3CBWA

Crystal structure of the ydht protein from bacillus subtilis
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
336
structure length
336
Chain Sequence
b'HTVSPVNPNAQQTTKTVMNWLAHLPNRTENRVLSGAFGGYSHDTFSMAEADRIRSATGQSPAIYGCDYARGWLETANIEDSIDVSCNGDLMSYWKNGGIPQISLHLANPAFQSGHFKTPITNDQYKKILDSSTVEGKRLNAMLSKIADGLQELENQGVPVLFRPLHEMNGEWFWWGLTSYNQKDNERISLYKQLYKKIYHYMTDTRGLDHLIWVYSPDANRDFKTDFYPGASYVDIVGLDAYFQDAYSINGYDQLTALNKPFAFTEVGPQTANGSFDYSLFINAIKQKYPKTIYFLAWNDEWSAAVNKGASALYHDSWTLNKGEIWNGDSLTPIVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YdhT protein
molecule tags Structural genomics, unknown function
source organism Bacillus subtilis
publication title Crystal structure of the YdhT protein from Bacillus subtilis.
rcsb
total genus 125
structure length 336
sequence length 336
chains with identical sequence B
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2008-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02156 Glyco_hydro_26 Glycosyl hydrolase family 26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3cbwA00
4U2ZA 1QNOA 5HOSA 3MKKA 3G6MA 3CIVA 1C8XA 2FGZA 3WUBA 3VDCA 2XFRA 3TONA 5LA1A 2BFGA 1H09A 1OSEA 4LPCA 1B3VA 1BG4A 1HIZA 4AYSA 1A47A 4GZIA 3VDBA 4BQ4A 2D0HA 1JZ5A 3VGGA 1W32A 1F4AA 3UESA 1UWSA 4LYQA 1CGYA 4MPKA 2J7FA 4EANA 3GNPA 1E5JA 2J7DA 3K4DA 5FL0A 2WCSA 3GH7A 3QOKA 3VD9A 4UQDA 4PMRA 2EPLX 4CN6A 1YQ2A 4HPHA 1V0MA 4C7GA 2CPUA 1JAEA 1RH9A 4PBGA 3VIIA 2BHZA 1JDAA 5KZ6A 1DWIM 3SUUA 3UCQA 1GZJA 1TVPA 3NIYA 5HPCA 4ACZA 4AD2A 7A3HA 1XSJA 2PBGA 1VFUA 4QLKA 1E15A 1CXEA 2WKLA 4CU6A 3VIFA 3PTQA 3WBEA 1ZBVA 3L2MA 3VUPA 2NT0A 2BV9A 1B0IA 2ZX7A 3BC9A 3TTQA 3RIKA 1ZU8A 3QR3A 1FP9A 3WEOA 4HZ8A 5I3DA 1XD1A 2CETA 3POCA 2VX7A 3CBWA 1J0ZA 3WUEA 1AQ0A 3VTRA 1E6RA 3MS8A 1H2JA 2VO5A 5A6BA 2O9PA 4LXFA 2VJXA 2ZUVA 3AIRA 2DDXA 1BFNA 3GNOA 1ISZA 2V5DA 4YHEA 2D0GA 2WZHA 1FH9A 4JHZA 2VTFA 5EB8A 5ABHA 1XSKA 4GZEA 4RE4A 4Z2LA 1SMAA 3T2OA 4HOZA 1JZ7A 3BAJA 1E1FA 3WD4A 4D71A 1HN1A 3VIJA 2DT2A 1V08A 1BVZA 2OSWA 1UQYA 4IM4A 4PMXA 4HZ7A 5GNZA 1GOQA 3BMWA 4IPNB 1XYFA 4J7RA 2OYKA 2J74A 5LYRA 2EJ1A 1WZMA 4A3YA 4W5ZA 5CSYA 2X09A 1V0KA 2C7FA 1ZB5A 4JFUA 2PWHA 4TOQA 1QOXA 5E09A 1CECA 4AZ5A 3SCOA 2DT3A 1KR0A 4BF7A 3SUVA 3CO4A 2QF8A 4JHOA 4WIWA 3FW6A 1GQIA 1W9VA 2GDVA 1X6NA 1KGUA 3VNYA 4XZWA 2GJXB 2JEQA 3RPMA 1LF1A 1GPFA 2DSWA 2DT1A 4DM2A 3WIJA 2NSXA 1UD6A 2AMGA 4WLCA 3U57A 3ZJ8A 1NP0A 2X05A 3UERA 4AD5A 2WM0A 3SCNA 1CIUA 2D3LA 4MTVA 1TUXA 1DWFM 3KL5A 3U5YA 3WD2A 2E9LA 3SCSA 1NOFA 4W85A 3AIVA 1BTCA 3NDYA 2A3AA 1DHKA 1W9BM 1RP8A 2WMHA 3L4WA 6TAAA 4U3CA 1ECEA 1E6NA 1JF5A 4CCEA 3M7SA 3EYPA 1VEMA 3GM8A 3WQ4A 5A6LA 1BVNP 3CZLA 4D6FA 2EPNA 1TE1A 1YHTA 1B90A 5I0DA 3L4UA 1E4LA 1JAKA 4W88A 3EDDA 1MYRA 2CBJA 4W8LA 4DM1A 1WDQA 4CD8A 5I2UA 3DHUA 1V3IA 1UOKA 1ZJBA 5I77A 3PZOA 3SCRA 3I3BA 5GNXA 3ARYA 3WUFA 1C92A 2EXOA 1ZS2A 2BVDA 3AFBA 4F9JA 4XV0A 1CDGA 2E8YA 2QV4A 4AZCA 3ZQ9A 5FIPA 1W2PA 3GYCA 1GORA 3OGRA 1R7OA 1UWUA 4J3XA 1JFXA 2G4FA 2D22A 1UR2A 5E6YA 4D6CA 5JBFA 2ZWZA 1V03A 4NI3A 3VPLA 2VX5A 2CXGA 3DYPA 1I1WA 2QPSA 3M6DA 4AD3A 1E1EA 2XIBA 3T2PA 1BGGA 2VRQA 3OB8A 5DT7A 5ECUA 1DWGM 3NSNA 4P7LA 1J0KA 4EAMA 4DWSA 2E9BA 3CZKA 2DH2A 1QI2A 2WVTA 3WF1A 2VUYA 2ZOXA 5BXSA 1CXIA 3BH4A 2WAGA 1BPLB 3ARUA 2AAAA 1OGBA 3CZEA 2EPOA 1UQZA 1X6LA 3AZTA 5C71A 3N12A 3WH6A 4MADA 1EO7A 1HXJA 3AISA 4UFKA 1XH2A 4MDPA 3D5HA 4V2XA 1EH9A 2MANA 5ABGA 3UR8A 4JFTA 1JDDA 2VZSA 2DPEA 1QHOA 4OBRA 2DH3A 3B9AA 1ITCA 2D1ZA 4P7NA 4A3HA 2J79A 1FFQA 2BVYA 1DP0A 1HVQA 2CBUA 1VFFA 1V6UA 1NWTA 1JD7A 3W81A 3VD3A 1ESWA 4IUGA 4PSPA 1M01A 1NQ6A 2J8FA 1J11A 4UOJA 3VGBA 5A6JA 3ARZA 4AZIA 1C93A 2XVNA 1MXDA 1PZ3A 4PMQA 2WSKA 1BSIA 4D1IA 1LLOA 3VVGA 5M3WA 1NWSA 1Z32X 1UWTA 2J7EA 1D2KA 1QW9A 4JIEA 3CUGA 1BLIA 1W2VA 3RO8A 3U5UA 3WH7A 5I79A 7TAAA 3MSGA 4QAWA 1UUQA 2UY2A 5BRPA 2XHYA 1MWOA 3RJXA 3N9KA 5DEZA 2WMFA 4BQ5A 1G01A 4EKJA 5CSUA 5A6MA 3VD5A 1GVIA 1WZKA 1UWRA 5GNYA 1IV8A 3AMLA 1H4PA 3SCVA 2A3BA 2X0HA 1OT1A 4M81A 1XC6A 3OGSA 3VO0A 1W9XA 2ZXAA 1G0CA 3AJ7A 3T08A 4AIOA 2VCCA 1QNSA 2WANA 4PUEA 1OB0A 3SCWA 1KWKA 4YHGA 5BXPA 1J10A 1NP2A 4J3UA 3W25A 3BAXA 1ISWA 1UWIA 4HPGA 1J0JA 1GOIA 3DECA 4AY1A 4FMVA 1GQLA 3MSDA 4UQEA 1VJSA 3BAKA 1C7TA 3NSMA 1ZBWA 4D6HA 3W37A 3VU2A 1E5NA 2FH8A 4HA1A 5JBEA 4H8UA 3NDZA 3UG5A 1UD8A 1DWHM 3I3EA 1HJXA 3ARRA 3ARTA 4KGLA 3T2QA 1QI0A 3PZ9A 3SIMA 1CTNA 4Z2KA 1UWQA 4F66A 3F5JA 1GOWA 3W82A 3CHCA 4HA4A 2BS9A 5GQBA 3VDAA 2WHMA 3OLIA 2OWXA 1M03A 1V3MA 1E6XM 2JFEX 4HOWA 3WMSA 5D9OA 1R85A 4J3VA 2WVUA 4M24A 2J47A 1UR4A 2WZEA 3MUY1 4OOZA 1ISXA 1US3A 1CXKA 4FF5A 3BSHA 3A4WA 2GDUA 1HKKA 2VQUA 2YBUA 3AYSA 5D8WA 3WH5A 4UCFA 3WD0A 4Z2JA 2XIIA 4UOQA 1RP9A 3VGHA 2VVSA 3FHQA 2VQTA 2PC8A 3RM9A 5CQ1A 1H11A 3UR7A 1GNXA 1Q6CA 5D9MA 1FP8A 3DHPA 1CGWA 3MMUA 4PTXA 3ZR5A 1SR0A 1B30A 1BF2A 1ISVA 1PBGA 3VIPA 3VNZA 1JXKA 4XB3A 5HDRA 3N04A 1W1PA 4AC1X 4M8UA 3BMVA 1CLXA 3W53A 1JIBA 3ZSSA 1K9EA 1EOMA 1NWUA 3CUIA 1FHLA 2C0HA 4M80A 3PZNA 4M1RA 1BG9A 1JI2A 4DUWA 3EBVA 3AIUA 4KGJA 1WDPA 2YLAA 4H8VA 5DT5A 3MV01 4CVWA 1L0PA 4GI8A 3ALGA 4J3WA 2CERA 1EDGA 1B3XA 2X1IA 4BQ3A 3AIEA 5BROA 1Q6DA 1E4IA 4UFLA 1B3ZA 2ZUMA 3SCUA 3AIWA 1CGUA 5TD4A 2Z1KA 3IK2A 2V3GA 2XUCA 3EMCA 2EQDA 4CGTA 5LA2A 1OINA 5JUVA 4PMDA 1HX0A 4WK9A 3AHYA 4BCEA 1WAWA 2JF7A 4D1JA 1CWYA 4MB1A 1H0IA 3FHAA 1H3GA 1K9TA 3SUTA 2VL4A 3WQWA 3PZUA 1WPCA 1KBBA 2BHYA 4X0NA 3N11A 1XH0A 3EDJA 1V3KA 4IISA 2XSBA 1G94A 3U7VA 4HU0A 4AEEA 4J3TA 1UKSA 5F7UA 1ZJAA 2YJQA 4P7QA 2G3MA 1PX3A 5ABEA 3VIKA 2ZX8A 3VIMA 2OWWA 4MJ2A 1PIFA 1E56A 1C3FA 3CUHA 1QPKA 1UH2A 1FH8A 3O2LA 2OYMA 4W7VA 5A2BA 3OG2A 1UD2A 1PX4A 2VZVA 2JF6A 1W9PA 1NWRA 3UETA 3RM8A 2EPKX 1VEOA 4GINA 3PZTA 4PTWA 3RCNA 3MUZ1 1OBAA 3ARSA 3VILA 4ZE5A 2WMJA 2ZXQA 4E8CA 4TTGA 1XD0A 4AZBA 2FHBA 2ZWYA 4W7UA 3WMCA 5HPOA 1JFHA 3RMEA 2J7HA 1V6WA 4UFIA 1LWJA 2F8QA 3AMCA 3CMGA 1GQJA 1E3XA 4HTYA 1UKPA 3WNNA 1WB0A 3TTYA 2ZX6A 3PTMA 1KXVA 1W1TA 3ARPA 4B15A 1B31A 1XCWA 3KL0A 3SCPA 1V02A 3EDEA 1IZJA 3AZSA 3AXHA 3GBDA 5BWFA 3AXIA 1RD6A 4MJ4A 1GUVA 3J7HA 3AQUA 1TMQA 4UFJA 3AS0A 1H5VA 4Q7NA 2G3IA 2D3NA 4FLSA 4GXPA 4FLQA 3O6AA 1OIFA 2W92A 2ZUWA 3K4AA 1JNDA 1HJQA 2YDRA 1AMYA 3WEMA 3JUGA 4HMCA 1JGIA 3GXDA 3ECQA 1JZ6A 1EOKA 1C7SA 2XM2A 3E1F1 1UR9A 2IUZA 4OKDA 3GXMA 4RE2A 2VT0A 4HOXA 4B3KA 4P8VA 4PCTA 3W27A 1JZ3A 4GZJA 3AZRA 3AHVA 4GQQA 1LJYA 2VR5A 4WSJA 2WVVA 1UKTA 2YL9A 3PZGA 2C8NA 2VX6A 1C90A 1WDRA 3AHXA 2WCAA 1PJ9A 5E0FA 1AQMA 5EFFA 5CG0A 3PHAA 1E6QM 1IZKA 2DSVA 1W1VA 1H41A 3RJYA 3KE0A 1E40A 3CH9A 3QHNA 1UZ1A 3PTKA 4N0RA 4OJYA 2DIEA 1CGXA 2V3EA 1KXQA 5HNNA 2PB1A 2YBTA 1ISYA 1QI3A 1U33A 1V3HA 2RGMA 3HU7A 3LPOA 1KB3A 4PTMA 4W5UA 2W5FA 1BAGA 4F9DA 5JIWA 4PEEA 3GXFA 1OM0A 3MMWA 1ITXA 2YKKA 3CHDA 3F4VA 1UR1A 3VGEA 1W3LA 2ZX9A 4U2YA 3WSUA 1UD4A 2XYLA 4D6JA 5CJ5A 1H0GA 1NARA 3GTNA 3ZMRA 4Z2HA 2PBOA 1QBBA 3L4ZA 1J0IA 3DC0A 4NSBA 1CXLA 4HU8A 1EGZA 3WFZA 4ZE4A 7CGTA 1US2A 5I78A 5IHRA 2XVPA 1QHZA 1CEOA 2VCBA 1SYTA 4LYPA 4J3SA 2B31A 2VZUA 4MNLA 4B3LA 2WWDA 5CPTA 3OZOA 5D8ZA 3MO4A 3OA5A 3RDKA 4W87A 1JZ8A 4CUCA 5A6SA 3SUSA 3B9EA 2GK1B 3WNPA 4BS0A 2VZOA 4UFMA 1VBRA 4RL3A 2Q8XA 2WXDM 1PX8A 5A8NA 4Z2IA 4FLOA 2TAAA 1LL6A 2E40A 3AHZA 1K9FA 4D72A 2WLYA 4B9YA 4U5IA 3WBAA 4PMYA 1J18A 2CCRA 1UR0A 1I75A 4LGXA 3VKKA 1B1YA 2YL8A 3WF3A 3AYRA 4WJXA 4ATLA 3EMQA 2XJ7A 2WHLA 3AI0A 4QCEA 3T0BA 2ZXBA 4AW7A 3IAPA 2ZUUA 4URIA 3UEQA 3M07A 2BHUA 1DWAM 1PZ2A 1VJZA 4TXEA 5ABFB 1V3LA 3WKZA 4AD1A 4JCMA 5A8MA 3EMZA 3W6MA 4M29A 2Y24A 4BQ2A 1E70M 1FA2A 5EBAA 3POHA 2YLLA 1L8NA 2BNJA 3WL0A 2NW0A 5FL1A 1AVAA 2WLZA 5FCZA 1TCMA 2A3HA 3T0DA 1M53A 1E6PA 1GJUA 4PMVA 1LL7A 2BY3A 1J0YA 1BHGA 4JCLA 2YA1A 3THDA 4L4OA 1JZ2A 5BRQA 4UQCA 5KEZA 2DEPA 4E8DA 3IJ7A 3NYDA 3WELA 5CGMA 5BXTA 2VURA 2VCAA 5D9NA 5M17A 1BYBA 1H1NA 2VZTA 4TX8A 4MB5A 2W63A 1JYXA 3FNDA 3MUAA 3WDQA 3CUFA 2CIPA 3K8KA 5A8QA 3IAQA 1E71M 4OBSA 4MDOA 1K6AA 1CENA 3AICA 4QLJA 3MANA 2WC3A 3ZT6A 4GQRA 2EO7A 5AC5A 2XM1A 1GOKA 4AZGA 5A6BD 3OGVA 3WNMA 1OWQA 2VOTA 3ARXA 1JNEA 3F5KA 2CBVA 4YPJA 5IFTA 2PI6A 4TTUA 4J28A 2YIHA 1J12A 1MVYA 2Z1SA 2W61A 4KRUA 3GXIA 2XGIA 2ZICA 3OLGA 1KQZA 2J75A 3AROA 5HXMA 3CLWA 2RGLA 3AMDA 3QHMA 3FY1A 2W4XA 4B9ZA 4XZBA 3CMJA 3ZT7A 4H8HA 1SFSA 5A1AA 3AIBA 4AZ6A 3TP4A 4WF7A 5IDIA 2CKRA 3ZSTA 5CGTA 2J7BA 1EHNA 1VRXA 4B16A 1DEDA 2FGLA 2CNCA 4ZXLA 1PIGA 3AS2A 1FHDA 2WMIB 2HVMA 2DSUA 3A3HA 3CGTA 3S2CA 3N18A 1MW0A 4NZCA 4E4PA 1E3ZA 2YA2A 1MW2A 4MNJA 1E6SM 1UHVA 3K1DA 2QPUA 3BCDA 3TTOA 1KXHA 4BZYA 3VOCA 4AISA 3VMOA 2D20A 1Y7VA 1F4HA 1JZ4A 4U31A 2GFTA 1HP5A 2D2OA 4U5KA 1WP6A 1QHPA 1PEZA 1W1YA 3WNKA 4AXNA 3SURA 1GVYA 3RILA 4CU7A 1E73M 1G9HA 2Y8VA 3VX0A 4N42A 4C7FA 4PMZA 1HL9A 1XV8A 1GHSA 1MQRA 4D6GA 4ATWA 1E55A 3GNRA 4AD4A 1KFWA 3O9NA 3IANA 5A6KA 2ZUNA 1EDQA 4ZEPA 3L4VA 5BXRA 5FOOA 2EEXA 1JXJA 2YOCA 3CZGA 1UD3A 3W26A 1D7FA 4AZ7A 1LQ0A 4AEFA 1O6IA 1HL8A 2VNCA 3NUKA 4PN2A 5AC4A 1LG2A 5E0CA 2XPKA 4CD6A 2F2HA 4GKLA 2GK1A 3WDPP 1R86A 2JALA 2CBIA 3SEPA 1UZ4A 1OGGA 1GHRA 3A6OA 2WZIA 4PUDA 1E0VA 2D0FA 2WC4A 3TA9A 1W3KA 5FKYA 1CGVA 3VINA 2G41A 2XFFA 5A95A 4YN5A 1NOUA 2ZUTA 1P6WA 2O9OA 5HBFA 2EPMX 4JKMA 4Q22A 3FXYA 5GPRA 2ZE0A 1HKMA 3VMNA 2VRJA 5D4YA 1VENA 4AD0A 1WKYA 4PMOA 5EFDA 2O9RA 3WF4A 3HN3A 4W84A 2GJXA 1Q6EA 3CZ8A 2QMJA 1V0LA 1FOBA 2V3FA 1MW3A 4M82A 1LL4A 3M46A 3GZAA 5M03A 1CYGA 2A3CA 3N13A 1BYDA 3PZVA 1TA3B 2FH6A 2UY5A 2XVLA 3K46A 1D3CA 3BAIA 3RM4A 2VC9A 4MB3A 3AXXA 2J77A 2Y8KA 1E9LA 1V6VA 4UR9A 3FAXA 2OSYA 4GIAA 1M04A 4W8BA 3SCQA 4CD7A 1JG9A 4LYRA 4FLRA 2WVVB 2JEPA 4GO8A 5FD0A 3VGDA 1MQPA 4U33A 1JYWA 3AMKA 3WDJA 3HJEA 2OWCA 2QMKA 4R27A 1GW1A 4UFHA 3I3DA 1ZL1A 1HP4A 3WQ6A 2J7GA 2G3JA 3KWXA 4CCCA 2GJRA 5ABFA 4LQ1A 3K8LA 2YDSA 3PN8A 4V27A 4P8UA 2G8ZA 3HMCA 4UQBA 4S3JA 3ARVA 5JBDA 2OLHA 3ZJ7A 1DWJM 4J27A 2BY0A 1J01A 2EBNA 5IFPA 1K9DA 1CNVA 3D3AA 1QNQA 1VIWA 3W28A 4EK7A 2JIWA 1KQYA 4PRWA 5BCAA 6A3HA 1QNRA 1TG7A 4QFUA 3APGA 1LG1A 1UD5A 1HJUA 1B3YA 4E2OA 2WMGA 1ZBKA 2WWCA 1UKOA 3WDRA 5DMYA 4L4PA 1B3WA 5E9AA 2VR4A 4JAWA 4ZFMA 1HJVA 4ACYA 1PAMA 5CXPA 4ACZB 5IHSA 1W91A 1VEPA 1MW1A 1E0XA 1WE5A 4W8AA 4P7OA 1XSIA 4TVDA 5CPQA 2DIJA 1JD9A 1CLVA 4PTVA 5A8OA 1KGXA 3WQ8A 1WZAA 2E4TA 1A3HA 1XYZA 2WK2A 3VX1A 3ZJKA 2WPGA 5C8BB 4UOZA 3T0AA 3NJ3A 2V5CA 3THCA 4D6EA 1FH7A 3OLEA 3CTTA 1OD0A 2FHFA 4H04A 3BAYA 3AMGA 5DO8A 3ARQA 3DYOA 3L2LA 2Y2WA 2FDMA 3CZJA 2CHNA 3CPUA 3W6LA 2W91A 2OSXA 2ZUSA 1EQPA 2WSPA 3AOFA 4PSRA 3PZIA 2IXUA 3BCFA 1WDSA 3K8MA 3QOMA 1HT6A 3WH9A 4H41A 5AYIA 4XUYA 3A4AA 1CBGA 3WD1A 1J9YA 1ODZA 3S6TA 3EDKA 2GSJA 2XVGA 2BXYA 4PMUA 4D6DA 4NRRA 1GOMA 3W0KA 5A8PA 4S3KA 3MV11 1E72M 4WKAA 3GDBA 3WQVA 3GBEA 3WDHA 5CPSA 2ESCA 5BYWA 5EMYA 3BLKA 4MNKA 2F61A 1G1YA 3WEZA 3WUGA 3VGFA 3BAWA 1EIBA 1SMDA 3II1A 2GUYA 2V3DA 2PWEA 4HMEA 2QLYA 2CITA 3WFLA 6CGTA 3OLDA 4JZ5A 3ZO9A 3WENA 1BGAA 1C8QA 2PWDA 2BVTA 4OIFA 4BA0A 4HP5A 1MFVA 3VM7A 3GH4A 3MMDA 4V28A 1UR8A 3ZT5A 3OBAA 5E6ZA 1R8LA 1KXTA 1Q4NX 2E9MA 4OZOA 1IT0A 2ZIDA 1NM9A 1B9ZA 3ZJ6A 4RE3A 1CXFA 2W62A 3QGVA 4HA3A 4UZUA 4GI9A 1KCLA 1TFVA 3AS3A 8A3HA 2BXZA 3ZOAA 1GOOA 4JKLA 3WNLA 1VAHA 2GJPA 4QCFA 1OT2A 1AQHA 5A94A 1OGSA 5A2AA 2O92A 1GJWA 2E8ZA 2GVYA 3UG3A 1NH6A 3L4TA 3LPPA 2J8GA 3IJ9A 1EXPA 2CEQA 1KWGA 1JYNA 2X8RA 2DT0A 1W3HA 3W29A 1U2YA 4GO9A 5JIPA 3CHFA 3NSXA 4W7WA 2YL6A 4DWSB 1UYQA 1WO2A 4AIEA 4ML4A 4H7VA 3N17A 1V6YA 3SCTA 1HVXA 1KCKA 2OYLA 4UQ9A 1R7AA 2UY3A 1TA3A 2DGAA 3WH8A 3QHOA 4IPLA 4MNMA 3VIHA 4JFSA 4FK9A 1HNYA 4CN4A 4F8XA 1KBKA 4GPNA 2G3NA 3NCOA 4MAVA 2V38A 2PWFA 2DSKA 2WHKA 1RPKA 1XRVA 4MAZA 1CGTA 3WF0A 2DQXA 5DF0A 4TX6A 2XVKA 4PCSA 5CZKA 3ALFA 3WQ5A 3W4RA 4LX4A 5A6AA 1NOWA 1E0WA 1CPUA 2PF0A 2WW5A 4U3AA 1QW8A 5A3HA 4CD5A 1G5AA 3W38A 2O9TA 3KEHA 1OD8A 2D24A 3VDHA 1MXGA 1W3JA 4C7DA 4DUVA 3PZQA 4QDMA 1BYCA 2WNWA 1E43A 4W93A 3AIQA 3BGAA 1HJSA 3A47A 2CHOA 3PBGA 1Q6GA 4QLLA 2WVSA 5CLWA 1UG6A 4A4AA 2X2YA 3PZMA 3U7BA 2JE8A 3WMBA 4UZSA 4CD4A 1X1NA 5CLTA 2NT1A 2WBGA 4PMNA 1N82A 4TUFA 2CKSA 4AIUA 1XCXA 1M7XA 1ZBCA 1DTUA 3MUIA 4WKHA 1FFRA 3F5LA 1VFMA 4P8WA 5I6SA 1ODUA 1TR1A 1U30A 1XGZA 4AMCA 4CKQA 1PPIA 1HJWA 1UA7A 2E0PA 4UQAA 1V0NA 1HKIA 5A2CA 4UTFA 1WZLA 1MFUA 2XWDA 3VIGA 2J7CA 3WD3A 1VF8A 4KWUA 3ARWA 1Q6FA 2A3EA 2VVNA 4JL1A 3L4XA 2XFYA 1J0HA 4CVUA 4CU8A 1XH1A 3OZPA 3L4YA 2DSZA 1WNOA 4Y7EA 3LMYA 5M5DA 3A4XA 3KZSA 4XX6A 4UNIA 4DUXA 1CZ1A 3FAWA 1E4MM 3LPFA 2J62A 2PWGA 5C70A 1EDTA 3UG4A 5D9PA 3KL3A 1JL8A 1R87A 2UWFA 4KRTA 3VM5A 5AY7A 4WSKA 1C91A 3TOPA 3VD7A 4HZ6A 1BQCA 2Y5EA 4JFWA 2IXVA 3VMPA 1I1XA 4DWSD 4F79A 1EHAA 3WF2A 3G6LA 4W89A 3ZM8A 3WN6A 1GQKA 1QVBA 3TTSA 1TZ7A 3GH5A 3FN9A 4HMDA 3EDFA 1UKQA 1QI5A 1V6XA 1C8YA 3T09A 2BY2A 2WBKA 4PYSA 4GI6A 2VMFA 3BLPX 4JL2A 1VBUA 4JKKA 4WKFA 4KMQA 1XHGA 2X0YA 4TVUA 4ZXOA 4Z2GA 2YA0A 4CCDA 1GCYA 4TVCA 1UH3A 1WCGA 3ZR6A 3OIHA 1UH4A 5I5RA 4ZENA 1W9UA 1KGWA 1E6ZA 3VIOA 4D6IA 3WDIA 4NF7A 3WL1A 2WKGA 1H49A 2WMKA 1EA9C 4X9YA 1OCQA 2CYGA 1OIMA 2WHJA 2VRKA 1KR1A 3LPGA 4DWSC 3MU7A 3DYMA 3ZIZA 4EE9A 2WMIA 3AS1A 1QNPA 2XWEA 1UA3A 3N1AA 2FHCA 5IXEA 5E70A 9CGTA 5AYBA 1VFOA 1S46A 3IJ8A 4K68A 2ZXDA 2WCGA 4CN1A 1B2YA 3CUJA 2ZX5A 4AZHA 1V3JA 1V02E 5I24A 1MQQA 4NRSA 2W66A 4QP0A 2XG9A 1HF6A 2E3ZA 4P8XA 3AHTA 2J25A 2CESA 3B9DA 2VX4A 2BY1A 1QI4A 2QHAA 3SUWA 1LWHA 5A69A 2WYSA 1CXHA 2UY4A 1EQCA 4AZCB 2VI0A 2AOSA 1HKJA 2W67A 1BYAA 4AWEA 4JFVA 4P7RA 1W9DM 2JIEA 2XTKA 2D23A 3WY1A 4ATDA 3WNOA 2HISA 1TVNA 4R5EA 2XSAA 5LA0A 4OUEA 1JDCA 3BXWA 4X0VA 1JYVA 2WB5A 1JF6A 1VB9A 4M56A 3VD4A 2J4GA 1E4NA 5DFAA 5I23A 3W24A 1QBAA 3N15A 3B8SA 4OOUA 1EO5A 2Y4SA 2WC7A 4KH2A 2XGBA 3BSGA 1O7AA 4H2CA 1GONA 4W86A 8CGTA 2YL5A 4MB4A 3CHEA 2J78A 2YDQA 1JI1A
chains in the Genus database with same CATH superfamily
1Z6KA 1N8IA 1TTPA 1XIBA 5HOSA 4DJEA 2OFJA 2G5WA 2FGZA 3WUBA 4L6DA 3TONA 1OX5A 2BFGA 4IMAA 4I5UA 1DIDA 1RCQA 3MI2A 5CPOA 1YADA 1HIZA 3CS2A 4BQ4A 3LCWA 3IJ6A 5H8UA 4AH7A 1W32A 1UWSA 4MPKA 2J7FA 4EANA 1L2UA 3WG6A 4I8YA 1RBLA 3VD9A 3QOKA 3C3NA 2HMCA 4PMRA 1T0OA 1BXCA 4RZ6A 4C7GA 4LT9A 1JAEA 1A5LC 4LSBA 1JDAA 3UT0A 4FF7A 4L4LA 2NQHA 1DWIM 1OYBA 3R4IA 1TVPA 2PTYA 2A85A 3M0KA 4AD2A 2X1RA 1FWFC 1O5KA 5A8GA 1KLYA 1SZEA 3PUGA 3TMQA 3ABRA 3PTQA 1ZBVA 3L2MA 3CQKA 3VUPA 5C2GA 3RIKA 4Q8NA 1XRSA 4HZ8A 1TV2A 3EOUA 1KM5A 1XQKA 3PBUA 3N6QA 3POCA 2J24A 3UJEA 3CBWA 3WUEA 3NQ2A 4IIGA 3R89A 2VO5A 5A6BA 1MSSA 2WNQA 1R9ZA 4LXFA 2VJXA 4H2HA 5EU9A 3M5YA 4GJJA 2V5DA 3AXMA 3DKJA 2D0GA 1XQLA 3TIMA 3KRBA 5EB8A 3UG8A 3TUUA 1SSDA 3LTYA 3PP7A 4IQEA 3T2OA 2Q8LA 3B8DA 4ERIA 3G0UA 4BK9A 2E1WA 3ZVHB 1V08A 3Q94A 1BVZA 4NKCA 2F6XA 1Q7MA 4TIMA 1KFKA 2QCHA 3QSTA 1XIIA 5GNZA 4JDBA 5CPLA 3BMWA 4IPNB 1O68A 1XYFA 4HU3A 4HHHA 4RZ5A 3BV4A 4LBSA 3TCSA 1ZFJA 2CLLA 5CSYA 3PR2A 2VELA 1V0KA 4Q8OA 3UPWA 1P6CA 2VWSA 3UVIA 3UXAA 1QOXA 1HGYA 3IIVA 5DQPA 4AZ5A 1DBTA 4FIQA 1S1PA 1X7IA 3V0SA 3LHVA 1LOSA 1X6NA 1KGUA 1EGVA 2DT1A 2GVGA 3QTGA 1UB3A 1TV4A 4AD5A 4ZBCA 2C71A 2YCIX 4FIRA 3TQVA 4C6FA 1DWFM 3NPVA 2E9LA 4DXVA 4W85A 3AIVA 3S1VA 4HNVA 1DHKA 3EOEA 1L9WA 2FFIA 3MMTA 6TAAA 3CMFA 1TQJA 3G22A 4CCEA 2ZVIA 2POTA 1A4LA 3PPFA 1H50A 2JBMA 4D6FA 1CT5A 2HBXA 4LV4A 4A3RA 1KD0A 1HQTA 5H1WA 2DY3A 2FMOA 1IEVA 3ZZ1A 1K7XA 1E4LA 4OQVA 3QY7A 4W88A 3EDDA 1MYRA 1L6WA 4M6VA 1WDQA 4OTKA 4CD8A 5I2UA 3QQ0A 4K7YA 2X1SA 1UOKA 4HSOA 1ZJBA 3PZOA 3SCRA 3ZWTA 3OA3A 3B04A 2RDWA 3VZXA 3PNUA 3SZ8A 2GJLA 3E38A 2BVDA 4IQDA 3FKKA 4XV0A 1CDGA 4NI8A 2X40A 3KM8A 4DF2A 5FIPA 4XUGA 6REQB 1GORA 4IX0A 2BX7A 1UWUA 3TH6A 1JFXA 2PDQA 4JOMA 5FJTA 2ZWZA 1IT7A 1XIFA 1ZLPA 5G2HA 3O16A 2DV0A 1MNSA 7REQB 1I1WA 4WHBA 3EWDA 4L1GA 4IP7A 4AD3A 3T2PA 3NL6A 3VK5A 3LQGA 5DT7A 4P7LA 2GQ3A 3L12A 2E1DA 2DH2A 1X38A 3O63A 1DOSA 5D04C 2DZSA 2ZOXA 5BXSA 3BG3A 1SZFA 1KC7A 4RJEA 4O1FA 3RLHA 2ZZ2A 3DFQA 1OGBA 2HCVA 3F2DA 1J2BA 1ONXA 3CZEA 5G4EA 3NVDA 3MVTA 2AQWA 5C71A 2YCEA 3WH6A 3SI9A 3IGXA 1EO7A 3KVJA 3EOLA 3AISA 3UYIA 1XH2A 4MDPA 3WQFA 2MANA 1IEIA 4JFTA 3EZ4A 1GPWA 1JDDA 2DPEA 2DH3A 2GQ9A 1YNYA 3B9AA 5FEPA 2D1ZA 1FFQA 2BVYA 1FUYA 3HG4A 1NWTA 3BLDA 1ESWA 2R24A 2JKEA 5LIKX 4PSPA 3GU1A 4WQ6A 1B54A 2J13A 5C9XA 1NQ6A 1SSGA 1J11A 4LVGA 1ZAJA 2O7QA 4QNWA 1XF0A 4Z1CA 4A21A 3LSCA 1BSIA 4OU1A 2KZHA 3PBWA 1D2KA 3U5UA 7TAAA 2VWTA 2I14A 4GUIA 1XIJA 4E4UA 4LW7A 5BRPA 2XHYA 1MWOA 3RITA 3U4FA 2I57A 4Z0JA 4LEFA 3DG3A 3PSWA 3N9KA 5DEZA 4BQ5A 1HO4A 3O0KA 4EF9A 1AA1B 1X97A 2EAWA 4ZGYA 4REQA 1XC6A 1ICQA 3VO0A 2VGIA 1RBAA 1G0CA 4ZODA 3URAA 4AIOA 2WANA 3RUBL 4LNCA 3N4EA 2QCCA 1S2WA 2XIQA 3H2OA 4ORIA 2BMBA 2ADAA 1J0JA 3W9ZA 2QAPA 4ASTA 3TJ4A 1UMYA 4DJED 1DHPA 3C4UA 4D6HA 4LCRA 4PUNA 3GIPA 3PAOA 3VU2A 2PDUA 4H8UA 1Q63A 3WJWA 3CPGA 1DWHM 1HJXA 5C2XA 3YPIA 2XGZA 4DO7A 3QY8A 1TJPA 4WDXA 5ABTA 1QI0A 4J5NA 1UWQA 4F66A 1RA0A 4G5DA 1BWKA 3CHCA 4L6OA 1E6XM 3C52A 2JFEX 4HOWA 2VEKA 3QRHA 3S2JA 5D9OA 1R85A 5HINA 3RLVA 4TMBA 3C86A 4YLWA 2INZA 4F3HA 1PKYA 4M24A 3LMZA 2J47A 1UC5A 1UR4A 1Z48A 3LK6A 5FEWA 3V35A 3SGZA 5J5RA 2YBUA 1XUZA 2Y6ZA 1DIOA 1LUCA 4AMAA 1I45A 1A0EA 2XIIA 2YYTA 4MZ8A 3EWWA 3CQ0A 4KIEA 5ECVA 3MMUA 4DN1A 4C5ZA 1SR0A 1KRCC 3K4WA 3ANVA 4PMJA 5DLCA 3GAKA 4XB3A 1EJ7L 3N04A 4I6KA 1E1CA 3KP1A 5F2LA 4JXCA 1SW0A 3BMVA 2Q6ZA 1AZ2A 1JIBA 2QDEA 3DDMA 3MC5A 2Y85A 1NWUA 2J8TA 2ZZ5A 5F1VA 2C0HA 3G8RA 3VE7A 4XIMA 1BG9A 1JI2A 3AIUA 5HQLA 5G1TA 2V82A 4H8VA 4CVWA 3KCOA 4GI8A 1SO6A 3HOJA 3QR0A 3TC3A 3KRSA 1EDGA 3PY2A 3T81A 1B3XA 3O3RA 2X1IA 3AIEA 3BLEA 4UFLA 4EPDC 2BBFA 2P3ZA 3W2LA 4O13A 3IK2A 4HN8A 2FTWA 4C6CA 2EQDA 1DORA 1ZY9A 1EA0A 4FNSA 4QBXA 1RVKA 4D1JA 4MB1A 2R14A 3FHAA 3WJXA 1H3GA 4H19A 1K9TA 4UTKA 1V77A 2PF8A 3CHVA 3WQWA 4EP8C 5AHLA 4DF0A 3EX3A 2BHYA 1VJIA 3N4FA 3BURA 4IISA 1NVMA 1EB3A 3HTWA 3U7VA 4HU0A 1OF6A 4J3TA 3IS4A 4HN4A 2F6KA 2X42A 3VIKA 3KVLA 5AHMA 3TXZA 5AC7A 1NTHA 2PGWA 1OVDA 3MI3A 1QPKA 1FH8A 5FACA 3W1UA 5LHFA 1NWRA 2HEJA 3UXDA 3W7IA 3L9CA 5H6HA 5A6TC 4BF9A 4NUWA 2ISWA 3MUZ1 6PTDA 3ARSA 3TV8A 1M41A 1KKRA 4ZE5A 2WMJA 4UMBA 3G3MA 4GH3A 4Y9OA 1UPPA 1O95A 1JFHA 2OT1A 3RMEA 2J7HA 1V6WA 4N9EA 1G7UA 1ZPTA 2EHHA 1GQJA 2HZGA 1YIXA 1UKPA 3QMRA 3WNNA 1ELSA 4JIRA 3TTYA 1I2PA 1ZJIA 3ARPA 1XCWA 4Q8UA 2WSYA 3SCPA 3EDEA 1IZJA 3CUZA 3OTRA 1RD6A 3R11A 1O94A 3J7HA 3TZNA 4H7CA 2EG7A 1BKSA 3HBLA 4F40A 1H5VA 4ZOAA 2O7SA 1NDZA 1WBHA 2X0SA 4AHPA 1QOPA 2W92A 3OYZA 1AMYA 3WEMA 3KBWA 4PCPA 1MDLA 2QKFA 3GXDA 2XM2A 1I2RA 2DP3A 2IUZA 3DZ1A 3VZYA 4RE2A 1UBSA 3LRLA 1KO0A 4P8VA 1CX9A 3C2FA 3EAUA 3DX5A 5BZAA 5E9XA 4WSJA 1UKTA 4JTGA 1FWGC 3MZ2A 1QT1A 4FNQA 3ZLGA 5AECA 4GUFA 4OHQA 3RJYA 2RJGA 3CH9A 3PTKA 2XISA 4L4MA 1KXQA 2NXGA 2PB1A 2C16A 1EP1A 3B97A 4D8LA 4IG2B 5LNSA 1KB3A 3GFZA 4W5UA 2F2KA 4OV4A 1BAGA 1S1RA 1QK0A 3GXFA 3JW7A 3RFAA 2YKKA 1KNWA 1P4CA 3F4VA 4GACA 3VGEA 1W3LA 5D03A 3TNBA 4Z17A 1EJWC 5CJ5A 3DFHA 4FXRA 3VOGA 4Q4RA 5F1UA 1BQGA 2Y70A 3DC0A 1VRDA 4TV5A 4HNUA 4HU8A 3WFZA 5I78A 1EJTC 4IL2A 1I6NA 3EWCA 4LYPA 3W02A 3GW0A 2V2HA 4GGBA 3NZ1A 3OO2A 4J3SA 4MNLA 2WWDA 3OZOA 1OX4B 3VC6A 4AB4A 3OA5A 3R13A 3XINA 1QWKA 3B0PA 3GHUA 3WQDA 1A5AA 1FWSA 4UFMA 5J8LA 3QLDA 4RL3A 3WK3A 1PX8A 4Z2IA 4FLOA 3AAMA 2X41A 3M5XA 3WZ0E 3E0FA 1K8CA 4D72A 1TWSA 1KBIA 2CCRA 4HK6A 4DJDA 3VKKA 1B1YA 4CNPA 3QMTA 2WHLA 3UJRA 1H60A 2QCMA 3T0BA 3IAPA 2ZUUA 1K8YA 4MUZA 2L5HA 3S5YA 2B0MA 3RCYA 1PZ2A 1YRRA 3EKGA 3GLCA 1W5QA 3GYEA 2ODOA 1BSLA 3EMZA 4RNIA 4JEQA 4AF0A 3SBFA 5JQ9A 2XIJA 2ZA1A 2PTWA 3M1ZA 5BMWA 5FL1A 2A3HA 2Z1VA 3N9RA 1M53A 3SY1A 3HPZA 3ITXA 2C18A 2BY3A 4JCLA 1DKWA 4JTEA 3VKDA 1REQA 2ZRXA 3ZLHA 1GZGA 2CZ5A 1EJSC 1F5ZA 4ZOBA 4UQCA 4XZ9A 2DEPA 2I5IA 4JQ4A 4E8DA 3NYDA 3FJLA 5M17A 3U2ZA 2VZTA 4TX8A 1BVWA 2W63A 5EMKA 4IHCA 1H7RA 3UWUA 3KRZA 1DJWA 2A7PA 1YTKA 3BWWA 3UNDA 5TAOA 2Y7DA 4U28A 1EJVC 5D02A 4RUBA 4AZGA 5A6BD 2G3FA 3WNMA 4Q3MA 3ARXA 1JNEA 1IIHA 2CBVA 3KBMA 1F6PA 2YIHA 1MVYA 5HUPA 3OLGA 1KRMA 1WA3A 3M43A 5FA5A 2RGLA 3QHMA 2OGYA 1XLAA 1QNVA 4B9ZA 4Q8WA 4HB7A 3HIJA 2RJHA 3GS6A 4XAYA 2A79A 3L5AA 1X1OA 3IJQA 1TPC1 3IPWA 2CC0A 3EX6A 2VHLA 3AS2A 5EMLA 3A3HA 3RG6A 2P50A 4LAMA 1XLGA 3FA3A 4NZCA 5A5WA 1W8GA 1MW2A 4IFRA 2NX9A 1TTIA 1OX6A 4CNUA 1W1A1 1QWGA 3BCDA 3TTOA 1KXHA 4BZYA 3VOCA 4BWLA 5DCDA 1F4HA 1TPVA 4DYJA 1HP5A 4U5KA 4UCGA 1GVYA 4F0LA 1TZZA 1G9HA 1VD6A 3DG7A 2E28A 4R9OA 5JU6A 3LENA 4GJ1A 2IQDA 3AU2A 4PA8A 2ZRWA 1XXXA 2ICSA 4I9TA 3GNRA 5AZ0A 4I7VA 3UWQA 3O9NA 4F0HA 4E3TA 3GRIA 1H5YA 3L4VA 5BXRA 4IGSA 4GYKA 4ZQPA 1JXJA 3HURA 3W26A 2VDIA 1D7FA 4N7QA 1LQ0A 1HL8A 3IUDA 3NUKA 4MF4A 5D2XA 1NSJA 2OKTA 3FKRA 4H7ZA 5E0CA 2J9YA 3IGSA 4DQWA 4M6UA 4Y96A 2GOUA 2P8CA 2EJAA 5K7JA 3R0DA 2Z29A 4Y9PA 3A5VA 1Y5WA 1UZ4A 1OGGA 4LFYA 1RR2A 3A6OA 1E0VA 1XR2A 2H9AB 1PUDA 2QVNA 5FKYA 1QDSA 3VINA 3TWAA 3TZFA 3JZUA 1NIUA 5A95A 3M16A 1S2VA 1NOUA 4ECLA 4I9MA 2EPMX 4K2SA 1F05A 5IRPA 5I07A 5GPRA 4FR6A 1VFSA 4AD0A 5EFDA 3CXOA 7ENLA 1R3YA 3WF4A 1ZQ5A 2WKJA 1Q6EA 3W1MA 3EPNA 4NJHA 3DESA 4ZMGA 5LIYX 2WZMA 3SSJA 3H2FA 3N2MA 3GZAA 4YWIA 1K6WA 4AY8A 5M03A 1VYSX 2DJXA 1EIXA 2VDGA 4IJCA 1OC6A 1D3CA 4US6A 3IEBA 2V2CA 3W7MA 2PFHA 3AXXA 4DBEA 2XU2A 4B92A 4QJ3B 3FAXA 3ZVIA 3O6DA 2OSYA 4W8BA 3T1GA 3NA8A 3SADA 4GY0A 2WVVB 4L9XA 4Q6JA 3W76A 4OGZA 3EWXA 3WDJA 5T9CE 3HJEA 4AU0A 3QEZA 3I3DA 1ZL1A 2J7GA 5XINA 4B5NA 1L8PA 3CV1A 5LZLA 2GJRA 5F2MA 3HM7A 3K8LA 3CV7A 3W7KA 1H7XA 3C61A 1LRQA 1RBOB 4GABA 3SSZA 1TO3A 5DANA 3LG3A 3HGJA 4UQBA 3G1SA 4XTDA 3S2NA 5HATA 1D8CA 1FWIC 1PTDA 1C8VA 3BPWA 3D3AA 1SU5A 2QCLA 5K4XA 2YZRA 1FXPA 2OKOA 1VIWA 5D2YA 4EK7A 2NV2A 4FX7A 1QNRA 1TMHA 3APGA 3HMJG 9RUBA 2WMGA 3MTWA 5HMDA 4HJWA 4O52A 4KCWA 4M5PA 3QFEA 3O05A 4L4PA 5DMYA 2VR4A 4DJFA 3GKFA 5CXPA 1VEPA 3CUXA 4W8AA 4P7OA 5CPQA 3LRMA 4UNKA 1VH7A 4A6GA 4C6OA 1F8IA 3XISA 2P1FA 4PTVA 4WUIA 4XKYA 1KGXA 3M0XA 5C9ZA 1XDMA 2QJJA 2WPGA 3BE7A 4C1NB 3THCA 4D6EA 3CWNA 3GHSA 4H04A 3AMGA 4MYAA 3ARQA 3L2LA 3F2CA 4DZ5A 1A0CA 2OSXA 3NTYA 4BFAA 2J6VA 4MY1A 3STFA 3EPOA 4PCFA 2AGKA 4JR5A 3QOMA 3ITTA 2TODA 2VOMA 4PRRA 1AD4A 1L2QA 4PH6A 3A4AA 1J9YA 1ODZA 3S6TA 4QX4A 3EDKA 2GSJA 3GNXA 5DELA 2C14A 3NQ6A 2QJHA 4C6LA 1GOMA 4MJMA 5HNUA 3TYBA 5A8PA 4NZJA 4C1LA 3PC0A 1TQXA 3LLDA 2YXOA 3BG5A 1RVGA 3GDBA 1QFEA 3WDHA 3G1XA 4XD5A 3K2GA 1AG1O 1THFD 5FJOA 1A5NC 3GK0A 1UPMB 2VM8A 1SMDA 4UTHA 2PWEA 1POJA 1U5HA 3U0HA 2CITA 2G37A 2Z24A 3WFLA 4JZ5A 1BGAA 2PWDA 5EY5A 4GYPC 3MYOA 1XCFA 1IWAA 2YX0A 1R8LA 1KXTA 3NZQA 2ZIDA 2YB4A 3GNNA 1NM9A 1DIEA 3MPGA 1DQXA 2EKGA 3MCMA 3R58A 2WM1A 3QKEA 1IYXA 1TTJA 1CXFA 3CC1A 3PPCA 3ZR4A 4A3QA 4UTTA 2DVXA 2VEFA 2QGHA 5IM51 3JU2A 4O50A 2Z27A 1SJDA 3TWBA 2BXZA 3ZOAA 2QZRA 8A3HA 2NVDA 3W71A 1V7YA 1AQHA 4O11A 4PFMA 4FXSA 5A2AA 2GVYA 1JVNA 4XAZA 3RR4A 3KZPA 4XD4A 1CW2A 3LPPA 3IJ9A 4DELA 4ROQA 2ATSA 2DT0A 3LDVA 1U2YA 3TN3A 2NQ5A 3KCJA 4BJHA 5JIPA 1LOQA 4W7WA 2YL6A 1UYQA 1WO2A 3NYZA 4H7VA 1YPIA 2BB0A 3SCTA 4K38A 4GVGA 2PLJA 2UY3A 3O07A 1LQAA 1TA3A 2DGAA 3QHOA 4XZHA 3S3GA 4MNMA 3N2CA 3GG8A 1XLCA 3SECA 4QEEA 4FK9A 1HNYA 4F8XA 4JIHA 1B3OA 2PWFA 1XRVA 3GUWA 3I4KA 4MAZA 3WQEA 1VPXA 2XVKA 5CZKA 1Q13A 4PCNA 1S5NA 1VR6A 4S3DA 4LX4A 2PZ0A 3KTSA 2YXXA 2OO0A 2WW5A 3VKJA 4U3AA 2E6YA 4B4HA 1IR2A 4DLFA 2CWXA 1IEWA 4WX2A 1WUEA 1OD8A 3VDHA 3AUJA 4G7FA 2ACSA 3IV8A 1BYCA 3M5ZA 4KWSA 4G56A 5E0KA 5FJJA 1HJSA 1ADSA 1U22A 1OK4A 4HMNA 4P5UA 2WVSA 3MYPA 5CLWA 4A4AA 2X2YA 3PZMA 3KFTA 1OX4A 2VFIA 4LAZA 2JE8A 3P93A 1PIIA 4NNCA 4PBEA 2GOKA 3NL5A 1JDEA 2NT1A 4AWTA 3WMLA 3OBEA 2WBGA 4TUFA 3PULA 1XCXA 1M7XA 1ZBCA 2BGSA 3VABA 1XJBA 1ODUA 1OEPA 1TR1A 1VYPX 1RQBA 3FGCA 3SFWA 3TSDA 3KLLA 3MB9A 4AMCA 4CKQA 1UA7A 1B4KA 2BOFX 2ZRUA 3W7QA 4JTKA 5FF2A 2HV5A 5CJNA 1OFBA 3N9SA 2XWDA 1I60A 3DC8A 2Q8ZA 2J7CA 4GUGA 3WD3A 4G6CA 2DIKA 2HPMA 1W1ZA 1A5MC 2XFYA 4CVUA 2DSZA 3KZSA 1H7NA 2HNEA 3FAWA 2PWGA 3GG1A 3TLLA 5C70A 1EDTA 3ATZA 4PB3A 5D9PA 2UWFA 1R87A 3VM5A 4KRTA 3FXGA 3G8EA 5AY7A 3Q2DA 3QM3A 4JN6A 3VCNA 4WSKA 4N4QA 1TE6A 3VD7A 2YYUA 1B57A 1BD0A 3FEMA 3RX4A 3MUCA 5C7VA 2J9XA 4F79A 1GQKA 3FN9A 1LCOA 3UZXA 1QI5A 2P76A 3H24A 3TC6A 3T09A 2WBKA 2CLOA 4GQGA 4Y9MA 3LQLA 4JKKA 3E74A 4YS1A 4KMQA 2ZA3A 2WQPA 1QO5A 3KDOA 1LM1A 2X0YA 4TVUA 1UROA 1XFCA 2YA0A 3PAJA 4CCDA 1GCYA 3NR0A 4LVDA 1N55A 3CU2A 4AHOA 4CEUC 2VEIA 5HANA 1KGWA 2R9RA 3UCDA 3WDIA 3WL1A 1EA9C 1BF6A 5J5DA 5JXQA 1RJQA 2DUAA 2AKZA 3I10A 2Y89A 3LPGA 3DYMA 1A80A 3W1QA 2WMIA 3NL3A 1RY0A 3S2LA 1VHCA 4UC5A 9CGTA 3EEGA 4A22A 2WCGA 3CASA 4Q4QA 3VOJA 3VNKA 4I5XA 1W17A 4NZ4A 2QPXA 4ZTYA 2J25A 3KVKA 8RUCA 3LTPA 3B9DA 2W3ZA 1K70A 2E6AA 3QW3A 1WYIA 5A69A 2UY4A 3HQPA 3T55A 4GA8A 4G7EA 3LGDA 1A5BA 3K5XA 4NAEA 1W9DM 4ZQNA 1SJCA 3WY1A 2ISDA 4QROA 3WNOA 3NQDA 4RXGA 2XSAA 4Q8QA 1JDCA 3JRKA 5I3KA 5FEXA 2AQVA 1VB9A 2ON3A 1MRAA 2P10A 2O4MA 4NYUA 3VD4A 3EA2A 1TPEA 1E4NA 1ADDA 5I23A 4KF1A 3B8SA 4OOUA 3MI6A 3FYYA 4QJ5B 1IZCA 1R9XA 4W86A 1TIMA 3KTXA 1K7FA 4UTTC 4XBKA 4DZHA 4DAFA 6REQA 3MKKA 3M5VA 2PS2A 1MZHA 3VDCA 2VDHA 2XFRA 3OP2A 3IJDA 1RK6A 5LA1A 3IK4A 2SFPA 3URQA 2ZC1A 1H09A 2QR6A 1B3VA 4DAIA 4AYSA 1A47A 3VDBA 2V81A 3LI1A 4A8IA 1F4AA 3GNPA 3R79A 1R2RA 4R34A 3MBDA 4HPHA 3L0GA 1RH9A 2HSAA 3VIIA 5KZ6A 1FWCC 1FQ0A 3SUUA 3KLKA 3UCQA 3NIYA 5HPCA 4QM1A 1XSJA 3IUIA 7A3HA 1VFUA 4K3ZA 3BMXA 3OBKA 5C54A 4CU6A 3VIFA 3WBEA 2ZX7A 3FX4A 3KX6A 1XX1A 3QFWA 1MDRA 3GIYA 2CETA 3TA6A 1AZ1A 1OC5A 1FHUA 3LV5A 1SZNA 2VX7A 5FEZA 2OTDA 3M0LA 3SM0A 5CC7A 1PYFA 2Z2UA 3QN3A 1M7OA 3LNPA 3MVIA 2ZUVA 3AIRA 1BFNA 4YHEA 3CIWA 4GY1A 1FH9A 4JHZA 2VTFA 3GXNA 5ABHA 1XSKA 5LXEA 4GZEA 4RE4A 2J88A 5CBJA 4HU4A 3H55A 3H53A 3TC7A 3BAJA 4O16A 3WD4A 3N2OA 4D71A 3VIJA 1S2CA 4S23A 4DY1A 3MT1A 2OQHA 2OSWA 5TBOA 4IM4A 4PMXA 4HZ7A 3C56A 1DIKA 5HULA 2OYKA 3OQ8A 2PDBA 2OZTA 1XGDA 4FOUA 5LYRA 2EJ1A 1WZMA 1P0BA 1QW7A 4S3FA 3LXCA 4NJKA 1DXIA 2VGGA 2Y61A 4CNNA 2C7FA 4JFUA 2OXNA 2DJLA 1WKDA 4TOQA 3SO7A 2NQLA 1GZ1A 2JK2A 3SCOA 1XBXA 3USBA 4NVTA 1KR0A 3NEHA 4X3ZA 3TAKA 3B8TA 4JHOA 2P5NA 3CT2A 4WIWA 4HYRA 1V8EA 1W9VA 3ITVA 3VNYA 4UTWA 1QPQA 1GPFA 2DSWA 3SB0A 3DCPA 3LM3A 2NSXA 1UOZA 4WLCA 3U57A 4MLRA 4H6EA 1U5JA 4IGMA 1Z7AA 2D3LA 4MTVA 3KL5A 4C6NA 3WD2A 3UY8A 1BTCA 1PCKA 4E3VA 1W9BM 2WMHA 1GKRA 3LGGA 5DMLA 1ECEA 3GUGA 4ALDA 3W23A 1XICA 4WGHA 1G7VA 3M7SA 2QGYA 2G50A 3Q37A 5A6LA 4DJFC 1TE1A 3KDNA 3L7RA 2EF9A 5DMNA 3MKCA 5EL1A 1XYBA 3LZ5A 1JAKA 3S8HA 1JCXA 4O8AA 4YYCA 2CBJA 4W8LA 4JTHA 3BLFA 2XIOA 1V3IA 5I77A 1O1HA 4UR8A 3ARYA 3WUFA 1DJGA 3R0UA 2EXOA 1ZS2A 1XIMA 4LANA 5KETA 1O60A 4AZCA 3ZQ9A 1YTDA 2X2GA 1J93A 4J3XA 4CQBA 4JTAA 4FX8A 5AYYA 3CV2A 4JNZA 5E6YA 1UR2A 3H22A 1FKXA 1L6GA 4LS0A 3IIXA 2A5HA 3CLMA 3G1VA 2QPSA 2UBPC 4DB7A 2BVWA 1E1EA 2XIBA 3DG6A 3QPZA 3FDGA 1V51A 2VRQA 3OB8A 4AWSA 1NFBA 4MOZA 3VNLA 3RNDA 4Z08A 3W7OA 3E9AA 3NQFA 1OQFA 2VFHA 2WAGA 3UZJA 2DUZA 3ARUA 1NY1A 4M7SA 2EPOA 1AMKA 3N6HA 5REQA 4MADA 1HXJA 4UFKA 3L23A 4V2XA 3ITGA 1EH9A 1RLCL 3PF3A 2WNNA 3P3BA 3DBPA 3N14A 2PP3A 1EP3A 1IE7C 5D09A 4O0KA 4JTIA 1PHWA 1AFSA 4OBRA 4P7NA 2C79A 2W27A 4PEKA 1DP0A 1HVQA 4BF5A 3R94A 2CBUA 5K9DA 1KFCA 2FPYA 4O19A 3VD3A 2RAGA 3GWQA 2VKZG 4ADTA 1S3TC 4ZO8A 4DF1A 3NQCA 4AZIA 1C93A 4W9TA 2JGYA 1PZ3A 1IXPA 3QC3A 1LLOA 3VVGA 5M3WA 2FVMA 1Z32X 2CLHA 1WKFA 4NX5A 1LT7A 3GB6A 4N2YA 4JIEA 1BLIA 1W2VA 1W6TA 1N8WA 3BW4A 4H6QA 5I79A 3HJZA 3MSGA 4QAWA 1I2OA 4HK5A 3KBJA 1KFBA 4LS1A 3PBYA 3NQGA 1RK5A 4GVHA 3P74A 3OHIA 1OCJA 2HROA 4O1CA 2WMFA 1ENUA 2PDLA 4EKJA 3ITOA 5A6MA 3UPBA 5BOFA 3AMLA 2X0HA 1RSCA 3LB0A 1OT1A 2V30A 5CBIA 4H6KA 3Q58A 3O1NA 1OYCA 2VCCA 2TMDA 4HNCA 1OB0A 1VFLA 3SCWA 4C60A 3SRHA 3M4HA 3W00A 3N34A 4YHGA 5BXPA 1J10A 4YCPA 3L5MA 1KFJA 1W8SA 3LERA 1ISWA 4FX6M 1UWIA 4HPGA 2QCEA 4LUSA 2NLYA 3DECA 4AY1A 3V5CA 1LRNA 2XN1A 3BAKA 3NSMA 1ZBWA 1SPQA 4YMZA 4ZZ9A 4IOTA 1XS2A 2FH8A 4HA1A 3NDZA 3UG5A 3I3EA 3B9NA 3ARRA 3DGRA 2F6UA 2OX4A 2NXIA 3ARTA 3P61A 4KGLA 1XLBA 2H90A 2OQLA 1OY0A 4Z2KA 3TN5A 2PLCA 1XLIA 1GOWA 1HGWA 4HA4A 1S38A 1NAL1 5GQBA 6XIAA 3E49A 2WHMA 2OWXA 3T0TA 3B0UX 2OZ0A 1XI3A 1R5YA 2WZEA 3MUY1 2W0UA 1SJBA 4OOZA 4JX5A 4L6HA 1GTHA 1VHNA 1CXKA 3BSHA 2IPJA 3W75A 1O66A 2GDUA 3IIZA 1HKKA 5D8WA 3AYSA 5BOOA 5BMXA 3EXSA 4HK7A 5EMJA 4UCFA 1EX5A 4UOQA 3G1DA 4ZTXA 3RU6A 1EP2A 3FHQA 3TFXA 2PC8A 1TCDA 2FJKA 1DQUA 2FFCA 4DI8A 1TPB1 1MMFA 3P14A 3W2MA 3ZR5A 6XIMA 1YXDA 1B30A 4GBUA 1QASA 1TIWA 1ISVA 3VIPA 2NUXA 1YEYA 2C1GA 4NASA 1CB7B 1W1PA 2PPGA 3C0SA 4H00A 2REQB 4M8UA 4MJZA 4LRSA 3W53A 4R85A 2CZVA 3ZSSA 5CSRA 3CT7A 1EOMA 3BANA 1I9CB 1FHLA 4M80A 4Y8FA 1XWYA 4DUWA 3EBVA 4ZVJA 1P5BA 1NEYA 1CI1A 1QTWA 3ALGA 4FOJA 2CERA 4KBXA 3E0VA 3E2SA 5F2IA 5D32A 2OT0A 3SN4A 4BQ3A 5BROA 1Q6DA 1E4IA 3V5FA 2ZUMA 1E1CB 3MWCA 1ADOA 3AIWA 1CGUA 5TD4A 3E5PA 3SDOA 2DZVA 2V3GA 2XUCA 3GFXA 1E9ZB 3OEXA 3E6EA 1ZUAX 5XIAA 4RNFA 1OINA 5JUVA 1XPGA 4PMDA 4WK9A 2W6RA 4BCEA 3IJIA 3DERA 4GNKB 1F6YA 3SUTA 1Q5MA 3VNMA 2WSRA 1FBAA 3KS6A 1WPCA 2BGNE 1KBBA 4C90A 2E67A 1GVEA 4AEEA 2YJQA 1PX3A 5KZDA 1I0DA 1F3TA 4XAFA 1PIFA 2HWGA 4C65A 6ENLA 2D2GA 2IQ0A 4W7VA 5A2BA 3OG2A 1W5PA 1UD2A 3UETA 2OVLA 2EPKX 3PZTA 3TR9A 2ZRYA 4C6KA 3RCNA 3E3HA 1OBAA 4LY8A 4GJIA 4B5SA 3GDTA 4H9UA 1S2TA 4MM1A 4TTGA 1R30A 4F0RA 3WMCA 4G1KA 2GVJA 4ZO9A 3GR4A 5T91A 3CMGA 5BU6A 4E2DA 5REQB 1E51A 1UJPA 5CG7A 4S38A 3IIPA 5AOUA 3IVUA 1EXBA 2QQ6A 4JX4A 3PTMA 1KXVA 2PRHA 3CEPA 1P7TA 3AXHA 3GBDA 5BWFA 1UW9A 1TMQA 4UFJA 3AS0A 1RCXB 4Q7NA 2G3IA 1FWWA 3FCPA 1AUSL 4FLSA 4LEQA 4C6MA 3W3OA 4FLQA 4Q7IA 3O6AA 2E6FA 3K4AA 1JNDA 2YDRA 1XDLA 2G96A 4C6PA 2OB3A 3JUGA 3S42A 4B5WA 1EJRC 3TNOA 1WXZA 2CLFA 3CV6A 3E1F1 1UR9A 3EWBX 2C3ZA 2ISVA 1KM2A 1A0DA 2AQOA 3NL2A 4GZJA 3AZRA 5D33A 1LJYA 2VR5A 2C8NA 3E02A 1WDRA 4NJIA 2Z1BA 1PJ9A 2ISSA 1AQMA 4TV6A 1JR1A 1FKWA 1YTEA 1TPH1 4Z1BA 5ENLA 1E6QM 1IZKA 1EF2A 5C2CA 3A9IA 4GUJA 3KE0A 1FY6A 1E40A 3HGOA 3EB2A 4HD5A 4N0RA 4OJYA 1OCNA 2DIEA 4YNGA 4X2PA 3MHGA 1ISYA 1QI3A 1U33A 1V3HA 2RGMA 4XAGA 3CAKA 2V67A 4PTMA 3GVRA 3RRAA 6ALDA 4HBKA 3WLJA 2I17A 2V8ZA 1ZTVA 4F9DA 2PDMA 4H01A 3LSBA 3TFCA 4IH3A 2DZBA 1UR1A 3H7RA 3WSUA 4B5XA 4D6JA 2NX3A 1I2NA 3M0MA 3GTNA 3G1FA 4RDYA 3S1UA 1QBBA 2PDYA 4TQTA 4ICNA 3RN6A 1US2A 3BK0A 2RDTA 5IHRA 1QHZA 1LOLA 2VCBA 1ITUA 3LI0A 3JZEA 3W7LA 5CPTA 1X8CA 2IMRA 3HQNA 5H91A 2Q3RA 5GJNA 3B9EA 2GK1B 3WNPA 4ADSA 4BS0A 1TJ1A 4YVPA 2VZOA 1POKA 2ZVRA 4NXKA 2Q8XA 1GEHA 2WXDM 4GBDA 4K39A 1F2JA 1LL6A 2E40A 1QCWA 3AHZA 3NM1A 3CQJA 4B9YA 3LCLA 1R6WA 3NVTA 3THUA 3CTLA 3WBAA 3IV3A 4JN7A 4PUKA 2OZ3A 4LGXA 4GY7A 4PC8A 4HJFA 3WF3A 4ATLA 1KKOA 3NZRA 2IPFA 1ME8A 1LLZA 3H6OA 3I6EA 4QR6A 4B2DD 3GDLA 3I7QA 5D38A 2BHUA 4FS9A 3R6IA 1JCNA 1VJZA 5ABFB 2OOGA 1ZGDA 4M29A 1H51A 3W73A 4AHQA 1FA2A 4DX3A 3POHA 4K37A 2BNJA 3WL0A 1K8XA 4FOKA 2VC5A 2Y7EA 4NQ1A 3PFRA 2VFEA 3NXLA 2FZDA 4EACA 1E6PA 3U2CA 1GJUA 3TJXA 1J0YA 4LAOA 1AJZA 1SUXA 3GXPA 1JZ2A 5BRQA 3GDMA 1DYSA 3W87A 3MO7A 1SQ7A 2RDXA 3H8AA 1BYBA 1H1NA 3OVPA 2QUTA 2CLMA 4AUBA 2DZUA 1JYXA 4I6VA 3WDQA 4GKTA 3WLOA 2CIPA 4GK8A 3K8KA 3KBVA 5A8QA 2OLAA 2PZNA 1N2VA 3HG3A 3WJZA 1BXBA 1YPFA 5I02A 2WC3A 3QQ1A 4KEZA 2EO7A 2XM1A 1OC7A 3UFYA 5I03A 4ZO6A 5LNUA 2PI6A 1PKNA 4IIFA 2XZ7A 1MUCA 2ZZ3A 2H8ZA 2XGIA 2ZICA 4JTJA 1KQZA 2J75A 1EPVA 5HXMA 1DL3A 4XZBA 3R7MA 4RZ4A 5A1AA 4A2SA 5FSEC 3AIBA 4J3ZA 3ZSTA 3FS2A 2PTZA 1O5RA 1DEDA 5EKYA 2CNCA 2CLIA 2WMIB 5CZ0A 3CGTA 3S2CA 3D6NA 4E4PA 2YA2A 4V1XA 3WCZA 1E6SM 3T78A 3VXGA 2AAMA 4RZBA 1SGJA 2YXGA 3LD5A 3F4CA 3FVDA 4R7JA 3VMOA 1Y7VA 1JZ4A 2D2OA 4JD4A 3PNZA 1WP6A 3TXVA 1QHPA 1Q6RA 4C91A 1W1YA 3WNKA 4AXNA 4CU7A 1D8WA 4WSHA 3VX0A 4C7FA 4PMZA 1XV8A 1GHSA 3OHMB 1MQRA 4ATWA 2A1YA 4KWWA 1E55A 1RHCA 4LH8A 1WUFA 3NO3A 2FB3A 3QMSA 1AQFA 2NWRA 3R8GA 3LLXA 5HJYA 3UA4A 5FOOA 3R8RA 3CNYA 5LGXA 2NWSA 4RCXA 3B06A 2YOCA 1UD3A 3KUMA 2DQWA 4WR3A 3C2OA 1IQ8A 1O6IA 4PN2A 1L6FA 2DZPA 4QG6A 3BLOA 3HF3A 2XPKA 2F2HA 3WDPP 1ZENA 3NXFA 3DFTA 1KTNA 2CBIA 1HKVA 1KA9F 4AX7A 5I3HA 2WC4A 3ES7A 3TA9A 1FDZA 3FJ6A 1CGVA 4GG9A 2CZFA 3ERPA 1AH0A 1FCQA 4O0QA 3STGA 3VNIA 4D9PA 1P6WA 1F76A 3H4GA 5I06A 1YLVA 4Q22A 1EBGA 1X98A 4H6RA 2VRJA 1WKYA 1HTIA 3LM7A 4MUPA 4PMOA 4FA3A 2Y62A 2YPIA 2GJXA 1XYCA 1YPXA 2QDDA 4IJRA 2VP8A 3GVQA 1RLDA 1V0LA 2V3FA 4M82A 1XISA 1LL4A 3W1AA 3W85A 2OGJA 3VOFA 3AYTA 1GK8A 1BYDA 3OJGA 1FWNA 1ME7A 4C5YA 3PZVA 1TA3B 2FH6A 2UY5A 5C9UA 3K46A 3OQEA 3W1XA 3BAIA 3WO8A 5HQEA 3R1ZA 1E9LA 4O1BA 4UR9A 3A23A 1DJXA 1NDVA 1T40A 3BOXA 3FJ4A 2JEPA 3VGDA 4LUYA 3AALA 3NGJA 1IWBA 1PCWA 4UFHA 1JJKA 3WQ6A 1EZWA 2DZAA 3KWXA 3W01A 4CCCA 5ABFA 1IXQA 2YDSA 4LVFA 3PN8A 4RK8A 2QJMA 2H9AA 4JHMA 4P8UA 2G8ZA 3NG3A 1QXLA 3CYVA 3EX1A 3G1HA 1HUVA 5CEWA 3GFYA 3MHFA 1ICSA 4QE5A 2A2IA 4S3JA 4Y9NA 2H6RA 5JBDA 2OLHA 1ZRQA 3ZWSA 2EBNA 4F2TA 3AYVA 4HPNA 1KQYA 1DV7A 4PRWA 3G2GA 2D2JA 3Q65A 4IGNA 1PSCA 2B7QA 1LG1A 1UD5A 1HJUA 4NNAA 3NQBA 5JVLA 4DO6A 1UKOA 3S1GA 4ZFMA 4NU7A 4JAWA 5IHSA 1MW1A 1E0XA 3CAWA 5C6MA 4QITA 1XSIA 3S0CA 4GYPA 1VCFA 2DIJA 1JD9A 1RPXA 1VLWA 5LGZA 3WQ8A 4UB9A 1A3HA 2NV1A 4JYFA 3NJ3A 2X7WA 3VCRA 1FH7A 4LAUA 3C2EA 4UTLA 1FCUA 1XYMA 3DYOA 3NDOA 3PS7A 2QF7A 3CPUA 3H4WA 3AOFA 3P7YA 5G5IA 1GYMA 1JCYA 2Q09A 3BCFA 1WDSA 4H41A 1A5SA 1QK2A 5AYIA 4IPJA 3WD1A 6TIMA 1RXOB 4JTFA 3LCFA 4POCA 2C0AA 4D6DA 2V63A 3ME3A 4S39A 1F07A 2PU1A 3U6WA 4HHLA 5HJXA 3DAQA 4JTCA 3MV11 1S39A 1NELA 2HK0A 4QAIA 4WKAA 4XISA 3WQVA 5CPSA 1I2QA 3HB9A 5BYWA 3A24A 1YE4A 4MNKA 1LTDA 4IUOA 3WUGA 3BAWA 3II1A 1NF0A 4MIMA 4I9AA 4E8GA 2PSNA 3V1PA 2QLYA 3LV6A 5D2VA 2IKIA 2R94A 1NJJA 2NUWA 4OIFA 1G4SA 4HP5A 2VD8A 1W54A 1KBJA 3CAVA 4HNTA 3BVJA 5LHEA 1P1XA 5E6ZA 1K77A 1Q4NX 1OFOA 2E9MA 3TQ0A 4OZOA 1IT0A 5MKGB 4DNHA 2YFOA 4RR4A 2CLKA 5FSDC 4YYFA 4RE3A 5G1YA 2GWGA 4OUIA 3C8NA 3JS3A 4UZUA 1GWJA 4FNPA 5H2ZA 1KCLA 3N2XA 1TFVA 3AS3A 2BZNA 5SWUA 2GJPA 4PZVA 3B8VA 3UXIA 2FGBA 4H9TA 3WQPA 5CBBA 4GLEA 1V4YA 1C9WA 4LC8A 2WOQA 3TYDA 2CEQA 2X8RA 4RXFA 1UBPC 4GO9A 4YTSA 3CHFA 1S5VA 4IICA 1EC9A 3B0XA 1AJ2A 1EZ2A 4HA0A 1HVXA 1KCKA 3KAOA 2OYLA 1GJPA 3P0WA 3NGFA 2ZC8A 3EWUA 4L80A 1OADA 3W7DA 2CW6A 4EIVA 4JFSA 2Y0FA 1S2AA 4DO4A 1A50A 4GPNA 4MAVA 2DSKA 3L5LA 2HRWA 3D46A 3KXQA 2DQXA 5DF0A 4TX6A 3RGTA 2NSOA 1N7KA 3W4RA 3GIQA 4LS2A 4XK2A 1E0WA 1LORA 2ZZ6A 2PF0A 1R3SA 1EGMA 1QW8A 3DGBA 4NXSA 4CD5A 1G5AA 1KRAC 3UZYA 3KEHA 3FVMA 4IGHA 3GD6A 4HHPA 4LBUA 4C7DA 4QDMA 1G4TA 4S3BA 4DIAA 4CQCA 4WOZA 2WNWA 1E43A 3AIQA 2YGYA 3FA4A 5DRCA 4AAJA 4QLLA 4Z42C 3LZ3A 1SO3A 3O06A 5CAKA 1HO1A 2BG5A 3NM3A 3P84A 4CD4A 3HO8A 4J1OA 5CLTA 2A4AA 2CLPA 3CL6A 2NVAA 1FWEC 4AIUA 4H83A 3MUIA 4KKXA 4HVXA 1FFRA 3F5LA 1UZHA 1VFMA 4LY4A 1RD5A 4P8WA 4Q6XA 5I6SA 3FYPA 4HIBA 2OEMA 4A8NA 1XGZA 2E0PA 4UQAA 3GC4A 1GVFA 4NAFA 2FIQA 3UXKA 1VF8A 1Q6FA 2A3EA 2VVNA 3L4XA 4CNOA 2YW3A 2ZRVA 4WD0A 4CU8A 1XH1A 3OZPA 5DXYA 4XTIA 3L4YA 2PRMA 5M5DA 3A4XA 2TYSA 4XX6A 1AK5A 4UNIA 4KCTA 4DUXA 1CZ1A 3GVVA 1ONWA 1E4MM 5F4WA 3V4BA 4IG2A 2PTDA 3KL3A 1I4NA 4JIQA 4C1KA 1UR3M 2QW5A 5C9WA 3TYZA 2VC6A 4L5ZA 1F3EA 5AHIA 1C91A 4NAFB 4HZ6A 3STCA 3B3DA 4JFWA 1YYAA 4XD6A 1QPRA 2XH4A 5FF3A 1I1XA 2F84A 4DWSD 3V18A 2J6XA 4W89A 1QVBA 1JUEA 4HMDA 1XGEA 5HR6A 3EDFA 5JMUA 1C8YA 2BY2A 4PYSA 4JIPA 5B7YA 4HPXA 1OZMA 5KSWA 4ZXOA 4Z2GA 1W3NA 4XQ6A 4TVCA 1WCGA 1YX1A 3A21A 3O7UA 1QATA 3F7JA 4JN8A 1E6ZA 3VIOA 2IPWA 3UGRA 1EEPA 2FVLA 2CLEA 1TX2A 2WKGA 1XBZA 2WMKA 4IP4A 4MYXA 7XIMA 3LCIA 4JQAA 1KR1A 2GPTA 2ZA2A 3WK2A 4ILSA 1VP5A 4EE9A 1QNPA 2XWEA 1O12A 2FHCA 3N1AA 4LNYA 5IXEA 5E70A 1S46A 3M0ZA 3CUJA 3DXIA 1A5UA 3SW6A 4A35A 5CH9A 4NRSA 4QP0A 2XG9A 4NNBA 4P8XA 4ICCX 4FNTA 2TRSA 3CH0A 3KHDA 1LDCA 4NJJA 4QJ4B 2QHAA 3SUWA 2WYSA 1LYXA 1CXHA 4G2DA 1EQCA 4AZCB 4FHAA 2VI0A 3OZYA 3LLFA 1KW1A 4OECA 1HKJA 1XLJA 3ITYA 4KCVA 3S47A 2XTKA 3S4TA 4GMEA 1LLWA 2HISA 4CEXC 5HWMA 2V0TA 1YW1A 4S3GA 1ZAIA 1K4GA 4LV9A 2PDXA 1XLKA 4KCUA 4DZIA 1JF6A 2G4JA 5DFAA 2BSLA 1F61A 5K2ZA 1SM9A 3E5BA 3DEQA 2Y4SA 2XGBA 3IGUA 1GONA 4KEUA 3CHEA 2J78A 4U2ZA 1QNOA 4UTMA 2GZXA 3G6MA 1RQEA 1C8XA 3F03K 5G4HC 3UP8A 3UNTA 4LVBA 4HNNA 4EVZA 2VR2A 4M1BA 1XKJA 2D0HA 3VGGA 3N73A 3LS9A 5DXXA 4K8GA 3C2VA 4CQAA 4N4PA 4LYQA 2QCDA 2QEZA 2J7DA 1TV8A 1WXYA 2FZMA 2WCSA 3GH7A 4UQDA 3RU8X 2O0TA 2ALDA 1V0MA 4ERAA 3E96A 5CPNA 1WDWA 4GD0A 4MHBA 3PPHA 4ACZA 4PR4A 2PBGA 4LOCA 3RCMA 4QLKA 1E15A 4NYYA 3TSMA 1TPWA 5EBUA 1CXEA 2WKLA 1KCXA 3OVQA 1KRBC 3RX3A 2NT0A 2BV9A 1B0IA 3TTQA 3QR3A 1FP9A 3CM4A 4J2PA 1XD1A 4DVOA 4IMCA 1J5SA 1VQTA 4WJEA 2GGJA 3NQ8A 1J0ZA 1AQ0A 1E6RA 3MS8A 1H2JA 3UY7A 3GC2A 2ZRZA 4YJ5A 2O9PA 5CZTA 2RHGA 2DDXA 2R1KA 1ISZA 4JQ1A 2WZHA 1P0NA 3W07A 3P80A 1FDJA 4Z2LA 1PV8A 1SMAA 3NURA 4HOZA 2YCKX 1W31A 4HHMA 4JTQA 2VYOA 3TOYA 1HN1A 2DT2A 4F2BA 2YBVA 4I90A 4GX8A 3CPRA 3EB4A 2PDCA 2HJPA 2CXEA 1YMYA 1M68A 4E6MA 2YCLB 4MFEA 4J7RA 3SRFA 3UBPC 4K7VA 1FCBA 1K03A 2E25A 4W5ZA 3EGJA 2ZYFA 1XFBA 3VFLA 4PL1A 5JH2A 3DIPA 3EWYA 1DPMA 5DX7A 1RAKA 3WLRA 4QEHA 4MY9A 4JNYA 3TKFA 4S3CA 1YNPA 2VXNA 5E09A 5FF7A 2DT3A 1UASA 4LYKA 3P6LA 4BF7A 3CO4A 3ANYA 4QJ1A 3FW6A 2GDVA 3QBUA 4XZWA 2JEQA 1M3UA 3N29A 3RPMA 4GCAA 5E5CA 4GOAA 3R2GA 4DM2A 1UD6A 3AWOA 2AMGA 2X05A 2Z2BA 3UERA 2WM0A 1CIUA 1TUXA 3U5YA 4ZB5A 1SO5A 3SCSA 5D30A 1UUOA 3NDYA 1XLHA 3L4WA 5AFDA 1QAPA 1E6NA 4PB4A 1FDYA 2EPNA 2QUUA 4IWWA 5I0DA 3G1RA 1LT8A 3L4UA 3BG9A 4IP5A 3SN0A 2DUXA 3RLUA 1IXNA 1Z69A 2PCEA 1TR9A 1P7TB 2HS8A 2GJNA 3BJFA 3DHUA 3SJ3A 2YCLA 4N6FA 1FWDC 4B5VA 1XC4A 3I3BA 1YKWA 3MW7A 1HL2A 4KESA 4F9JA 1LROA 1GKQA 2E8YA 4YIWA 3W2KA 1W2PA 3GYCA 3OGRA 4CQ9A 3W1NA 2LLEA 2G4FA 3HG2A 2GGEA 4J40A 3B8IA 3QVQA 3DOPA 4D6CA 3DH7A 4NI3A 1I0BA 3ISIX 1J6PA 4H9XA 2CXGA 3UR5A 1E0TA 1FWAC 3GVWA 1WOAA 3DYPA 4AYGA 3M6DA 2BOEX 3ABZA 4DUOA 1BGGA 2Z7GA 5ECUA 1DWGM 4EAMA 1J0KA 4AQLA 4R9XA 4DWSA 3CAQA 3OU8A 4A05A 3W86A 4IZGA 4G9PA 3A4JA 3DFSA 3MSYA 4YCOA 2WVTA 2VUYA 5BWAA 1M6JA 2AAAA 4PUUA 1W56A 3TQKA 2D2HA 1X6LA 3AXKA 3AZTA 3N12A 1HFBA 2Q02A 3FEQA 4FI4A 3LUTA 3D5HA 4MWAE 3MKVA 3M47A 1KLZA 4C6IA 5C5YA 2FDSA 1VPYA 3L0NA 1QHOA 4QSFA 2FYMA 3SGUA 1W5NA 2VEPA 4OE7A 2J27A 1VFFA 2C6QA 1V6UA 1GQNA 1TPDA 2OQYA 3UGVA 4IUGA 4OBTA 2J8FA 3D3FA 1RV8A 4UOJA 1XBYA 3S2MA 3VGBA 4HYWA 5A6JA 2RH9A 3GU9A 3RK8A 4J2MA 4PMQA 4XAPA 4D1IA 1NWSA 1VKFA 4YVVA 5HR7A 3L66A 2HS6A 2YB1A 3RO8A 3PFMA 4KERA 3WH7A 3M0VA 1Z41A 3NQ7A 5CSUA 3VD5A 1GVIA 1WZKA 5HUOA 1UWRA 4AY7A 3GX9A 4A8LA 2OX1A 3P5ZA 1IV8A 1EC7A 1H4PA 3SCVA 2CWNA 2A3BA 3FV9A 3SFKA 3UCCA 5M1TA 3AJ7A 2QVHA 3T08A 4N6EA 1QNSA 3KVMA 3S6DA 3KCLA 4JEJA 3KWSA 1MEWA 2V68A 5AYZA 4FR1A 3VUSA 4J3UA 4P2VA 3QKZA 1XIHA 2GGHA 3LCGA 1A5OC 4FMVA 3MSDA 1VJSA 2B4GA 3GC5A 1JCLA 3OIXA 1EUNA 1TVLA 3APTA 1DQWA 3C2RA 1UD8A 1PDYA 4RV8A 3FGCB 3R0KA 1D3HA 3TX9A 3UD6A 2ZZ1A 1R0MA 2WQDA 4L56A 3PZ9A 1CTNA 1XPYA 3F5JA 5DY3A 3W82A 4J35A 3HPXA 2BS9A 1G6CA 2A3LA 2HXTA 3OLIA 4IQJA 4NT0A 4B90A 2BXVA 1JPKA 3W84A 3KBSA 2QT3A 5DMMA 2QCGA 4J3VA 5I3JA 2QCNA 2WVUA 4Z1YA 1A5KC 3VAVA 1T96A 2QDGA 4FF5A 4FNUA 4S3EA 2BGQA 3PB0A 4EXAA 1RP9A 4DXKA 3VGHA 5C7HA 1Q7QA 2H8XA 3SY5A 1DJHA 2VQTA 1NF7A 3RM9A 4Q7BA 5CQ1A 1KTBA 1H11A 1GNXA 5D9MA 1ONRA 1CGWA 4Q8VA 4E5TA 1PBGA 3VNZA 1TKKA 4XKMA 1BXNA 1Q4WA 1QPOA 1EJXC 4AC1X 5U7SA 5H8MA 3DI0A 1CLXA 4P61A 3CIXA 3QZEA 1K9EA 1XLMA 3LN3A 3CUIA 2Z00A 4JBRA 4M19A 2QUVA 3PZNA 1MXSA 3AC0A 3BQ5A 2P0OA 1EFZA 2XN2A 4I7UA 3MBFA 4KGJA 1WDPA 1ML1A 4O10A 5DT5A 5FJPA 3MV01 1L0PA 4NZ1A 5EYWA 3LY0A 2XZ9A 3UZWA 2E7FA 2QIIA 3TJIA 5CGQA 1B3ZA 1HG3A 3O6YX 3SCUA 4Q4MA 3TE9A 4QE4A 3HFYA 1K3UA 3ES8A 4CGTA 1TWWA 2E77A 2AKMA 2YW4A 4LRTA 4MGGA 4C6DA 3EEZA 5IBXA 5LA2A 1XLDA 1QJWA 5GJPA 4E0CA 5EMUA 3AHYA 4C6EA 2JF7A 2POZA 1CWYA 3GAYA 1H0IA 4GYFA 2VL4A 5GJMA 3Q45A 2Z1WA 3PZUA 4PULA 4GFSA 1F3WA 4X0NA 1T6MA 1XH0A 2Y5JA 2AMXA 1V3KA 2XSBA 4GC4A 5I3FA 1TPUA 1TMLA 1G94A 3H2AA 3V3WA 4HCLA 1GVRA 1UKSA 5F7UA 1ZJAA 4P7QA 2G3MA 2QAFA 3UW6A 5HJLA 1Q3NA 3VIMA 3IARA 4DBSA 1FWJC 3TYAA 2DORA 1P48A 3H54A 3QYSA 3CUHA 4BI7A 4MSSA 3UXLA 2OYMA 2RKXA 3PBMA 2JF6A 3W7GA 5RUBA 1W9PA 3RX2A 1T7LA 3RM8A 5DBTA 4C6JA 1ZJHA 1QR7A 1WV2A 2WSQA 1EJUC 3MJYA 4EXQA 1GG1A 3NPXA 3B9OA 4QE1A 4JTSA 3VILA 3H2EA 3EA3A 4GVFA 3OVGA 4HPJA 3G0SA 4GQ0A 4EWJA 5M2FX 1FCVA 4UFIA 1Y5VA 3E0LA 3AMCA 2G0WA 2JKPA 2PDNA 4R7WA 4WVXA 1WB0A 3CB3A 1IIGA 2ZX6A 4BWLC 1W1TA 2E68A 1B31A 1ZP3A 3BGJA 3KL0A 1V5XA 4ZQRA 2G97A 1V02A 3H7VA 4ORMA 3AXIA 2FTPA 4MJ4A 1GUVA 2PU0A 3Q67A 5BNKA 5K9XA 2H3DA 4NY2A 2OEKA 4A3UA 3SIZA 3LRKA 1F7BA 3GDKA 3TN6A 3GG0A 3P0XA 2ZUWA 3H2MA 3QZAA 4IFKA 3S5ZA 1EOKA 2UV8G 4XBJA 3H2CA 3UWZA 4N9DA 4H9ZA 4OKDA 2VT0A 4B3KA 3DUGA 4PCTA 2FZBA 3LA4A 4X60A 7TIMA 2VX6A 1C90A 2OJPA 3AHXA 4ZQCA 2XSXA 5E0FA 4QRNA 3PG9A 4KT2A 3TCEA 5EFFA 1MRQA 3MSRA 5CG0A 3S1XA 3T9PA 4L9YA 1X1ZA 2DSVA 4JYEA 1W1VA 3ITCA 2I9UA 1V6TA 2C1IA 1K8ZA 4KW2A 4M0XA 3ABXA 5AZ1A 2YBTA 3EA1A 4TMCA 5HA7A 4DJDD 4BI5A 1M7JA 1V7AA 1QMLA 4PEEA 5EGRA 3S46A 4AVFA 1OM0A 3MMWA 4HTBA 1ITXA 5I3IA 2QCFA 4Q32A 3I65A 2PD5A 2A7NA 1EX1A 1UD4A 3U2EA 1VYRA 1NARA 1PVNA 4FNRA 2PBOA 3M0HA 3PUDA 3L4ZA 3ORWA 1CXLA 1EGZA 4ZE4A 2PDIA 4GQBA 3S83A 1GVOA 2Q3OA 3N19B 1CEOA 3LHWA 3HGRA 3FA5A 4NILA 3TDFA 3MO4A 1UCWA 3EXTA 5DCBA 3KOYA 4LCSA 3O0FA 1R9YA 3TROA 4CUCA 5A6SA 3T6CA 1IXOA 2BTMA 3IUHA 2VFDA 4X61A 4UMAA 5A8NA 3A13A 1GEQA 5CC5A 2FKPA 4O0ZA 1ME9A 1K9FA 5HNTA 1GVQA 3I6RA 2WLYA 3WK0A 3GU2A 1S5WA 4PMYA 1J18A 3SR7A 1I75A 3E2RA 2KX9A 1YXYA 1K7EA 3BOFA 2YL8A 2X16A 2B7PA 4YXGA 4WJXA 2X1TA 3EMQA 2XJ7A 3AI0A 1EWEA 1MI3A 4AW7A 5FF0A 4URIA 3UEQA 2OU4A 4ZL1A 1DWAM 1EYEA 4M51A 3KBNA 5U4NA 1GGOA 4JCMA 5A8MA 2TSYA 3W6MA 5G2IA 5EA9A 3VNJA 1E70M 4QSHA 1U1JA 1YDNA 4XWUA 2GSEA 1R47A 2NW0A 1AVAA 3NWRA 4ZR8A 3T0DA 2C13A 4PMVA 3DFNA 1Q45A 1BHGA 2PDWA 3QPYA 3L2IA 1AL7A 4L4OA 3U2OA 1ALDA 1X96A 5TIMA 2I5GA 3W7CA 1XG4A 3IJ7A 3VZZA 3FSTA