA 1GOOA 2PDNA 2VZUA 3MSGA 4O1DA 5T91A 5CSRA 3VYLA 3SGZA 1H5YA 2J66A 1XG4A 2X8RA 3NQCA 1ODUA 1A5BA 2DT0A 4K7VA 2BY0A 3WQWA 4NX0A 5E0FA 2HJPA 3GYEA 4LS2A 3H2MA 3M46A 3LM3A 2YW4A 5K9CA 5M03A 2J8GA 2WCGA 3LHYA 2PSNA 2HPIA 4KEZA 5KITA 1WUFA 3CEUA 3BL3A 1EA0A 2E6YA 2VQUA 1LG2A 3E6EA 2VNCA 3NGJA 1XRSA 2Y5EA 3W74A 1OM0A 3FJ6A 4H19A 4E2VA 4E8GA 4DF0A 3HV9A 4IT1A 2XIQA 2Z2AA 4GKTA 3SURA 1NOUA 4JFUA 3DFPA 4AD2A 3KBNA 1DJQA 3OBEA 3IK4A 3QF0A 2WNZA 4F0RA 4RE4A 3EDKA 5K7JA 4JKMA 4F8XA 1JZ2A 3NZQA 5HNRA 3A3HA 2WOQA 3W28A 3W7OA 5CPSA 1TPVA 4F40A 2VEPA 4MJMA 4AVNA 4A05A 4G1KA 5A95A 4C1LA 2G3JA 4C5YA 5MHBA 1UP3A 2OJPA 1QWGA 3Q65A 1EWEA 2VZVA 3QSRA 3W88A 3FAXA 2CHOA 1A50A 2QHAA 5D2XA 5A2CA 2AQVA 1IEQA 1O94A 3TQVA 1H49A 3A9BA 2P5NA 1CENA 4MMWA 3UFYA 1VHCA 4HCDA 3W7GA 4MJ2A 3PJXA 3ARWA 2DV0A 3AZTA 4UR8A 4FB7A 1N82A 3ONBA 2WHMA 1H1NA 3FA5A 2F61A 2F6XA 1OX4A 3TYUA 3UESA 2R1KA 4DJEC 1FWNA 5MF5A 1LYXA 3OU8A 4JQ1A 4EE9A 1AMYA 3OA5A 1KXHA 2ZRVA 2ZFAA 1CX9A 3SCWA 1N55A 3SW6A 1VIZA 3FXYA 4GXMA 3IUDA 3NPXA 3VIFA 2POZA 3VVGA 5AC7A 3KE0A 3BSHA 1ITCA 2WMJA 1WXZA 3MI6A 5C2CA 4TVDA 3VGFA 4H41A 3PNZA 4GBDA 3H4WA 2ZXDA 1VFSA 1ML1A 4L4MA 2X1SA 1VYPX 5D09A 3DENA 3K4WA 3KS6A 1VS1A 1VCFA 4OKDA 1KLYA 3KHJA 1KC7A 1SJDA 4XAGA 1LQ2A 1FWRA 5JIWA 4FPSA 2EJAA 4AXKA 5LIWX 1S5WA 4MWAB 4PUWA 2IS7A 3FA4A 1HJSA 1XYMA 2PTXA 3BAYA 4M1RA 3GXIA 4WDWA 2XTKA 4ENLA 1HO1A 1QK2A 4I5XA 1ZUAX 3GYCA 2ON3A 3DHDA 2VXNA 2CXEA 4GX8A 2WPGA 1YTEA 2Y70A 4UFJA 4J35A 1O5KA 1TV5A 3CC1A 3CWHA 4F0HA 3QR1A 3LLFA 1XIJA 3G8EA 3IJ8A 4GX9A 1R85A 4ICMA 3N15A 3O1NA 1K8XA 4HMEA 3WH6A 5I09A 4GXPA 1GVIA 1KFLA 4FOJA 3W7LA 1AW1A 3G18A 2GJXB 1ELSA 3ABXA 2YB1A 4N9DA 3HFYA 1DJZA 1K7EA 3TN4A 3EEZA 4IUOA 4P7OA 4QDWA 1JUEA 3EMQA 1JPIA 3WMCA 1XBYA 2VO5A 4JR5A 3PN8A 1Q13A 3S1GA 1B3XA 1NOFA 3TZFA 4EPEC 1J79A 4XWUA 3MPGA 3N12A 4HN4A 1RK5A 1V51A 4LEFA 3LPFA 1AW2A 3T55A 3TMLA 1SMAA 3W2LA 1JCXA 3GW0A 1NU5A 2HK1A 3QYSA 4K68A 3CQHA 4D1IA 4XBJA 5G1YA 4ZL1A 4XZHA 8RUCA 4OOUA 1QASA 5AC8A 2W6RA 1I75A 2NUXA 3W1UA 2YDAA 3R0UA 2BBFA 3ZM8A 1FCVA 4KCVA 3VO0A 3WQDA 3GTIA 2ZTJA 3GH5A 4OU1A 4C6IA 3DUGA 1KKOA 3EWYA 4QRNA 1DJNA 1O66A 1U30A 4M3PA 3VI2A 3HZ3A 2GVYA 2OVLA 4KIRA 1LLOA 4GISA 2YCLB 3INPA 3VKAA 3NSXA 4HPGA 2WNNA 4O8RA 3APYA 3G0XA 1RVKA 1E0UA 2OOFA 3SN0A 3L2IA 1VRXA 4J9JA 4QNEA 4H9TA 3AYRA 4GY0A 5D05A 4HK7A 4XV0A 3MVTA 3LMYA 4ACZA 1PDYA 1PTDA 1XV8A 1FCBA 1F3TA 3A23A 3LCFA 3OP2A 3URAA 5DQPA 2QCDA 3DKJA 4W86A 5GJMA 2BVTA 1X97A 2VDGA 1W0MA 4RJEA 3GXFA 2W92A 3EKLA 3TSMA 4Q7BA 4D6IA 1Q4NX 1ZJBA