4PGLA

Crystal structure of engineered d-tagatose 3-epimerase pcdte-ils6
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
298
structure length
298
Chain Sequence
MNKVGMFYSYWSTEWMVDFPATAKRIAGLGFDLMEISLSEFHNLSDAKKRELKAVADDLGLTVMCCIGLKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAGLNFCAWPQHPPLDMVDKRPYVDRAIESVRRVIKVAEDYGIIYALEAVNRYEQWLCNDAKEAIAFADAVDSPACKVHLDTFHMNIEENSFRDAILACKGKMGHFHLGEQNRLPPGEGRLPWDEIFGALKEIGYDGTIVIEPFMRTGGSVSRAVCVWRDLSNGATDEEMDERARRSLQFVRDKLALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-tagatose 3-epimerase
publication title Directed Divergent Evolution of a Thermostable D-Tagatose Epimerase towards Improved Activity for Two Hexose Substrates.
pubmed doi rcsb
source organism Pseudomonas cichorii
molecule tags Isomerase
total genus 117
structure length 298
sequence length 298
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.31: D-tagatose 3-epimerase.
pdb deposition date 2014-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4pglA00
5EMKA 2QULA 4GJJA 4A8NA 1XLLA 4G56A 4HHMA 2J6VA 1QTWA 1S5MA 3VYLA 3NGFA 4KW2A 2QUNA 4GQBA 5AVHA 2XIMA 3VNKA 3XIMA 1XIBA 3BZGA 3QC0A 1A0EA 3P6LA 3BWWA 5H1WA 4X61A 4YTTA 1QT1A 1XIJA 3M0XA 3N4AA 5AVNA 3TVAA 5I7GA 3U0HA 2ZVRA 3UVAA 3IUDA 4X60A 4DVOA 3UA3A 6XIAA 1XLHA 5EMLA 7XIMA 4ZB0A 4A8IA 4GJIA 4XIAA 3UU0A 4XKMA 3QXBA 8XIAA 2I57A 2GUBA 4YTRA 2X7WA 1CLKA 9XIMA 4XIMA 3WQOA 1XYBA 1S5NA 2QW5A 1BXBA 5FA5A 1XP3A 4QEHA 2NQ9A 5C9ZA 3BDKA 3KBMA 4HNOA 4QE4A 4QDPA 3AAMA 5H6HA 1O1HA 4Q7IA 3UXIA 4PFHA 3KTCA 1XIEA 3GNXA 5XIMA 2NQHA 4XSLA 1XLIA 3C0QA 4ZB5A 1QUMA 3AYTA 3KBNA 3VNLA 3VNMA 4DUOA 5J8LA 3CQJA 1XINA 1XIFA 2G4JA 1XLDA 3KBVA 5XIAA 4K1GA 3KBSA 3KCJA 3ITLA 2HK1A 4K3ZA 3IUHA 3KWSA 4YTSA 4YTQA 3LMZA 3BANA 3TC3A 3U3HA 3P14A 1XLJA 3CQKA 3KBWA 3KCLA 2XISA 2HK0A 1XIDA 2I56A 3AALA 1XLMA 5XINA 3ITOA 4XSMA 3M0YA 1XYAA 1XLEA 4HGXA 3IUIA 3M0VA 4US6A 4LNCA 3KCOA 4EAYA 1XIMA 1XIIA 3M0HA 1XLKA 4QE1A 3VNJA 3KBJA 4EACA 4YTUA 1DIEA 3QZAA 1I60A 4W4QA 9XIAA 2G0WA 4GLEA 1XISA 3M0MA 1YX1A 3XISA 1XICA 1XIGA 3ITYA 1BXCA 5B80A 2HCVA 1XLCA 5EMMA 1TZ9A 5EMJA 1XYLA 3JU2A 3UA4A 3L23A 1OADA 1XLFA 3VNIA 2GYIA 3ITVA 4XISA 4QE5A 3QYSA 3FVMA 1DE5A 1I6NA 3XINA 8XIMA 4ZBCA 3C0LA 3CQHA 4HHLA 3BZJA 3DBNA 5B7YA 2X7VA 3OBEA 4J4KA 3ITXA 4ZB2A 1DIDA 1DXIA 3DX5A 2NQJA 3C0SA 2GLKA 5TNVA 3AYVA 4PGLA 4A8RA 1XYCA 4A8LA 6XIMA 1DE6A 3ITTA 1D8WA 1GW9A 1XIHA 3M0LA 1A0DA 2XINA 3CQIA 2OU4A 1MNZA 1XLAA 2GVEA 2ZDSA 1XLBA 4OVXA 1A0CA 4QEEA 2QUMA 2Q02A 4E3VA 3CNYA 3CWHA 5B7ZA 4X63A 1XYMA 4QDWA 1K77A 1MUWA 1XLGA
chains in the Genus database with same CATH superfamily
4JHOA 4K8GA 1YDOA 2ONEA 2F61A 2FVKA 4OBSA 5CKSA 1WOBA 5KTLA 4B4HA 3TOPA 1ZAJA 4LYKA 5G5IA 3UWWA 4B5XA 2Z24A 1ZS2A 4PMYA 3TH6A 1BWKA 3WLJA 2XH7A 4QG9A 2W67A 4FPSA 3TK7A 3RYSA 3TFCA 4OQVA 2F38A 1A5LC 4GC3A 2G95A 2YDAA 1L0PA 1LT8A 1KQYA 5LIKX 3CYJA 4GGHA 1A5AA 1WPCA 4GINA 2CWXA 2FLIA 3CH9A 2DT1A 1BVNP 2PU1A 4JTUA 4QG8A 3KBVA 5XIAA 3GTFA 3OIXA 1VC4A 4J3TA 3M6DA 1E1CB 3P0XA 4HA1A 1T7LA 1MEWA 1TIWA 4FX8A 2QCCA 4V27A 3CQKA 3AXHA 3VNYA 4MPKA 1PIGA 3QMSA 2P0IA 1DJZA 6CGTA 4IP7A 3IGUA 5LHFA 2R1MA 3AIQA 1XC4A 4PBFA 1G7VA 3OZYA 4D6DA 2VVNA 2CLIA 1KNWA 1UUQA 3RMEA 1QNPA 2GYIA 3Q94A 4LV4A 3ZJ6A 3SGGA 3ARVA 1TFVA 3W73A 4ICNA 4GC4A 4QP0A 1GKRA 1FDJA 4NJIA 3M0KA 4KFOA 4ZSTA 5FEXA 3G1VA 1K1DA 4DY1A 3ITTA 1IQ8A 5A8MA 4UTUA 1GGOA 3VIOA 4WZHA 1UHVA 1O5KA 1RQHA 4YLWA 1BRLB 2RJHA 2WC4A 4GYFA 4MB3A 3RMJA 3AIEA 3GUWA 4G7EA 2EPLX 4XK2A 1HW6A 5KZEA 3NM3A 5LA2A 4I90A 3T0CA 3BZGA 3WENA 4S23A 3MMTA 1J6OA 3N2OA 1IXQA 2QIIA 1OZQA 1YQ2A 2CIPA 3CUZA 3W02A 1E56A 1TQJA 2BS9A 4YVPA 1CX9A 1EDQA 4HCDA 1FFQA 1GQKA 4CCZA 2Y88A 1US3A 5FJRA 4DXKA 4IUOA 1KM5A 3AHXA 3BG9A 3T1GA 1ISXA 3H53A 1W5OA 3BXWA 1R7OA 1TTQA 4LAKA 4UWMA 1BFNA 4YNGA 3MSRA 3WBEA 1NQ6A 3WBWA 5CPSA 1L8NA 4PUNA 3QR0A 4J3WA 3BMWA 3DYPA 2GJNA 4P2VA 2WKLA 2VJXA 3O06A 4HYRA 3G1FA 1B9BA 1EQPA 5K9CA 3G3DA 1B54A 3V35A 3VKCA 3DHUA 1XLCA 3GDRA 4Y9AA 1QCWA 3L23A 2GQ9A 1S38A 3O2LA 3F7JA 1C3FA 2W0UA 5FI8A 1QOQA 4LCQA 3WQ8A 4O4VA 3NL5A 3S5OA 1MQQA 2EPOA 4D6EA 5JBDA 3C4UA 4LU0A 3JZEA 2W62A 4ZOCA 4IM4A 5B7ZA 4H83A 4MG4A 1ISYA 3K46A 4D8LA 1Q8JA 4LF2A 4JKLA 3MC5A 1AA1B 4KESA 5DANA 4CVUA 4HCHA 2D23A 1RCOB 2XYLA 1TE6A 1IIGA 3CC1A 2REQB 3B04A 2TRSA 3CQ0A 1GOIA 2WNWA 1R6WA 3CK5A 4HU3A 4J7RA 2GVJA 2XVPA 3GIQA 3T07A 4IP4A 4H2CA 3T05A 2BBFA 1HQTA 1JPDX 1NY1A 2Q3OA 4DNMA 3BLDA 1ZENA 4XZWA 3VIIA 1QNRA 2D73A 1H3GA 1UQYA 4GKLA 3AIWA 3K8KA 1O5XA 1ZQ5A 3QQ0A 2IQ0A 1F07A 1ECEA 1GQJA 1F6PA 4Q8TA 2AGKA 3TJIA 3EPNA 3N2CA 4S38A 1U1HA 4AXNA 3A5FA 4LUYA 3NSMA 3OODA 3M6YA 3F4VA 2O7QA 3A47A 4OUEA 2ZA2A 3N4FA 4J27A 4MB4A 2CU0A 3VIJA 4EXBA 3FLUA 2Z7GA 1X38A 1LDCA 1QK2A 5HJXA 1R87A 1BQGA 2W92A 4RKAA 4ACZA 2CWNA 1U30A 2PC8A 5DQPA 4C6OA 4QXIA 2J6VA 2QCHA 1EC7A 4AZGA 4M80A 1H4PA 2YDQA 4YWIA 5F2IA 2YA0A 5LA1A 3N14A 4JHMA 3LU2A 3PZVA 1LOQA 5CGTA 5IFTA 2E09A 2NVAA 4DYEA 2CXEA 2QIWA 1C91A 4ERGA 3UP8A 3OZMA 5CC7A 4M19A 4GZEA 1IT0A 3BJSA 4HZ6A 3TSDA 3M0YA 3KHJA 3SCUA 3MV11 4ZTYA 2W4XA 1ISWA 2OSXA 1JZ7A 2HBVA 1PIFA 2BXZA 1VZWA 3QW4B 3RITA 3C3NA 3W6LA 5H2ZA 1QBBA 3U5YA 2XIQA 4P8XA 3CV2A 3IIXA 1MW0A 5BWAA 1NWRA 4M81A 4L6HA 3W1AA 1TJ1A 4Z1BA 5B7YA 3GNPA 3Q4DA 4CQ8A 1W3TA 3UJRA 3SCOA 2X05A 4X0VA 2ZX7A 1EX1A 1PZ3A 1Q85A 4FOKA 4D6FA 1QPRA 3CWHA 1XRTA 4OKDA 4ZE5A 1EOMA 4AZCA 4KCWA 1FP9A 1XLLA 4RZ4A 3W70A 1QTWA 3WBYA 1EA9C 2HWGA 4QTGA 2G50A 2R6OA 3G1HA 4XVEA 3MMWA 2IPFA 1U2YA 2DJLA 2VWSA 2DFAA 3ECQA 2UWFA 3O6YX 2OQHA 1TCMA 1OFAA 1H5VA 5HAOA 2X30A 4NG3A 4RZ5A 3TQVA 1CECA 1G69A 1L6GA 3GVRA 2ZUSA 2J47A 1ZRQA 4S3JA 4NAEA 1E4LA 1W9XA 1HKIA 1I8JA 2VD8A 1BWVA 3W7EA 4Z2LA 4K38A 2CLFA 3A4JA 3OZPA 5C8BB 1PCWA 2QVNA 1A5UA 3W7HA 4YTUA 2R14A 1E40A 1L9WA 3T55A 3W1LA 1KFLA 3E0WA 2FYMA 3WJXA 1UASA 3FYYA 1H49A 2XFWA 2P88A 2QZRA 4MWAC 1XBVA 4NX5A 2TPSA 2YJQA 5A6KA 4S3DA 1FWHC 4DJDC 4I9AA 2C1HA 1SO5A 3OOQA 2QCDB 4M0XA 4ZOBA 1CXIA 5CEWA 1TJ2A 3M7SA 1NF7A 1XIHA 3PANA 4PMRA 2VTFA 3QOMA 4QR6A 2V69A 3NPVA 1MUWA 4EAMA 3MYOA 2ZX6A 4QLJA 3P84A 2DZWA 4I6VA 3EWWA 4PB3A 5D2VA 3K8MA 2NW0A 4L61A 2V3DA 4IXXA 3W1UA 1TPB1 2F6KA 1B3XA 1H5YA 3B0XA 3P5ZA 5M2FX 1CWYA 4YVXA 2ZOXA 2EQDA 1O1ZA 1DBTA 4C6CA 4Z1AA 3OBKA 2X7WA 4CKQA 4XTDA 5LHEA 2YFOA 4KIRA 3BLKA 3THCA 2PDQA 4CCEA 1J0KA 2AKMA 3VNLA 5BU6A 1XUUA 2A3EA 1PVNA 3QBUA 4W85A 4EP8C 5AC5A 1FHUA 3VUSA 5FF2A 3R43A 3AALA 2WZHA 4LC8A 1PZ1A 4GXWA 1GZ1A 1WXJA 4LCRA 4D72A 2E67A 3S6OA 1POKA 1MRQA 4LNCA 4IZGA 4WD0A 3BLPX 3DG6A 1PB0A 2D0FA 1UMYA 1OYAA 2PP0A 3P61A 5EMYA 3ITVA 4UTJA 3UXAA 1VP5A 2J78A 5BMWA 4JX5A 1LBMA 1DJXA 3NZGA 1S2AA 4L56A 4QLKA 3P82A 3EXRA 3WN6A 5F2GA 4AD4A 3M5ZA 5AYZA 3GNNA 2C1GA 4PMOA 1RJPA 1PO9A 1VBRA 2WVTA 5EMKA 2J62A 4JICA 4HPHA 2WHKA 3EOOA 3MBFA 1S3TC 1DWIM 1EWEA 4BEQA 3NWRA 4QBXA 5J5RA 1YYAA 1G4PA 2A3AA 2ISFA 4D1JA 4ZTXA 2X0YA 1TMQA 2CPUA 2ZFAA 4RPQA 4LX4A 2OO6A 2CYGA 1QW8A 3HPXA 3KBMA 3PVFA 6ALDA 2OGYA 4LS1A 2WHLA 3KDOA 1D8CA 1JF5A 3TFXA 3NO1A 4O16A 2ZC8A 3R6IA 1IEIA 1HN1A 3DFPA 1DPMA 2IPJA 5I07A 4AG0A 1OIFA 4XSMA 1ONXA 4ZXOA 3ZJ7A 1UOZA 2XPKA 3SM0A 1K6AA 4CQAA 1J96A 5J5DA 4NT0A 3UVIA 3KTSA 1ICQA 4A3UA 4MF4A 5ABHA 4ENLA 1KCZA 1TPH1 4US5D 2OKTA 2RGLA 3PB2A 4HNVA 4HZ7A 2ZUTA 2PCEA 2AL2A 2JIWA 3E1F1 5C2GA 5HBFA 5JU6A 4MNMA 2PLJA 2BDQA 1FBAA 1XC6A 2A5HA 3A64A 3PB0A 3U2CA 1JZ6A 4GNJA 3VNKA 4DF0A 5HDRA 2WZMA 1ZBCA 2IUZA 3WJZA 3DN5A 3OVRA 1R5YA 3UJEA 4MLJA 3FJ4A 4X9SA 4F66A 1CGYA 3KLKA 3FGCA 5MF5A 4V1XA 3NJ3A 3SIMA 4B3ZA 3GNXA 3BARA 2PDNA 4JYFA 4W84A 4DZ5A 4JDYA 1TX0A 2CHNA 4UZSA 5HR7A 1J01A 3WMSA 3DERA 1VLIA 4W87A 1XLMA 4IGMA 1OF6A 5JUVA 4R34A 2YCLB 2WZTA 3FA4A 2IKJA 4Z2IA 1X1ZA 2ATMA 3UWEA 3TR2A 3IJIA 1FCUA 1VF8A 3NSXA 1Q6LA 3NUKA 4FNSA 2ZXAA 1G5AA 2A3LA 5CH9A 4ZQCA 5M3WA 1MXDA 3PBWA 5F1UA 4JFWA 2Y1HA 5C5YA 1NOUA 3NG3A 6XIMA 2QCMA 3ZYZA 1MUCA 4DPQA 3TTSA 1E4NA 3H7UA 3F5LA 5I6SA 4R7OA 2AAAA 2BXVA 4QS6A 1TWSA 1WKYA 1JGIA 2JEQA 1QXLA 5REQA 1AW2A 3AIVA 5A8QA 4F0KA 4L9ZA 1MEIA 1DJIA 3B97A 4Q7NA 4QNEA 1E1FA 4A3QA 3FX4A 1TB3A 4IIGA 3OPSA 3BMXA 5LIUX 2GUYA 2A6NA 4IIDA 4JKMA 3H12A 1XBXA 4GVFA 1V0KA 4H6KA 5DELA 1S2WA 3BV4A 3QQ1A 4KGLA 5I3IA 3LD5A 4AXKA 1KCXA 5G1TA 5CQ1A 5AYBA 3KBWA 4L5ZA 3WFZA 2GQ3A 4C6KA 1LUCB 3GW0A 3S4TA 2XH4A 4HMCA 4GUIA 2FFCA 3CS2A 4GMEA 2I1OA 4BA0A 4DBEA 1H7RA 2ALDA 3AWOA 5ABGA 1EP1A 5I3JA 2OYKA 3IK4A 3EWDA 3BURA 5E0CA 1VBUA 3UXDA 3FVMA 1JZ8A 2WJEA 2Q6ZA 3TTQA 2VFIA 3UCDA 4FX7A 1IR2A 4I5XA 5FL1A 4QISA 1V6XA 3ANUA 3OBEA 4M7TA 4OBRA 1V6UA 5C2XA 2GLKA 2OLHA 3WQ6A 4K7YA 4A8LA 1M65A 2VEKA 3FA3A 3VDHA 3OIHA 4KBXA 2QUMA 4Y2WA 1ISZA 5E6ZA 4BHYA 4R7JA 4HA3A 3DGRA 1V08A 1EP2A 5C9WA 2B7PA 4GJJA 3S47A 1J10A 1A80A 1HZYA 4C6IA 1MW2A 1E9IA 3KS5A 2ZZ5A 1RZMA 3BV7A 5FAGA 5A1AA 3GFXA 5H91A 2PWFA 3FDGA 2I7GA 2HVOA 1XLHA 1JPMA 4XQ6A 4GNVA 2OT0A 2EKCA 4C6LA 4RW5A 4JD4A 3LHYA 5GVJA 3IAPA 2VC5A 1LTDA 7REQB 1TPEA 1J0HA 4UFJA 3PWGA 1U5JA 2DSZA 5M5DA 1QHZA 4GQ0A 2GJLA 2BFGA 5I3KA 4CQCA 4PRTA 3DHPA 3SI9A 2D0GA 3OA5A 3FSTA 5F4SA 4Q7BA 3ZVHA 4HYVA 1O4UA 3FK4A 1ZLPA 3PPHA 5CBJA 4JDBA 1I1XA 2Q8XA 1GPFA 3IJ6A 3G1XA 2GZXA 1AW5A 2PI6A 3XINA 3A3XA 3UWYA 4MMWA 3S2NA 1HKVA 4AD5A 4LRSA 1QFEA 3DZ1A 3V3WA 2WSPA 2O9RA 1WCGA 2V5BA 3VX0A 4PCFA 4JNYA 3KOXA 2C3ZA 5EB8A 3W1RA 4QS5A 5JH1A 3DFQA 4JIPA 4B9YA 4X22A 5ENLA 1BF2A 4PE8A 1A50A 3SBFA 1L6SA 2O55A 2E1DA 3ZR6A 4E2BA 3AIBA 3GYEA 1OB0A 1BEUA 1OABA 1XH1A 3KFTA 3IJ7A 1BKHA 1PCKA 2H6RA 3MVIA 4XAYA 1PXGA 4NJJA 5H6HA 3B06A 1JZ2A 1BYDA 5FEWA 4Q6XA 5CZ0A 4J5NA 2QUTA 3NGJA 1OFBA 1LL4A 1XBZA 4UBPC 3WLSA 4PMDA 4GISA 3MZNA 1OYBA 2YW3A 4FNPA 4O15A 2ZZ2A 4QHRA 1KLYA 3STGA 4LNYA 1CI1A 4JN7A 4B5NA 4J40A 1EWDA 2OYMA 4KCUA 3R8HA 3ZM8A 4WEVX 1XDLA 2FZDA 1O94A 4KIEA 3P8IA 1A5CA 2VELA 1J12A 1JRBA 3QY7A 2CCRA 4GOAA 2Y8VA 5GJPA 2CLPA 3SW6A 4YVVA 1VBGA 2ACQA 3PUOA 1U33A 2WBKA 1IWBA 3AMDA 4JZ5A 4O53A 5HJYA 4B16A 2CLLA 2X8RA 2YCKX 1HXJA 1WZLA 2MNRA 4J2PA 2P8CA 3EWCA 1XPGA 3UY7A 1C29A 1GEHA 4FAMA 1B30A 2ZE0A 3GXFA 4ERIA 3WH5A 4WKFA 1FX6A 1SSDA 3OG3A 5HNNA 1MZHA 1VFMA 1GYLA 5F2MA 1VCFA 4LWWA 2HZGA 3IK2A 3GS6A 3HZ3A 4HHPA 3WG6A 3VGDA 5HUPA 3WEZA 4HTBA 3P2VA 1TJRA 3V0UA 1RLCL 3D0CA 3H2FA 5D38A 4HSHA 2Q71A 1JI2A 4C5YA 4JY9A 5CLTA 1IWPA 1SW7A 3VNMA 3O16A 4JL1A 1M7PA 5E70A 1LLWA 4MSSA 4YYFA 1F76A 2J7EA 1JNDA 3N17A 3QHOA 3AISA 4AHOA 1FY6A 1BG9A 3LRLA 4NZ3A 3WL1A 4G7EB 2HBXA 3KCOA 4YMZA 1UPPA 3NFUA 3VOFA 1DIEA 4W8LA 6PTDA 1R3WA 3W0KA 3U2EA 1CXKA 3M0ZA 2BX7A 3AROA 1MFVA 4UFIA 1ZFJA 1UH3A 3GX9A 1RD5A 2NV9A 1U1JA 8XIMA 4DYKA 3SZ8A 2G37A 4AY8A 3VTRA 2FKPA 4MTVA 1ZZMA 3UR2A 4BY3A 3ENLA 1FH9A 4P7OA 2OEKA 2V5CA 4LSBA 4GVHA 3ELFA 3WYZA 1LG2A 3W83A 2VDHA 3VIGA 1W6TA 3R58A 3AHTA 4CN4A 1B3YA 3MUXA 3W2UA 1JZ3A 3BPWA 4OGZA 1JDDA 2NQZA 1TV7A 4U3AA 3UERA 7XIMA 3L4ZA 3UU0A 4FI4A 3RDKA 7ODCA 1WDPA 2Y6ZA 2PD5A 2ZX5A 9XIMA 2GJPA 2HE8A 3BQ6A 3SCSA 3DC0A 5E9XA 1ITCA 1T96A 4S3GA 2H8XA 1UZDA 1DJWA 2Q09A 3UYIA 3KBNA 4FIQA 2FGBA 4YS1A 3H4GA 1RH9A 1R3RA 3KHDA 3SN0A 3MT1A 2AQWA 4AIBA 3T8LA 3GZ3A 1G7UA 2YXOA 1JQXA 5LNWA 2R1KA 2W91A 1BTMA 3O6CA 1R38A 1LWHA 3B4YA 2POTA 1UP3A 3HPSA 4W7WA 4RE2A 1E4IA 1N55A 1YNPA 4H6EA 4OV9A 3BC9A 1F4AA 4IGHA 1EYWA 3PJTA 2E8YA 3A21A 8CGTA 3CMGA 3ABQA 3A22A 4DWDA 2VC6A 4Z0JA 4MGGA 5J04A 4HVXA 1GONA 5PTDA 1IZCA 3T0DA 1JPKA 1ZBVA 3CL6A 3UG3A 5MKGA 2PA6A 1JNEA 2QPUA 1XCFA 4RPPA 4J3VA 1PBGA 3UQNA 1H60A 3HQOA 1EO7A 4DWSA 5ECVA 4P5UA 3EDFA 4AYGA 4C60A 2YOCA 3II1A 4FB7A 4F2UA 3RPMA 1YMYA 3BG5A 1TVNA 5BROA 3WQCA 1M5WA 4IQJA 2G97A 2JIEA 4AUBA 2AMXA 3KOZA 4A8IA 4Q8MA 2VR4A 2H9AA 4Q4RA 1KBLA 2WBGA 3QKZA 1TUXA 3CLMA 4DN1A 4O1BA 1V6VA 3RM4A 3TONA 3HV8A 4H3DA 4V15A 2VCCA 5A6MA 2GSEA 3L68A 1K8XA 3MUCA 2DW6A 4UTMA 4DJEC 1ZJIA 3EOUA 2VDIA 1XXXA 2ZADA 4G5DA 4WCJA 2Y5EA 4IH3A 5CZKA 1QAPA 1RA5A 1PTDA 1EB3A 1VENA 5AECA 2BZNA 4NNCA 1CGVA 2O92A 1VB9A 1AQ0A 5G1YA 2A7RA 4KWOA 4N4PA 3VFCA 3CTLA 2C16A 5H8UA 2ISDA 1E0VA 3NVTA 2R1PA 1XLFA 4DUWA 1QOXA 4AIUA 1EF2A 2OX4A 3OLGA 1TV3A 1XDMA 1OQFA 1UBPC 1FWAC 3L21A 3ONCA 1JCTA 3BAWA 3BK0A 3DBPA 2XINA 3B8UA 5GNZA 3SRFA 4PODA 3A9BA 1UWAA 1B3OA 1KXHA 3C2RA 1QO5A 2DZPA 5EA9A 4PMNA 4MZ8A 4JKKA 5E5CA 4P7QA 1X6UA 3MUY1 4L1WA 2HNEA 3AWNA 3IANA 1R3SA 3UA3A 3CAWA 3EDEA 1A5BA 2BHYA 3CXOA 2AOSA 3QMTA 1SR0A 4IMCA 1TPC1 4XKYA 2VZUA 3MWAA 3S2CA 5CPLA 3D3FA 3FJ6A 3NL6A 3WNNA 5C7VA 4LANA 3MO4A 5T91A 6A3HA 3O6DA 1R2SA 2OR2A 3GYCA 4PUWA 2ZCGA 1K7XA 1XI3A 3NZRA 4GFIA 2PDCA 2QCNA 2XISA 4H9YA 1W5NA 3GU9A 4AZCB 2QAFA 2ZYFA 4NL1A 4JFTA 4YCPA 1LLOA 2QS8A 1BGGA 1WXYA 1M3UA 2EGZA 3OB8A 3GC5A 3H7VA 1BXCA 3CO8A 3LLDA 3CPGA 1GT8A 4GZJA 4O1EA 1MXSA 4LVAA 4K8EA 2DUZA 4XD6A 1ZBWA 1V03A 3S6TA 3LM3A 5I09A 4O0ZA 1E6XM 1LQ2A 3LBCA 4MVAA 2O7SA 4S39A 1P1MA 2P76A 1G01A 5DMMA 3ALGA 4JEJA 4PBGA 3GBEA 1WOAA 1H51A 4R27A 3CZ8A 2QHAA 1V6WA 4CVWA 2DSVA 3G0UA 5HNTA 3POCA 5BRPA 1JXJA 2NV2A 4GYKA 4JQAA 3ES8A 1AZ2A 6XIAA 1UWIA 3LN3A 4S3CA 4FP1A 1W0MA 1TWZA 1V02E 4WF7A 1M9HA 1O5QA 1UWRA 3ONBA 2A7NA 5DN1A 5I00A 1TPUA 4WQ6A 1TSIA 3WD3A 3HPAA 4FF7A 4ML9A 1W17A 2A2IA 1GORA 3NZPA 3SUUA 2UZ9A 3N25A 4U3CA 5LGXA 4EWJA 5BWFA 2IKGA 4CNOA 3MMUA 5I3HA 4MYXA 4RX0A 5K3VA 3QF0A 3C3UA 3LCHA 3WBAA 1CTNA 3LQGA 2ZC1A 1W9BM 1O60A 3EDJA 4O57A 2QAPA 5A8PA 4HMEA 3RLVA 4KCVA 4MJMA 1W56A 3GC2A 4XUGA 1QHOA 3AU2A 1OZMA 3JUGA 1RCQA 2W61A 1T8QA 1QNSA 1KV8A 4OECA 1TELA 2CZFA 2ESCA 4A05A 2GOUA 4A8NA 3EWXA 4HJFA 4U5KA 5AVHA 1F3TA 3COTA 3RX2A 4GYPA 3U2ZA 1BLIA 2IQTA 5ABFA 1EX5A 2V3GA 2ACRA 1K8YA 1HL2A 3GHRA 4DUXA 1VYRA 2H3DA 4ROQA 3N6QA 3MP3A 1F61A 3VXGA 3R25A 1O1HA 3UXIA 4HOXA 1YNYA 3B8SA 3K4DA 1W1YA 4JGDA 1DJHA 1OM0A 3KWSA 1QW7A 3TC3A 4DZIA 2QV5A 2XU2A 1NH6A 4D71A 3HG4A 1DQUA 2NSOA 1PAMA 4UTLA 2ZZ6A 2GGEA 3P5YA 2ZA1A 2QLYA 3W85A 1YEYA 5E09A 3HGOA 1GOOA 3L65A 1OK4A 2PPGA 4GKTA 4U2YA 3LV6A 1DXEA 3EMCA 1Q6GA 2D2GA 3LNPA 3GZAA 4A2SA 3E5BA 2VI0A 4CNPA 4I9JA 4J4KA 3ITXA 4GX9A 1CXFA 5I03A 3NSNA 5CSYA 1XYCA 3M0LA 3V1HA 3RFAA 1SO4A 1W32A 4ZE4A 1W1TA 4BI6A 3RIKA 3QPYA 3VGFA 4O8AA 4F0SA 3TTEA 4LBSA 3N12A 1FQ0A 3M64A 3CHEA 1GJWA 1F3XA 4IL0A 3B8WA 4YTTA 3G77A 1H50A 2OYLA 3PTDA 2WJDA 4IXHA 3GU1A 5CC3A 1CIUA 1A53A 3A12A 2E0PA 3FXGA 3U5UA 3VCRA 3N18A 4UQAA 3N6JA 5HMFA 2BXYA 2PZNA 4I3GA 4OU1A 1QI4A 4RNHA 5FIPA 1TKKA 1A5SA 1W5QA 2AL2B 2G4JA 2XM2A 3I68A 3W1QA 3UGRA 1AD1A 3OHIA 1EXBA 4NJGA 4MUZA 1UW9A 3ISIX 2PUZA 3QVQA 1TV2A 1FWEC 4I5RA 1ZSXA 2V5DA 1QHPA 2PGEA 3GXNA 1A3XA 1UOKA 5D09A 3W3OA 1NP2A 2O9PA 3W88A 3REQA 3U7VA 2WCGA 1GOXA 1HFBA 2ZRYA 1TCDA 1BKSA 2VRKA 3W82A 2X0SA 2DH2A 1YE4A 4H01A 4HMDA 1ZP4A 4GIRA 2XSXA 2VFDA 1JAEA 3G0SA 3W1TA 4JHZA 2V67A 2DZTA 1A3HA 2WWDA 1I2PA 4E8CA 3CNYA 2BSLA 3WQVA 3ZR4A 1HJXA 4D1IA 1XLGA 1V8EA 5HOSA 3TW7A 3QTGA 1LROA 3QGAC 4BFAA 1A5MC 4JYEA 3USBA 1W5PA 3IVTA 2PEVA 3WELA 3BL3A 4XD3A 3F2DA 3T2QA 4JTGA 4C7DA 3BJTA 1JD7A 4LH8A 2JFEX 5FEPA 1UR1A 1KM0A 2QW5A 3DEQA 3ZT5A 4AZBA 1W8GA 1LG1A 3CQJA 4BS0A 3NTYA 2QV4A 3I7RA 1VJIA 1UUMA 3DI0A 2XIOA 2WW5A 5T9BG 1Y5VA 3W07A 4IPJA 4Q8QA 1B1YA 2YBVA 2RDXA 1GPWA 1ZCOA 2DU2A 1YDVA 1WKEA 3TEVA 1RR2A 3LPOA 5JH2A 5K4ZA 3C52A 2VP8A 3JU2A 3NZ1A 3C5QA 4NU7A 4BF9A 3U4AA 2GOKA 4I7WA 5DX7A 3LBMA 4JYDA 4ONVA 4HQVA 4XZMX 5BRQA 2C79A 2HISA 2XTKA 1A0DA 1IT7A 4ZO7A 1EF3A 4XD5A 3TN5A 4NAFB 1HF6A 2A0NA 1F8MA 4GXMA 2XIMA 2VWTA 2D2JA 3U0HA 2DVUA 5AHLA 4GH3A 2BOGX 1KTNA 3S5SA 3LRKA 3W01A 2J8FA 3BG3A 3M9YA 4YJ5A 1AG1O 1QNOA 3K4AA 1ADSA 3IJLA 1I2NA 4CQ9A 4PMJA 2LLEA 4H8VA 4Y9OA 4XO6A 3Q2DA 2PBOA 3K13A 4PRRA 3CO4A 5AC4A 1HP4A 4S2CA 4K1WA 2PGWA 3W87A 4C5ZA 1ZP3A 2DORA 3TYEA 5LXEA 1J2BA 4C7GA 1JCLA 2X1SA 1MUMA 4M6VA 2FZNA 4P7RA 2DQXA 3CUXA 3L4VA 3ARSA 3A4XA 4BQ4A 3RNDA 3SN1A 3VNIA 1J5TA 4GQGA 3KRBA 5CPOA 3F1QA 4BWLC 2V2CA 5FJOA 5EKYA 3SR7A 4AD3A 3O05A 3M5XA 4Q4QA 4UNIA 3HFTA 1EZ2A 3CQIA 3CL7A 4Z42C 4Q33A 2CLMA 2V6AA 3AJXA 1FWIC 3ZR5A 5JXQA 4Z1CA 3W2MA 2WKGA 4WOZA 4PL2A 1J9YA 3Q58A 2Z6JA 4IGSA 4N2YA 2D20A 4KWVA 3IIZA 4N9DA 3O15A 4RNIA 4JN6A 1W31A 3NQCA 1MEHA 2V3FA 1BXBA 1XP3A 4I9MA 3DC8A 2FTYA 3UR7A 2WNNA 3MBDA 1E3ZA 4DELA 2VHLA 4QIUA 3G1RA 4RV3A 2ANUA 1FWRA 4WY0A 3VCCA 1QRQA 2UY5A 1E5NA 1TPFA 4QSHA 4K3ZA 5KSWA 4IUGA 3DH7A 2Z27A 3VD5A 4GBDA 4UFKA 3NQMA 1VGAA 4Z08A 3VU2A 3UPWA 2XUCA 5LNRA 5DCEA 1AJZA 2PTZA 3DYOA 2ZXQA 4C6PA 2ZA3A 4S3BA 5DT5A 3SFKA 2XWEA 4TR9A 3WF1A 4NZFA 1R7AA 2PMQA 4LTSA 3NPWA 3N13A 5AYXA 1UD2A 3W1MA 5DXYA 7TIMA 5HQLA 1R86A 5TNVA 3ARWA 3PS7A 2BB0A 3S5YA 3GG0A 1I2OA 4MIMA 1EJUC 1WAWA 4QDWA 1DWFM 1KBJA 1TV5A 2XGZA 3APYA 3Q67A 4NI3A 1BQCA 1LYXA 4N9BA 1SUXA 3ARQA 4IPLA 2CLKA 4X2PA 3UVAA 2YGYA 2ZZ1A 4Q3MA 1RK6A 2O9OA 3QM3A 2FZ8A 1RVGA 4LF1A 1OG6A 5CAHA 3RO6A 3CLWA 3LHVA 3B0VC 4B5VA 3LTSA 5FF0A 3NL2A 3MZ2A 4O18A 3TC7A 5G1MA 2DZXA 2PTYA 2ZQ0A 5E0FA 1CXHA 1WUFA 2PDHA 3JW7A 1BYAA 5CGMA 2ACUA 1WAUA 3URQA 5AFDA 4V2XA 3STPA 4AEFA 4MY8A 4DZHA 1E0TA 1NTHA 1TMLA 3RF9A 3WLOA 4DAFA 2E6AA 4UTWA 3A23A 2YBTA 1AMYA 3PAJA 4J3ZA 5HK4A 3LCXA 4HTYA 1ALDA 2NX1A 3QH2A 1PS9A 3AYRA 1LJYA 1KCLA 1UZHA 2QEZA 4D8AA 1E6RA 3W7QA 4BJHA 1DORA 3TTOA 1Q2RA 4IIHA 4PCSA 3UCQA 4MNJA 1VFFA 2QCLA 1MW1A 2B7OA 3PF3A 4QNWA 1ADDA 1HJQA 1UC5A 4ZFCA 1S2UA 2XHYA 2W63A 4HIBA 3ZLHA 1DIKA 4ICMA 4PSPA 3HJEA 1F73A 1KM6A 3LENA 4URIA 1ZGDA 3QV7A 1TE1A 1OD0A 1I75A 4ICCX 2YCEA 4KEUA 4YWSA 3BAIA 4GIYA 2XH2A 2FTWA 2J75A 4MOZA 4US5A 1THFD 2OZTA 3QOKA 1NFBA 4ZENA 1NU5A 2ICSA 3NXFA 3AXKA 1XF0A 3URAA 4HPNA 3TN4A 3SQSA 4UIOA 4TV6A 3TA6A 1Q45A 1RPKA 3WCZA 3KRSA 4X2RA 3W7KA 1WDSA 4XZNX 2TYSA 2QGHA 3D6NA 1KFCA 3GVGA 2C18A 2UY3A 1US2A 3POHA 4Q8UA 3BLLA 4C65A 4IFKA 1R47A 4UTFA 2CHRA 1F2JA 2FDMA 4MM1A 3S1XA 3ZLGA 5DXXA 2NWRA 1PUDA 3GDKA 3CT7A 3A9IA 3V75A 1DTUA 3E12A 3F4WA 4FLOA 4AY1A 1X1NA 2OKOA 3CV1A 2XH0A 2YL5A 1OFDA 3AO0A 1ISVA 3W29A 3EOLA 4WIWA 6REQB 4WY0F 3H2EA 3WLIA 1D8WA 2P53A 4NXSA 4E3VA 2PURA 2TAAA 3G8EA 4ZFMA 1RP8A 2BWGA 2FJKA 3HG5A 3R1ZA 2CKRA 4MFEA 3W53A 3PNZA 4BF7A 3IIOA 4OOUA 3EEGA 3G1SA 3M0XA 3UWVA 2CW6A 2PU0A 5LNVA 2OQLA 1KBBA 1O5RA 1TJPA 1FWWA 2EXOA 3S3GA 4AZIA 4XIAA 3E2SA 4GJ1A 2OB3A 4L9XA 3LG3A 3K30A 3WH8A 1X98A 1GOQA 2ZVIA 3PN8A 1QJWA 4GX8A 4IMGA 4PL1A 1NWSA 3W2JA 1XGDA 2O56A 2ZXDA 4KWSA 3S0CA 5MKGB 3AFBA 5I3DA 1JZ5A 1E0XA 2FHFA 3TKFA 1D3GA 2XZ7A 5FSEC 1EQCA 3B05A 3WD2A 5I5RA 1IEQA 4IF2A 4HU8A 4LB3A 4KRZA 3NA8A 4C6NA 1P0NA 4CEUC 2F8QA 1GJPA 3UESA 2RKXA 4CLMA 3KW3A 4PUUA 3NOEA 2WNQA 1P5BA 3HF3A 3RCMA 4JTSA 1UH2A 4A22A 2RH9A 2H9AB 3CAKA 4H9MA 4E5TA 1I6NA 3MANA 5EFDA 1M53A 2P3EA 3C0LA 4LBUA 3NPUA 3P67A 1ZUAX 4BI5A 5CC5A 5C9RA 3N29A 1GQLA 4JIQA 1Z8AA 1QBAA 1SJCA 1GW9A 1W3KA 1FWDC 4IQEA 2HPIA 1K8CA 1XHGA 4CU6A 3L2IA 2DP3A 3W74A 1FKWA 4FX6M 4GYJA 4WX2A 3EPOA 1SJDA 1EDTA 3FV9A 3XIMA 3ZT7A 3CMFA 1A4MA 3WK1A 3LUTA 1XIJA 2F2HA 3AUOA 4ZQOA 1N7KA 5D30A 1D3CA 4GI8A 4N02A 4DWSD 1ZTVA 3MU7A 3PWAA 3T08A 3LDVA 2H90A 2O4QA 2Q01A 4FR1A 1BHGA 3BLOA 1CXEA 2UBPC 1V02A 2W3ZA 4O10A 1WDQA 2PRLA 3VKJA 1L6FA 2POZA 1B4KA 3CUHA 3F03K 1UP2A 1P7TA 1XIMA 3MP5A 3KBJA 2YA2A 4C1KA 3TCEA 1K70A 2C0AA 1WDDA 2PODA 3DFTA 5A8OA 9RUBA 5M17A 3LLFA 1Z89A 3GM8A 1S5WA 1TZZA 3AXIA 5GJNA 3W1PA 1VJZA 2ZZ7A 2E8ZA 3T2OA 1DIDA 4DM2A 4IWWA 3UZXA 1GWJA 1J0JA 4I7UA 1D9EA 1DJNA 1LL6A 1SGJA 2EG8A 4LUSA 3GC4A 1LBLA 1OVDA 1OGBA 1LRQA 3I10A 3L4TA 4AF0A 1Z9AA 4LUJA 3V5CA 2Z28A 1CZ1A 1Z69A 2OZ3A 2QF7A 2P10A 1R3TA 2PWDA 5CZJA 4AX7A 4KGJA 1A47A 2D2OA 4ZL1A 2ZRXA 4L4MA 1WB0A 4DYJA 2QJNA 3FKKA 4L4PA 1Q4NX 3TZFA 3UD6A 3PSVA 1O7AA 4MFDA 4WDUA 3NZQA 3R79A 5I23A 4PCTA 3MHGA 4S3FA 1HL9A 5DBUA 3T6CA 2V8ZA 3RAOA 4Q6JA 1H41A 3H21A 2VR2A 3OTRA 3IRDA 1EO5A 3NVDA 3S1WA 3WX7A 7CGTA 3E0FA 1FHVA 5AC8A 4NNBA 3DFYA 4FOJA 4DBSA 1XR2A 3DHFA 1TV8A 1WX0A 2NV1A 4LCSA 2PP3A 4GIEA 1SYTA 4QJ1A 3CH0A 4FXFA 1FCVA 1E1EA 3VKKA 3CUJA 2Y63A 5A6BA 1PZ2A 4UQBA 4G9PA 3IV8A 5D33A 3P3BA 2BHUA 4XISA 1XG4A 2WCSA 2CZ5A 4XAFA 2NVDA 1UZ4A 1XCXA 3ABOA 1FWFC 3SGUA 1ME9A 1WYIA 4O52A 3QFWA 1OCNA 1V7AA 2YA1A 1NP0A 1A0CA 1AH3A 3W4RA 3SJ3A 3KZPA 2PLKA 1JCNA 1TREA 3TAKA 2VCBA 3QRHA 4H9TA 3KRUA 1TUFA 2X40A 4XBJA 3URNA 3GFZA 3BH4A 4GQBA 3SAZA 5CCZA 1UG6A 4IX2A 2AGTA 2QCEA 3C2EA 1EIBA 4GUFA 3H2MA 2YL9A 5A6AA 5FEZA 2WZEA 4JBRA 1XUZA 4GBUA 5T26A 3QSRA 3BDKA 2WK2A 4QCEA 2B0MA 3FAWA 2XZ9A 3F2BA 3CMJA 4DJEA 4BI7A 4Y90A 2DIEA 2RDUA 2R1LA 5LIWX 2GK1A 4LVFA 4RV8A 4PFMA 1B4EA 4MZYA 4H00A 3ITOA 4YHGA 1W2VA 1PKYA 2XJ7A 1HKJA 2D22A 4S3KA 3KVMA 3C8NA 4LV9A 2X0HA 1KV5A 3XISA 5ABFB 5B80A 4N0RA 1Z7AA 3PZNA 3TSBA 1IE7C 1I0DA 4GUGA 1WQ5A 3NYZA 1KRAC 1DV7A 4IGNA 4QQUA 3T9PA 1LBFA 1FWSA 2OODA 1WZMA 1F6YA 1IEVA 1Q6EA 5EBAA 1JF6A 3VFLA 4U10A 3RU6A 2V0TA 5D4YA 2JALA 5D04C 1E71M 1XYMA 4RE0A 1Q13A 1XPYA 1MDRA 3TC6A 5H8MA 1DQXA 4R33A 1H1ZA 4OV4A 4MJ2A 5K4XA 3PJXA 4HPJA 1I1WA 1KXQA 3TR9A 3AYSA 3M7WA 3AS3A 3GNRA 2PWHA 2O9TA 2ZRWA 4GQQA 5JBFA 4BQ2A 3QR1A 1NM9A 3BSGA 3LTPA 1ICSA 1DHKA 4AIEA 3FY1A 2V81A 4E4FA 4QX4A 5D03A 1CDGA 1ADOA 2EHHA 5I06A 4ADSA 3FVDA 5XINA 5EBUA 4D8ZA 2EG7A 3M41A 3AQUA 3MKKA 3KVLA 5IBXA 2CKSA 2BY0A 1XLKA 2YBUA 1V93A 1UIPA 2YX0A 1VBJA 3STCA 4UR9A 3VOHA 1B2YA 2HTMA 4L65A 5DLCA 4HN4A 2VX7A 4PCPA 1R3YA 1EJRC 4V33A 1L6WA 4Y8EA 1I9CB 4O4WA 1DXIA 4K7VA 3EX6A 2WAGA 3VABA 1JFHA 1M68A 1R3QA 2OQYA 1Q4WA 3WD4A 3CGTA 1RQEA 2Y0FA 4DPPA 3BOLA 1GVYA 1OYCA 4NQ1A 2X1TA 1W9DM 4GE8A 5CBBA 1MW3A 1Q6CA 2WB5A 3OO2A 4XX6A 2P1FA 1DJQA 2QF8A 3UT0A 2I5IA 3RPTA 3DYMA 4K37A 4S1FA 5I7GA 3REQB 3SN4A 3UW6A 4U2ZA 3W75A 4ZVJA 2HXTA 2G3FA 3OVGA 3B0PA 3FFSA 2NLYA 1UZ1A 1P0DA 3LB0A 3WMLA 3AAMA 4Q32A 4OIFA 1KXTA 1XIEA 1ME8A 4ZEPA 1EJSC 1R3VA 2PDBA 3LXBA 2Y7FA 3WLPA 2H3BA 2BY1A 1RD6A 3RR4A 4A21A 3ZWTA 3D47A 3VOGA 1KM4A 1TPWA 1CLXA 1P1XA 4NHVA 4AD1A 4EE9A 4DO4A 4REQA 5DCDA 3BW3A 1T5AA 2VOTA 5AHIA 5GNXA 1YTDA 1G4TA 4W88A 4DHGA 3A3WA 2YPIA 4I8YA 4H04A 1TWWA 3QTPA 1GOKA 1AJ0A 1KRBC 2QJGA 4POCA 2Z1XA 1TWDA 1VHCA 3L0NA 2A3HA 2REQA 5C2CA 4GO9A 6TAAA 3UJ2A 3ES7A 1VHNA 3W7IA 4MWAD 4CD6A 1T8XA 3CPRA 3W28A 4DQWA 3WK3A 4HNLA 2JGYA 3OBAA 1KW1A 4IPNB 1OEPA 3FJLA 3HPFA 2AQOA 2ZUWA 4F2TA 3FYOA 4E3TA 1C90A 5LGZA 1VPYA 2X41A 2OTDA 1O12A 3B9DA 1JL8A 3LPGA 4LUTB 4HNTA 4C7FA 4PZVA 2P50A 2V30A 3LSBA 4EF8A 1GG0A 4GCAA 2E28A 5GNYA 1OCBA 1PV8A 3E0VA 3GG8A 5LIXX 3TJXA 4LOCA 2GGJA 3CHFA 3EEZA 4CGTA 4TX8A 1W3LA 3CZLA 1HT6A 2TMDA 5TIMA 3R13A 1BWLA 3S1GA 3LGGA 2J13A 1TVPA 3VNJA 1W1A1 3IGHX 4UTIA 3BAYA 1YRRA 2RHGA 3IARA 2CESA 4J28A 5CXPA 1EPXA 4NASA 4QSFA 4B15A 4JTCA 3L4WA 5CPMA 2Z26A 1TRIA 3IV3A 3W38A 2HEJA 4Z1YA 4R85A 4PMXA 3NDOA 3EA2A 3ICJA 4IIFA 4WSKA 3IJ8A 3EGJA 4H6RA 2OO0A 5BOEA 3QY6A 3APTA 2BGQA 4LXFA 2AQVA 1DJGA 2JKAA 3TYZA 1X7IA 2ZICA 4PULA 3RLGA 2GVEA 2FZBA 1H7NA 3NDYA 4IMFA 4F48A 4UQCA 3GR4A 1S5MA 2GL5A 3VYLA 5U4NA 4W8BA 3VGGA 2PDUA 1HJWA 3GHUA 1SJAA 3QKEA 3LEPA 2G41A 2VXNA 3UXLA 1R2TA 1NOWA 1FWBC 4W86A 3AI0A 5TAOA 3CWOX 4F2BA 4EPEC 3GG7A 4HKPA 4GNKB 1OG0A 5CPQA 5FL0A 3VD3A 1V0NA 3B9NA 1TQXA 2VGIA 4RXFA 1LCOA 5J8LA 5BMXA 3VM5A 1TV4A 3CAVA 4PUEA 1H0IA 3N9RA 3PZIA 4G1KA 4DNHA 2EPMX 1A49A 1J11A 2V9DA 3SEPA 4HGXA 3KM8A 3GR7A 3I3DA 3QW3A 2XG9A 2EG6A 5FOOA 3BE7A 1ZU8A 4UFMA 2YXGA 2WKJA 3LS9A 4RL3A 1J0ZA 3N19B 3SRKA 2V38A 4QE5A 4WK9A 3SADA 1XG3A 4ZBCA 3WL0A 3S1UA 3TA9A 1KC7A 1X8FA 2YR1A 3KLLA 1E0WA 4DJFA 3MKVA 2GSJA 1JI1A 5HQMA 2VRJA 3T44A 3W7CA 2PTXA 3CU2A 1DVJA 1KGXA 3CL8A 4HOWA 2ACSA 4DXVA 1K77A 1UKSA 2WSKA 1GVRA 1TG7A 3WDJA 3OU8A 3L5MA 3HFYA 3QR3A 4PH6A 1N2VA 2FMOA 2WXDM 3I7SA 2C13A 4OE7A 1HP5A 4GWEA 3UWUA 4AWUA 1QR7A 4ML4A 4UTTA 1B31A 3KOYA 1CB7B 1JZ4A 1RSCA 1EA0A 2DSUA 2EJ1A 4GUJA 4IT1A 3LCIA 3VE9A 4AU0A 3I65A 3F2CA 3M43A 2CBUA 4B9ZA 4EXQA 4JTFA 3IUHA 1FWCC 1UJPA 4G8TA 3RRAA 3R8GA 3ABZA 3FKRA 1Q6FA 4DO6A 3VX1A 3UYCA 3WK2A 4HZMA 2PDMA 3HGJA 3UEQA 2AKZA 1VKFA 5C9UA 4RUBA 1J2WA 1GK8A 4HN8A 4XV0A 3WFAA 3NL3A 4DZAA 1U83A 2JBMA 3L0GA 3EX4A 1FRBA 5E93A 3KZSA 3LERA 2VVSA 1RY8A 2W79A 2PDGA 4MB5A 3DDMA 1XD0A 4GCXA 2A3BA 1F74A 2F2KA 3DECA 4DI9A 1M7JA 3DFOA 1XQLA 4NNAA 4HSNA 1KWGA 5ABEA 4S2BA 2PCQA 1V6YA 2HS6A 2HJPA 3QC0A 1A0EA 1GQIA 4EOUA 1S1RA 5AVNA 4L1XA 1FWGC 3HU7A 1E70M 4GACA 4TIMA 3BQ5A 4Q4OA 1IEWA 3NQBA 2X1RA 1U5HA 3ZJ8A 2HXUA 3G1DA 3VI2A 4RK8A 3UWZA 3E2QA 4K39A 5CG7A 2E3ZA 2AL1A 4HNOA 4PFHA 4HA4A 4HPGA 3UG8A 2W66A 3VD7A 3W24A 3LV5A 4NZ4A 3TNBA 5CSRA 3MI2A 4F0LA 1MQPA 1UD8A 5D37A 1JRCA 3SJNA 1S2VA 1OC6A 3ARZA 4PTVA 4DI8A 2WWCA 2DIKA 4NKCA 3DAQA 4WGHA 3M0VA 4NILA 4RZ6A 1SR9A 4BKNA 1X6LA 3M0HA 4EKJA 4EPKA 4EACA 4O0KA 3NAVA 5HANA 1FDYA 2QJMA 2CZEA 1K9EA 1ONRA 5JIWA 1YIXA 3IPWA 1AQHA 1PYMA 3UZJA 3E5PA 3GNOA 3WJSA 2BNJA 2VFEA 1QO2A 5HMDA 4IQLA 1V3JA 2QDDA 1JYXA 1PTGA 1MQRA 3DBNA 2GVLA 3VK5A 4ZQRA 1KD0A 1OF8A 4NJKA 2WC3A 3AHYA 2OLSA 5LA0A 1UWUA 1CNVA 3UJFA 1WDRA 4RNFA 1V3MA 3PUDA 3CT2A 4N9CA 5FJUA 1TYGA 2BVWA 3B8IA 1OHLA 3S6DA 2QPXA 3GIPA 6TIMA 2GDUA 4M8UA 4ZCWA 2MANA 4R3UA 1S2CA 3NDZA 2PD9A 2WVVB 3H70A 1X7FA 4IFKB 4YN5A 3GKAA 5E0KA 1DJYA 1W9UA 2GDVA 4FLRA 2PF8A 5C6MA 2QJHA 4E2VA 3UZZA 2FFIA 3GH4A 2W27A 3WLNA 3KS6A 1G4EA 3UZYA 5KZMA 3PULA 4PMZA 4H1ZA 2NLIA 1XSJA 2P5NA 4GABA 1JYVA 4ZB5A 4DM1A 1T41A 3W86A 2GVGA 1R8LA 3ITLA 1XJBA 4XZBA 4WKHA 3BANA 5A8GA 4JTRA 1QATA 3QPZA 4I8DA 2HK0A 1XIDA 4JIHA 2FPTA 1JR1A 2J6XA 2RGMA 2YW4A 3KOFA 4L64A 2VFGA 3OGRA 2Y8UA 3BCFA 5KMYA 4NIRA 2DZBA 3GHSA 4LYQA 1YX1A 3VCNA 5HA7A 4GK8A 4XBKA 3W00A 1WE5A 4B2DA 1MDLA 4N6EA 3RU8X 1RXOB 1V0LA 2CNCA 1IGWA 1H1NA 4IICA 1ENUA 5C0QA 4Q4KA 3QV9A 4H9ZA 7PTDA 4MADA 4AC1X 1KM2A 2J79A 1G1YA 4XZIA 1OJXA 2EKGA 2RJGA 3L67A 1M04A 3GTNA 3I3BA 3HQ1A 1ONWA 4JS3A 3CASA 5AC7A 4GD0A 4AMCA 5H1WA 3OYXA 2OLAA 1M7OA 4H19A 2PP1A 3G22A 1FTXA 4FXJA 4X60A 2J88A 5A69A 3OA3A 4OT7A 5AY7A 2XWDA 3IGSA 4WLCA 3BOXA 1KKOA 3HN3A 3K4WA 3OLEA 4QE4A 3N1AA 4HA0A 2WMFA 3WH9A 2Y5SA 4YU1A 3WO8A 4W8AA 1OX6A 1UKPA 5G2WA 2WQDA 1KFBA 1ONEA 4YYCA 3WUFA 2D0HA 1LOLA 2CEQA 4O8RA 1GTEA 3O07A 3VC6A 1LF1A 5GPRA 1YPXA 4TV5A 1PKLA 4FHAA 2J24A 1L2QA 3HURA 4LY8A 2VL4A 1W1VA 3H23A 3U4FA 1KWKA 2HE5A 3E2RA 2J8TA 2G0WA 2FPYA 2GQAA 3QN3A 1XSIA 3GG1A 1UB3A 3LQLA 3N15A 4DX3A 3WJWA 4YL2A 1K4GA 2EPHA 3RHGA 3MHFA 3ZFHA 2YIHA 3CQHA 3U6WA 3WD0A 1KM3A 2CLEA 1VRXA 2ZUVA 2WZIA 4UOQA 1NARA 2YB4A 1DHPA 1HGWA 1MNSA 5BCAA 4N42A 3EDDA 3H24A 2BVTA 1YPIA 1UR3M 4NI8A 2J4GA 2WO5A 1YDNA 4G56A 3LXAA 3FXYA 3AJ7A 1OFRA 1P7TB 1XX1A 4LRTA 3IRSA 2WV8A 3BOFA 1R9ZA 3LPPA 4PB5A 4QDMA 5A6SA 3B03A 1JVNA 2X2GA 2WCAA 3FN9A 4CN6A 5I2UA 1JDAA 1MFUA 3MJYA 4DBWA 4PMQA 4MWAE 4WKAA 5AKQA 1LUCA 2ZE3A 2BG5A 1CW2A 3W7RA 1FDZA 3S83A 4ZQMA 3WY1A 2EPNA 3NOYA 1Q7ZA 3M5YA 2PS2A 3N34A 2ZZ4A 1OX5A 2Y4SA 5FJPA 3DESA 1LLZA 4LUSB 5CSUA 3W76A 1YLVA 3VIPA 1C8VA 3DIPA 5IHRA 1NJJA 4G6CA 4M6UA 3NQAA 1AQFA 3JVAA 3GH5A 1BAGA 3C2OA 3KVJA 2PGRA 1J79A 3QPEA 4KKXA 5G4EA 1CGXA 5EMMA 3GAKA 4ZO9A 3W1NA 1PJ9A 2B7NA 1H7PA 3HJZA 2G3NA 2Q8ZA 1BSIA 3PJWA 3GVVA 2FH8A 3PG9A 2FVMA 3N6HA 1XRVA 5BNKA 3U9IA 5I3GA 4A2RA 3CAQA 4ZGYA 1WO2A 4HCLA 2JE8A 2WJFA 4DAIA 3W2KA 4HHMA 1OC5A 1B3WA 1XIBA 4N6FA 1UH4A 2CERA 3S42A 2INEA 2GVYA 1O6IA 1PWLA 3ZVIA 2VYOA 1DKWA 4ROPA 3WQFA 3BW2A 1CCWB 1QMLA 2IPGA 1T0OA 4HK7A 4BK9A 3EX3A 2YLAA 3WUGA 1POJA 1PE1A 3WDQA 2ZDRA 3AZSA 4FXSA 2NQHA 4O50A 1E72M 3PBYA 1ZHAA 2DJXA 3W72A 5KZ6A 1E6NA 3RJXA 4CQDA 1Q6QA 2Y89A 4A29A 1VFLA 3EX2A 4TTUA 2J66A 1E9YB 1UP0A 4XZHA 4UMBA 1M41A 2EJAA 4HHHA 1SO6A 1O66A 3K1GA 1H2JA 3AMLA 1UJQA 4H8NA 5A6LA 2E9MA 3SRDA 2C0HA 3ARRA 2IKIA 1Q7MA 3PPFA 3VINA 2J25A 4GY0A 1MWOA 4QQ3A 5HULA 3IVUA 1J18A 2GGHA 1F3WA 3IGXA 2YLLA 4NYUA 5A6BD 3OEXA 4Q8OA 2PBGA 1CGWA 3A24A 2BODX 3F4DA 4P7LA 2ZX8A 1KQZA 1WDWA 3QHMA 3LYEA 1WXZA 1BSLA 2Y7DA 2Z2AA 3G0XA 1KFWA 1GZJA 3E02A 4TOQA 2DVTA 4UOJA 1P0BA 4F79A 2CITA 3LSCA 3N3TA 3FAXA 3C6CA 3ZMRA 3H22A 2IXUA 1YPFA 3PUGA 2QDHA 1VAHA 4JQ3A 1X39A 1SO3A 2Y8KA 2PSNA 4XAPA 4DWSC 1KB3A 1KR1A 1IHIA 3SCVA 2F6XA 3SGZA 1K4HA 1OT2A 2QMKA 3EXTA 1XINA 3VGEA 4GY1A 1XD1A 5LZLA 3MI3A 2FHCA 1GVSA 1S5TA 2PGFA 1SMAA 2J8GA 3WH7A 3VA8A 2R1NA 1EHAA 2OZ0A 4U4MA 1EOKA 1GNXA 4RXGA 1HUVA 3R94A 4IJRA 4DJED 5CC6A 1IXOA 3WLLA 1OT1A 1XISA 1I2QA 1Q3NA 4UNKA 3TXVA 4WJEA 2RDTA 4NVTA 1DL3A 1OADA 2B7QA 2FZMA 1X97A 3AOFA 5A6JA 4HK5A 1Z41A 3O6AA 4IPPA 4Y96A 4C1NA 3H54A 4AVFA 4LC6A 1MNZA 1JCJA 2YDRA 2G3IA 3ARUA 5AHMA 2Z7KA 4DLFA 1KFKA 3LRMA 5LNUA 3T09A 2ZTJA 1DIOA 2J27A 3LHTA 1VEMA 3WFLA 4N7QA 2Z1VA 3NQ6A 2FH6A 4OJYA 1DXFA 1E5JA 4AWSA 1AQMA 4GHRA 1R2RA 4DVOA 3GKFA 1G4SA 1UC4A 4GUHA 3GLCA 1M7XA 1I2RA 3R11A 3WEOA 1VPQA 4B92A 3LLXA 3RO8A 1FFRA 2EF9A 3HGSA 4UFHA 4LFYA 7A3HA 1W54A 4NZ1A 1E15A 3OLIA 2VZVA 3T4WA 3ATYA 3LXCA 4CUCA 3GXDA 2ZRZA 3KL3A 2JF6A 4GVGA 4MKNA 3N2TA 1EJVC 4MY9A 5K9XA 3ABXA 3KOWA 5HMSA 1GOMA 4MHBA 4F8XA 4P8VA 5DFAA 1MI3A 2YL8A 3VKBA 4YPJA 4KMQA 3MCMA 5LKYA 4GI9A 2I9UA 4KFNA 5BXSA 2BTMA 1EL3A 2Z0IA 4U31A 1S1PA 3OJGA 2D24A 3TOYA 3L2MA 5FKYA 3KX6A 3WH6A 5DO8A 3KXQA 5AHEA 1RLDA 4D6HA 2WPBA 5CPNA 3UFYA 3TLLA 3LTYA 4UQDA 3TQKA 4WDTA 2ISWA 4G7FA 3G24A 3IVSA 2J74A 2JGQA 3FSUA 5G4WA 3RX4A 3UF9A 4JTJA 4KERA 2WOQA 1IXPA 4HPXA 2A79A 4REQB 3N4AA 2CLHA 4PTWA 1BF6A 3HIJA 2INZA 4OTKA 4GJIA 4J9JA 3RG6A 3CIVA 2ZRVA 1VCVA 3C56A 1SPQA 3WLRA 4E0CA 4HP5A 5BXTA 1UYQA 3KDNA 2JKPA 1RK5A 3GXTA 4UOZA 2YCIX 4KEVA 1P4CA 2ZZ3A 5I77A 4HK6A 3KCJA 2I5QA 2HSAA 2DZUA 1B90A 2R82A 3SCNA 5FCZA 1CGUA 2YZ5A 4IFOA 2QUVA 3WLQA 3TYDA 2G3MA 3EB4A 4O19A 5CLWA 2VC7A 4UTHA 4Q4SA 4ASTA 3W7DA 4TUFA 4AEEA 2WSQA 3T4CA 1GW1A 3F4NA 1GOWA 1XYLA 1B0IA 2ZWYA 3FEMA 1I45A 5K2ZA 3KUMA 5IDZA 1WBHA 3QGKC 2J7HA 1BVWA 3RUBL 3L5LA 1ELSA 1Y5WA 3IIPA 3TYBA 1QPNA 3SSZA 1AMKA 1ITQA 2VNCA 4AAJA 3MO7A 3C8FA 4HNUA 4JTDA 3A13A 2ABAA 3LBOA 1SFSA 2OSYA 1FXPA 4LT9A 1QWKA 4X0NA 4V28A 3LPFA 5I79A 4YXGA 3GW3A 2E9LA 4ACZB 3SECA 5CJNA 3QGVA 2YKKA 4M56A 1NDWA 1XYBA 3F4CA 1EC9A 4OUIA 3PBMA 1PDZA 4H7ZA 3UGVA 1JAKA 2X1IA 5HQEA 3QV6A 4GYPC 2WHJA 1BTCA 1E55A 2A85A 3AU6A 4PB4A 1Q6OA 5C54A 3U3HA 2BGNE 3CHVA 4JTKA 3VZXA 1DWHM 4O12A 1C92A 2PDLA 4H7CA 2DVXA 2G3JA 3E0IA 2VD9A 5D2TA 3ITYA 3QC3A 1CT5A 4IMAA 3LCWA 2YL6A 2VX5A 1LORA 3GTHA 3S9IA 3BW4A 1Q2SA 4O17A 2V5KA 3MCOA 4A6GA 1FOBA 2CFFA 3N4EA 5IFPA 3S46A 5HPCA 2D1ZA 3C0SA 4DEFA 3HQPA 4C1LA 2FB3A 1TO3A 3L66A 4Q4PA 4KEZA 3HA1A 2IS7A 3CIXA 3B9EA 5LNSA 1RUSA 4P8WA 1C9WA 3M16A 1JGMA 2NXHA 2GSHA 1O95A 3DGBA 3WSUA 2A4AA 4MNLA 3C2VA 4CU8A 3AICA 3SDOA 3BTNA 1AFSA 1XS2A 3N9KA 3WIJA 2D3LA 3LGEA 3EXSA 2PDKA 1UA3A 4XBSA 1YXCA 1FH7A 4LYPA 1FHLA 4MYAA 2XIJA 3E49A 1EC8A 1KLZA 4B5UA 4LS0A 3J7HA 4KWUA 2ZXBA 4X9YA 1S46A 4RW3A 3G5EA 4Z2JA 4EANA 2WSYA 1EP3A 3UETA 3FNDA 3EMQA 4WXZA 1F6KA 1QW9A 4EWND 1PHQA 4ZO6A 2CLOA 1I0BA 3PK7A 1DWGM 4HU4A 1Q6DA 1IWAA 3C2FA 4JCLA 1UR2A 2KZHA 1A5OC 3HG2A 3L4XA 3KTXA 4NAEB 3W9ZA 1TZ7A 2HCVA 5DRIA 3LHUA 3STEA 4ALDA 4FS9A 3TE9A 3BVJA 2C15A 1BYBA 3H8AA 1DWJM 5KITA 4W93A 5HPOA 1BXNA 3LNMA 4JTLA 7TAAA 3LOTA 3PZQA 4KWWA 3NQFA 3AHVA 1SMDA 3IAQA 1K02A 1A5KC 3W7GA 1HJSA 3AS2A 3W23A 4Z2KA 4Z0SA 3DOPA 3P93A 1FHDA 2GFTA 4DJFD 5G2IA 4X3ZA 1TTJA 2VO5A 3QFEA 1TTIA 4L6DA 4Y6GA 4OHQA 4L7ZA 1QDSA 4TX6A 1VH7A 2XFYA 1E9LA 2DDXA 3UWQA 5AZ0A 2UV8G 1JDCA 4Y7EA 2OWCA 4W89A 2JF7A 4W7VA 4CNUA 5D05A 4PC8A 3UY8A 2JQXA 2PWGA 3MCNA 1NIUA 2GGIA 1MXGA 4LS2A 1BGAA 2HK1A 1K3UA 2V63A 3DKJA 4IHCA 1OINA 3KAOA 3TUUA 2V2HA 3TV8A 3TJ4A 4Q22A 4QITA 5A6TC 2VQUA 3ZQ9A 1KTBA 4WHBA 1W91A 2VUYA 2QCGA 1PKMA 5LXXA 1SM9A 4PEEA 4JFVA 4FNUA 3W2LA 4XTIA 1RA0A 4D6GA 4UTKA 2A3CA 3GD6A 3B3DA 3EPMA 4AH7A 1OSEA 3UR8A 1IEXA 3B8DA 3UG4A 3VO0A 4CN1A 4PCNA 4JOMA 2FGLA 2VEGA 1ZJHA 3VVGA 4LUIA 4PMUA 1SW3A 3EB2A 3NEHA 4MB1A 3GQYA 1MSSA 2QUNA 4O14A 1GJUA 3QQWA 2XVLA 5CBIA 1H62A 2WNZA 3IACA 4X61A 4KQNA 3C61A 4O11A 4KFPA 4KH2A 1V3LA 4RJEA 5U7SA 2PWUA 5FESA 5A2CA 2QQ6A 3FYPA 1DP0A 3WKZA 2R8WA 1E6SM 1J5SA 1Y65A 4UQ9A 3C86A 1YXDA 4NRRA 4V1YA 1VFUA 1QPQA 3BCJA 2Z1BA 1CBGA 3LCLA 3ITGA 4F0RA 3JZUA 4I6KA 4O28A 3TWAA 3ZZ1A 1JPIA 5F4WA 4AD0A 4QE1A 5DBTA 1PKNA 3N2XA 4W4QA 4JCMA 3WZ0E 3VDCA 4E38A 4XAGA 1IV8A 5SWUA 2E7FA 1KFEA 2VFHA 4IG2A 1O68A 3PC0A 1I4NA 1FCBA 2OGJA 1SVDA 3W25A 2W6RA 4XD4A 4IFRA 4BF5A 3CUIA 3F5JA 3TN3A 1EXPA 4MKVA 2W5FA 4QG6A 2Y85A 5AHNA 2CC0A 3MWCA 1PZ0A 2FGZA 4ECLA 3V4BA 1HVXA 3LA4A 3OYZA 4LAMA 1DWAM 4AY7A 1PTAA 3VC5A 4RNJA 1CXLA 4ATDA 4QM1A 4BZYA 1OCQA 3H7RA 1E4MM 3ZSTA 3MYPA 1K9TA 2DT3A 1S5NA 3GXIA 5FA5A 1YTKA 2WANA 2QXWA 3AMCA 2NQ9A 1WUEA 5C9ZA 2QUUA 4ZXLA 4RDZA 1QPOA 3NQ8A 2HROA 3G2GA 4P7NA 3ARPA 2QJJA 1E0UA 3JR2A 5AYYA 2C6QA 1FKXA 2CBJA 3ORWA 3LMZA 4O1DA 4MWAA 1V4YA 2ZWZA 2VX6A 3M44A 2BGSA 4ZZ9A 3FGCB 1GVEA 2TODA 1NF0A 3GDLA 4DJDA 5HNUA 4AVOA 3V36A 3SY8A 2XVKA 2DY3A 4M51A 1TZ9A 3VKAA 4F4RA 3VNDA 5EU9A 2QNEA 2I14A 3QY8A 3QYSA 2QDGA 3H26A 1IF2A 2ADAA 3UJSA 3HMJG 1ITXA 2R24A 3M0JA 3S2MA 2BVDA 1ITUA 2VOMA 1IYXA 3CWNA 1UD6A 1OD8A 4KF1A 4WJ8A 3BGJA 3NQDA 5LYRA 4FIRA 4B2DD 1X1OA 3K8LA 1TRDA 1FH8A 3EWZA 3KBSA 3OLDA 2Q8LA 1TTPA 3P81A 8A3HA 3VE7A 2VT0A 3MUZ1 1Z44A 3DHDA 2C19A 1UKTA 1KTCA 3WQDA 1Z48A 2YZRA 4MZ1A 2OWXA 5HATA 4F40A 3PWIA 3ITCA 5CGQA 3ID7A 1CLKA 3H4WA 5EL1A 4F3HA 3W2NA 5REQB 3TXZA 3VGBA 1T40A 1GVFA 2OZ8A 4DUOA 2DIJA 1VPXA 3ERPA 4JEQA 1VEPA 2ZUMA 4NJHA 1SZNA 1ESWA 4GZIA 2OELA 3BLEA 4M1BA 3QZEA 2WMGA 3O1NA 3TAOA 3SRHA 1QWGA 4C6MA 4WSJA 4ORIA 1XLEA 3VD4A 3W71A 4D2JA 3HO8A 3PAOA 1LQ0A 4CD8A 4CD7A 2NQLA 5G2HA 1VFTA 1XKJA 1WNOA 4Q8PA 2QVHA 5KZDA 3W26A 5EMJA 1AUSL 1CLVA 3K2GA 2OXNA 3EYPA 1HJVA 1D2KA 2HS8A 3HMCA 4NAFA 1ZBKA 4WR3A 4GFSA 4NSBA 2HV5A 4UTWC 3CV6A 4CQBA 4JIRA 2WLYA 4RLIA 3CIWA 5TF0A 1A4LA 2E9BA 1C8YA 5JIPA 1JUBA 4IJCA 4IQDA 2UY2A 3I4KA 5EMUA 5CSSA 4DBUA 1XDJA 3E6EA 5C7HA 1ZPTA 1TJ0A 3GUGA 4H9UA 4XZ9A 3SSJA 3P6LA 2IW0A 2NX3A 1JCMP 3PM6A 2WSRA 3EAUA 1GEQA 3BCDA 4PUKA 3G6MA 8XIAA 1SSGA 3QXBA 1SZGA 1XV8A 1XL9A 4MAVA 4RR4A 5D2YA 1GG1A 1OX4A 2Z00A 1VFSA 3GTIA 5AOUA 3QMRA 3OP2A 1XYFA 4NY2A 4J1OA 1PX8A 5CPTA 3E9AA 3AIRA 3MI6A 3WBXA 2R9RA 3PTMA 5A8NA 1FP8A 3UPBA 3MS8A 3I6RA 1QNVA 2NX9A 4PA8A 3KCLA 3R4IA 4US6A 1TR1A 3PBUA 4PMVA 4JIIX 3CZKA 3LCGA 4LALA 3ZOAA 2X1UA 1EYEA 5D32A 4JTAA 1CENA 1JUEA 4C6DA 4TVCA 2E40A 1JCXA 1W9PA 2QKFA 4FNTA 1QU4A 4S3AA 3U7BA 4JTHA 3BZJA 5D8ZA 3ZVHB 4TTGA 5T8GA 2NQJA 1UPMB 2G5WA 3AYVA 4PGLA 3I7QA 1A3WA 4I9TA 4JX4A 5DT7A 3B9OA 3D3AA 2HVMA 1HKWA 2VEFA 1E9ZB 2VFFA 1Y0EA 1KM1A 4QROA 2P0OA 3PTQA 1H7XA 1OK6A 1K9DA 1HNYA 4O1CA 1LM1A 3WF4A 3S2LA 2WM0A 3VDBA 1L2UA 1PSCA 4UXDA 3EBVA 1XFBA 1IIHA 3H6OA 4FSAA 4G1NA 4BCEA 2E6YA 2FJUB 3P8JA 3NQGA 2PB1A 1DTNA 3DI1A 2VX4A 2DZAA 4XSLA 3TSMA 2KX9A 4MKSA 4K1GA 4IOTA 4AISA 1UWQA 4WVXA 3GVQA 3Q45A 3FA5A 4U28A 2PLCA 1NOFA 2I56A 5M03A 3L2LA 4A35A 3FS2A 4HT3A 2VEMA 4JFSA 3V1PA 1V77A 4JTEA 4A4AA 3THUA 3ZO9A 4AHQA 2EO7A 3SFWA 2E5BA 1L8PA 3ARXA 3EOSA 4L9YA 2Y62A 1TA3A 5A5WA 2Y2WA 4UMAA 4PUDA 1V7YA 1JYWA 2GUUA 4H41A 2FZ9A 2F9RA 4HBKA 2NUWA 3CB8A 4H7VA 1TVLA 1OBAA 3VPLA 5CJ5A 2JEPA 3WQEA 3RGTA 3WNPA 2E6FA 1SZRA 4ZMGA 2PDFA 4J35A 5F2LA 1UR9A 1XLAA 2PDXA 3DXIA 3RLUA 3WK0A 1EFZA 1QOPA 2A21A 2VUNA 3TX9A 1NELA 1DYSA 1RVKA 5C9XA 3LK6A 1PIIA 4Z2GA 1QT1A 3PZUA 5T9CE 2HQAA 4RCXA 3OVQA 4ZR8A 1TMHA 1BG4A 4C6QA 4MPQA 1W2PA 3NIYA 2BP1A 3OGVA 3NQEA 3CEUA 3QSTA 1V3HA 1W3HA 4GO8A 1DOSA 1QK0A 3MQTA 1G9HA 3MSDA 1Y7VA 4H8UA 1XBYA 3BAXA 4F0HA 4DRSA 3S9ZA 5KINA 3TROA 2FTPA 4C1NB 4HOZA 2D3NA 2ZUNA 3FCPA 3TLQA 1SZEA 4PEKA 3LHZA 4FF5A 3KWXA 3W22A 3RJYA 3IWPA 1FUYA 3M47A 2IMRA 3ZLFA 3TTYA 1JQVA 3E74A 3W7MA 4AWEA 4GQRA 1LZOA 1M01A 3MDWA 4O1FA 5JMUA 4AZ7A 4MNKA 1X96A 4A3RA 3AC0A 1XIGA 2Q3RA 4XWUA 1NAL1 4LY4A 2WYSA 4R9OA 1YTEA 3N9SA 4IISA 2E5DA 1QI2A 3VNZA 3HGRA 4WXYA 1Y5XA 1R46A 2ISSA 1J4EA 4IP5A 3THDA 4DF2A 4GY7A 3MB9A 3URBA 3BGGA 1SU5A 1AK5A 1RHCA 1UD4A 3DENA 1AL8A 4JNMA 2ABBA 3TW9A 2EPKX 4QRNA 4X63A 2PDWA 3FHQA 3JS3A 2FHBA 1RALA 2PDIA 3DG3A 3NQ2A 2E25A 2DZSA 2ZVRA 1EIXA 1HGYA 2ASHA 5IDIA 1E73M 1OGSA 4YTRA 2Z6IA 3WUEA 1KR0A 2J7DA 3WJYA 2F6UA 2Z1SA 4I5UA 1TIMA 3VZZA 3PTKA 3RX3A 3MDUA 4QDPA 4UUIA 1QNQA 2OOFA 3ZWSA 4JY8A 2INFA 3SIZA 1RJQA 1ZAHA 4GA8A 1ODUA 3HBLA 3NNTA 5C71A 1CYGA 1SQ7A 3NO5A 1SFJA 2KAUC 5GJMA 6REQA 1VJSA 4B3LA 3TP4A 3PHAA 5DMNA 3O7UA 4WRHA 5IOBA 1BD0A 2NUYA 3WLHA 4IL2A 1B3VA 1G67A 3R12A 1DQWA 1UMLA 1W9VA 3EWUA 5F7UA 1ML1A 1D3HA 1JXKA 3RM8A 4RDVA 5K7JA 2VURA 3ZS4A 3RRXA 1AW1A 4N4QA 4R9XA 2FB2A 2QT3A 4ADUA 3V7PA 2PAJA 4MUPA 3T8QA 3THAA 3RR1A 2NT1A 3O0KA 3EWBX 1JDFA 3P7YA 5AYIA 1RJRA 2VRQA 2DT0A 2QJIA 3MP4A 2NZLA 4C6FA 2WM1A 2XVNA 3NR0A 1YW1A 4J3XA 1YXYA 1E3XA 4TMCA 4XKMA 1V3IA 2PFHA 2XN2A 2YFNA 3N2BA 1H7OA 3CPUA 4DWSB 1G0CA 1YKWA 3IIVA 3T0BA 5K9DA 3GE7A 3IEBA 4QCFA 4AZHA 1REQA 1VCGA 4HYWA 1NVMA 4QAIA 3PPCA 4ZA0A 3PY2A 3WQ5A 9CGTA 3BICA 5JBEA 2QCFA 1FWNA 1OGGA 1V0MA 1GHSA 4S3EA 2A1YA 3DFHA 3Q65A 2W9MA 2VKZG 3THQA 3VMNA 3USZA 3E0LA 2A7PA 2F7FA 3ZXWA 3MY9A 3ALFA 2DPEA 4JX6A 2HMCA 2C8NA 2ZRUA 4OOZA 3S5NA 1W37A 4C6JA 3JRKA 3D46A 3PZ9A 4AQLA 1YBQA 1LP6A 2WQPA 4R53A 1A5NC 4DLMA 2XM1A 1ZB5A 1EUNA 2E77A 1Y8BA 3MUIA 4NX0A 1LRNA 4ERAA 2JK2A 3IJQA 1F5ZA 4CCCA 3EX1A 4OFCA 2OWWA 1YNQA 2UY4A 3EDKA 3B4UA 4ZQNA 1VRDA 3MVTA 1ECQA 1FVPA 3NM1A 3QLLA 1N8IA 4CU7A 4DUVA 3A6OA 1CB2A 4AYSA 4UZUA 5BXRA 3R89A 1EHNA 2CXGA 4H9XA 4O0QA 3VDGA 2GJXA 3V18A 3FJNA 1G6CA 5HJLA 4HSOA 1QASA 1KA9F 1RCXB 3UBPC 1Q5MA 2XN1A 4I7VA 4Q8VA 3TWBA 3MPGA 3V5FA 1ODZA 2YDSA 1D7KA 1Q6RA 2GWNA 4L4OA 3I3EA 3LMYA 4QFUA 4BR1A 3T0TA 3GDBA 3G1AA 3G1YA 5DY2A 5D9OA 4XKYB 3R0KA 4W9TA 5BOOA 1W5MA 1MMFA 3HPZA 2E1WA 5DMYA 2IQDA 3QZAA 3EOEA 5FSDC 4O54A 1EGMA 4UC5A 3W84A 3WDHA 4IPIA 4P8UA 1HJUA 4HZ8A 4KEMA 3SUSA 3TJLA 4PN2A 2QGYA 2C14A 5E9AA 3AMGA 3EZ4A 3R0DA 2OFJA 1C93A 1SZFA 5IBXC 4Y9NA 2FPVA 4Q8WA 5A95A 1BVZA 1LWIA 1GZGA 2OMAA 4DO7A 3HM7A 5GQBA 3LHWA 1J0YA 4IMDA 3S5ZA 2QMJA 3B0UX 5AC6A 3IJDA 4PTNA 8TIMA 1OFOA 2VR5A 1DEDA 3L4UA 1RY0A 4EIVA 3ANYA 1S5VA 5HR6A 1RBAA 1Z6KA 4JQ4A 4XG1A 3LCFA 4EXAA 4DO5A 3TVAA 1UR8A 4GRSA 1RPXA 3SB0A 4AD2A 1UR4A 3CZEA 1N8FA 1U1UA 4G2DA 4B3KA 1XRFA 4RE4A 1E6QM 1KCKA 2WMHA 3H4XA 3EA3A 2DUAA 5BOFA 2ZKMX 3AYTA 4RE3A 4PUJA 1K03A 3WMBA 3M46A 1ZJBA 3R7MA 4EPDC 3MW7A 2GJRA 2XGIA 3F5KA 3EKLA 4BQ5A 2RFGA 2C91A 2WHMA 3WQWA 3EWYA 2NXIA 2QDEA 3WNOA 3VUPA 1Q65A 3T78A 1GTHA 3QYQA 2WMIA 1UKOA 3RXZA 1XICA 4XVDA 2BVYA 4ES4A 3BMVA 3M07A 1W3IA 3PJUA 5ABTA 3B8VA 1IZKA 2OVLA 3GWQA 4PBEA 3BLFA 3DG7A 4JXCA 1EUAA 1CGTA 1ME7A 3DU0A 4UFLA 3W1XA 3ARTA 1VQTA 3GDMA 2YSWA 3W7LA 1MZRA 2ATSA 4OVXA 4NYYA 2Q02A 3WQPA 3CTTA 2J9XA 5I0DA 3TDFA 1FA2A 4LJ3A 2BLEA 4UR8A 4E6MA 2PDYA 3O63A 2EBNA 3DFSA 3W81A 3EMZA 1Z3NA 4HB7A 2VEPA 4GH1A 4KRUA 4HNNA 1XW8A 4E2OA 1F9CA 1VYPX 3T42A 1GVQA 3ABSA 1CPUA 4CCDA 5DY3A 3SUVA 1KGWA 4A3HA 1OCJA 2JKEA 3B9AA 3INPA 1E6PA 1EBHA 4XB3A 4NZ5A 3UNDA 3GB6A 3E96A 3S2JA 4H6QA 1FCQA 3P60A 2ALRA 1P43A 3NURA 4YTSA 1RP9A 3PUEA 1HO4A 3TYAA 2FDSA 1S39A 2OPJA 1PX4A 3GVWA 1SFLA 3P62A 3PP7A 3WDIA 4GLEA 4ORMA 4FLQA 3HOJA 4ILSA 2RUSA 3L9CA 5AN7A 1AVAA 5CZTA 1VIZA 4JTTA 4CNTA 3IJ9A 1EJWC 1EH9A 2ZBTA 2VEIA 1R85A 1M1BA 1VD6A 1E43A 3LI0A 3KE0A 5DMLA 3VIMA 1FWJC 5MHBA 4GZ7A 4YHEA 1VEOA 4L6OA 1VFOA 4NRSA 2OG9A 4F0MA 1HIZA 1H11A 4EPBC 3QZ6A 4KRTA 4CD5A 3A3HA 1K9FA 1E1CA 4C6BA 1XLBA 4LVBA 4K8HA 5JQ9A 4GI6A 3PG8A 3VMPA 3UZ5A 1NWTA 1GYMA 2PDJA 3UR5A 1M6JA 1EEPA 4JR5A 3RM9A 2VENA 4CNNA 3BUVA 3ATZA 2DSWA 3L7RA 3QV8A 4JPGA 2H8ZA 1YADA 1UCWA 1HVQA 4IG2B 4UCFA 2R91A 3MTWA 3R2GA 1H7WA 4L80A 3V0TA 1KXVA 3BO9A 1OFQA 2OEMA 1VFHA 2VGBA 3EKGA 1UQZA 4XO7A 3WDRA 5HMEA 5IM51 3ZT6A 2YXXA 3HTWA 1NDZA 2V68A 1JPHA 1C7SA 3U8GA 3GNDA 3SY5A 1MVYA 1W1ZA 3SO7A 1PDYA 3HG3A 1BRLA 4H9VA 4Q4MA 3VILA 5L6UA 1OFEA 1KFJA 1RV8A 1IT8A 2WVSA 5D2WA 2V82A 3WNKA 2NWSA 3MKCA 2BY3A 1OFPA 2GPTA 1Z42A 4AW7A 1SW0A 1AH4A 4F9JA 5EPDA 2J9ZA 3WQGA 1N82A 2Y24A 4KCTA 1EPVA 3ARYA 2X7VA 5EFFA 5G4HC 2I5GA 3PZOA 1MO0A 1LT7A 1UWTA 4OZOA 5A3HA 3GTXA 1UBSA 2O4MA 2BASA 1AH0A 5DRCA 4E4PA 1AJ2A 4TVDA 4MWAB 3O8AA 4C91A 4NP7A 1WP6A 3SCWA 1XGEA 3BAKA 3GXPA 3TYCA 1GKPA 1J0IA 4RDYA 3NGFA 4DJFC 3P74A 5JVLA 1UD5A 3QHNA 1XGZA 1H61A 3OG2A 2RAGA 4MJZA 5C55A 2DQWA 2XN0A 5DF0A 3B8TA 3MSYA 1XH2A 2HPMA 4HD5A 4CEXC 1N8WA 3K1DA 4Y9MA 5H8PA 2B31A 4ZOAA 3C0QA 3OQEA 3O3RA 2GQ8A 4W5UA 4DB7A 1XLDA 1W3JA 1B9ZA 2VZOA 4LYRA 3FHAA 3N11A 1W1IE 5RUBA 2WLZA 4UTTC 2B81A 4DBDA 4PTMA 1NFPA 1OC7A 2PWEA 4EAYA 1HKKA 4KETA 4AZ6A 1W1PA 5FJJA 1TWIA 3VAVA 2CBVA 4NF7A 3TMQA 3OHMB 1U22A 3YPIA 1QI3A 4DJDD 3MUAA 1M03A 4B4FA 1ZCCA 3HQNA 3I6TA 1RBLA 3NQ7A 3PR2A 3CYVA 5DCBA 1R30A 2AMGA 2L5HA 1GUVA 4LAUA 3WF0A 2DSKA 3MHUA 1XQKA 4LUTA 4UB9A 1NWUA 3SCQA 1AODA 3O0FA 1W3NA 2ISVA 5AHFA 1VYSX 3CEPA 1E51A 2PRMA 3IUDA 3LGDA 4ZSUA 3STFA 4D6JA 3PFRA 3UXKA 7ENLA 1W8SA 4FOUA 3LZ5A 3NYDA 1H63A 3KTCA 4HJWA 4Y8FA 4AB4A 1GKQA 3E38A 4LB4A 3SUTA 3VOIA 2VGFA 4TQTA 5TQLA 4IMEA 2R94A 1V51A 1UR0A 3V0SA 1XLJA 3TQ0A 4RZBA 1AZ1A 1NDVA 4GXPA 4JTIA 4GIAA 3CB3A 3DUGA 1I60A 2OSWA 4JAWA 3AXMA 3M0MA 5EYWA 1H09A 5DEZA 4R5EA 4INFA 4EVZA 1V6TA 1KKRA 4WJXA 2PWVA 4PTDA 4RDWA 4C90A 2V5LA 2Z1KA 2DUXA 1PWMA 2YYTA 2PZ0A 1OX4B 3LZ3A 4NZCA 4J3UA 3D5HA 4ZOEA 3PSWA 3AMKA 3OQ8A 4FALA 4C6EA 1VS1A 3FIGA 1PYFA 3S9YA 2Y70A 4NUWA 4E8GA 2OU4A 4QEEA 4H4IA 3QJAA 2WVUA 1GVIA 2ZDSA 1VLWA 3KP0A 2EEXA 3TZNA 3VMOA 4GG9A 1KBKA 3R8RA 2V3EA 4H8HA 4PR4A 5CZSA 1LRTA 2PF0A 3V16A 2J9YA 3VKDA 5IRPA 3WUBA 2WC7A 4PSRA 3WF2A 1YDYA 1T6MA 1X6NA 5LSMA 3O9NA 2FIQA 3KP1A 4TX9A 2HVNA 3R0UA 3GBDA 3K5XA 4PYSA 1LL7A 3T7VA 1Z32X 1H0GA 1Q7QA 1R9YA 3A4AA 2SFPA 3RK8A 4J3SA 2I16A 1XWYA 3U2OA 1XFCA 2DV0A 4M82A 1XIFA 5IHSA 2F84A 1RAKA 1PX3A 3W6MA 1AD4A 4BQ3A 4M6PA 4TVUA 2VZTA 1MRAA 1QI5A 1C7TA 3UG5A 2VDGA 3N04A 3ANVA 3AUJA 4KT2A 3SCTA 5FACA 3HV9A 1ICPA 4WY0B 3G3MA 3E3HA 4WGXA 3WEMA