4PGLA

Crystal structure of engineered d-tagatose 3-epimerase pcdte-ils6
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
298
structure length
298
Chain Sequence
MNKVGMFYSYWSTEWMVDFPATAKRIAGLGFDLMEISLSEFHNLSDAKKRELKAVADDLGLTVMCCIGLKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAGLNFCAWPQHPPLDMVDKRPYVDRAIESVRRVIKVAEDYGIIYALEAVNRYEQWLCNDAKEAIAFADAVDSPACKVHLDTFHMNIEENSFRDAILACKGKMGHFHLGEQNRLPPGEGRLPWDEIFGALKEIGYDGTIVIEPFMRTGGSVSRAVCVWRDLSNGATDEEMDERARRSLQFVRDKLALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-tagatose 3-epimerase
publication title Directed Divergent Evolution of a Thermostable D-Tagatose Epimerase towards Improved Activity for Two Hexose Substrates.
pubmed doi rcsb
source organism Pseudomonas cichorii
molecule tags Isomerase
total genus 117
structure length 298
sequence length 298
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.31: D-tagatose 3-epimerase.
pdb deposition date 2014-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4pglA00
4X63A 3DBNA 1XYLA 4QDWA 2HK1A 1A0EA 1DIEA 3P14A 5EMMA 2Q02A 4A8LA 4W4QA 2J6VA 4A8IA 4YTQA 3ITOA 3BDKA 2QUMA 4ZB2A 4ZBCA 1XLCA 3IUHA 5XINA 1XYBA 1XIFA 3VNIA 1DIDA 4A8RA 2NQJA 5J8LA 2OU4A 4ZB5A 4US6A 6XIAA 1XLHA 2XINA 1I6NA 8XIAA 5TNVA 3BWWA 5AVHA 3U0HA 3CQKA 1XLFA 1A0DA 2HCVA 3WQOA 3N4AA 3IUDA 1XIJA 3CQHA 4YTTA 3QXBA 5AVNA 1XLAA 4HGXA 4QEHA 1XLGA 2X7WA 2G0WA 3L23A 3AYVA 4DUOA 4GLEA 3VYLA 5EMKA 1XLMA 1GW9A 1QUMA 1XLKA 2I57A 1XIDA 4YTUA 3KCLA 3GNXA 5EMJA 3AAMA 3BANA 3CQJA 4HNOA 4KW2A 4XIMA 3M0VA 3IUIA 3KBWA 3KCOA 3KCJA 4GJIA 3C0SA 4YTSA 3C0LA 3LMZA 4G56A 3TC3A 3M0XA 2X7VA 1XYMA 3NGFA 5C9ZA 3U3HA 3TVAA 1CLKA 4GQBA 3KTCA 1QT1A 3DX5A 5EMLA 3VNJA 1K77A 1O1HA 1I60A 1XP3A 2GLKA 4PGLA 4EACA 3XINA 4OVXA 4XSLA 4XSMA 4J4KA 4ZB0A 1XIMA 4K1GA 2G4JA 5B7YA 9XIAA 3CNYA 3KBNA 1BXBA 1OADA 1XLLA 2QULA 1XIBA 2ZDSA 3UA3A 3XISA 3C0QA 2GVEA 3KBSA 4GJJA 4XKMA 3VNMA 4K3ZA 1XIIA 3XIMA 3QC0A 2QUNA 1XINA 4PFHA 3VNLA 1DXIA 3KBJA 3KBVA 3CWHA 4QE4A 3M0LA 4XISA 5H6HA 1DE6A 3UA4A 4E3VA 3BZJA 1S5MA 3ITTA 1QTWA 1XLJA 3ITVA 4HHLA 5I7GA 2XISA 3BZGA 1A0CA 4QE1A 5XIMA 3CQIA 1XIGA 3KWSA 2QW5A 4Q7IA 2ZVRA 3UXIA 2XIMA 4HHMA 4XIAA 3ITLA 3M0YA 5B7ZA 4QE5A 1XICA 4X60A 5H1WA 4QEEA 4X61A 4EAYA 1XIEA 2GUBA 1BXCA 1YX1A 2HK0A 3JU2A 3UVAA 6XIMA 1TZ9A 3AYTA 3KBMA 2NQ9A 9XIMA 1DE5A 3AALA 2I56A 3VNKA 4A8NA 1XLIA 1XYAA 4LNCA 3UU0A 1MNZA 4YTRA 1D8WA 2GYIA 1XYCA 3M0HA 3FVMA 4QDPA 1XISA 3ITYA 8XIMA 3M0MA 1XLBA 3P6LA 1S5NA 3OBEA 1XIHA 3QYSA 3ITXA 5XIAA 7XIMA 5B80A 5FA5A 1XLDA 3QZAA 1MUWA 2NQHA 1XLEA 4DVOA
chains in the Genus database with same CATH superfamily
1L6SA 3URNA 3UXLA 1GVEA 1R9YA 2BY2A 1GOQA 3BV4A 2ALRA 4DJED 1LORA 2UWFA 1JAKA 1XIFA 2W9MA 3NNTA 3GAYA 4XZIA 4US6A 2V67A 2HBXA 3U8GA 3QY8A 2ZXQA 1LOSA 1E5JA 1A5LC 3RM8A 1XPYA 1XIJA 3B8VA 1AW2A 3NXLA 4DWSB 4ACZB 4U31A 1QW7A 1XG4A 2VGIA 3G8EA 4PR4A 3WLQA 3M0ZA 3P74A 5CH9A 3UGVA 3MCNA 5M5DA 1W3LA 4FA3A 4XO7A 3N2TA 4H41A 3W2LA 1FWWA 3FVDA 5T26A 1QT1A 3I65A 4QQ3A 4ASTA 4XD3A 2NXGA 2OKTA 3E2VA 2RGMA 1YTEA 2GQ3A 4WRHA 4ROPA 3G1RA 5MKGA 1C8VA 4WSJA 2XIJA 1Q4WA 3GW3A 4E6MA 1I2OA 4PMQA 2E25A 4HKPA 3AZTA 1R87A 2HS6A 3DYOA 4UFIA 2BGQA 2PP0A 4N9BA 5AC7A 1KBBA 3JRKA 4O11A 1BHGA 1VBRA 4LFYA 3DENA 1G67A 3DESA 3ALGA 2I9UA 3N17A 4E2BA 3N04A 3TLLA 1BWKA 3CV2A 2FH8A 4AB4A 2GOUA 1ONWA 5E93A 3ZFHA 4LRSA 2DVXA 1GQNA 1YNPA 3WUEA 1HT6A 1UBPC 3S1UA 3KM8A 2FTYA 4WK9A 3LN3A 2VRKA 4M82A 2XSAA 1YKWA 2C14A 5CC5A 1MXDA 4IPIA 5ABEA 1QNRA 3LK6A 4Z2IA 5D30A 2HEJA 3HB9A 2RFGA 3URBA 3RPMA 5J5DA 2VEPA 3ABXA 4UCGA 5K9XA 1Q85A 3T9PA 4PEKA 3K8MA 2V5JA 4A4AA 1MDRA 1O4UA 4W89A 1OYAA 1G69A 2VEFA 1GVYA 4CU8A 4GYFA 2WVUA 3SB0A 4AEFA 1QI4A 3TX9A 2F7FA 1OCNA 1T6MA 2CBJA 4IM4A 1CB7B 1MUMA 1C7TA 4L4MA 1E43A 3H2OA 2QUNA 1H5YA 1QHZA 4GUJA 3KOXA 1MXGA 3CXOA 2VX4A 4O1DA 3GG8A 1WV2A 6TAAA 3R5EA 3ITTA 1JPKA 3QMRA 8CGTA 1EJRC 4GJ1A 2XVPA 4HSHA 2ZRZA 3PY2A 4S3CA 3GIPA 3DOPA 1D3CA 4S3KA 1US3A 3U2EA 1FWDC 1U5JA 3R0DA 1SMAA 3AXIA 5HINA 3NOEA 2PODA 4CCDA 3NZGA 4CQBA 4QNWA 3N2XA 2FFCA 4O13A 2NLYA 1DXFA 3QR3A 2PF8A 1RJPA 4GBUA 1DWAM 1S5TA 4IXHA 4CCEA 4OIFA 5DBTA 2C3ZA 1XYBA 3VNZA 4E2DA 1V3HA 3M07A 2DZVA 3WCZA 3PN8A 2VT0A 1J0JA 3KL3A 4MB1A 3BXWA 3F5KA 1YXDA 1P0DA 2GVLA 4W86A 3TOPA 3NSXA 2PD5A 3OODA 1N8IA 2JGQA 5CBBA 1GEHA 4HCLA 1HL8A 2REQA 1UOZA 1JCMP 3OO2A 4HSNA 2BOEX 2O92A 5AY7A 3VMNA 4C6BA 1TWSA 4J1OA 1QW9A 4P8UA 4K38A 4F8XA 3WBYA 1TV3A 1S46A 4Y2WA 4XSLA 1RBAA 1EF2A 3EMZA 4DX3A 4XAGA 1LF1A 3GHTA 4D6IA 1QNVA 1GYNA 4JPGA 2FPVA 4FLSA 2OCZA 4RZ4A 4XTIA 2G3FA 3THQA 2Y8KA 2VURA 3SCOA 4EANA 4GQRA 3ZSSA 4WGXA 2J66A 4HHLA 2WLZA 1P6WA 1U1HA 4P61A 4MYXA 2Q3OA 2H9AA 3O8AA 3GR7A 2OWCA 1PSCA 3PZGA 3WLTA 1Q8AA 2X30A 2GGJA 2QCLA 1Q45A 4ZQRA 3U4FA 1TJ0A 3W02A 2WM0A 2YCLA 1TJPA 5I02A 1H7PA 3VNYA 3AIRA 4TMCA 1RQEA 2Z2UA 2W62A 3W37A 4QLJA 4ZENA 3C52A 4HNLA 1FH8A 1IHIA 3CH0A 1UA3A 2QJJA 2VKZG 3N3MA 2DU2A 2O55A 2XM1A 2PU0A 1NWTA 1ALDA 1AMYA 4DF1A 3O06A 4QHRA 2C6QA 3F2BA 1EZWA 1GVRA 2DT2A 5JH1A 4B5SA 1AH3A 4K8EA 4C6OA 2OEKA 3SECA 3EGJA 3V5FA 4DQWA 3KVLA 1W5OA 3WD1A 4X9YA 4AZGA 4M8UA 1MUCA 4BCEA 2EQDA 5DXXA 4H19A 4Q6XA 3LUTA 1OZMA 3CZ8A 5D9MA 1OF8A 5HQMA 5AKQA 1I45A 2FQIA 2YL8A 3LCFA 4PFHA 3WBEA 2IPFA 1EZ2A 5CZ0A 2XH0A 1RALA 1JI1A 1IGSA 2I5QA 4ZXLA 3SW6A 4K6AA 4AD3A 4G7FA 1NFGA 2R1NA 1YDOA 3SRDA 3TCEA 4GNJA 5CPOA 4JHMA 2GWNA 5AC8A 2PI6A 2DORA 4GE8A 1WKDA 4OV9A 5FF7A 4P8WA 4I3GA 5EMYA 3B4UA 3PZ9A 4JYEA 1SFJA 1X6LA 5C6MA 3UG3A 4HZ7A 1EOMA 4WY0B 2AL2B 1GQJA 3W2MA 4JOMA 4UTLA 3SY8A 1IGWA 2FHFA 4UR8A 1VCVA 2A5HA 3PTKA 3R2GA 4JAWA 4HOXA 4JL1A 3A64A 2YB1A 2R8WA 3PANA 4MWAE 3DG6A 4AZCB 1ME8A 1EJSC 1HL9A 2ZRYA 3S47A 4A3HA 4PFMA 3GYCA 3LG3A 4B5VA 3AQUA 3KTSA 4IP4A 3Q58A 3UP8A 3CEUA 3KVJA 3WQPA 4RE0A 4YVXA 1OF6A 4W85A 4GINA 3V7PA 1P1MA 1IIHA 3SGZA 1QI3A 4RDWA 3F5JA 5K9DA 4JEQA 1Q6OA 1H7RA 4LVDA 3DUGA 1FWCC 3L4ZA 3AI0A 3GVQA 1CXEA 3AS0A 4GZ7A 1R7AA 1SW3A 3WLPA 4HPGA 4QE4A 1K6AA 4GUFA 3SCNA 4KEZA 3S5OA 3PNUA 4IPPA 4QDMA 4MM1A 1IEIA 3T2OA 4FNUA 2PE4A 2QQ6A 3MZNA 3N11A 3LCHA 3CAWA 3MYOA 3UU0A 3LCXA 4C91A 2J7GA 3BOXA 3ITXA 4REQB 5HMEA 4ADUA 5HULA 3W84A 1G01A 5CLTA 1DJWA 3LEPA 1R7OA 3SN1A 2B7QA 4W4QA 3WMCA 4KEVA 2WJDA 3DFTA 1V5XA 3H6OA 4PTDA 3PAJA 2VGBA 3OZMA 2P5NA 5ABFB 2FDMA 3MI2A 2XIQA 4L61A 3ZR6A 2GVYA 1TYGA 4EXAA 1TR9A 5LIUX 3E2QA 2HXUA 5TBOA 1OBAA 3NZPA 4FO4A 4IISA 4G56A 2WW5A 2BFGA 3CIXA 4O16A 2HNEA 3DFHA 1EBHA 5C5YA 3AXHA 3LGDA 1TE1A 4JEJA 3GH5A 3GBDA 4I9MA 4IJBA 3GTIA 1GTEA 4BQ4A 4W93A 4U33A 3LCIA 5AHEA 4TR9A 2TPSA 2WCGA 1J5TA 1ZBCA 3UCDA 3UF9A 1WZKA 3QOKA 4ZVJA 3ZR5A 1ODZA 1EJUC 3KRUA 4Z2GA 2DGAA 1A0CA 3NUKA 4IT1A 2P50A 1RY0A 4FOKA 2W63A 4P7RA 4XZNX 3E49A 3WH6A 1TMLA 1V6VA 4LCQA 4WZHA 4KH2A 5FEPA 4BS0A 3UQNA 1XLIA 2WMGA 1UD6A 3MP3A 2X8RA 1CIUA 2Y5SA 3UY7A 5ABHA 2W3ZA 3QTPA 4MUPA 1HNYA 1UH4A 1SU5A 4QDWA 1RP8A 1O6IA 3DERA 4WLCA 4DBWA 3K4WA 1A5UA 3MKCA 1UPMB 2Y63A 3BJSA 1YIXA 3GZ3A 2P53A 4Q32A 5H91A 3QOMA 5HWJA 4ERIA 1H1ZA 1KBJA 2J78A 1VFTA 3H26A 1OHLA 3OGVA 4KWOA 3TUUA 1QAPA 2AAAA 2ZXDA 4ZO9A 2RAGA 3ZVHA 3JUGA 2Q8LA 1TVNA 4NAEB 3W07A 2J7BA 2QXWA 5CGQA 3TN3A 3FDKA 3EA2A 1YE6A 3GG1A 2XFRA 1Y5XA 3SO7A 2HNHA 3BUVA 1K3UA 5CJMA 4MF4A 3TV8A 1R3TA 1E1CB 4ZA0A 3FJ4A 5DF0A 4CN6A 1B1YA 4G7EA 3KWSA 4E2VA 5D32A 5BW6A 3CUFA 4NXSA 1I0BA 3BMWA 4BJHA 1LBLA 1JVNA 3S6TA 1FKXA 4IXXA 5LSMA 5EMUA 2Y89A 2YBUA 5GJMA 2FIQA 3RK8A 3WDHA 3RJYA 1VBJA 4XZLX 3QR1A 1UHVA 4N02A 4NT0A 5TNVA 1FFRA 4DB7A 3ZJKA 3MANA 1QJWA 3GM8A 1A3XA 5HBFA 3U9IA 4S3JA 2INZA 4B5XA 2OGJA 1BD0A 1CPUA 2WQPA 4EIVA 2QDEA 2VNCA 1PV8A 4KFNA 3OVGA 3EWWA 3LQLA 5LA0A 1W9UA 3EZ4A 3SCPA 1ZFJA 3QR0A 5DCDA 1VF8A 4GLEA 5AZ1A 2YCKX 4WSKA 3LZ3A 1S3TC 4UTFA 3KHJA 1LDCA 3N2OA 2BASA 1JZ4A 2CKSA 3QV6A 3QF0A 5KZ6A 4PMJA 1YNYA 3E0WA 4RZ5A 4J4KA 1IT8A 3PG8A 4IX0A 5I3KA 2F9RA 3SJNA 5FF3A 4HVXA 3R89A 5C0QA 1LP6A 4J9JA 1J79A 4L4PA 5HR6A 2VTFA 4MB5A 3BAXA 4IMEA 4IUOA 2RUSA 3OA3A 2NLIA 3KEHA 4WSHA 2PDLA 3F4NA 2IPGA 1GK8A 2HTMA 3P0WA 4F48A 4IMCA 2CLHA 4AW7A 1XGZA 4KRZA 2X16A 1LWHA 1PKYA 1EUNA 2OO0A 3PSWA 4NJKA 5B80A 3PZVA 4AXNA 4DVOA 5FESA 3LMYA 1XYLA 4JTQA 4LS2A 1ICQA 3MT1A 2AMXA 3QW3A 3NQDA 1JDFA 1GVSA 4C6EA 1J96A 3VE9A 4PZVA 2CETA 4M51A 2ZVIA 2ODOA 5KZDA 3VM5A 1EC8A 1YLVA 1H49A 2ALDA 3D47A 2F2HA 2BLEA 4LYKA 4J3XA 4B2DA 2QCMA 1HJSA 3H2FA 3A13A 4ES4A 4D2JA 3QKEA 3UPBA 3UPMA 5D4YA 3DFYA 4RW5A 4CVUA 3KBWA 4NAFA 4GJIA 2XU2A 3M0XA 5EL1A 3DYMA 1TX0A 1QO2A 3OVRA 5D2XA 5FIPA 1EP3A 1EWDA 3VCCA 4IQJA 4NXKA 3F03K 3I7SA 1TCDA 4QAIA 1PWMA 3BMXA 1E70M 3N73A 5LNWA 4MY9A 3GD6A 3PHAA 2Z00A 1SUXA 4HK6A 4IG2A 4NZFA 3M0LA 2V3GA 2W66A 2PURA 3LRMA 1DWFM 3UXIA 3PSVA 6ENLA 4LYQA 1H1NA 1EOKA 2VUYA 4UTHA 4BA0A 5AB3A 3E12A 4GZEA 4LUTB 4DXXA 4GYKA 5LIXX 4NKCA 4HPXA 1F7BA 1DJZA 1P7TA 1GW1A 2R1PA 3P5YA 4H8VA 1PKLA 1JPIA 4F66A 4FLQA 3W76A 1CENA 3MY9A 1XLDA 3TYBA 3R0KA 3V1HA 4AWSA 3DBPA 2ZA1A 3W7RA 3CB8A 4PTXA 4RDZA 3AU6A 2OZ3A 1ZJIA 3MCOA 1GVIA 4AISA 3IJIA 3LQGA 4FIRA 3TQPA 3MP4A 3MJYA 1XH0A 3UG4A 3M1ZA 3B8WA 5EMKA 4X3ZA 1B30A 5EYWA 4F0LA 1R3YA 2E09A 3I6EA 6A3HA 1WB0A 3C61A 4K7YA 3ANUA 5CZJA 3T81A 3VNJA 3PZUA 4DJFD 4AHPA 2JKEA 4J3VA 3W73A 4C1NA 2OB3A 2FKPA 3UA3A 2MANA 1WNOA 4MFEA 3SAZA 3G6LA 3PPFA 2VRQA 3KBJA 4DJDC 2ZQ0A 3WNNA 3VZZA 2DVTA 1P6BA 1VAHA 4M7SA 3EMQA 1XSJA 4O57A 4GXPA 1AQMA 3ZXWA 1TZ9A 3QLDA 3GB6A 3GUGA 3ZOAA 4BF7A 5CQ1A 3JW7A 1XM3A 4QJ1A 4MG4A 1JCXA 2BHUA 4PEEA 3KP1A 1KD0A 5XIAA 1VEPA 1MW1A 4PB4A 3AXKA 1BQCA 3R11A 5CG0A 3STCA 4I6KA 2H6RA 2VD9A 3QPZA 1S2UA 1H0GA 4WD0A 1TIWA 2WANA 3TYCA 2RDWA 4JIIX 4IWWA 4AG0A 3CWNA 2XHYA 3NQEA 4UZUA 4DWSC 3LRLA 3PNZA 4YWIA 5JIWA 1DORA 4H6RA 1KXVA 4PUDA 1HO1A 3U5UA 1D7FA 3H7RA 4JHOA 2ICSA 4CQAA 4IX2A 4MDOA 4ML4A 4GCAA 2DSUA 2O9RA 2IKJA 1I2NA 1I60A 4KF1A 3PTQA 3W86A 3HJEA 4PSRA 3WQ4A 4D6FA 1QWGA 3GXNA 1M3UA 2GOKA 3L9CA 4WEVX 2F6KA 4JS3A 5H6HA 2V2DA 2G41A 2YL5A 5D03A 2EO7A 3W2JA 2ZE3A 3AXMA 1VJZA 4Y9OA 4RV8A 1GVQA 3A21A 4DJDA 4P7NA 3WD4A 5D02A 1A5NC 4JIQA 1MNZA 4H6QA 3GNNA 1KRMA 3M9YA 3AO0A 5ABTA 5LZLA 5CSSA 3HTWA 3IV8A 5CGMA 3RFAA 3PUDA 2PC4A 4IMDA 1ME9A 5FD0A 2B7PA 2FLIA 3GRIA 4UQ9A 3W7JA 4PTMA 5CC3A 3DGBA 3OJGA 1VJSA 1H5VA 4A8IA 5I06A 3BV7A 3W6LA 3MKKA 3HV8A 1XBYA 1P0EA 5HAOA 1H51A 1QHPA 1VZWA 1PZ3A 5HPOA 4R9OA 4JTJA 3WJXA 3EOLA 2NVDA 4IGMA 4QEHA 5D38A 1Q6EA 1U33A 3ZIZA 2CHOA 1B3ZA 5KITA 4S3FA 3TJLA 1TCMA 5AFDA 3PBGA 1JCTA 5MF5A 5CSUA 3L5MA 3GZAA 1XR2A 1W56A 2X42A 3LCLA 4DWSA 5A2CA 3M41A 1PIGA 3FKKA 2AQWA 4LCSA 3IGUA 3F4DA 3BARA 3B0XA 1LG1A 2J6XA 3AIUA 4I7VA 4G9PA 3LERA 3VXGA 3TYDA 1UR4A 2DVUA 4LB4A 5G4EA 2OYKA 3CU2A 1Q7QA 4B9YA 3GK0A 1UCWA 2ADAA 1FH9A 2E68A 2VR4A 4ROQA 3BK0A 1D8WA 2MNRA 2WNWA 4HSOA 3ARYA 1GOMA 3D0CA 3SZ8A 1UZDA 1OEPA 3W9ZA 4E38A 4LV9A 4L1GA 3R10A 5I3HA 1PE1A 3SUVA 3ITGA 4IFKA 4RZBA 1XI3A 4N2YA 1H7WA 1WOBA 2ZZ2A 1A0EA 1W3KA 1H09A 1KRAC 3CT2A 2VWTA 1WYIA 3QLLA 8XIAA 3IJ7A 3B0UX 2J8TA 4IFOA 3LCGA 1XRTA 1TWIA 1UH3A 1QK0A 1XCWA 3AHXA 3BLIA 3AMLA 2IKGA 5DCBA 1NWSA 1X6UA 4UTWC 1SO4A 2YL6A 5IDIA 1NDZA 4EWJA 3S8HA 2PDBA 1DQXA 3OTRA 2GLKA 1XJBA 4UFJA 2J47A 1BXBA 2HSAA 3PZMA 2ABBA 5K7JA 4UNIA 4OFCA 2PRHA 1O68A 1AFSA 1GTHA 4AZIA 5J04A 1P48A 3AYSA 4OZOA 3N18A 2OOGA 5FOOA 4AX7A 2OODA 3V0TA 3O3RA 1L0PA 1HP4A 2EAWA 2Y88A 1H11A 4KGJA 2OKOA 1XG3A 1GZ1A 2E5BA 4EVZA 4L7ZA 3GLCA 3ANVA 3IIZA 5D9OA 2A7NA 3RDKA 1E1FA 3R1ZA 3RYSA 4Y96A 4LANA 3G2GA 1XC6A 4JX4A 3VKJA 1XLCA 4LAMA 2GJXB 3WQVA 4PRRA 3UZYA 1V6TA 1KCKA 3CUXA 1FOBA 4HIBA 3GS6A 5LHFA 5C9UA 2BVDA 4O0KA 3MO7A 3HBLA 5FJIA 1MEIA 1Z3NA 4GC4A 3AZRA 1J0YA 1UD4A 5A3HA 4L6HA 1WOAA 2VFIA 2WZHA 1WA3A 3NQCA 3RNDA 3T6CA 5I3FA 4U4MA 2G3IA 4ADTA 1S2AA 3AHVA 4MPQA 3POHA 4RCXA 1LT8A 3I6RA 3PJUA 1I0DA 3B9AA 2A3AA 4M29A 4UTWA 1GQIA 3PBWA 3BH4A 4AFYA 4AD5A 3SUWA 1W54A 3HFYA 1JJKA 1QK2A 1MO0A 4EX4A 3BZJA 4J3UA 3N12A 3ITVA 5BXTA 3O05A 1XDLA 3NQBA 5HK4A 4GIRA 2O4MA 3GDBA 3OPSA 1GORA 5E0CA 1Q8JA 2IS7A 1K4GA 5CPLA 1ADDA 2G96A 2WSQA 2WWCA 4ECLA 4A8NA 5HUPA 3EX4A 4KWVA 1YE4A 4I5UA 1W37A 2CNCA 4ENLA 4HA0A 3MQTA 1ZHAA 4FK9A 3FYYA 2G4FA 3LPFA 1CTNA 1PWLA 2X40A 2EG6A 2XDFA 2FZMA 1DJIA 3HPAA 2ZA2A 1JZ7A 2QGHA 1TE6A 2PDQA 2CLMA 1EL3A 3WQEA 1PL9A 1ME7A 4XUGA 1AVAA 2GK1A 1S2VA 3MUCA 4GVFA 4IH3A 1PDZA 4UOQA 4DUOA 3IACA 3NVTA 1KGWA 4LALA 2WVSA 3OLDA 3SCWA 2UBPC 2QPUA 1J6PA 2PGRA 3KOZA 3LSCA 2O56A 3QBUA 2Y62A 3BW4A 1E73M 4YJ5A 3W28A 2V82A 1UQZA 4US5A 2D22A 1H7OA 3UERA 3HPFA 3DHPA 5A8OA 3EOOA 3ZJ7A 5BNKA 3W38A 1JD9A 4NVTA 5FACA 1CNVA 1VPQA 3LLFA 1QATA 4GQ0A 1QBBA 4KCUA 3F1QA 1V6YA 4XIAA 5CCZA 4QAWA 2OFJA 1KKOA 2VGFA 4ACYA 2FMNA 1US2A 4CCCA 1V02A 4YTRA 4K7VA 1RPXA 3EOSA 4LX4A 2QV5A 4IGHA 2AQVA 1XL9A 3QZAA 5DBUA 2H3DA 1EXPA 3EWXA 3URAA 2NV2A 3DFNA 1U5HA 1O12A 1K8ZA 3II1A 1JZ8A 1EYWA 3W82A 3AIEA 2DZXA 3RILA 2CW6A 1VEOA 1EKOA 1UKSA 1JG9A 1VP5A 2WMKA 4MWAB 4JTLA 1UWSA 2YYTA 1IR1A 3GHUA 4MZYA 2D73A 3GTFA 5AHLA 4WY0A 1NSJA 4GXMA 2AL2A 1BTCA 4R53A 1NFPA 1HJXA 4N4QA 4DAFA 5A8PA 2PFHA 3UEQA 1BPLB 4PBGA 3V3WA 3VIHA 4CNTA 4C6IA 3S2CA 3HG3A 1ZNNA 1EYEA 2KZHA 3C0SA 1UZHA 1OYCA 3T09A 4AZCA 3C0LA 1K9EA 4AXKA 3HA1A 3S9IA 4DYJA 4RR4A 2VL4A 1W2VA 1K1DA 1ITUA 3VNMA 1AZ2A 2WLYA 3OVQA 1VGAA 2CLLA 1S5MA 1J0IA 2E0PA 3MKVA 4WKFA 2Q09A 1WKEA 5L9FA 1H61A 2DSWA 5HDRA 4JL2A 1B5TA 1ZCOA 4C6QA 1CW2A 2VEGA 2I7GA 4Z08A 4TVUA 3S2LA 3CGTA 4PE8A 1C29A 3V35A 3N9SA 4R7JA 3UCCA 1XIHA 3BLLA 1KR0A 3MUIA 1P5BA 4RZ6A 4XAYA 2ZUUA 1JNDA 4ILSA 1EXBA 1X8CA 1K8YA 1Z69A 3SIZA 3SR7A 4S2BA 3C2VA 1FWTA 4IJCA 3CBWA 1J4EA 1XKYA 5D9NA 4F0SA 4NNAA 1HX0A 2J25A 1M9HA 4FLOA 2ZTKA 2YA0A 4REQA 3P60A 1KFKA 3FAXA 2X0SA 1RD5A 3U48A 4KWWA 3VOGA 3SJ3A 4LH8A 4MPKA 1UIPA 1KM3A 2FVMA 5U7SA 3FXYA 1OVDA 3OZPA 3TVAA 1WUFA 1L6GA 2EPLX 3AZSA 2O9OA 4GPNA 3A24A 3T0AA 4KMQA 2OR2A 4PN2A 3ZWSA 3BMVA 3VOHA 5CEWA 4V1XA 1DOSA 3WMSA 5GJPA 2Z1SA 4DO5A 1CGXA 1J11A 3EB3A 3IRDA 3L21A 3NQ2A 5BU6A 1KRCC 4PUJA 4KWSA 1DJHA 4FR1A 1RHCA 5C9RA 4D6GA 3W2UA 3I3DA 4FF7A 4GI4A 3HOJA 3O7UA 2E67A 4D6DA 2DJXA 3WL1A 3D3AA 1UZ1A 1VPYA 5FA5A 2Z27A 4DBSA 3LTSA 3RCYA 1RCOB 3GUWA 1R3SA 4LVBA 4OOZA 3GC2A 5FI8A 1EEPA 5KSWA 3WH5A 4H00A 3BG9A 4PSPA 3VNDA 1DXEA 2WC3A 3P62A 2R91A 3IJLA 1MEHA 1AW1A 2QDDA 4X2PA 4LEFA 3INPA 3FEMA 2HXTA 3AAMA 4PH6A 1HJQA 1I1XA 2NT1A 4DBDA 4ZQCA 1AK5A 4TX9A 2JALA 2VCAA 1MQRA 2FB2A 3PBYA 1KC7A 4Q7BA 3THUA 3QRHA 4ML9A 3CMGA 1EJ7L 4F9JA 4GGBA 3ZO9A 4HU8A 4FP1A 2V68A 1UC4A 4O17A 5BRBA 3KDNA 3S1VA 4B3KA 5LNUA 1R8LA 4QSHA 4NAEA 5E6ZA 3R94A 1LQ2A 2DIKA 4BY3A 2V0TA 3NTYA 3R13A 1JCYA 3GTXA 5IOBA 1WUEA 3SQLA 1PDYA 1YTKA 3KRSA 1OK6A 3PZOA 4QEEA 4CEXC 2C1HA 2PU1A 1KBIA 4PRWA 3K2GA 4C6PA 5AN7A 5AOUA 1E1CA 4JY9A 3S2NA 4YIWA 3AISA 3VZXA 2VHLA 4IPJA 3AMGA 3GU9A 1LBMA 3ZWTA 3TQ0A 2PTDA 2Y6ZA 3B9EA 2ANUA 3NDZA 1SZFA 3IRSA 4JFSA 2VZOA 2RJGA 2V9DA 3I4EA 1OX5A 2VQTA 3A23A 1OABA 1U1JA 4PUMA 2D2HA 2NVCA 2F61A 5RUBA 1ZU8A 2WZMA 4PCSA 2WAGA 3EKGA 4YTTA 3WJWA 3QVQA 4RV3A 1ZENA 3MMDA 5I3IA 2RKXA 4LGXA 2BB0A 3P93A 3SADA 1J0KA 3P80A 1WE5A 3WUBA 3BANA 3LHWA 2Z6JA 1VFLA 3ABQA 3D6NA 1JXKA 5CJNA 3NOYA 1YDNA 2VC6A 3S1GA 3NR0A 4GQBA 3CPUA 3C8FA 3CNYA 3DKJA 2XFFA 1CXFA 4PA8A 2WQDA 4PUUA 2WKJA 1WQ5A 3FX4A 1GPFA 1EPXA 3TH6A 1W9VA 2L5HA 5M03A 4F3HA 1DL3A 3AS2A 4OT7A 1WO2A 1M04A 3T1GA 3QGAC 2OELA 1B57A 1T7LA 1EJVC 3MVIA 3RJXA 1XICA 4A6GA 3PF3A 3VX1A 1YX1A 3KS6A 3G3DA 2A3HA 2E40A 4LYRA 3TP4A 2Y7GA 3LBCA 8XIMA 4H9YA 2HV5A 1V6WA 4ZQNA 4PMNA 1F74A 1BF6A 4YYCA 3CL6A 3OG3A 3G1AA 4LAOA 4KERA 1E4NA 2VR2A 1XLHA 3W1RA 1ZRQA 3QKZA 4EXBA 3N14A 4FNTA 3I6TA 2DIEA 2YXGA 1FFQA 1WDDA 3C2EA 3USZA 2IQ0A 2ZZ3A 2QF8A 3UZWA 3MO4A 1PX8A 4HNVA 2F6XA 2V5KA 1K8XA 5C7HA 4GYPC 3KCOA 4HPHA 1TA3B 1LUCA 3OOQA 1XYMA 3W2NA 5EU9A 2WJZA 2Y1HA 3EA3A 4PMUA 3HJZA 4WHBA 2HRWA 3BGGA 4HN4A 3UXDA 4FALA 4DPPA 1LRQA 1BKHA 4H7CA 3UJRA 1TJ2A 1O94A 2YDQA 1CX9A 1UD3A 2VJXA 4J5NA 4F0HA 3HGSA 2R94A 3G8RA 3E1F1 2VM8A 4IL2A 3RRXA 3N9KA 4Y90A 3TJXA 3O07A 3B0VC 3G3MA 5CG7A 5AECA 2I56A 4KCVA 3KHDA 1IWBA 2HPMA 3ZS4A 4AZ6A 3THCA 1HKIA 4C5ZA 3U7BA 1XKJA 3UXKA 2J9XA 1A80A 3K1DA 1EUAA 3G1FA 3S6OA 4LUTA 3GFZA 4M3PA 3GSMA 2WKGA 1E0TA 1M7JA 1TPVA 4AYSA 1V51A 4XD6A 4BQ2A 1QFEA 5D05A 2XIOA 4GO9A 1JAEA 3TR2A 1FWBC 1EA0A 1AUSL 2HCVA 3PS7A 3QM3A 4Q4RA 3RLUA 2P8BA 3WBWA 4UZSA 3W4RA 2Z7KA 1ECQA 3T05A 4CD5A 1LOLA 4LBRA 2GDUA 4AWEA 4DZIA 4J2PA 1Q7ZA 3KCLA 4J3WA 4LVAA 1VKFA 3EWUA 1DYSA 1D2KA 4QLKA 4AZ7A 2A7PA 3S5ZA 1KRBC 1T41A 4WOQA 3T0BA 2ZRXA 2ZRWA 4OVXA 2G95A 3EKLA 4UB9A 3ZLGA 2YFNA 4PCFA 4AU0A 4RXFA 3MVTA 4FOJA 3WF3A 1OX4B 4LUSB 3UR2A 2WWDA 3O6CA 4E5TA 4GYPA 4UC5A 3IJ8A 2E8ZA 1QBAA 2OO6A 1XBVA 2E6YA 2PZNA 3WQ8A 3WH9A 1A5SA 4HMEA 2OQLA 4H8HA 4QE5A 3SFKA 4D1IA 4LWWA 1K9TA 2YB4A 4M5PA 2A6NA 3PK7A 4PB5A 2PWUA 2OLSA 1XCXA 3ES8A 4NSBA 3ONCA 1EP2A 5ABGA 3FA5A 4XAFA 1WBHA 5TIMA 6CGTA 5DXYA 4DJDD 2WSPA 3QYSA 3HG4A 4DEFA 2W92A 4LY8A 3JZEA 2DSZA 3CHFA 3B9OA 1J12A 4NU7A 1QHOA 2FZDA 1JEZA 3LCWA 1BVWA 2O0TA 3L2IA 1RQHA 1WKFA 1WZMA 3OBAA 1S5VA 2BSLA 3M64A 3RO6A 3IUDA 1CBGA 3V75A 1LBFA 4DELA 1H7NA 3IJDA 1ZZMA 4PMOA 4H9UA 4ZOCA 4BI7A 4QJ5B 4CNSA 4C7FA 4PTVA 2PDWA 4MKNA 3RN6A 5E9AA 2BY3A 3W7MA 4IIBA 1TWZA 2DZAA 3KAOA 1OFAA 4G5DA 5HJLA 1QU4A 3RR4A 4DWSD 3KBNA 3L4YA 1GJWA 4EF9A 4QNEA 4JKMA 3P5ZA 4K3ZA 5D8WA 2XSBA 1LRTA 3KRZA 2V3DA 4BZYA 2DSVA 3UG8A 3UNTA 1VRDA 1OCQA 4C65A 1QI0A 3VOCA 3VABA 1GJUA 1DBTA 3WY1A 3RCNA 4D71A 1OIFA 3LHYA 4NILA 4LAZA 4HYWA 3HURA 4DLMA 2YL9A 1WDQA 3EPOA 4Y7EA 5D2WA 5A6KA 1M65A 1W3TA 4GVIA 3SURA 2C15A 1GCYA 4AD0A 1X38A 1A5AA 3C56A 3IIOA 1F3XA 3PTDA 1WAWA 4QR6A 1AG1O 1KGXA 2VFEA 3PWGA 1Q6QA 3VKAA 2QCDB 1C9WA 3FA3A 5HMDA 1NP0A 2HVOA 1KLYA 3PZTA 2QT3A 1OCJA 1N55A 3PG9A 4B4FA 2ASHA 4HNCA 1DEDA 4KW2A 3WF2A 3V4BA 4NJIA 2Z1WA 4UTUA 4PBFA 1K77A 2YBTA 2YKKA 4FZIA 4AWUA 4XSMA 4S1FA 1HN1A 2R1LA 1E9YB 2WHJA 4NP7A 1BTMA 1H7XA 3ATYA 3WNPA 2ZUNA 4M6VA 1UMLA 1KM5A 5J5RA 4IPNB 1SW7A 1QDSA 2NT0A 1R47A 3HIJA 3CLMA 1HJUA 3VD5A 4M7TA 3TC7A 1EFZA 4S3GA 1UWIA 4J2MA 1XRSA 3CZKA 3WIJA 1BXCA 3BCDA 4GKLA 2BS9A 4J28A 3S3GA 2VELA 2TRSA 1TV8A 2GYIA 1A49A 1I75A 3BPWA 3UWWA 4ZTYA 1YBQB 5DMNA 4XBKA 2ZZ1A 1NOFA 3C5QA 3FAWA 2Q6ZA 3M46A 2D69A 1XYFA 3QZEA 2PLKA 1JZ3A 3W01A 1MRAA 1E72M 4XBSA 1WXZA 1A3WA 2NXHA 3G24A 2EPOA 2R82A 3FSTA 1WPCA 4GQGA 1XLAA 5E0FA 2PA6A 5FJTA 1R3RA 2AGKA 1RY8A 1XGDA 2V2HA 1UR0A 5CAKA 1XLKA 2V30A 5IRPA 1CXHA 4O1BA 4HNOA 5EMJA 1XH1A 1UPPA 1S1PA 3NGJA 1CT5A 2OLHA 5FF4A 1E6QM 2QDGA 3MHGA 3AHYA 1U1UA 2AMGA 4WKAA 3WNKA 3VX0A 3WLJA 1TVPA 3C2RA 4Q4SA 1TRIA 4H2CA 3W88A 3W27A 1RBOB 2WM1A 4LNYA 5HQLA 3MHUA 2QS8A 3A4JA 3NG3A 1OQFA 4HNUA 2WNZA 1NARA 2CBUA 4S23A 2QIIA 3FLUA 4E3VA 3M0JA 2I9EA 3OYXA 3A4WA 4OBTA 2OSXA 1ODUA 3ICJA 1LZOA 1ZBVA 2Z1VA 2PS2A 3GDTA 3WQCA 2GL5A 1RJQA 2O7SA 1TZ7A 3B40A 3OGRA 1FHVA 2DH3A 3OIHA 4TV5A 2ZZ5A 3T40A 3EPMA 4LUJA 5C7VA 1RCXB 3CHCA 1LCOA 4WUIA 5F4SA 5I3DA 1RXOB 5FEWA 3LBOA 3IARA 4EF8A 3VK5A 4HU3A 4HNTA 4ONVA 2E1DA 1FDJA 5CZTA 3E0IA 5JBFA 1C90A 2FYMA 1MZRA 3OHIA 2VO5A 1UMYA 3L4VA 4JICA 3LV5A 3WG6A 2NSOA 4BR1A 3FDGA 1EO5A 1BRLB 4WQ6A 3A9IA 2NVAA 5L6UA 3C3UA 2GJXA 2VC7A 1XX1A 3ZYZA 4GVGA 1T8XA 3LMZA 3SSZA 3QQ1A 4UNKA 3APGA 1LTDA 2LLEA 1T40A 3WUGA 5A2AA 4RW3A 4US5D 5LNRA 1O66A 1UUQA 4R85A 3ABSA 4O18A 3VDAA 3W75A 3WQDA 1DXIA 4QJ4B 1XV8A 3TJIA 7A3HA 4NX0A 3GFXA 2P0OA 8A3HA 4D1JA 4UQAA 3NEHA 1P6CA 2XIBA 3AHTA 3VDHA 2PTYA 1MSSA 2WVTA 4NG3A 4UR7A 2PDUA 2E6AA 3QHOA 1YNQA 1GG1A 3NQFA 2FB3A 2AKZA 4NI8A 3H2MA 2DUXA 3N19B 4JTEA 3QPEA 2ISSA 4BEQA 3H7UA 1QI5A 4PMYA 3EB4A 3AICA 1PKNA 3HM7A 2WJEA 1UOKA 3PZQA 2Z2BA 4D6JA 4DYEA 1E51A 2DUAA 3SRFA 2XWEA 1H4PA 1PS9A 4PTNA 1JZ5A 4H9TA 3SCUA 3GTHA 4JCLA 1MQPA 4WOZA 2CITA 4PCTA 3QHNA 3THDA 1TPC1 3HFTA 3P8JA 3R4IA 4TU1A 4WVXA 4XO6A 1DJXA 4MWAC 1E0UA 3T55A 2D24A 1OFOA 3SGUA 1LLZA 1XF0A 2IXUA 2A3LA 1IEVA 1EH9A 2J13A 2Z29A 3SM0A 2VGGA 3UT0A 1UR2A 2RH9A 5LHEA 5BRPA 4F0KA 4IGNA 4LPCA 4LC6A 1EIBA 1FXQA 1DWIM 4QLLA 1Q6CA 4HU0A 1PX3A 2HS8A 4A29A 3EOUA 1TVLA 3WN6A 3W1QA 3NL3A 3B8UA 1ZS2A 2VI0A 1KM1A 1KGUA 1BGGA 1FCBA 1GONA 3UY8A 3IVSA 4O28A 1Y5WA 3FFSA 5A6LA 4GOAA 3UCQA 4KQNA 1X39A 4C6MA 2ZDRA 4M6PA 3NM1A 3GIQA 2YA1A 4MTVA 2XN2A 3R58A 4LBSA 1GOKA 2Y8VA 4PRTA 4JY8A 2XIMA 2BHZA 3L0NA 1PB0A 3URQA 2WPBA 3T2QA 3FV9A 1JPMA 3ABZA 3N15A 2PC8A 3W1NA 5IBXC 4D72A 1EIXA 1IEQA 1AW5A 3M0HA 4UQDA 4HMNA 2NWRA 5KTLA 3KX6A 2W79A 1Q3NA 2RDUA 4Q8OA 4EPEC 1FP9A 1NY1A 4RLIA 3CV1A 5JQ9A 3OLEA 2GUYA 2CXGA 3W7OA 5I0DA 2DT1A 2WMHA 4BFAA 1W91A 3GXPA 5BU9A 2JK2A 1PPIA 1IIGA 1VC4A 4YPJA 4J35A 3TW6A 1KWGA 5AVNA 4HHHA 1QASA 4DAIA 4XZMX 1W2PA 1JXJA 3GIYA 4Z1YA 1HFBA 5E0KA 5A69A 4F2UA 3TSMA 4BK9A 3GU2A 2YCJA 3VD7A 4HT3A 3L2LA 4I90A 4F0MA 4MWAA 1J6OA 1LLOA 4LS0A 1SFSA 4YXGA 3PC0A 3YPIA 3ZJ6A 4Q8QA 3EB2A 2PTXA 3TWBA 4M19A 4M6UA 3W1XA 4O8AA 4QROA 5D33A 3RM4A 2W91A 2XWDA 3HGRA 5EBUA 2QULA 1R9XA 3VIJA 3NZ1A 2VD8A 2A4AA 5HJYA 2OX1A 5C71A 2QJIA 1RP9A 2WZTA 3CJPA 5BWFA 5AYZA 5F7UA 3W26A 1KFLA 5CZSA 4IP7A 3BZGA 1G7VA 1NDVA 3HG5A 4K36A 4XX6A 1FWIC 3MUZ1 1K7EA 4B15A 1VS1A 3JR2A 3TOYA 4MDPA 4DBUA 4JYFA 3CO8A 2R9RA 3AYRA 3CAVA 5HJXA 1XYCA 4IJRA 4HN8A 1E6PA 3VILA 4YHGA 1FDYA 4G6CA 4R5EA 1M7XA 1NJJA 2P3EA 3M7WA 3D3FA 2GQ9A 2KX9A 1VR6A 3C8NA 4C6KA 1O95A 1OK4A 3VD9A 3WBXA 4RE3A 2QEZA 4YTQA 2XGZA 5IBXA 4CVWA 3EOEA 3GDLA 4WGHA 5J8LA 1KV8A 2GZXA 3U2ZA 1OGSA 2Z26A 4A2SA 1RPKA 1KFBA 5BMXA 3NYZA 5I23A 4H8UA 4LYPA 3W0KA 2NX1A 1RLDA 1F2JA 4UNLA 5F4WA 5EFDA 4NF7A 4HMCA 3GY1A 2HE8A 1TPDA 2GVGA 1OFBA 2OEMA 3CO4A 3TYZA 2VX5A 2OQYA 4A21A 5DRCA 1XFBA 3F4CA 1VIZA 5KZMA 4UCFA 4NZJA 4KKXA 3STFA 1H62A 3N3TA 2FGBA 3CK5A 1GGOA 1K4HA 5AYXA 4JQ3A 5D37A 3W74A 5LIKX 5FJPA 2D0GA 1UKPA 4QTGA 4S2CA 4JFTA 5FAGA 4UTMA 3MC5A 4H9XA 2RHGA 5TQLA 4XISA 2VEIA 5D2TA 3N25A 3P84A 3TA6A 1JPHA 4Z1CA 3PVFA 4A35A 2GDQA 2DEPA 2Z1BA 1XRVA 2OSYA 3M5XA 3CQ0A 5FCZA 4AIEA 2FGLA 1NOUA 5B7ZA 1L8PA 4AZ5A 1IEXA 1BLIA 7TIMA 2OG9A 1KM2A 4GFIA 3KBMA 5F2IA 2ATSA 5K2ZA 4WIWA 2IMRA 1QNPA 5A6BA 3TNBA 4H9MA 3ARXA 3U57A 3RXZA 5K4XA 3U6WA 4I9JA 4KT2A 3F5LA 2E77A 1Z44A 4ZO6A 1RBLA 3CASA 1IE7C 3VIIA 3PTMA 1TMQA 3CZGA 1T5AA 1LG2A 1KTCA 3IK4A 4QX4A 4CKQA 4TTUA 1DJGA 1JUEA 4ZMGA 2QJMA 4DUXA 3ZZ1A 3BL3A 4B5TA 4JNZA 3W7PA 4RDYA 4HOZA 3ORWA 4MNMA 1B3OA 4AC1X 4FF5A 1AH4A 3RG6A 2REQB 4PUKA 4UXDA 2YYUA 4HZ8A 1EPVA 3LRKA 3MPGA 4CLMA 1FWRA 1W1VA 3GVVA 4MJ4A 2C0AA 1GEQA 2X7VA 4W7VA 4AC7C 1XD0A 4QISA 1PEZA 4Q8NA 4DN1A 1V3KA 3SFWA 1Q6FA 1BWVA 3L0KA 1JPDX 3S0CA 4A05A 2PDMA 4LOCA 1JUKA 1U5VA 1XGEA 4IZGA 3M0IA 3N13A 3WO8A 4UWMA 1XBXA 3LNMA 4L6OA 2JF6A 3VFCA 3F2CA 4AAJA 5DCEA 1F9CA 5IXEA 1AJZA 1I8JA 2QIWA 2PWHA 3T2PA 5LNVA 1VCGA 1Q66A 4EKJA 1HUVA 4QDPA 5HNRA 1J8VA 2PDJA 4BKNA 3K46A 3Q65A 3EDJA 3FOKA 4AX6A 3HMJG 4XVEA 5HPCA 1KW1A 5IFTA 2YCLB 2CESA 4M0XA 2H3BA 4AY1A 3O6AA 5FKYA 1VPXA 5T91A 3W7NA 4LC8A 1JYXA 3Q67A 3QH2A 3ZLHA 1S5WA 3P82A 2DW7A 1FTXA 3DECA 2GGHA 1I2PA 2WKLA 5IDZA 1HIZA 1RQBA 4RDVA 2OOFA 2B7OA 1ML1A 4GY0A 1KKRA 1O1HA 3CUZA 4ORIA 4GK8A 3NVDA 1X98A 2CLKA 1K70A 3P7YA 4HHPA 1JZ2A 1OWQA 5JMUA 3IIXA 1E71M 3AU2A 1GOXA 3W7EA 1UR3M 4UFMA 3UWVA 2PTZA 5HMFA 4CCZA 1MYRA 1DE6A 1J2WA 2PBOA 4ZFMA 3MZ2A 3NL2A 4GIAA 1O5KA 1NOWA 3UETA 1FDZA 4X9SA 4NI3A 3MP5A 1TO3A 4GISA 4X60A 1CLVA 4WJXA 5HA7A 3K13A 2PWEA 3E38A 2BX7A 1DTUA 1NQKA 3LHVA 2P88A 3PUGA 1V02E 3TK7A 1G4PA 4HK5A 1GQKA 1W1A1 3I3EA 3CB3A 2C71A 4E8DA 3KDOA 5FL0A 4H83A 2IUZA 1PZ1A 1CGUA 3B9DA 4UTTC 1Z42A 2QV4A 2WBKA 4WY0F 4LSBA 3LM3A 4O19A 3IJ9A 2HROA 3UWZA 2ZX8A 1D3HA 3IJQA 5BYWA 1VHNA 3VYLA 4XVDA 1Z9AA 3WLOA 4O53A 4ZR8A 3RO8A 3WDRA 1XCFA 4AHQA 2FJKA 2Z7GA 4B90A 5AYYA 1P0NA 3ITCA 3AIVA 4KBXA 1TZZA 4AHOA 4IP5A 4RK8A 5D09A 3R8RA 2ABAA 4NYYA 1C9DA 2R24A 3PULA 4W7UA 4NX5A 3C2OA 4O50A 2V6AA 3TLQA 1RA5A 1OD8A 3FKRA 3NL5A 4K8HA 2NUYA 2GVEA 2TMDA 1POJA 2FZBA 1CXKA 1JZ6A 4ZODA 3KOFA 4GUIA 1DIKA 3OGSA 1A4LA 3PPHA 5JUVA 2Y5EA 3GVGA 1ZY9A 2W4XA 4W8BA 4TUFA 2C0HA 3L66A 3LTYA 4MY1A 3EWZA 2Y7DA 4DZ5A 4DO4A 2P0IA 3T4WA 5EY5A 3DU0A 2INFA 2YLLA 3BO9A 4FS9A 3WMLA 1BSLA 6REQA 3CPRA 1WDSA 2ESCA 4B3ZA 3QMTA 3IWPA 1X97A 3SUTA 4F40A 1FXPA 4CGTA 4X2RA 5JVLA 4ZBCA 1KM4A 5D8ZA 2DP3A 4JTTA 5HNUA 1FH7A 5GVJA 5DT5A 4B5NA 1A0DA 3KE0A 4OGZA 4WXZA 4GYJA 1Q7MA 3PJTA 2E28A 4BWLC 3WD0A 2NWSA 1IF2A 3SSJA 2G37A 3S5NA 4UTTA 2UY4A 2Y4SA 4HCHA 2B31A 3WLKX 2HISA 2V69A 1RVGA 2YCEA 1Q6RA 1DVJA 4JCMA 3M6YA 4HZ6A 4XV0A 3TZFA 5EMLA 1FQ0A 1V4YA 2VDHA 3CHDA 2V3EA 1RH9A 4AF0B 3KRBA 3UJFA 1EWEA 3TN5A 4R7OA 4DY1A 4GJJA 2J75A 2C13A 3VKCA 3FYOA 3W1TA 3EEGA 5BWAA 4U10A 5HQEA 3RU8X 3VDCA 3ISIX 4FNSA 2ZKMX 1OX4A 4RNHA 4LUSA 4DZHA 1LL4A 1Z41A 2V38A 3MI6A 4ERGA 2ZZ7A 1NWRA 1B0IA 3FHAA 2A79A 1IWAA 2EG8A 1SM9A 4AY8A 5C55A 4NJJA 1ZP3A 5C2GA 1KBKA 2HBVA 3UWEA 1VD6A 2GGIA 1JFXA 4JTSA 4A8LA 5JBDA 5JU6A 1JGIA 4YCOA 3UR8A 1IV8A 3H22A 3CUHA 1XH2A 1PYMA 1KCXA 1TG7A 2QMKA 2VXNA 4H8NA 2NX9A 1W32A 1K9DA 3O9NA 5EA9A 3BGJA 3OBKA 1XQKA 5IM51 5HNTA 3G0XA 3DXIA 5EGRA 5T8GA 2V3FA 3UZZA 1WAUA 1F73A 2EG7A 1DTNA 5GPRA 4OV4A 1W5MA 5HR7A 3ZJ8A 2PCQA 4Q8PA 1UD2A 3GQYA 3VKKA 2Z1XA 1ZP4A 1TR1A 3DI0A 4J40A 2EPMX 1XP3A 4BWLA 2RDTA 3FS2A 4Z2HA 1PCWA 3VA8A 4MNKA 1BG9A 4IIFA 4MFDA 3E0FA 3KBSA 1F5ZA 4O1EA 1R38A 3OHMB 3AFBA 4H7VA 3BOFA 1ZJHA 1SSGA 4GA8A 3B05A 3SQSA 5DEZA 4G7EB 1CGVA 3E6EA 1R2RA 1UWAA 5HNNA 3FEQA 2WSRA 1DJQA 3EYPA 2OLAA 5E6YA 3LYEA 5FF2A 5BCAA 1XPGA 4TVCA 4PUEA 4OECA 1C3FA 1K03A 3W29A 1W1PA 3RGTA 4N6FA 2ISVA 4MB3A 3NQVA 3UWUA 1W5QA 2QAPA 1TIMA 3IGXA 4WDUA 3DFPA 3M16A 2FDSA 2J8GA 4JIRA 2XTKA 4L56A 5HATA 3P0XA 4O10A 3OQEA 2WNNA 1SJBA 4CD4A 4EPBC 4LRTA 2FH6A 4ICNA 3QC3A 4OJYA 3M44A 1VFOA 4FPSA 5LNSA 2DH2A 2ACUA 3WZ0E 3PFMA 4JR5A 1R0MA 1XHGA 2Z24A 3MDUA 5H8MA 1UJPA 5AYBA 1OY0A 1Q6DA 3A4XA 3BJTA 3WH7A 4MNLA 2QHAA 4U3CA 3N4EA 3FN9A 4GI6A 5ECVA 4XKYA 4EAMA 1ENUA 2TAAA 1AQFA 2YOCA 4BI6A 3E74A 2WYSA 3Q45A 3E96A 2VCBA 2VRJA 1IXPA 2PGFA 1J18A 3HMCA 4AUBA 2O9TA 2UZ9A 4S3AA 9CGTA 5A95A 3LY0A 1NH6A 1W3NA 3QSRA 2A2IA 3W6MA 1WX0A 1H2JA 4C6LA 4BEUA 1IT0A 1E6NA 4P5UA 4GVHA 1KCLA 4PCNA 2VZSA 4GMEA 2BOGX 4DHGA 5M2FX 2NQZA 1VYPX 4JQ4A 1NVMA 3FGCB 4H6KA 4K1WA 2ATMA 1YBQA 3APYA 2E5CA 8TIMA 2PD9A 1A3HA 4N7QA 3CPGA 5E70A 3H21A 4NJHA 1DV7A 4NZ5A 1NAL1 3A3HA 3KLKA 4HYRA 2HWGA 1K7XA 4N9DA 4D8ZA 1EJWC 1CGWA 2TYSA 3A5VA 3KTCA 4S38A 1FCQA 3G1XA 1FHLA 2DT3A 3AHZA 1RV8A 2ZADA 5D9PA 4ZB0A 2YDSA 3THAA 4HTYA 3TCSA 1W9BM 3B9NA 4UQBA 3R8HA 5F2GA 3U2CA 1NELA 2GDVA 4FNPA 3RLGA 2Y8UA 2HQAA 2ZFAA 4IG2B 4JFWA 4WKHA 3VVGA 1OZQA 4NASA 4TVDA 1A50A 1O60A 3WJZA 1A4MA 2O4QA 4D6HA 5H1WA 4JTCA 4HZMA 1FUYA 2VCCA 4ZO8A 3KL0A 3AYTA 4CD7A 1M5WA 4LNCA 3VTRA 1TQJA 5LKYA 5AZ0A 5AC5A 1OX6A 1QNOA 1SJCA 4NZ1A 3B0PA 1A5CA 2D2GA 3G77A 2DQXA 1MVYA 3W7DA 3OA5A 3MYPA 2HK1A 4CN4A 3W1UA 3BW3A 2P10A 1BKSA 3QGVA 1R6WA 2AKMA 3DIPA 1H1YA 3LTPA 1BVZA 2ZUWA 4JDBA 4O14A 4OBRA 2XVNA 3VIFA 5KETA 3IGHX 5DY3A 4GC3A 3CQJA 1QO5A 1DWGM 4GG9A 3E3HA 3DKLA 5CBIA 1UR1A 2DDXA 4FB7A 4Z17A 2QF7A 2J74A 1LT7A 3NQ6A 3XINA 3MBFA 3TTEA 4O15A 3STPA 2RDXA 3E2RA 2XZ7A 4C1NB 4FNRA 3UG5A 3UYCA 3KS5A 2VX7A 3COTA 4AMCA 2X1TA 4K68A 4QJ3B 1OT2A 4Z1DA 2VC5A 1W3JA 3UESA 4Q7IA 3GE7A 1CXIA 2ZRUA 1TJRA 1VYSX 1T96A 1UH2A 2A3EA 2HVMA 2J7EA 1V0NA 2X0HA 5CGTA 1W1ZA 3ABRA 3ENLA 1LQAA 4ORMA 3K8KA 1TWWA 5DQPA 3W1MA 1FWNA 2V5BA 1JQXA 3EXRA 4U3AA 1QW8A 2YPIA 2NQHA 1O1ZA 1XDMA 1QPRA 3V0SA 1E5NA 2CHNA 4S3DA 4HA1A 4AEOA 3NSMA 3AWNA 1QNSA 3APTA 3OQ8A 4LF2A 1AH0A 1GZGA 2WHKA 3LHUA 2ZOXA 3S5SA 4ZCWA 1H60A 2BMBA 5CPMA 3WQ6A 3UZXA 4IICA 4GKTA 1Q5MA 5AHFA 3W7CA 3TYUA 2JF7A 3WNLA 1VRXA 3S83A 1GKPA 4GZJA 2E9BA 3P8IA 3R0UA 1U30A 3T07A 4Q4MA 2O7QA 3QZ6A 3B03A 3LPGA 3DX5A 3ZMRA 4CQ9A 1BVNP 3RX4A 1YQ2A 2PP1A 1M7OA 2G4JA 3CL7A 2G50A 1VH7A 2ONEA 1MW2A 3A47A 3W87A 1TPH1 3CH9A 2XVGA 2C19A 5I7GA 3BURA 3EX2A 5XIMA 3R6IA 4QCEA 4K8GA 4MY8A 3M47A 4NUWA 2WNQA 1JDAA 2JEPA 5LGZA 3JU2A 2OZ0A 4H04A 3NDYA 3EA1A 5IHSA 3FVMA 3NFUA 4UMBA 1FWAC 2JIEA 3WBAA 3ARZA 1IR2A 4ZQPA 5GNXA 3WFZA 3WFAA 3DYPA 2YR1A 4EOUA 3T44A 1V8EA 3AJXA 3KLLA 2OT1A 1W8GA 1C7SA 4YLWA 1Q6GA 1Q6LA 4JQ1A 1ONRA 1HKMA 3IUHA 3NIYA 1SZEA 3TAKA 2OYMA 1V79A 2ZC1A 4PULA 1OCBA 1GHSA 3I10A 3U0HA 2QGYA 4AH7A 2VC9A 3A3WA 3JZUA 3EX3A 3GXDA 4TQTA 7REQA 3AS3A 4NRRA 1V7AA 1OINA 3I4KA 1CYGA 1R3WA 2C79A 2X7WA 3EDEA 3W7KA 4B16A 2PCEA 3GAKA 1HVQA 2UV8G 4JTDA 3WF1A 3RRAA 3EWCA 1V03A 3M5YA 5GQBA 1NU5A 2PLMA 1JUBA 4L65A 3UPWA 5CXPA 1JRCA 3NQ8A 2BHYA 1G94A 4R7WA 3N9RA 5G1TA 4C1LA 4LS1A 1C92A 3UR5A 4I7UA 3B8TA 3SGGA 1YHTA 3MUY1 1X6NA 1PZ0A 4LUYA 4QG8A 3RMEA 3SIMA 3EEZA 2JBMA 2D2OA 4UTIA 2UY2A 3ARUA 2ZC8A 1SZNA 3LHTA 5E09A 1WZAA 2YZ5A 4XK2A 2VENA 1HKVA 5ECUA 5FEXA 1JDDA 2Q3RA 1QCWA 1S5NA 3KWXA 5A6BD 3RAOA 2AGTA 2JFEX 3VI2A 1L8NA 1S2CA 4IFKB 2FFIA 5EMMA 3EWDA 5DT7A 3U7VA 1J9YA 1SO3A 2J7CA 3WX7A 4PODA 4MLRA 3OLGA 2BGSA 3CHVA 2QPXA 3DFOA 3BJFA 3H2EA 3O0FA 2YIHA 5C54A 1T8QA 1LL7A 4ACZA 3E02A 4U5KA 3T42A 4HA3A 4GIYA 3WUFA 1OYBA 1F07A 4KCWA 4MSSA 4MB4A 3TE9A 1BYBA 3L0GA 4GY7A 4GGHA 1Y8BA 1X7FA 3MUAA 2OQHA 1GOIA 3AWOA 1WXYA 2VOMA 1ONXA 5I79A 1T0OA 1E3XA 1A47A 4IIHA 4MZ1A 1V3MA 2QPSA 2WXDM 2BXVA 4F79A 3A12A 2QUVA 3KVMA 4XQ6A 3WQFA 1OGBA 1DJYA 2CWNA 1JCNA 4Q4PA 1UUOA 1M41A 3GH7A 5G4WA 2QAFA 2YDRA 3S9ZA 2HJPA 1XFCA 5K3VA 3STEA 4MADA 1N2VA 3R8GA 1Q63A 2E4TA 1C8YA 1L6WA 3IVUA 3W72A 2WMJA 1R85A 2AQOA 3ZT5A 4XAZA 4AIBA 1ZL1A 4GWEA 5PTDA 4ALDA 2G3JA 3TYAA 3STGA 1R9ZA 2CC0A 3H54A 5BROA 4PUWA 1E40A 1VBUA 3GBEA 1TPEA 2G3MA 5LXEA 4A3YA 3Q94A 5A8GA 3REQB 3BSHA 4DUVA 3UW6A 3NQAA 3MB9A 1CDGA 3IV3A 4Y9NA 4D6EA 5REQB 4Q6JA 4KESA 3N6HA 5EBAA 4QFUA 1FWSA 2I57A 5H8UA 1GHRA 2VDIA 4FMVA 3SN4A 5GJNA 1PX4A 4S3BA 4PMDA 3PAOA 4JN6A 3BQ5A 4QITA 3CL8A 1FHDA 3TU9A 4HPJA 4L4LA 2VOTA 4J3ZA 1R46A 4GXWA 1RAKA 4DYKA 3NEVA 1KBLA 2IXVA 3MUXA 4CQCA 2FZNA 4OHQA 3T7VA 3G1SA 3KP0A 1PXGA 5EFFA 5E9XA 3CUGA 3NURA 2WC4A 1SQ7A 3VD4A 3G22A 2A85A 3WLIA 1L6FA 4CNNA 3PJXA 3UA4A 1F4HA 1U83A 4CNUA 4Q8MA 3KUMA 3WLNA 5A94A 2NQ5A 3BVJA 5JXQA 3HO8A 2VZUA 3WL0A 5EKYA 4AVNA 4E4PA 1VEMA 3E0LA 3TQVA 2D20A 3BSMA 1RK5A 4IUGA 1M01A 3B04A 4Q4QA 3WLHA 2PDGA 1Z89A 1XQLA 1YXYA 3P14A 3TSDA 1JFHA 4D9PA 2J6VA 1QPKA 1D9EA 2OU4A 1KXQA 1P43A 5C9WA 3JVAA 4WJEA 1SZRA 2GK1B 2OZ8A 3FHQA 3NO3A 3LNPA 3OU8A 1QUMA 4HOWA 3POCA 1QOXA 2IPJA 2OJPA 4N9CA 2J7HA 4PL2A 4IIDA 2GJLA 4JDYA 1V3IA 3G1VA 4XB3A 5AC6A 2FHCA 2O9PA 4LJ3A 1N8WA 5M1TA 4TTGA 2PLJA 3IK2A 1GVOA 5A6TC 4BF9A 1KM6A 8RUCA 4CN1A 4ADSA 1G4EA 3HGJA 4MZ8A 4IMAA 4JTHA 3HPZA 2ZZ6A 4GNKB 1PZ2A 3W1AA 1DWJM 1GUVA 5DY2A 3O2LA 3ZT7A 1OFRA 4QS5A 1KTNA 1KO0A 3TTYA 3WD3A 3AIQA 4Q8WA 1MWOA 1GWJA 3M0KA 4CU7A 4PCPA 3ITLA 3T0TA 1VFHA 3CTLA 2XIIA 2OYLA 1QI2A 2NUWA 4JHZA 3ID7A 3WDJA 3EKZA 3CIVA 3M5VA 4G1NA 1UBSA 1W9DM 1NFBA 4GH1A 2OSWA 1TTQA 4XTDA 2E8YA 3TNOA 1JDEA 3PJWA 1F3WA 3O16A 4JTRA 3BLDA 2D3LA 5C2CA 3VCRA 1DPMA 4IFRA 3ITOA 4M6QA 4O1AA 1EGMA 1V77A 3ZM8A 4XZBA 2UY5A 3SCSA 1A5OC 4M81A 1UQYA 3MCMA 1BEUA 1ZALA 4PC8A 3N2MA 2GSJA 3A3XA 1PYFA 4C6JA 5KMYA 4O54A 5FSDC 2QCGA 3IEBA 3GNXA 1NDYA 2WHLA 5BMWA 4I7WA 1QXLA 4KS0A 1IQ8A 3IUIA 4DUWA 1HF6A 1J2BA 1UP0A 3DC8A 2WB5A 3W7LA 3TA9A 1TUXA 3MW7A 1UWQA 5BOFA 5HOSA 3F2DA 1R2TA 1E0XA 1FWJC 2C18A 1KQZA 3CS2A 4B3LA 2FPYA 3C0QA 4V33A 4TV6A 1HZYA 4Z0SA 1PIIA 3W24A 3W81A 3BAJA 2JQXA 3GNRA 3WD2A 3CV7A 4CNOA 5FJOA 1KR1A 4QE1A 3CQIA 4F2BA 1ZB5A 5KINA 3WK1A 2OGYA 4TOQA 2PDPA 1CECA 4JD4A 1AJ2A 5DELA 4CNPA 1FWEC 4JTKA 2QCHA 5I24A 4LV4A 1E9IA 2IPWA 3H8AA 3P67A 2QUUA 1MXSA 1NQ6A 3MTWA 3TWAA 3TYEA 1EQCA 1A53A 4Y8FA 1JR1A 3NL6A 1NWUA 5EPDA 5CPQA 1RZMA 2IKIA 1PUDA 4UOJA 2CWXA 4JYDA 3RM9A 1F4AA 3WQOA 5C9XA 4RPQA 1UB3A 3C6CA 2EHHA 4M24A 1H50A 1JIBA 4ZOAA 2W67A 4GHRA 3L2MA 2J27A 4ZOBA 1MDLA 3D46A 2I14A 6TIMA 3BC9A 3LBMA 1UW9A 2EF9A 3V16A 2DZBA 4CD8A 1OFEA 5BOEA 1HP5A 3R12A 2A0NA 4O1FA 3TXZA 5C8BB 4LXFA 4HTBA 1JD7A 3VPLA 1CLKA 3U4AA 1SYTA 4PBEA 3SRKA 2WVVB 1FX6A 2H8XA 2VFHA 4M1RA 1JYVA 3W7GA 2XH7A 2GQAA 3M4HA 3NCOA 1P1XA 1ISZA 3PZIA 2BP1A 3T08A 4FSAA 2AL1A 4GX9A 2V5LA 5I2UA 3M0YA 2BBFA 4AF0A 2YXXA 3PFRA 2QMJA 4MLJA 1FP8A 4W88A 1E0VA 3E5PA 1UR8A 2OWXA 1XUZA 5DN1A 4DF2A 4XUYA 1KFWA 1JI2A 4ICCX 3QN3A 5I3GA 3TTQA 5G1YA 1AL8A 5CPNA 1VBHA 4QP0A 4DXVA 1IYXA 3OG2A 3QSTA 1KQYA 4ZSTA 4HB7A 1K8CA 1UD8A 1NM9A 4Z0JA 1JCJA 1E6RA 5ABFA 1AJ0A 3B97A 4BHYA 1XLGA 3S46A 3CIWA 4FI4A 4JXCA 2J79A 4ZGYA 3G6MA 3HZ3A 1QMLA 1YRRA 1XRFA 2GJNA 1UJQA 3UJSA 1ZJAA 3M43A 1ADOA 3GHSA 3F4WA 4QG6A 4U5IA 3CZLA 4RL3A 2WCAA 2DZWA 1XIMA 4B5UA 3BTNA 2FHBA 4JFVA 3KZSA 3KL5A 3S5YA 4P7OA 3S2JA 3WDQA 1IZJA 3B8IA 7CGTA 1CWYA 3EWYA 1B90A 3RF9A 3BOLA 4Q33A 3OYZA 2B4GA 3PBMA 3P81A 3DN5A 1TX2A 2WC7A 4EWND 4UMAA 1Y5VA 4QGCA 4H9VA 2GFTA 3O6DA 3TTSA 1WP6A 3WFLA 2Z2AA 4LTSA 2C8NA 1F3TA 3IPWA 1YEYA 1EHAA 4AVFA 3WEOA 5I09A 2ZX7A 3V5CA 4RKAA 3CYVA 1F6KA 1HW6A 2C7FA 3CZJA 3VUPA 4O4WA 3TEVA 4KPLA 2QVNA 1TJ1A 1B54A 4A8RA 1X1OA 3GXIA 3TDFA 5BOOA 3ARWA 2Y7EA 5AVHA 1LOQA 3CQKA 1C91A 5HXMA 9RUBA 5F2MA 4UOZA 4FX7A 4NQ1A 1WCGA 3QXBA 3W2KA 1IZKA 4J3TA 2Q8ZA 1UKOA 3EXTA 2X2GA 1LL6A 4LT9A 1ITXA 1V7YA 5HWMA 1B3XA 1TV5A 3QV9A 3NGFA 3MWAA 3R7MA 2XGBA 1HJWA 4J27A 2VR5A 1OSEA 4ZL1A 3K5XA 3RCMA 3GU1A 3P2VA 2YGYA 3VE7A 3VNLA 3EDFA 1KTBA 1LWIA 1TFVA 4IHCA 3WQ5A 5FSEC 2X2YA 3S4TA 3BICA 3MV01 2E5DA 1RA0A 3BCJA 4RJEA 4HHMA 1Q2SA 2XJ7A 2H90A 2TODA 1UWUA 3ZQ9A 4UR9A 1AZ1A 1EB3A 3G1YA 4I5XA 1NP2A 3IGSA 1J5SA 1BG4A 1UUMA 2F8QA 1ZAIA 3DEQA 1TELA 1UYQA 1QRQA 3FY1A 2HVNA 4GACA 3NPXA 4XZ9A 4JKKA 4KCTA 1FA2A 3N29A 1F6YA 1CGYA 3VGDA 4B2DD 4AZBA 5XINA 1TV7A 5DFAA 2V81A 3VM7A 3A6OA 2GQ8A 4U2ZA 4ZO7A 1N7KA 2E6FA 1GG0A 4LB3A 2CEQA 3WEZA 4IIGA 1LM1A 4AIOA 1U2YA 3NQ7A 2ZWZA 2OXNA 2WMFA 2J77A 1FHUA 2ZBTA 4P8VA 4Y9AA 3FGCA 5LIWX 4G2DA 4Y8EA 3WYZA 1WZLA 1MRQA 1S2TA 1LUCB 3C4UA 2ISFA 2QJHA 2ZE0A 4P7LA 3DG3A 2B81A 3V0UA 1F76A 1POKA 3VU2A 9XIAA 4XZHA 1P0KA 2GJRA 4O1CA 3GDKA 2VX6A 4TIMA 4DM1A 3VMPA 1UASA 3VOJA 2A6LA 1QTWA 3RUBL 3KFTA 3SY1A 1F8IA 1G5AA 3W7HA 3RMJA 4DM2A 3NDOA 3GKFA 3H4XA 2POZA 3RX3A 5AYIA 4ZE4A 2R14A 1BAGA 1JNEA 3MSGA 3LLDA 1HO4A 2W27A 3PB0A 1R2SA 1VFFA 2ZWYA 4JTUA 2YA2A 2VEKA 2EXOA 2ZYFA 5D2YA 5A8NA 3C2FA 4PMVA 1L2QA 5I6SA 3UFYA 2QUMA 3RPDA 4DF0A 1G7UA 1HQTA 1UWRA 1EDGA 2I5GA 4HA4A 4ZB5A 4RNJA 4L9ZA 1I2QA 2WMIB 3WENA 1CGTA 1F3EA 4DPQA 3SCTA 2VYOA 1XWYA 4DXKA 2VZTA 4YMZA 4TX6A 1AD4A 1UIOA 2NX3A 1CB2A 4BI5A 3VOFA 1FWFC 1H3GA 1LYXA 3TKFA 2RGLA 5AHNA 3UGRA 2NV1A 4WDWA 3G18A 4H7ZA 1GYLA 2CU0A 2OEJA 5BXRA 1H41A 2V8ZA 1EEXA 2E9MA 1NDWA 5TF0A 1D7KA 2OX4A 3GG0A 3H2NA 1OFPA 1HGYA 4HK7A 4OUEA 3SUSA 3OEXA 2D2JA 4DNMA 2F2KA 3RU6A 1HVXA 4KIRA 1WXJA 1YADA 1Q4NX 1X7IA 4H01A 4MYAA 4X0VA 5C70A 4W8AA 4V27A 2BG5A 1A5MC 1PVNA 3UWQA 2ZIDA 4R33A 4K2SA 5LA1A 3O15A 3FCPA 3O6YX 3W85A 3USBA 3IAQA 1TPB1 2XINA 3NQMA 2BNJA 1QPOA 2H8ZA 4JKLA 4OUIA 3N6QA 5I78A 4ZSUA 1ICSA 1KFCA 5CC6A 2A7RA 1ZBWA 1PBGA 1PTDA 3LENA 2E1WA 2Y61A 1UZ4A 3L4TA 5I07A 3FA4A 2EKGA 1U22A 1JULA 2EPHA 1QNQA 5LA2A 5CPSA 4MJ2A 1CCWB 2D0HA 2XGIA 3LGGA 3NAVA 1XSIA 4AMAA 4INFA 4OQVA 3WELA 1NF7A 2OTDA 1GYMA 1V08A 3AJ7A 3SDOA 1PIFA 1ZSXA 2FVLA 3FXGA 1XIBA 2E9LA 1UG6A 4HD5A 3GVWA 4JN7A 3H53A 3FNDA 4LBUA 1R30A 4OOUA 1CI1A 3V18A 3GO2A 5JBEA 1LROA 3GG7A 2NUXA 3DG7A 2CLPA 4O12A 3HGOA 2P1FA 3AALA 4LEQA 1E9ZB 3QW4B 4KRUA 4P7QA 3TONA 3KOYA 2UY3A 3OBEA 1M7PA 1HGWA 1ZPTA 3H70A 4C6CA 1YYAA 2Y2WA 4AIUA 3AIWA 5FEZA 3T8LA 1YDYA 2J9YA 3AMDA 2CLIA 3EWBX 5DX7A 2NSXA 1SFLA 3NZQA 3N4FA 4POCA 1PAMA 2MUCA 3S1XA 4OBSA 4H9ZA 4E8GA 1K9FA 1E15A 3TC6A 3IAPA 3L7RA 1QPQA 1F8MA 5AHMA 3WJSA 1ONEA 4I8YA 2PEVA 4HP5A 3P61A 3LI0A 3RX2A 3I7RA 3WLMA 4FR6A 5C9ZA 1TTIA 5I3JA 4UFKA 1TTPA 1ZJBA 1C93A 1Z48A 3HQ1A 3MA8A 4JZ5A 1YPFA 3BLPX 1EC9A 3ZSTA 2OVLA 2E6DA 1B9ZA 4G8TA 1UKTA 2EJAA 3AC0A 3SY5A 1OD0A 2PGEA 3ARVA 5KZEA 3TN6A 3NXFA 4C6DA 5CC7A 2CHRA 4FAMA 4C6NA 4RX0A 3ARPA 1BSIA 1HJVA 2NXIA 4W7WA 2DQWA 2A3CA 1SMDA 3MMTA 1SGJA 4WX2A 3UVAA 4DBEA 1S38A 2VQUA 2PB1A 3CHEA 3NZRA 1JQVA 2ZTJA 1EGVA 3CMJA 5G2IA 2CIPA 3TXVA 4DLFA 3C86A 3BAIA 4DI9A 1PTAA 1HTIA 4QXIA 4PGLA 1OJXA 1DKWA 4KEUA 5CSRA 1DHKA 3LHZA 4W8LA 4UTKA 3WDPP 5BRQA 1ELSA 3VNIA 3VIGA 4Z2LA 2Z28A 4F9DA 1NF0A 4YVVA 3BGAA 3OW1A 3A9BA 5E1QA 5DMMA 2R6OA 3GNDA 5FJUA 3W71A 2CZEA 3QFEA 2BVTA 4NNCA 4CQ8A 2ZX6A 2YX0A 4MVAA 3FJNA 3MHFA 1R3QA 3BAWA 3LXBA 3GWQA 5A5WA 4Q3MA 3K4AA 1CEOA 3S6DA 3CUJA 3RLVA 3S2MA 4C60A 1BQGA 1KB3A 4UUIA 2CLEA 4KEMA 4R88A 1Q2RA 3QQ0A 2C16A 2VFDA 1TPWA 4FX6M 1GT8A 4MIMA 3RLHA 3IIVA 5G4HC 1TSIA 1E9LA 3W70A 2YCIX 1CLXA 3TR9A 1C8XA 1TB3A 4URIA 2QCEA 3HPSA 4WCJA 3BE7A 2FZ8A 4AD2A 4FXJA 1TV2A 3CWOX 4W5ZA 3WQGA 3ITYA 3NO1A 1J01A 1K7FA 2AOSA 1Q13A 3BSGA 3AROA 4MAZA 1UKQA 2NZLA 4GRSA 4H1ZA 5F2LA 1L6YA 3Q37A 1DQUA 2PRLA 5I5RA 2XG9A 1Z6KA 1YMYA 1ISVA 3A4AA 3VINA 4CEUC 1PTGA 1DIOA 1DQWA 2FJUB 2SFPA 5LXXA 4EE9A 4C6FA 3EMCA 4X22A 4RPPA 5ENLA 1F05A 1B3YA 5CSYA 1JYWA 3MS8A 2VDGA 1HKKA 1B4KA 4R27A 4ZXOA 3WLSA 2PDXA 3QEZA 3OP2A 4AEEA 4C5YA 1L2UA 2HMCA 1EC7A 3REQA 2XVLA 1B4EA 3VDBA 3K4DA 3U3HA 4A2RA 2JEQA 3ERPA 5REQA 4O4VA 4OKDA 1T99A 4JQAA 4GH3A 4K1GA 2J9ZA 5TAOA 5IHRA 2XUCA 5K4ZA 4V1YA 2IKHA 1DWHM 4J7RA 1E6XM 1THFD 2CLOA 3VGBA 2GVJA 2Z4GA 5CZKA 2V5CA 4PUNA 3HG2A 2RJHA 4M56A 1SR0A 4DNHA 4LQ1A 4PB3A 4X61A 4WR3A 3QPYA 5F4XA 2Q71A 2QVHA 3QY7A 2QDHA 1E0WA 2FVKA 1Z32X 2WBGA 4W87A 1SR9A 3MMUA 2YBVA 4JFUA 4GIEA 4KETA 1EA9C 4HBKA 1NIUA 4RNIA 4C7GA 1TPFA 2X1UA 3HU7A 3DI1A 4O8RA 3GXFA 7ODCA 4H6EA 3EPNA 1GQLA 4JN8A 4YN5A 4QSFA 4E2OA 1DIDA 2NQJA 4I8DA 3W7IA 3OB8A 1S2WA 2ZCGA 4GQQA 1XUUA 3WF4A 1YTDA 2BDQA 2CFFA 1ICPA 4O0QA 2TSYA 3L23A 1GW9A 1OFDA 3T78A 3OZYA 1W8SA 4A3UA 3QTGA 3T4CA 2CZ5A 5A8QA 2W0UA 4H4IA 2JKAA 2WZEA 1KFJA 3W1PA 4E3TA 3UXAA 3RPTA 1XDJA 3FYPA 1RJRA 1SJAA 2G5WA 2WCSA 3QY6A 2BV9A 3VAVA 1ZLPA 1TPUA 4G1KA 2Y24A 3LLXA 3EDKA 1BYDA 4Z1BA 1REQB 1OC7A 3VOIA 2CZFA 1ZGDA 3M7SA 1P0BA 2Y5JA 4QRNA 5A6SA 3GX9A 4IMFA 3PUOA 1XIEA 5FJRA 4W9TA 3LSBA 1BXNA 3LXCA 4V28A 2CZVA 4P8XA 3VIKA 1XISA 1EHNA 3N2CA 4AQLA 2HPIA 2E3ZA 7TAAA 5DRIA 4KIEA 4KGLA 2W5FA 1KWKA 3SN0A 2DSKA 2BY0A 4CQDA 3WNOA 1R5YA 3LOTA 3VZYA 2W6RA 5I77A 3WDIA 1RLCL 3VMOA 4I6VA 3N4AA 5LGXA 1Y0EA 1AA1B 2PDHA 1EDTA 1OGGA 5JH2A 3KW3A 1SFTA 1I2RA 3VC6A 1L9WA 4YTUA 2EKCA 3AXXA 1ZAHA 5DLCA 3HN3A 1M68A 4YTSA 4FXFA 4RNFA 4IIEA 4GCXA 3KTXA 4FEZA 2XSXA 3BG3A 2WJFA 1J0HA 3EBVA 1XLLA 2ZDSA 1Z7AA 3HQNA 4ZQOA 3SCVA 2ACQA 1MW3A 2DFAA 1LRNA 4XD4A 4NIRA 2VZVA 3KBVA 4UTJA 3KXQA 2DZPA 2DV0A 3FJLA 4GX8A 3G0SA 4ERAA 1UP3A 2PWFA 4DJEC 2HE5A 3IIPA 3B8DA 2WSYA 2DIJA 1FRBA 2G97A 1DE5A 2CCRA 4HQVA 3TROA 2VWSA 4GZIA 1O5QA 3M5ZA 1QPNA 4Q7NA 2P76A 3P6LA 1SSDA 2HDJA 1YPXA 4AD4A 3DCPA 1OT1A 1BGAA 4I9TA 3HQPA 4UQEA 4I5RA 4F0RA 1KNWA 3NPVA 3HPXA 2DJLA 1FBAA 3GDMA 1US0A 4MKSA 2PP3A 1IEWA 4C7DA 3FSUA 4DRSA 1F6PA 5AHIA 3MV11 4O0ZA 3MJMA 1EX5A 4LAUA 3EXSA 4E4UA 1BYAA 4Q8VA 5F1UA 1X8FA 1AMKA 2PDNA 3VIMA 5MKGB 4Q22A 1E4LA 3K8LA 3PWAA 4RXGA 3DGRA 3B3DA 4LAKA 1KXTA 1YPIA 2WPGA 3OLIA 2EPNA 5SWUA 4Q4OA 1X96A 2X05A 4Z42C 3K30A 2D1ZA 2XZ9A 1FWHC 3SEPA 3GXTA 4S3EA 2QZRA 2OWWA 3DHFA 1UD5A 1YW1A 3WLLA 5DO8A 4OTKA 4Y6GA 4XG1A 1W5NA 3LPPA 1V0LA 2WVVA 2XVKA 4UBPC 4XZWA 1M1BA 3AOFA 4JX6A 2ZICA 3O63A 3FJ6A 2X1RA 4UFHA 2ZUSA 1NEYA 2J7DA 3MI3A 4JIHA 1EO7A 2W61A 1JRBA 3DHUA 3AIBA 1BYCA 2FMOA 1E6ZA 4MKVA 2I17A 1JCLA 1MUWA 2ZXAA 4DJEA 3DDMA 3Q2DA 3GDRA 3MSRA 2BXYA 2XN1A 4KFPA 2CBIA 5T9BG 1I6NA 2BGNE 3R25A 4BF5A 4JIEA 3UBPC 3NSNA 3WQWA 3NO5A 3ES7A 5HWNA 3EAUA 2QJGA 4XD5A 3DFQA 3H55A 3GH4A 4IQDA 3GYEA 2VUNA 4CUCA 5D04C 1UP2A 4LCRA 2BODX 4A3QA 5FAJA 2J4GA 1DP0A 3E5BA 3NPUA 4E0CA 4RE2A 1XBZA 2YW3A 1PHQA 2A21A 1W1YA 2PTWA 4B92A 3L4XA 3CYJA 2CLFA 1C8QA 1WKYA 2JGYA 3ANYA 4MGGA 3W23A 2GPTA 1EQPA 1TWDA 1GZJA 2ZZ4A 1H0IA 1VIWA 2POTA 4B5WA 3CT7A 4M80A 1E4MM 1W9XA 2PWVA 3LGEA 3FK4A 3LXAA 1MFVA 1K02A 4FNQA 3DHDA 2XYLA 1D3GA 1XS2A 4YCPA 3NPWA 3IVTA 2P8CA 4TO8A 3ABOA 3G0UA 3OVPA 4EXQA 3QV8A 5M17A 3ZT6A 2PDIA 7XIMA 3LD5A 3E0VA 3KOWA 2B0MA 4JNMA 3RHGA 1W6TA 3W25A 3M6DA 2QCCA 3ALFA 4H3DA 2Q02A 3SQMA 4N9EA 4D8AA 3G5EA 5H2ZA 4KRTA 4Z2JA 1FWGC 1BF2A 1KFEA 4V15A 5I03A 4GUHA 4PYSA 3PB2A 2PWGA 2C1IA 4MJZA 3GC5A 4HGXA 1VLWA 2JIWA 2G0WA 3L5LA 2NV9A 4JBRA 5TD4A 1G1YA 4HPNA 3EX1A 2YXOA 3I7QA 2BWGA 2G8ZA 2XFYA 3BLKA 1BFNA 1SJDA 3ATZA 3NYDA 3WNMA 3RR1A 1MEWA 1B3WA 3SCRA 1ZUAX 1AODA 3N2BA 5A6MA 2H9AB 3WK2A 1OADA 1G9HA 3PPCA 4MNJA 3RITA 5G5IA 2VVNA 2Z1KA 1VJIA 2V2CA 3DAQA 2FPTA 1HG3A 3ZLFA 4UMCA 1OC5A 1UR9A 3WH8A 2FTPA 1NTHA 3W3OA 1G6CA 2Y7FA 3UZ5A 2BZNA 1F61A 3WF0A 1B3VA 2QYGA 3ELFA 4LF1A 3CLWA 2CXEA 4PMZA 3E9AA 2DY3A 3I3BA 4ATLA 1ZCCA 3VGGA 3H12A 2R1MA 4BQ5A 4JTAA 1E55A 1SPQA 1DIEA 2QLYA 1LQ0A 3BG5A 4O52A 1V3JA 1Q65A 4N42A 2CKRA 1WBJA 3NA8A 4DZAA 4GI9A 1TKKA 3PZNA 2XH4A 1RCQA 2A3BA 3WEMA 1XLMA 4L1WA 2WO5A 3S1WA 5GNYA 3GR4A 4FIQA 4F4RA 3KCJA 4NZCA 4ZE5A 3GR8A 2I16A 5CJ5A 1VCFA 3GKAA 3LPOA 1VBGA 4EACA 4C1KA 1M03A 1GNXA 5HANA 1W9PA 1E56A 4ATDA 3FW6A 2Y70A 1VLIA 2DPEA 4XKMA 3XIMA 3D5HA 5KEZA 1KXHA 1XSKA 1IT7A 2PUZA 1V0KA 2XM2A 1UA7A 2VVSA 4JNYA 1UWTA 1XW8A 4OE7A 1WDRA 4NL1A 4Y9PA 2GWGA 3UYIA 4JGDA 4GD0A 4DO7A 2G3NA 6REQB 1O7AA 4AD1A 2GUUA 1G0CA 2EEXA 4L9XA 1ITCA 2VFFA 1V6UA 1J10A 3ARSA 5CLWA 3OZOA 4ZB2A 1N82A 4QBXA 3H2AA 4LW7A 2BY1A 3LA4A 1XLFA 3GFYA 3K1GA 3BLFA 2WSKA 3CQHA 5FF0A 3G1DA 1A5BA 3AYVA 4Q8UA 2J62A 4NJGA 3PWIA 3UJEA 3N34A 4W84A 1AQHA 3TFCA 5BXSA 3C3NA 1TA3A 1V6XA 4UIOA 5I00A 1Z8AA 2WMIA 1TREA 2D0FA 1GJPA 2ACRA 1MQQA 2Y85A 2OMAA 4HNNA 1E6SM 1A5KC 3L65A 1R86A 2XFWA 2Y0FA 1RK6A 1PO9A 3HF3A 3SRHA 3LZ5A 2OT0A 4XAPA 1W3IA 3CAQA