4PGLA

Crystal structure of engineered d-tagatose 3-epimerase pcdte-ils6
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
298
structure length
298
Chain Sequence
MNKVGMFYSYWSTEWMVDFPATAKRIAGLGFDLMEISLSEFHNLSDAKKRELKAVADDLGLTVMCCIGLKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAGLNFCAWPQHPPLDMVDKRPYVDRAIESVRRVIKVAEDYGIIYALEAVNRYEQWLCNDAKEAIAFADAVDSPACKVHLDTFHMNIEENSFRDAILACKGKMGHFHLGEQNRLPPGEGRLPWDEIFGALKEIGYDGTIVIEPFMRTGGSVSRAVCVWRDLSNGATDEEMDERARRSLQFVRDKLALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords D-tagatose 3-epimerase
publication title Directed Divergent Evolution of a Thermostable D-Tagatose Epimerase towards Improved Activity for Two Hexose Substrates.
pubmed doi rcsb
source organism Pseudomonas cichorii
total genus 117
structure length 298
sequence length 298
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.31: D-tagatose 3-epimerase.
pdb deposition date 2014-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4pglA00
1XIBA 5H6HA 3OBEA 1XIJA 1XLHA 3KBNA 3TVAA 5TNVA 4HHMA 1I60A 1OADA 3C0LA 3VNJA 1XYCA 3CQJA 1TZ9A 1XLDA 1XLFA 3NGFA 3U3HA 5EMLA 4EACA 1XINA 3GNXA 3N4AA 4QE4A 4XKMA 3VNMA 5XIAA 3C0SA 4HGXA 5EMMA 3ITLA 4HNOA 2Q02A 1XLCA 5J8LA 4E3VA 2XINA 3M0HA 1QTWA 9XIAA 1XIIA 6XIAA 5B80A 1K77A 1XLKA 4XIMA 4XSLA 3IUIA 3ITVA 4K3ZA 1XICA 4GQBA 4QE1A 3JU2A 5C9ZA 2X7WA 8XIMA 4K1GA 3AAMA 4YTQA 3CQHA 1XYMA 3P6LA 2GUBA 2NQ9A 1MNZA 4QDWA 1GW9A 1I6NA 3BANA 5FA5A 1MUWA 5I7GA 5EMKA 3XIMA 3QXBA 3BWWA 1XIMA 4ZB0A 3VNKA 5XINA 4QEEA 5B7YA 3KBVA 3KTCA 1XLIA 4KW2A 1A0CA 4QDPA 4X61A 7XIMA 4YTSA 4QEHA 3IUHA 4PGLA 3CQIA 3ITXA 2I57A 2XISA 2HK1A 3L23A 2J6VA 4YTTA 3ITYA 2GYIA 3C0QA 3BZGA 3ITOA 4DVOA 4J4KA 4YTUA 4Q7IA 2I56A 4US6A 4GLEA 1DIDA 4ZB2A 1XIDA 3QC0A 3KBMA 3KWSA 5XIMA 1XLMA 4LNCA 4XSMA 1DE6A 3UU0A 1BXCA 5EMJA 3AYVA 3CQKA 3XINA 4G56A 3BZJA 3FVMA 5AVNA 3UA4A 5B7ZA 1XLJA 3M0XA 1A0DA 1XLGA 3DX5A 1XISA 2QUMA 1XLLA 4HHLA 1DIEA 2ZDSA 3CWHA 3KBJA 3LMZA 3VYLA 1S5MA 2GLKA 3QZAA 2GVEA 4A8RA 4A8LA 8XIAA 4EAYA 2OU4A 1O1HA 3M0MA 3VNIA 3XISA 2HK0A 3KCOA 3CNYA 1A0EA 1XIEA 1XYAA 4PFHA 4X63A 4X60A 4XISA 3UA3A 3VNLA 1XLBA 3UXIA 3ITTA 2ZVRA 3KCJA 4QE5A 1CLKA 3M0YA 3AYTA 1D8WA 1XLEA 2NQHA 1S5NA 4XIAA 4A8NA 6XIMA 1XYLA 3KBSA 3AALA 1XIHA 2QUNA 4ZB5A 1XLAA 4GJJA 1QUMA 3TC3A 5H1WA 1QT1A 3BDKA 3UVAA 2HCVA 4YTRA 4DUOA 2G4JA 2X7VA 3M0VA 5AVHA 1XYBA 2G0WA 1BXBA 1XIGA 1DXIA 3KBWA 3WQOA 3P14A 4ZBCA 2NQJA 4W4QA 3QYSA 9XIMA 1YX1A 3M0LA 4OVXA 3IUDA 4GJIA 3U0HA 1DE5A 1XP3A 2QULA 2XIMA 3DBNA 4A8IA 3KCLA 1XIFA 2QW5A
chains in the Genus database with same CATH superfamily
2Y7EA 2VR5A 3B8DA 2VX7A 4JKLA 1TR9A 3H7UA 1O6IA 3CZEA 3G1HA 3N3TA 1LTDA 4NZJA 4JEJA 2OO0A 4LJ3A 4GVIA 1UW9A 3DOPA 3JR2A 3NQFA 2VZSA 1UR3M 4UOZA 2WCSA 4X2PA 1EJ7L 2WVUA 4XB3A 3DGBA 2QCDA 1AH0A 4Q8QA 1NTHA 3H2CA 2OKTA 3WK0A 4DNHA 1P6BA 3H6OA 4E8GA 2FGLA 1SYTA 1E9ZB 4HPNA 1ZPTA 3VNKA 1VPYA 4GA8A 2OKOA 3QSRA 5FEZA 2YCIX 4AWTA 7XIMA 1OC6A 3MKKA 3SDOA 4QS6A 2I57A 2AMGA 2AKZA 3TQKA 1N8IA 4QROA 4EIVA 4ATWA 4AD3A 3BMXA 4DX3A 4JN7A 1BKHA 1K6AA 1G69A 5LXXA 3TOPA 2ZYFA 1WDDA 5D8ZA 1GOXA 3WBYA 1S5VA 4RNFA 2W4XA 1KRAC 3AJ7A 3IIPA 4JTTA 5LIXX 2ZDSA 4GUIA 1EP3A 4EAYA 5I0DA 1XYAA 3ITTA 4CD8A 3U48A 4ZB5A 4MZYA 1CCWB 3APTA 3TSBA 3JW7A 4Z2IA 3U4AA 2OEJA 4HN8A 2PI6A 5CZ0A 1WXYA 3W7OA 2V0TA 3FAXA 1W1B1 4GQRA 1TZ9A 2EG8A 3QW4B 1F5ZA 1Q8JA 9CGTA 3EWDA 5JMUA 1V08A 1XIIA 2ZC8A 1L6YA 2PU1A 3OGVA 1RY8A 4YVXA 2ZTJA 5CJNA 2XVNA 1MUWA 2IKHA 4O1BA 1ISVA 1V4YA 1H7RA 3OBAA 7PTDA 4UXDA 3A24A 3B97A 2CLMA 5CXPA 4LGXA 2UY5A 5LHFA 3RX2A 1JF5A 3WK1A 3UNTA 4IFOA 2CLIA 3CUGA 3QR1A 2VGBA 4JS3A 1MQPA 1QOQA 4KRZA 4L6HA 3K8MA 3RDKA 3W7MA 5ABHA 2G97A 2IUZA 2ZXBA 4FI4A 2I1OA 5IDIA 1MDLA 5AVNA 5BOEA 3TKFA 1VHCA 1UA3A 2X1SA 1OQFA 1PKYA 2DU2A 3KVJA 3DHFA 1GYLA 4H9YA 1VB9A 3DG3A 1FWBC 2WZTA 3BAKA 1KWGA 5TIMA 1LP6A 1S39A 1YKWA 2VVNA 4IPJA 3A3HA 3QMRA 3ZMRA 2QAPA 3IIZA 2VEFA 3KW3A 3RIKA 3GG0A 4S3AA 5F2GA 1TKKA 1BSIA 4Z2KA 5JIPA 2F6KA 2J88A 4GJIA 2NQ5A 3GTIA 1XP3A 3LSBA 1MVYA 1A5SA 2A21A 1FFRA 4UCFA 1JAKA 4IP4A 4DJDC 3CQJA 3GLCA 1EC7A 4UFKA 1F07A 3RN6A 1XCXA 4LBUA 4HOZA 1MQQA 2GPTA 1W2VA 1CX9A 1XLKA 2WSYA 1N8FA 1E56A 3VD4A 3B9AA 3QMTA 5D05A 1XL9A 3UP8A 1MXSA 3CMJA 1D3CA 4IMFA 4TUFA 3P81A 1M68A 3CAKA 1YXCA 2P3ZA 4XK2A 2YB4A 3GVQA 4IIGA 1F3XA 3LPGA 1KLYA 2FJUB 2QQ6A 4JNYA 3VGGA 4PH6A 1TIWA 1JPHA 1BQGA 3RILA 2EKGA 4CU7A 4IMAA 3MMDA 3BZGA 4I9AA 2XZ7A 3UWUA 4GC4A 4NL1A 4C7DA 3I4KA 4ACYA 1X96A 1Z69A 3GC5A 4MB3A 5AYXA 1CIUA 3F2DA 1EEPA 1Q45A 5JXQA 1VBJA 1JFHA 2EGZA 2PD5A 3HGSA 1XFBA 1ZNNA 4YYFA 4L61A 2VEMA 4QHRA 1J0JA 3QGAC 3WQFA 4NNCA 3UETA 5BMWA 3ITGA 1XIHA 4WDUA 4XBSA 2WHLA 1PVNA 2RH9A 2E5BA 1XQLA 2ZZ1A 2QZRA 3FSTA 1PYMA 4DJEA 1SO5A 3W01A 2Z24A 4HHMA 4XUYA 3LZ3A 3TN6A 4HMDA 2QIIA 3A21A 4GCXA 4J3WA 4K38A 4MPKA 6ENLA 1J5TA 2V2HA 1PTAA 3PPGA 1B4EA 5FKYA 5G4WA 5HMSA 3HA1A 3VFCA 3RRAA 2QDDA 3FYYA 3RX4A 4WUIA 5E09A 1WPCA 2WOQA 4MTVA 2XN0A 4RNHA 5DQPA 3EDKA 4O0ZA 1M04A 5LKYA 3WBWA 2B7NA 2FGZA 1SUXA 2PWVA 2X0HA 4AVOA 3POHA 3MYPA 4DELA 1LRQA 1UKQA 4E8CA 2VFFA 4WY0A 5ECVA 5D2WA 4O8AA 1C92A 4AD1A 1EZ2A 3KWSA 4PULA 5MHBA 3QOMA 3BG9A 3BXWA 1SSDA 3MQTA 5H8UA 3WDPP 2UY4A 1ONXA 3QZEA 4ECLA 3FA3A 3Q45A 1Q6GA 3IGUA 1UKOA 3QYQA 4Z2JA 4M6QA 3RLGA 5HR7A 4RCXA 3AXIA 2BOGX 4Y8EA 3QGKC 2VD9A 4NY2A 2PDMA 1B31A 3VKCA 1BVZA 2HWGA 3N25A 2FDMA 3T9PA 4BEQA 1WKYA 1G9HA 2PDHA 3FFSA 1RA5A 4DZHA 1VYPX 2E6DA 3L4ZA 1BG4A 3T0TA 4CQCA 3T0AA 4Q8WA 2VT0A 3Q65A 3BPWA 4IG2B 5JUVA 2QCEA 3H70A 5AHMA 2H8XA 4LYQA 1AZ2A 1FWRA 4DI9A 1PIFA 1OCJA 2CKRA 5IXEA 4MNKA 4HZMA 3GO2A 1S2TA 4YHEA 3DH7A 1IXPA 1EOKA 2DIJA 3EGJA 3GVVA 1EA9C 4PBFA 3UPWA 2F7FA 3UJEA 4B5VA 3VDHA 2NQ9A 3BJTA 5F2MA 2W79A 2I9UA 4KETA 2EPOA 1EYEA 1WDPA 1I2OA 4BFAA 2P53A 2PGFA 3VGBA 1A5KC 4KW2A 1ZJIA 2WZIA 4DO6A 1PZ2A 1A5NC 1ME9A 2J6VA 2QJGA 3PJUA 4RE0A 4F8XA 5DCEA 1A5CA 4ALDA 4PUDA 1PKNA 5CEWA 1WP6A 4JTSA 4K6AA 4QQ3A 2QKFA 4C60A 4M24A 1DIEA 2TMDA 1AG1O 1TQJA 4GYFA 4PTDA 3HF3A 5GPRA 3BH4A 2PDBA 1NOFA 5CPSA 3U7BA 3BSHA 5LGZA 3PJTA 3TONA 3E0WA 4OQVA 4LWWA 3KDNA 3LI0A 4O12A 1FWNA 4S1FA 1PCWA 1T7LA 3M6DA 2V3GA 4LCRA 3F1QA 1KFKA 4D8LA 7A3HA 4XKYB 2I5GA 4I90A 3CASA 3UXLA 1SU5A 4LAOA 4Z17A 4TX6A 3LGGA 3THQA 4Q33A 2DGAA 3RLHA 3V5CA 3ZJ7A 3R8GA 2CLLA 4D8AA 3W53A 1XRTA 3H12A 4WX2A 3QFEA 4YJ5A 3BURA 1FH7A 3QF0A 5F7UA 3M0JA 2FZNA 1XXXA 2D0FA 5FSEC 5I03A 4EOUA 4K1GA 2RJGA 4LUIA 3L0KA 3L66A 4GIYA 3D6NA 5FA5A 4G7EB 1U33A 1VJZA 1OB0A 4PCSA 4DF1A 4WZHA 3EEGA 5EMKA 1GQNA 4C6CA 1C9WA 4LRTA 1K03A 5DMYA 4ZR8A 5FL0A 4K36A 3AS2A 4ML9A 2CBUA 1MMFA 2BDQA 4NF7A 2YCEA 5L6UA 2GYIA 2PF0A 2J8FA 3NQMA 5M2FX 3FXGA 4S38A 4C6IA 3OIXA 1OG0A 4CNPA 4ERAA 2X41A 3O7UA 1AZ1A 2XFYA 1IXOA 3WZ0E 1W1A1 5JIWA 3CT2A 3HQPA 3NQAA 1S38A 3QLLA 3MSYA 1DQXA 4XZ9A 3E2QA 2YA2A 3PB0A 3UXAA 1DHPA 3QR0A 2DSVA 1GKQA 3Q94A 4RZ4A 2D2OA 4M0XA 2BX7A 1OX4B 1ZAHA 5CBBA 4DYKA 3LGDA 1CGVA 3ZR5A 4ZXLA 3CUXA 4C6NA 4FB7A 1F3EA 3C0LA 1K8YA 1K4HA 5CSSA 4C91A 4UTJA 2FPTA 3IRSA 3N17A 4Q32A 1Q2SA 3AIRA 4MVAA 2BODX 3VZZA 1OYBA 2E5DA 4LC8A 4BI7A 1P0KA 1JD9A 3MUZ1 2GGGA 5BXSA 3MV01 2INEA 7CGTA 3FS2A 5ABGA 3VGFA 3FDGA 7TIMA 4TX8A 2E25A 3NOEA 3IJ7A 3MVIA 3RF9A 1MW2A 2Z0IA 1T8XA 3FIGA 3TFXA 2VC7A 4GGBA 1R85A 3H55A 2EHHA 1ISZA 1CYGA 4IPLA 4H2CA 1YTDA 2CEQA 1O66A 2C15A 1G6CA 4RX0A 2ZX7A 3B9DA 4AC7C 4Z2GA 2ASHA 1K8ZA 2VWTA 3REQA 2GDQA 1XGZA 1IZKA 4LUSA 3EWYA 5EL1A 4O57A 2WANA 2J77A 1RQHA 2B0MA 1A5LC 5HR6A 1JDEA 1CENA 1F3WA 1RK5A 2O9PA 2JALA 3GW0A 4PMNA 3U8GA 1O94A 1XLHA 3OVQA 1JCXA 3BICA 1S2WA 3SUUA 4RW5A 3SUTA 2EBNA 3UG3A 1V93A 4FXJA 1OF8A 4H9UA 1KCLA 4N2YA 3EKZA 3VI2A 1GOOA 2G3FA 5FESA 3KDOA 3GK0A 2DY3A 3OG2A 2YDQA 4PZVA 1DTUA 4MAZA 1EJSC 3LTSA 4PCTA 4FNQA 3EDEA 1L6GA 5JH1A 5JH2A 3KOXA 3NEHA 1HO1A 3I10A 3RMJA 3R2GA 4XWUA 3MUAA 1QI0A 4CQDA 2FH8A 2BFGA 2IMRA 2BXZA 3DXIA 1Q7QA 2PDYA 1NEYA 1JZ6A 3SCTA 1ZY9A 1LYXA 1DORA 3DX5A 4E2DA 1KBLA 2C1HA 2UWFA 4Y9MA 5I78A 1G5AA 3OHMB 2NWRA 1D8WA 4HQVA 4YHGA 4XAFA 3AJXA 2V63A 2G3MA 3RNDA 3DC0A 4GD0A 4PUWA 1UUQA 3PZNA 3MKCA 4OVXA 3WNMA 2DW7A 5JBFA 3B0XA 1OADA 1U5VA 2VC5A 1X6NA 1JUKA 4YS1A 3E0VA 1F73A 1QDSA 2A7RA 1DBTA 3J7HA 3G1DA 3AMLA 4N42A 4D1JA 4FNUA 2R82A 2F9RA 1OCNA 1RPKA 3AS3A 3M16A 2P8CA 3GQYA 1M7OA 2H3BA 2WM0A 1XRFA 1C29A 4MJZA 1TELA 4D6CA 2OVLA 1P6WA 1OGSA 1H1ZA 3UZWA 4Z42C 1TV3A 2Z2AA 1R30A 1TVPA 5FJUA 1G7VA 3WF0A 3A13A 2B7PA 3IGHX 4HU8A 4LUJA 3LU2A 4EANA 1A3HA 1LLOA 1UD8A 1AUSL 1HGWA 3BAXA 4OZOA 3CT7A 1OFOA 4ORMA 4UMCA 2FH6A 4S3KA 1B1YA 4BQ2A 2IQ0A 2FVLA 3VXGA 1J0HA 3ARSA 4G5DA 2BY1A 5FJIA 5A6BA 2TPSA 2Y88A 3D3FA 5HATA 1JQVA 2ZZ7A 1VBUA 4JQ4A 4QTGA 3TQVA 2G5WA 3SW6A 3R89A 3TYZA 1XHGA 5SWUA 4IIEA 2G8ZA 3M0VA 4ZBCA 1PUDA 1P6CA 3GAYA 1ADOA 4IMEA 1REQA 3CZ8A 4RDVA 1IZCA 3SCVA 2W5FA 2Z25A 4O4WA 2DZSA 3W1XA 4QSFA 3WG6A 3G6LA 2VQTA 3COTA 1UMLA 3N18A 1TVLA 2B7OA 3V75A 3S9YA 2Q8LA 3VC5A 3CWOX 4GJ1A 3NZGA 3W22A 1FP8A 1FHVA 4AD0A 1QI5A 4I8YA 1JXJA 1HQTA 3VX1A 2ZWYA 1OX6A 4XUGA 3AIBA 3MHUA 1AQMA 5I3HA 4ZFMA 1CXIA 4H1ZA 4OECA 5AHLA 4V1YA 2V5KA 3IUHA 4NILA 4DBEA 3TYDA 4BWLC 4DLMA 3QTPA 4H9ZA 3WQ5A 2XSBA 3GYEA 3VMOA 2ZA2A 2Y24A 4NAFA 5TD4A 4WJEA 2I5IA 3IV3A 3HM7A 1TTPA 1A0DA 1IWBA 4JTJA 4U3AA 1QHZA 4K8HA 3I6RA 4AZIA 2V67A 4LH8A 1F4AA 2FTWA 2YOCA 4D6HA 1LG2A 2PMQA 4OIFA 5I3IA 4HJWA 1AK5A 4J2MA 3PZGA 3UEQA 3UJSA 1RHCA 5LNUA 4RZ6A 1ODUA 2VOMA 2PP1A 5I23A 2OQHA 4GBDA 5DELA 3KBNA 3ATYA 1QNVA 1JUEA 5F2IA 1TG7A 2P3EA 4DLFA 2PWUA 4UZUA 5HOSA 3R6IA 1UJQA 2NT1A 1KKRA 1R46A 1J6PA 4JOMA 1SFJA 4Z08A 2F2HA 4O1DA 3VIMA 3I65A 1OT1A 4XQ6A 1V51A 2VZUA 2ZX9A 1MW1A 3GXPA 2V2DA 3NWRA 3U2EA 2WB5A 1B3XA 3LRKA 1B54A 2D2GA 1O5RA 3FHQA 1VFSA 1XQKA 2YL9A 1J12A 4IGNA 2Z6IA 1LM1A 1A5AA 1BG9A 4KGLA 3TAOA 3QH2A 1V79A 2WYSA 1OGGA 3PZOA 4A2SA 2NX9A 3A6OA 4DJFA 4H19A 1WUEA 3EX4A 4AY7A 1W9BM 3CQKA 4CNUA 1ZBVA 5A2CA 1XG4A 5HBFA 4JTEA 4FHAA 2DFAA 3FNDA 1XBVA 4RZ5A 4WJXA 2CZVA 4DM1A 2WJDA 4FAMA 4L4OA 3KCOA 4NX0A 1N7KA 3NPUA 2C0HA 5CC6A 1TYGA 1PX3A 4TMBA 4GI9A 4YN5A 4GKLA 2A3BA 5AC6A 2OEKA 2VFEA 2AQOA 3L4YA 4JN6A 4FXSA 3P8JA 4AZCB 4GOAA 1ZGDA 2IS7A 2PLJA 4JYFA 3E5BA 3T07A 4F9JA 4DF0A 2Z7GA 6XIAA 3R1ZA 4RPQA 2ZADA 1Q63A 4HPXA 2EPKX 3EA3A 4IPNB 2X40A 1Q8AA 1E6PA 2J7GA 5A69A 3L0GA 1ICPA 2E9BA 4IUOA 3LV5A 1WKDA 3CC1A 5AECA 3N2MA 4UOQA 5FF7A 3MZ2A 3NO1A 1VCVA 3UR5A 3LHTA 3BCFA 2F2KA 3IGSA 4EF9A 4UWMA 2C19A 3AMKA 1TPC1 4DZ5A 2VM8A 6REQA 4QJ4B 5HINA 1MUCA 4WXZA 5BW6A 3TCSA 3S9IA 3JRKA 5M3WA 1JZ2A 1XISA 2Z2BA 1DJYA 4IGHA 3G22A 1Q3NA 1ZTVA 2CIPA 2JF6A 3EB3A 1W17A 1RV8A 1O4UA 4TQTA 4GZEA 1GUVA 3BDKA 3IK4A 3L0NA 4MHBA 3BK0A 3NQ8A 4BS0A 1HL8A 2AL2A 4OJYA 1EX1A 3MANA 2OO6A 3R12A 3SEPA 1K9DA 4H41A 4XD3A 1R3WA 5ENLA 5G2HA 3ZSSA 2G37A 3AYSA 2G95A 3IUIA 2XJ7A 4H7ZA 7TAAA 3OA3A 2OG9A 5C9WA 1PBGA 5CZKA 3WLRA 1NOWA 4MNJA 3CV2A 1A5MC 2HQAA 1QW8A 1MEHA 2ZRVA 3PBWA 4ICCX 2PTYA 4W7WA 3N2TA 2Z1XA 3DBPA 4XD6A 3RUBL 3T44A 3TZFA 1MRAA 2V3FA 4GVFA 1QASA 3PTDA 1H0GA 4F0SA 1VJSA 3E2RA 2VMFA 4J3XA 3QGVA 3OVRA 2X1IA 3THAA 3GC4A 2O9TA 1P1MA 2JEQA 3W7JA 3M0XA 1OCQA 1TA3A 1VC4A 3L67A 3WQEA 1XSJA 3PBGA 2QJHA 4AISA 1D2KA 2OQLA 4EXBA 3WJYA 4TR9A 1LRTA 1DXFA 2V8ZA 5CGQA 3WF4A 4WR3A 4FO4A 4CUCA 3RR1A 1YXDA 2CLEA 1MSSA 2I7GA 3LPFA 1SJAA 3H21A 2OT1A 2PWHA 4D6GA 2XVKA 1BRLB 1PWLA 2BB0A 3CL8A 1XKYA 3W83A 1S3HA 1B3VA 2OOFA 4HHPA 1ZP3A 2V9DA 3AXMA 1EJWC 3OZYA 1I75A 2OXNA 1VFUA 1JCYA 2GUBA 1J0KA 4DHGA 3HJEA 1OFQA 3G18A 3ZT5A 3N19B 3WN6A 3U4FA 3RPMA 4A22A 5D4YA 1ZCOA 4HSOA 3WNKA 1GZ1A 3M7SA 1I4NA 2BWGA 3P84A 4UTWC 3VIHA 4LV9A 1IR2A 1IEVA 1KFWA 2D69A 4ZTYA 3E2SA 1TTQA 4ZE5A 4RZBA 1E9YB 2VCCA 5HQMA 2WZMA 3VOJA 2V2CA 1WDQA 3HU7A 1EIXA 2ODOA 4NAEB 4D2JA 5KZEA 3GG1A 1H49A 4C7FA 4NJHA 3KM8A 4NAFB 5IHSA 2X2YA 2BGNE 2P0OA 4GFIA 4DZAA 2Z2UA 4PFHA 3ALFA 1EP2A 3NSMA 4DUXA 3W1TA 3UWYA 4QIUA 1OD0A 1R7OA 4CCDA 1DHKA 3GKFA 1RD5A 4JX5A 4RE3A 1WOAA 4U5KA 3KE0A 4E4UA 1W3IA 3C56A 5BXRA 5LNSA 4I5RA 3A9IA 3AXKA 3MSDA 4LYRA 2PRLA 3T2QA 1UP0A 4WSHA 2VCBA 3WFLA 1R2SA 1HP5A 2XVLA 1IZJA 2CBJA 2W6RA 3B4YA 3UR7A 1ZAJA 4S3GA 5IFTA 2YBTA 4Q8NA 2VDGA 1O60A 5DY2A 4W89A 4W8AA 4XX6A 2QPSA 5HQEA 5J04A 1H2JA 3ITLA 3OYZA 3PBVA 2DUZA 1E1FA 1V0KA 3MDWA 1IIGA 1IEIA 3PUDA 4U31A 1RD6A 3H2NA 4X3ZA 3EMCA 3TJIA 3W1UA 4HMNA 3ARWA 2XH7A 3QHNA 4JAWA 3MB9A 3MHGA 4PUEA 2HS8A 2Q6ZA 3DHDA 1GOMA 2DT2A 3A64A 2D2JA 4WSJA 3P0WA 2A7NA 3WDRA 5FSDC 3PK7A 1W3JA 2P5NA 2DSUA 1KWKA 3GVGA 3G1VA 1EP1A 4QG8A 2W91A 3C2RA 1OWQA 1OY0A 2L5HA 5LIKX 2I56A 3M46A 3V0TA 2JIEA 3LNMA 3RMEA 2I17A 3TLQA 3R43A 3QPYA 4I9TA 3O63A 1ADDA 3F5LA 3WD4A 1XW8A 2FFIA 3N2OA 2BVWA 2F8QA 5I24A 1CDGA 1X1OA 1I8JA 5LGXA 1C91A 1Q4NX 4H83A 3ALGA 1Q6FA 1FCVA 4DO5A 1LOLA 1TX0A 2ZVRA 3SCUA 1T5AA 1GPWA 4HK5A 1WX0A 5E1QA 3VILA 3NZ1A 3AMCA 1L6WA 4HCLA 1XYFA 5D37A 5AHIA 4RUBA 1S2AA 4BQ3A 1N82A 3KCLA 5ABFA 4WIWA 5JU6A 1ENUA 1QNOA 2E8ZA 1PTDA 2RGLA 4IFKB 1WO2A 3L5LA 2BHZA 4HN4A 3P61A 3SCNA 2BV9A 2EF9A 3KL0A 1XRSA 1HW6A 2OB3A 3WLSA 1I0BA 4U33A 4AX7A 1H41A 5C9ZA 1TZ7A 5AC7A 4MUZA 4HBKA 1X7IA 4FIRA 1DJWA 4QLJA 2OQYA 4PTNA 1U5JA 1Y65A 5DANA 3P62A 4NIRA 2GGHA 4O18A 3BAYA 2DJLA 2NUYA 3I7SA 3HMCA 3TXVA 2WSKA 1R5YA 2DZWA 4G1KA 3D5HA 3FDKA 1KTNA 3LTPA 1FUYA 1WUFA 2YIHA 3MCNA 1GVFA 4GNKB 3W7KA 2GOUA 3EXSA 1RSCA 4QITA 3P80A 1KB3A 4M51A 1XH1A 4FLRA 6REQB 3WX7A 8XIAA 4R34A 5EA9A 1MUMA 4J2PA 2AAAA 4JX4A 1BHGA 1GTHA 3L12A 3NPWA 1I45A 4EX4A 3SAZA 5M03A 4MLRA 2CHOA 4GUHA 3RO6A 1TUXA 3CMFA 2YA0A 2E67A 2GSEA 4I9JA 1ELSA 1S5WA 2HVNA 2RDWA 3V4BA 4NRRA 3W71A 4QM1A 4PE8A 3S1VA 5I3DA 5M17A 3C0JA 1AQ0A 4X9YA 3CBWA 1KM6A 1MZRA 1GVQA 3GNXA 3GKAA 3SZ8A 2BHUA 1T96A 4HNOA 3TC6A 1X6UA 1POJA 2DQXA 1DJQA 2QJMA 4PMDA 2X42A 3HTWA 3JU2A 4PL2A 4C1NA 1FKXA 1LUCB 1TPB1 3B0VC 1VD6A 4E2OA 5CZSA 5BNKA 4Y9AA 1WNOA 3LMYA 3VUSA 2V81A 4JR5A 1F4HA 1R2RA 3W1LA 3NZRA 1M65A 5E70A 3IJ9A 4AF0A 4CCZA 2WLYA 4IOTA 1TCMA 4A35A 1R3QA 4CNSA 4F3HA 3WQVA 3TYBA 4RW3A 3KP1A 3VNDA 2ONEA 2WVTA 4GX8A 3OPSA 3UU0A 4GZJA 3UA4A 3ITCA 7REQA 3PC0A 1RZMA 2Z00A 2WZEA 4DWSC 4ILSA 1ICSA 1LDCA 3T40A 4X60A 3FYOA 3ORWA 2WNZA 1E1CA 2ZOXA 1XS2A 2NQHA 2C71A 3W3OA 3WQ8A 1E6ZA 2X0SA 2QVNA 1QW7A 2GVGA 3F4DA 4HIBA 3IANA 1FWSA 1OCBA 4Z0JA 5L9FA 3IJIA 1ZP4A 4O54A 1DXIA 4OT7A 4PUKA 4US5D 3GTHA 2INZA 3R25A 4JTHA 2WC3A 3TN3A 3E74A 5E5CA 1C8XA 5HXMA 2JGYA 3GAKA 4KS0A 2FTYA 3UWVA 4J9JA 4XBJA 4ZOCA 1VFTA 3SRHA 3FKKA 5FJOA 5CG0A 4UTKA 4R27A 2WVVB 4LF1A 2R14A 1RCQA 1DJHA 5IM51 1PB0A 2OZ3A 1GJPA 3VCRA 4U10A 3PUOA 1J10A 2WKJA 3LLDA 2C7FA 3L7RA 1QHOA 3WLTA 4Z1CA 5BXPA 3CS2A 3OODA 4B3ZA 4FZIA 2PC8A 1C8VA 3EOLA 4O15A 3RPDA 4UB9A 1PXGA 3IIVA 3VD3A 3CH9A 4JTKA 4R33A 4XZHA 2GWNA 1Q66A 1TCDA 1LWIA 5EGRA 3LMZA 1R38A 3DI1A 2H9AA 2WCGA 1OK4A 4TO8A 1QOXA 1N2VA 2ZZ3A 2EPMX 3PM6A 1EX5A 3VOGA 3VGEA 2X05A 2GSJA 2J7EA 1X98A 1IWAA 1BWVA 1UOZA 2Z6JA 3GBEA 2ISWA 1ZFJA 3UWQA 5A8OA 3TTOA 1A5UA 3U2CA 4CU6A 2E1WA 5XIAA 2ZUTA 3B8WA 3VIOA 1DQWA 5D33A 3OP2A 3LV6A 1XV8A 5MKGA 3GRIA 4N9DA 1ITUA 1PDYA 3ARRA 1KR0A 3AAMA 3I3BA 3KLKA 3CPGA 3AHXA 3LBCA 3TA6A 2YYTA 2E6YA 1NFPA 2WHJA 3WUBA 4CD4A 1SO4A 4KFPA 1H4PA 1EDTA 2UZ9A 1Q5MA 3ZVHA 3K8LA 3UZXA 1K6WA 4LB3A 1V0MA 1QPNA 4S3JA 3KX6A 2ZTKA 1LRNA 3LHVA 2BGSA 1Y5XA 1Y7VA 2FJKA 4GLEA 1QO5A 1NU5A 2W27A 4HNUA 1OBAA 1UIOA 1CXKA 2YFOA 1MW3A 3G5EA 3KAOA 3BW2A 4GBUA 4PMUA 3W26A 4D71A 5I07A 1EQPA 4QJ5B 4ZFCA 1UC4A 3QC3A 3FCPA 2OJPA 1PSCA 1NARA 4AZBA 1S5NA 4RE4A 4KMQA 2WSQA 5FAGA 5KSWA 3G1RA 4DUOA 1ZS2A 2ZXQA 3DDMA 3NDOA 3NZPA 1TB3A 1Y5VA 4F0KA 5A5WA 1TQXA 4G8TA 1UD4A 2QULA 4LYPA 4Q4PA 4LNCA 2XTKA 1JJKA 1KQZA 1H7NA 4FMVA 5A1AA 1FBAA 2DUXA 1SZFA 3W85A 5BWAA 2R8WA 1V8EA 4N9CA 5DMLA 2VUYA 5A8MA 3L4XA 1OFBA 1DKWA 4C5ZA 3BL3A 4KPLA 2OZ8A 3ECQA 3ICJA 4LCQA 3MA8A 4NNBA 1GOWA 1P0EA 3BGGA 1E4MM 3AIEA 2V38A 3B8UA 3W29A 5EY5A 1FXQA 3UERA 4NASA 4OOZA 2FZDA 1NY1A 3SY8A 3N4FA 2Z29A 3BO9A 2Y62A 3ZLGA 1FDYA 4B3KA 2EEXA 1Z44A 4CN1A 5K2ZA 3MJMA 1VLWA 3U57A 1SR9A 1WXZA 1JCJA 4ZENA 3W2LA 4Z1AA 2DT3A 4WD0A 2ATMA 3OG3A 4DB7A 1XLLA 3M0ZA 3WY1A 1GVEA 2NV1A 3T4CA 3YPIA 3TW6A 3EX3A 4HNCA 1G4TA 1WOBA 4PB4A 1DPMA 3C2VA 2HSAA 1ZUAX 3DG7A 3SY5A 3UZJA 1S1PA 4HTYA 2F84A 5IBXA 4EPKA 1PDZA 3DEQA 4ZE4A 3PJXA 4CNOA 4CQAA 2NQLA 3MW7A 4A6GA 3FAWA 3WH5A 4A3RA 1MZHA 3GXIA 1UQYA 5GJNA 5H6HA 3VIJA 3LUTA 1XG3A 2X2GA 3OW1A 4J1OA 1L8NA 4L4MA 2ZZ4A 2X16A 3WK2A 5J8LA 4I5UA 1AW1A 3RLVA 4GUJA 1SZRA 3TP4A 1BWKA 3HO8A 4ICMA 2YCJA 4XVDA 3R13A 4KGJA 4UFHA 1FY6A 4A3HA 2YBVA 1UP2A 2PP0A 2OYKA 3EB2A 1ZJBA 2VVSA 2HROA 3A4AA 2OZTA 1U5HA 4M1BA 3N9KA 5CBIA 5U4NA 4WKAA 4HK7A 2D24A 3EX2A 4AMCA 2A3HA 1PCKA 1HP4A 3ES8A 3JS3A 3G2GA 1BKSA 4DEFA 3KVKA 1U1UA 3IACA 3O05A 4RE2A 1OF6A 2ZUVA 4LVBA 1EO5A 4G56A 4PB3A 2RDUA 1L6SA 1JYNA 3S5ZA 1OZQA 3CWNA 2Y0FA 4B15A 4UTIA 3KCJA 4J28A 1UG6A 1KTCA 4ZO6A 4ZOEA 2EPLX 3UVAA 3G1FA 1NIUA 1E1CB 3WEMA 2TAAA 3GUGA 3CLMA 3WUEA 1KM2A 3Q67A 3IUDA 3KWXA 5A6TC 3AYRA 1LT7A 4JHZA 4X2RA 3DFTA 1GHSA 1XIBA 3HPZA 1A5BA 4NJJA 4LB4A 1PJ9A 4O53A 4GVHA 3A4XA 3WLIA 4ZQOA 2QJIA 4FNRA 3NSNA 2J7BA 3DN5A 4I6KA 1E5NA 1CPUA 4NZ1A 4ERGA 2XZ9A 2ZE0A 3VIPA 2CZFA 2OLAA 3GTNA 3SBFA 3WH8A 3VZYA 3UF9A 3CO8A 3CGTA 4JQAA 2TODA 1K4GA 5LA1A 3V7PA 1MNSA 1DEDA 1F8MA 4B9YA 3KOWA 1P43A 2QMKA 4U3CA 5CC5A 3GDLA 3TNOA 2XH2A 1C8QA 4W7UA 3AZTA 2FDSA 2GK1A 2XH4A 1IEXA 3BE7A 4DBUA 1HXJA 4AHPA 5IDZA 2HV5A 1POKA 2OR2A 2OMAA 3A12A 3W2NA 1F8IA 3CB8A 3GFYA 1YHTA 4C90A 2VP8A 3AZRA 1S5MA 4EF8A 4Z2HA 1AL7A 5HULA 2YX0A 4MLJA 2OYMA 3TQPA 3WSUA 1ISYA 3V1HA 5T8GA 1IGWA 3SCSA 2AGTA 3GY1A 2C0AA 4WEVX 2OOGA 1BXBA 1FVPA 4Z1BA 1F9CA 4W88A 1M5WA 5G4EA 1KXTA 2QT3A 3QOKA 2XM2A 3WNOA 1BTCA 3PFRA 3AHYA 2AKMA 2GZXA 4GI8A 5BYWA 4E2VA 4NZCA 1OFPA 4PMJA 3EPOA 3A3WA 4PMQA 1R6WA 3HQ1A 3RHGA 4IQJA 3T0CA 1KFJA 3FX4A 1VZWA 2PDWA 1KCXA 1E4LA 2VGGA 3STCA 1LF1A 3ABRA 1SO6A 1ONRA 4NZ5A 4M7SA 4Y8FA 3OVPA 1AMKA 1TWSA 3WQDA 3H54A 4PMYA 3N15A 3KBMA 2HS6A 2B7QA 2QCMA 4GGHA 4DWSB 3GVWA 3TUUA 3NQ6A 5B7ZA 3GH5A 3GZAA 4HKPA 1R2TA 4MWAC 3MPGA 1Y0EA 2IW0A 4QQUA 3A9BA 2J6XA 2PFHA 3NEVA 4NNAA 3XISA 2DZAA 3UA3A 4ZVJA 5HWNA 4U2YA 3O3RA 3WENA 3E2VA 1Z32X 3BMWA 1Z8AA 5HUOA 1XYBA 1JRCA 2UBPC 2Y6ZA 3BGJA 3MUY1 3W7LA 1FWCC 2A3AA 3U0HA 3M0IA 3HPSA 4A2RA 3H2MA 4TVCA 4GPNA 5EBUA 3S42A 1AQFA 4ES4A 2PDNA 3CIXA 5EMLA 2GDUA 1C9DA 4MKVA 1ME8A 1UWRA 1R3YA 5CAHA 1WDSA 3B8SA 4B2DD 3VIIA 1KM1A 4C6JA 4I7VA 4AIEA 4D6EA 4NZ4A 4M1RA 3HFTA 4EK7A 1IV8A 3SQLA 3SFKA 4QE1A 1OVDA 3GNDA 4P8XA 3UY8A 1TRIA 3NPVA 1PZ1A 4H6EA 5KITA 2PRMA 2V69A 1D7KA 1V3HA 3QKZA 4FX6M 4WF7A 3AIUA 2XGZA 1EUNA 3L9CA 3C3UA 3O6DA 3PWIA 3N9SA 3GHSA 4J4KA 4B5NA 4NU7A 1E15A 3GUWA 3LENA 1YXYA 3BZJA 3GNNA 1H7OA 2PU0A 3EMQA 3DUGA 3LHUA 4M19A 2DT1A 3UXDA 4B4FA 2Y85A 1TRDA 3DFNA 4RK8A 1E0VA 1L2UA 2VTFA 4C6BA 1LBFA 2FFCA 1HN1A 4IT1A 3HG4A 1E0UA 1CTNA 5GNXA 4MDOA 1WDWA 2ZVIA 4JHOA 4GQQA 4IL0A 3MP5A 5D9MA 2QJNA 4E3TA 4Q22A 1GG1A 1QMLA 1DJIA 2DPEA 4J3ZA 2H8ZA 3TK7A 3PVFA 4ZQNA 1TPVA 1H1NA 2E68A 1OK6A 1DJZA 1UZDA 4FPSA 4AAJA 3GU1A 3VKKA 3W7IA 3VKAA 3NA8A 1FWAC 3Q2DA 1QR7A 3MP3A 3DG6A 1JYVA 2HK1A 1UASA 2WMFA 3W1NA 4KCWA 1ZSXA 4UTMA 3SN0A 5A6AA 3IJQA 4UQ9A 1GZJA 4M6UA 3HIJA 2ZIDA 3LYEA 3TWBA 3I6TA 1XCWA 2PTZA 1IYXA 3O8AA 4HYRA 1G94A 5A8NA 4EWJA 2ZC1A 1Q7ZA 2E6AA 2H6RA 5LYRA 5A6KA 4MB1A 8A3HA 1EXBA 3E12A 1Y8BA 3PUGA 4OBSA 2V5JA 2GGIA 2WNQA 3WLOA 3KVMA 3F4WA 1WZAA 3CXOA 4P61A 2QEZA 4Q8PA 4UFLA 1BXNA 4J40A 5KZ6A 1KXQA 2HE5A 4I6VA 1ISWA 4L64A 1UYQA 1XINA 2VR2A 2ZZ2A 4P8VA 9RUBA 2NVAA 3WQCA 5I2UA 4H4IA 5B80A 5K4XA 1XRVA 4H7VA 5HNNA 3VNZA 5A6JA 4C6KA 5A2BA 3G0XA 4NKCA 1JRBA 3WDIA 4NG3A 1VR6A 2Y7DA 2J25A 4B5WA 4RJEA 2A3EA 3KOZA 3B04A 5AYYA 3GWQA 1GONA 3VGHA 1S1RA 3HOJA 3H53A 3E0FA 5F4XA 4BHYA 3Q4DA 5DN1A 1IWPA 3GB6A 1H62A 3ITOA 4LALA 4PMOA 4IUGA 3FN9A 2E3ZA 1C3FA 4AVNA 1AJ2A 1CXFA 3UG4A 2GK1B 4IGSA 2V5DA 2Y2WA 3KRUA 3NURA 1L9WA 1NQ6A 4QG6A 3OQEA 1HFBA 3OA5A 3SCPA 4MADA 1HKJA 3VPLA 3ZYZA 4AC1X 2WMGA 3WJXA 1F6YA 1O1HA 3O16A 1SJDA 1PHQA 3W74A 4L1GA 2PDUA 2Z27A 3KXQA 1OZMA 2PC4A 2QUNA 4GXPA 4JTGA 5DT5A 3ZJ6A 3NR0A 4BY3A 4C5YA 1EC8A 1TMHA 1NWUA 3STEA 4LFYA 1VGAA 2VGIA 3QYSA 1BGAA 4MDPA 3SQMA 2ZXAA 2WMHA 4NP7A 2REQA 3M44A 5MF5A 4MFDA 3HN3A 4Q6JA 2WKLA 3UG5A 3EOSA 3M5VA 1K9FA 2O4QA 2A0NA 3T8LA 1XX1A 2W61A 2YDRA 4S23A 3V1PA 2DIKA 1AVAA 2CWNA 2O56A 2QF7A 4KRUA 4RV3A 4TVUA 3VCCA 4ZXOA 3I6EA 3TJLA 1FWEC 1UH4A 3SUSA 1EA0A 3PF3A 1LQAA 4KEZA 1YEYA 5J5DA 1MQRA 4MSSA 4TV6A 3XIMA 2GQAA 2NX1A 2D23A 1H60A 4GYPC 3TEVA 2R24A 3EWCA 3CL6A 4YXGA 3NVTA 5A3HA 5C7VA 2OTDA 2C13A 3SADA 3QN3A 5C6MA 4FIQA 1N55A 1I1XA 1ECEA 1P7TB 1GQJA 4GUGA 3L4TA 2G96A 1XDJA 1UBPC 2ZBTA 3MCOA 4NVTA 3GHRA 3O0KA 3IRDA 4XTDA 3EPMA 2GVEA 2AQWA 2WNNA 2PWDA 3ABSA 3A47A 1DJNA 5AZ0A 4FOJA 3CHVA 1ITCA 4XIAA 3IJ6A 1XLAA 1PE1A 1VPQA 5FEPA 4XAYA 4O8RA 4I3GA 1RAKA 1VAHA 4FLQA 3V18A 5DT7A 5AYBA 2AOSA 4LW7A 1CGTA 2RFGA 1JPKA 2E8YA 2ZDRA 3ARYA 3IK2A 1W56A 3L65A 4JDYA 3NL3A 4L65A 1SZGA 1MXGA 5A94A 4JEQA 4BCEA 2G3IA 3AWOA 3MU7A 5DXYA 4ACZB 2D20A 4O52A 2VUNA 1YNPA 3VK5A 4H04A 3O9NA 4AY8A 4WRHA 4JIQA 4Q4MA 3QR3A 5G1YA 4PB5A 4M6VA 5HMDA 5FCZA 2VCAA 4K7VA 3BARA 1LZOA 1UR9A 3W7GA 4B5XA 3OVGA 4JTCA 3AU6A 3L68A 4YTTA 2JE8A 3STGA 2J66A 3BGAA 5CPTA 3QHMA 1QO2A 3W0KA 1XH0A 5D2TA 4A3UA 4XKYA 4GABA 3HG2A 4HHLA 1KD0A 3E6EA 2R1KA 5C2GA 3MBDA 4LXFA 1EIBA 2WMIB 3P67A 3MWAA 1XLBA 3H7RA 1FWDC 1W5MA 3NGJA 3WEOA 4AEEA 4C6DA 2YCKX 5CZJA 2GQ3A 2OPJA 4G7EA 2XG9A 3BAWA 3FY1A 4AY1A 4J35A 1VRXA 4AZ6A 5E9XA 3T0DA 1OIFA 3EZ4A 3GFZA 3LG3A 1S5TA 3T0BA 4HZ7A 3NGFA 1ZCCA 1ADSA 4O1AA 1P1XA 1XD0A 5HK4A 3DZ1A 3F5KA 4LBSA 3W02A 3VOFA 1HKKA 3FW6A 4NX5A 1H1YA 1WZKA 5TF0A 1MYRA 4F2TA 4C1LA 1E0TA 2D0GA 4NYYA 4DO7A 5RUBA 4AZGA 3GU2A 3GTFA 3HQOA 3DAQA 4XZIA 3LEPA 3NG3A 2B4GA 3G6MA 4UR8A 4RDYA 1OX4A 4MWAB 2Z1BA 1ZAIA 2VENA 2QS8A 3UNDA 4OHQA 1E55A 1G7UA 1OM0A 1UCWA 2JEPA 1W3HA 4GE8A 1ODZA 5DO8A 3G8RA 3B06A 4XISA 3RLUA 4WOQA 2R1MA 2A6NA 2PDIA 1QI4A 1FDZA 4HPJA 4K2SA 4MYXA 3OO2A 2YGYA 1UROA 3R58A 4DNMA 3KTSA 1O5QA 1SMDA 4EPDC 4ZMGA 1CBGA 4PSRA 2TSYA 3EWXA 2CLPA 3CB3A 5DCDA 3I3EA 4JIHA 3H4GA 3UZYA 3T4WA 2V5CA 4JZ5A 3G1YA 3CV7A 3UCDA 5I6SA 1VQTA 4AWUA 3UWZA 4DBWA 3P82A 3QPZA 3WLMA 2HVOA 4IZGA 1M7XA 1MI3A 3WMLA 4M3PA 1E9IA 1W3KA 3C8NA 3ZQ9A 3CK5A 4CQBA 3L2IA 3V36A 1DL3A 2ZICA 4J3TA 5T91A 3A4WA 1AD1A 3TA9A 2ZCGA 1TWZA 4F9DA 3O6YX 4ZCWA 1VRDA 4A29A 3ZWSA 5DLCA 2UY2A 4GZ7A 4JIPA 1GOQA 2J78A 3BSMA 2O9RA 4Y90A 4UNLA 1C8YA 2VZOA 1BF2A 1F6PA 1LQ0A 2PD9A 2DORA 1X8FA 1TJRA 4NXKA 4H6KA 4PCNA 2PBGA 4LCSA 3LOTA 1KO0A 3HG3A 5M5DA 3KOFA 4CVUA 1VYRA 2J9XA 3IPWA 4PTVA 3QV6A 1U1JA 2DVUA 5H1WA 2HCVA 5F1VA 2AGKA 4JTUA 4UQAA 3CMGA 5I5RA 2RUSA 1V0LA 1HKWA 1KBBA 2PUZA 2DH3A 3CJPA 1H63A 1XYZA 5FJTA 3E0LA 3TVAA 3W7NA 1PO9A 3VNJA 3VNMA 3ARPA 3EWBX 3OBKA 1EPVA 1W9DM 2REQB 5JVLA 3E38A 4M7TA 3BC9A 5HNTA 1YBQB 3ITVA 3CUFA 4P7LA 2A6LA 4PC8A 4W9TA 1XSKA 3ZWTA 2QGHA 4HSHA 5KINA 2XFFA 4LBRA 1SJCA 2G4FA 3AIWA 5I7GA 4IJBA 1XUZA 1FA2A 4RNJA 1WCGA 1SGJA 3MKVA 3TLLA 2C18A 4V28A 3N14A 1RBOB 3DECA 2XH0A 1E1EA 5HJLA 3RM8A 4HU4A 2XSAA 4DJDA 2FQIA 3SN1A 3IAPA 3PPHA 2QCHA 2E40A 2YLAA 3LRLA 2PGRA 2J4GA 2YDAA 3QFWA 3LCFA 4H3DA 1VEMA 1VENA 4M80A 1SSGA 4GRSA 2FHCA 2VQUA 3W7HA 2R1LA 1IIHA 3W2KA 7ENLA 4D9PA 1QJWA 3VNLA 4CLMA 4IL2A 2NSXA 3D46A 3JZEA 2FZMA 4B5TA 4HCDA 4XO7A 2DZTA 4QXIA 3VE7A 3FEMA 3SJNA 4P2VA 4OKDA 2J27A 1XBYA 3WBXA 1QNQA 3PN8A 4GINA 1IQ8A 1WXJA 5LZLA 1RJPA 4EACA 5ABTA 4P7NA 5AC4A 4C6EA 1IT0A 3TNBA 2CBIA 1CWYA 4IICA 4A3QA 1TPEA 4DXXA 1HL9A 4MZ8A 4WDWA 4S3DA 1VCGA 1E71M 3TMQA 1M6JA 4QDWA 1HIZA 2ISDA 2QLYA 5D2XA 4GI6A 1UPPA 3M07A 2UV8G 2PS2A 1TWDA 5BOOA 4EE9A 1E72M 1NDZA 5CPMA 1CB2A 4ML4A 3IARA 5D2VA 4Q7IA 1EHNA 1ZBKA 2VWSA 4NJGA 1ML1A 2DVTA 3W7EA 4M29A 4AIOA 2C79A 1J0IA 2VRJA 5I09A 1Q6DA 1IGSA 5CQ1A 4IH3A 4WHBA 5DXXA 5I77A 3N13A 3TYAA 4GXWA 1A3XA 1DQUA 2NQZA 3R0DA 3DFQA 4S2CA 3GR7A 1HJVA 4HZ8A 2YZRA 4QJ1A 4ERIA 3KL5A 1FH9A 4IPIA 4H8HA 3W7RA 1EEXA 3W2MA 2FGBA 4E0CA 3PULA 4KCVA 1EYWA 4BJHA 1LT8A 1I60A 1DJGA 1JNEA 3QRHA 1YRRA 3EBVA 1MRQA 2SFPA 5F4WA 1CEOA 2Y8UA 4XIMA 2Y7GA 1V77A 1VEOA 4PCPA 3N6QA 3W70A 3B40A 2J74A 3VAVA 4TTUA 3LZ5A 4FEZA 3E5PA 4H6RA 2F61A 3EB4A 5DX7A 4QGCA 4MAVA 3GNRA 3ARXA 1BLIA 3SGUA 4LAMA 1WA3A 1UH2A 5XINA 1B3WA 5A8QA 5LHEA 3CAQA 2WO5A 1BYDA 3O06A 3WK3A 2PB1A 2PODA 1IF2A 1X7FA 3AUJA 1DIDA 1AMYA 2CBVA 1VFMA 5CCZA 1JULA 5EMJA 1W37A 3BTNA 3EOUA 2VOTA 3XINA 1EL3A 2PDCA 1YADA 2J8TA 1MW0A 1JCLA 4W5ZA 3N3MA 3W87A 2QHAA 2XPKA 4JD4A 4ZZ9A 4U4MA 4MJMA 4AD5A 3AXXA 4X63A 3SFWA 3TTYA 2EPHA 4LT9A 4HVXA 1EFZA 1OYCA 1CB7B 1OGBA 4OV4A 3R0KA 2PTDA 3TFCA 4JFVA 4QBXA 4GMEA 3GHTA 3SUVA 2C16A 4AD4A 4PMRA 2A1YA 3RGTA 5C9RA 4P7QA 4IF2A 2C8NA 2WMJA 2BVYA 1XKJA 4TX9A 4NZFA 5F4SA 3OIHA 2XYLA 1L8PA 1GTEA 1V3KA 1B3OA 1K77A 1GYNA 1EUAA 4FS9A 3GFXA 3TROA 2Z1KA 5AC5A 2POZA 5DBUA 2C3ZA 4C6LA 3UZ5A 4Y6GA 2BP1A 1CI1A 5I3FA 2F38A 4AVFA 1G4PA 3B0PA 3NTYA 3MP4A 1RP9A 2R9RA 3BWWA 1FXPA 3WJWA 2ATSA 3DHUA 3VDGA 4N6EA 1L6FA 1ICQA 3ABZA 3W6YA 3AHZA 1MFUA 4AEFA 4Y9PA 1JCMP 4E2BA 1UD3A 3AIVA 3FLUA 3ARQA 1NJJA 1DE6A 4JCMA 4F0MA 3F03K 3K4WA 2WWCA 4AZCA 5EFDA 3WMBA 3W7PA 3W27A 4O10A 4TU1A 5D2YA 1B90A 1CGXA 1RBLA 3WBAA 3INPA 3TC7A 1EBGA 1TWWA 3UJ2A 3LA4A 3B0UX 3ENLA 3C2YA 4KWWA 1EOMA 4DIAA 2V6AA 3LLXA 5JBEA 4ZO9A 5D02A 1GJUA 1TUFA 3IIOA 2PGWA 4RV8A 1Q65A 4GO9A 2NWSA 1TMQA 1GEHA 3MMUA 1K70A 2Z1VA 5T9CE 3WH6A 2ACRA 1XLFA 5G4HC 4HNLA 5A6LA 4UCGA 1TV8A 4KBXA 1V7AA 3QHOA 1NSJA 2YL8A 2X1TA 1V3JA 4DYEA 3WQ6A 3NZQA 1XYMA 3R8HA 3HJZA 1B30A 4F4RA 4JGDA 3S5SA 2Q8ZA 1US2A 2BXVA 1GT8A 5G1TA 1Z42A 4ZB0A 2OX4A 3RJYA 2VEGA 1LL7A 1TV2A 2BLEA 4DWSD 1D3HA 2CU0A 3BLIA 3CUJA 1UWAA 4ZQMA 3C0QA 5BMXA 4MY9A 2YR1A 2VHLA 2XVGA 4CGTA 3UJRA 2PCQA 2PWGA 4WGXA 4O50A 1PZ0A 3L4WA 5C55A 2WQDA 1KBIA 1D8CA 4IX2A 3AYVA 4Q3MA 2EG7A 1EJTC 2PDFA 4FOKA 1W1IE 2FZ9A 3CAVA 3SI9A 1KRBC 5GNZA 1LLZA 2CYGA 4JY8A 4Q4RA 1H50A 1E40A 3IS4A 5DFAA 4GJJA 4W86A 3DKLA 4CCEA 2YPIA 4GACA 1J0YA 3FOKA 5AVHA 4ROPA 3EOOA 1I2QA 4JYEA 1KV8A 3CM4A 3G0UA 1E5JA 1SPQA 2NZLA 5C71A 1KM4A 3HBLA 3SIZA 1H51A 3VD5A 1VS1A 3AC0A 3W23A 4R7OA 4NJKA 1JPIA 1EF2A 3ID7A 5A6BD 3AS1A 4HOXA 1RXOB 1KXHA 1RQBA 1FP9A 4J3SA 5AOUA 4WQ6A 2W63A 1PKLA 5I00A 4IM4A 2NUWA 1K9TA 1QBBA 3T7VA 5E6ZA 1ZBWA 2HRWA 3ZZ1A 3N9RA 4R9OA 3KBVA 1J11A 4JIRA 2G3JA 4QEHA 1YE4A 3RFAA 3L23A 3B8IA 2WSRA 4KESA 1LBMA 1RH9A 5D8WA 4US6A 5BCAA 4PMZA 5BXTA 3ATZA 1BRLA 1JYWA 1OEPA 1XLGA 4CD7A 3HQNA 3KBJA 2PF8A 2DZXA 1CXLA 4N4QA 1GVIA 4FNSA 3VDBA 4FR6A 3S1GA 4CNNA 4A3YA 1QI2A 1XBXA 3KBSA 2OELA 5TBOA 1WAWA 5K7JA 3USZA 4JYDA 3ZJ8A 2X7VA 3FGCA 1VCFA 4YL2A 2Q71A 1R87A 1PX8A 4LANA 2DJXA 3AICA 4AD2A 4PEKA 3WD0A 2OX1A 3SRKA 4O1FA 3GR4A 3PZVA 9XIAA 1EO7A 1W3NA 3BJSA 4A21A 2NV2A 3PWGA 3MSRA 3TZNA 5CJ5A 3CEPA 4NAEA 5I3JA 4ADSA 4JCLA 3SUWA 3WD1A 4PMVA 4D6FA 2VEIA 2HTMA 2Z28A 1WAUA 1XLIA 1A0CA 1JG9A 3F5JA 5GNYA 4YCOA 4R7JA 1VBGA 2E9MA 1TPH1 2VXNA 1LBLA 2OT0A 3WD3A 1Z9AA 1XLMA 4GI4A 1JZ4A 4AXNA 3FK4A 1XR2A 1GOIA 1HJWA 1Q6QA 3LS9A 4V33A 4K8EA 4W93A 2GLKA 2OZ0A 3VKJA 2XHYA 2PDGA 2E5CA 3IGXA 1E9LA 4E6MA 4LEFA 2A7PA 1V3MA 3VKDA 2IKIA 4AIUA 4IGMA 3GYCA 5IOBA 2ZRXA 4WDTA 2PTXA 4AEOA 1FFQA 4Y7EA 2TYSA 1RLDA 1HKMA 4GYJA 3PJWA 3SCRA 1D9EA 1AQHA 3AS0A 2BY2A 3GG8A 3PPCA 4K1WA 4PR4A 3GHUA 4DJFD 5EMMA 1QPKA 3M43A 4GH3A 3FEQA 3LB0A 4IPPA 2OWCA 4O1CA 3ZIZA 3OZMA 1J01A 2ON3A 4Q4KA 4F0HA 3RRXA 4NXSA 2Y70A 4C1KA 4CN4A 4HYWA 5K4ZA 1V6WA 5C9UA 3PG8A 4IQDA 4NSBA 1KM5A 3LX9A 3JVAA 3ZOAA 5LXEA 3NPXA 5BRQA 1R86A 3CO4A 1B4KA 4S39A 2ALRA 1Q13A 1QHPA 3ITYA 1H61A 1MFVA 3T81A 2CPUA 4GQGA 2XWDA 3CPUA 2O4MA 4TIMA 3PZIA 5D04C 4I7WA 3UD6A 4KEMA 4RR4A 5FIPA 1E3XA 1XLJA 4ZSTA 4MUPA 1I1WA 1EWEA 3OLIA 4IFKA 4O0QA 2ZFAA 5EKYA 4OV9A 2DUAA 3P5ZA 4AFYA 1OD8A 4Y9OA 3GDKA 4UFJA 4QE5A 3N6JA 3H7VA 4LS0A 3S2CA 3AUOA 1Q4WA 3CTTA 3BLPX 3KRSA 3FXYA 3PANA 3A23A 2BASA 4HOWA 2EO7A 1ZJHA 4RDZA 4MJ2A 4O11A 3C2OA 4QR6A 4A8IA 4BWLA 3BAIA 3WKZA 4EWND 2ZRZA 3OGRA 5D32A 1CGWA 4C6FA 3NL5A 4IFRA 1MWOA 3U2OA 4BQ4A 4IXHA 4POCA 3ISIX 3EYPA 3L4VA 3RO8A 4GKTA 4NJIA 2PLMA 3DGRA 3UYCA 4AIBA 4GG9A 1AA1B 1XBZA 1IXNA 3S8HA 1OFEA 3POCA 4LX4A 2QNEA 3QXBA 3W24A 1XGDA 3WQWA 2PURA 2FZ8A 5F1UA 1RALA 1NVMA 1TPWA 2GJLA 2XN2A 4PL1A 3GBDA 1BFNA 5KZMA 4DJEC 4CD5A 3CHEA 1KC7A 4ONVA 4ZQPA 4RXGA 2BTMA 3W76A 2HEJA 2J79A 3CU2A 1OJXA 4LV4A 3CYJA 3IJDA 4A8RA 3BOFA 3W86A 4R5EA 1A0EA 3RM9A 3N29A 3TXZA 3RJXA 5GJMA 3ZSTA 1LUCA 3SB0A 3V0UA 3VABA 3QY6A 2Y4SA 1W9VA 3K4AA 5REQA 4H9MA 2XIIA 2GSHA 1DXEA 4C6QA 4S3FA 1TFVA 1XIFA 1QAPA 5AY7A 4NHVA 3T2OA 3DENA 3VOCA 1X97A 3E49A 2FKPA 2P10A 2EJ1A 3VA8A 3RXZA 4B91A 3O1NA 1GOKA 3VD9A 3FYPA 3WH7A 2WJFA 1JZ5A 1TVNA 3UYIA 1HGYA 2PDQA 2W3ZA 5I79A 3F4NA 4L4PA 1FWFC 4JL2A 3VCNA 3AI0A 3KS6A 4HTBA 1YPIA 2OFJA 4IIHA 3TCEA 3C6CA 5EBAA 2HXTA 3VMPA 1PHWA 1QPQA 2PWFA 2VO5A 3AISA 4L80A 1BYBA 5I02A 1QPRA 4HNTA 3V5OA 3KHJA 3SRDA 2OSYA 8RUCA 5PTDA 5E0KA 1KFEA 1WV2A 1GNXA 2BG5A 4R9XA 2CKSA 2Y8KA 3P0XA 2PP3A 2QVHA 4DRSA 4H9XA 1D7FA 4UC5A 3KRBA 3U9IA 3BMVA 1W5NA 1JL8A 4G9PA 4LUTA 5EPDA 1YDNA 6XIMA 3CUHA 1VFHA 2EAWA 2Z26A 2WVVA 2W66A 3DESA 4REQA 1W1PA 2D73A 4BI6A 4H8NA 1Q6EA 5AC8A 1JI1A 3KL3A 3B9OA 3WDHA 4AZ7A 2PRHA 3FGCB 3M5ZA 2JQXA 3B9EA 3ME3A 3UPBA 1TPUA 3VZXA 1HKVA 4K7YA 3T1GA 2QUTA 2X8RA 1M7JA 2QCNA 3USBA 4LAUA 3MUXA 2D1ZA 4PFMA 1QWKA 4JXCA 2VDHA 3B4UA 5GJPA 3URQA 2FHBA 4K8GA 3VX0A 3U5UA 3ERPA 3DYMA 3ZT6A 3W73A 1OINA 5D03A 4JIIX 4MWAD 4FOUA 5C8BB 1P4CA 3HFYA 5FJRA 1LL6A 2PDJA 1K7EA 2HPMA 1G4EA 1L2QA 1W3TA 4YTUA 2WHKA 3S83A 1R8LA 1GVRA 4OUEA 4FALA 2GDVA 3QKEA 4AQLA 5D09A 1EQCA 1J8VA 4DBDA 1GQKA 4QSHA 2P8BA 3AOFA 2IXUA 4OTKA 3VO0A 3E3HA 1UZHA 2QIWA 5FJPA 2PLCA 1P48A 4XV0A 1RVKA 3DFHA 2WM1A 2ZZ6A 3F7JA 3H2AA 4GISA 3L5AA 3G77A 3STFA 1QATA 9XIMA 3EDDA 3EEZA 3URNA 1J79A 2Y5SA 3CIVA 1X38A 3CUIA 3MO7A 2BSLA 1FRBA 2C6QA 3N1AA 2CXEA 4CNTA 4M8UA 2QV5A 4QE4A 2F6UA 1HJSA 3GH4A 4BF5A 1AW5A 4X0VA 1J5SA 3AU2A 4M56A 2G50A 1LWJA 3LPPA 3RK8A 2XN1A 1VF8A 4LNYA 1YMYA 3P6LA 2DEPA 5HQLA 1VYSX 4PSPA 2RJHA 4JDBA 3EDFA 1DJXA 2WZHA 2CZDA 3ZVIA 2VDIA 3IJ8A 2NUXA 1K1DA 3AROA 1U22A 4KWOA 1O5XA 2XM1A 3HURA 3H26A 1TV5A 1RY0A 2XISA 2OGYA 3H2OA 2QCGA 2CXGA 4WOZA 4R88A 1BEUA 3BCJA 1UA7A 3W1RA 3T55A 5DMNA 3UWEA 4ZOAA 3CZGA 2W0UA 1UHVA 1H7PA 1HKIA 3AHTA 3FVMA 4UTFA 2QCDB 3FKRA 1XM3A 2FMNA 2NLIA 3N11A 3R79A 1RP8A 2JBMA 4AG0A 3LPOA 3CNYA 3GIYA 4WCJA 3UXIA 1SFLA 2OYLA 4M6PA 3AALA 4HA1A 4O0KA 1ZALA 1DIOA 1QT1A 1HL2A 4IIFA 3GW3A 2WC7A 4K68A 4NUWA 1UBSA 3PS7A 1JDDA 2VX6A 4UTWA 5TQLA 3MCMA 2IXVA 1BD0A 3ARZA 5TNVA 4ZTXA 4KKXA 3QY8A 1EGVA 4WVXA 4ZO7A 3LBOA 1XLCA 2ZKMX 1TMLA 2WXDM 1X1ZA 3VOHA 3LGEA 4WSKA 5FOOA 2CNCA 3TR9A 4CU8A 2PGEA 4B92A 3GTXA 5IHRA 1PYFA 4LTSA 3SRFA 4IQEA 2VI0A 2OWWA 3EAUA 2ZUNA 1LQ2A 1KBKA 4ADTA 3NO5A 1XI3A 3LCLA 4YVPA 3MI2A 4P8WA 2ICSA 4V15A 3NYZA 5ECUA 4Y9NA 4EXAA 4BF7A 1VBHA 2FPYA 2D3LA 1NWTA 4XBKA 4XZLX 3BSGA 2QF8A 1ZLPA 2WBGA 1VIWA 1J93A 1E43A 3QVQA 3WIJA 4MKSA 1FCUA 2QXWA 4JBRA 2VL4A 3M0YA 1B5TA 2YBUA 3W07A 2RDTA 3C61A 3UT0A 4WLCA 2QDHA 4L1XA 1TJPA 2E1DA 1UPMB 1BSLA 3WLPA 4W4QA 2O55A 2GL5A 2YL6A 3WQ4A 5A95A 1KA9F 4CCCA 2ABBA 3CV6A 2NVDA 3A5FA 1E70M 5I3KA 1KCZA 4MJ4A 4IP5A 3MTWA 5REQB 3LXCA 3LQGA 3M0HA 1ALDA 4YMZA 4JPGA 2CLKA 1NOUA 2YA1A 2CLHA 3OLEA 3BW3A 4WK9A 5HDRA 3GDTA 5AZ1A 2YZ5A 1ECQA 4BI5A 3O15A 4MPQA 1LCOA 4YVVA 1W5QA 4QEEA 4TXEA 4F0LA 3RCMA 4RLIA 4UUIA 1VPXA 3B8TA 3UR8A 5AHEA 1DWHM 3BV4A 2Y7FA 2ZRUA 3R94A 4UBPC 3S6OA 4PEEA 3WBEA 1KFBA 1EJRC 3KFTA 5LIWX 3K13A 3OEXA 1RLCL 3K30A 3SCWA 4DO4A 3S5OA 3QQWA 1FOBA 5CZTA 1ONEA 4KEVA 1IEQA 4GXMA 5G5IA 2OLHA 1H0IA 4BQ5A 3HG5A 1RVGA 5FF2A 5CPLA 2INFA 2QV4A 4E8DA 4MNMA 1GG0A 4LUTB 3LSCA 1F7BA 2PDLA 5KEZA 1W1ZA 5LA2A 3AO0A 4CVWA 1EGMA 4GHRA 5KTLA 1DWGM 4QCFA 1XLDA 4Q8VA 4REQB 4Q8UA 4Q8MA 3SN4A 5FACA 3K4DA 1JIBA 4KIEA 4EPBC 4UOJA 5LNWA 3I7RA 3SO7A 1R3SA 4DUWA 2VRQA 3A3XA 4JHMA 1VHNA 3EX6A 3SSZA 3NCOA 4LS2A 2J7DA 4DAIA 4NYUA 3C86A 1PAMA 1JD7A 1O68A 1AH4A 5T9BG 2MNRA 2BMBA 2EKCA 2CZ5A 3IAQA 3KTXA 3VINA 3W25A 1LOSA 1QU4A 1RA0A 2PLKA 2QYGA 4MNLA 4HMEA 1QXLA 3EWUA 5D30A 3PSWA 2J13A 3IVTA 4GY0A 4DQWA 1UD5A 3T2PA 3W84A 4QG9A 2PZ0A 1JZ7A 1K9EA 1THFD 1RBAA 2YDSA 2J47A 4AX6A 2R94A 5JBDA 3LLFA 4UTTC 4JFSA 3KHDA 1EJVC 4Q4OA 1NF0A 3EXRA 4DY1A 3WFZA 2FB2A 4MM1A 1S2UA 4R3UA 2Y5EA 3QV8A 1XYLA 4J5NA 1YDVA 1AW2A 1DOSA 3S3GA 4S3CA 2J9ZA 1OYAA 1ZBCA 2CHRA 4WY0B 3N2XA 3W38A 1PV8A 1US3A 4HU3A 4P7OA 1DE5A 3PY2A 1B3ZA 2GJPA 1ZL1A 4DN1A 3R5EA 4W7VA 3OBEA 2Q8XA 3W00A 2P88A 1TTJA 1Q6LA 5K9DA 1OFDA 1JCNA 4IHCA 1CXHA 2DT0A 4DWSA 1IR1A 1OFRA 5D9OA 5C2CA 4YTQA 4Z1YA 4C6PA 5DRIA 1A49A 1YYAA 1U30A 3VM5A 3DHPA 3B03A 3PZTA 3MS8A 2JFEX 4XO6A 5D9NA 4GNVA 3W7QA 4QISA 1DVJA 3P2VA 1P0NA 1XIDA 3ZFHA 2XIQA 1D3GA 4WY0F 2CETA 3RPTA 1NAL1 3N2CA 4XAZA 1GVYA 3MVTA 1KCKA 3URAA 1BYAA 1E6QM 6A3HA 4CEXC 4KIRA 3W2UA 1V3IA 1JXKA 5C2XA 3RU8X 1SW0A 1SJBA 2WAGA 3CZKA 1US0A 1VJIA 3UFYA 4GY1A 4F2BA 5H8PA 2HNEA 3PBMA 2O7QA 2HE8A 2YSWA 4FX8A 1F74A 1CLXA 2GVLA 3FV9A 1EPXA 2BOEX 4Q7NA 3GU9A 5HPCA 5FF0A 4LU0A 5AYIA 4DJFC 1ISXA 1UKTA 3NQVA 3QW3A 1W1YA 2VURA 1JVNA 4NZ3A 2CLOA 2O7SA 3VFLA 1M1BA 4KWVA 4MYAA 5LIUX 4GX9A 1I6NA 4GUFA 1YE6A 4DXKA 3UW6A 3S0CA 1BPLB 1A3WA 4CEUC 3DKJA 4GIAA 3GC2A 2Y1HA 2ZUMA 4E4PA 1R3RA 4UTTA 4X61A 4ADUA 3GE7A 4B5UA 2FVMA 5K9CA 4MF4A 2EPNA 4B16A 1JZ3A 1GKPA 3HV9A 3RAOA 2QCFA 1XPGA 4F2UA 3ZJKA 1ZRQA 5BZAA 1B0IA 5AKQA 3AHVA 4U5IA 3QPEA 3BLEA 4AWSA 5G1MA 3DFYA 5FL1A 1HJUA 2ISSA 2VC6A 8CGTA 1PS9A 1TJ0A 2D0HA 2PZNA 4FLOA 3OOQA 3C5QA 4H9VA 3AYTA 1XLEA 2A4AA 4LYKA 2DZBA 3LD5A 3TTEA 1EZWA 5HJYA 3M47A 2X09A 1PZ3A 1DP0A 3VC6A 3M9YA 3RX3A 4ATLA 3K8KA 3I7QA 1JEZA 2E4TA 2WMKA 1F05A 4JTAA 1XWYA 2X1RA 3GZ3A 3SSJA 3C2FA 4PCFA 2DSZA 3MWCA 2XIMA 4LVDA 3M1ZA 2W9MA 4X0NA 5DCBA 3KEHA 3ZT7A 1EWDA 3ANUA 4IXXA 2CFFA 3VIFA 1ONWA 2JKAA 4UR7A 1E4NA 3R11A 1GEQA 2WCAA 3WQPA 1QNSA 3N4EA 3LCHA 5C5YA 2Z7KA 2YXXA 4BA0A 4F48A 2ZQ0A 2VKZG 3MJYA 1J2WA 3ARTA 1L0PA 2V5BA 1W31A 1FWJC 2IQTA 3TWAA 2FB3A 1W5PA 2ACUA 4N9EA 2I16A 3ARVA 1DTNA 2JKEA 3L2MA 4PTXA 3WJSA 4AB4A 2OLSA 3CQIA 3ZM8A 3W2JA 2J9YA 4KEUA 4MY8A 2AMXA 1X1NA 3BW4A 3F4VA 3NDYA 3PZ9A 2GVYA 1BXCA 3GXNA 5H2ZA 4JQ3A 4UIOA 3G0SA 4R85A 4AMAA 4PRWA 5ABEA 2GJXA 1UZ1A 4ICNA 3GXDA 4UNIA 5AFDA 3NM1A 4PUUA 5EB8A 5CPQA 3UESA 1G01A 1BTMA 4AW7A 2UY3A 3O6AA 3GDMA 1FX6A 2PBOA 3S4TA 3TN5A 3QM3A 4LPCA 2G4JA 4LC6A 1AL8A 4E38A 4N0RA 3VTRA 4AHOA 3NM3A 1VEPA 3H2EA 2OODA 4ROQA 4IP7A 1AJ0A 3L5MA 4QAWA 3Q58A 1OC7A 3LI1A 2AAMA 4PMXA 1FQ0A 1SFSA 1UJPA 2A85A 3REQB 1S3TC 3UCCA 4RDWA 1UR1A 3MBFA 2I5QA 4LUSB 4K3ZA 1GW1A 3BV7A 4OBTA 4IIDA 2VC9A 5CSUA 2RKXA 5AHFA 2BZNA 1QK0A 3PNZA 1AH3A 4L7ZA 3NQDA 1S46A 5J5RA 1T41A 3CTLA 4O16A 3WELA 3QZ6A 2PSNA 4PODA 1I2RA 2JIWA 1V6UA 3DIPA 4GNJA 1UMYA 4XZBA 3WLJA 4OU1A 1C93A 4AXKA 4C65A 1VFLA 3TIMA 4CD6A 3DCPA 3VU2A 1OG6A 5IFPA 5H8MA 4C7GA 1UZ4A 3AZSA 1GVSA 1GQLA 4AWEA 3KP0A 5A6SA 1VH7A 2X30A 4G1NA 3RM4A 4AH7A 1W1TA 4BF9A 2WLZA 3BJFA 3STPA 3WDJA 1QBAA 4ZGYA 4LAZA 3EA2A 1E6XM 1ESWA 4JNZA 4FX7A 2HXUA 1I9CB 3ZO9A 1R3VA 4LEQA 3WEZA 4HD5A 3IVUA 3URBA 4CN6A 3V3WA 1E0WA 2IQDA 1R0MA 3RG6A 3S2JA 2YFNA 1J4EA 4PTMA 1CT5A 1W8SA 2E0PA 4M81A 2CHNA 3EDJA 4HGXA 4IIBA 3PTQA 2XINA 1H7WA 1P7TA 3EKGA 5A8GA 4RPPA 3BQ6A 3ABOA 4JQ1A 3P7YA 3QQ1A 3GIQA 1J9YA 2MANA 3GNPA 1P5BA 1HX0A 3UCQA 1G1YA 4PRRA 2HNHA 3F2CA 1FH8A 3AIQA 4O13A 3WF2A 3TYCA 1BVWA 3TW7A 3UGVA 2QGYA 2A3LA 2LLEA 3NL6A 1KQYA 4HA3A 1KTBA 4PGLA 3ELFA 4QLKA 4DI8A 1NWRA 4N7QA 4W87A 4GYKA 3FHAA 3TTSA 4GK8A 1RUSA 4DZIA 2BBFA 1BQCA 3K5XA 5HMEA 2BOFX 2PDPA 2XUCA 3KS5A 4ZA0A 5XIMA 5E9AA 3PBUA 3ZS4A 4YIWA 1YNQA 4FP1A 3WMSA 4Q8TA 3BOXA 3CH0A 4GIEA 2CZEA 4MMWA 4AHQA 4YPJA 3QSTA 1JGMA 3WD2A 3WF3A 1M01A 4TTGA 3P74A 3M0MA 3AWNA 2YW3A 3HPXA 4H9TA 4ACZA 4FXFA 2PTWA 4WGHA 1FTXA 2NT0A 4L6DA 3DFOA 5DF0A 5BU9A 3B05A 2HBXA 1H3GA 3SIMA 1XIGA 3WLQA 4DAFA 2YLLA 2ZUUA 2BXYA 1KV5A 6TAAA 4H2HA 1VIZA 1EC9A 1XIJA 1XGEA 1KFCA 3AQUA 1Z41A 2WC4A 5C9XA 3KVLA 2CW6A 3DFPA 3SY1A 3PBYA 4UTUA 4FA3A 4OWGA 2FTPA 2WWDA 1QPOA 3PFMA 1SVDA 1V5XA 4H6QA 4QP0A 2ACSA 3FJ6A 4N4PA 3MYOA 2OCZA 3B3DA 3MC5A 1WB0A 3S1WA 2VELA 5K9XA 1JDAA 4QS5A 3NNTA 1DWIM 1FDJA 5BRBA 1NWSA 3KUMA 2WMIA 4MOZA 1FWGC 3PTKA 1H5YA 2C14A 1W0MA 2FPVA 1LJYA 1REQB 4KCTA 4S2BA 2NXIA 3ANYA 1H5VA 3W81A 2QJJA 4E4FA 3D47A 2O0TA 1JDFA 4Q8OA 1EBHA 3L4UA 4W8LA 1XH2A 4LRSA 1AD4A 2FZBA 3QC0A 2R1NA 1PIGA 1CW2A 3S47A 3PUEA 3DFSA 1K3UA 3T6CA 1E6NA 3BLKA 2R91A 3PAJA 3GXFA 2YKKA 2QUVA 4O4VA 3KOYA 1Z6KA 1O7AA 4GQ0A 4L9XA 3TR2A 1WBJA 3A5VA 1JYXA 2Z1WA 1I2NA 1K02A 1KXVA 1FWHC 5EFFA 5BOFA 1YLVA 4BZYA 1T99A 3NQBA 3KBWA 4QX4A 3OHIA 3E1F1 3S1UA 3GDRA 1EXPA 4IJRA 4AZ5A 4JNMA 1W91A 4KERA 1RCOB 2XSXA 4RL3A 1UR2A 3OB8A 5AB3A 1OSEA 4MWAA 4UQEA 4J3UA 4WKFA 2P1FA 5HWMA 3EA1A 5FEXA 3C8FA 4HZ6A 4ORIA 3LNPA 2GUYA 2E6FA 1R3TA 2G41A 2R6OA 2CITA 4IISA 3OU8A 2HZGA 2QR6A 2DIEA 3SURA 3TSDA 2CLFA 3KRZA 3TU9A 3WJZA 2Y5JA 3BOLA 2B31A 1BYCA 1KKOA 1X8CA 3O6CA 4GVGA 5CSYA 2OSXA 3SECA 2E9LA 4BR1A 3CZLA 3NQEA 4P8UA 4QDMA 1YTEA 1QRQA 4TOQA 4LF2A 3AFBA 1OABA 1HG3A 5CSRA 3SR7A 4MFEA 2WJEA 4IMDA 1FWWA 1YTKA 4OBRA 1PL9A 5M1TA 3GG7A 5K3VA 4AYGA 1W8GA 3QV7A 3FJNA 1FWTA 2DH2A 3WDQA 3T09A 2CC0A 3NYDA 1M7PA 2GJXB 1YW1A 2WPBA 3PSVA 4DM2A 3W7CA 2GOKA 1PX4A 4KFNA 3WLKX 1U2YA 1VBRA 4LUYA 2DV0A 1JFXA 4PUJA 2EXOA 2VR4A 2NQJA 4TV5A 4PTWA 4GZIA 3M41A 1QI3A 3VGDA 3PNUA 2VEPA 4HPHA 3T8QA 1GYMA 4KWSA 2OWXA 3PR2A 5CPOA 1JPMA 1TTIA 1UR4A 1FHUA 3S2NA 2GFTA 2NXHA 1M9HA 3W88A 1WBHA 1X39A 2XIOA 3G1SA 1QTWA 3C4UA 4HT3A 1UR0A 4B5SA 4MGGA 5HNUA 4ASTA 1OHLA 3BQ5A 3ZR6A 1V02A 4L56A 3TOYA 3L2LA 1Z3NA 3SQSA 2VGFA 1W9XA 4EKJA 4I5XA 5KMYA 2XVPA 4CQ8A 3K2GA 1PTGA 1G0CA 2XWEA 3EMZA 1O12A 4FLSA 3KTCA 1SO3A 3BLOA 3H23A 1PWMA 4P7RA 4XD5A 1BWLA 1IEWA 1QNPA 2GJRA 4LSBA 1NELA 4ATDA 3B8VA 3PG9A 5A8PA 4BEUA 3WYZA 4OGZA 3NQ2A 4UQBA 1XDLA 3ZXWA 3CWHA 1SM9A 1LL4A 1UWIA 5HNRA 5F2LA 5I06A 3HB9A 5E0FA 5C0QA 2HK0A 3I4EA 1UB3A 3NUKA 1YBQA 2PE4A 4M82A 2VNCA 1UR8A 2HVMA 3TAKA 1YDYA 4LQ1A 4G6CA 4DYJA 1A53A 4HU0A 4QFUA 4R53A 5AN7A 4O17A 3NVDA 4RNIA 3LXAA 1UD2A 1B9ZA 3FVDA 3DC8A 4MY1A 4JY9A 2ZX6A 5LSMA 3W1MA 3ZR4A 3BLFA 2QCCA 1A4MA 5CGMA 4IJCA 1TIMA 3C0SA 1UUOA 3S2MA 3IIXA 4QAIA 1U1HA 3UPMA 2VFDA 1UKSA 4XZMX 1P0DA 5HUPA 1TV7A 1HJXA 1W9UA 3CZJA 4H8VA 4V27A 3CQHA 1J18A 1HF6A 2PEVA 2C91A 2QUUA 1GJWA 2QAFA 3ABXA 3PZUA 2GJNA 2AL2B 2VFGA 1LOQA 3S2LA 2ALDA 2ZRWA 2YB1A 1RCXB 1NF7A 2VJXA 1FHDA 1B9BA 4E5TA 2ISVA 1F61A 3QTGA 4HMCA 5B7YA 4YTSA 3KZPA 3GVRA 2YXOA 3GR8A 1H11A 3QEZA 2YL5A 1ZHAA 1OX5A 1TPFA 3OZPA 1T0OA 3P3BA 4Y96A 3N2BA 1K8XA 2EQDA 3W75A 4MZ1A 1SR0A 3K46A 2KZHA 3HZ3A 1A47A 1XSIA 2ZXDA 3NXLA 3WO8A 2Q3OA 2E09A 1KW1A 3VDAA 2YW4A 4F40A 3E0IA 4HHHA 3AMDA 4EAMA 1JQXA 5LNVA 2X1UA 4UNKA 2WV8A 5FF4A 1YIXA 2GUUA 1SMAA 2HISA 3CAWA 2IKJA 4V2XA 5EU9A 2IPWA 4HA4A 5FEWA 3PZMA 1YX1A 1MO0A 4UFMA 4B3LA 3M64A 2KAUC 1V7YA 2DDXA 4H7CA 4LY8A 2QMJA 4FXRA 1SW7A 3UGRA 2WBKA 6CGTA 4L6OA 4NI3A 1TA3B 2WNWA 1B57A 1CECA 2Q02A 4HNNA 5TAOA 1JCTA 3CV1A 4KCUA 1DWAM 5G2WA 3GSMA 4OOUA 1CNVA 1V0NA 4QNEA 1S2CA 2BVDA 4V1XA 2FLIA 4C6MA 3H4WA 1NDVA 4YWSA 1ZENA 3LHYA 1XJBA 3HPAA 2XIJA 4BKNA 3LCGA 2FIQA 1XIMA 3NXFA 5HJXA 3FA5A 5KETA 5DMMA 3TMLA 4HYVA 3UQNA 4US5A 1R9XA 2ISFA 1CLVA 3VKBA 1TJ2A 1AODA 1BF6A 4FF5A 3S6TA 3WF1A 1UQZA 2GWGA 3T78A 2DQWA 3M4HA 2GVJA 1A5OC 3WNPA 1E6SM 4B90A 3ABQA 3BUVA 2RHGA 1NDWA 5FAJA 3VDCA 2V3EA 1XIEA 3CHFA 4OUIA 4GC3A 2BY0A 3LERA 1CLKA 3E96A 2PDXA 4GYPA 2ZX8A 4FNPA 4UMAA 3CPRA 4GIRA 3CL7A 3OJGA 1JDCA 4XZNX 1W2PA 2DSWA 1H09A 3HGRA 1MDRA 2ZA3A 4LAKA 3S1XA 3NSXA 3N73A 1KNWA 4HPGA 3QY7A 4UQDA 4JFTA 3TQ0A 4PA8A 2QDEA 3OGSA 3GDBA 4N02A 3N4AA 3MI6A 3UR2A 3SCOA 4JQ2A 4WKHA 5GVJA 2H3DA 3CUZA 1EJXC 1RQEA 1BGGA 1TX2A 1NH6A 1KRMA 2ZA1A 4N6FA 5LIYX 1J96A 1V3LA 2FMOA 3R8RA 3RR4A 4LVAA 1DV7A 1B2YA 3W1PA 4MG4A 1LORA 3S5NA 1R47A 1CGYA 5FD0A 1YQ2A 4HJFA 5IBXC 3P5YA 2Q09A 2VRKA 5AHNA 3WCZA 1HTIA 3MUCA 3DYOA 1VKFA 4JTDA 1O95A 2XFRA 3ES7A 4YYCA 5E6YA 3TN4A 4JKKA 1GZGA 2Q3RA 1EDGA 5CKSA 3TX9A 5DRCA 1WZMA 1C90A 5CAKA 1GHRA 4CQ9A 4H00A 2A79A 3PAOA 1WDRA 4GCAA 1ZJAA 3MDUA 3NIYA 1Q6OA 1M41A 3FSUA 2NX3A 1Q6CA 1UWTA 1EJUC 4BK9A 4D8ZA 3AMGA 2A5HA 3V5FA 4QNWA 3OLDA 1HJQA 3HMJG 4GO8A 5BROA 1AFSA 3SM0A 3WQGA 1QUMA 4F79A 2EG6A 4PN2A 3R4IA 5E0CA 5CLWA 3GM8A 1KR1A 4L1WA 3GIPA 2P76A 3N12A 3M5YA 3UBPC 4PBGA 1G4SA 2BS9A 2QW5A 1TWIA 3II1A 4L9ZA 4AZHA 1NP2A 3WL0A 2PAJA 3UXKA 3OTRA 4KRTA 4JTLA 2HPIA 3V35A 1O5KA 4ZO8A 1QVBA 2C1IA 4DBSA 1FCQA 1LROA 3TYUA 4XAGA 1HUVA 5AYZA 4CKQA 1MXDA 3N34A 5CJMA 3NFUA 2C1GA 1NQKA 3O0FA 4DJED 4H01A 3TJ4A 3NOYA 2NXGA 4ZODA 2QPUA 4I7UA 4N9BA 2J24A 4LVGA 1P0BA 5ABFB 1EH9A 3LCXA 4FF7A 2VFIA 5CLTA 2EJAA 1NFBA 2WVSA 4UFIA 5D38A 3LHZA 2D2HA 5HPOA 3I3DA 3WNNA 4UQCA 1O1ZA 3BLLA 3H2FA 2B81A 1T6MA 2Y8VA 4XG1A 2HJPA 1SW3A 1LG1A 2OU4A 1NM9A 4O1EA 3VNIA 4Q4SA 3H22A 1FWIC 2YCLA 4GWEA 1YPFA 1LWHA 4TVDA 4LY4A 5BWFA 4I8DA 1PIIA 4I9MA 2W62A 2QCLA 6ALDA 2BY3A 3W82A 3P14A 2H90A 3QBUA 4O19A 1HVXA 3GD6A 4MB5A 2PPGA 2VYOA 2W92A 1OT2A 1S2VA 4KT2A 4DJDD 4XTIA 3A4JA 1W54A 1UOKA 3APGA 2XU2A 2PCEA 1ITQA 1EB3A 1U83A 3UVIA 3THDA 3M0KA 1E3ZA 4X9SA 1M53A 2WQPA 3K1DA 3OQ8A 3W6MA 4WDXA 1A80A 1LLWA 1PEZA 3W4RA 3WUFA 1R9YA 1Y5WA 5G2IA 1UC5A 2V5LA 4UR9A 3OYXA 1UWUA 2ESCA 4MWAE 4IMCA 3VNYA 3KZSA 3MZNA 2BVTA 1GORA 3WUGA 4HP5A 1YNYA 3WLHA 3MY9A 3U2ZA 4IX0A 1KRCC 2GQ8A 1KGWA 1TPDA 5C7HA 3CHCA 1EGZA 2DP3A 1GCYA