4PGLA

Crystal structure of engineered d-tagatose 3-epimerase pcdte-ils6
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
298
structure length
298
Chain Sequence
b'MNKVGMFYSYWSTEWMVDFPATAKRIAGLGFDLMEISLSEFHNLSDAKKRELKAVADDLGLTVMCCIGLKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAGLNFCAWPQHPPLDMVDKRPYVDRAIESVRRVIKVAEDYGIIYALEAVNRYEQWLCNDAKEAIAFADAVDSPACKVHLDTFHMNIEENSFRDAILACKGKMGHFHLGEQNRLPPGEGRLPWDEIFGALKEIGYDGTIVIEPFMRTGGSVSRAVCVWRDLSNGATDEEMDERARRSLQFVRDKLALEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-tagatose 3-epimerase
publication title Directed Divergent Evolution of a Thermostable D-Tagatose Epimerase towards Improved Activity for Two Hexose Substrates.
pubmed doi rcsb
source organism Pseudomonas cichorii
molecule tags Isomerase
total genus 117
structure length 298
sequence length 298
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.31: D-tagatose 3-epimerase.
pdb deposition date 2014-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4pglA00
5EMMA 3KBVA 4G56A 1S5NA 3TVAA 5EMJA 3KCLA 2GYIA 4XSLA 2QULA 4GQBA 4PFHA 3M0MA 5TNVA 1S5MA 1GW9A 4ZB5A 4YTRA 4HHMA 4PGLA 7XIMA 3UA3A 2QW5A 2XINA 4EACA 1XIBA 3FVMA 3QXBA 3M0HA 4XISA 2X7VA 1I6NA 3CWHA 1XLHA 2HK1A 1A0CA 2I56A 1O1HA 2X7WA 5C9ZA 1DXIA 2NQJA 1A0DA 3WQOA 4ZB2A 3OBEA 1XLDA 3VYLA 5XINA 9XIAA 4A8NA 3BZGA 5B7YA 1XYMA 1XIMA 3KBNA 3GNXA 3P6LA 3IUDA 3AYTA 3C0QA 3KWSA 1XLJA 3ITXA 1XLAA 3U0HA 5B80A 2ZVRA 3KCJA 3KBWA 1XICA 1XIIA 3BZJA 4QEHA 4A8IA 3QZAA 1K77A 3CQHA 2OU4A 4HHLA 3VNJA 1BXCA 5H1WA 3ITLA 4E3VA 4A8LA 8XIAA 1XIEA 4X61A 3KBSA 3UA4A 3XIMA 1XISA 3KTCA 1QUMA 1DIEA 3L23A 4XIMA 3VNMA 3NGFA 4YTSA 4QE4A 3DX5A 1XLFA 4QDWA 4A8RA 6XIAA 5AVHA 3AYVA 1XIDA 1XLEA 1XLGA 1MNZA 1I60A 3C0LA 3LMZA 4QDPA 4YTQA 3AAMA 5EMKA 4GJJA 4YTTA 3UXIA 1XIJA 3ITVA 1A0EA 4ZBCA 3JU2A 3TC3A 3C0SA 1XLLA 4DVOA 1OADA 1XINA 1XIFA 4ZB0A 3XINA 6XIMA 4OVXA 4GLEA 3KCOA 2GLKA 3BDKA 3VNKA 2G0WA 3M0LA 1QTWA 2ZDSA 1XLMA 4HGXA 1XYLA 5H6HA 1XYBA 1D8WA 5XIMA 3KBJA 1TZ9A 4LNCA 4W4QA 3KBMA 5AVNA 4DUOA 5EMLA 2HK0A 5I7GA 1XIHA 2I57A 2QUNA 4QEEA 4X60A 3UVAA 2GUBA 5FA5A 4XSMA 1XYCA 3ITYA 3AALA 3IUHA 9XIMA 3P14A 4Q7IA 4GJIA 4QE1A 1DE6A 1XLBA 1XP3A 4XIAA 1XLKA 5J8LA 1CLKA 5B7ZA 1YX1A 2NQ9A 4US6A 3UU0A 4XKMA 1XYAA 1DE5A 4HNOA 3M0XA 2Q02A 3XISA 2XIMA 3ITOA 3DBNA 4X63A 4EAYA 2HCVA 3BANA 1QT1A 1XLCA 3CQKA 3M0VA 4K3ZA 4KW2A 3CQJA 3CNYA 1DIDA 5XIAA 2XISA 1MUWA 3ITTA 4QE5A 2NQHA 3M0YA 3N4AA 2GVEA 3QYSA 3VNIA 3BWWA 3VNLA 3CQIA 8XIMA 4K1GA 1XIGA 3QC0A 1XLIA 1BXBA 4YTUA 3U3HA 2G4JA 4J4KA 3IUIA 2QUMA 2J6VA
chains in the Genus database with same CATH superfamily
1FFRA 5M3WA 2KZHA 2VC6A 1EJRC 1JJKA 3CYVA 4O54A 1A5KC 2J78A 3CHCA 4W7UA 5CSSA 7A3HA 4JX4A 4Y8EA 2ZE0A 3QHNA 1ONEA 3W86A 2A3BA 3IIVA 1ISZA 4IIEA 3LXBA 3VMOA 2XZ9A 1PHQA 1J0JA 3F03K 1I0BA 1J0YA 4Z2LA 3UPMA 4P8VA 3DG7A 5FESA 1V3MA 5J04A 1A4LA 1EOKA 1ZB5A 3BW3A 3W7JA 2FZ9A 1JCLA 1YQ2A 2WLZA 4G6CA 4UMAA 4GVGA 3VM5A 2GLKA 4HSHA 5AC4A 2WZIA 3F5LA 1PZ0A 2F8QA 1K6AA 3FKKA 2B7QA 2V3EA 2WO5A 4R9XA 1F76A 1F74A 4MGGA 4ZFCA 3ISIX 4YVXA 3MKVA 3T2OA 1E15A 3OU8A 2X40A 3G6LA 4LUJA 4LBSA 3HIJA 1C3FA 1BG4A 3MQTA 4KRUA 4PTNA 2PMQA 1J5SA 2O9PA 1P0DA 1XBYA 3QFWA 1IYXA 2ASHA 1J01A 4DQWA 4MUZA 3LHZA 1XJBA 4QCEA 4BQ3A 1X6LA 4L6OA 1TUFA 1VPXA 3HPZA 3GUGA 1F3EA 3HQ1A 4GY0A 2Z2BA 1J8VA 4IX0A 3GDLA 4B5NA 3WH7A 5D32A 4ZZ9A 2OJPA 4XISA 4S3GA 1P5BA 3M0ZA 1OEPA 3P0WA 4NX0A 4JYDA 3NSXA 3PNZA 3GTFA 1RVGA 3WLHA 1W5QA 2DW6A 2FLIA 1JI2A 5U7SA 3VZXA 2GJPA 4GH3A 4K36A 2WC3A 4XO7A 3PANA 5L9FA 3W85A 3QVQA 3GU2A 3GHRA 2OOFA 4PRRA 4QAIA 3BLFA 3L68A 3L5LA 3XIMA 5LHEA 1WZLA 1FWJC 1DTNA 5CC6A 4IIHA 1MNZA 4F0HA 4CNUA 4N42A 1XLLA 3MBFA 2NT1A 3GKAA 2FPVA 2ZA1A 1SSGA 5A95A 2V81A 2E5DA 4LNCA 4EWND 1LT8A 4IWWA 1AJ0A 1SZGA 1UA3A 1EJTC 4FXFA 1KV8A 3T8QA 1IEWA 1JPIA 1RLDA 3V3WA 3S5ZA 3I6EA 3EAUA 2PS2A 4LW7A 1NWUA 2QMJA 1RBAA 3M0VA 4CGTA 3G77A 4RE0A 4OBSA 2Y7EA 1TWSA 7TIMA 3MCOA 4N9BA 4JTUA 4MF4A 5BMWA 5DEZA 1QAPA 3URNA 1DIKA 5DANA 2UV8G 3E2QA 1DVJA 5HJXA 4DPPA 1VQTA 2ZA2A 4EK7A 1QWKA 1KRBC 4XVEA 2JF6A 4Q8PA 1MI3A 2Q8XA 5HULA 5DBTA 3BZGA 4ICCX 2X2GA 1TE1A 4MUPA 3FFSA 3OLDA 1S3TC 3PZOA 1A47A 2QMKA 4UFMA 7REQB 2IKIA 1S2AA 1P6CA 4MY9A 3WQEA 1A5MC 2BVWA 3W1LA 3G1HA 3EBVA 4H6KA 3RCYA 1H5VA 3VNMA 2GDVA 3PWGA 2W91A 5EMKA 3SIMA 1KO0A 4UQCA 2NV2A 1GZJA 2ZRVA 1OGGA 1WZMA 3OLIA 1E72M 5HA7A 5G5IA 2Z4GA 1Q63A 4I3GA 2BXZA 7REQA 4FNRA 3M47A 3MY9A 3HF3A 1DJQA 2G4FA 2ZXDA 2RDTA 1ZBWA 3STCA 4PL1A 4E8GA 4GC4A 4JIRA 2VUYA 5BNKA 3R8RA 4UB9A 3H2AA 4L61A 4Q4SA 3B8WA 3W1AA 4K1GA 1KKOA 3QRHA 1DL3A 1WB0A 3VI2A 1M68A 3TA6A 1ME9A 4WKAA 4FOUA 1TTQA 3CZEA 4IPIA 2E6YA 3H2NA 1TSIA 2DZPA 1TV3A 4Y90A 5JMUA 4CCDA 3ZIZA 2ZTKA 2QQ6A 2XVPA 4Q3MA 4DYKA 3LHYA 1HF6A 1QO5A 3S8HA 3O63A 5BXPA 3EA1A 2AGTA 4GI6A 1UIOA 5BWAA 1BAGA 1UC4A 1PL9A 3TX9A 2ZVIA 2Z0IA 2C18A 3B8TA 4O53A 1F3XA 2CERA 3KP0A 1P1XA 3EPMA 3WY1A 2WSYA 1W54A 4H83A 4UR8A 4F0MA 3C0LA 3V0UA 1ITUA 4KGLA 4LH8A 2BASA 4O52A 4PUWA 3G6MA 5F4WA 1XLMA 2PWGA 4IPNB 1PYMA 4JTEA 1XPYA 2J74A 1ZJHA 3QOKA 5AHMA 3W25A 3WUBA 2XZ7A 1IGSA 3B0YA 1C92A 4Z08A 1WOBA 1PDYA 3BMXA 4ZQPA 3PPFA 3AS0A 4NJKA 4XIAA 2BV9A 1HP5A 4UIOA 1ZS2A 1UW9A 4Z2HA 3Q37A 1HKWA 3RU8X 1H0GA 5GJMA 2QF7A 3O05A 4NQ1A 3SN0A 1ZFJA 3VNIA 3SCTA 1CGYA 1H51A 3S2JA 1VFUA 3IUIA 1HL2A 4GE8A 4W86A 1LP6A 4UFLA 4CQCA 4GQBA 2PA6A 1A5AA 3ZWTA 3EDEA 4JEJA 3U4AA 3WFAA 2GWGA 3TR2A 3TK7A 3K8LA 1VFTA 2G3FA 3ALFA 4W88A 3FVMA 4LAKA 4LJ3A 4Y8FA 4JNYA 4D71A 3USBA 1DORA 5FEXA 4B2DA 3POHA 3GUWA 4OE7A 3LDVA 2E40A 1T96A 4HK6A 3T42A 3TN3A 2TRSA 4JTJA 3WLOA 3NAVA 4ZEPA 3KOZA 3EWWA 4MADA 2YFOA 4A3QA 3CHVA 4N6FA 3AAMA 3NYDA 2PTYA 2JIWA 4QCFA 3WBXA 1C93A 1OG6A 2OLSA 3IJ8A 1WQ5A 3ARVA 3EGJA 4NU7A 5IDIA 4L9XA 3KXQA 4LRSA 4EKJA 1F05A 3IAQA 3EMQA 3GFYA 3UWQA 3WF4A 3NOYA 3NQ6A 3L4ZA 2Y6ZA 3LRMA 3W23A 1AMKA 3UF9A 3ZO9A 4ZOBA 1YDVA 3MBDA 1UR9A 4LC8A 3XISA 3M07A 1B3WA 2G37A 1XLCA 3WBWA 1U5HA 1QO2A 3SM0A 1C8YA 3THAA 3N6JA 1EF2A 3T55A 2O56A 4IL0A 3CAVA 1PWLA 1KXVA 5HQEA 3HG5A 3PPGA 1GEQA 1E0UA 2EF9A 1UWTA 4NZ5A 3WF2A 1UR8A 3MWCA 1J6OA 3CPUA 3N4FA 1X7FA 3UXKA 5C9ZA 2C79A 4FNTA 4GHRA 1FHLA 1P7TB 3GYCA 1UZ4A 1XYMA 2RJGA 2AQWA 2C91A 4TX6A 2HQAA 2PBGA 2H8ZA 2YDAA 2ACUA 3EEGA 4FEZA 2TSYA 1ML1A 5BU6A 2FPTA 4AY7A 2OLAA 2QPUA 1FCQA 2G41A 3H4WA 1EC7A 2WSQA 4JHMA 3UWWA 1XCWA 4IFOA 3NOEA 4UTWA 3MUIA 1X38A 4EXBA 3CZJA 4P8XA 5MHBA 5EGRA 1PKYA 3QW4B 2WZTA 4NXKA 2YYUA 4JIEA 1CDGA 2PP1A 4PSRA 3RGTA 3K5XA 1XYLA 3JUGA 4CQ8A 1W3LA 4CKQA 2QAFA 2QAPA 3G8RA 2CKRA 2QR6A 5AC6A 2VUNA 2VXNA 2HZGA 3LZ3A 4QBXA 4XTDA 3VCNA 4J3WA 2VCAA 2PGRA 2QJMA 2WM0A 2TAAA 3DZ1A 2HCVA 3N3MA 5KTLA 2CPUA 4HYVA 3S1XA 4Z2GA 4A2RA 4A6GA 2BMBA 3TN4A 4LOCA 1BQCA 3PZMA 3VIHA 2NV1A 1SZFA 3PHAA 3VC6A 4AZ7A 1EWEA 4IGSA 4L4PA 4B3ZA 1ECQA 2J27A 2VDIA 2DVXA 3DDMA 1AFSA 4O1CA 2WQPA 4RZ5A 6PTDA 3BG5A 3E1F1 3IJQA 1XKJA 3JRKA 1TIMA 4KWOA 3W2JA 3FSUA 1VBUA 3I6TA 1VJSA 1S5VA 2PAJA 1OYBA 1GVRA 2PDNA 3MCMA 2VZSA 1UMYA 2WVVB 3AS1A 2H90A 3W71A 4DI8A 1LF1A 3M7WA 3Q67A 4F2UA 3HURA 3JU2A 2WNNA 4QS5A 1X98A 1OK6A 2VGBA 5BYWA 3UNDA 3M0IA 2AL1A 2E25A 1IZJA 2IQDA 1Q66A 4K7YA 1YDNA 5CCZA 3WDPP 3KZPA 2ZA3A 3CZLA 4NJJA 1R9ZA 1N8FA 4GFIA 1LJYA 3SCQA 4DWSB 4PBFA 4EAYA 2HROA 4LVFA 4QE5A 2J7EA 2E3ZA 4W8LA 1GJWA 3IAPA 1WOAA 3UPWA 3NZRA 1R7OA 3MMDA 1B9BA 2F84A 2OGYA 5LNRA 2XVNA 3CK5A 5F1VA 1VYRA 4B92A 4PCNA 3APYA 3INPA 1S2TA 3TJ4A 2P8CA 1JD9A 2GJXB 2ISVA 1NWTA 5HUOA 4H04A 1NARA 1GKRA 2VFIA 2X42A 1K8XA 2XSXA 2ADAA 4GI8A 4LUSB 5L6UA 4ICNA 5CQ1A 2OOGA 4M24A 1QNSA 1EZ2A 5I3IA 4HPXA 4TU1A 1OX6A 4DM2A 3RO8A 3KUMA 1LUCB 1C29A 4DBDA 2V5DA 3E49A 1HJXA 4ZB0A 3CEUA 2GJXA 3KCOA 2VRKA 2I9EA 3U5YA 3UGVA 3DI1A 4QJ5B 3VGBA 3UZWA 1HX0A 3PWIA 2VT0A 4LUSA 4QEEA 4ZO8A 4MZ8A 9XIMA 4XAFA 4JKLA 4UC5A 4ATLA 4Q8TA 3W0KA 3S5OA 2P3EA 4XZ9A 5I09A 1DOSA 1LUCA 1P0KA 2EPHA 3LOTA 1E5NA 4X3ZA 1NELA 3QC0A 3P8JA 2QUMA 1BWLA 2RUSA 5EMYA 4V28A 1FXQA 4QFUA 3EZ4A 1N8IA 3UW6A 3BLIA 1V08A 3CL6A 4FNSA 3GNPA 1JIBA 5IDZA 1IT8A 1PB0A 3MB9A 2HVOA 4M5PA 1HG3A 5DT7A 2OT0A 4W8BA 1Y5VA 3ANYA 2CXGA 3SQSA 1UOKA 3PG9A 1SZEA 1TCDA 1Y5XA 2Z25A 1AW5A 1KQZA 2YXXA 4A4AA 4AY1A 4HA0A 1ZY9A 3WLMA 4C6JA 3QZEA 1E4IA 3BTNA 1OD8A 5CLTA 4JIHA 1UD4A 2QUTA 3LNMA 4ZXOA 2Y7FA 3UR8A 3IJ6A 1M65A 1UBPC 2DZAA 2HNEA 4ZTXA 4UTFA 3JZUA 2ZZ4A 2XN2A 3AHVA 3HFTA 3OIHA 4M6UA 5CZSA 4DJDD 4CNSA 1E55A 1VFLA 1UD6A 1OWQA 1XIHA 5C2GA 1OT1A 1LG2A 1TX2A 5E9XA 1QPOA 4G8TA 2QZRA 1RSCA 3IK4A 1SFSA 3KLLA 3KZSA 2FTYA 1GT8A 2XGZA 4GXMA 3CMGA 5F2IA 4LQ1A 5HMDA 2QF8A 2G5WA 4O1AA 3CZ8A 1MW1A 3CB3A 2ZZ5A 4UZSA 2PDPA 3VIGA 3ZJ7A 2Y88A 1ZENA 3IANA 4JYEA 2ZZ3A 1GNXA 3EX4A 3WQPA 1AQ0A 4HYRA 1BYAA 1CLVA 2QNEA 5A69A 2HK1A 4FOKA 2WANA 1W0MA 1GYNA 3GDKA 4NVTA 3NEHA 3BAIA 2RJHA 1BF2A 1FWRA 1ZBCA 1P43A 3BC9A 2DVTA 1KXQA 3CUZA 4HP5A 2FHBA 2PRMA 2QLYA 5C55A 3WQ5A 1LLOA 2HBXA 3K4WA 3ZM8A 3K30A 3TNOA 3DH7A 1VENA 4O57A 4H9ZA 4O1EA 1NWSA 4DBSA 1VF8A 3SRKA 4M56A 4G1KA 2I9UA 5HQLA 4C6KA 1BHGA 3WNMA 4JIQA 1KXTA 2QCEA 1W1ZA 4WQ6A 3VIIA 3LMYA 4POCA 3GR8A 1W9PA 4ZO7A 3JZEA 3N25A 5D9PA 1Q7ZA 2Q8LA 1E1EA 1VR6A 5DLCA 4AD1A 1LCOA 2FZNA 1ZPTA 1CNVA 2X16A 3WENA 1ZQ5A 1UPPA 1J12A 5BRBA 3VOFA 4ZENA 4IIDA 4XKMA 2YA2A 4O8RA 2XTKA 1NJJA 4I5UA 3O1NA 1K9FA 1RQHA 3RJXA 3RM8A 3WFLA 2IXUA 3ITTA 5HMSA 3R12A 4CU6A 3RUBL 2WJZA 1FBAA 5IHRA 1OBAA 5IFTA 2A7RA 2YIHA 3SGZA 2XIIA 3TP4A 3EYPA 3QN3A 2A79A 1XLHA 4DLMA 3K4DA 5CJNA 4LYQA 3AFBA 1NSJA 4LVBA 4E4PA 3GVGA 3IWPA 3A4XA 3C56A 4PMXA 4BWLC 4L64A 2JBMA 4K68A 1HJQA 1RK5A 5A6BA 3QV8A 3HV8A 3RNDA 4LNYA 1I2NA 2BOGX 2JKEA 2WHLA 4LWWA 3VGFA 3CQHA 1GG0A 4ATDA 4AY8A 2DH2A 3HN3A 1EB3A 3LN3A 4S3JA 3BSGA 3ITCA 4GCXA 1K8ZA 4E4FA 3PB2A 1NVMA 3OO2A 4JDYA 4R85A 1EJUC 4FLQA 3SCOA 1NQ6A 6ALDA 4WZHA 3KRSA 2CETA 5GVJA 3S5NA 5AYBA 3AALA 4WKHA 2WYSA 4LVAA 4H00A 1V77A 4UNKA 2PE4A 2OWWA 1ESWA 1AVAA 3UU0A 1XX1A 2FJUB 4HNOA 1WDRA 3GVQA 2OODA 3M4HA 3IJLA 1PAMA 3VE9A 1E4LA 1XBZA 3GY1A 2GYIA 3ICJA 3L4XA 2OCZA 1O5QA 3W1XA 2A0NA 2GGHA 1CENA 1B4KA 2CLEA 3COTA 5FI8A 4RE2A 1B3YA 4D8AA 5M1TA 1UKPA 3PY2A 3A3HA 5GJPA 4NL1A 1O1HA 1A0DA 2PC8A 3AIUA 4GNJA 2DIEA 2W66A 3DG6A 2GSHA 5FF7A 3I68A 3IV8A 5SWUA 1K7XA 5FJIA 3SBFA 1DQWA 1FHVA 3AHTA 4H6EA 2WZEA 5KMYA 1CXEA 3MS8A 1UR0A 2YOCA 4AEOA 4FSAA 2ZCGA 3GX9A 3N19B 3C8NA 4IGHA 3M46A 4HA3A 3UZJA 1RPKA 1WDSA 4YTTA 2ZXAA 2E4TA 4LV9A 3UG4A 3FK4A 3G1YA 1PXGA 1I1WA 2HISA 3TTEA 1FKXA 1HVXA 4JTFA 3PJXA 4ZQOA 2WMGA 1EXBA 3KWXA 2WCAA 4ROQA 3W82A 5XIMA 5FAJA 2YPIA 4RE4A 1W3JA 1Z32X 3V5OA 3OTRA 4OT7A 1WUFA 5LIYX 3P14A 4GH1A 4LU0A 1UOZA 3VKBA 5J8LA 3KFTA 1VEOA 3A9IA 3LZ5A 1ZTVA 5EBAA 1AJ2A 3SIZA 3IGSA 5EFDA 5DQPA 6CGTA 1O4UA 3AXIA 8XIMA 2XSBA 3QC3A 4UTUA 4PZVA 3R89A 1QNQA 2PFHA 3AI0A 3MWAA 4AEFA 4MNKA 4MM1A 3LGEA 1SZNA 4DAIA 2SFPA 4Y96A 4PODA 3I3EA 1GTHA 2EJAA 2XM1A 3CAQA 2WOQA 5CAKA 1MEHA 2FFCA 3FY1A 2BP1A 4UFHA 2O92A 3G0XA 2KX9A 3VYLA 3IJIA 1MXSA 1XS2A 4Q8NA 4J1OA 1CLXA 3UWEA 4F48A 4AIOA 1W3IA 4U10A 2VMFA 1A49A 5CZTA 1JZ2A 1PS9A 1E70M 4QNWA 1OFOA 1EUAA 1K8YA 2VFEA 3TXZA 3TEVA 2ZC8A 3U2OA 4FF5A 3BAXA 1B5TA 3UJFA 3GB6A 4I5RA 3N9SA 3GDBA 3R13A 4PEEA 2HWGA 1KLYA 3M1ZA 1LROA 1W8GA 2DU2A 2YZRA 4GX8A 4IFRA 3CUHA 1V6UA 1J5TA 1LWIA 2VC5A 1G5AA 5LA0A 4D8ZA 3ITVA 1LOLA 3H4GA 1FWSA 1R5YA 1BF6A 5A5WA 4AU0A 2OT1A 1VYPX 4MNLA 1W1B1 3W29A 1XSJA 2RDXA 1RAKA 4BEUA 1KM2A 2GGEA 5JBFA 4ZODA 1ZAHA 5E0KA 3G1VA 4ECLA 1DWJM 2ZFAA 3IJ9A 1NOUA 3W1PA 3EWCA 2P0OA 4FALA 3ABRA 3O07A 3UZZA 1G1YA 3TNBA 3MKCA 3EKGA 4XD4A 5HANA 1DIDA 4XZIA 4UCFA 1F2JA 2PLCA 2NLIA 2BG5A 3T0BA 2VX6A 4LCRA 4K7VA 3CQ0A 1XRFA 3W2MA 2XFWA 3J7HA 3L4UA 2GJNA 4G1NA 4L4OA 1JCJA 3LCFA 3H7RA 1HO1A 3EX2A 3ARSA 3Q94A 1HJSA 3GWQA 4GUIA 4AVFA 2JIEA 2BY2A 2YA0A 4PTMA 3WMLA 3T9PA 1EP2A 3UFYA 4CCEA 2E28A 3P6LA 4ZVJA 1FFQA 2IW0A 3WLJA 2CYGA 4ADTA 1Q8JA 3L12A 2GFTA 3ZSTA 1TTIA 3RMJA 4HHLA 4I6KA 1JZ5A 2BY3A 2NVDA 1GPWA 4CNTA 1YYAA 1LYXA 2D2HA 3AC0A 1IZKA 4GKTA 3UXIA 3VM7A 4C91A 1E0XA 3PJWA 2R1PA 3HMCA 3HTWA 4RV3A 3G1XA 4QQ3A 2Y8KA 3ZLGA 1KFKA 2Y7DA 1YBQB 1Y0EA 4WEVX 3V0SA 4ONVA 2QUVA 3UP8A 1Q2SA 2ZX8A 3L2MA 3NO1A 1MUMA 1KWGA 3L65A 5T91A 2B7OA 4MLJA 2FB3A 3H54A 4AYSA 1WYIA 3IJDA 3LSCA 2MNRA 4FNPA 4R27A 2DY3A 2I5GA 1OC7A 3QLDA 4NAEB 4YL2A 3C2FA 1W5NA 1YBQA 4PFHA 3LBCA 4ORIA 3G0UA 4GRSA 3EX1A 4LYKA 3WBEA 3PBMA 2YSWA 2OZ8A 4L4LA 3PUGA 3AHZA 3UR7A 4OV4A 4S1FA 2VR5A 2J7HA 2JGYA 1OFEA 4ZOEA 1QDSA 4NAEA 3KBWA 3P82A 1OCNA 1ICSA 1EF3A 5CSYA 1E4MM 3ARRA 4S23A 1DHKA 4HPJA 4JN6A 1RPXA 4JTGA 1GVQA 5FEWA 4P5UA 1WZKA 3WLIA 4E8CA 2VDHA 2O9TA 3MZ2A 1OADA 3UCDA 2C19A 1YADA 4EXAA 2BZNA 1JAKA 4I7VA 3P80A 5A6LA 1CGUA 4DIAA 3VD5A 4ZMGA 1MUCA 2I1OA 1WA3A 2DUXA 3W7QA 1OYAA 4W89A 5AVNA 3IIPA 3U7VA 2GQ3A 2FH8A 3ITYA 2Z27A 4DJFD 3KVMA 3W7DA 3C2EA 3B9OA 4W87A 3TKFA 3M7SA 3WEOA 2CBVA 2PWEA 3SR7A 3JS3A 1W1TA 3QW3A 4PMRA 1B3XA 3RXZA 3K1GA 4IJRA 4RDYA 5BXSA 1AH0A 2QCGA 3AJ7A 1X97A 3VDHA 1B3ZA 2WM1A 3PJUA 2WHJA 1MW3A 3Q2DA 3ARTA 5D8ZA 3TXVA 5A8GA 2YL8A 1FH7A 2QDDA 4AISA 3DN5A 3SCRA 2OZ0A 1TWDA 2CKSA 4WHBA 3FCPA 3W7PA 2WHMA 2OLHA 2QYGA 1F73A 3TH6A 1Q6RA 3SCSA 1I45A 3KBNA 3BG3A 4Q4QA 1JYXA 4QITA 1SW3A 4B9YA 3DFPA 5I00A 1CB7B 3W1MA 1BTCA 3NYZA 3PC0A 3EB3A 2ZUMA 3CIXA 4RDWA 3CYJA 2VTFA 2OWCA 3P74A 3QFEA 1X6UA 5HWNA 3THDA 3G1RA 4UXDA 1AA1B 3IS4A 5CSUA 3TTSA 3W84A 5JBDA 3ZJKA 3WL0A 3PBYA 3LHWA 3G0SA 1JZ7A 4B4HA 3NWRA 4C5YA 1H7OA 1LQ2A 4Z42C 1W5OA 4QTGA 4M6PA 1AL8A 3TWBA 1BYDA 5ABGA 4H1ZA 1W91A 2G3MA 1W2PA 3U3HA 5HWJA 4D6JA 1EO7A 2ZRXA 3PUDA 3OA3A 2C14A 1W3HA 3RLUA 3HG2A 5BCAA 4XAYA 2BOEX 1NF0A 4D9PA 2DSVA 3GIQA 3AMLA 1W9UA 1D3CA 4JNMA 5AC7A 2WMHA 3WLRA 4PB5A 1OG0A 3NSMA 3D6NA 4RZBA 2EQDA 4EAMA 2VL4A 4M1BA 3DHPA 1RVKA 3TOYA 1K7EA 3H2CA 3QTPA 3BSHA 4HZ6A 4R7JA 3IGUA 3VMNA 3AYVA 3SQMA 4IXHA 1QNVA 1XPGA 2R94A 1S46A 3JVAA 1ME7A 1YPFA 1V6YA 4Q22A 5BU9A 1J96A 3RHGA 1SJDA 2OR2A 3LERA 1C8QA 3CUGA 4HNLA 2DZSA 3QKEA 1KGXA 4Q7IA 4LPCA 2YL5A 1W2VA 4LXFA 3UVIA 1XP3A 3TZNA 1W1A1 2Y63A 4L5ZA 3UG8A 3BE7A 5CAHA 1X7IA 2V67A 3CV7A 1A80A 2V0TA 4MZ1A 1RZMA 3C52A 4GUJA 4H8VA 4A3RA 3UD6A 3EA3A 2A7NA 3B8DA 3W6YA 3ZWSA 3FHQA 3HG3A 4MJ2A 4UFKA 1JYWA 2O0TA 4A35A 2WSPA 1IXOA 2CHRA 1E3ZA 1FWDC 1OFAA 1MSSA 1V3LA 1TMLA 3DESA 1EBHA 1HP4A 1F61A 4PBGA 5I03A 1IWPA 2H6RA 3ANUA 4QG8A 4REQB 3SCVA 3MHGA 4IPJA 5JXQA 4PUDA 3FJLA 3CL7A 3JR2A 3FS2A 3CASA 3ITXA 3VZZA 2VEPA 3TFCA 4HU8A 1XH1A 2YFNA 3G3MA 3TOPA 3AUJA 1JEZA 1A4MA 1TA3B 3CO8A 1HVQA 1H7WA 2JEPA 2Z1WA 2ZUVA 4IQLA 4KGJA 1FWWA 2E67A 3KEHA 1H3GA 1TV7A 2V2HA 3SSJA 1GHSA 1XLEA 3TQ0A 4QDPA 5GNXA 3WK3A 2AOSA 1OABA 2DPEA 4REQA 1TKKA 3BK0A 1VHCA 6REQB 2HS6A 4HOWA 3ZZ1A 4AX6A 1SO5A 1V02A 1E6SM 4ENLA 3PK7A 4NNAA 2PDGA 2PLKA 4JQ4A 2OB3A 3DFNA 3KVJA 4U4MA 1OGBA 3KVKA 3LHVA 4CQAA 4WGXA 3NFUA 3KW3A 4P61A 5EPDA 3VOCA 5HMFA 3OGRA 1FWGC 4TVDA 5I2UA 4TIMA 3W6MA 4O0ZA 3LI1A 2B0MA 4KEUA 2VVNA 1NDVA 3ARXA 1I9CB 3UZXA 5HXMA 5G2HA 3TUUA 3L0GA 3TV8A 1S2UA 3GG7A 4YJ5A 3TYCA 3UWUA 3LLXA 2QIWA 5I3FA 2V2CA 4XAGA 2JGQA 1QFEA 1H4PA 4D8LA 5A2CA 2VM8A 4P2VA 1IEQA 2AQVA 3LLFA 4H7CA 1C9WA 3PP7A 1JL8A 2HNHA 3GM8A 3AYTA 2VC7A 4TOQA 4Z17A 2E8ZA 2P8BA 3F4WA 5D37A 1EJSC 5H8MA 2PLMA 1SR9A 4UTKA 4IT1A 5HNRA 3WJSA 3NJ3A 3QZAA 2A3HA 2DH3A 1VFSA 1UKOA 4GACA 4X61A 1PKLA 3K4AA 5A8QA 1W37A 1GK8A 3O15A 1T99A 4JR5A 2VX4A 1XSIA 1HKJA 4IPLA 3RM9A 3WUFA 3MMTA 3QKZA 4H01A 3TC6A 4S3KA 2X1IA 4QJ1A 2J8TA 1VRDA 3DU0A 5LHFA 3SUSA 3L5MA 1OVDA 4KESA 3BL3A 2Y24A 5HNNA 5AHNA 1UWQA 1X8FA 2XFFA 1FOBA 3B4YA 3LCWA 2ZZ2A 4YCOA 3H70A 4O1BA 5C9WA 4IMAA 4O16A 5DXXA 3OZPA 4GYPC 1FWAC 3NSNA 1BYCA 4NSBA 4WIWA 2VFHA 2G3IA 1AQHA 4JTAA 3TTYA 2E8YA 3SY1A 4HN4A 3WNKA 3SAZA 1NEYA 2PRHA 2Z7GA 5DT5A 3BAYA 3W81A 1TV2A 3BO9A 4AZBA 1FWHC 4NZJA 3N4EA 2OEMA 2F7FA 1M7OA 3RPTA 4UTIA 2G97A 4BWLA 1BTMA 2PI6A 1F7BA 5HPCA 3PPHA 3TROA 3FSTA 3WQCA 1LBMA 4RXGA 1I75A 4RJEA 3FKRA 1ZCOA 2D69A 4M6QA 3STEA 3IIZA 3QY6A 2DQWA 4W7WA 3ZVHA 5G4EA 1AODA 2OFJA 1TVPA 2CESA 4GKLA 2VEFA 3VIOA 3VU2A 5HDRA 4HZ7A 3UERA 1OCBA 1Q6OA 4EX4A 2DZBA 5BMXA 5FD0A 1S1PA 3LGGA 4DUWA 1FWCC 1OFBA 3M0LA 3LBOA 3ERPA 5FF4A 2A5HA 3SUTA 5JH2A 3UVAA 2V6AA 4JQ3A 3GXIA 3N2CA 3WLQA 4N9DA 4RLIA 3ZR4A 1VH7A 3W7GA 5XIAA 4TV5A 1VJZA 1I0DA 4LEFA 2HTMA 2F6KA 3GHSA 2FJKA 4X2RA 2INFA 3KAOA 1DXEA 3ANVA 4DBUA 1M53A 3WNLA 1JR1A 1RR2A 2C1GA 2ZDRA 2Y2WA 4HA1A 5F2MA 3WQ4A 3UWVA 3VAVA 4UUIA 4UNLA 1DEDA 1JCTA 1Q45A 4DYEA 2D2OA 3UJRA 2V5CA 2DDXA 2DZWA 4GNVA 4N7QA 4C6CA 2VCCA 2EJ1A 1LBFA 2NXHA 1XIMA 5DMNA 1QASA 2F6XA 1NFBA 2XFRA 3LBMA 2YDRA 4D6CA 4QNEA 1CECA 3VGGA 4JEQA 4V2XA 3CV2A 4GIAA 3R58A 1V7AA 4P7RA 2HPMA 4NXSA 3II1A 1FDYA 2Y8UA 1AMYA 1KTNA 5CXPA 5A8PA 4BFAA 3NGJA 1YDOA 1JPDX 3V7PA 2J9YA 4DO4A 3B9EA 1OZMA 1YMYA 4IP4A 2DGAA 3E2SA 3VX0A 4MAZA 4ZGYA 2WC4A 1R3YA 3RU6A 4M29A 3WH8A 4CQ9A 5FF3A 4ROPA 1ADDA 4FHAA 1RJPA 3NL5A 3NR0A 1QWGA 1ONWA 3GQYA 4NP7A 4M8UA 1RJQA 3VIFA 4QE1A 1XLKA 1D8CA 3VD4A 2BVYA 1GOQA 4PUUA 5A94A 3M0YA 3L0KA 5DRCA 3QEZA 3UWZA 1H62A 5LNWA 2PZNA 1WBHA 2WSRA 4JIIX 1PSCA 4D1IA 4YYFA 4XBJA 1GOOA 4OGZA 1DJGA 4JDBA 4C7DA 5JUVA 5LNVA 2F2HA 1G6CA 4RZ6A 1GG1A 1NFGA 2NW0A 1QOQA 3I65A 1XFCA 3QXBA 3PTMA 3ZS4A 1MW0A 3IV3A 3OVRA 2R1MA 1T8XA 2QCDB 1GORA 3AU6A 1SPQA 3NUKA 4AQLA 2ICSA 1NU5A 1XG4A 4FZIA 3H4XA 1CXKA 4FIRA 2OYKA 3G1AA 3MA8A 1XUUA 1VCVA 1US2A 2NZLA 3WMCA 4Y2WA 2W27A 1F6YA 1RV8A 1M41A 3WF3A 4CEUC 3SRDA 3WK2A 1V3JA 4B2DD 2QCDA 3MVIA 2Z28A 1QTWA 1Y5WA 2ZZ7A 4Z0JA 3OA5A 3H26A 1E56A 4Q32A 1VIZA 1EIBA 4JKKA 5DF0A 4L80A 3SI9A 3WD4A 5CJMA 4OWGA 1SJCA 1OT2A 1QRQA 3FGCA 4JXCA 1PE1A 4BKNA 3QMRA 1QI2A 3W2LA 1L2QA 2OMAA 3VIMA 4FA3A 5A2AA 1CXHA 1X96A 1GQJA 2BNJA 2E6DA 1UWUA 2XN0A 3E38A 2W6RA 4Y7EA 4E2BA 4CD7A 2GK1A 3AIVA 4U5IA 2G3NA 5I77A 4PCSA 3C0JA 1MW2A 5HNUA 3SEPA 4K37A 3PUOA 3H6OA 1WDWA 5FJJA 4LGXA 3VNZA 3KOWA 5E1QA 4H9MA 4A8NA 2WMIB 4WXYA 4C7FA 4FPSA 4QLKA 2ABAA 1UWRA 3HOJA 1RA5A 1PPIA 2Y85A 3GFZA 1TIWA 5D4YA 1U22A 3QV9A 4U33A 2ZUNA 4XZBA 2D2GA 4DY1A 1MZHA 2VHLA 3U8GA 1XD1A 3M0KA 2G3JA 3BXWA 1XXXA 1H1NA 2WJDA 3A4WA 4BS0A 4DUVA 1UR4A 4GISA 4EPEC 4RL3A 3GIYA 2DJXA 1V5XA 3SUVA 2Q8ZA 2ABBA 3BOXA 5A8MA 1JVNA 4HNVA 4YWSA 5K3VA 1XYBA 2QDEA 3S2LA 1CIUA 1IIHA 1EHNA 2QUNA 1V02E 4QXIA 4DM1A 2A3CA 4EP8C 2EPLX 3IK2A 2VP8A 2P50A 1AH3A 3BV7A 1F6KA 1PZ2A 4I9MA 1A5NC 4A05A 5H8UA 4MY8A 1QPKA 3O0FA 4Q8UA 3NQBA 1MUWA 2J4GA 4EWJA 5IM51 2F9RA 4NHVA 1LL6A 1OB0A 3QYQA 3UCQA 2VELA 1A3WA 3K8MA 3VIPA 1LORA 1FP8A 1G69A 4MB5A 3A12A 1OM0A 4WOQA 3IVUA 3LHTA 3AO0A 4QS6A 1SMAA 3WLSA 4GIYA 1J2WA 1EIXA 3IJ7A 3VTRA 4RPPA 4DHGA 2PDBA 1DV7A 3GU1A 3BGJA 1WO2A 5K7JA 3BOFA 3W6LA 5U4NA 3L4YA 3WK0A 2NSXA 2Z00A 3B8IA 4J28A 4LV4A 3KL0A 1R46A 3N2MA 2REQB 3W38A 4J3VA 3AXKA 2OKOA 4AZGA 3E12A 1G7VA 5M17A 3MJYA 3O6CA 4HGXA 4RW5A 3DUGA 4UR7A 5DY3A 3AUOA 5FJPA 4PMNA 1G4EA 1XBXA 4HMDA 3VOIA 2ZZ6A 2AL2B 4L9YA 3WFZA 2PWHA 4RUBA 3UJSA 2RGLA 4XKYB 4A22A 4PRTA 1W5MA 2FTWA 1O12A 3W53A 3N1AA 3SGGA 3L21A 3SURA 2REQA 2I14A 2PP3A 4IQJA 4HBKA 4YIWA 1CGXA 2D0HA 4Q4RA 1V7YA 2PGFA 1M04A 2Q6ZA 1RH9A 4JYFA 3UZ5A 1XCFA 3NQ2A 3WSUA 4JFUA 3RR1A 9CGTA 4RNJA 2AL2A 2TYSA 3W7MA 3W01A 3MDUA 4AW7A 4QGCA 4XKYA 5DFAA 1F9CA 3BOLA 3KRUA 1U1UA 2OX1A 3HGSA 1Z44A 5ABHA 1PIIA 3S46A 5C2CA 3FNDA 1ZUAX 5JIWA 4NUWA 3VA8A 2BHZA 4O17A 1UKSA 1UR2A 5CGQA 4DJEA 3DC0A 1SFLA 4PUMA 2PUZA 1WXJA 4C65A 3VK5A 4B91A 3G3DA 3SN4A 4B3LA 1RLCL 3T2PA 3EEZA 1CWYA 4PTVA 3TMLA 3D46A 4HTBA 4D2JA 3H7UA 3AQUA 1JF6A 2HEJA 2DP3A 4R7OA 4AMAA 3CUXA 4XK2A 3NZ1A 3D47A 4ERGA 3HG4A 1LDCA 3B97A 4YN5A 3AIRA 1DQUA 4PTWA 4XVDA 2OSWA 3NQAA 1YTDA 1VZWA 2WV8A 4O14A 3MHUA 3WEZA 3MYPA 2WWDA 4AWSA 1ITXA 1V93A 4DNHA 1WZAA 4UOQA 4Q8MA 2YGYA 4H8UA 4ADUA 3CO4A 3M64A 4UTMA 3VOGA 1EPVA 3QHMA 1G4SA 4DO5A 2D73A 4FMVA 4GZJA 1A3HA 3NG3A 4HPHA 4BI5A 1XLJA 5D9NA 1B57A 4DEFA 4U5KA 4UBPC 4QM1A 4AG0A 3RRAA 1S2WA 1J6PA 4R7WA 1E6QM 1QPRA 3DXIA 1UQYA 4OKDA 3BICA 1V0NA 3E02A 5ABEA 3KS6A 1UA7A 4JX6A 1Q2RA 1LTDA 4GG9A 3T0DA 1LL4A 4HK7A 3LCLA 3U57A 2QGYA 1A50A 3RPDA 3OBAA 4TMBA 3AOFA 3H55A 2XU2A 5T9CE 1VBJA 1FCVA 1SQ7A 4MFDA 2XIBA 4XX6A 3WD2A 4C60A 2VURA 1XRTA 2JALA 4LAMA 1V6TA 3NZGA 4CN1A 3MUZ1 1W3TA 5C6MA 1UHVA 1DXFA 2HE8A 3V5FA 2TODA 4KF1A 2OELA 4CU8A 5HK4A 1WUEA 3W7NA 2GQAA 4DF2A 5C0QA 4FS9A 1H2JA 1A5UA 4N9CA 1TPDA 1Z42A 1VBGA 2BXYA 1G01A 1ZP4A 2Y8VA 1MEWA 2DZVA 4RE3A 3LHUA 3UY7A 1V3HA 2ZC1A 5KZ6A 3W7RA 3I7QA 5C7HA 3UYCA 3MPGA 2D20A 4JD4A 5HJLA 3VKKA 2PTWA 3GW3A 1H1ZA 3W00A 1EEPA 2O55A 4P7OA 4BK9A 1PO9A 3C0QA 1ONXA 2YLLA 4DXXA 1TV5A 3GC4A 2OEKA 1F3TA 1OX4A 4U3CA 2X05A 5IHSA 2ZX6A 1PUDA 8XIAA 1TPC1 7CGTA 1XISA 3ABXA 4F0KA 1DIEA 3WMSA 2WZHA 4GINA 2BODX 4Q33A 4J40A 3WUGA 1TPFA 3AICA 2OQHA 2ZKMX 1A0EA 1U1JA 4Q6JA 2CFFA 3SECA 4QX4A 4U28A 4TUFA 4DBWA 2FZ8A 1L0PA 2R1LA 3OB8A 3W37A 5E9AA 1Q7MA 4J27A 3KBMA 3EXRA 4FNUA 1U83A 1OK4A 2IXVA 1PX8A 2YYTA 4KKXA 5MF5A 4Z2IA 5DMLA 1FH8A 1IR2A 4H9TA 1KB3A 1NP0A 1L2UA 4HIBA 3RPMA 4L1XA 1KM6A 1XLIA 4R5EA 4KT2A 1FWFC 1IHIA 2GGIA 3DHDA 3I7SA 1TX0A 1O5XA 4WRHA 3QGAC 2ON3A 2GSJA 1KBJA 2WC7A 3P67A 1RBLA 3O8AA 1AL7A 4CCZA 2NV9A 1R85A 1I6NA 2NQJA 3OGSA 3WUEA 2IKHA 1JULA 3MKKA 4PA8A 1ZNNA 2ODOA 2VJXA 1E9LA 1UMLA 1KBKA 3C86A 1RJRA 3RR4A 3NPVA 1TPWA 2J8FA 3N12A 3GVWA 3URQA 5G2WA 4F9DA 3WDRA 5HINA 1ZU8A 1EKOA 3U2CA 2OU4A 4MWAE 1MRQA 1IXQA 3GYEA 2XH0A 3GXDA 3MVTA 3DYPA 3TWAA 3WKZA 3PULA 4XAPA 3L23A 4MYAA 3G8EA 4Y9AA 3GNOA 1X6NA 4GWEA 3STGA 5DN1A 3LI0A 4GYFA 2MUCA 2ZOXA 2GSEA 3W72A 4HJFA 2PF0A 4UWMA 4RV8A 2BS9A 1BRLB 4O11A 4ILSA 1FVPA 5HR6A 2TMDA 5A6BD 3EOUA 2OEJA 3DERA 2ONEA 4JTTA 5BWFA 1S1RA 1K4GA 2YCIX 3E2VA 2O7QA 3ES8A 4KCTA 5LNSA 5AHEA 4OIFA 3GVVA 2QCCA 4GYPA 4W9TA 1LL7A 2P1FA 3QTGA 2VOMA 2WVTA 1O1ZA 4X2PA 1Q6DA 3CTTA 1EP3A 3TSDA 1BRLA 2NLYA 3WLNA 3PBUA 5IBXA 5G2IA 1AW1A 5G1MA 3SUWA 4H6RA 4AD2A 1MWOA 1XIBA 4H3DA 3N3TA 4IX2A 3QSRA 4EIVA 4KEZA 5LIXX 4E2VA 2FFIA 1YNQA 2EAWA 2E9LA 3OBKA 5A6AA 2XVKA 1U1HA 4PMJA 1E0WA 2XH7A 1NDWA 3ORWA 1C8VA 3TYZA 3TLLA 5EFFA 4XZHA 1LOQA 4AWUA 2GVYA 3HPAA 3PSVA 3KRZA 5FJTA 1QUMA 1JD7A 3W27A 4PC8A 5AYIA 2NT0A 1PEZA 1NP2A 2GL5A 2VWSA 5KITA 1KLZA 2VX7A 2X30A 1E9IA 5HQMA 1RA0A 2B81A 4UFJA 3C3NA 4XD6A 4K1WA 2YCJA 5CPTA 3RO6A 2UY3A 3SFKA 4WJEA 2VO5A 4QSFA 1ZAIA 3VUPA 3O6YX 4LT9A 1GGOA 1M7XA 2UY4A 3M44A 2HRWA 1IXPA 1DE6A 2VR4A 1YX1A 1PDZA 1DE5A 3LK6A 4MY1A 1Z7AA 2NQLA 4HSOA 1B31A 2UBPC 3WF0A 3I4EA 5DCDA 1XH0A 4W84A 4YTUA 3RYSA 3E5PA 2E1WA 1D9EA 1JZ3A 1CB2A 1VFHA 3M0MA 2O7SA 3I3DA 2Q01A 2PCEA 2W63A 4EACA 4O1FA 1CGTA 1XLDA 3WYZA 1TVLA 3ATYA 3ARUA 2FQIA 3W2UA 3NQGA 3IACA 1BPLB 2HS8A 4V1XA 4UZUA 4S3FA 3F2CA 1A5SA 4LFYA 3D3AA 1QATA 1GKQA 1WE5A 2J47A 4LCSA 4AUBA 2PDLA 1FWNA 4GIRA 2EPMX 4O50A 2ISDA 4TMCA 3LG3A 3NGFA 3GC2A 2PDWA 1Q8AA 3C4UA 3VD3A 3AROA 4GJJA 2R1KA 1W31A 2RH9A 3TQVA 1EYEA 1V3IA 1W1IE 3WIJA 3NEVA 4KIRA 5CC5A 4JX5A 1LWHA 5E0CA 4D6GA 3QPEA 1C7TA 4WX2A 4XZMX 3W7KA 2ACQA 1W5PA 2OYMA 1WDDA 3VILA 2E77A 5KZDA 1MQRA 5KSWA 3MSGA 1O94A 3OLGA 1VPYA 1YE6A 1QT1A 1UUQA 5LYRA 4UQEA 3P60A 1QW8A 3EOSA 4PR4A 3URBA 1BGGA 2UY2A 1WPCA 2QGHA 4M81A 1DIOA 4WGHA 5D9OA 4HTYA 4MIMA 1UKTA 1TPEA 2RDWA 5M5DA 3VIJA 1PV8A 4BI7A 2QVHA 5BXTA 5JBEA 3KP1A 2GDQA 4YPJA 1UR3M 3FLUA 1IQ8A 4LF1A 1CX9A 1HJVA 2CZDA 3UEQA 4P8UA 4IHCA 4GYKA 1M1BA 5CPLA 3OVPA 3HJEA 5D9MA 5AZ0A 1XICA 5A1AA 1MEIA 4ZSUA 3HMJG 4GCAA 1IIGA 4Z2JA 1QI4A 4L4MA 4IL2A 1V0LA 2Z1XA 4C6FA 4QG9A 2RDUA 4AHOA 3W28A 2Y5SA 2J13A 4GVFA 3EX3A 4F79A 3TYAA 1EEXA 4ERAA 1TRDA 3FN9A 2HXTA 2VGFA 1DPMA 2GVGA 1RXOB 1L6WA 3W3OA 1OIMA 2CU0A 3ECQA 2YB1A 2JE8A 4Q8QA 2Y62A 1B3VA 1LRQA 1E71M 2A6NA 3W75A 3BPWA 3VOJA 1UP0A 2P76A 1WNOA 4IXXA 2I7GA 3MZNA 5REQB 1JUBA 1TPB1 1XGEA 4DNMA 4I8DA 1KKRA 5DRIA 3LEPA 4BCEA 3NL2A 4X63A 1QPQA 1QBBA 2PTDA 3GXFA 2PGEA 1BVNP 2VGIA 3GDRA 4XB3A 1JF5A 1YTEA 2OX4A 3E96A 2O4MA 3KL3A 4O0KA 1XCXA 4XG1A 4G56A 3UQNA 3CTLA 3E0WA 2W67A 4XD3A 4UCGA 1C7SA 4IMCA 1UWSA 3ES7A 3NPWA 5REQA 1I2QA 1ZCCA 2WMJA 3FA5A 1NTHA 3EKZA 2F38A 5HWMA 3GU9A 1QK2A 1GCYA 2WBGA 1VHNA 4CCCA 1H7XA 8CGTA 4Q4MA 3LQLA 4IGMA 2GVJA 3VO0A 1FDZA 3WO8A 1H11A 3KTCA 5AOUA 4QDWA 1U5VA 4ERIA 1Q4NX 1KXHA 1R87A 1VEPA 3B9AA 1XRSA 1Q5MA 4ZQNA 4FXSA 1R7AA 3ID7A 2CITA 3O7UA 1UQZA 4WDUA 1JGIA 4GBUA 2F61A 4H41A 1QNPA 3A5FA 5A6JA 3S47A 1TJRA 5D38A 3TSMA 3N2XA 4A3HA 1Z3NA 1JDDA 4W8AA 1A3XA 1LZOA 4H9VA 1SYTA 1KM4A 4I9TA 1UJPA 3NO5A 3RX4A 7ODCA 1MQQA 1DJXA 1J4EA 4KW2A 3GXMA 3FDGA 3CHDA 3LCIA 3N73A 2NWSA 1NH6A 3VKCA 4H8NA 1RP9A 1TE6A 4WDWA 4OUIA 4D1JA 5DO8A 3F4DA 3GR4A 1W1PA 5BOEA 2ZX7A 1ZZMA 3GTNA 3N9RA 1Y8BA 2VFFA 4BR1A 1BSIA 4Y6GA 2OWXA 1X1NA 4WJ8A 4F3HA 2HMCA 1V51A 4US5A 4XZWA 1P7TA 5D02A 1QK0A 3VGHA 2ISSA 4M51A 5C54A 3CV6A 4JTSA 4INFA 1TPVA 5CPMA 1JPHA 3F1QA 2NUWA 1S2VA 3L2IA 3IGHX 4UNIA 3E2RA 4HJWA 2WJFA 1V0MA 1XKYA 4LBRA 4NJIA 3CL8A 3BMVA 1W9VA 5E6ZA 1XQKA 2QV4A 1E0VA 2C0HA 1R38A 3MO4A 3CEPA 3KTXA 2X41A 1XBVA 2WK2A 2R14A 4X9SA 3AHYA 3WQWA 4ZL1A 4Y9NA 3PFMA 4LTSA 4HPGA 1VPQA 2XIQA 1H09A 3GE7A 1IR1A 5CC3A 5DMMA 4HMEA 1KR0A 3PWAA 3CV1A 1QNRA 2BOFX 1UP3A 3EWXA 3OG3A 4KCWA 5JIPA 4HZ8A 3EOEA 2QULA 4GY7A 2VRQA 1ZP3A 3T44A 4HHMA 1SSDA 3C61A 3TC7A 4CN6A 2VEKA 2YKKA 3V18A 1KRAC 4CD6A 3DOPA 4H4IA 3S42A 3B0UX 1DXIA 1Q6EA 3OPSA 4LSBA 4FNQA 3A5VA 4Q8WA 1QU4A 1EHAA 4U31A 2XHYA 1SU5A 3O6DA 4FR6A 4G5DA 3CH9A 2ZRZA 2Q71A 3RFAA 4O8AA 3S3GA 3FVDA 3M9YA 1BXCA 2CLFA 3B06A 2GQ9A 3RIKA 4Z1BA 5EB8A 1B90A 5T9BG 5E6YA 2XUCA 3BLKA 4JICA 3D3FA 1RUSA 4HU0A 2WVVA 4MKNA 2GOKA 3RAOA 4Z1AA 1KQYA 3RILA 4HYWA 4BJHA 1UWIA 1YW1A 3RF9A 4GZIA 4F8XA 4QDMA 1ZJIA 4ZR8A 5EL1A 3Q4DA 2R91A 1GZGA 2R1NA 1C9DA 4UQBA 5AKQA 1SJAA 1D7KA 1UYQA 5CPSA 1VS1A 2EG8A 4PCPA 5B7ZA 3SADA 1F4HA 4IM4A 2A7PA 4IMEA 2WJEA 4E2DA 4M19A 1QOPA 2RGMA 4GC3A 4M82A 2W92A 4DWSA 1CXLA 3FHAA 3AMCA 4C6IA 2VZOA 3R10A 1YXYA 3LUTA 4AVOA 3CPGA 4MJMA 4DWDA 2WSKA 1L8PA 2AMGA 1R47A 1T0OA 4PCFA 2XINA 1WX0A 3IIOA 3KS5A 1YPIA 1GJPA 3ENLA 1EQCA 2E1DA 1BVWA 2PEVA 2BWGA 4L9ZA 4B9ZA 4JCLA 4CN4A 1H49A 2V68A 4WF7A 3U5UA 4NYYA 3LXCA 3MI3A 4AD5A 5BOOA 2BB0A 3TE9A 3O9NA 3R94A 2ZUUA 4IFKB 4IUOA 3AIBA 4QEHA 1K77A 3DGRA 2IKJA 2DT1A 3E5BA 4Z0SA 8RUCA 2CLHA 2FB2A 3N04A 3QPZA 1E73M 1X1ZA 2DT0A 3SCNA 1GOIA 5FOOA 1SO4A 1UH2A 3H2FA 4RNIA 4TR9A 3BH4A 2OGJA 1EJWC 4CNOA 2X0SA 4GO8A 1QW9A 1KCZA 4RDZA 5MKGB 3KVLA 3TJXA 4LS2A 1EFZA 2BVDA 3UXDA 3VXGA 4DPQA 5H6HA 4L6HA 3ZLFA 3RMEA 3V75A 4IFKA 1K9TA 2XYLA 2GUBA 3IRDA 5H2ZA 1SW0A 1T7LA 1VCFA 3BLOA 3HZ3A 4BQ5A 1CZ1A 3H2EA 5FL0A 5IOBA 4HOXA 1SW7A 1BVZA 2PGWA 4Q4PA 2ZX5A 5D8WA 3U7BA 1VBRA 2V8ZA 5MKGA 1H61A 4BQ4A 4WY0F 1NFPA 4Q4OA 3UNTA 4K8HA 3Q45A 3CB8A 3DHFA 2D0GA 2CLOA 4DZHA 1JZ8A 1RQBA 2Z2AA 2WWCA 3FAWA 4K8GA 4YTRA 1O60A 1TR1A 3O06A 3T78A 2V3GA 3T08A 5K4ZA 4GJ1A 1H63A 4BQ2A 1TWIA 3E0VA 9XIAA 1BKSA 1PKNA 4N4QA 1Q6LA 1A5BA 2HDJA 5RUBA 2WMKA 1PJ9A 2Y70A 1CW2A 3H23A 4AXKA 4FF7A 4OFCA 1RD5A 4PMQA 4TO8A 4AZHA 4CD4A 3MSYA 2WHKA 4IMGA 5AYXA 3VCRA 2YW3A 3CLWA 4F0SA 2G8ZA 3EMZA 2QDGA 4NZ1A 1CCWB 2XPKA 2D3NA 1XM3A 4IP7A 3HPSA 3T1GA 2X0HA 4E2OA 2D22A 4IJCA 3ARYA 3B9DA 1XC4A 2C0AA 2YCLB 2W0UA 4IG2B 4PMVA 1QHZA 2X0YA 2J8GA 5A2BA 4YYCA 2E5BA 8A3HA 2W3ZA 3DI0A 5F2GA 3W7CA 4RXFA 1JFXA 1F6PA 1GOKA 1HKMA 4B5TA 1O6IA 1E43A 1AZ1A 3FX4A 3N4AA 4HNCA 3THQA 2YCLA 2C1HA 1JXJA 4IG2A 4H9XA 5AB3A 3C2VA 1YRRA 4NKCA 5LZLA 1FY6A 3M41A 7XIMA 4DBEA 4KIEA 4C6NA 2A3LA 3P7YA 1S2CA 4B5XA 1I8JA 3B03A 7ENLA 4TVCA 1QPNA 4C6LA 3WNPA 1AK5A 3IUDA 3KWSA 3UR5A 3W76A 4HK5A 3F2BA 1GVFA 1P0NA 2PSNA 4YVVA 1J9YA 4B16A 3NXFA 4E3VA 5AC8A 3KE0A 2NXIA 3B8UA 1TMQA 2OZ3A 4YTSA 3DX5A 5T26A 4NZCA 2DW7A 1IGWA 3EWZA 3W7OA 4KRTA 2EHHA 5LSMA 4U3AA 1R9XA 2QJIA 1GW1A 2XIJA 1GZ1A 3UZYA 2XM2A 3NDOA 4DF0A 2FHCA 3OYZA 3QV7A 4YVPA 4I9AA 1B54A 3AU2A 5K9CA 1GOMA 4UMBA 2PZ0A 2YR1A 4YHGA 3C6CA 3KRBA 3FYYA 1XYAA 3ABQA 4Y9PA 2PTXA 4AD0A 1W9DM 4N0RA 3PZTA 3W1NA 3GTXA 3W9ZA 2GZXA 3FEQA 3POCA 4G9PA 4AC1X 1F3WA 1H7PA 3IVSA 2BHUA 1WCGA 4I5XA 4DZIA 3VDBA 3S1WA 4MTVA 1XRVA 5CGMA 4RZ4A 1ME8A 2A4AA 3PSWA 5G4WA 4LUTB 3RK8A 2X09A 4C90A 1QHPA 4F40A 1EJXC 1M03A 2Z1KA 4B5WA 2ALRA 2F6UA 3NA8A 2VEIA 1E6NA 4LYRA 2YL6A 3B0PA 3WH9A 4KH2A 2OKTA 5FSDC 1JDEA 4WSHA 3WG6A 4A8IA 3ZT6A 2OSYA 3NQFA 2YBUA 5JVLA 3NZPA 4DELA 5LIWX 1IV8A 4LUTA 4NZ4A 3F4VA 3PVFA 3GAKA 3R6IA 2OSXA 4KQNA 1B4EA 4DO6A 2GGJA 3QY7A 3O6AA 5G1YA 1SUXA 1EGMA 3UBPC 2VC9A 1AD1A 1J11A 4Z2KA 3RDKA 2IKGA 3CC1A 3VVGA 5BRPA 3MMWA 3ARWA 1FA2A 1DTUA 3OEXA 2Y7GA 2QS8A 1LM1A 3OW1A 4JN7A 1U2YA 1O5KA 2NQ9A 1NOWA 5CH9A 4Q7NA 3BLLA 4AHPA 3LM3A 2WAGA 5DCBA 1VJIA 4UTLA 1DJWA 3CQJA 1EQPA 4Z1CA 1G67A 2V5KA 5D05A 1WDQA 3BQ6A 4J9JA 1KM5A 4AFYA 5I78A 1C91A 3W4RA 1DJHA 1QHOA 3WLPA 5KETA 1MRAA 2VD8A 2AAMA 1H41A 5H8PA 1OC6A 3MV11 4GABA 4G7EB 2PWDA 3KTSA 1KFCA 5I02A 1KGWA 3PR2A 2VQUA 5FEPA 1EP1A 3EX6A 1A5CA 3CM4A 3BCFA 1WXZA 4G7FA 4JQ1A 3UXLA 2HE5A 2FDSA 1E40A 3QLLA 3O0KA 3WQOA 1J0IA 1EDTA 3PF3A 3CZGA 1EWDA 1HGWA 3N34A 1N2VA 2HVMA 4XTIA 2UZ9A 3PN8A 1OFQA 1ZGDA 2PURA 2GQ8A 4BA0A 4JN8A 4JNZA 3PBGA 5D04C 1XH2A 2WLYA 4G7EA 3F4CA 5C7VA 3TN6A 1UZHA 4JHZA 3OQ8A 4AZIA 2FVMA 3HGOA 1EXPA 4HHPA 3DKJA 3TYDA 3TW7A 2AMXA 3BDKA 5H91A 1B0IA 1Q6FA 1JUEA 1MDLA 3KLKA 2BHYA 1HQTA 2WW5A 3ALGA 4PMDA 4AZCB 3BMWA 3QQWA 1PCKA 3VKJA 3UJ2A 4IISA 2D24A 3UPBA 1MQPA 2D0FA 2VCBA 2R6OA 4RR4A 5C2XA 3DBNA 5D2WA 5KINA 3GNNA 2YL9A 1FHDA 1WKYA 3W2KA 2PB1A 5HBFA 2YLAA 2P5NA 3ATZA 4AZCA 3TSBA 2FZBA 3WQVA 4O13A 1NDYA 3NIYA 4RX0A 1TQXA 4DF1A 5F1UA 2X7WA 3KDNA 3IEBA 1PIGA 3MHFA 4LAUA 4KS0A 3C2YA 4C1LA 5AY7A 5K9DA 3LENA 3APGA 2OO0A 2DVUA 4N02A 4TVUA 1LOSA 5I3KA 3C2OA 4UOJA 4X9YA 1VAHA 3V5CA 3ME3A 3H21A 1W8SA 2DUAA 3GH7A 2ZQ0A 4QE4A 3B0VC 3LS9A 1QOXA 1V79A 1KFBA 1HL8A 4HU4A 2G96A 3T8LA 1BSLA 1GPFA 4MWAD 4PFMA 4ZXLA 4DUOA 2HK0A 1KBBA 5F4SA 4GZ7A 4S2CA 4E38A 1GQKA 5TIMA 2X1RA 3BSMA 2WNQA 3UR2A 2QV5A 4S3DA 3WLTA 4PMOA 3IVTA 3R0UA 3T81A 2C15A 3WQ6A 1PX4A 3AYRA 1BKHA 5LIKX 1JYNA 4D6FA 1ZRQA 4QISA 5FF2A 4YWIA 2OG9A 1XC6A 3RN6A 1VCGA 3PJTA 1F8MA 5GPRA 3S2MA 1Q6GA 3CUFA 5CG0A 1XF0A 3N6HA 3S6TA 1TWZA 3WLLA 4ORMA 1M5WA 2PDKA 4MB3A 3AZRA 3B9NA 1K8CA 4XQ6A 3ZJ8A 2UWFA 4V27A 3N29A 2Z6IA 4LALA 2HBVA 1Z89A 1OX5A 5DY2A 3OVQA 3MC5A 3T2QA 1RD6A 1JCXA 5A6KA 2AAAA 3BV4A 3BZJA 1H7RA 2OXNA 2NX9A 1HIZA 4LAOA 1BYBA 1R0MA 4GMEA 2EO7A 2QCLA 2D2JA 3CIVA 3ZFHA 1OINA 5CEWA 4R88A 1WKEA 3CHFA 4MYXA 5BRQA 3RRXA 2ATSA 4XBSA 1KRMA 2PDYA 2ZZ1A 1ZJBA 3W73A 1I2OA 5K2ZA 5GJNA 3BG9A 4CVWA 4RW3A 5LGZA 3CU2A 4A29A 1VEMA 3TYEA 1SO6A 1N7KA 2PTZA 2H3BA 4O4VA 4CUCA 1E1CB 1ZBKA 1JI1A 3QOMA 3V36A 2ZTJA 1N8WA 1UWAA 3SCUA 4GPNA 1UKQA 1GHRA 4R34A 1SR0A 1BWVA 4ML4A 2XVGA 3PM6A 3W02A 5F7UA 2ZUSA 4NRSA 3B04A 3GC5A 2ZRWA 4ALDA 5BW6A 2P0IA 3B8SA 3CWNA 1REQB 5LXEA 4GI4A 4W5ZA 1H7NA 1E1CA 1TZZA 3T6CA 3WJZA 3HQNA 4CQDA 1K9DA 3GNXA 3N2TA 5CPNA 4EVZA 5CC7A 2ISFA 1L6YA 3QPYA 3BCJA 3FJ4A 3P61A 3W87A 2XIOA 3M43A 4YMZA 1TMHA 4F66A 5LNUA 1REQA 4F2TA 3QHOA 3TC3A 5EMUA 3GFXA 2W61A 2DZTA 2CWXA 1NWRA 4FI4A 2ANUA 3CHEA 5A3HA 1TUXA 4PL2A 4D6HA 4X22A 2XWDA 2CZFA 3VFCA 2V5LA 3OVGA 4R33A 3FJ6A 1E6RA 1MFUA 2DIKA 1E3XA 1KCLA 3VE7A 3M6YA 4KRZA 4DJED 4TTGA 4ICMA 3MW7A 1UG6A 4W5UA 3E0FA 4JL2A 1XWYA 3H22A 2PWFA 2CWNA 1P4CA 3SDOA 1H5YA 4GUFA 4URIA 1VGAA 3CBWA 4PULA 2QT3A 2J6VA 1HZYA 2O4QA 4AEEA 3C5QA 1P48A 3OLEA 1XD0A 3AHXA 4GIEA 5F4XA 1DHPA 4QG6A 3UG5A 3QR0A 3VNDA 3DFOA 3M5VA 2D23A 4EANA 3GDMA 5EU9A 3W1UA 1OGSA 3MI6A 5I79A 3E0IA 2I17A 2CZ5A 3APTA 2ZVRA 2CXEA 4GQQA 1UD8A 4JTRA 3EDDA 4K2SA 2DIJA 2C13A 1UZ1A 3M16A 3UA4A 3BAKA 4NJGA 1DWFM 2PDCA 4GYJA 3T7VA 4IUGA 3GBEA 2DV0A 3OQEA 2PF8A 2ZADA 1XIFA 2YZ5A 5C5YA 2O9RA 3ZJ6A 3ZT7A 4FO4A 2ALDA 2VKZG 3AISA 3MUY1 2ZE3A 4ZE4A 5ECVA 3TFXA 2QCHA 5AYYA 4ASTA 2DUZA 4CNNA 3H2OA 3QGKC 5ENLA 3NCOA 4LUYA 3TA9A 2GVEA 1SO3A 1V3KA 3C8FA 1KTBA 2C16A 3CJPA 4Q7BA 3MP4A 2E0PA 1B30A 4DAFA 1TJ2A 2PODA 4Y9OA 3FXYA 4NI3A 1E9YB 4O15A 4IMDA 2WVSA 1TYGA 3OHMB 2WKLA 5BZAA 1EGZA 2X7VA 3BUVA 4ATWA 1R3SA 2HXUA 3HGRA 4MB4A 1W32A 3H24A 1TV4A 1T8QA 4AX7A 1BEUA 4FR1A 3T07A 1XIIA 4AD4A 3S5SA 3TQKA 4NG3A 4F0RA 3MMUA 4KWSA 4A21A 3KBSA 3G1FA 4AMCA 2A85A 3NQMA 3SUUA 1ODZA 4H7VA 1WP6A 3C0SA 2Y5JA 1SJBA 1KWKA 4FLRA 1FUYA 1F4AA 3L9CA 1KTCA 1JAEA 1CT5A 2IPWA 4WLCA 2WZMA 4OBTA 4NNCA 5I7GA 1NIUA 2ZICA 4X60A 4YS1A 4PUJA 2J7CA 3V35A 1Q7QA 4GQRA 5CPQA 1GJUA 2J7FA 2WXDM 3I10A 3WZ0E 2W4XA 3GLCA 4NIRA 3QQ0A 1ICPA 2V69A 2BVTA 4H9YA 3PZIA 4PCTA 3GBDA 2BY1A 2EG7A 2Z24A 1YHTA 2QDHA 4TXEA 1RCQA 2A2IA 3G18A 1CGWA 2OZTA 5E70A 2I5QA 2INEA 3F2DA 2VX5A 3A4AA 2J77A 3H8AA 3PBVA 3PZVA 4O10A 4E0CA 1LG1A 4OUEA 3R25A 1E6PA 4QLLA 3KOFA 2ZXBA 4KCVA 2W9MA 3VC5A 2CBUA 4DXVA 4JTLA 3VABA 2VFDA 3LGDA 4HCLA 1E9ZB 2EPNA 2FHFA 1M3UA 1KNWA 3HPXA 1XDJA 1MVYA 1SZRA 1TA3A 5FJOA 1BLIA 1XLFA 5A8NA 2ZUWA 1W1YA 3OYXA 4K39A 4JFWA 3PUEA 3E74A 1RY0A 1VFFA 2Z29A 2JK2A 3OG2A 5E93A 4DI9A 4I6VA 6REQA 1JQVA 1MZRA 4HHHA 2V9DA 3AZSA 1TO3A 3CS2A 1PBGA 1V6XA 2P53A 1DWHM 2E09A 1MFVA 3UETA 2TPSA 3NQ8A 1TTPA 3BARA 1XV8A 2VD9A 4IF2A 1TWWA 4PRWA 1NY1A 3W88A 3M5YA 2QJHA 3DAQA 4N6EA 4OZOA 3DHUA 2XSAA 4LBUA 1VIWA 1PHWA 1R9YA 2IQ0A 5EYWA 1RP8A 3NURA 1OCJA 3GS6A 3TDFA 2XGIA 4ZA0A 4QLJA 4IQDA 1R3QA 3MSDA 4JTIA 3MUXA 1S5WA 5JU6A 1HW6A 1T6MA 4AD3A 3Q58A 4DUXA 2ZWYA 4LVGA 1J2BA 2Q3OA 4LAZA 2FKPA 1UR1A 3KL5A 1W9BM 1D3HA 1EGVA 4DXKA 1AZ2A 2Q09A 1XLAA 3HPFA 3VOHA 3OP2A 4BF9A 4LS0A 1TPUA 4UMCA 1CYGA 4HNUA 4B5VA 3EDJA 2AQOA 3E0LA 1LLWA 4C6PA 1TRIA 2QHAA 2PPGA 1EC9A 4MG4A 4PYSA 3NO3A 1VFOA 2V2DA 1UZDA 1W3NA 2VYOA 3LV5A 1AJZA 1HXJA 2HVNA 3F5JA 5A8OA 1J93A 3HU7A 3FYOA 2QPXA 4GY1A 3PZGA 4HZMA 3K2GA 1E0TA 4UR9A 3LV6A 3MT1A 4ZSTA 2WCGA 4Z1YA 3GRIA 1W9XA 3GZ3A 1K02A 3VNLA 1PCWA 3R0KA 2QCNA 1WAWA 3M5ZA 1H1YA 3SSZA 4UTHA 4O4WA 4UTTC 2WNWA 4JGDA 1JGMA 1UH4A 1Q65A 3WQ8A 2NUYA 1HJWA 3AS2A 1OF8A 1VYSX 4D6EA 3P0XA 4FX6M 3DFTA 5LA2A 1A0CA 3CGTA 1DJIA 1ICQA 2RFGA 3L0NA 3ONBA 5D09A 2G95A 5EBUA 1MYRA 4DJDC 5CZ0A 3ZVIA 3H53A 1YTKA 2PCQA 3K13A 1L6GA 4KCUA 6TIMA 3MCNA 4AYGA 2ACRA 2PDQA 3OZOA 3N15A 2Z2UA 1ISWA 3W70A 4LCQA 5AHFA 1K7FA 3ELFA 4L6DA 1QCWA 3A23A 3LPFA 4JY8A 4HNNA 2XH4A 3BJTA 4AAJA 5CPOA 1E1FA 4M1RA 3A9BA 2XVLA 3B3DA 4ADSA 3FEMA 3PZ9A 4O0QA 1OYCA 2F2KA 4JZ5A 2PDJA 3NVDA 3BJSA 2I57A 3L67A 2QPSA 3EKLA 2E9MA 3EXSA 1A5OC 1UUMA 4H2CA 3QJAA 1XYFA 1GVYA 2B31A 4L1GA 3BGAA 2PC4A 4QQUA 3CQKA 4QP0A 3R8HA 2PBOA 1KM0A 3ONCA 3S4TA 3LD5A 5EMMA 3DYMA 1FWEC 1Q13A 5J5RA 4KETA 3PB0A 2W62A 2GPTA 4V33A 1D3GA 4NASA 3EXTA 4Y9MA 4AXNA 4S3BA 1ADSA 4DRSA 4ZB2A 3S9YA 3EB4A 3WJXA 1P0BA 4ZOCA 4WD0A 1PKMA 1P0EA 5DCEA 4J3UA 4EPKA 4GXPA 1E6ZA 4H2HA 4TX9A 4RNHA 2CC0A 4S38A 4PUEA 2YX0A 5H1WA 3LSBA 3MTWA 1JPMA 1LQAA 2PDIA 3HJZA 3CZKA 2WKGA 2IPFA 4XIMA 3V1PA 3NQEA 2DJLA 3AJXA 3V16A 3BGGA 1RBOB 1RCOB 1K03A 3SJ3A 3DFHA 4U2YA 3SJNA 2AKZA 8TIMA 1ZJAA 3VGDA 5I5RA 4FX7A 3CMJA 4A3YA 1XYZA 4WVXA 4KPLA 2GUUA 3UXAA 2VEMA 5M2FX 3LYEA 4HOZA 4I90A 4KFOA 5GQBA 2Y89A 3ZLHA 1J18A 3CNYA 2XISA 1Z69A 1JDCA 3VNYA 3H12A 3FA4A 1DJYA 1XIGA 1US0A 3U9IA 5FCZA 1EJ7L 1FWIC 3VKDA 4UQDA 4IICA 1KC7A 2IPJA 3NPUA 1LLZA 4B90A 4LB3A 4FXRA 2YCKX 3MANA 4UFIA 2WPGA 3EOOA 3BLPX 4KEMA 3P8IA 3QZ6A 2EPKX 3QM3A 4CD5A 1R2TA 2ZIDA 4IGNA 5AHLA 1QW7A 4AVNA 3GDTA 3RCMA 2C8NA 4D72A 3A21A 4V1YA 4J3XA 4A3UA 1VLWA 2QKFA 4GI9A 4CVUA 1OD0A 4AH7A 5I3DA 3O3RA 5JQ9A 3TMQA 3ITLA 2FMOA 1HGYA 4GXWA 1XUZA 4KWVA 1QVBA 4F9JA 1W6TA 3I7RA 3A3XA 3QH2A 2OTDA 2PD9A 2GOUA 3KX6A 4I7WA 2ACSA 1LWJA 2VQTA 3AMKA 1KM3A 4AC7C 4QIUA 3SRHA 1VRXA 5HMEA 3EWBX 4YHEA 3R1ZA 2JFEX 1LQ0A 2WBKA 3GAYA 2VFGA 1VFMA 4XUYA 5EMLA 2EKCA 4UTJA 5HJYA 3EMCA 3R0DA 2PRLA 4MB1A 2EKGA 2A6LA 3KOXA 4PN2A 1J0ZA 3U2EA 5CZKA 2UY5A 1MXGA 4UOZA 4LS1A 5CGTA 3QR3A 2W5FA 2V63A 5I24A 1HNYA 3W74A 2E6AA 3NNTA 4WY0B 5G1TA 1M6JA 3KBVA 5D2YA 2Y4SA 5I07A 2OYLA 1KRCC 1I4NA 3UA3A 5FF0A 3WQFA 2D1ZA 5FL1A 4S3EA 3CT7A 1OSEA 1GWJA 4WCJA 3A6OA 1THFD 4N2YA 1HL9A 1R86A 4WDTA 4GBDA 1JNEA 3ZSSA 1GVIA 4MHBA 2VDGA 2WMIA 3NXLA 4WY0A 1N82A 4C6OA 1XSKA 4C5ZA 4K38A 4C6BA 4BF5A 3AIEA 5ABTA 3QR1A 4E5TA 5TQLA 3FAXA 2BGSA 1I2RA 4IIFA 1BGAA 5I6SA 4JPGA 4P7NA 1FXPA 4HCHA 4PB3A 2YW4A 1KD0A 2BDQA 3WD0A 4BF7A 3HGJA 3N9KA 4ZQRA 3P93A 3TN5A 1TZ7A 1UB3A 4C6EA 4US5D 2V5JA 1QJWA 3R4IA 5FA5A 1XI3A 4OTKA 2FYMA 2JKAA 4QAWA 4R3UA 1XLBA 4NT0A 2CHNA 1EA0A 1K9EA 1QNOA 3LPGA 1KFEA 2A21A 4JHOA 1HKKA 4S2BA 4MFEA 3PZUA 2VOTA 5CG7A 3OIXA 4O19A 1HFBA 3VMPA 4MKSA 3GVRA 4XSLA 4JS3A 1HUVA 3UT0A 3REQB 1GW9A 3G22A 1MO0A 1W3KA 2CW6A 4J2MA 3TW6A 1US3A 3IPWA 3N17A 4W85A 3WDIA 2YBTA 1P6BA 3L66A 5K4XA 1XDLA 3SB0A 3WDJA 3GW0A 1W1VA 2QCFA 3NQCA 4HA4A 2CZVA 4I7UA 1M9HA 1IWBA 3PTDA 1OC5A 3LTYA 4RCXA 3T0CA 3WDHA 2V5BA 1MNSA 5I3GA 3QMSA 1YIXA 3A22A 3TYUA 3REQA 3M0JA 2WKJA 4AZ6A 4IZGA 1XIDA 4YLWA 2HSAA 1XIJA 4GO9A 4ZBCA 3N13A 3XINA 5C8BB 4JAWA 3SCWA 1ZL1A 4MWAC 3ZXWA 4XUGA 3T4CA 4LY8A 4N9EA 2J79A 1JNDA 1K70A 1EX1A 4B15A 3A24A 1R2RA 3MYOA 1VD6A 4RK8A 4XSMA 1RQEA 5FJRA 3LNPA 1NQKA 2H3DA 4KERA 1FH9A 3S0CA 1Z6KA 2FH6A 3EPOA 1C90A 5CLWA 3MU7A 1BWKA 1J0HA 3OODA 3T09A 4KFPA 4C6DA 1X39A 2J9ZA 2Z6JA 4JQAA 3GTHA 3NM3A 3TIMA 2BGQA 3CT2A 9RUBA 3RLHA 1AH4A 4F0LA 3G1DA 3OOQA 2XFYA 4KWUA 4MDOA 3TVAA 1GYMA 3CLMA 1LRNA 3NDZA 1S3HA 5TNVA 1S5MA 4EE9A 3EPNA 3PAOA 4DX3A 4LYPA 5EA9A 1RHCA 1AG1O 1ADOA 1OIFA 1FP9A 3WF1A 2PDMA 4BHYA 4XBKA 3L2LA 2NUXA 3AXXA 4WSJA 5B7YA 1VKFA 2XN1A 3LA4A 1W17A 1JXKA 2J7DA 3WBYA 3TTQA 3WH5A 4DWSD 1TJPA 2J75A 3LRKA 5B80A 4ZTYA 1VP5A 1PIFA 4O12A 1C8XA 2CLLA 3FYPA 1ODUA 1E4NA 3BVJA 3SY5A 3RX2A 3VGEA 3RX3A 5AVHA 4WSKA 3LMZA 5DBUA 1EA9C 3Q65A 6XIMA 2B7PA 4MJ4A 4HSNA 1JCNA 3BAWA 3VNKA 2HPIA 1ENUA 1PYFA 3LU2A 3N14A 1G4TA 2O9OA 2BXVA 2WNZA 1QBAA 1POJA 1R2SA 4H19A 2WCSA 3R2GA 3ABZA 3PG8A 4KFNA 4LY4A 4XAZA 3WLKX 3M5XA 4NY2A 3CXOA 1CLKA 2Q02A 3BANA 1IWAA 4JL1A 1VB9A 3FV9A 2NQHA 3QYSA 2AKMA 3FXGA 4HQVA 2ZBTA 4CQBA 4AIUA 5D30A 5HUPA 3TU9A 4HKPA 3EWDA 3AIWA 4JTKA 2BTMA 3ZT5A 1R8LA 2Y0FA 4GGHA 1H50A 2V3FA 1OJXA 3AS3A 2VWTA 1NM9A 5C70A 2DZUA 4L56A 4GUHA 1IXNA 1R6WA 4DZAA 1WDPA 2E7FA 1V6WA 3ZR5A 2GJRA 3DKLA 1Y7VA 4XZLX 4ZFMA 4S3CA 4F2BA 4GOAA 1X1OA 1WKDA 4XD5A 3E9AA 2W79A 4XV0A 2D3LA 4J3SA 4DJFC 5K9XA 3IGXA 4A8RA 1G7UA 1AQMA 1DWIM 3CMFA 4L7ZA 3GZAA 1GEHA 2Q3RA 2FZMA 4ZQCA 3HB9A 5E5CA 1ELSA 2NWRA 1T5AA 3OZYA 2QIIA 1IZCA 1IT0A 2FIQA 2NVAA 3BLEA 3W22A 4DJEC 1PWMA 3C3UA 5DELA 4E3TA 2OQYA 1JYVA 3MO7A 4GJIA 1BFNA 4LB4A 4MKVA 1EL3A 2DFAA 2GDUA 2ZRUA 3AXMA 4FX8A 3L7RA 3MP5A 4OV9A 3LB0A 3TJIA 3P81A 2QJGA 2FTPA 3W1TA 1VBHA 2VR2A 3MV01 4XO6A 2QVNA 4J7RA 4WKFA 1PZ3A 2JEQA 3VDAA 1B3OA 4MPQA 3V0TA 1UROA 2P10A 3G2GA 1DWAM 1TV8A 2WPBA 2XDFA 4C6QA 2DEPA 3LRLA 2A3EA 1G0CA 2EG6A 4HT3A 1CGVA 4H6QA 2IPGA 1XHGA 2FMNA 1K1DA 4B5UA 4C6MA 1DWGM 3WCZA 1YEYA 2FVLA 4BY3A 3KCJA 3WJWA 1M7JA 1OHLA 4S3AA 1R3VA 3VDCA 2DSUA 2Y1HA 3VPLA 1TCMA 1CPUA 1K6WA 2C6QA 4YTQA 2E9BA 1AW2A 5A6TC 4NX5A 1V8EA 5AFDA 1XINA 3CPRA 5EY5A 3S6OA 1FCUA 3LLDA 5C9RA 1PTDA 2ZDSA 1ZBVA 4ZE5A 4LUIA 2EXOA 3MDWA 3R79A 3U2ZA 2OVLA 3LM7A 2Z1VA 2VNCA 4JKMA 4EPDC 2QEZA 1KCKA 2DSZA 3UJEA 4HU3A 1Q6CA 1AQFA 2XG9A 1LT7A 3P5YA 1U30A 1L6FA 3TCEA 4YXGA 3E6EA 1XG3A 2CBIA 3GNDA 3N18A 3MJMA 1KFJA 3F4NA 3T0AA 3GG0A 1Z9AA 3TTOA 2KAUC 5KEZA 1EO5A 3NQ7A 4JBRA 2J7GA 1POKA 2RKXA 1AD4A 4MDPA 1Q85A 3SO7A 2PDHA 4PUNA 1UJQA 4IIGA 4ZO9A 1S39A 5LKYA 3DBPA 5TAOA 4CLMA 4HNTA 1UCWA 4RNFA 2NXGA 1RALA 3TONA 3RJYA 3PNUA 2E68A 4LF2A 3VIKA 4MNJA 3W83A 1GVOA 1EBGA 3WNOA 4QHRA 1E6XM 1ZSXA 3T40A 5F2LA 3QGVA 4JTQA 1WAUA 4A8LA 3USZA 2R82A 3A64A 5TF0A 2WVUA 1J79A 1DBTA 3AMGA 4C1KA 4LC6A 3HO8A 1KW1A 4CEXC 3IIXA 1KBLA 5LIUX 4MMWA 3S83A 1FWBC 3ZMRA 2PWUA 3JW7A 4UQ9A 4ACYA 3GH4A 4PTXA 2NQ5A 4ZCWA 1S5TA 3IUHA 3ARPA 4O18A 4BI6A 4ZOAA 1TG7A 4QRNA 4IPPA 1I1XA 2YA1A 2X1TA 3R5EA 2A3AA 4RPQA 3BWWA 1J0KA 1ISXA 2BY0A 3G24A 3BAJA 4CNPA 1I2PA 3SW6A 4UTTA 3STFA 2E5CA 1GOWA 3KCLA 4NILA 4TTUA 4J5NA 4FP1A 4IQEA 1EDQA 4QSHA 3LCXA 1CTNA 2INZA 3GO2A 3OBEA 1JCYA 4GUGA 3R11A 4DJDA 3AWNA 3W24A 3AMDA 1R3RA 4MOZA 1TJ0A 5D2TA 2CLMA 2C1IA 3S1GA 2B7NA 2XWEA 2BBFA 3R8GA 5FAGA 1HN1A 3HQPA 4C1NB 2XJ7A 3UCCA 3LQGA 2V38A 2ATMA 4OHQA 3DC8A 1I60A 2BFGA 2QUUA 5HNTA 6A3HA 2VZUA 1ONRA 4FXJA 3W7HA 5DXYA 1RY8A 3QV6A 1QI0A 5C9XA 1EZWA 1NDZA 4C1NA 1LRTA 1OFDA 4OBRA 4FLOA 3HV9A 3HM7A 4JOMA 3I3BA 1ITCA 1VLIA 3OGVA 2V30A 4P7QA 2I5IA 4US6A 1H60A 2YDSA 2Z1BA 1BQGA 5AHIA 1K3UA 1EJVC 3R7MA 2J7BA 4M3PA 2YXGA 2QJJA 4HCDA 2GUYA 3W26A 2IUZA 1GQLA 4OOZA 3PFRA 4IIBA 3HFYA 1Y65A 2CLKA 2LLEA 4EF9A 4J35A 5EKYA 4GFSA 2B4GA 2RAGA 3W07A 3MP3A 2CNCA 4L65A 3IARA 1UD5A 3SFWA 1FDJA 3T05A 1UH3A 5PTDA 4W93A 5I3JA 1CXIA 3CUIA 1BXNA 3TW9A 2CLIA 2PD5A 3TJLA 3PTQA 3SCPA 3U0HA 1OZQA 2DORA 3BLDA 3ZVHB 5IBXC 4AHQA 3MUCA 2R8WA 2FVKA 3GKFA 1KR1A 1EOMA 3G1SA 1V4YA 5HOSA 2CIPA 4HVXA 3TLQA 5AC5A 3WD3A 2BSLA 3NTYA 4L1WA 4Q4KA 2PDUA 1KBIA 1OQFA 2IS7A 4GVHA 1OCQA 3CUJA 1O68A 4IH3A 3GH5A 3ABOA 4H8HA 3S9IA 3V1HA 3HBLA 4GLEA 4GA8A 2CZEA 2G0WA 5G4HC 2R9RA 2JKPA 5FACA 5GNZA 4CD8A 4LX4A 1D8WA 1O7AA 2CBJA 1XGZA 4W4QA 1M7PA 4A2SA 1YNYA 5ABFB 1R30A 3GXPA 4BZYA 5E0FA 5C9UA 1X8CA 4H9UA 5T8GA 1DJZA 3NZQA 2JF7A 1EH9A 1O5RA 4OJYA 2OPJA 3EDFA 3OZMA 4K3ZA 2QCMA 4PTDA 1TELA 2YXOA 3QBUA 3SRFA 3QF0A 4E4UA 3DECA 2VZTA 4K6AA 4LVDA 4M80A 3NPXA 2ZX9A 3MSRA 2VI0A 4O1DA 3RCNA 3ARQA 1GQNA 2ZUTA 3URAA 3STPA 1FWTA 5D03A 4ZB5A 1RCXB 1YXDA 4PGLA 3NM1A 3WMBA 5BOFA 5ABFA 3LCGA 4NI8A 2NSOA 1XW8A 4D6DA 3WQGA 1CI1A 2VRJA 4IP5A 5FSEC 1FRBA 4M0XA 2A1YA 4NAFB 2PDFA 3MI2A 3ABSA 1JRCA 3D0CA 4NZFA 1P6WA 3LTSA 5I06A 2PDXA 1V03A 4M6VA 3TAOA 2CHOA 2WMFA 1YPXA 3P3BA 3AYSA 4MZYA 1HJUA 1OF6A