4PMRA

Crystal structure of the mycobacterium tuberculosis tat-secreted protein rv2525c in complex with hepes (monoclinic crystal form ii)
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
204
structure length
202
Chain Sequence
SLGTLLDYAAGVIPASQIRAAGAVGAIRYVSDRRPGGAWMLGKPIQLSEARDLSGNGLKIVSCYQYGKGSTADWLGGASAGVQHARRGSELHAAAGGPTSAPIYASIDDNPSYEQYKNQIVPYLRSWESVIGHQRTGVYANSKTIDWAVNDGLGSYFWQHNWGSPKGYTHPAAHLHQVEKRKVGGVGVDVNQILKPQFGQWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies suggest a peptidoglycan hydrolase function for the Mycobacterium tuberculosis Tat-secreted protein Rv2525c.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Unknown function
molecule keywords Tat-secreted protein Rv2525c
total genus 79
structure length 202
sequence length 204
ec nomenclature
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08924 DUF1906 Domain of unknown function (DUF1906)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4pmrA00
1GOWA 4JKLA 4Q7NA 5CXPA 3AZTA 2CESA 2YKKA 4U3AA 5A8QA 2XIBA 2OYKA 4AZCA 1TR1A 3WMBA 4AD0A 4AIEA 1EOKA 2CNCA 4ZFMA 3AI0A 1TA3A 2Q8XA 4CD4A 3G6MA 5GNXA 5A2AA 3WF2A 1QNPA 3ZO9A 1XD0A 4C7GA 2WM0A 3VGEA 3ZT5A 4TVUA 1WDRA 5E0CA 1OT1A 3BCDA 1QHPA 1LLOA 5A2BA 1JAEA 5A8PA 1GVIA 3TTYA 2ZUSA 2F61A 5ECUA 4U5KA 1Q6CA 4QLKA 3TA9A 1B3ZA 1C90A 4ZE5A 4MTVA 2QHAA 3WDIA 1F4AA 1NOWA 3AMCA 2ZIDA 1KXVA 2WWCA 2PWEA 2YL6A 1QI4A 4D6FA 1J0IA 1UA7A 1CLVA 2WVSA 1CXLA 1W2PA 2JIEA 3W53A 2CCRA 2VCCA 1EDGA 5FL1A 1JI1A 1XD1A 2J7HA 1QPKA 3WF1A 1W3HA 3W27A 1JYWA 5AY7A 4BCEA 3PZIA 1US2A 4LYRA 5C70A 1E6XM 3WEMA 4UOZA 3AS3A 1HXJA 4PUDA 3W24A 4CKQA 1E56A 4QLLA 2D1ZA 2D2OA 3EDEA 4M82A 3KL0A 3PZVA 2W63A 2GJXB 4MJ4A 1HP5A 1R8LA 4D6IA 1BGAA 3MUAA 3SCWA 4CCCA 3AIRA 1E1FA 2WZIA 4UQEA 4UFIA 1GJWA 2BY0A 4AEFA 1B3WA 3GBDA 2W92A 3GM8A 2ZXBA 3OG2A 4D6JA 4KWUA 4AD5A 1EQCA 4OZOA 5D8WA 3MMDA 3SEPA 3IJ8A 1B3XA 1CNVA 5M3WA 2ZXAA 4MB1A 1EGZA 4M80A 2PWGA 2OSWA 3VOCA 2J75A 3B9AA 1GCYA 5A6SA 1WP6A 4Y7EA 5ABHA 4HP5A 1I1WA 1UD4A 1FP9A 1VBRA 4PTWA 5CQ1A 3ZJKA 2J8FA 1UR2A 5EFDA 3LMYA 2ZX6A 1YHTA 3WUEA 4ATLA 5BXRA 4PYSA 1V0NA 3OGRA 4J3XA 2JF7A 1JZ4A 1H11A 5GNZA 3WDPP 1KR0A 3RJXA 1VFMA 2QPSA 2YL5A 4PMXA 5AYIA 1XRVA 3TTQA 1UZ1A 3WNMA 1J18A 2EPLX 3AOFA 1JL8A 2W62A 1RP8A 1OWQA 2DT1A 2B31A 4FK9A 1J0KA 1EDQA 3VIIA 2WMIA 3IAPA 1BYAA 2ZX5A 1GONA 1I1XA 4P7QA 1GQIA 1CENA 3VVGA 2YA2A 3UG4A 1V02E 1WB0A 2OLHA 5E9AA 1FOBA 1CGVA 3T09A 1B1YA 1SMDA 3WQWA 3ARTA 1UWQA 3ECQA 4W85A 1J0JA 1BPLB 2WW5A 3SIMA 1V3LA 5BXTA 4MPKA 1JD7A 1C8QA 4QDMA 3B9DA 3VPLA 5CG0A 1RP9A 3FAWA 1E0WA 2J78A 4W5ZA 3VIMA 1EO7A 2E8ZA 2IXVA 2XVPA 2WHKA 2VC9A 1UD8A 3WUGA 3PTMA 2CXGA 1JF6A 1CGXA 4PCSA 3F4VA 3EYPA 4PMVA 4AW7A 4J3SA 1VFOA 1UH2A 3KEHA 3W82A 3AIQA 5A8NA 2V3GA 2VQUA 1GOKA 2JE8A 5DEZA 4AIUA 2D23A 1KB3A 3HN3A 5EB8A 1E6PA 3W26A 5LA0A 3NDZA 2GDVA 2VX4A 4NI3A 3WQ4A 4URIA 3MV01 1E6RA 3RM4A 3GH5A 4A4AA 1EDTA 1V6VA 2VX7A 5HBFA 3VD7A 4QLJA 3DHUA 2G3IA 4W84A 3AIBA 3APGA 1W9BM 2O92A 2XGIA 3O6AA 1KXTA 3BAIA 4DM2A 4P7NA 2VTFA 3ARVA 1BF2A 3N15A 2YBTA 2PF0A 3N9KA 4HA1A 1C8XA 1QHZA 5KEZA 2E9BA 4XB3A 4ZXOA 1UHVA 1E4IA 3VIKA 4H41A 3UESA 3CZKA 2WAGA 2DGAA 3PN8A 4UFHA 3T0AA 1Q6GA 4AZ6A 1VB9A 1JZ5A 1MQPA 4TVCA 2VMFA 2WC4A 4L4OA 1UG6A 2YL9A 2QLYA 3AYRA 3NYDA 4PSPA 4AZ5A 4BQ3A 3EDDA 3SCSA 4E8DA 2WKGA 1CEOA 1OBAA 1JD9A 4XX6A 4WKFA 1PAMA 3ZJ6A 4CGTA 1BG9A 3VDBA 4J27A 5AC4A 1IV8A 1HP4A 2ZUNA 4LXFA 3WD4A 1QW8A 4PMUA 4P8UA 3TOPA 2TAAA 3PZUA 3BC9A 2FGLA 1VJSA 3THDA 3PTKA 1DWJM 3OA5A 2DQXA 4HA3A 1UD3A 2ZUMA 1CDGA 1OIFA 5A95A 1C91A 2WPGA 5CGTA 2G4FA 3UERA 5JIPA 1LWHA 3WNPA 1A47A 4JKMA 3GYCA 3W0KA 2GVYA 2X2YA 5I2UA 1KXQA 1FA2A 3PZNA 7TAAA 3GDBA 2D0FA 2WZHA 4P8VA 3AHTA 5CJ5A 4QCEA 1E73M 3B8SA 1H1NA 3ARUA 4U2YA 3M7SA 4MNLA 2QV4A 4FMVA 3CO4A 1E6QM 1X6LA 3ARPA 4V28A 1BG4A 1CECA 5FIPA 2PI6A 1GJUA 1N82A 4FLOA 4UZUA 3W28A 2A3HA 3WNLA 3L2MA 4TVDA 1K9DA 3NUKA 3WH5A 1NP0A 4AMCA 1QI0A 4GO8A 4RE3A 4U31A 3WD1A 3VKKA 3ALFA 3SUUA 4DWSA 1CZ1A 4JFTA 2WMJA 2BVTA 4E2OA 2F8QA 2VOTA 2YLLA 4KRTA 4OOUA 5FKYA 1NOUA 4AISA 3BSGA 3MU7A 4PEEA 4MADA 1DP0A 4UFMA 1UR4A 1E4LA 2GJPA 4BA0A 2O9TA 1VF8A 4DWSD 3WD3A 4DUVA 3SCOA 8A3HA 3K4AA 2J77A 1E71M 2G8ZA 1C3FA 1V03A 1GZJA 5ABFB 1WAWA 5IHRA 2D3LA 3O9NA 5HPOA 3AS1A 2JEQA 3WQVA 3O2LA 1QI3A 4RE2A 1NP2A 1QI2A 2GJXA 1DWHM 2YJQA 4B3LA 2QF8A 3BAWA 3NJ3A 2XM2A 3UR7A 5CPQA 3VIOA 5KZ6A 2RGMA 1AQMA 1CLXA 2GFTA 1XH1A 4OBRA 4J7RA 2XG9A 2XM1A 1B31A 1X6NA 3NIYA 5I5RA 4D72A 1DWIM 5BRQA 4PMOA 1FH7A 3WQ8A 1B30A 1D2KA 1C7TA 3OB8A 4YN5A 1J01A 3AJ7A 2VZSA 1IZJA 2JFEX 3T08A 2VRJA 3MUY1 5CSYA 4WKAA 3AHVA 2HVMA 1WZLA 3F5KA 2OYLA 3N11A 4PCTA 1UKQA 2PWHA 3VD9A 1D3CA 1K9TA 1MW1A 1V3MA 2Z1SA 4R27A 2XWEA 2XHYA 3IK2A 1ISVA 4YPJA 3WH9A 1Q4NX 3WUBA 2ZUVA 1L8NA 3M07A 1NWUA 3LPOA 1CXIA 4HMDA 1EHNA 1MXGA 1ISYA 3HMCA 4CD8A 1UWIA 3ZMRA 2CETA 3L4VA 4MB4A 1D7FA 1VEOA 3GNRA 3VILA 1AVAA 3DYOA 5I3DA 4A3YA 2E0PA 5AYBA 5A69A 5M03A 1IZKA 3IJ7A 3AFBA 3RDKA 3N17A 5DO8A 5HDRA 4F9DA 4TX8A 4UFLA 2GSJA 1LL4A 4W87A 5LYRA 1NOFA 1B90A 5DT7A 2EPOA 2OWCA 1JIBA 4BF7A 2JALA 4M29A 1GW1A 2VR5A 5A94A 4D6CA 3VDHA 1A3HA 1KBBA 2ZE0A 3NSMA 4W5UA 3RO8A 2J8GA 3WF0A 1OD8A 2VJXA 4M56A 5D9NA 3ARWA 1W9XA 1HL9A 2DH3A 4LGXA 2WMFA 2WANA 3PBGA 4E4PA 3BMWA 1SR0A 5D8ZA 4LX4A 3LPGA 4W8BA 3N1AA 5TD4A 2ZOXA 5IXEA 2E9LA 1ODZA 1JDCA 1B0IA 4DUXA 3WDRA 4Z2KA 1UR1A 1HKJA 1ZJBA 1H5VA 3I3DA 1LG2A 2NSXA 3SCNA 1CBGA 4ACZB 2VR4A 2EJ1A 4GI9A 3AROA 1EIBA 3CUJA 2DIEA 4N42A 4D1JA 4PMQA 2O9OA 4D6DA 2DDXA 1KFWA 3ZSSA 4W88A 1UKPA 1PX3A 4WF7A 1WZMA 4JIEA 1JDDA 2V5DA 4NRRA 1Q6DA 1JF5A 4MAVA 1V3HA 2WHLA 2FHFA 4CN4A 3VNYA 4U2ZA 3VUPA 1E55A 2OSXA 3QHOA 2BFGA 1LF1A 3MV11 3ARYA 4H8HA 4OBSA 2WBGA 3RILA 3VD5A 4F79A 1KWGA 1V3JA 1C92A 1TG7A 4B9YA 2QMJA 4AZHA 1UD6A 1ZBVA 1P6WA 1W1TA 1DWGM 1NM9A 2BNJA 4D71A 2VVNA 1GOIA 1V6XA 2OWWA 3WFLA 3KL5A 2DT2A 1K9FA 3BAXA 4MJ2A 1HNYA 4Q22A 1JZ7A 2ZX9A 1O7AA 1V0KA 3BAYA 4Z2IA 1ZU8A 4CU8A 4JFUA 1GOQA 4GO9A 4WKHA 1WE5A 1J0ZA 3W6MA 1E4NA 1TMQA 2D22A 4KRUA 3ZR6A 1WZAA 6CGTA 2ZUWA 4PTXA 2NT1A 3AIWA 3UR8A 2CITA 5GQBA 2AMGA 2VZVA 2WMKA 7CGTA 1KBKA 2PWFA 3QGVA 1E40A 2CERA 1ZB5A 3UEQA 1BAGA 1IT0A 3QHMA 1M01A 5M5DA 3A4WA 1JZ2A 4QAWA 2FHBA 2D0HA 3FY1A 1J12A 5CPTA 1BSIA 4RE4A 1H49A 3WBAA 4BQ2A 1MW3A 4PMDA 3D3AA 1OT2A 3FHQA 2DSVA 1LQ0A 1G01A 1KQZA 1GQJA 2DSWA 3AXXA 4GIAA 3J7HA 2ZX8A 1I75A 4WSJA 2EBNA 2GUYA 3KWXA 1ITCA 4AWEA 3W81A 1PZ2A 2YIHA 1H09A 1B3VA 1BYBA 1LL7A 3SCRA 1JZ6A 4FF5A 1EO5A 4CD5A 3OLGA 3D5HA 2WK2A 5I77A 3DYPA 1H0GA 4OKDA 2WLYA 1W3JA 3VGHA 1CIUA 3GXMA 3CHCA 4W86A 3CIVA 3MMWA 1WPCA 4U33A 3OLEA 1KXHA 3WFZA 2VRQA 2XGBA 4PSRA 4TUFA 4V2XA 3F5JA 4PN2A 3DC0A 1BGGA 3QOMA 4UOQA 4PUEA 4EE9A 1EXPA 4D1IA 5GNYA 1UQZA 1VEPA 3W6LA 1VRXA 1GORA 4MNKA 3RCNA 3N18A 4H7VA 4BS0A 3AS0A 4C7DA 1KCKA 1BQCA 4UQDA 5I23A 4ACYA 2C8NA 4EK7A 4F9JA 1XSJA 3RJYA 1R7AA 2MANA 1J11A 3K46A 5E6YA 4PTMA 3AYSA 5D4YA 4TX6A 2ZUUA 3QR3A 1TVNA 2J25A 2X05A 5A3HA 3WMSA 4F66A 2WSKA 1GUVA 4CCDA 3CHDA 4P8WA 5A8MA 3PZQA 3OZOA 3FXYA 3WKZA 4HMEA 4JCMA 4H8UA 2VQTA 4EANA 1JFXA 3GXDA 5EBAA 4HZ8A 2EPKX 1JNEA 5EMYA 2UY5A 2WBKA 3CZLA 4PMYA 3ARXA 3AMGA 4R5EA 3WH8A 1V6WA 5A6AA 1NARA 1PZ3A 3W38A 4NRSA 1W3KA 6TAAA 6A3HA 3WDQA 1LG1A 1XSIA 1XV8A 1WZKA 1UOKA 1FHDA 2BHZA 3CUIA 4CU7A 3UG5A 1W2VA 4TTGA 1C7SA 1UA3A 3PZGA 2VZUA 3BLKA 3MO4A 3WL1A 1W3LA 1M04A 2WC7A 3CUHA 5A6BD 1HF6A 2GJRA 3WDHA 4JHZA 1ISWA 3FHAA 2XJ7A 3QHNA 2YLAA 3VDCA 1UYQA 4GKLA 1DHKA 2GDUA 2WYSA 1V02A 3QOKA 3B9EA 1Q6FA 4PRWA 2NW0A 4MDOA 3LPFA 4D6GA 1W1YA 4IPNB 1OIMA 3GZAA 1MWOA 2DT0A 2RGLA 2WVVA 2ZXQA 3WD0A 3N04A 3CGTA 1OGGA 3W29A 4ZENA 3WN6A 2FH6A 1FHLA 1MQRA 4HPHA 4XUYA 5BXSA 1KGXA 1QW9A 1VBUA 3ZOAA 3SCTA 1O6IA 4ATDA 1W1PA 3K8LA 2E40A 4JL1A 4M81A 3NSXA 4M1RA 2WKLA 4LPCA 1ZL1A 2GK1B 2Y4SA 4LYQA 4ML4A 1V3KA 1CTNA 4MB3A 3VGBA 1OCQA 3CMGA 5M17A 2ZICA 5JIWA 2Y5EA 4PMNA 4OOZA 4JFSA 2VT0A 1B3YA 3EBVA 1E3XA 3II1A 4B3KA 2WZEA 1XYFA 4W8AA 1AQHA 3UCQA 3SCVA 3CUFA 3K8KA 2DSZA 2Z1KA 2EEXA 1EH9A 5HNNA 1X1NA 2YDSA 1CGUA 2Y8KA 3ZSTA 2XPKA 3AMLA 5ABFA 1UH3A 3I3EA 2VCBA 3N13A 1HJWA 3PZMA 1H3GA 4P7RA 1VIWA 3GH7A 3VO0A 3ZR5A 3VGDA 2PWDA 4UQAA 4JFVA 4WLCA 3WIJA 2DEPA 1KQYA 4ZXLA 4GZJA 1ISXA 2V3EA 2J7EA 1CGYA 2E3ZA 2FH8A 2XFFA 4QP0A 3U57A 3NDYA 1PX4A 2JEPA 3AICA 2AOSA 2D20A 1CXEA 1QHOA 2BXZA 3WH6A 2DPEA 2XVLA 4AYSA 3KE0A 3L4UA 3ZT7A 1WNOA 1MYRA 4MAZA 4AZBA 1G0CA 5CSUA 2E4TA 4X0NA 3A4XA 1JYVA 4PMRA 3U7BA 1TCMA 3ZJ8A 3POHA 3RM8A 3L4ZA 3WUFA 1ITXA 1SYTA 1MW2A 3AXIA 3BSHA 1E5JA 3T2OA 1XCXA 2A3CA 3T0DA 3GXIA 4J3VA 4W93A 4CUCA 3CTTA 3ARSA 2XVKA 1G1YA 3A47A 1S46A 4HZ7A 1UD2A 1EA9C 1ZS2A 3OGSA 1U2YA 1WDPA 3VM5A 4ATWA 4AZIA 1Q6EA 5JUVA 2G3JA 1UR9A 3L2LA 4BQ4A 4X9YA 1JFHA 1ECEA 3KZSA 1PIFA 3S2CA 1E6ZA 3OIHA 3TP4A 3L4WA 1FP8A 1WO2A 3CZJA 5E0FA 1J10A 2X0HA 4Z2LA 1JYXA 1TFVA 2J79A 1E4MM 1UKOA 1J0YA 1UD5A 4U5IA 2WMHA 1OSEA 5IFPA 5D9OA 2BS9A 4DWSB 3HJEA 1CWYA 1BVNP 3EDJA 3WNNA 4PTVA 4W7VA 1GQKA 4UFJA 4WK9A 2JIWA 3KL3A 2C0HA 4JCLA 3WMCA 4JHOA 3HU7A 4ACZA 2VCAA 4A3HA 3VM7A 1JXKA 1BTCA 3IANA 3CZGA 1CGWA 2X8RA 3VMOA 5BXPA 4GPNA 3VGFA 1V3IA 3RM9A 2YBUA 5ABEA 1WDSA 3AXHA 2CBUA 3VX0A 1V0LA 4JL2A 3ALGA 4EKJA 3F5LA 3WH7A 2WWDA 1Y7VA 3ZJ7A 1TZ7A 3GNPA 2J62A 1MFUA 3OZPA 5E09A 1UWUA 3MS8A 2QMKA 1XHGA 1WCGA 1ZBWA 2XUCA 1RPKA 3EMCA 1GOOA 1HIZA 2ZXDA 2X0YA 2WCAA 4KGJA 3ZT6A 2V3FA 5BYWA 2PBGA 1CGTA 5E6ZA 2DIJA 1E43A 1K9EA 2FGZA 1QNQA 3BAJA 1BFNA 2BXYA 3WELA 3W4RA 1H4PA 2XYLA 2V3DA 3VIFA 3RIKA 1VJZA 4YHGA 3MANA 4WSKA 4UQBA 3VGGA 1Z32X 3AS2A 2X1IA 3E1F1 1HJSA 5CGMA 2XIIA 1VFUA 2VZTA 1W9PA 2CHOA 1OGBA 1KGUA 2IUZA 3BH4A 3OLDA 5GPRA 5A1AA 2WC3A 1DTUA 1XH2A 2BV9A 4DWSC 4CN1A 1MXDA 1UKSA 4GI6A 1H41A 1GOMA 3BMVA 4DM1A 3GH4A 3T2QA 4NF7A 2XVGA 4UCFA 4IISA 4S3JA 1C93A 2VZOA 2FHCA 4FLQA 2CIPA 4C7FA 4CD7A 1U33A 4J3UA 3AZRA 5JBEA 4AD2A 4OJYA 1QI5A 1E72M 2PBOA 4UFKA 3K8MA 4UR9A 1EQPA 3OGVA 3VU2A 2X09A 3POCA 2J7BA 5A6JA 1JZ8A 1HVQA 4JAWA 4QFUA 3RPMA 3W37A 3PZOA 1R85A 3EMZA 4EAMA 1KWKA 3MKKA 3AZSA 1CYGA 1NQ6A 2VVSA 2QPUA 4CVUA 3UG3A 1JAKA 4CU6A 1KCLA 4HA4A 2UWFA 1HL8A 2W66A 1JXJA 4UOJA 4AIOA 5DFAA 2Y8VA 3VTRA 1E70M 4LYPA 1JZ3A 4LQ1A 3IAQA 5DT5A 4JFWA 5LA1A 1US3A 4GI8A 1CPUA 4BZYA 4P7LA 1SFSA 2V5CA 2WMGA 4K68A 1RH9A 4B15A 2XTKA 3FN9A 2ZWYA 2ZWZA 3GTNA 5C8BB 1HJXA 5A8OA 3SUWA 4UQ9A 1G94A 2W4XA 4TOQA 2PB1A 1XH0A 4JKKA 3BCFA 3T0BA 4AD4A 3CUGA 5I6SA 2WSPA 2HISA 3AIUA 2V38A 2O9PA 1UWTA 1XC6A 1E5NA 5BWFA 3BXWA 3JUGA 2BHYA 1HKKA 1HN1A 4UQCA 3ZM8A 2VUYA 3WNKA 2CKSA 3ZQ9A 1UR0A 2W67A 1ESWA 4HMCA 2W61A 2JF6A 1HT6A 4AXNA 3CH9A 5C71A 2J74A 2VI0A 4M8UA 4P7OA 1W9VA 2DT3A 1E6NA 2BHUA 3MSGA 1HX0A 2DSUA 4W7UA 2D3NA 5A6MA 3M6DA 1W91A 2J4GA 1UWSA 4AEEA 1PIGA 2WCGA 3VIPA 2E8YA 2UY2A 1BYDA 4NZCA 1ZJAA 5I0DA 8CGTA 3VD4A 3EDFA 2CPUA 1QOXA 1YQ2A 1GQLA 1NH6A 2EQDA 3NCOA 3SURA 1TUXA 3OLIA 2ZX7A 1TA3B 5A2CA 4W8LA 1GHSA 4FLRA 1E1EA 2UY4A 1MW0A 2FDMA 4X0VA 3A6OA 2G3MA 4GQQA 5HXMA 4HOZA 3EDKA 1VAHA 2Y2WA 5I78A 3LPPA 4AC1X 5FOOA 3A3HA 1PBGA 1CXKA 4KGLA 4AY1A 1HJUA 1B9ZA 3U5UA 4CN6A 2G41A 3WF3A 4AD1A 1TVPA 4MB5A 4MNJA 2VRKA 3SUTA 4N0RA 5JBFA 2XFYA 1XSKA 1CXHA 1EHAA 3WEZA 1XYZA 4D6EA 1G9HA 2A3EA 2CBIA 2BY1A 2A3AA 2F2HA 2W91A 3CZEA 2XSAA 3WQ6A 1HJQA 4UZSA 4OUEA 4NSBA 3CHFA 1J0HA 5I79A 3PTQA 1GHRA 2WVUA 2YOCA 1K6AA 1QBBA 1KR1A 4PMZA 1VENA 1OGSA 4IM4A 3S6TA 2CKRA 1OB0A 4P8XA 3WD2A 1OM0A 1AQ0A 4GQRA 4HPGA 2YA0A 1G5AA 3WEOA 4KH2A 4D6HA 4J28A 2A3BA 2XFRA 1GPFA 1UKTA 3TTOA 1QVBA 4HTYA 1ODUA 1QNSA 1MQQA 4HZ6A 2E9MA 5HOSA 3CMJA 3VD3A 1E0VA 2CBVA 2OSYA 4ZE4A 3OBAA 2VX5A 1LJYA 3VMPA 4DUWA 5CLWA 3AMDA 1E3ZA 5D9MA 2VX6A 2OWXA 5AC5A 4HOXA 1J9YA 1BHGA 2EXOA 4TTUA 2PC8A 3WDJA 4CVWA 1E6SM 5A6LA 1HVXA 4WIWA 3ARRA 2O9RA 2WXDM 1R87A 1FH9A 1OD0A 2BVDA 5CPSA 1PPIA 1JG9A 5A6BA 1FFQA 3ZIZA 5IFTA 9CGTA 1U30A 2Y24A 1XGZA 3L4TA 4WJXA 3VX1A 4AZCB 2YA1A 3RMEA 1TE1A 3G6LA 4MNMA 2WHMA 4CD6A 2W5FA 5LA2A 3IJ9A 4L4PA 1JDAA 2VL4A 1MVYA 3TTSA 1B2YA 3GBEA 1PEZA 2YL8A 4ZEPA 3AHZA 5FL0A 5A6KA 1UQYA 2J47A 5FD0A 3U5YA 1W9DM 1QNOA 2CYGA 3ARQA 5BROA 2CHNA 5ABGA 2G3NA 5D9PA 3UETA 2C7FA 3SCQA 1PJ9A 1DWFM 1EOMA 3AIEA 4RL3A 1L0PA 4W7WA 2BVYA 3CPUA 3DHPA 3BGAA 2D24A 4OIFA 4H2CA 1JNDA 1M53A 2J7DA 4GZEA 2YDQA 3A4AA 1W9UA 2WVTA 4XV0A 3DYMA 1QNRA 5FCZA 4AD3A 1BYCA 2WVVB 2XWDA 1VFFA 4AZ7A 3L4XA 3GXFA 3CLWA 3I3BA 3K1DA 1E15A 2J7CA 3NSNA 1LWJA 4HOWA 4HU0A 1ZBKA 5CLTA 4AZGA 1M7XA 1JGIA 2EO7A 2VURA 2D0GA 4U3CA 1DWAM 3CHEA 4H04A 3AIVA 5DF0A 1F4HA 3AQUA 1E9LA 4PBGA 5JBDA 3WF4A 2XSBA 4BQ5A 3AISA 4W89A 2XVNA 4FLSA 1MFVA 2WNWA 2J7GA 1HKIA 1RD6A 2WB5A 3GNOA 3BAKA 4GXPA 3MMUA 1UZ4A 3WQ5A 5F7UA 4XZWA 4Z2GA 4QCFA 2CEQA 3ARZA 3N12A 3WBEA 4GINA 1DEDA 3WSUA 7A3HA 5E70A 1UH4A 3VMNA 4M24A 3W25A 1AMYA 1M03A 1WKYA 2BY2A 4JZ5A 2EPNA 5IHSA 1V6UA 3THCA 2DSKA 3VIGA 3WENA 1NWSA 2DH2A 3K4DA 3TONA 1GVYA 1ZBCA 3VNZA 3AHYA 4Z2JA 3SCUA 1PX8A 1XCWA 3L4YA 3MUZ1 1C8YA 2IXUA 1NWTA 4B16A 1FH8A 2WHJA 3SUVA 3AMKA 1R86A 2CBJA 4IPLA 1ISZA 1HJVA 4J3WA 4UNIA 2WLZA 2WCSA 4J3TA 4UTFA 3VIJA 3VIHA 2YDRA 2ESCA 3PZTA 5IDIA 3MUIA 1JYNA 4V27A 2VNCA 3VDAA 1KGWA 4F8XA 1R7OA 1V08A 4Z2HA 3AHXA 5EFFA 2J7FA 3CBWA 3DECA 2EPMX 3BLPX 4H8VA 3VINA 5DMYA 1VEMA 1W1VA 3FAXA 2OYMA 5BCAA 3SCPA 3U7VA 1H0IA 1GNXA 3EMQA 3FNDA 4GZIA 1UWRA 1V6YA 3MSDA 3PZ9A 4E8CA 3WNOA 4MDPA 4S3KA 3FW6A 1W32A 1FFRA 4TXEA 1BLIA 1BVZA 2NT0A 2WMIB 4KMQA 3T2PA 1UUQA 2GK1A 1JI2A 2BY3A 1NWRA 2VO5A 1UR8A 1QBAA 4CCEA 1CXFA 1H2JA 3M46A 1SMAA 1OINA 4B9ZA 5CZKA 2UY3A 4YHEA 4IUGA 1LL6A 3PHAA 3CZ8A 1WDQA 5BRPA 1E0XA 3SUSA 3WL0A 4HU8A 5HPCA 1HKMA 3WY1A 2ZUTA 5I24A 1V0MA 4XZBA 2AAAA
chains in the Genus database with same CATH superfamily
4RZ5A 3AZTA 4U3AA 3UJEA 5LIWX 4AZCA 4AIEA 4ZFMA 3PBVA 4NQ1A 4WGHA 3QKZA 4L1XA 1FXPA 3ZWSA 1C9WA 2WM0A 3W7IA 3AYVA 3RG6A 3VI2A 1W1ZA 3TTYA 9RUBA 2X30A 2ZUSA 4TIMA 3DCPA 3OO2A 1W56A 2OZTA 1FTXA 4QLKA 3W7NA 1C90A 4HK6A 4ZE5A 2QT3A 2FFCA 4G5DA 5B7ZA 2DVTA 4H8NA 2QHAA 3WDIA 1F4AA 1NOWA 2WNZA 3AMCA 3UGVA 1TWDA 5AC6A 3Q37A 4RR4A 1UA7A 3HTWA 4QEEA 4S38A 2F6XA 2WVSA 2VCCA 3UA4A 1JCXA 5FL1A 5AYYA 1QASA 4IJCA 3GXTA 1W3HA 1OFDA 2J6XA 2XISA 2RJHA 3QQWA 2X42A 1OK6A 1LRNA 4UOZA 1YX1A 1LBMA 5CZJA 4MWAA 5TIMA 4M82A 1JCNA 1ML1A 3UZZA 2GDQA 3KL0A 4LC6A 4MJ4A 1OF8A 3DG3A 4X60A 2MNRA 1E1FA 2WZIA 2QUMA 1GJWA 2EG6A 4IQJA 4GVFA 2O56A 4KWUA 4J35A 1EQCA 4OZOA 5LSMA 1PYMA 4LY4A 1B3XA 5M3WA 4N2YA 4MB1A 2I9EA 4US6A 2OSWA 3VOCA 1R30A 3UWWA 2E67A 3P0XA 1GCYA 5A6SA 3GKFA 4XTDA 4PTWA 5CQ1A 1DJNA 5T9CE 2ISVA 3GUWA 3WUEA 4JY9A 1OVDA 2EAWA 1V0NA 3G1AA 1H11A 3QV9A 3NQFA 3CWHA 1TV5A 3T55A 2YL5A 5DMMA 1OFQA 3LCXA 1TELA 4ADSA 5AYIA 1UZ1A 2OO0A 2EPLX 6TIMA 1RQBA 2VFEA 2C18A 2W62A 4Q8PA 1OWQA 2DT1A 1MI3A 3BZGA 4JTCA 1J0KA 1EDQA 1BYAA 2YPIA 1GONA 4P7QA 1GQIA 3ID7A 3VVGA 5E9AA 2OLHA 1NVMA 4GX9A 3UPBA 4YYFA 4JNMA 3DC8A 3G1SA 4UTHA 4XBJA 3KVLA 3SIMA 1EF2A 4IMAA 1TJ0A 4Y2WA 4HNCA 1C9DA 1XPGA 4GC4A 1RP9A 5LNWA 4JTGA 4F0LA 1O1HA 4AAJA 2J78A 4W5ZA 4WD0A 4QE4A 2E8ZA 2PU0A 2VC9A 2Z7GA 3S6OA 3P60A 1JF6A 1CGXA 2VGIA 3DBNA 5J8LA 1UH2A 4MKNA 1W31A 1GVRA 2VQUA 2R82A 3Q58A 2JE8A 4O8AA 3IWPA 3IVUA 1PKYA 1E6PA 2GDVA 3WQ4A 3MV01 1E6RA 1RBOB 2CC0A 4WDXA 3GH5A 5KITA 3ABQA 1EDTA 2YCJA 1EP2A 4DPPA 2I9UA 2E5CA 5A6TC 4RXGA 4QLJA 1XYCA 4DXKA 4W84A 3U48A 3RU6A 3N9RA 3APGA 3QMTA 2DW6A 3G1DA 2O92A 2XGIA 4H9XA 1KXTA 4RPQA 5DLCA 4DJEC 3BAIA 4DM2A 1HKWA 4MIMA 3N15A 4PE8A 4XIAA 1U1UA 2PF0A 1F3XA 1PZ0A 4DLMA 4QEHA 3P14A 4J2MA 1YXDA 4DNMA 4H41A 1KFCA 3UESA 2YR1A 1A50A 1Q6GA 3KXQA 4YTRA 1M1BA 4TVCA 2EG7A 4L4OA 1UG6A 2YL9A 2YW4A 2I7GA 3WLTA 3EDDA 3HA1A 4E8DA 2Q3RA 3HQPA 4GE8A 1L2QA 3V7PA 3W1PA 3BLOA 4FNRA 3KBMA 1BG9A 4J27A 3WD4A 1KM6A 3TOPA 3PZUA 2FGLA 2QCLA 3GR8A 3P5YA 3SSZA 3OA5A 3P67A 1YIXA 2ZUMA 2GQ8A 1CDGA 2RFGA 3MY9A 1UROA 1NY1A 4GG9A 5CGTA 4ALDA 1XKJA 4MZYA 1LWHA 3WNPA 3ZLHA 1PS9A 2E6AA 3GYCA 3W0KA 1KBIA 1V8EA 1RHCA 2X2YA 3BSMA 3LBCA 1ZTVA 3AHTA 5CJ5A 3YPIA 1KCXA 3M7SA 1KM1A 1X6LA 3ARPA 3E2RA 1ZJIA 5FIPA 2TYSA 1N82A 3W28A 2A3HA 3NO3A 5EYWA 1S2VA 1XBXA 3P81A 4TVDA 4F4RA 1OFPA 4AMCA 5MF5A 4IIFA 4C5YA 1FKWA 3ATZA 3PULA 2WMJA 2AQVA 3QR0A 4CQCA 5AOUA 2PDJA 2YLLA 3SFWA 3SAZA 4C6MA 4OOUA 4F0MA 1JEZA 1Q66A 2WSQA 5AC7A 1W37A 3LGDA 2C3ZA 1TWSA 3VNKA 3OIXA 2FKPA 1EJRC 3MSYA 2OQYA 4LBUA 2GOKA 4E8GA 3TYDA 1MO0A 3MW7A 6REQB 1TSIA 3A13A 1H51A 3TZNA 3VYLA 3NO1A 3WD3A 4DUVA 1OX6A 4M6QA 2G8ZA 4G56A 3GYEA 3LHZA 3DKJA 1M41A 3R5EA 3EOEA 3MPGA 3LHVA 2QGYA 3P8JA 2WZTA 2JEQA 4AWUA 1QI3A 3G0SA 1J5SA 4EWND 2RAGA 1K8XA 1NP2A 4JTLA 1SSGA 2A2IA 2GJXA 2YJQA 2DUAA 5AHLA 5GJNA 5CPQA 4LVFA 4C6CA 3WLKX 3AYTA 5I3GA 2XG9A 3R2GA 1UZHA 5HJLA 1B31A 1XYAA 2VEKA 3GFYA 4D72A 3S1GA 4PMOA 3WQ8A 3PSVA 3WBWA 3OB8A 1J8VA 4UC5A 4Q33A 5FI8A 2JFEX 3T08A 3IV3A 2OODA 5CSYA 4WKAA 5KSWA 3R0KA 3F5KA 4QSHA 3W9ZA 1XYLA 2NQ5A 1DIDA 5HNTA 4PCTA 3MWAA 4TV6A 4WR3A 1JUEA 1A3XA 4YPJA 2XHYA 3I7RA 4RDVA 2W0UA 3S6DA 1H1YA 4GYJA 1OFEA 4LOCA 3WMLA 4KS0A 2PDUA 4CD8A 1UWIA 3UR2A 1I4NA 4H3DA 2R1LA 3EX2A 1D7FA 4GHRA 1VEOA 3VILA 3W00A 2E0PA 5TBOA 3SRKA 5M03A 4O1CA 1IZKA 1KFKA 3AFBA 3N9SA 1X98A 1Z7AA 5I03A 4OFCA 4DWDA 2NVCA 4HHHA 4GJ1A 5G2WA 5DT7A 3UWYA 3N2BA 2QJGA 2F7FA 4KW2A 4LVBA 1IR2A 1K7EA 2J8GA 3WF0A 4LBSA 3LDVA 3CQ0A 2CZVA 3TDFA 4KWWA 4DYJA 2C79A 1W9XA 4LVAA 2VDHA 3ENLA 5HUPA 2OKOA 1R9YA 4A29A 4F3HA 4E4PA 3UXLA 3BMWA 2OX1A 5D8ZA 2GPTA 2ZOXA 2XH0A 1B0IA 2FQIA 3LN3A 1H5VA 4I6VA 4IHCA 4Q4RA 1XDMA 4DF0A 4DO4A 3S5NA 1GK8A 3KTCA 4JICA 4ACZB 1VBGA 3GNXA 2VR4A 2EJ1A 1EIBA 4PMQA 2G50A 4E4FA 2O9OA 3VDGA 1UKPA 1FWEC 2E6FA 4JIEA 1NQKA 2INZA 4FNPA 1MXSA 2IQTA 4P5UA 4NILA 4LCQA 2VHLA 3QV6A 4LYKA 3MV11 3MDUA 2ZRUA 2Y6ZA 3MZNA 3AUOA 3QY7A 4D9PA 3VZZA 2HS8A 1V3JA 1UP3A 4DZAA 1TG7A 4UMCA 2QMJA 5AYZA 3E02A 4RW3A 3O06A 3H2NA 4MYAA 2I57A 1W1TA 2BOEX 2ACUA 1NM9A 4OECA 1P43A 4XG1A 1ICPA 4O12A 4Q22A 3S83A 2FVLA 4NZFA 3QV8A 1O7AA 3MKCA 5HMEA 3QVQA 2NXGA 3PNZA 4ZO7A 1XM3A 2RUSA 5FF2A 1J0ZA 4I9JA 1K3UA 3IJLA 4KRUA 3ZLFA 3ZR6A 1WZAA 1TCDA 1VQTA 5HNRA 1QPOA 2ZUWA 5CC5A 3UWZA 3S46A 1DE6A 3AIWA 3ISIX 3STGA 3UZWA 1F76A 2AMGA 3MCNA 3GG1A 4NZ3A 7CGTA 2E6DA 2CERA 3W1AA 5IBXC 2ASHA 1JZ2A 4DJFA 4QAWA 4YCOA 1VCFA 3SGZA 4PMDA 2HS6A 3VNJA 3D3AA 1OT2A 4FI4A 3I7SA 5CAHA 3RPTA 1F05A 3FA3A 1QRQA 1I75A 3R10A 4S2CA 2PF8A 3PK7A 3HG3A 4JBRA 4LC8A 3TN4A 1BYBA 3SCRA 1JZ6A 4CD5A 5D38A 3CIXA 1OFAA 3M0MA 2WK2A 1OYCA 4OKDA 1RLCL 1O68A 4UTIA 5CJNA 3GXMA 2YX0A 3CIVA 1WPCA 1LUCA 5H6HA 1E0UA 1Z42A 2LLEA 1AH4A 2PEVA 3PPCA 2VENA 4PUEA 1EXPA 1PDZA 4RJEA 2Z1VA 2GVLA 3N18A 4H7VA 3QRHA 3AS0A 2PLMA 4HQVA 1IXOA 4MUPA 5C0QA 2HVNA 5BRBA 5I23A 3B3DA 1RUSA 3TC7A 4F9JA 3IEBA 1X8FA 1XRFA 1LOQA 1MUCA 3K46A 5H91A 3TAKA 4U10A 5HQMA 1SO6A 4QG9A 2X05A 5A3HA 4R7OA 4F66A 2WSKA 1OYBA 2QAFA 3CHDA 3G22A 3GDMA 4JS3A 4H8UA 2VQTA 1JFXA 1HL2A 2MUCA 4HA0A 1KBLA 1X8CA 4C91A 4XD5A 4PMYA 2PAJA 1R9XA 3AMGA 4O4VA 2B4GA 2Y0FA 1TV7A 1PZ3A 3RFAA 4TMBA 2ZZ5A 3WK3A 4Z1YA 1LG1A 1XV8A 1UOKA 4TO8A 4CU7A 2NV1A 3WJXA 2IKIA 3UPMA 1FDJA 2EJAA 4O14A 1C7SA 1W8GA 3BLKA 3MO4A 3RX2A 3S2MA 3CPGA 3ANUA 5EMJA 4HCHA 2GJRA 3WDHA 1ZLPA 2ACSA 4K7YA 1UJPA 3DZ1A 4IZGA 1DHKA 2WYSA 3SDOA 1RAKA 5J5RA 5K2ZA 1TR9A 3IS4A 3RU8X 3B9EA 4C6DA 2RHGA 4R7WA 1PKMA 3N4FA 4IPNB 2QJIA 3GX9A 2DZXA 3GZAA 1MWOA 4HZMA 4WOZA 4ZQOA 2RGLA 2WVVA 4Y90A 3M0LA 3N04A 3DDMA 2Q8LA 1TRIA 2RKXA 4IMCA 1RZMA 2PD5A 1A49A 4IF2A 5AB3A 4MZ1A 3BW2A 4ZSUA 3MYOA 1FHLA 4MLJA 5SWUA 1QW9A 4KF1A 4N9EA 3EKZA 1QPQA 1O6IA 1QTWA 5PTDA 4JL1A 2XDFA 4O16A 4DI9A 4M1RA 5D03A 3FK4A 4ML4A 1CTNA 1OCQA 1KV8A 4HB7A 3CMGA 2DUZA 5HAOA 5JIWA 4L56A 3LB0A 1K4HA 4N6EA 2PTYA 4PTDA 3TJLA 2WZEA 4O4WA 4W8AA 1AQHA 3FA4A 3UCQA 5C5YA 3SCVA 2DSZA 2O55A 3FDGA 3RX3A 2Q01A 2PDBA 2ONEA 4HSHA 3C2EA 3PUOA 3S5SA 5MKGA 3LCHA 1O5QA 3KFTA 3ZSTA 5LIUX 2Q09A 3LXAA 1F74A 4GNJA 2E25A 2POZA 5K4XA 2VCBA 3N13A 5EU9A 1IEVA 4GMEA 4P7RA 1VIWA 3AXKA 3ZR5A 4S3AA 3TKFA 4N9BA 1A5CA 3GVRA 4LUYA 4WLCA 2OR2A 3ORWA 3WIJA 2WQPA 1L9WA 3BOFA 4ZXLA 4JX4A 4GZJA 2A0NA 4NY2A 2VDGA 2E3ZA 3FFSA 3NDYA 1PX4A 2JEPA 1S5NA 1IIGA 1DQUA 1IYXA 3L4UA 5CZ0A 5EMLA 3ZT7A 5HMFA 1W0MA 4X0NA 2Y5JA 3U7BA 4B5SA 3B8UA 1SFLA 2CLOA 3ZJ8A 3POHA 3WUFA 1ITXA 2DQWA 4GBDA 1YXYA 3W73A 3AXIA 4C65A 1GTHA 4KFPA 4AF0B 2VOMA 5EBUA 1GT8A 1XCXA 3R7MA 4J3VA 1GQNA 3CTTA 1I9CB 2G3FA 1G1YA 1A3WA 3A47A 2H6RA 1UD2A 3OGSA 3VM5A 2I5QA 1UUMA 2YBVA 5FEXA 4DO6A 4PUUA 1Q6EA 4O28A 4KEUA 2G3JA 3HPFA 1UR9A 4XWUA 1PHQA 2IS7A 3L2LA 1AG1O 4GY1A 1XR2A 1XUZA 3W76A 1ECEA 1YYAA 2WQDA 4GXWA 4FOJA 3K4WA 4FNSA 3V5FA 4Q4PA 3ABOA 4W9TA 2ALDA 1TFVA 4FR1A 3BW3A 3LXCA 4I9AA 1UD5A 1CCWB 1VYSX 5REQA 5IFPA 5D9OA 3IPWA 2QCHA 3RYSA 1RK6A 4DWSB 2PDYA 2OLAA 4CLMA 4WK9A 3A23A 1IF2A 2JIWA 3KL3A 2C0HA 4JCLA 3WMCA 1T8XA 4CNTA 1BTMA 2GWNA 2G0WA 4NZ4A 1BTCA 1VCVA 3WBXA 4O1AA 5EMMA 1SW7A 3TSDA 1TB3A 1MEIA 3S1XA 3AXHA 3GDLA 2CBUA 1OYAA 1R3VA 3BVJA 2G4JA 1XLAA 2XN1A 4I8DA 4NX0A 1RJPA 4XAZA 4DZ5A 1ADDA 3ZJ7A 2ZKMX 5CAKA 3G0UA 2QJNA 1MFUA 4FO4A 3UU0A 3OZPA 1XLFA 4B4HA 1XDJA 1B4KA 2BX7A 5DN1A 1ZBWA 3DENA 1L8PA 1HIZA 1EWDA 2FTPA 4KGJA 1PE1A 2CZFA 2JGQA 1M7PA 4WXYA 2BB0A 2D73A 1H4PA 2V3DA 3UYCA 2REQB 3KHDA 4WSKA 2H3BA 1Z32X 3BTNA 3TSBA 1HJSA 1TJPA 3RCMA 3CAVA 3JS3A 3BJSA 3NQ6A 2B7NA 2XIIA 1W9PA 4Q4MA 2P3EA 3OLDA 2OT0A 1EF3A 3NZPA 5CEWA 1KM5A 3GVQA 1DTUA 1XH2A 2CU0A 4DIAA 1MXDA 4C6PA 4LWWA 4DM1A 4LV4A 2XVGA 3B0UX 4S3JA 2VZOA 4GIRA 3C86A 4LB3A 3S1VA 3ES7A 3Q67A 5AZ1A 3M5ZA 2PODA 3M4HA 3AZRA 5HNUA 6REQA 4NZJA 4OJYA 1AZ2A 2BGSA 4NNBA 2NVAA 4QS6A 2XN2A 4HNUA 1DKWA 1GVOA 1IGWA 2G97A 1NDWA 1JZ8A 1HVQA 3PFMA 2NZLA 2QKFA 4GRSA 4HU4A 1P0NA 1KWKA 4UTTC 1BXCA 5AN7A 2OU4A 3UG3A 1JAKA 4HA4A 1HL8A 4Z1DA 4AIOA 3ZVHA 4IXHA 1SZRA 5DT5A 5LA1A 2PLKA 3UYIA 3H7UA 4BZYA 4MMWA 1B5TA 1F3TA 4P7LA 4LUTA 5CBJA 2AQWA 2WMGA 1ADOA 2J13A 4DF2A 4BFAA 1JCLA 1HJXA 5FSEC 1YDNA 3T8LA 4PH6A 4WDWA 1G94A 4E2VA 4TOQA 2PB1A 1XH0A 1VR6A 3T0BA 3CUGA 2GSEA 2HISA 2O9PA 3BXWA 3CT7A 4UQCA 3GDTA 3VUSA 3KDOA 3KTSA 2W61A 5C71A 4C6FA 4M8UA 3GRIA 3IIZA 1W9VA 2DT3A 3VKJA 3QV7A 4B3ZA 1HX0A 4DAIA 3TEVA 3GK0A 4PC8A 1EJTC 4EIVA 3KVJA 1ZP3A 4LALA 2HK1A 2C91A 2E8YA 1ZJAA 3LNPA 2YFNA 4C6KA 1AD4A 3CT2A 1DBTA 1A5LC 4XBSA 2PRHA 4M3PA 1O66A 4Z0SA 3T7VA 1TMLA 3DBPA 5LIYX 1GQLA 1FBAA 3M5YA 4A05A 1EA0A 3C5QA 3VKBA 3W7JA 2ZX7A 5JH2A 4GI4A 5A2CA 1GHSA 1E1EA 1TV2A 1MW0A 2FDMA 1XCFA 1XLEA 4I5XA 4E2DA 1D8CA 3QFEA 3A6OA 1VAHA 2NXHA 4AC1X 4RLIA 5FOOA 1DJXA 4HK7A 1SJDA 4XISA 4KESA 3T07A 1HJUA 3U5UA 4Y9MA 1BKHA 2ODOA 1VZWA 3CLMA 3H7RA 4LF1A 5BMXA 1EPXA 4LNYA 4RKAA 2G37A 4N0RA 1FWSA 1TPWA 1XSKA 3LHTA 1CXHA 1WAUA 4YJ5A 3NL5A 2CXEA 3PAJA 3NYZA 3UR5A 4WDUA 2BY1A 2CLPA 4FSAA 1ZZMA 3GUGA 1HJQA 1RY0A 1QJWA 4NSBA 4FXJA 8XIMA 5CZTA 1QBBA 4F0RA 3RMJA 1Q3NA 1CW2A 5LKYA 3W7HA 2R9RA 3KBWA 3IRSA 2J24A 4IL0A 4IP7A 4IT1A 4AVFA 4B90A 1EC9A 4AU0A 2C1GA 1HO1A 4A2RA 4DNHA 2XFRA 1P4CA 1UKTA 5IDZA 4HTYA 4KEMA 5HJXA 1VLWA 3CMJA 2VDIA 1E0VA 2OSYA 4ZE4A 3VMPA 4UWMA 3AMDA 3LCWA 1E3ZA 4DHGA 5BNKA 1WBHA 3C6CA 1UIOA 4MYXA 5L6UA 5F2GA 3WDJA 4PTNA 1L6GA 4BKNA 2A7RA 5A6LA 4GFSA 3AWNA 1U5VA 1R2RA 1W17A 4H9UA 4EACA 5A6BA 2XIQA 2E5BA 2P0IA 4LS1A 9CGTA 2Y24A 4YVVA 4Q4QA 2YA1A 1TE1A 1V4YA 3G6LA 1FWBC 2VL4A 2OFJA 2JGYA 4CQDA 1B2YA 2XIMA 3KBSA 2YL8A 4LUJA 1KFBA 1LDCA 2ACQA 5FD0A 1W9DM 1YADA 2XGZA 1TV8A 1M7JA 1KC7A 4LUIA 3SCQA 2FZ9A 1KLYA 4M7TA 3TFCA 3EX4A 2BVYA 4Y8FA 3W1NA 4DBWA 1R46A 1XBYA 2J9YA 1M53A 2YDQA 1W9UA 1R3WA 3VK5A 4XV0A 4XAPA 3WLNA 3QEZA 1T5AA 3BG3A 2WVVB 4AZ7A 2VGGA 3L4XA 4DBUA 3K1DA 4L9YA 3L68A 1LWJA 1JQVA 1Q6OA 1ZBKA 2DZPA 4LS2A 2BDQA 2VURA 2D0GA 4NHVA 3CHEA 2A1YA 1RCXB 5FJTA 1OFOA 2CZ5A 1F4HA 3AQUA 4LF2A 5G1MA 4ZZ9A 3NM3A 3WF4A 2XVNA 1MFVA 4FLSA 2VUNA 1HKIA 1BWLA 1ENUA 3GNOA 4GXPA 4H9VA 2NQ9A 3OBKA 2DW7A 5FJRA 4KIEA 7A3HA 5E70A 3CS2A 1H7RA 4IJBA 4O1FA 1AMYA 3VC6A 1M03A 4JQ1A 4NKCA 5IHSA 1TKKA 3QW3A 4AG0A 4NAEA 4A8LA 3VIGA 2V5KA 3W7EA 5FJJA 1QPRA 1PX8A 1S5WA 2YSWA 1D8WA 2Z6JA 3BCJA 2DP3A 2IXUA 1E9ZB 1LOLA 4MHBA 1R86A 1YMYA 3STPA 3OYZA 4H1ZA 4B5UA 2FPYA 4W4QA 4RUBA 1HJVA 1XQLA 4LTSA 4J3WA 2WLZA 4H6QA 2Y8UA 3VIJA 2QCCA 2ESCA 5IDIA 3MP4A 3VZXA 5I7GA 2C0AA 2VNCA 3VDAA 4G9PA 3GTFA 3N2XA 3LLFA 1Q7MA 3W1XA 2PE4A 2QCGA 3SBFA 3VNMA 3W1MA 2FMNA 5HJYA 2OYMA 3G3MA 3L65A 4OUIA 1V6YA 3MSDA 1V79A 3PZ9A 1C8VA 4RZBA 4E8CA 1ZFJA 2PGFA 4HIBA 1Z9AA 3AUJA 4MDPA 1Q63A 3FW6A 3SY1A 1TPB1 3AWOA 1GVSA 3QQ0A 2NT0A 4KMQA 1P0DA 3S2LA 2RJGA 3CQHA 2FJUB 3LZ5A 1JI2A 4ORIA 5GJMA 1NWRA 4RV8A 3VABA 5F4XA 1KRMA 4MWAC 4FF7A 1H2JA 2X0SA 4B9ZA 2CZDA 1XIMA 2WM1A 4IUGA 1Q13A 3OZYA 1WDQA 5BRPA 1E0XA 4UCGA 1KD0A 5HPCA 5I07A 4LT9A 5I24A 3KOYA 1AW1A 3BJFA 3LCGA 4A8IA 2OYKA 5LGZA 3TA6A 1FUYA 1OC6A 3KW3A 3AI0A 1WDWA 3B0XA 4CD4A 3SI9A 1A5UA 3B9NA 3XISA 1FWHC 5GNXA 4YTSA 2GQAA 3TYBA 1QNPA 3G1VA 4U28A 5DCBA 3VGEA 1WDRA 5E0CA 1OT1A 3BCDA 1R2TA 1QHPA 2Q3OA 4G6CA 1TPDA 1I2PA 3BWWA 4DXXA 1KFJA 4H6RA 2V69A 4BEUA 4FOKA 1J4EA 3R6IA 2OZ0A 4YS1A 3KCJA 4JQ2A 2DORA 4HYWA 1ZAJA 1QI4A 4D6FA 1IR1A 4HNLA 3TN6A 1CXLA 3DHDA 1S2WA 3W7GA 3FVMA 4DO5A 3W53A 1YTEA 2W9MA 4GX8A 1XD1A 3GG0A 2J7HA 2PTDA 1W3NA 3W27A 4MZ8A 1JYWA 3MJMA 1E0TA 3TMQA 4N02A 3ZVIA 4ONVA 4LYRA 5C70A 2J6VA 4ZBCA 3CWOX 3R8GA 2EPHA 4PUDA 3W24A 2D1ZA 3EDEA 4XZMX 3LI1A 3MC5A 4WJEA 1SM9A 2OCZA 2GJXB 1HP5A 4M7SA 2X1TA 4D6IA 3CL6A 3SCWA 4ADTA 3AIRA 4UQEA 4XD3A 2Q02A 2BY0A 4AEFA 3W7MA 2GQ3A 3WQOA 1AL8A 3SZ8A 4IIBA 3GBDA 2W92A 3GM8A 3UWVA 4C6OA 2HROA 5D8WA 3MA8A 4ZGYA 3MMDA 2BG5A 3SQLA 3APTA 3SEPA 2FGBA 1CNVA 3Q94A 3QSTA 1XIFA 4M80A 2PWGA 2PLCA 4KCUA 3N3TA 3B9AA 3ELFA 4Y7EA 4HP5A 3DKLA 3VKAA 4O18A 4RDYA 4DJFC 4RV3A 1UR2A 3O15A 4UTLA 2ZX6A 3PG9A 4ATLA 3BOLA 3OGRA 2P8CA 4J3XA 2JF7A 4ROPA 4XKYB 1KR0A 3A12A 3NZ1A 3SGGA 1VFMA 2UBPC 3B8IA 2QPSA 4GOAA 3LV6A 4GABA 2QDEA 3UVIA 3GLCA 3QLLA 1ONRA 3TU9A 1IT7A 1RP8A 7ENLA 4MFDA 2YXOA 3B4UA 3CL8A 2WMIA 3WZ0E 2ZX5A 1JCJA 3KVKA 1R3SA 3UG4A 1V02E 1WB0A 1CGVA 4C6EA 3PJXA 3T09A 1SMDA 4EWJA 3ARTA 3TR9A 3EB3A 4W85A 1J0JA 1BPLB 5BXTA 1V3LA 1C8QA 3TC6A 4AX6A 1VPQA 2Z2AA 4QDMA 3VPLA 5CG0A 2QYGA 3GIPA 1TQJA 3GSMA 3AO0A 3FAWA 4PL1A 1W5NA 3IUDA 3DGRA 4HNNA 4EPKA 3IUIA 1VPYA 2XVPA 1GGOA 3GU9A 3BZJA 3F4VA 4NNCA 3NQGA 3HGOA 3WQDA 3EYPA 4AW7A 2OO6A 1WDDA 4NUWA 3W82A 1QO2A 1HO4A 3URNA 2QJHA 3UZYA 3H4WA 2D23A 1KB3A 3HN3A 5LA0A 1P6BA 3NDZA 4M6VA 4NI3A 3E5PA 4URIA 3RM4A 3WX7A 1B4EA 4A4AA 2PUZA 2FTWA 4B5XA 3QC3A 3TJXA 4QSFA 2VGBA 3NNTA 4L6OA 1XBZA 3AIBA 3B0VC 1UZDA 5XINA 8TIMA 3CQIA 4IFKA 2VTFA 3VOFA 1BF2A 4XAYA 3S0CA 2OQLA 4RNJA 1X97A 4ZXOA 1YXCA 5D32A 4UFHA 2X1SA 3T0AA 1TZ9A 1RA5A 3BANA 3ICJA 1A5KC 1JZ5A 3S9IA 1ECQA 1MQPA 5J04A 2WC4A 1EKOA 3ITLA 2QLYA 3NYDA 4M51A 4PSPA 1H7WA 2WKGA 5TQLA 2INFA 4XX6A 2ZRWA 1XX1A 4GQGA 1J79A 3SGUA 2VFHA 2HBXA 4LH8A 3W70A 1QW8A 2YZ5A 2FPVA 1V5XA 3NL2A 3GE7A 4YWSA 1VJSA 2HXUA 3PTKA 3HV9A 4KT2A 3A64A 3NM1A 4GCXA 3KX6A 4UMBA 3T42A 5A95A 2WPGA 4C1NB 1DQWA 3DU0A 4ICMA 1EJSC 5LXEA 5G2IA 1TTPA 2PGRA 1MNZA 4WUIA 3GU1A 5I2UA 4DVOA 1KXQA 2E68A 3EZ4A 3MYPA 7TAAA 2D0FA 1E73M 3B8SA 1H1NA 4KQNA 1FHUA 4FP1A 2QV4A 4FMVA 2Z29A 1WA3A 1BG4A 1CECA 1W8SA 2VWTA 4UR8A 3PB0A 1GJUA 3E5BA 4FLOA 4UZUA 3L2MA 2GVEA 5CPOA 4ADUA 1SSDA 1S2TA 3S1UA 1NP0A 4FPSA 3SQMA 1UWAA 5F2IA 1FWFC 3VFCA 3ALFA 3HG5A 3S8HA 1QDSA 2NUYA 4E2OA 2F8QA 1XYBA 3TV8A 4KRTA 3VE7A 2P88A 3WQPA 3LYEA 4AISA 3BSGA 3BLIA 1SO3A 3L0GA 4FXRA 1G7VA 3C2FA 4PEEA 3KRBA 4WQ6A 4UFMA 4F48A 1UC4A 1KM3A 1UR4A 1V77A 2FB3A 2ZZ6A 4L1GA 3VE9A 1VF8A 3OG3A 4LW7A 3LM3A 2E1DA 5DXYA 3IIOA 4EF9A 3SCOA 3K4AA 2J77A 3N2OA 3MP3A 5ABFB 4UTTA 2C6QA 1VJIA 5CC6A 5IHRA 1JGMA 2D3LA 3NG3A 3G2GA 2DFAA 1POKA 3GD6A 3AS1A 2OTDA 1X1ZA 1SGJA 4ZSTA 3L0NA 1JDEA 4PEKA 2QF8A 4HYVA 3NJ3A 4RZ6A 1OABA 3LTPA 4YU1A 2ISSA 4J7RA 3MVIA 3NEHA 2XM1A 1X6NA 1XIBA 3NIYA 2QF7A 4JYFA 4RNIA 3NQ8A 2R91A 3TYUA 4QISA 3NQDA 1B30A 3MDWA 4QJ1A 1V7YA 3ITOA 3KP1A 5K3VA 3M47A 3AHVA 2HVMA 2OYLA 4C1LA 2PWHA 2FYMA 1D3CA 1WUFA 3ITCA 4LVGA 1V3MA 1FWTA 2Z1SA 4R27A 1FDZA 1ISVA 4V1YA 5HR6A 3WUBA 1L8NA 1KW1A 3GIYA 4NZ5A 5HWJA 4PFMA 3L66A 3HMCA 4UXDA 3CEPA 5I3DA 3CQKA 2XH4A 2PPGA 1UIPA 1GKPA 3LK6A 3IJ7A 2YXGA 3RDKA 3N17A 1W5PA 3QGKC 3RUBL 4TX8A 3ABXA 3SN4A 4QTGA 4KEVA 4UFLA 2GSJA 3B04A 4W87A 5LYRA 1NOFA 1B90A 3E3HA 4NIRA 2EPOA 2OWCA 4BF7A 5TAOA 4C6LA 1H5YA 2VR5A 5A94A 3CUZA 4D6CA 4X63A 2O7QA 4W5UA 3FLUA 3C0SA 3M0JA 2HMCA 5D9NA 3WLPA 1HL9A 4LGXA 4PRRA 1TJRA 3QY8A 3PBGA 1WXYA 5H8PA 3AU2A 1S3TC 2IKHA 1ME8A 1F6YA 3EWWA 4NG3A 3N1AA 4W8BA 4IFKB 2ISDA 2E9LA 3T1GA 1ODZA 1XLIA 5DQPA 1GVEA 5HQEA 5DELA 1H7OA 3B97A 1WQ5A 1XXXA 4A8RA 2KZHA 6ALDA 5RUBA 3HF3A 2HPMA 4N42A 4DB7A 3UPWA 3ZSSA 1XJBA 4W88A 4WF7A 1WZMA 3C2VA 4Q7IA 4AWTA 1Q6DA 2WHLA 3W74A 2DIKA 3W07A 3DFOA 3W85A 4CN4A 3N6QA 3QHOA 1S3HA 2BFGA 2F6UA 1LF1A 1ALDA 1DJGA 3D3FA 1CB2A 3ARYA 1W3TA 2FIQA 3RNDA 3RILA 3LHUA 2JKPA 3EXTA 1C92A 1YBQA 3WLQA 4PRTA 4Y9OA 1QT1A 1R3TA 2JQXA 3SY5A 2C1HA 1Z6KA 1KA9F 4GYKA 4JY8A 1DWGM 1GOIA 2DZAA 5F1UA 3R79A 1IEWA 3KL5A 2DT2A 1K9FA 4MJ2A 1T99A 1HNYA 1G7UA 1JZ7A 3RAOA 1V0KA 3BAYA 1FY6A 3RXZA 5C6MA 1UBSA 3W01A 3H23A 4TV5A 1XG4A 3KZPA 5EGRA 2E09A 4ZA0A 3TYCA 1E40A 1ZB5A 4WJ8A 4OGZA 1OFRA 2PDXA 3QHMA 5T26A 5H8UA 4XTIA 1ZHAA 2NX9A 2QCDA 2BOGX 1AW2A 3NA8A 3ZYZA 4LEQA 1J12A 4H9YA 3W2LA 4BQ2A 3WQEA 3HGRA 2V5BA 1S2UA 3HV8A 4UNKA 1F5ZA 2QR6A 4GIAA 4BY3A 3HPSA 3J7HA 1BEUA 4WSJA 2ZE3A 2GUYA 3KWXA 3CPRA 1ITCA 4AWEA 1PZ2A 4AVNA 4PB4A 1H09A 4FF5A 1EO5A 3L12A 3OLGA 3D5HA 3LQGA 3SRHA 4YYCA 1H7XA 5I77A 4NAEB 4HVXA 5I06A 3C8FA 1CIUA 5EMKA 3BL3A 3EAUA 3CHCA 4GISA 1PDYA 1UBPC 4O1DA 1KXHA 3GDRA 3OVRA 2VRQA 3SR7A 2XGBA 2AL1A 3W7DA 3Q65A 3GHSA 1ZRQA 3V1HA 4EE9A 4IL2A 4FNUA 4D1IA 4NJIA 3TVAA 1VEPA 4JTKA 3W6LA 3H2EA 2OJPA 2FB2A 4C7DA 1IQ8A 4IPIA 3LCLA 3P8IA 2O0TA 3H8AA 1R7AA 5E6YA 1TREA 5D4YA 1KBJA 2YDAA 4TX6A 2ZUUA 1TVNA 2J25A 3NGJA 3TW9A 3V0UA 1GUVA 4CCDA 1XPYA 2HNEA 4P8WA 5A8MA 4DJFD 3PZQA 1I45A 3OZOA 3S1WA 5DRIA 4HMEA 5JMUA 3TN3A 4EANA 2PD9A 3H2FA 4IG2B 1A53A 5EBAA 4HZ8A 3V3WA 1UP0A 3DFPA 3EWDA 1QU4A 2WBKA 1IT8A 1TX2A 1UJQA 4IG2A 3ARXA 4HYRA 4H9MA 4R5EA 3WH8A 1V6WA 5A6AA 1NARA 4NRSA 1QUMA 3WDQA 4B2DA 4E4UA 2GUUA 4QNWA 4IMEA 2Y7FA 1LROA 1UA3A 2ABBA 3IK4A 3ONBA 3WL1A 1YLVA 2WC7A 3CUHA 4CCZA 5A6BD 1HF6A 4H9TA 4IMFA 4JHZA 4HJFA 2XJ7A 1UYQA 4GKLA 3H4XA 5B7YA 3NXFA 3LGEA 1V02A 5AHMA 3A22A 2HDJA 1BXNA 1Q6FA 4PRWA 4K6AA 3DFNA 1SO5A 2DT0A 5E5CA 3WD0A 1OK4A 3CGTA 4XD4A 4A6GA 4QE5A 3V35A 4ZENA 1P7TA 2FH6A 4H9ZA 1PUDA 4D8ZA 3DHFA 1MQRA 2FTYA 4KWVA 1UCWA 2JKEA 3V16A 3WLOA 2OZ3A 4DN1A 1GEQA 1AL7A 1MEWA 3LUTA 4IFRA 3NSXA 4EF8A 2GK1B 4DPQA 1S2AA 1V3KA 1BWKA 1QNVA 1XL9A 3KWSA 2Y5EA 4OOZA 4ZQCA 4HSOA 4RCXA 4UR7A 1B3YA 3EBVA 2F9RA 3RITA 4B3KA 4KERA 1XYFA 1YDYA 1SR9A 3W2MA 3I7QA 3UT0A 1EH9A 4ERIA 2L5HA 2YDSA 3NQMA 5ABFA 2QUVA 3V0TA 1P0EA 2WOQA 2NQJA 1HJWA 1NU5A 3I4KA 3PZMA 1U83A 3FJ6A 2PWDA 4R88A 3B8VA 4O0KA 3IGSA 3TOYA 3HFYA 2V3EA 3BLEA 3STEA 4JIRA 2NLIA 3U57A 4O52A 1XICA 3U4FA 3BG9A 1QHOA 3B0YA 5HMDA 2XVLA 2P76A 3TQKA 1WNOA 4MAZA 3QZ6A 1JR1A 2E4TA 3W86A 2Q6ZA 4HT3A 1JYVA 4PL2A 1U22A 2TRSA 2PLJA 4QJ5B 1XLCA 3A21A 3IVSA 4L64A 4DJDC 3T0CA 3L21A 4ORMA 5M1TA 4MF4A 3HQOA 1E5JA 4D8AA 1YPFA 3MVTA 3JRKA 3T0DA 3GXIA 4CUCA 3B8DA 2E5DA 1TV3A 4INFA 3ZR4A 4EXQA 4MLRA 1EA9C 1ZS2A 4ATWA 4AZIA 1DXFA 1W6TA 3U2ZA 1SUXA 3RCYA 1ZCCA 3GTXA 1O1ZA 2PDCA 1JFHA 5I02A 4WDTA 3S2CA 3WLIA 5CBIA 3T78A 1XG3A 3OIHA 1TWWA 1HZYA 3AC0A 1WO2A 3CZJA 2X0HA 3GWQA 1JYXA 1LRTA 1UKOA 1NF7A 4LAMA 2NQHA 3B06A 2QV5A 4QHRA 4R7JA 4F2BA 1LLZA 4KFNA 1EP3A 3CNYA 3KCLA 3RLHA 3BV7A 1YNQA 3VXGA 1DV7A 3CTLA 3M0KA 3T44A 1X6UA 1BVNP 3U4AA 4P61A 5BOOA 3OZMA 4UFJA 4BI5A 2J8TA 2J9ZA 4TX9A 1XI3A 2VCAA 3A5VA 3OEXA 4A3HA 3M5XA 4HNVA 3CZGA 1CGWA 3VMOA 3I6EA 5BXPA 1V3IA 1JPHA 3RM9A 4OBTA 2YBUA 1PVNA 3LOTA 1WDSA 2HNHA 6ENLA 5HULA 3ALGA 4EKJA 1GWJA 1I6NA 4K39A 4QRNA 2WWDA 1TPVA 1DQXA 5C54A 5CSSA 2ZZ1A 2Y63A 3MS8A 3KRZA 2QMKA 1XHGA 1WCGA 4BI6A 2XUCA 5KMYA 3EMCA 2X0YA 4MUZA 1CGTA 3TNOA 1K9EA 2FGZA 4ZB5A 1ZSXA 3BAJA 1XIGA 1ZY9A 2HEJA 3GG7A 3W4RA 2CLEA 1VIZA 2YW3A 3RIKA 4O13A 1VJZA 2F38A 3NPVA 4UQBA 4K7VA 5EKYA 4DJDD 4E3VA 1RCOB 2KX9A 4MY1A 2XFWA 3CYJA 1RLDA 2F2KA 2QDHA 3BH4A 3BO9A 1RALA 2BV9A 2ZVRA 4ZFCA 1ZJHA 3RPDA 1UKSA 3PBMA 1GYNA 3GAKA 1VCGA 3BMVA 3T2QA 2XZ9A 3TLQA 1KM4A 4IISA 1RPXA 4X9SA 5EPDA 4XAGA 5D04C 3FJ4A 1C93A 2OB3A 2QGHA 1V51A 4FLQA 4MJZA 4C7FA 1XIHA 3RK8A 1A0CA 3LHWA 5IRPA 4JTRA 4AD2A 1GYLA 1QI5A 3N6HA 4WCJA 4UR9A 1EQPA 3HG4A 3SY8A 1NDZA 4K8GA 3VU2A 4AQLA 4AXKA 3WJYA 1X7IA 1Q6LA 3UY7A 3N34A 1VYPX 1Z8AA 4EAMA 3V75A 1GYMA 3LGGA 4CVUA 1KCLA 2UWFA 2W66A 1KTNA 5DFAA 1J6PA 2V8ZA 2Y8VA 4JTIA 3VTRA 3WBYA 1E70M 4LYPA 4LQ1A 1TIMA 4PB5A 1US3A 1CPUA 2XINA 5CC7A 4IFOA 4EXBA 2V5CA 5CJMA 1BRLB 3I4EA 4A2SA 4B15A 2XTKA 2ZWYA 4G7EB 3UZXA 2ZC8A 2ZWZA 1DJWA 3D46A 3TJ4A 2R14A 3SUWA 4KEZA 2W4XA 3GHTA 4NJHA 3TW7A 7XIMA 1VFTA 4IOTA 2WSPA 3MI3A 4UBPC 3GVGA 1R47A 1XC6A 2X2GA 3F2DA 3FOKA 4X2PA 3TX9A 5BWFA 3PAOA 3ZM8A 3WNKA 2CKSA 1UR0A 2W67A 1XIDA 4HMCA 3CXOA 4AXNA 3G0XA 4IICA 3WQFA 1B57A 1CLKA 1P0BA 2D3NA 3O05A 4TQTA 1EJUC 1UWSA 3FEMA 1PIGA 3GTHA 4DELA 4K3ZA 4G1KA 2UY2A 2DZUA 4NZCA 2GSHA 4WSHA 2Z00A 3UXIA 4AF0A 3VOGA 2NLYA 2CPUA 2ZFAA 5AHIA 4LUSA 3SQSA 2HK0A 1NH6A 2EQDA 1OHLA 3SURA 1FWWA 3TUUA 4FLRA 2ATSA 3C0LA 4X0VA 2Z1XA 2G3MA 1ZENA 5I78A 3A3HA 1PBGA 3LLXA 2ZA1A 4KGLA 4AY1A 1KCZA 4PUNA 1B9ZA 3R12A 5KZDA 4X2RA 1SO4A 5AC8A 4AD1A 2VRKA 3CU2A 4Q4SA 4KKXA 4IP4A 5JBFA 4ZTYA 1EFZA 5AVHA 5C9XA 1MSSA 1AJ2A 4D6EA 3TSMA 2BWGA 2CBIA 2SFPA 2VD9A 3CZEA 1IZCA 2VEPA 2XSAA 3HGJA 3VNIA 3BK0A 2DU2A 2PP3A 2RDXA 4M1BA 3LRLA 1KR1A 3UD6A 3W71A 2FDSA 3INPA 4FAMA 1FHVA 3CQJA 2CKRA 1OB0A 3WK1A 2ON3A 3IJQA 4Z08A 1T6MA 5HINA 1WKDA 3WD2A 4PULA 4Q4OA 4GQRA 2YA0A 3WEOA 4WZHA 1GPFA 2VELA 3STFA 1QVBA 1LOSA 1ODUA 1QNSA 3F4WA 4HZ6A 5CKSA 3OVPA 2E9MA 1UP2A 3URBA 5KINA 2CBVA 3HPAA 3NEVA 3NZGA 1US0A 4GVHA 4UTKA 1WV2A 1MZHA 3TXVA 1J9YA 5E9XA 2EXOA 3CAKA 3Q45A 3E0LA 3AJXA 4CVWA 2Y7EA 1E6SM 2BBFA 3ARRA 1QOQA 5DRCA 1H61A 1FH9A 2BVDA 3O63A 1N55A 5CGQA 1PPIA 3U2OA 2DVUA 4FX6M 2Z1WA 1EUNA 1SW3A 5FF0A 3OVQA 1U30A 3VX1A 4AZCB 3RMEA 3V0SA 4CD6A 2WHMA 4DQWA 5MHBA 2W5FA 4L4PA 4F40A 1MRAA 1MVYA 3PWGA 5D2WA 9XIMA 4NYUA 5FL0A 5A6KA 1UQYA 2PC4A 2CYGA 1AODA 2CHNA 3U8GA 2V2CA 2VD8A 2G3NA 6XIAA 2Y85A 4LY8A 4NXKA 3H70A 2C7FA 4IPJA 1IWBA 1PJ9A 1L0PA 2V2HA 3DHPA 3BGAA 3M7WA 4K38A 3VA8A 2J7DA 4GZEA 3UXKA 2ZBTA 3BICA 4CNSA 1GKQA 4FB7A 4AIBA 4ZOAA 2GGHA 1G4SA 5C7VA 2XWDA 1VFFA 3CV6A 4FIRA 3CLWA 4AVOA 3I3BA 2J7CA 2QJMA 1ICQA 1XIJA 3QH2A 2ISFA 2R94A 4QQUA 4HOWA 3W7LA 1FCQA 1M7XA 2IKGA 2I56A 4H04A 1TVLA 3R43A 1TUFA 1E9LA 4PBGA 1M9HA 4HCLA 4HNTA 3AISA 4NXSA 1GG0A 2DZWA 1IEXA 3N6JA 1UZ4A 4L9XA 3O7UA 2CEQA 3WBEA 1QW7A 5GVJA 4I8YA 4AY7A 4H4IA 1WKYA 4UTWA 1V6UA 2DSKA 5K4ZA 1GVYA 4R9OA 3DUGA 3IVTA 3T9PA 2R1MA 4S3DA 1XCWA 3ITTA 4XSMA 3FJLA 2QJJA 2PU1A 2J66A 3H2MA 2OPJA 4B16A 3LBOA 3SUVA 3MKVA 4K37A 1ISZA 1XLMA 4UNIA 1RD5A 2H90A 1DJQA 1FQ0A 1AJ0A 1J6OA 4B2DD 1WKFA 5IOBA 2CLHA 3GS6A 2I5GA 1V08A 3COTA 4Z2HA 4D2JA 4R33A 5EFFA 2F84A 4KPLA 3QPZA 1RVGA 1WYIA 4WEVX 5DMYA 2EPMX 3BLPX 1K7XA 4XIMA 3MB9A 4MJMA 3E2VA 2DZTA 5BCAA 1H0IA 2FLIA 3OVGA 1GNXA 4GY7A 4GZIA 4H7ZA 4IP5A 4ZMGA 2PGEA 1Q2RA 1N8IA 3JR2A 1FWIC 1BLIA 2WMIB 1FKXA 3EGJA 2CW6A 1UUQA 4JN8A 2QUTA 4Z0JA 1LLWA 2VO5A 1DJIA 3GHUA 2PDPA 4CCEA 1CXFA 4JTAA 3M46A 1SMAA 4JNYA 1DJZA 2PS2A 4YHEA 1LL6A 4DJEA 3CZ8A 1E9YB 2WNNA 3EOOA 3KM8A 1OX4A 2QCFA 1HKMA 2QW5A 3WY1A 2ZUTA 1V0MA 1GOWA 4JKLA 4Q7NA 5CXPA 5A8QA 1UMLA 1JPKA 1L2UA 1EOKA 2CNCA 5AHFA 1R3RA 3L67A 1TA3A 3W7QA 4B5NA 3R11A 3NOEA 5ENLA 5F2LA 3V36A 3WF2A 2PDLA 4DBSA 3W1UA 2IPWA 4Y9PA 4GZ7A 4Y6GA 3NQVA 3RR1A 1EGVA 1XD0A 3FEQA 4C7GA 3ZT5A 4TVUA 3TN5A 3S5ZA 2OGJA 2WV8A 3G77A 1RBAA 4RE0A 2C16A 3SO7A 2HSAA 2WSRA 1JAEA 1GVIA 3W7OA 1T7LA 3REQB 2GLKA 3QM3A 4GVGA 4OE7A 3TA9A 1NFPA 5K9DA 3TNBA 4C6NA 2ISWA 2QPXA 3KHJA 2ZIDA 3H12A 1YEYA 5F2MA 1CLVA 5I3JA 3E0FA 1EJ7L 1EDGA 3HFTA 4JN6A 2AKMA 3WF1A 1V7AA 3NL6A 4BCEA 1E6XM 4QR6A 3WEMA 3FIGA 3AS3A 3CASA 4CKQA 1E56A 4M19A 4QLLA 3UXAA 1EIXA 3GU2A 5DCEA 2D2OA 3ANYA 1IWPA 2W6RA 2I17A 3QXBA 3UZ5A 4LB4A 3PZVA 4JTUA 1H63A 2W63A 4TU1A 4KCWA 3G1HA 1BGAA 3MUAA 4CCCA 4UFIA 4HMNA 4RNHA 1OQFA 4RK8A 4A22A 1CB7B 3MT1A 1T96A 4QJ4B 2ZXBA 3OG2A 4AD5A 3QN3A 2FZMA 3EPNA 5C2GA 3N19B 1Z44A 3NO5A 2ZXAA 4KCVA 3FX4A 3WK2A 1EGZA 5CZSA 1NFBA 2J75A 2XIJA 1LWIA 2WNQA 2VWSA 3V1PA 1Q8AA 4WX2A 5ABHA 1UD4A 4L1WA 1FP9A 1VBRA 2PSNA 5C9UA 2WPBA 2J8FA 1AJZA 1YHTA 1RBLA 1F73A 1JZ4A 3E6EA 4A3UA 5GNZA 4LVDA 3WDPP 3ITXA 4I7VA 2VGFA 3RJXA 3T05A 3UCDA 4PMXA 3W1LA 1XRVA 2V81A 3TTQA 2A6LA 3WNMA 1J18A 3T4CA 1POJA 3UWQA 4NJJA 1AD1A 3NDOA 1QXLA 2B31A 3U3HA 3VIIA 2GVGA 4GYFA 3EA3A 3W1TA 5FF4A 2X1RA 3NPUA 1CENA 5FESA 3AALA 3P2VA 3TCSA 1G6CA 3F2CA 4IGHA 3WQWA 4R85A 1U1JA 4MPKA 1JD7A 4GUJA 4IX2A 3AXMA 3B9DA 5FAJA 4XKMA 2ZZ2A 3MSRA 1E0WA 1VFSA 3IJ6A 4Q8MA 4MY9A 4GGHA 1N8WA 5AECA 1AMKA 1J96A 5JU6A 3VIMA 2V68A 1EO7A 4PCFA 2WHKA 1UD8A 1D3GA 4GJJA 2CXGA 4PMVA 4J3SA 1VFOA 3DFYA 3KEHA 1OC5A 3CL7A 3AIQA 4Q32A 5A8NA 2V3GA 1GOKA 5DEZA 2Y7DA 4AIUA 4IJRA 4BK9A 4IWWA 5D33A 1V6VA 2VX7A 4EAYA 2CZEA 2IPJA 3AU6A 3S4TA 3VD7A 3TLLA 3DHUA 2RDWA 1SZGA 3B4YA 3GHRA 1NDVA 4RZ4A 1W9BM 1YBQB 5LIKX 3EB2A 3I6RA 4H00A 3SN1A 3B9OA 1F6KA 2YBTA 1MUMA 2ZVIA 3FYYA 1LQAA 3N9KA 2QCMA 1C8XA 1QHZA 4YTQA 4F2UA 1YTDA 2E9BA 4XB3A 1VBJA 4QNEA 1PB0A 1E4IA 3R58A 3N25A 3PN8A 4Q8NA 2E6YA 5CH9A 3UJFA 2D2JA 3TC3A 3DAQA 4GUIA 4QG8A 1THFD 4Q8QA 3TQPA 1FWNA 3MMTA 4BQ3A 1XKYA 3SCSA 4B91A 1CEOA 1OBAA 1G69A 2FVMA 3KTXA 3UJSA 3ZJ6A 4CEXC 2ZUNA 4O10A 2A7NA 1ADSA 4P8UA 4FEZA 2AL2A 3BC9A 4HU3A 3PR2A 1UOZA 2NWRA 3W7PA 1XGEA 1IEQA 1O5XA 4HA3A 1VYRA 4ZQPA 1OIFA 3MTWA 3GAYA 4HPXA 4E6MA 3LZ3A 3UERA 5C9ZA 4CEUC 3KLLA 1P1MA 2REQA 4LCSA 3VCCA 5FEWA 4DI8A 2GVYA 4K36A 1M7OA 3EX1A 3PZNA 1R6WA 1V93A 3L0KA 2WZHA 4P8VA 4LSBA 4JIHA 3W23A 3HPXA 1FWRA 4GQBA 1M3UA 2VFDA 4N4QA 1JPMA 1PWMA 2R24A 3H22A 2PDIA 1LBLA 3TH6A 3NUKA 3WH5A 1LT7A 4GO8A 4NI8A 1T41A 3M6YA 4I3GA 3LMZA 3VKKA 1X7FA 3SUUA 1K77A 4KWOA 4YXGA 3ES8A 4JQAA 1F9CA 2J27A 3ME3A 1EJWC 3LTSA 5FKYA 1NOUA 3NGFA 1Z48A 2Q8ZA 3H21A 1SZFA 1K70A 4JR5A 5HATA 1DP0A 3V18A 4GNKB 3L9CA 2V0TA 2NUWA 3S5YA 3THAA 3THUA 4NJKA 5REQB 3TK7A 4ZQRA 8A3HA 3NQAA 1MZRA 3F7JA 1E71M 4ZO6A 1TWIA 1C3FA 1V03A 4HN8A 1EX1A 1L6YA 1ZCOA 3GIQA 3PJTA 4B5VA 3O9NA 5HPOA 3S9YA 3UJRA 3WQVA 3O2LA 3QPEA 1H50A 4RE2A 4UNLA 3BAWA 1REQB 2XM2A 3UR7A 3VIOA 5KZ6A 2RGMA 4A35A 1CLXA 2GFTA 1EC7A 1XH1A 4OBRA 2X40A 3S3GA 4IQLA 1DWIM 1QMLA 2DVXA 5BRQA 4C1KA 3USBA 1O94A 4YN5A 3KOWA 3AJ7A 5I3KA 4O8RA 4CQ9A 1OFBA 1UC5A 3I65A 1NSJA 3CB8A 2A7PA 4BEQA 1K9TA 1MW1A 3A4JA 1HGYA 3IJIA 4Q8OA 1VKFA 2XH7A 4LAKA 3IK2A 3WH9A 2RDUA 3XIMA 1NWUA 1CXIA 4HMDA 1EHNA 1MXGA 3G1FA 4JTEA 3C56A 3ZMRA 3GNRA 1AVAA 3EKLA 1ZQ5A 1LRQA 3MCOA 2FZNA 4BHYA 1ONEA 5HDRA 3WLMA 1EYWA 3NVDA 1AQFA 3GC2A 1Y5WA 5LNUA 1GW1A 1JUBA 1ITUA 3E38A 3VDHA 2ZE0A 1PTAA 1OD8A 3H55A 2DZBA 1FDYA 4GACA 3EPOA 3OTRA 3A9BA 5LHEA 1Z89A 1K6WA 2WANA 2H8XA 1ZAIA 3DI0A 3OBEA 3TWBA 2OOGA 4LX4A 3N4EA 5TD4A 9XIAA 4DUXA 4US5D 1ZJBA 1HKJA 1KV5A 1LG2A 4UTMA 3SCNA 1BXBA 4NP7A 1ZNNA 3AROA 3CUJA 5LIXX 4D1JA 4HJWA 2P8BA 4D6DA 1KFWA 1RJRA 2OEJA 1JDDA 2V5DA 1WXJA 1HKVA 4NRRA 4D8LA 4KIRA 1JF5A 2CFFA 4MAVA 1V3HA 1E55A 2OMAA 5FJOA 2OSXA 4LCRA 4N9DA 4H8HA 3P82A 3PUDA 5CPMA 3BPWA 4JNZA 2WBGA 3E0IA 4XZNX 4J4KA 1IXPA 3HM7A 3VD5A 4F79A 1KWGA 1OX4B 3EXRA 4QITA 4B9YA 3O16A 3LD5A 1P6WA 2YCIX 2J88A 3H7VA 2BNJA 4EPDC 4L80A 1V6XA 3WFLA 3LTYA 3BAXA 3O07A 4R34A 1VPXA 2ZX9A 1H1ZA 2PCEA 1ZU8A 4CQ8A 4GO9A 4IGNA 4WKHA 1WE5A 1E4NA 1TMQA 1RA0A 1SZEA 2EKGA 4FXFA 3ZFHA 4JIIX 3L5LA 6CGTA 4PTXA 5EMUA 3VZYA 3W3OA 4H19A 5GQBA 1J93A 5U7SA 2WMKA 1KBKA 1T0OA 4REQA 1M6JA 2OELA 4S3CA 1IT0A 1M01A 1XIIA 2OVLA 1NELA 1Q45A 2FHBA 2D0HA 1MW3A 5A8GA 3BARA 3UFYA 3FHQA 1VP5A 1LQ0A 2DSVA 4BJHA 1KQZA 2DSWA 1MDRA 3AXXA 2CWXA 3S5OA 5HUOA 2EBNA 1PKNA 4ROQA 3UWEA 3OPSA 4DX3A 1B3VA 1R38A 5D37A 2QVNA 4EXAA 4QDWA 1Q2SA 1F3WA 1YDOA 3SFKA 2FMOA 2WLYA 3VGHA 4MY8A 4W86A 3MMWA 5DX7A 2HV5A 4JEQA 3OLEA 1LUCB 3WFZA 1A5MC 3BDKA 4TUFA 4V2XA 2HRWA 1BVWA 4S3GA 4N6FA 3DC0A 3W2JA 1BGGA 1W1A1 2WSYA 3QOMA 4UOQA 3P93A 3TIMA 4JXCA 1MEHA 1SU5A 5GNYA 1UQZA 3W2NA 1GORA 4MNKA 3RCNA 4HCDA 1H7NA 1MMFA 2G96A 4UQDA 4ACYA 5D02A 2C8NA 4EK7A 1LZOA 3RJYA 1HTIA 1EBGA 1J11A 4PTMA 1S5VA 3AYSA 3EEGA 3QR3A 2XZ7A 5H2ZA 4JIPA 4AFYA 4RDWA 3W75A 3FXYA 3BURA 4XZHA 2V6AA 5KETA 3PF3A 3G8RA 1B9BA 3WJSA 1G4TA 3GXDA 2W3ZA 1JNEA 5EMYA 3NL3A 2UY5A 3REQA 5I3HA 1DIOA 4IIDA 1W3KA 3DESA 6A3HA 3GQYA 4S3BA 5B80A 1XSIA 4BI7A 1FHDA 3CUIA 3UG5A 5HR7A 3LLDA 2VZUA 5CSRA 1KRAC 2Y89A 4GH3A 1W3LA 1M04A 5TF0A 4NNAA 1ISWA 3FHAA 1NTHA 3QHNA 2YLAA 2EGZA 3VDCA 2BMBA 2GDUA 3H4GA 1FCUA 3DH7A 1EJXC 3LPFA 4D6GA 3HIJA 2ZDRA 1G4EA 2ZXQA 2X16A 2OXNA 8RUCA 3W29A 1UR3M 3WN6A 4Z1BA 4J5NA 2BXVA 2HBVA 2Y7GA 4HPHA 3E49A 1KGXA 5GJPA 1XLLA 3ZOAA 3W2KA 4ATDA 2VC7A 1W1PA 2FPTA 3K8LA 2E40A 3NZQA 2WKLA 4LPCA 1TV4A 2D2GA 2VYOA 2BLEA 2Y4SA 1T8QA 2CLMA 4RDZA 1YPXA 4JD4A 3VGBA 1XLGA 2FFIA 1XW8A 5M17A 3Q4DA 3T4WA 1S2CA 4JGDA 4PMNA 4DJDA 4JFSA 3BQ6A 2VT0A 1KNWA 1E3XA 1LM1A 1BF6A 3B03A 3K8KA 3QC0A 3CIWA 3BE7A 1X1NA 3AMLA 4ZO9A 1VHNA 3UNDA 1VH7A 2Z25A 3I3EA 4EPEC 3N29A 2PZ0A 3VOHA 1H3GA 3SSJA 3VO0A 3RLGA 2R1KA 2V5LA 3M44A 5HA7A 4JFVA 4E2BA 2YCLB 1ZPTA 5D09A 3GC4A 1KQYA 3ABRA 2H9AA 4E3TA 4F0SA 2NUXA 2XFFA 4GFIA 2NX3A 3VKDA 4AYGA 3AICA 1Q85A 2D20A 3M43A 1CXEA 2V5JA 4Q8UA