4PGLA

Crystal structure of engineered d-tagatose 3-epimerase pcdte-ils6
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
298
structure length
298
Chain Sequence
MNKVGMFYSYWSTEWMVDFPATAKRIAGLGFDLMEISLSEFHNLSDAKKRELKAVADDLGLTVMCCIGLKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAGLNFCAWPQHPPLDMVDKRPYVDRAIESVRRVIKVAEDYGIIYALEAVNRYEQWLCNDAKEAIAFADAVDSPACKVHLDTFHMNIEENSFRDAILACKGKMGHFHLGEQNRLPPGEGRLPWDEIFGALKEIGYDGTIVIEPFMRTGGSVSRAVCVWRDLSNGATDEEMDERARRSLQFVRDKLALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Directed Divergent Evolution of a Thermostable D-Tagatose Epimerase towards Improved Activity for Two Hexose Substrates.
pubmed doi rcsb
source organism Pseudomonas cichorii
molecule tags Isomerase
molecule keywords D-tagatose 3-epimerase
total genus 117
structure length 298
sequence length 298
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.31: D-tagatose 3-epimerase.
pdb deposition date 2014-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4pglA00
3NGFA 2NQ9A 1YX1A 4GJIA 1K77A 1XIFA 2G4JA 1XLLA 3IUHA 3UA4A 3DBNA 2ZVRA 3BZJA 1XIMA 3C0SA 1XLEA 4ZB2A 5EMJA 1XIGA 3UU0A 4W4QA 4HNOA 4DVOA 6XIAA 3VNIA 3M0XA 3KWSA 1XINA 3M0LA 4A8NA 3CNYA 1QT1A 1XISA 2X7VA 5J8LA 1XLIA 1GW9A 1XICA 1BXBA 4QE1A 3N4AA 4ZB5A 3AYTA 3GNXA 5XIMA 1A0DA 2X7WA 3XIMA 2QW5A 1XIHA 1A0CA 4XIMA 2OU4A 1OADA 3ITYA 3M0MA 4QE4A 1CLKA 5B7YA 4PGLA 4HHLA 6XIMA 3XISA 3QYSA 3P6LA 4PFHA 3AAMA 4QEHA 4E3VA 9XIAA 5AVNA 4G56A 1MNZA 4X60A 3KBJA 4X63A 8XIAA 3IUIA 3TVAA 1XYBA 4XSMA 3BWWA 4ZB0A 1XLFA 4J4KA 4YTTA 3U0HA 1XLJA 1QUMA 1TZ9A 3VYLA 4US6A 1XLDA 3LMZA 4OVXA 4YTRA 2I57A 3C0QA 2QULA 3ITOA 5TNVA 3M0YA 2NQHA 4YTSA 3AALA 2XISA 3UA3A 2NQJA 3KBVA 4EACA 1DIDA 1I60A 1XLCA 4K1GA 3ITXA 3ITTA 1XIJA 5FA5A 5XINA 7XIMA 3JU2A 2HCVA 2GYIA 1A0EA 3M0VA 2I56A 1DE6A 2J6VA 3QC0A 8XIMA 3VNJA 3QXBA 1O1HA 2GVEA 3IUDA 3C0LA 4GLEA 3KBMA 3OBEA 3TC3A 4QDPA 4DUOA 4QDWA 3KBWA 3VNKA 5B80A 4K3ZA 5AVHA 3KCOA 3U3HA 4A8IA 5H6HA 1XP3A 1XIEA 3QZAA 4QE5A 1D8WA 4ZBCA 3FVMA 4XIAA 2HK0A 3BANA 5H1WA 4XSLA 4X61A 5EMLA 9XIMA 2GLKA 3AYVA 3M0HA 1MUWA 3L23A 3KCJA 1XYMA 1XYCA 4HGXA 2XIMA 4A8RA 3CQKA 3BDKA 3BZGA 1XIDA 3KBSA 1XLHA 5I7GA 1XIBA 1BXCA 3CWHA 3VNLA 4GJJA 1S5NA 2QUNA 1XYLA 3UXIA 4EAYA 1XYAA 1DE5A 3KCLA 3DX5A 4HHMA 4XKMA 4QEEA 2QUMA 3CQHA 2HK1A 2XINA 3KTCA 3ITLA 5EMKA 1XIIA 4YTUA 5B7ZA 3P14A 2ZDSA 3UVAA 3CQIA 1I6NA 5XIAA 5C9ZA 1XLKA 3VNMA 1DIEA 2G0WA 1S5MA 1XLMA 4LNCA 5EMMA 3WQOA 1XLAA 4A8LA 4Q7IA 3XINA 1XLBA 1DXIA 1XLGA 4YTQA 1QTWA 4KW2A 3ITVA 2Q02A 2GUBA 3KBNA 4GQBA 3CQJA 4XISA
chains in the Genus database with same CATH superfamily
4KERA 4JN8A 2Y7GA 4C6PA 2WNZA 3UZXA 3RILA 1JZ4A 3HB9A 2QJJA 3M0LA 3GXNA 1OB0A 2X7VA 2QR6A 1MEWA 1XDMA 1S38A 1L6FA 5DQPA 2W0UA 2BY1A 3MP5A 1TPEA 1W8SA 3G1YA 1US0A 3SSZA 5B7YA 3GQYA 4CD8A 1JPIA 4URIA 3OZMA 1TWIA 5I78A 1WZAA 2DJXA 3LBMA 3VKBA 2J8FA 2C91A 2XVLA 4H2HA 1Q4NX 2FGBA 4YTSA 3AALA 1S1PA 2VR4A 3GSMA 2F6XA 4QCEA 1VJIA 2F6UA 3PNZA 1Z69A 2HXTA 1WBHA 4L1XA 1P0NA 4N6EA 2YDQA 1XD0A 4H2CA 3E0FA 1AW5A 1MSSA 1EF2A 4Y9NA 1PHQA 4ECLA 5CZJA 4W8AA 5BMWA 4B4FA 2QQ6A 2QVNA 4JNMA 1LM1A 2YL5A 3TYAA 1MWOA 2P0IA 3VINA 1EDTA 1XYLA 4I9AA 3QLDA 3N4EA 5JIWA 3MWCA 3UZJA 1VD6A 2E67A 4LC8A 4TMCA 8A3HA 1EHAA 2P3EA 4WY0A 5L9FA 2ZA3A 4OZOA 3O05A 4A8LA 1Q5MA 3WF2A 4D9PA 2QCFA 2OWCA 3EA3A 2Q71A 5TQLA 3TA9A 2JGQA 3SQMA 3WQWA 3QH2A 1XLEA 4ONVA 4C6OA 4MY9A 4HOWA 3TK7A 1XM3A 4MKSA 1G4EA 1DORA 4S3AA 2WCGA 3HGOA 3KZPA 4Q8TA 4L80A 4YL2A 3MU7A 5CZTA 2X1RA 2Z2AA 3BUVA 3UJFA 2ZICA 1KQYA 1KFCA 2ZYFA 1SFJA 4M7TA 3IPWA 1UD5A 4TX9A 3ZMRA 1KBJA 3V1PA 4A2SA 2AKMA 1LRTA 5BXSA 2VJXA 4NZJA 3USZA 1YNYA 4O1CA 5XINA 2CLPA 1EH9A 5DO8A 4GINA 3NZPA 2NQ5A 5C5YA 5GJMA 1QPRA 4DAFA 4QDWA 3UXAA 3W53A 5H1WA 5HMEA 1S1RA 5D05A 4PTDA 3TFXA 3SEPA 1XBYA 3RDKA 2BWGA 1TQXA 1V4YA 4RDWA 2PMQA 2PDYA 1AJZA 4JGDA 4R7WA 3UCQA 1QK0A 2ON3A 1LWHA 3B0YA 4IP5A 3YPIA 1K9FA 2VCCA 4D2JA 3VD3A 5FJTA 5HXMA 4KMQA 4AZHA 3SRFA 4YJ5A 4ZL1A 2PTDA 2IPFA 5LIKX 4AF0B 4YN5A 1F74A 3A3HA 1SZFA 1XUUA 4B3ZA 3CYJA 3QGVA 2ZZ7A 4XD5A 4O54A 4G5DA 3OHMB 2ZUNA 5DT5A 2P1FA 1FUYA 2BVDA 4FHAA 2OB3A 1KRBC 3NQEA 1JUBA 1XIHA 3K4AA 4GUHA 2HS6A 4NG3A 1FWEC 1TA3A 3P61A 5HUOA 1VF8A 2Z1VA 4F2BA 1EBGA 5G4HC 3V18A 1XYBA 4AB4A 5CC6A 1W3TA 3MV11 2EG7A 1YDNA 1XWYA 4Q8NA 3SAZA 1XLDA 1W9BM 4HK6A 1UW9A 3V5CA 4ZR8A 4F66A 4IG2B 2Y8VA 1MXSA 1PKMA 1WBJA 2FTWA 4UFKA 3N73A 3TR9A 1O66A 1TPWA 3EA1A 3VE7A 5K3VA 1JDDA 5K4XA 1LRNA 2GK1A 3LZ3A 4A3HA 3H2OA 1V6XA 3L4TA 1A53A 2OSXA 4L1GA 5I3IA 3QJAA 4PCTA 3VC6A 1DE5A 1EDQA 3P93A 4P8UA 1W1TA 3WDQA 4Q7BA 1KCZA 2OO6A 5FF0A 2OOFA 3DOPA 2PI6A 3ES7A 1Z8AA 3FGCB 2ALDA 4LPCA 2ZIDA 1Q6DA 4GH1A 4M82A 4MPQA 4K36A 5F1UA 3LQLA 1H09A 4MUZA 3TTOA 4AWSA 4MAVA 3M0JA 3TR2A 3PHAA 3FVDA 1KM4A 4IQJA 4WSKA 1KM0A 2NZLA 2DT3A 4F0MA 4G7FA 3T42A 1ZHAA 4ZO7A 3RLVA 3WY1A 4WDUA 2EAWA 4FS9A 3I7QA 3LENA 4JKKA 3W2LA 3CUJA 2DEPA 3SJNA 4B15A 1UWTA 2YL8A 1JDAA 4EXBA 2ADAA 4I5RA 1E4IA 4NY2A 1KBBA 3NR0A 3AHVA 4XAGA 1VHNA 3K1GA 2W63A 1E5JA 2ZUVA 1FWCC 3H2FA 3NSMA 3TTSA 3T0TA 3NYDA 2QJHA 3ZS4A 4CKQA 1QI2A 5LA1A 5SWUA 5E0FA 4C6LA 3GBEA 2FKPA 3R10A 3QGAC 1TSIA 1TVLA 4O13A 3WH9A 3LHYA 3AIEA 2IS7A 3VIIA 1V7AA 1OFEA 3GNOA 3U2EA 3NZQA 4RJEA 3U48A 2VURA 1LBMA 5I02A 3IAQA 2G97A 4UNLA 5HPCA 1B5TA 1KW1A 2VOMA 3CHCA 1TVNA 5HMSA 2A85A 2OKTA 2WCAA 5HQLA 2ALRA 1J5SA 3L2MA 1P0EA 1L6GA 3W1PA 2WV8A 4JHOA 3SFWA 4B9YA 1S2VA 2VFGA 2C1HA 4IJCA 4LYKA 3CH0A 2WVVA 3M41A 2YW4A 1UC5A 1GORA 3W7GA 1KQZA 2E40A 3XIMA 2WLYA 1B90A 3CIXA 5CG7A 4C65A 3S1GA 3QV6A 2QT3A 1ZBKA 1ZENA 1A4LA 2EKCA 4JR5A 4B5WA 3GB6A 1J01A 4C1LA 1D3CA 1J0KA 4GFSA 3BL3A 4S39A 2OJPA 2QAPA 2Z27A 4U2ZA 1B31A 3T6CA 4HPGA 2DW7A 4U28A 3L2IA 4CEUC 2ZX6A 3W27A 2G5WA 1XQKA 3N12A 1Z89A 2RAGA 4RUBA 3B0XA 2J7HA 1K9EA 3TW9A 3GVQA 4JTFA 3T05A 3TN5A 2CU0A 4IFKB 4N2YA 4NU7A 4LAUA 4Z17A 4JBRA 1HXJA 4O1BA 3FA5A 4BQ2A 3FA4A 3GR7A 3DCPA 2D1ZA 4CN4A 2WHKA 4J27A 3GW3A 4RPPA 1S5TA 3N6JA 1JYNA 3DECA 3UXKA 4Y6GA 1FCVA 5CXPA 2QV5A 3CUGA 1T6MA 4ZMGA 3KM8A 4ZA0A 1BGGA 3EX1A 3VGBA 2QPXA 4Y9AA 1KWGA 2ZRXA 3LBCA 3OLDA 4JTDA 3LPPA 3Q2DA 3KXQA 1ZQ5A 3T0DA 4ICCX 4PGLA 3KBJA 3CZLA 3VNYA 1TTIA 4JTJA 1VBRA 2XIJA 1P0BA 4J4KA 1X8FA 4TUFA 2IPGA 1H7XA 2WPGA 3GHRA 1CX9A 3M0YA 3GYEA 1EBHA 3N2TA 3IK2A 3WENA 2GDVA 1EX1A 1I60A 2DORA 1AA1B 1O5KA 2HCVA 7ENLA 4BKNA 1U5JA 3DG3A 1O1HA 4LAOA 1H41A 4LRSA 4QDPA 4JICA 5T9BG 4C1KA 1GOXA 1RCXB 5G1YA 4Q7NA 4Z1BA 3APYA 3FVMA 5BOOA 3REQA 2X2GA 4IUOA 1W54A 3VMPA 3KLKA 3LHVA 3S0CA 4KQNA 4AEOA 1UWUA 1O5QA 4LUIA 2WVTA 1KRMA 4FOUA 3KX6A 4J5NA 4W89A 2DQWA 4HPNA 3WUBA 3I6EA 3S5NA 1ALDA 4GUFA 2EHHA 5C8BB 3GDMA 4P5UA 1BKSA 3NDZA 2AKZA 1JQVA 2RGLA 4O57A 3MQTA 1DVJA 4CD7A 2O7SA 2FHCA 3MY9A 1E1CA 2XFWA 4PMQA 2YDAA 4DLFA 5D9MA 3GK0A 3SDOA 3AS3A 8CGTA 1OFBA 5DCEA 1R9XA 3WLJA 3M0MA 1HFBA 1K8ZA 3G1SA 4N42A 1G7VA 1C91A 2ZZ1A 1EJ7L 3IUIA 1R3WA 1ADOA 3CAQA 3SUTA 3TJIA 3TYBA 2OPJA 3U5YA 4KEVA 3CASA 4ZQPA 1VCGA 4PTMA 2YXXA 2R1LA 3GBDA 4RCXA 1E0TA 5FSEC 1V6WA 2WSQA 3MBFA 3MP3A 1TV7A 2CESA 2GOKA 3FAXA 1SMAA 3OIXA 4RZBA 4LUJA 2H6RA 3JZEA 4AY7A 3PNUA 4XK2A 1UUQA 2E77A 1QHPA 3T55A 3II1A 2CZFA 4XZWA 4EWND 1ZBWA 3PB0A 4NIRA 2YDRA 5HAOA 4O52A 3AQUA 3DU0A 3E38A 2H3BA 1QATA 3GZ3A 3UXIA 2OG9A 2QCEA 4LANA 3ARPA 3ITGA 3TC7A 4NRSA 3PAJA 3AROA 3P14A 3WDRA 1VS1A 2IQTA 2PC8A 3W82A 1BVWA 4NAFB 3EWYA 2V5CA 4MJ4A 3EB2A 1R9YA 1K7XA 2UBPC 1UH3A 1CNVA 3QVQA 1WDQA 2ATSA 4W88A 3W84A 3QHNA 4EF9A 3WEOA 3I3EA 3OA5A 2PWFA 3DYMA 1Z48A 4EX4A 4MB5A 4PUJA 3UWYA 3WQDA 1XINA 4FNPA 4KF1A 2PTXA 3H8AA 1XCXA 3LA4A 1YNPA 3GC5A 5IFPA 1NOUA 4AY1A 1TG7A 3HPSA 4AMAA 2VC6A 1QNRA 4BF7A 4XAYA 4YTTA 2J7GA 1OIMA 3TAOA 1AQHA 1X1OA 4PUMA 1UH2A 1OK4A 1J4EA 1DPMA 2YPIA 5A6SA 1LOSA 2QF7A 2Y5EA 1HGYA 1NP2A 3UG3A 2OELA 3R8RA 4FNRA 1PDZA 1C7SA 1QAPA 1IZCA 1G5AA 2WZHA 1XP3A 2NWSA 2PA6A 1PPIA 2HNEA 1JUEA 3NXFA 1FWHC 2C13A 1TCDA 2GJRA 4A8RA 1OC7A 3GU2A 2QJNA 4FNUA 5KINA 1VRDA 3UEQA 1JRBA 1UP0A 3L9CA 4KFNA 3A64A 5LSMA 4H9UA 4GQBA 1GNXA 2BZNA 1JRCA 1Y5VA 1OFQA 1HKVA 1P7TA 1W37A 1RPKA 4JYEA 2J66A 5CJ5A 3NZ1A 4J3UA 4PULA 4FOJA 2ZFAA 4FR6A 1RY8A 5HUPA 4ZODA 1GYNA 1JD9A 3LCXA 1J0JA 1XS2A 2YSWA 4AUBA 5CBJA 1QNSA 3STCA 2WNWA 4TR9A 4WGHA 3EDDA 2OR2A 2ISFA 4MOZA 1FWRA 3GIPA 4LGXA 3VGGA 1ZPTA 3F7JA 4O8RA 4CU7A 4AD0A 1CGTA 1EOKA 1AL8A 3HFTA 3BURA 1FOBA 1DIOA 3NZRA 4CCCA 1RR2A 3BTNA 3QFWA 4O0QA 3TTYA 9RUBA 2VZVA 2Y0FA 3NCOA 1JZ5A 3R1ZA 4E5TA 4ADTA 1G0CA 1EC9A 1GGOA 1WAUA 1GOKA 3TNBA 1GVOA 3HGSA 4RK8A 5ABFA 3F5KA 1TIWA 4MWAD 5HNRA 1W3JA 2GUBA 2PU0A 3KBNA 2JK2A 5FCZA 2OX1A 3FKKA 1E6RA 3WD1A 3V35A 1P43A 1HX0A 3B8TA 1ENUA 1XDLA 3WQ8A 2PU1A 1IWPA 4QM1A 1FBAA 5CLWA 4L61A 4C6JA 2ZZ3A 4ZQCA 1CW2A 1NY1A 3BJFA 1BTMA 1R3VA 5FF7A 5ECVA 1K03A 2FVMA 1OG6A 1RQEA 1DEDA 3IJ8A 1M41A 1EJXC 1W3HA 4PCNA 5HNTA 2W92A 3TDFA 1XLFA 3GVVA 4J28A 2R1MA 2VWTA 1L6YA 2VI0A 1DXEA 3EPNA 4LUSB 4QROA 3AU2A 3IGSA 4OV4A 5ENLA 1VFFA 5FIPA 2WHLA 3EDFA 3PBGA 2GPTA 3GD6A 3O9NA 3CL8A 4NJJA 1LLOA 4PSPA 5A2BA 2PWHA 3LS9A 1YE4A 4JL1A 3M7WA 1MW1A 2FGZA 4IOTA 3WQPA 3H2MA 2VVSA 3S6TA 2C18A 2BTMA 4C5YA 6CGTA 4MFDA 1XBZA 3FV9A 4AY8A 2WSKA 2BGQA 3IACA 2JQXA 1Q4WA 3H7VA 3PPFA 3OG2A 1OYCA 1E73M 2QIIA 1YMYA 2GSHA 2E25A 1QBAA 1YDOA 4Q7IA 1DTNA 2XHYA 1QTWA 3BCJA 3T07A 1XL9A 3GUWA 2Q02A 4M6QA 1O94A 3KRSA 1E0VA 5E0KA 1UP3A 2J25A 4GJIA 3RM8A 4M1BA 1B3ZA 1ITUA 4DUXA 6TIMA 4C91A 3IANA 3I7SA 2WXDM 3CLMA 5LIUX 4PN2A 5HPOA 1EKOA 2HZGA 3UJRA 4IISA 4G9PA 4ERAA 1T40A 1TKKA 3S5YA 1ECEA 3V3WA 1JFXA 4HSOA 1Z7AA 3R43A 1HTIA 3W1MA 1IWAA 2WSPA 2PDNA 1JAKA 2EPHA 4JTIA 1TIMA 4GO9A 5LA2A 2NQHA 1JF5A 3GNNA 4GIYA 2ESCA 3UCCA 3FKRA 1M3UA 5H8UA 1PXGA 5G5IA 1CCWB 3PZQA 3JU2A 5CZSA 1ITCA 2KAUC 8XIMA 3DFOA 3UVIA 4GISA 1QFEA 3Q37A 2WB5A 2IQDA 3VK5A 1MO0A 4WY0B 2HK0A 3SUUA 4WKAA 3VUPA 2HBXA 1MUWA 2PWGA 3CQKA 3GXMA 4TIMA 5F2LA 1TJ1A 7ODCA 1WUEA 3V5FA 3WK1A 1BYBA 1X98A 2VZTA 4MWAA 1PJ9A 3SI9A 5B7ZA 2QDGA 2WC4A 3G3MA 3M0ZA 1UP2A 2IKJA 1C8QA 1GEHA 2E9LA 2NT1A 1J2WA 4UR8A 1LORA 3CQJA 3TEVA 1C8YA 2QCGA 1UG6A 3UPMA 5HR7A 2PF8A 4PUUA 1U1HA 3LU2A 1V7YA 4GQQA 3QV8A 3TW7A 1GOIA 3QQ1A 1A49A 3GHUA 3MB9A 1QPNA 4XO6A 1PB0A 4AWEA 4NF7A 3NQDA 1GVQA 4QJ4B 4JN6A 3TSDA 2QLYA 2O92A 2DIEA 3MJMA 2WSRA 1XGZA 3IJDA 4B92A 1HGWA 4I7UA 4PB3A 2I57A 3K1DA 4Q6JA 3MA8A 4C6DA 4O10A 4LS2A 3A9BA 2ABBA 2IKGA 4GUGA 1VAHA 1J0IA 1J93A 1F6KA 4AH7A 3EDEA 1FWDC 1QPKA 3NL2A 1V03A 3KTXA 1LRQA 3AMGA 1K4GA 3GY1A 4U10A 1TJRA 3FS2A 3BO9A 1AK5A 3H70A 4V15A 1WKYA 2DSKA 2J7EA 3CGTA 5C9ZA 4XZNX 2WVUA 3WD4A 5C7VA 4NRRA 3OVRA 4AZBA 3S2CA 4ACZB 4MWAE 1ADDA 3IIVA 3U9IA 4ZO6A 3SGGA 4LTSA 3M43A 1C9DA 4FXRA 4GXMA 3U7VA 3DGRA 3WQ5A 9CGTA 3H2NA 4TOQA 6ENLA 4LAMA 5DCDA 1QT1A 1V0LA 3W1QA 4HNUA 3EWBX 4GX9A 1O6IA 3S9YA 2FZMA 1Q6QA 3FXGA 2G50A 4F9DA 1E0XA 3W7LA 4UMBA 2PSNA 4DXKA 3E2RA 2VFEA 4H9VA 3ARRA 3GW0A 3BWWA 2F9RA 3R94A 4B5SA 1GK8A 3KOWA 3WFAA 4XO7A 4HPXA 1ZCOA 1GQKA 3ORWA 3R0KA 1HKWA 3NQCA 1XD1A 1U2YA 1QO5A 4PTVA 4DXXA 3EXRA 2J7CA 4S3KA 3PBVA 4A3RA 4D1IA 4IM4A 4GKLA 4ZXOA 2UWFA 3P8IA 3TE9A 3CYVA 4W8BA 1AZ1A 2XN0A 4QG6A 2BOGX 3EA2A 4DF1A 1BG4A 2PCEA 1ICPA 2DZBA 2WMJA 1ZJHA 2VM8A 2Y7FA 1QW9A 2XM1A 4OFCA 3FOKA 3OVPA 1OCNA 2DZAA 5FEXA 3AI0A 3TYEA 3M7SA 5D2YA 4H1ZA 1VBGA 1MI3A 2WHJA 1YXDA 1A4MA 5TD4A 1DXFA 3BLOA 1J6PA 3PR2A 2GFTA 1PTDA 1SFSA 1M68A 3G2GA 2VKZG 4JQ1A 1XLLA 4Z0JA 4LUYA 2C1GA 3FXYA 2PP1A 3NM1A 4FEZA 1K4HA 1G1YA 4WDXA 4Z2HA 4ZOCA 1B3YA 4J3WA 1WDWA 2VGGA 1IT7A 5T8GA 4TX6A 4L4LA 1TRDA 2TSYA 4L5ZA 2OZTA 1O5RA 3A4XA 1JYXA 3FHAA 2VQUA 4S38A 3IGHX 3AIUA 3KLLA 3WL0A 5E09A 3RIKA 4IP4A 2A7RA 3C0QA 4N7QA 3MCMA 2ABAA 4Y8FA 4WXYA 1U5HA 4MHBA 4R9OA 3H6OA 2VD8A 4PEEA 1HP5A 1R6WA 3WLSA 2X1SA 1CXLA 4XZ9A 3W2UA 2FJKA 3VIMA 1PO9A 1MUMA 4QG9A 1E6QM 3B9DA 3WQFA 2D2GA 2X41A 3Q45A 4IMDA 1QNQA 4JAWA 3LNMA 3OEXA 2VMFA 4G2DA 5I7GA 4DF2A 3NURA 1SYTA 2NXHA 4O19A 4NX0A 3TJLA 3W7QA 2QCNA 4JX5A 1YPXA 2EKGA 3F4NA 3ITCA 3MCOA 4L6HA 2PUZA 1ZUAX 1BG9A 4JHMA 4C7FA 4GI6A 3O16A 4JTEA 3VDBA 1X8CA 2GGHA 3LLDA 4CQBA 2WMKA 2YR1A 2FVLA 2G4JA 2NVCA 1TZ7A 4LQ1A 4W7WA 3SECA 1MW2A 4DY1A 1TMQA 4WUIA 2A1YA 1XICA 1ZY9A 2O9OA 3WD3A 3GHTA 1DWGM 1OADA 4FX8A 1O12A 4M8UA 4GZIA 1XCFA 3DI0A 3KVJA 3ZVHA 3GDBA 6A3HA 1QXLA 1QWGA 5A8QA 4JCMA 2AQVA 3OGRA 4F2UA 4DJDD 1KFEA 1E56A 2ZX5A 4K8GA 2MANA 1R5YA 2A3HA 4OBRA 1YBQB 1HP4A 1OK6A 3GUGA 4NQ1A 2FFIA 2XIIA 4YS1A 4CNUA 4F0KA 5IFTA 2I56A 1NOFA 1MW3A 5CPLA 3SUVA 1UMLA 3USBA 4ZSTA 4DUOA 4GACA 3G22A 5G2IA 2BV9A 4QGCA 4UTUA 1S3HA 3CHDA 4WDWA 1KO0A 3VOJA 5DBUA 2Y85A 4XX6A 5KEZA 4GOAA 2OOGA 1TPB1 1XLHA 4NL1A 3PUDA 3VIOA 1KFKA 3QY7A 4CQDA 4F9JA 3AIQA 1HKJA 2HV5A 3DHFA 4PRTA 1MUCA 5A94A 2VEFA 3VFLA 2JKAA 1W3NA 3WQOA 4AU0A 2W67A 1ISXA 3NG3A 4P7NA 4OBTA 2C14A 4GVFA 1OIFA 3W1AA 3VIFA 3ANUA 1H0IA 1XRVA 2Q6ZA 4PUNA 4W4QA 5BYWA 3OLEA 4M51A 1EP1A 2HS8A 2PTWA 5KZ6A 2PDUA 3S42A 4LEFA 3SCRA 1NF0A 2XFRA 4KRZA 4Q8UA 2GVJA 1DWAM 4M24A 3G1FA 4YTRA 3NQFA 3CT2A 3R8HA 3R7MA 2TYSA 1FCQA 1H60A 2FYMA 3N6QA 4E4PA 1K70A 2TPSA 4WOZA 2P50A 2WK2A 3VD5A 2WYSA 1OX6A 1R47A 1DTUA 1JZ2A 1ZJAA 1U1UA 5TIMA 3KBSA 1QBBA 3LTPA 3SY5A 4PB4A 2Z6JA 1G01A 4RZ5A 2PDGA 3EXTA 4LAZA 4XKMA 3BMWA 1UWSA 3KVMA 3OTRA 4H00A 5K9XA 3W7JA 2NQZA 1TWSA 4LC6A 4ENLA 3C4UA 2E9BA 1TR9A 5GVJA 4GVIA 3B9OA 1P6BA 1KTNA 2LLEA 3RPMA 3EX2A 1LUCB 1WXJA 5C54A 1UD6A 2DT2A 2Z4GA 4CVWA 1BF6A 2YBTA 4HK5A 4OOZA 3SCOA 2E9MA 3G0UA 4JDBA 4C5ZA 2IPJA 4E2BA 2ZA2A 1Q6RA 2INZA 2NW0A 3FIGA 3LG3A 1FDZA 3APTA 2OMAA 1D3HA 1VCVA 4I7WA 1O5XA 2GOUA 3ERPA 2E28A 2W5FA 1AQ0A 2Y2WA 4KFPA 1XLJA 1U30A 4OQVA 3LZ5A 4PMYA 2XISA 1LCOA 1D8CA 4QRNA 4ILSA 3GTXA 7TIMA 5DY2A 3JW7A 1OHLA 3IIOA 4XZBA 4UCFA 4W7UA 5FAGA 3UT0A 3GG7A 3I3BA 4CNPA 1BKHA 5FI8A 3K8LA 1N8WA 2FH6A 3BCFA 5IM51 3SY8A 1FH8A 4MJMA 3TOYA 4FZIA 3W81A 2GLKA 4IFRA 1S2CA 3WLPA 4R85A 3UETA 1UD8A 1VGAA 1MXDA 3UR7A 1AUSL 4GI9A 3P3BA 5HATA 1PL9A 1IEWA 1GONA 3QTGA 1RALA 2R9RA 2DQXA 3V4BA 2KZHA 3E74A 3IJQA 1ITXA 1GKPA 3ZFHA 4GRSA 4OU1A 2EGZA 4HB7A 1OZMA 1XSKA 1JDEA 4PRRA 3UZWA 4AZCA 3VM7A 3LXBA 2HWGA 3LPFA 2EJAA 3AIBA 4Z08A 2QPUA 3I6RA 4JIIX 1BQCA 4TVDA 1DJWA 4PSRA 3PF3A 4L4OA 4HN8A 4QAIA 1O68A 1I1XA 3ITYA 4UTTC 3BLIA 3XISA 5AVNA 4Q4MA 4G56A 4YMZA 5HR6A 3PUGA 2BODX 3MZ2A 4X63A 1SW0A 2Y7DA 3B9EA 1W9VA 4JTRA 2NX9A 4MWAC 3QMSA 3B8SA 3UJEA 1V3KA 1VYPX 3TCEA 2OQYA 2D2HA 4PMXA 5GNXA 3LV5A 2WKLA 3BAKA 4ZOAA 1H63A 3N9SA 2E5CA 2GJXB 3KS6A 4GI8A 1DKWA 3W7PA 4BEQA 1B1YA 1UZDA 3ZYZA 3MT1A 2FB2A 3VIHA 4Q8QA 2YZRA 5BRBA 2PE4A 2A3AA 1R46A 1W1PA 5F2GA 2PPGA 3M6DA 4HHPA 2GJLA 3STEA 2B7QA 3BSMA 3M07A 3CQ0A 2AL2B 4M0XA 1JZ7A 3UPBA 4GBDA 4ZO8A 1Q45A 4H7ZA 1Q7MA 4AZ7A 4U4MA 2CFFA 4MZ1A 1S2TA 2HVOA 1SJBA 5IDZA 1R0MA 2FTPA 4GIRA 1GHRA 3N9KA 2G3JA 1H5VA 2OODA 2XYLA 5AZ0A 1H4PA 3QZ6A 3NIYA 3WBEA 1X96A 4GIEA 5IRPA 1Q6FA 3T9PA 1MZHA 1NDYA 1SW3A 1W1IE 1DJGA 2UV8G 2ACQA 5J8LA 5D02A 5C9RA 4POCA 4S3BA 3L65A 5AZ1A 2JF6A 2IXVA 4IX0A 4DNHA 5H91A 1LBLA 3T44A 3VIPA 4YYCA 1FKXA 1BQGA 1JVNA 1VKFA 4TU1A 3EBVA 3MDWA 4MNMA 4CNOA 3N2XA 1FHDA 5LZLA 3CPRA 3U0HA 3WLRA 1H7WA 3ARQA 3GFZA 5HJXA 2NT0A 1TR1A 3BSGA 4LAKA 1JZ3A 4HYRA 5BXRA 2VX7A 3HPXA 1EF3A 2Y62A 3VDAA 5I3KA 3MANA 4M6VA 3S2MA 2NSOA 4BWLA 1YYAA 4O15A 3URNA 5AHLA 2OT0A 1AJ0A 4DO7A 4F0LA 1XIDA 2YA1A 2QUTA 1ZZMA 2V82A 4DWSB 1S2AA 4C6IA 3QTPA 5HQEA 1TA3B 2J9XA 3KTCA 1PSCA 3ALGA 1W8GA 1L8PA 1SZNA 1WQ5A 4JHZA 3C2FA 1L2QA 3UESA 5MKGB 3D6NA 1RCQA 3B0UX 2BP1A 4OTKA 1IR1A 4M3PA 1ELSA 1XC4A 4TV5A 4YCPA 3OGSA 3IV3A 4H01A 4AF0A 3KTSA 2J7BA 4KGLA 3EGJA 1AL7A 1EXPA 2G3NA 2DZWA 4ORIA 4R33A 3LGEA 5AC6A 1F73A 1VBHA 3T0AA 3OBKA 4N9CA 2VNCA 3W7EA 1OX4B 3S8HA 1CLKA 4AZCB 3T2OA 2V30A 1VH7A 3BG3A 4EPDC 2C79A 1JYWA 4YHGA 2QDHA 3TXZA 1GVFA 1MNSA 1RQHA 2RHGA 2PDHA 3LMZA 4I7VA 4UTFA 2OZ8A 3CMJA 2DDXA 1RH9A 3I4KA 3NSXA 5D30A 2NUWA 4PMRA 1ZS2A 1FWAC 3AJ7A 5DMNA 1R85A 4E6MA 1JUKA 1TX0A 3AHTA 3MS8A 2CLEA 3WF0A 3M46A 3NVDA 1R38A 3SCVA 3BICA 4LVAA 4FSAA 1QHOA 1JYVA 5C55A 3PSWA 3WJSA 1AMYA 1ZNNA 3U6WA 1G4PA 4G7EB 4S3CA 5T26A 1G94A 3W7IA 4H8UA 1SO6A 1F4HA 1P48A 2X1IA 2A3EA 3LNPA 3BOXA 4KIRA 1H7RA 4Y8EA 3UG5A 3VGDA 1QPQA 5G1MA 1FWJC 1EWEA 2ACRA 1ZP4A 1NM9A 4NUWA 3WDPP 3DZ1A 3PTMA 4JTHA 1UZHA 2JBMA 3BPWA 4HA1A 3VNIA 4O0ZA 4DO5A 1GZGA 3RM4A 2OWXA 3OZYA 2BGSA 5EBUA 3SCPA 3FEQA 3VKJA 1KM1A 3ABRA 4AIUA 3WQ4A 2I16A 4JFUA 1LOLA 1S3TC 2DVTA 1UQYA 3HPFA 1HJSA 4NI8A 2ZE3A 4HZ8A 4V33A 3LX9A 3FHQA 1NELA 2HROA 4QNEA 3BOFA 1V08A 5C2GA 2QGYA 3OYXA 1VFUA 4PTXA 1UZ4A 1XBVA 2VX6A 3GDKA 3LI0A 3R4IA 3M5YA 2V5BA 1FCUA 3ANYA 4Z2LA 2FB3A 4LJ3A 1N8IA 4CEXC 2OT1A 4RX0A 1HKIA 2W91A 1C8VA 1I0BA 1XRSA 2XVPA 4JYFA 2XSBA 1EYEA 4GA8A 5DT7A 3CL7A 1GOMA 4XV0A 1DL3A 5I0DA 4N9BA 3ARSA 3W4RA 3VIJA 4XKYA 4Q4KA 1VYSX 1EJWC 1VJZA 2PDCA 2EPLX 1FXPA 3ZT5A 1MYRA 5G4EA 3GDRA 2XFYA 5T9CE 3OHIA 3AYSA 3N25A 4YTQA 2C1IA 3VZYA 3WK3A 5AB3A 5EPDA 1UR0A 1AG1O 3AOFA 4QXIA 4IL2A 1E0WA 2V2CA 3TH6A 1ZBVA 1RQBA 1N82A 2HTMA 4R34A 1NARA 1RHCA 2G3FA 5G4WA 3LCWA 4MYXA 3W76A 3OGVA 2B4GA 3AHXA 1E1CB 1AW2A 3O3RA 5LIXX 2NLIA 4GY1A 3L0GA 1NIUA 2I14A 4ATDA 2OWWA 1IYXA 1OM0A 1VFMA 4GQGA 4G1NA 1B3VA 1LQ2A 1Q3NA 1XIJA 5FA5A 5AN7A 3WDHA 4GY0A 4J3ZA 2DUZA 3VX1A 1RV8A 3LOTA 5KMYA 2UY3A 1YXYA 1AFSA 4YLWA 4DZIA 4HZMA 4G6CA 2Z29A 4PZVA 2QV4A 4ZOEA 3BAXA 1E71M 5EMLA 1NAL1 2GDUA 1I75A 5CSSA 2DSUA 1XC6A 5LGXA 4DJDC 2QJMA 3SIMA 5K2ZA 5D2XA 5REQA 1VFTA 2OYLA 4C1NA 3BLFA 3NL5A 5CAKA 1TV2A 4NNBA 3RITA 3MBDA 1DWIM 1OFOA 4Z2IA 2CC0A 3LEPA 2QGHA 1TPFA 1LL6A 4V27A 1Z6KA 1WNOA 4FXSA 3CO4A 5JQ9A 1DQXA 4GK8A 4JY8A 5CPTA 1FP9A 6XIAA 1BWKA 3AU6A 3MSGA 1NQKA 1W9DM 3GXTA 1K6AA 1AH0A 2PDXA 1W1A1 1TWZA 3IJ9A 3VD4A 5HBFA 5AHNA 1O60A 4DBUA 3CAKA 1SR9A 3ICJA 2UY4A 2J75A 3WF4A 4W84A 4IQLA 1PCKA 2DGAA 4DO4A 3L0KA 4F3HA 3H7RA 3N2CA 1JZ6A 1VHCA 2CPUA 5C71A 3P60A 2HMCA 3VIKA 3CT7A 3NM3A 1SU5A 4LV9A 2FMOA 2J13A 4RE3A 1U33A 3DFYA 3RMJA 3RXZA 2ZX9A 3WNKA 2Y63A 3G8RA 2VXNA 4P7OA 1T96A 4YVXA 4M81A 4O17A 3RCNA 4CNSA 3ZOAA 2ISWA 3LXCA 3T8LA 2CXGA 3D46A 4OBSA 2PRLA 3WMSA 3FSUA 3ALFA 4A3YA 3NUKA 1GOQA 3DYOA 1X97A 1ZU8A 2FZBA 4Q8OA 5C6MA 1JFHA 1VFHA 1VP5A 1V6UA 1V02E 1Q2RA 3FK4A 4LF2A 2H9AB 1V3IA 4L56A 3AWNA 3I68A 2WLZA 1JGIA 4DM1A 3B03A 4Q8PA 3W02A 1F3EA 1TPVA 4Y7EA 3H2EA 4YPJA 4AYSA 2XWDA 2GVLA 4QE4A 3CEUA 1MZRA 2O4QA 2WQPA 4UFHA 2TMDA 3HQOA 1UPPA 2GK1B 4Q8MA 1VLIA 3Q94A 4XZIA 3ZZ1A 1XQLA 4QG8A 5DMLA 2WQDA 2Q8XA 5HOSA 1G4SA 1VLWA 1PZ3A 2KX9A 4PTNA 2W79A 1XBXA 1M5WA 3K13A 1KV5A 1KLZA 3STFA 4IJRA 1NSJA 5BNKA 5F7UA 4GUJA 4X61A 5CGMA 2ZRWA 2PDJA 3PVFA 5PTDA 3WF1A 1N55A 4S1FA 3RU8X 4R5EA 2XH0A 2WMFA 2XN1A 4GI4A 1F76A 5FEWA 3VKCA 1GOWA 2HSAA 4RKAA 1HO1A 3AICA 3ELFA 1KKOA 3EWDA 1HVXA 3O06A 1KCXA 2B81A 1DHPA 4A21A 1DJQA 3EB3A 4C1NB 5ABGA 2H90A 3QQ0A 2VFIA 3DDMA 4PFMA 4AG0A 4JTGA 3RHGA 3SN0A 5JU6A 2AL2A 1YTDA 4US5A 3LV6A 2FMNA 3EX3A 5GQBA 4XWUA 4UQ9A 4DUVA 2EXOA 4ZTYA 3GH5A 1LJYA 3RFAA 3QYSA 1B9BA 5BMXA 1PX3A 3IIZA 3P74A 1AQFA 3TVAA 3VOCA 3IIXA 3LHZA 1KV8A 3WUEA 3PANA 1UR8A 3WNNA 4L6OA 3KBVA 3GU1A 5F1VA 2EBNA 3EZ4A 3O6AA 3NDOA 3PBUA 4PCPA 3CK5A 3QC0A 3MVIA 4YXGA 3W86A 1Z44A 2V9DA 3W2NA 1JDCA 1PDYA 4W5ZA 2HE5A 3HGJA 1QCWA 1RZMA 4H8HA 1LP6A 2XG9A 4V1YA 3A47A 3N17A 1QW7A 2ZA1A 4XSLA 4PBGA 3UBPC 2XIMA 3L68A 3WEMA 3BW2A 1J18A 2VRKA 5I5RA 1TE1A 3W7HA 4MJ2A 5FAJA 2DUAA 4PMNA 3CV1A 1XLKA 4IHCA 4LF1A 1EOMA 3QV7A 4LBUA 4PCFA 3WSUA 4UOJA 3MMTA 1T7LA 4AXNA 4GZ7A 4J40A 2EEXA 2VC5A 5HJYA 3E0VA 3HJEA 4KETA 1OG0A 4ZEPA 1SR0A 3MJYA 1F05A 4HSHA 3O1NA 4HNOA 3FN9A 5CPOA 2BS9A 3SO7A 5I3GA 2XDFA 4QAWA 2XVGA 4W85A 3PPCA 3VCRA 4J9JA 2OGJA 4PE8A 2PF0A 3PG9A 3MZNA 1H7PA 4KH2A 3WLOA 3WJXA 3QW3A 3UNTA 1JCMP 4MMWA 2YB4A 3PZNA 3ZSTA 2PGEA 2FPTA 4UBPC 4Q3MA 2PGFA 2NXGA 1EYWA 4UFJA 4MKNA 3W37A 2V5JA 5F4WA 4H9MA 2DV0A 5HMFA 1Q63A 1A0EA 3T4WA 1TPC1 4JKMA 4KPLA 2CERA 4M29A 1K02A 1POKA 1EB3A 3SADA 2HBVA 2HQAA 3HG4A 3PZMA 4XD6A 3W3OA 4Q32A 3UXLA 3R13A 2C3ZA 1CGUA 4LS1A 3BZGA 4BEUA 2YFOA 2ZXQA 2DVUA 3JUGA 4LYPA 3LTSA 4ZSUA 3ARXA 3W87A 4HCHA 2UZ9A 3E12A 3NQ6A 4IIBA 4OGZA 4KGJA 3TSBA 2NQLA 3T8QA 2V2HA 4LNCA 4JKLA 1BRLA 4KW2A 3IVSA 3MO4A 4B2DA 1G7UA 3GVRA 4K6AA 4UIOA 1KM6A 1EUAA 3W88A 1CZ1A 5DCBA 4QJ5B 4PMJA 2CHNA 3IVTA 3RO8A 4CD5A 3W7RA 3STGA 2ZRVA 3FA3A 2VDIA 4JTCA 1XPYA 1V77A 1OABA 5FJPA 4CUCA 1O1ZA 4B2DD 5LXEA 4CD6A 4RNFA 3T08A 3WL1A 1CT5A 2J79A 2PZNA 2D2OA 1EWDA 1BXNA 4FNSA 3W74A 3LPGA 1K3UA 4D1JA 1HJQA 5D37A 5JIPA 1RVGA 4UTMA 2PDMA 3WYZA 1JIBA 3W22A 3PS7A 4OIFA 4UB9A 3MKVA 3WQ6A 3QC3A 4ES4A 3LY0A 1J6OA 4IQEA 3EOEA 5I3HA 1IIGA 3E0LA 4AAJA 4H8VA 1AW1A 3HG3A 3REQB 1QWKA 4P8WA 4W7VA 5D4YA 3BMVA 3G24A 3AFBA 4FNTA 5AECA 1SVDA 4GJJA 3AXMA 3OJGA 4HPJA 3TN6A 2WVSA 1CYGA 2F2HA 2J24A 5XIAA 3CUXA 1BPLB 4EPKA 2QUUA 3AHYA 3IJ6A 3LM3A 2JFEX 3ABZA 3DC0A 1TX2A 3FFSA 4D8AA 2GUYA 2ZVRA 4DVOA 2I9EA 2CKRA 3N2MA 3SRDA 3P81A 3RG6A 3C2YA 1R7AA 3AJXA 3N2BA 2PDKA 4QS6A 2JIEA 4C6BA 3A3XA 1CGVA 2X09A 4WJ8A 1C29A 3GZAA 3EKZA 2GGIA 4R53A 1WKEA 5J5RA 2MNRA 3DN5A 5CPQA 2VOTA 3WBWA 2YXOA 4RNHA 4TO8A 4U5IA 2RDUA 1R3QA 2JF7A 5DMMA 2YCLB 4H7CA 3ATZA 3GAKA 4Z0SA 2J88A 4WKHA 4EK7A 1X6UA 4Q8VA 4IMGA 4O4WA 3PPGA 2CEQA 3W0KA 5CG0A 2OX4A 3I10A 1FWTA 2X0SA 4XD4A 2QXWA 3RLHA 3N18A 4DBEA 3HTWA 1FHLA 1H50A 4S3EA 3ZJKA 4X0NA 4PUEA 4BJHA 3R12A 1J96A 2VZSA 1BXCA 3NDYA 4NJHA 2QHAA 2E8YA 1W31A 5LNUA 1SO4A 2FFCA 3P5YA 3ITLA 2FZ9A 3CZGA 1C92A 2J27A 1GVSA 4PMOA 2W9MA 1QOQA 2OLSA 1XG3A 1BYCA 2CWXA 4UQDA 3U2CA 1TB3A 3B4UA 1X38A 4J2PA 3TONA 5A6TC 4LFYA 3DFQA 4RLIA 3UXDA 5GNZA 3T81A 2VTFA 1KXTA 4NYYA 3ZXWA 4QISA 3ANVA 5EMJA 3WMCA 4DIAA 4BCEA 2BOEX 2IQ0A 4WRHA 3LMYA 2FJUB 2VGBA 3URBA 3WJWA 3DKLA 3LB0A 3RX4A 3GXPA 4ZB5A 4RE2A 2VGFA 2WNQA 4BQ4A 2IUZA 1S2UA 1KRCC 4CN1A 4HMCA 1E72M 2PDLA 3C2EA 4D6EA 1IXPA 2CZDA 2V5KA 1EEXA 4AISA 2QZRA 3PC0A 4OVXA 3LYEA 5A1AA 3L4ZA 1JD7A 3TYDA 1LT8A 4NJGA 3CZJA 1GTHA 2XSXA 1F9CA 4A3QA 4MAZA 2E68A 1HG3A 1CGXA 3VNJA 3HURA 1ZP3A 3G0SA 1KB3A 2GQ8A 4BI7A 2CLMA 3WJYA 4DELA 3CV6A 3QEZA 4WX2A 1QNOA 3AMKA 5A2AA 1IEVA 4HIBA 4KWOA 3DXIA 4LYQA 3IGUA 5A8NA 3QR1A 4P7QA 4MLJA 5FJIA 4E2OA 4PUWA 2QUMA 2TODA 4M7SA 4C6MA 4DZAA 1O95A 3MMWA 1BYDA 5LNVA 1GPWA 3WUFA 2VEMA 4YNGA 3KZSA 2B0MA 1H1NA 2YX0A 2XM2A 1DJHA 3DC8A 1BAGA 2ZE0A 4MNLA 2D22A 4IMFA 4GKTA 3Q67A 5J5DA 3N3MA 4TVUA 3H26A 1GT8A 1D3GA 3N3TA 4N9EA 1H3GA 3PAOA 1QR7A 2DH2A 4ML9A 1FXQA 1I2QA 1W56A 2QMJA 5HULA 1XRFA 3PZIA 4AZ5A 4C6KA 1KCKA 1VEMA 4RXGA 4X60A 2ZUWA 4O1EA 2YXGA 2JIWA 3VILA 3O15A 1TZ9A 1XFCA 4GFIA 4U3AA 1DQWA 2ASHA 1UWQA 1XW8A 1B3XA 1OGSA 3PN8A 1L0PA 4HYVA 1SGJA 2GYIA 3GC2A 1UOKA 3MI2A 3WKZA 3O7UA 3CXOA 3R79A 2YYTA 3U7BA 1HJXA 4W86A 1FHVA 2I5IA 2WMIB 1CPUA 2YCLA 6REQB 3TMQA 4P7RA 6PTDA 1XYFA 6TAAA 4ROQA 1YE6A 3QLLA 4B5TA 1K9DA 1TUXA 3VIGA 3KCJA 2XZ9A 2VL4A 3JR2A 3SB0A 5A6AA 3UWQA 4IPNB 4JDYA 1A5AA 4JTLA 4K1WA 3ZJ8A 2A7PA 5FJOA 4CQCA 5AC7A 3CMFA 3LCHA 2E8ZA 3BQ5A 1OF8A 2Q3OA 1OVDA 1I1WA 4XAPA 4IXXA 1WDSA 1U5VA 3O8AA 2NV2A 2O9RA 2NSXA 3GXFA 3GLCA 3VVGA 4AD1A 3T2QA 2BY3A 3CO8A 1FP8A 3M5XA 1VEPA 3HA1A 3W7DA 2YIHA 1WA3A 5A8OA 1DWHM 4IPPA 1IQ8A 2BVTA 1W1VA 1XPGA 3COTA 1GW1A 1UZ1A 3S4TA 2R1PA 4RDZA 1MNZA 3AC0A 4AHOA 2A4AA 4O18A 2F6KA 1UD2A 2J4GA 3WFLA 1IT0A 3F1QA 3ITOA 2J74A 3KDNA 2V2DA 1UKSA 3B8UA 4HNNA 2QJIA 2VP8A 4K8HA 1CIUA 2Q3RA 3A4AA 3NXLA 1KCLA 3A9IA 3B06A 2CLFA 3VZZA 1NQ6A 1NWTA 3H54A 3KBMA 3LGGA 3OBEA 3SURA 1SZRA 3J7HA 3KUMA 1BEUA 5E6ZA 2ISSA 1OD0A 2C0HA 3ZT6A 3M47A 4ZGYA 3W1RA 5HWNA 3M0HA 2P3ZA 3RM9A 4J1OA 5BZAA 1V6TA 4AIEA 3S2JA 3SUSA 3CWHA 1XYAA 3CQHA 3GFXA 4I9JA 1PEZA 2WOQA 3V0UA 3VI2A 1TJPA 3FDKA 1QASA 3N34A 3R5EA 4A22A 3DFPA 2BXZA 4HU0A 2QAFA 2FVKA 1ZAHA 3C5QA 1OFPA 5D2TA 4M19A 4O4VA 4HOXA 1SJDA 1TWWA 3IEBA 1ITQA 1HZYA 1NU5A 1WOAA 2X16A 2QCDA 4INFA 1RAKA 2VUNA 5IOBA 2P8CA 1JGMA 4JIHA 1SQ7A 1PYFA 3G1AA 2G37A 2D23A 1XISA 1S5WA 1SM9A 4DJDA 3TX9A 4AMCA 2DSZA 1BWVA 4U5KA 4E4UA 3LRLA 3W7MA 4Q33A 5DRCA 4F8XA 2GJPA 1WKDA 3TZNA 1EEPA 2R91A 4OUIA 4CQAA 4JZ5A 3G5EA 2F8QA 1FFRA 3RPTA 1VFOA 1PV8A 3OOQA 2VZOA 3AYRA 3C8NA 2RGMA 4HJWA 5FJUA 3B8WA 2NV1A 4GWEA 1WCGA 5K7JA 1LG2A 1P1XA 3AS0A 3E49A 5F4XA 4ZBCA 1OX5A 4GIAA 3QM3A 3TXVA 4ZZ9A 1H1YA 4LOCA 2XVNA 1ZTVA 2P76A 1E4NA 1EX5A 3UF9A 3SUWA 3SGZA 3GNDA 4ASTA 3ZO9A 1DIKA 3MC5A 2BVYA 3H4WA 1XLBA 2WCSA 3PB2A 5CEWA 1LL4A 5KZDA 1ZFJA 1REQB 4PBEA 1KGWA 4UCGA 3OA3A 1RJRA 1E9LA 2ZXBA 4A2RA 1PS9A 1GW9A 1Z41A 4CGTA 3LLFA 2BOFX 5AHEA 3ARWA 1TJ2A 1U22A 2VR5A 3O0KA 5ABHA 3DESA 1NWUA 5K4ZA 4UZUA 5E93A 3N11A 2XVKA 1GWJA 2CLKA 4OWGA 1Z32X 1V5XA 4GGBA 5FKYA 3RYSA 1HT6A 2BHUA 3ISIX 4WGXA 4MLRA 3VNKA 3UY7A 5LHFA 3WZ0E 1FWFC 3AUJA 4CCDA 3GTNA 1W91A 3RJYA 3A21A 1GZJA 4KBXA 2V68A 5LNRA 3TZFA 3B8IA 4HTBA 2DFAA 3BARA 2CZ5A 3DX5A 4GNJA 1I8JA 4DPPA 3W9ZA 2ZXAA 3PJUA 1KXQA 4WLCA 1MVYA 4H6EA 2V69A 3LTYA 2EPOA 2UY2A 2PDBA 4UR9A 3OG3A 4MDPA 4DJFC 3PSVA 3P82A 3IUHA 2SFPA 3U4FA 3LSBA 3IJ7A 4W8LA 1JNEA 3DFSA 1UKQA 3FW6A 4QE1A 3NOEA 4D8LA 4FXJA 1FH9A 3AO0A 1B30A 3ONBA 1ISZA 3KHJA 5IHRA 1E9IA 3S47A 1A5LC 3RNDA 1FCBA 3B04A 1R9ZA 2FDMA 2E5DA 4D6FA 3L2LA 2A3CA 1P0KA 3GTFA 3W26A 4Z2KA 5BRQA 3E2QA 3GIQA 1TV4A 4XVDA 3V36A 1O7AA 3L4YA 3THQA 3WLQA 5FESA 1LDCA 2WW5A 2GVEA 3O6DA 3W24A 1MW0A 1JCNA 4JXCA 2ATMA 1KGUA 4A8IA 4D6DA 3QZAA 2H3DA 4EPBC 4GNKB 4PYSA 1KRAC 2XIQA 3S1XA 3Q4DA 1FDJA 3EMCA 5M03A 2QDEA 2ZTKA 4H9XA 1X1NA 1EGVA 2V63A 3HO8A 2G3MA 4AIOA 3NEHA 3O6YX 1IT8A 2V5DA 3OW1A 3QGKC 5A5WA 4QEEA 3M44A 3F2DA 5J04A 4WOQA 6ALDA 1A80A 4QSHA 1J9YA 1M7PA 3I4EA 3VMOA 4Z2JA 2DSVA 1HN1A 1SPQA 2FHBA 4JTQA 4JQAA 1EPXA 3HBLA 3RX3A 1UMYA 3B05A 4GGHA 5DMYA 1NFPA 1Y5WA 2DH3A 3ATYA 4UZSA 3BH4A 3G1XA 5H8MA 1GVEA 3W72A 2ZX7A 3C3NA 3H4GA 3D5HA 1V0MA 2CXEA 2Q09A 2HISA 3F5JA 1EJSC 4X9SA 3RO6A 1BXBA 3FDGA 5U7SA 3N4AA 3AYTA 3GNXA 5AHFA 2P88A 3PZOA 3A4JA 2CBUA 1EPVA 2J8TA 4W87A 4MG4A 3C56A 4FI4A 1HKKA 5G2HA 1FX6A 5M5DA 1BFNA 3W70A 4BQ5A 3DUGA 3VYLA 3CTLA 2D3NA 1OY0A 2ZKMX 4RZ4A 4HT3A 4KCUA 1A5NC 5F4SA 3HV9A 4G8TA 1DIDA 3E1F1 4CU8A 1B4KA 4NXSA 1JULA 3WFZA 5G1TA 4S3DA 2GVYA 1L6WA 5AC5A 4C90A 4QR6A 2PRMA 2PRHA 4LH8A 3P67A 2XGIA 3HFYA 3WEZA 5HNUA 4R27A 2WJZA 1VRXA 3POHA 2GUUA 8TIMA 1V6VA 2E6FA 9XIMA 4OT7A 3HMJG 4UMAA 3ARYA 4MY8A 1OGGA 2JEQA 2F2KA 3VKDA 1LUCA 4PA8A 4XUGA 1J11A 4NZ5A 4MB1A 1NOWA 4I8DA 5CZKA 3GR8A 4GY7A 2ZDSA 2VFDA 4HK7A 4DJFD 3BK0A 1HO4A 3BOLA 1KBIA 3QFEA 4C7DA 2Q8ZA 2ZBTA 1W6TA 4ZXLA 1KM2A 1JXJA 4DWSD 1TVPA 5EMUA 2F38A 1KLYA 4NYUA 1NFGA 3CMGA 1EL3A 4I8YA 2YLLA 3CTTA 4NNCA 1QNPA 1NDZA 1QOPA 5AYZA 1NVMA 4PMUA 3PZGA 3TQ0A 3BLPX 1EP2A 3N14A 3DI1A 4ZB0A 1EGZA 2YCEA 2Z1WA 5IBXA 1I0DA 3L7RA 2VT0A 3W6MA 2YFNA 1OSEA 3IRSA 3DHPA 4LBSA 3GVWA 1NDVA 3F4DA 2DZSA 2G8ZA 4EXQA 4DNMA 1WKFA 4REQB 4TV6A 1IE7C 1W2VA 3H23A 6REQA 3VU2A 3LQGA 3R11A 1VIZA 1T8XA 3L5MA 4I9TA 4NZ1A 1HL9A 2YGYA 5M17A 3MV01 4JPGA 4HU8A 3VDGA 3HF3A 4I5UA 2XIOA 2JALA 1F07A 1RBOB 1XJBA 3VNMA 4CNTA 2AAAA 4HMNA 4B5XA 5BXTA 2IXUA 4FX7A 5A6LA 2BY0A 1XYZA 3ARTA 1H62A 1PTAA 4Q4QA 1PX8A 4F40A 1IGSA 3DAQA 2F84A 3HMCA 1XIGA 2A21A 5A6BD 3UFYA 3BGAA 2DP3A 4ADSA 2FZNA 4QNWA 1UWAA 4MB4A 4AHQA 3BW4A 4Q4RA 1KFLA 1GG1A 4J2MA 3CUZA 4MNKA 1SZEA 4UTIA 2A5HA 4NX5A 1TPUA 4UC5A 3VNDA 4JEQA 5DY3A 1E3XA 3INPA 3CIWA 4MIMA 3O6CA 1UA3A 4J7RA 3B3DA 3S5OA 1H61A 4HMDA 4MJZA 4CQ8A 2YL6A 2CLOA 2ZX8A 5HNNA 3H22A 1X6NA 2DVXA 4JL2A 2FH8A 3GKAA 2MUCA 2O56A 1ME8A 4EWJA 4LSBA 2JKPA 2V67A 3B8VA 3TJXA 2D0HA 1XUZA 5E5CA 5AY7A 2J9YA 4UTKA 2VRQA 1CENA 2WMGA 3NQVA 2E6YA 1B9ZA 1DWJM 4FLOA 1E40A 1S5NA 2QUNA 1JPHA 3DYPA 1NWRA 1UB3A 4GCXA 3EKGA 3CV7A 4G1KA 1QW8A 1F61A 1WOBA 4D6GA 2PDIA 2VFHA 4GYFA 5CAHA 1H0GA 2AGTA 1CXHA 2B7NA 3ZJ7A 1UYQA 3W2KA 4N4QA 1AJ2A 2FTYA 3MWAA 4JIPA 4IMEA 1VENA 4HBKA 1ZAJA 3F2BA 4BQ3A 5DX7A 4D6IA 1Z42A 2VEGA 3CNYA 4O53A 1EC7A 3RAOA 4KEUA 5AHMA 4GH3A 3S6OA 3SBFA 5AKQA 1R2TA 3L5AA 1C90A 1UKOA 1AQMA 4DBSA 2I9UA 2VRJA 3W07A 3FJ4A 5I77A 2REQA 3MTWA 1GZ1A 1QUMA 1XV8A 1TE6A 3GX9A 5A69A 1JI1A 1P4CA 4E8CA 1GVRA 4K1GA 1PTGA 2XZ7A 1EJVC 3GO2A 1V6YA 3W23A 2O55A 2VCBA 4KESA 1A5OC 5DLCA 3LCFA 5EGRA 2P5NA 3E5BA 1H7NA 1M03A 3KL5A 1KC7A 2QPSA 1PIFA 1OF6A 3AMCA 3MP4A 1SO5A 1J0HA 2E09A 3OIHA 1BVZA 1KR0A 5BRPA 1ISVA 2GSJA 2ZZ6A 4FAMA 4TMBA 5FF4A 3SIZA 3SR7A 1YRRA 4IFKA 4PMZA 3FYPA 3QN3A 2CIPA 2VC7A 3HQPA 3VMNA 5IXEA 3WLNA 4FMVA 3ZR4A 4FIRA 2YLAA 3GG0A 4AZGA 3GNPA 3WBAA 1W5MA 3EB4A 2A2IA 3S5ZA 1WZLA 4WVXA 2VUYA 1ODZA 3TIMA 1MRQA 4IPLA 2Y61A 3KVLA 3LCIA 4PMDA 3VTRA 3BAJA 3CLWA 4LB4A 4NNAA 1K7FA 2XUCA 4RDYA 1EIBA 4PRWA 3K4DA 2CLLA 2BXVA 1GOOA 1NFBA 1X39A 4HNVA 2Y7EA 3QKEA 3CWOX 3TN4A 4Y96A 1M7OA 1RBLA 4E3VA 3QHMA 2CETA 3VA8A 2GVGA 3WNOA 1ONEA 5CGQA 3H2AA 1XRTA 4UTHA 1J8VA 7PTDA 4DWSA 1T99A 4U2YA 5BCAA 4MFEA 3WH5A 5BOFA 4YCOA 2P53A 4CQ9A 2GZXA 1H7OA 4IIHA 3N6HA 2V0TA 2OLHA 3UA3A 2RUSA 3W83A 2YOCA 2A79A 3WLHA 4BZYA 4MVAA 5LIYX 2XH7A 1I2PA 3R0UA 4RZ6A 2DW6A 4GLEA 3SSJA 5I00A 1GKRA 1YTKA 4GD0A 2C71A 1LWJA 4E3TA 2NLYA 4FX6M 5CKSA 4QJ1A 1OCJA 3L23A 2DUXA 4P61A 5H2ZA 3RLGA 5BWAA 4L9ZA 3CUIA 2XFFA 1F7BA 1HL2A 3MHUA 3S6DA 2PLKA 2JEPA 5JBEA 5JH1A 2ZZ5A 2V8ZA 3W1XA 2BX7A 2HDJA 1PZ2A 2G3IA 1D7KA 2TAAA 5I06A 5D2WA 1RY0A 4XISA 3H21A 1KBLA 1OYAA 4DF0A 1H49A 1KD0A 2GQAA 4XTIA 1UPMB 1F4AA 1EP3A 4WIWA 3PZUA 1AODA 3NOYA 2ZWYA 4WHBA 3EMQA 2Y24A 3QQWA 4DI8A 2B31A 4I90A 2XTKA 4R7JA 4YVVA 1F5ZA 2Z00A 5I3JA 2L5HA 4KCWA 4REQA 1MEIA 5D09A 3OZOA 4D6CA 5I79A 1T8QA 4TXEA 4QS5A 3GE7A 2XPKA 1HNYA 1HIZA 2PD5A 4AHPA 1E9ZB 1DV7A 2ZXDA 3KP0A 2EG8A 3UGRA 3C52A 3WH8A 2GJNA 2DIJA 1E9YB 4M1RA 3A4WA 1LTDA 2R24A 3DGBA 2YYUA 5CBBA 3FSTA 7XIMA 2VFFA 5BXPA 4D6HA 1WPCA 4AIBA 1XSIA 2VQTA 2X1UA 4ADUA 4H6RA 3T1GA 1IF2A 4OV9A 3AIWA 3GDTA 4MDOA 2CZVA 5A6JA 5JMUA 1K7EA 1YTEA 2V5LA 4NSBA 3WLKX 3TN3A 3NL3A 4IGHA 4IP7A 3VKAA 5JXQA 2Z1KA 3H24A 3E3HA 5HJLA 1IIHA 3AISA 4GXWA 5I09A 3TROA 4GO8A 3K8MA 2OFJA 4WSJA 3GG1A 2OEMA 4DLMA 2QUVA 3MUZ1 3TTQA 2GWNA 1W5QA 1VBUA 4LWWA 1BGAA 5C9WA 3SCQA 4BY3A 4ALDA 1DXIA 1BSLA 1E1EA 3UZZA 3B97A 2HNHA 1BWLA 2WC7A 1WYIA 1ICSA 3MKCA 1PWMA 3ECQA 4O11A 1JPMA 4O14A 1OINA 3I65A 3EWXA 4Z1AA 4I6VA 3W6YA 4LRTA 4J3TA 1A0DA 1X1ZA 2BASA 5I24A 1H5YA 3JS3A 1TUFA 2O9PA 1QMLA 2PTZA 3SJ3A 3G18A 2JKEA 1JAEA 4NT0A 4US6A 1FH7A 1FKWA 5TNVA 3P62A 3P7YA 3FX4A 4LS0A 5G2WA 3EYPA 3VXGA 1H1ZA 4JQ4A 4QLKA 3PWGA 4X2RA 2PDPA 4K7VA 4DB7A 1RD6A 4JEJA 1BRLB 3EWUA 4X0VA 1S39A 1M53A 4AWTA 5C2CA 4LVGA 4LYRA 3V16A 1V51A 2V81A 1A50A 1Q6LA 4BI5A 1QOXA 4UWMA 3M0IA 4KIEA 2QDDA 1LWIA 2F7FA 4DPQA 5GPRA 5IDIA 3AWOA 2A0NA 5KETA 5C0QA 5K9CA 3G1RA 4AEEA 3EXSA 1QI3A 2WC3A 3EWWA 4HHLA 5FD0A 3VPLA 3WBXA 2OVLA 3UA4A 1L2UA 1ZALA 4AC1X 1RXOB 4UTWC 1XLIA 5LKYA 3M0KA 5E70A 3ARVA 2IKHA 3GWQA 3UW6A 5HK4A 3BLKA 2QW5A 1DJZA 3A24A 3VNZA 1QO2A 4TX8A 2WMIA 5D32A 3TCSA 3AAMA 5DXXA 1PE1A 1CWYA 1QNVA 4IX2A 2WO5A 1T5AA 3L66A 1ZJBA 4YIWA 4JTTA 2QULA 3OQ8A 2OZ0A 3P0WA 4XAZA 5HANA 3FAWA 3CZEA 3MSRA 4FO4A 4A35A 1ML1A 5CQ1A 1PKLA 2PWVA 4FLSA 4OJYA 3KRZA 2PBGA 5CC5A 1HJUA 2RKXA 1JCXA 3PP7A 4W93A 3U3HA 1GHSA 1EXBA 3HU7A 4AVNA 2BNJA 1E15A 5FSDC 4KKXA 1Q6OA 1TJ0A 4RW5A 4IUGA 1QI5A 2EPNA 1R8LA 1UJPA 4O8AA 4JFSA 4RXFA 4EAYA 4HHMA 1U1JA 2XINA 1JCTA 2BGNE 2ZRZA 2ZVIA 3WJZA 3QR3A 2CHRA 2WNNA 4GYKA 3VCNA 4HZ7A 2O9TA 3TQVA 2NV9A 3RPDA 1E43A 1GUVA 1RSCA 2FHFA 3F4CA 2X2YA 2IW0A 1XLMA 5I3DA 1R3SA 3UJSA 2VO5A 3WDIA 4ZCWA 2GQ3A 2HVNA 1RJQA 3AXIA 3UWUA 5LXXA 2VEIA 1K77A 2HPIA 4WD0A 1ZAIA 2FPVA 1JL8A 3U2OA 1RA0A 2FIQA 3UU0A 2A6LA 3EX4A 1BSIA 3LM7A 3T2PA 3T09A 2C16A 5HWJA 1A0CA 3WH7A 2Z1XA 3T40A 2D3LA 1DWFM 4TTGA 5K9DA 1SUXA 2ZUUA 3A6OA 5GNYA 3QMRA 4NZ4A 1F8MA 4ZTXA 4X2PA 3WO8A 1UR9A 4QLJA 2WVVB 4UXDA 1KTBA 3TTEA 2Z1SA 7REQB 2RJGA 4JTUA 4LX4A 3LDVA 3SCWA 2F61A 3EDKA 3FY1A 2OXNA 3LPOA 1TMHA 2WWCA 1V02A 4IIDA 3MUIA 5H6HA 3Q58A 3HQNA 4GZEA 1BVNP 1XHGA 2ZOXA 4KRTA 4NVTA 4TVCA 3ONCA 2E5BA 4HA0A 1J12A 4V28A 3W6LA 2W27A 1CECA 2C6QA 1R2RA 2HK1A 4GC4A 1SW7A 4J35A 2RH9A 3LHWA 3UP8A 2ZCGA 1RJPA 4K7YA 3N04A 5D8WA 5CSUA 1GYMA 2G0WA 1XLAA 3OU8A 3BQ6A 3AZTA 3THCA 2AGKA 1ZRQA 4AQLA 3C0SA 4H9TA 4UTLA 3OBAA 2ZC8A 5KITA 4PMVA 1RK5A 4UQAA 4GCAA 3E5PA 1QVBA 3EOSA 1PUDA 1RP8A 4PR4A 1US2A 3C3UA 1E6NA 3A23A 3MUCA 2I7GA 4Z42C 4AXKA 1PYMA 2ZUSA 1M04A 3QPZA 2ODOA 3ABXA 2XN2A 3CV2A 2OQHA 2BVWA 4R3UA 3UZ5A 1LL7A 2CLIA 3V0SA 2D73A 3E02A 2VWSA 3JVAA 3SZ8A 4C6FA 1AD4A 2WZIA 2QYGA 3W38A 1KNWA 2Y89A 1YXCA 1V0NA 3V75A 3W1TA 2YZ5A 2WSYA 1HF6A 1XYMA 2QIWA 1XYCA 4M80A 1CXKA 4AYGA 3W73A 1E5NA 2YBVA 4Z1YA 3P84A 1B3WA 2OCZA 1CGWA 2NVDA 3VOGA 3ZLHA 1DBTA 1Q2SA 4UQCA 3OYZA 2Z6IA 1CBGA 2AAMA 1Y65A 3PM6A 3W71A 3PUOA 5D8ZA 1W17A 1W3KA 3ABQA 4GC3A 1ZBCA 2P0OA 4GBUA 1JCJA 2XGZA 4ACYA 2D2JA 3L5LA 2PDFA 3NJ3A 3PZTA 4OECA 1V8EA 5LIWX 2BMBA 1JDFA 4J3XA 1XH0A 1XGEA 1WDRA 2PWUA 3PPHA 5JH2A 3WG6A 1IXQA 2VZUA 2Y8UA 1PX4A 1PKYA 1H51A 3W7NA 5FL0A 1X6LA 4I9MA 4NKCA 5EMYA 3W7OA 4P8VA 5IHSA 4ZE4A 3QHOA 3W2JA 5LNSA 3AMLA 1K8YA 5C7HA 2H8XA 1YHTA 1FQ0A 2YB1A 4PUKA 2C0AA 4IG2A 4YWSA 3SRHA 7A3HA 2DZTA 2NQJA 2QCCA 5AYBA 1CXFA 2FGLA 1R3TA 1R87A 4GUIA 3N4FA 4O50A 3W1NA 1C7TA 3Q65A 1JPKA 3NA8A 4PCSA 4KRUA 3I7RA 4K3ZA 2D0FA 2WJDA 1FVPA 1PWLA 3PZVA 2UY5A 1UUMA 1TRIA 3IV8A 3QY6A 3P2VA 4AX6A 5D04C 3LHTA 1Q6CA 3B40A 3PTKA 1NJJA 3AXHA 3IIPA 3NZGA 4PB5A 3BJTA 2GL5A 3CHFA 3FJLA 3AHZA 5ECUA 4AD4A 3E96A 4QITA 3BGJA 4HZ6A 3W1UA 2O4MA 3A22A 4S2BA 1UIPA 2H8ZA 3LK6A 3GXIA 4B91A 3PFRA 1D9EA 5I07A 1JZ8A 4YHEA 3TAKA 1A3XA 2VEPA 3KWSA 2E3ZA 5A8GA 3KOZA 4JS3A 3CPUA 4FLRA 1W3LA 4BWLC 4HU4A 4MSSA 3MI3A 1RK6A 2X7WA 4XIMA 2P8BA 4PFHA 1ZLPA 3N1AA 2CLHA 1FY6A 3CUHA 4UFLA 1N2VA 3TOPA 3UZYA 1P0DA 2YDSA 3O0FA 4HTYA 3T7VA 2QKFA 4DZHA 4JOMA 3BJSA 3LHUA 4B4HA 4GYJA 1EQCA 2AL1A 4XBJA 1ADSA 2POTA 4WY0F 4AVOA 5DELA 2CWNA 2GGJA 1A5CA 5HWMA 1K1DA 5LYRA 1CGYA 3IRDA 3VOHA 2WZTA 5D33A 4IF2A 4QX4A 1UBPC 3P0XA 3L21A 1XIEA 4Q8WA 3GH4A 5CBIA 3WK2A 3GS6A 4DAIA 3FLUA 3DENA 2C7FA 5EA9A 3TP4A 1W0MA 4BI6A 1B54A 4A4AA 3HIJA 2OYKA 1HJVA 2ACUA 1CEOA 5A3HA 4PEKA 5KTLA 1W5NA 2XH2A 4NAEB 2OYMA 4WK9A 3QR0A 3NO3A 3TWAA 4UR7A 4EKJA 1QHZA 4MADA 3M4HA 3K4WA 5EMMA 1G9HA 3XINA 1EA9C 1E1FA 1NEYA 2GGEA 1PBGA 3PBMA 4LVFA 1UROA 4NZFA 4QQ3A 4XTDA 4EXAA 1GPFA 3CBWA 3H53A 1KXHA 4W5UA 1RP9A 4QLLA 3GM8A 1E6PA 2YCJA 1LQAA 5DRIA 3GXDA 3F4VA 3M1ZA 1M01A 4M5PA 2QJGA 4UOQA 5AC8A 2PB1A 3THAA 2WM1A 3R6IA 3RRXA 2Z2UA 1V0KA 2OO0A 2PDWA 1P5BA 3NYZA 3NQ8A 3MHFA 4HOZA 3CS2A 5EL1A 1KA9F 1XKYA 3NAVA 4H9ZA 2Q8LA 4WR3A 3R58A 2XWEA 4F2TA 4RV8A 2BY2A 1XGDA 3QV9A 4MGGA 2XJ7A 3L4UA 4ICMA 4EAMA 1YPFA 2WWDA 4NI3A 3QF0A 2YBUA 3PG8A 1WXZA 3G8EA 4O12A 2CKSA 2D20A 1P1MA 4FF7A 2VGIA 3VGEA 4QSFA 1ONWA 3CEPA 1UKTA 3DHDA 4F0HA 1OFRA 4IMAA 4WDTA 4GE8A 1DHKA 1Z3NA 2NWRA 3CZKA 2VVNA 4IH3A 4DBWA 1WDPA 1E70M 1B3OA 2P10A 3UYIA 3DFTA 3NTYA 2Z2BA 2OLAA 3R89A 2HEJA 1EO7A 2YA2A 1YLVA 1C93A 2CCRA 2D0GA 3NO5A 3S1UA 2PWDA 2POZA 3OLIA 3BG5A 4P8XA 5D38A 1RUSA 5L6UA 2C15A 1PAMA 1PCWA 1YPIA 1OFAA 2QCMA 3DERA 3MPGA 2PEVA 4GJ1A 3BCDA 3MUY1 1MXGA 1AD1A 4DWDA 2RJHA 3KOFA 3UR5A 4H3DA 1A3HA 1GQLA 2J7FA 3K46A 4B90A 2FDSA 3BSHA 1M6JA 2NXIA 2JGYA 3C0LA 4DYEA 3NNTA 4FK9A 3GAYA 4FA3A 4F0SA 1EHNA 3E2VA 4D72A 4ATLA 5BROA 5KSWA 1LG1A 2I5GA 3ENLA 1G4TA 2CNCA 4XAFA 3RK8A 3KL3A 3S3GA 4DWSC 1OFDA 3CB8A 3ME3A 2TRSA 3THDA 3AIRA 1Q8JA 1EUNA 3CJPA 3FGCA 1YDVA 5I3FA 4LVDA 4JFVA 3RCYA 5CZ0A 4GYPA 3WNPA 4A05A 3WUGA 5CH9A 3QBUA 1Q65A 1HW6A 2FQIA 1OC6A 3OZPA 2R82A 3UCDA 2V6AA 4GXPA 1WX0A 2PCQA 3L4WA 4EF8A 2WBKA 2O0TA 4JQ3A 1W9UA 3OODA 1R3RA 1CLVA 3VOFA 1XH2A 1GQJA 4JN7A 1ZJIA 4JNYA 5A6MA 1TZZA 4P2VA 2E1DA 2NUYA 3BLLA 2J47A 1W32A 4QBXA 1VPQA 5BU6A 5M2FX 4MF4A 1VQTA 1MQPA 3BAWA 1ISYA 2DY3A 5E9XA 4FIQA 3TW6A 3P8JA 1M9HA 4EACA 3BXWA 5MKGA 1V79A 1A5KC 4UFIA 3UNDA 1FWNA 3RU6A 3S83A 2X0HA 2V3GA 1GJPA 5I23A 4GYPC 4NHVA 2PURA 1X7FA 4Y9PA 1VBJA 2W66A 5AVHA 1E0UA 4KWWA 1WZKA 2PTYA 3GR4A 3MSYA 4UFMA 3EOUA 5EBAA 1VC4A 1GTEA 4XQ6A 3R0DA 4I5XA 4L4PA 3HOJA 1IWBA 4IPIA 3NEVA 1XG4A 3CIVA 1W2PA 3RJXA 1VB9A 3GYCA 2R94A 4WXZA 3L4VA 3EAUA 3G77A 4JIQA 4CLMA 2E7FA 3EDJA 5AC4A 3LCGA 1LROA 4NJKA 1IGWA 3OO2A 2Y1HA 5DANA 3T0CA 4CU6A 3WD0A 4AVFA 4L9XA 1AVAA 5EY5A 4B5NA 3URAA 3UY8A 3BZJA 2EPKX 3S2LA 3LD5A 3HQ1A 4OE7A 3GG8A 1TO3A 2DT1A 1E6SM 2W62A 1EJRC 1S5VA 3ZR6A 4GVHA 1CI1A 3DIPA 1KM5A 4BR1A 4IZGA 2QNEA 2D24A 4CNNA 4RNIA 3P6LA 4N02A 2PS2A 1I2NA 3K30A 1VYRA 2VD9A 1W5OA 1JXKA 2Z1BA 3E2SA 4HKPA 3BV7A 2ISDA 3LRMA 5AOUA 4NAFA 3D47A 3ZVIA 4WCJA 5CLTA 1XLCA 3ITXA 4DI9A 4DJFA 3BAIA 4XZHA 4C6EA 4NXKA 5B80A 1F6YA 3QYQA 2WZMA 5H8PA 1M1BA 1LLWA 3NPUA 3VD7A 1VIWA 1YW1A 4NAEA 5CSRA 4FNQA 3C2VA 3T0BA 2W6RA 4DX3A 1VCFA 2VYOA 4HJFA 4U33A 4QJ3B 3UVAA 4RV3A 3A13A 4Y2WA 1SFTA 1UIOA 2FZDA 3W2MA 1J2BA 4HVXA 3QW4B 4OHQA 4N4PA 2ZADA 4LEQA 4LU0A 1XIFA 1K9TA 1OC5A 3SCUA 3DBNA 2GSEA 3LI1A 4XKYB 2INFA 3WD2A 4I6KA 3WX7A 5FJRA 4BHYA 1MEHA 5D2VA 5E6YA 2G41A 1VEOA 3KRUA 1RPXA 2PBOA 2Z28A 3KVKA 1NH6A 4KWSA 4GPNA 4H83A 3TNOA 3IGXA 1US3A 3N9RA 4Z1DA 1J10A 1SSDA 3VKKA 4XD3A 3W7CA 2PFHA 1CB2A 1DJXA 4OKDA 4LY4A 1UWRA 1TPH1 4KCVA 3UQNA 4N0RA 5HQMA 5E1QA 3M0VA 4QHRA 1UOZA 4DJEC 2EJ1A 1UR2A 1E3ZA 3SQLA 1XX1A 1IEIA 1NDWA 3WIJA 4M56A 4HD5A 2RFGA 3EWZA 4MNJA 1BLIA 1F3XA 1YNQA 1YEYA 3OP2A 3CAWA 2QCLA 3A3WA 4O0KA 4EANA 2DPEA 2QCDB 2WM0A 2INEA 1YBQA 3RLUA 3NQ2A 4LBRA 4AEFA 1UASA 4L6DA 4L65A 3TYUA 3WQEA 4R7OA 2E0PA 2WPBA 4A6GA 4TQTA 3AZSA 3QMTA 3TUUA 3PTDA 4FOKA 3IUDA 4E2VA 3A5FA 2BHZA 4JFTA 3EPMA 3VGHA 4RPQA 1SSGA 4ZQOA 4HNTA 4V1XA 1WDDA 4QP0A 1PZ1A 5JBDA 1UH4A 1Q85A 4HMEA 4F48A 2ZWZA 4RL3A 1A3WA 4ORMA 2IPWA 1QJWA 4AFYA 4MY1A 2DT0A 4IFOA 2X1TA 2YA0A 1V3JA 3HJZA 3MUAA 4GZJA 5FL1A 3UWEA 5A95A 1P6CA 4HQVA 4Y9MA 1I9CB 4FP1A 4LV4A 2BSLA 1DP0A 4AD3A 1K6WA 1RCOB 2RDXA 2HVMA 3FCPA 3GTIA 5T91A 2BBFA 1ZL1A 4KS0A 4QDMA 3QRHA 3CL6A 1UWIA 3HV8A 3U8GA 3KCOA 4JIEA 4ML4A 2DZXA 4US5D 2R1KA 3PJWA 2AQWA 2VENA 5LGZA 4N9DA 3K8KA 2PLMA 1IZJA 5JBFA 3BAYA 4O1AA 2E6DA 1EGMA 3UWZA 4S3FA 3CU2A 4H6QA 1OEPA 4Z2GA 3BE7A 4O1DA 3DG7A 3NPXA 3GTHA 3T4CA 3WLTA 3VDHA 1GVYA 2YL9A 4WQ6A 4PL2A 3CPGA 1ZSXA 2EF9A 4CCEA 3ZLFA 4DBDA 1AH4A 4E2DA 2PZ0A 1EZ2A 3EEZA 3NGFA 3KRBA 3C8FA 4JFWA 3BC9A 1DOSA 3WNLA 5C9UA 5LA0A 4PODA 2VHLA 5F2MA 3N2OA 1MFVA 1PZ0A 5ABFB 3UJ2A 3CUFA 4DRSA 1UR4A 1T41A 3LLXA 4LNYA 1JG9A 3OB8A 4XSMA 3PUEA 2WKGA 4ICNA 1TTPA 2W4XA 4F0RA 4ZFCA 4B3KA 5MF5A 3VDCA 4FR1A 3H55A 5DN1A 1TCMA 3U57A 1KFBA 3KOYA 1JR1A 3BMXA 4LCRA 3RMEA 4O28A 3TA6A 4WKFA 5CSYA 3QSTA 1TWDA 3KW3A 1ZB5A 4TTUA 3B9AA 2RDTA 1TYGA 3PWAA 1F2JA 4QE5A 1J79A 2J6XA 5DFAA 3PJTA 2RDWA 4HHHA 3NVTA 4RR4A 3IARA 3F4WA 3VX0A 3WMBA 3UYCA 4E8GA 4YWIA 1UD3A 1PIGA 1TFVA 3WNMA 3BGGA 3ZLGA 2CBIA 4MYAA 4MM1A 3V0TA 2OSYA 1MRAA 4HCLA 3CQIA 1WXYA 3JZUA 3VO0A 4BF9A 1OWQA 4XBKA 1VZWA 3AZRA 4DYKA 1GEQA 2VR2A 5C2XA 4EP8C 3B9NA 1VJSA 1TV3A 1YX1A 5REQB 2W3ZA 1H2JA 2WMHA 4UOZA 4DXVA 3WLIA 1AMKA 1D2KA 3EWCA 2R6OA 3MYPA 1LBFA 1Z9AA 3NQAA 5GJPA 3NSNA 1F6PA 1GKQA 1W1B1 3SW6A 2OU4A 1FWGC 1XKJA 5MHBA 4QEHA 3EPOA 4XZLX 1FTXA 4MTVA 1E6XM 3RR1A 2G4FA 4C6QA 3NQGA 4IPJA 1IEXA 3KL0A 4J3VA 3BG9A 1NP0A 2Z26A 1TPDA 4LCQA 3V5OA 5AYYA 2DIKA 1IR2A 4D8ZA 3OPSA 5D9NA 2VELA 3THUA 2GQ9A 4P7LA 3P80A 1KKRA 4JX6A 1RD5A 1WE5A 3RN6A 3JRKA 4H6KA 4H9YA 1GYLA 4OOUA 3WN6A 2NUXA 4HGXA 3D0CA 4ERIA 3KE0A 3CC1A 1YKWA 8RUCA 4HNCA 1VPXA 3NL6A 4BS0A 4X3ZA 3VCCA 1UCWA 4Y9OA 4IL0A 1SMDA 3LSCA 4IWWA 1UJQA 1VPYA 3IAPA 4GMEA 1V3LA 3WLLA 1KFJA 2Q01A 4FXFA 4JQ2A 1G6CA 4XBSA 1XIMA 3M0XA 1X7IA 1Y5XA 4FF5A 1UC4A 5A2CA 2B7OA 1XXXA 1HL8A 2FLIA 3C86A 1L9WA 4ZOBA 3UWVA 1WO2A 3BLDA 1IV8A 3ZR5A 3ZWSA 1GQIA 3R8GA 2VDGA 4IJBA 4GQRA 1ONRA 4JY9A 3MYOA 1TQJA 3B0VC 2OGYA 3SRKA 3ABSA 1OCBA 2NVAA 1GJWA 2Y4SA 5M1TA 3SY1A 1FWBC 1MQQA 2J6VA 2J62A 1LLZA 2CBJA 3WQVA 3S5SA 3EEGA 5DBTA 3I3DA 4GX8A 4AZ6A 4QFUA 3MMUA 2OEJA 2YCKX 4IGSA 3F5LA 1GVIA 3OQEA 1NTHA 3BVJA 3A12A 3GHSA 3OLGA 1IXOA 1HKMA 4EPEC 3VFCA 3RUBL 1S2WA 3WF3A 1XIBA 1WZMA 2X8RA 1TTJA 4L9YA 3KCLA 4UTTA 5EMKA 2XU2A 3H2CA 1A5SA 4UQBA 4MUPA 1LYXA 1JF6A 3M16A 4RE0A 2AMGA 1EC8A 3B8DA 3QPEA 3T78A 4ROPA 4WEVX 2XGBA 1HVQA 2WZEA 4G7EA 5M3WA 1EFZA 1G69A 1TELA 4AD5A 2B7PA 4DUWA 3B0PA 1PIIA 1R7OA 4KCTA 2V3DA 4B16A 3C2RA 5AHIA 3M5VA 1PHWA 5FF2A 3QPYA 5XIMA 3CB3A 3QY8A 5A6KA 1FWWA 4MB3A 1MDLA 5AYXA 3ARZA 1Q66A 1CLXA 3MW7A 3IS4A 5TAOA 3W29A 2WJFA 1U83A 2Y8KA 1A5UA 3PY2A 3H4XA 1JNDA 3AXKA 3ABOA 4A29A 1P6WA 2PLCA 2CITA 3FJNA 4JYDA 2A3LA 3M64A 4ATWA 1W3IA 2E6AA 1OX4A 1A47A 3HZ3A 1QRQA 2PGWA 4GNVA 3GRIA 3W85A 4RNJA 2WANA 1XCWA 3N19B 4JNZA 2Z0IA 3KDOA 3PK7A 2X30A 1E55A 1Q13A 2QEZA 3BDKA 1LQ0A 3ZQ9A 1VFLA 3RX2A 1WUFA 4XZMX 3E9AA 2EO7A 4H04A 1QDSA 4C60A 4E38A 4H4IA 2XIBA 3UD6A 2VDHA 2V3FA 1ME9A 3PZ9A 1F3TA 2BG5A 4GABA 3UR8A 1IHIA 3WMLA 4B5VA 5FEZA 1NWSA 3NQBA 4LY8A 1LZOA 2OEKA 1W1YA 1WV2A 3VD9A 4BFAA 1BHGA 2X42A 4ERGA 4S2CA 1BTCA 4IIGA 3AMDA 1JQXA 5F2IA 3GC4A 3O2LA 2Y5SA 2J78A 1J0ZA 3SFKA 1XI3A 1ICQA 1GG0A 4DZ5A 3QOKA 4L1WA 2PLJA 4JD4A 2WJEA 2WAGA 3C61A 3G1VA 1PKNA 3DKJA 3G3DA 3ITTA 2VEKA 3WCZA 3QXBA 1UQZA 3AS1A 4HCDA 2Z7KA 4FB7A 2GDQA 3TC3A 1E6ZA 2CW6A 3DG6A 3U2ZA 3VC5A 5LNWA 2EG6A 1C3FA 2NX3A 3VOIA 3GDLA 1D8WA 1YQ2A 3BANA 2AQOA 1L8NA 2E4TA 2OQLA 4HPHA 3F2CA 1WAWA 4ZO9A 4L64A 3W01A 3ZIZA 3HPAA 3VNLA 4J3SA 4MZ8A 4K39A 2VX5A 3HPZA 4UNKA 3MI6A 5HMDA 4YTUA 3W25A 2YCIX 5BU9A 1H11A 1JEZA 3AUOA 5DF0A 4XB3A 1T0OA 4NP7A 1PVNA 4PH6A 4Q4OA 4LUTA 1B57A 2EPMX 2CZEA 1UA7A 3WBYA 3K5XA 1I4NA 4K68A 4MZYA 4AD2A 2AOSA 4DJEA 4QQUA 7REQA 1J0YA 3TQKA 3WLMA 3VAVA 4AX7A 3ZSSA 1N8FA 3MMDA 2YKKA 3LUTA 4JX4A 3M9YA 4DHGA 4PL1A 4EOUA