4PMRA

Crystal structure of the mycobacterium tuberculosis tat-secreted protein rv2525c in complex with hepes (monoclinic crystal form ii)
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
204
structure length
202
Chain Sequence
b'SLGTLLDYAAGVIPASQIRAAGAVGAIRYVSDRRPGGAWMLGKPIQLSEARDLSGNGLKIVSCYQYGKGSTADWLGGASAGVQHARRGSELHAAAGGPTSAPIYASIDDNPSYEQYKNQIVPYLRSWESVIGHQRTGVYANSKTIDWAVNDGLGSYFWQHNWGSPKGYTHPAAHLHQVEKRKVGGVGVDVNQILKPQFGQWA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tat-secreted protein Rv2525c
publication title Structural studies suggest a peptidoglycan hydrolase function for the Mycobacterium tuberculosis Tat-secreted protein Rv2525c.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Unknown function
total genus 79
structure length 202
sequence length 204
ec nomenclature
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08924 DUF1906 Domain of unknown function (DUF1906)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4pmrA00
2DPEA 3BLKA 3NYDA 1UWQA 4FLSA 3U57A 1B3ZA 3VUPA 3PBGA 2GJPA 3WMBA 3TOPA 3EDDA 1U33A 1VB9A 4LQ1A 1W2VA 1E6XM 4AZHA 5A69A 4Z2HA 3VIHA 1GHRA 3CBWA 1DWIM 4UQEA 5BROA 1B90A 1J12A 3N12A 4B9ZA 2V38A 2FH6A 2MANA 4JL2A 1GQKA 4DWSC 1OD8A 4EKJA 2EO7A 3WH7A 2ZX6A 3CUFA 4DWSD 1MWOA 4CD5A 1ZJAA 2YL5A 3EMCA 5A2AA 2WSPA 4WKAA 3TTOA 3CH9A 2Z1KA 4QLKA 2O9RA 3OLIA 1Q6DA 4M81A 3VD9A 1UWRA 2VZVA 3VDCA 4D6EA 1NQ6A 3N18A 4HA4A 1HVXA 4GXPA 1R87A 4PTWA 2D0GA 4Z2LA 4GO9A 1QNQA 1J10A 3VD7A 1O7AA 1ODUA 4PMVA 2J7HA 2Y8VA 5LYRA 2GDUA 1PX3A 3L4ZA 1WE5A 3VIMA 2VRKA 4QCEA 3PZOA 1HJVA 5IHRA 1B0IA 2OSXA 5A6BA 3EDEA 1O6IA 3K4AA 4CD4A 4PYSA 2NT0A 1VRXA 4JFUA 1DWHM 2EPOA 3A47A 2PF0A 2CITA 3MSDA 3EBVA 3PZTA 3RJYA 4H41A 4XZBA 3K4DA 4PMXA 1BVNP 1M53A 1WDSA 2J78A 1KR1A 2G3JA 3UESA 2DSUA 1MFUA 4AZIA 4PTMA 1JIBA 1G1YA 3WF3A 2VCCA 1IV8A 1QHPA 4CU6A 1MVYA 3BAXA 4AD0A 1JD9A 1V3JA 3GYCA 4HP5A 4P7LA 3POCA 4ZXOA 1K9TA 1S46A 4B3LA 4H7VA 3MU7A 2OWWA 3QHNA 5D8ZA 4DWSA 1XV8A 3ZMRA 1OD0A 3GH5A 5A8PA 3N9KA 1EO7A 4W85A 4QDMA 3ZR6A 1N82A 3VIJA 4WIWA 2GK1B 1XH0A 5E0FA 1HKJA 1OGGA 1UOKA 2JF6A 4IM4A 4J3XA 1J11A 5I5RA 1US2A 3N15A 3J7HA 3OB8A 1CGUA 2Y24A 4PUDA 3WMSA 4Z2GA 2IXUA 1V6UA 8CGTA 1UR2A 4X0VA 1SYTA 3ZJ6A 2VVNA 4WSJA 1CXLA 2BXYA 2XUCA 1FFQA 1V3LA 3SUTA 3VOCA 2NW0A 1UH3A 1BPLB 1U2YA 3ZIZA 3PHAA 1UR1A 1Q6FA 4B3KA 4HPGA 1C91A 5I79A 2J77A 3MS8A 1CIUA 1GONA 4UFJA 1RD6A 2XG9A 1VBRA 1BFNA 1CZ1A 3PZGA 1H2JA 4D6CA 4XB3A 1JAKA 5EBAA 4H8VA 3DYPA 2CPUA 2RGMA 2VCAA 1E0XA 4JKLA 2BVTA 1LJYA 3MMWA 1MFVA 3VDBA 1C7TA 5A8QA 1XHGA 2D2OA 2D0FA 4W84A 1M03A 2E4TA 1JZ2A 1JFHA 2QMJA 3SIMA 4LYPA 4J27A 1U30A 2VO5A 3WENA 4CN4A 4P8WA 2HISA 1JYVA 4RE4A 3VX1A 3TTYA 1BGGA 1ISZA 1E4MM 1V0KA 2CHNA 1QHOA 3WEOA 3UEQA 2GVYA 2YA1A 3FNDA 4P8VA 1WB0A 3AMCA 1XSJA 2EJ1A 1KWGA 4P7RA 3VO0A 2ZX5A 5A6MA 1EOMA 1V0LA 3WD0A 3IK2A 4MAZA 4U31A 3TTSA 4Z2KA 2CBVA 2D0HA 1EXPA 5M17A 1UR0A 3DHPA 4PSRA 3ZM8A 2CBJA 4CKQA 1V6YA 1HIZA 2JFEX 1UA3A 1G5AA 1CLXA 4ACZA 3CUIA 5CXPA 1HL9A 1VAHA 3WH5A 4WKFA 4PMYA 1W3LA 3A4XA 2VNCA 3GH7A 3QOKA 5M3WA 4KWUA 5I2UA 1MQRA 1VJZA 1V6VA 5BYWA 3DYOA 3WNOA 4K68A 4AZCA 3ZSSA 2IXVA 1J0IA 2W92A 3CGTA 4J3UA 3WNKA 4W88A 4MB1A 1UKTA 2VTFA 3L4YA 1W1PA 1GOIA 2D20A 1BGAA 1V02A 1JFXA 3CHDA 2WC4A 1PJ9A 2WZIA 5IDIA 1H1NA 2XHYA 1J0KA 3WQWA 5A8NA 3CUGA 1F4HA 1DP0A 5A95A 3AIEA 2GDVA 4YHEA 3WDJA 3GTNA 1JYXA 1YQ2A 2J25A 1EGZA 2WMIB 3VD5A 3L2MA 5ABHA 1QNSA 2XM2A 4CGTA 1W3JA 1UKSA 3SUVA 1UZ1A 4GO8A 5JBFA 1BAGA 4HMDA 5AYIA 3BAIA 2ZUNA 1VF8A 4PUEA 4MNJA 4HU8A 3OG2A 4D6DA 4R5EA 3APGA 5HBFA 1W1YA 2C8NA 2GJRA 1K9EA 3VINA 3A3HA 3AYRA 2BFGA 1I75A 1PIFA 4UZSA 1QNPA 2VC9A 3T2QA 5A6JA 3L4XA 5FL1A 3DC0A 1C8YA 1I1XA 4MDPA 2WC3A 2E9BA 1FP8A 2ZUSA 4ATLA 4X0NA 4EE9A 4D71A 1KCLA 4AZ5A 3ZJKA 1GQLA 3VNYA 3WF1A 5JBEA 4HTYA 2D3LA 1G01A 1KBKA 1MXDA 4LXFA 2G41A 4UNIA 1UR9A 1D7FA 2YL8A 3UG5A 1E1EA 2XWEA 2GFTA 4XX6A 1CYGA 2G3NA 3FY1A 4J3WA 2DDXA 4TVCA 4DWSB 4CVUA 4J3VA 4TX8A 2J47A 3VGEA 4AZ7A 2XSAA 3NCOA 4EAMA 3SUSA 1OIFA 3AHVA 1UA7A 1H3GA 1L0PA 1JZ5A 3OZPA 4LYQA 1WDRA 1ZBCA 2CEQA 3WH6A 1V6WA 3ARXA 4PMUA 2XGBA 1CNVA 3NSMA 2OWCA 1ZJBA 4HPHA 4AISA 1B31A 2XSBA 2Q8XA 2UY4A 1JI1A 1BLIA 1L8NA 1PZ3A 1H41A 2WLZA 1XD1A 4JAWA 2ZUMA 1NWUA 3PTMA 5HPCA 4Z2IA 1QI5A 2ZXQA 5CG0A 1XYZA 3CO4A 4GQQA 2BY2A 3SCOA 4MB3A 1RP9A 1GOMA 2FGZA 1WNOA 4CD6A 2CYGA 3CPUA 3THDA 3SUWA 1R85A 2BNJA 3QGVA 2WMFA 2DEPA 3WL0A 2JEPA 3W6LA 1Z32X 4KRTA 1BYAA 2E8YA 2VQUA 4FF5A 4OOZA 5D4YA 1NARA 2WPGA 2VUYA 3AIRA 5E09A 4GQRA 4V2XA 1FP9A 3BXWA 3WQ8A 1ECEA 3KEHA 1ZBVA 1JDDA 2OSYA 2YA2A 3DECA 3UCQA 1VENA 1NOWA 1GNXA 2DGAA 1TG7A 2UY5A 1JZ7A 1OGSA 3NSXA 1E72M 4D6GA 3VIGA 1PX8A 3L4UA 4HA1A 5ABEA 1G94A 2F8QA 4GKLA 2XVPA 3AS0A 2DT1A 5JIPA 1E4LA 5ABFA 3OGSA 1W1TA 3FW6A 1UHVA 2VRQA 1LWJA 1CECA 4UQAA 4UOJA 5HNNA 3MUIA 3BAJA 1TVPA 4IISA 2DSKA 1ODZA 1J01A 1IZJA 1IT0A 2V3GA 2DSVA 2EPLX 4HU0A 1OGBA 1X6NA 4OUEA 3WSUA 1H0IA 2Y5EA 1E6RA 1NWRA 1TR1A 3WL1A 3W6MA 1B3XA 4W5UA 4LYRA 3RMEA 4D6HA 3ARSA 2E9MA 3VD4A 2J74A 7TAAA 5IFTA 2WSKA 1VFUA 3NDYA 3BLPX 1JL8A 3GH4A 5EFDA 3I3DA 1JZ4A 2X2YA 1UWSA 1VBUA 5FKYA 1MQQA 1UD6A 5BXTA 3A4AA 2UY3A 3VMNA 2XWDA 3ZOAA 4BQ3A 5CPSA 4JFWA 2WVVA 3SCTA 1NP2A 2XTKA 1ZBKA 4TOQA 5I23A 1ZB5A 3VIIA 1C3FA 2OLHA 3WNPA 1CTNA 1WDQA 1BVZA 3AMDA 3ALFA 2PWGA 3I3BA 3K46A 3VM5A 3VMPA 3PN8A 4HMCA 4AZCB 3W27A 3RPMA 1FHLA 1E70M 1EHNA 2J4GA 1WAWA 4C7DA 2WHMA 2VZUA 4JZ5A 1V3MA 2EBNA 1G9HA 2YL6A 3AROA 1E15A 2J7GA 1UR8A 1E43A 2V3EA 3WD4A 4CCCA 1GUVA 3UG3A 2EPNA 2XFRA 1R7OA 2WZHA 1BF2A 3LPGA 3WIJA 3FXYA 1X1NA 1MW0A 2ZOXA 4H2CA 1GJUA 2DIJA 1KXQA 2O9TA 3AXXA 3WUFA 1RPKA 1R86A 3BMWA 4MNKA 3SCSA 3IJ8A 4FLOA 1JZ3A 4PCSA 3PZMA 1J0HA 5KEZA 2J62A 4U33A 4W86A 4DM1A 3L4WA 1CGTA 3SCNA 3POHA 1TA3B 4JKMA 1E6SM 2CKRA 2VX6A 5CSYA 3JUGA 3LPPA 3T09A 1W9BM 2VR5A 1V3IA 3THCA 4AW7A 3VDHA 1HJQA 2BVDA 2ZX9A 3GNOA 2C7FA 3WN6A 1ISVA 2XGIA 1E0WA 2ESCA 2YLLA 5DEZA 4DM2A 3GXFA 2YDQA 4F66A 5A6SA 1XCWA 2WVTA 1ITCA 1UD8A 5KZ6A 4U5KA 1E6PA 3ZJ8A 2ZUVA 4BQ5A 1K9FA 1QW9A 4MB4A 4HOXA 2HVMA 1NOFA 3AHXA 3AS1A 1QW8A 2E8ZA 1PZ2A 2EXOA 1EHAA 3T0DA 1PPIA 1NP0A 1QOXA 1KCKA 1X6LA 4CN1A 4MAVA 2YL9A 3MKKA 4TVUA 3WY1A 3U7BA 4J7RA 1HKMA 7CGTA 1HKIA 3KWXA 5A2BA 2XVKA 2WCSA 3IAPA 2WMHA 4QFUA 1XC6A 2XFFA 2WBGA 2W4XA 2WMKA 1E1FA 4AD3A 2AMGA 2VR4A 4QLJA 3VVGA 4OOUA 3M07A 3UETA 3VGHA 1E5JA 2CXGA 3WDPP 4D6JA 4U2YA 1UKPA 1QBAA 5D9MA 3NIYA 4P7QA 3TTQA 1DEDA 1HNYA 1HJUA 3IANA 2XFYA 4M8UA 1K9DA 5CGMA 1E3ZA 3T2PA 4AYSA 1XH2A 4CD7A 2RGLA 1ZU8A 1DWAM 1WZLA 5BWFA 4D6FA 1XRVA 3WNNA 3KL0A 5I77A 5FOOA 1E6NA 4F9JA 2XVNA 3CTTA 2CCRA 1ISWA 2NT1A 3W0KA 1SFSA 1HL8A 1E55A 2EPMX 2CERA 4RL3A 3TA9A 3EMZA 3GNPA 3PZ9A 1UD5A 4UFMA 1W9DM 1QBBA 1GQJA 1GOOA 4W7WA 2A3CA 2YLAA 4UQDA 3BMVA 3PZNA 2ZXDA 4D1JA 4L4OA 2E9LA 3PTKA 2ZUTA 3TONA 1CPUA 2WW5A 3WFZA 2X0YA 3BSHA 5DFAA 2WCAA 3AHYA 2PWDA 2DSZA 5BCAA 4BF7A 1VEMA 3AZRA 2WNWA 3WD1A 1H11A 5HPOA 3BAKA 3T2OA 1H4PA 2GJXB 3BCDA 1VIWA 3G6MA 5AC5A 5FIPA 1HX0A 1QI0A 1XGZA 3RJXA 4NSBA 1W32A 3K8KA 4J3TA 3SURA 4P7NA 3L4TA 1E9LA 3VIPA 3ARTA 2BXZA 4NRRA 3VIFA 3KZSA 2WZEA 3FHAA 3WUGA 1YHTA 2J7DA 3WD3A 1UQYA 1LL7A 1W91A 3W53A 3RIKA 4ZE5A 3T08A 1UD3A 2XIBA 4FK9A 2OYKA 4KRUA 3MUAA 2WBKA 2ZX7A 3MMDA 1OIMA 3QR3A 2WVVB 3KL3A 4PRWA 3ZJ7A 1PX4A 4TTGA 5E6YA 1W9PA 4BCEA 5HOSA 3W28A 2WB5A 3AICA 1DWJM 1KR0A 1KXVA 2EPKX 3IJ9A 1HXJA 4CU7A 2X0HA 3ECQA 1R7AA 1W3HA 1CWYA 3ZO9A 3AMGA 1XD0A 3CMJA 4QAWA 5E0CA 4JFTA 4AZ6A 2BVYA 1E5NA 3L4VA 3OGVA 4GIAA 5IXEA 1GW1A 2PBOA 3WDHA 2YDRA 1TZ7A 2DH3A 2ZWYA 3QHOA 4R27A 3WF4A 3AIQA 3U7VA 4IPLA 4CUCA 3ARQA 3CZKA 4WSKA 3GZAA 5GNZA 1OM0A 2TAAA 4OZOA 2BY1A 4PMRA 4EK7A 3WELA 1JZ8A 1TE1A 3WUEA 1TVNA 4B16A 4H04A 1E56A 3VNZA 1XH1A 3II1A 4V28A 1UR4A 3I3EA 2DIEA 2FHCA 1VJSA 1VFOA 4NZCA 3N17A 1OT1A 1W2PA 2XVGA 1LG1A 4GI8A 5A1AA 1FOBA 1ZL1A 1HN1A 3VTRA 2BV9A 3WF0A 1FH9A 4J28A 4YN5A 1KGUA 1LG2A 1VFFA 1WZAA 3B9EA 4AD1A 5DT7A 4E8CA 1EOKA 2A3EA 3CHEA 2BHYA 3A4WA 1LLOA 3HJEA 1JNEA 3IJ7A 1WKYA 1OBAA 2YA0A 2G4FA 2ZX8A 2A3AA 2PBGA 2JEQA 1QPKA 3W25A 1VFMA 4U3CA 2VX7A 3WDQA 1V6XA 5I0DA 3ZR5A 2OWXA 2YIHA 5A8OA 3WBAA 3CZGA 3AQUA 3WD2A 4F79A 2CHOA 2W62A 1TCMA 4MB5A 4W8AA 1CGWA 3NUKA 2PWHA 1V0MA 5GPRA 2Z1SA 1PEZA 4AZGA 5BRQA 2VQTA 3AIVA 4MJ2A 1WCGA 1W9XA 4W8BA 4WLCA 1M01A 3RCNA 4UOZA 5GNYA 4EANA 1QI4A 1HJSA 2EQDA 4PMOA 3K8MA 1LQ0A 5FL0A 2VX5A 5A8MA 2O92A 1KB3A 5C70A 2CESA 4PN2A 1HVQA 1GOKA 4FLRA 5DT5A 5D9PA 1TMQA 1LWHA 3AS3A 2WHJA 1CGYA 1CGVA 4HA3A 1GOWA 2UY2A 3CHCA 3AJ7A 1KXTA 2XJ7A 1DWFM 4AD5A 1UH2A 1C93A 1C8XA 3GNRA 1ESWA 4CCDA 3SCVA 2A3BA 1HP5A 4N0RA 4KMQA 5CJ5A 4BQ4A 5BXPA 4FLQA 1UH4A 3AZSA 1EH9A 3NSNA 1BYCA 2GK1A 1Q6CA 4TUFA 2D1ZA 4Q7NA 3IAQA 3MV01 2CKSA 3WKZA 1WO2A 1E0VA 1UQZA 4OBSA 2E40A 1JYWA 2W66A 1J18A 1D3CA 3AHZA 1J9YA 3W37A 4XZWA 4S3KA 1GJWA 1CBGA 3K8LA 3W24A 1OB0A 1SMDA 3AHTA 2VJXA 3OLDA 1B3YA 4QP0A 5E9AA 3MUY1 2YDSA 2YKKA 2G3MA 3M7SA 1OWQA 1GORA 4JFSA 2VOTA 3WF2A 1GCYA 1GOQA 2XM1A 3OA5A 4E4PA 3CUJA 1CEOA 1I1WA 4P8UA 5CLTA 1B3WA 2DQXA 1LF1A 1AQMA 3PZQA 3WBEA 4C7FA 1QI3A 1UG6A 4URIA 3KL5A 3EMQA 3ZT5A 4JIEA 2OSWA 1GQIA 1LL4A 4XUYA 2C0HA 1WP6A 3U5UA 2FHFA 4PMNA 3FAWA 4WF7A 3WH9A 5GQBA 3W4RA 4MJ4A 3WDRA 3HU7A 3TP4A 2VZOA 5A94A 4ACZB 1EDQA 1LL6A 4LGXA 1B1YA 2PWFA 3F5JA 3BCFA 4V27A 2E0PA 2IUZA 3VILA 4HZ7A 3GXIA 2CBUA 4CN6A 2BY0A 3E1F1 2AAAA 2W61A 4TX6A 2D23A 3OBAA 4A3HA 1E6QM 1VEPA 3W26A 2QV4A 4B15A 4W89A 3VGFA 1GPFA 3AMKA 4PCTA 1FH8A 4JKKA 2VT0A 1CXHA 1V3KA 2YBUA 1EDTA 5M5DA 1MW1A 1JXJA 4KH2A 6TAAA 2X8RA 5CPQA 1CXEA 3T0AA 2D3NA 5EMYA 4HMEA 3D5HA 4DUXA 3PZIA 1EA9C 2V3FA 2Y8KA 1V02E 2WKLA 1H09A 2J75A 4WKHA 2V5CA 4BZYA 2A3HA 1DWGM 4P7OA 1E71M 2VMFA 2QHAA 1EQPA 3DYMA 1J0JA 5A6AA 1EO5A 5CPTA 2WLYA 1PBGA 1Q4NX 1GVYA 6A3HA 3VU2A 1E40A 4P8XA 2UWFA 2ZIDA 3MANA 5DO8A 2VL4A 5E70A 3S2CA 3VGBA 3MUZ1 1BSIA 4W93A 4UFIA 3AIBA 5A6KA 8A3HA 3RDKA 4AD2A 1QNRA 4UOQA 3PZVA 3EDFA 2PWEA 1V03A 2WAGA 3SUUA 5CZKA 2BS9A 5AYBA 2F61A 1EDGA 5I78A 4ZEPA 2ZUUA 3ARWA 1BYDA 5EB8A 2WMIA 3VX0A 1TUXA 1E3XA 1K6AA 1PAMA 5CGTA 1WZKA 3AYSA 3VPLA 1UWUA 4AEFA 2VI0A 4Q22A 4UFLA 4TVDA 3WQVA 4D6IA 4AD4A 3SCQA 2WCGA 4AXNA 2O9PA 4W8LA 1E73M 1KXHA 4M24A 3EYPA 1E4IA 3BAWA 3VD3A 1WDPA 1NWSA 3N11A 1CXFA 2FGLA 5ABGA 5LA2A 2X1IA 3UG4A 4TXEA 2J7BA 1JDAA 3OIHA 2O9OA 1Q6GA 1ZBWA 3GXDA 5LA0A 2D24A 1JF6A 3NJ3A 2GSJA 4GI6A 1R8LA 2Y4SA 3CMGA 2WKGA 2CBIA 4HZ6A 2BHZA 4M1RA 4AWEA 2G8ZA 2D22A 2E3ZA 4YPJA 5F7UA 4MPKA 5IFPA 2FDMA 1RP8A 2QPUA 2WM0A 3NDZA 1UKQA 4CVWA 4A4AA 2ZWZA 3HN3A 1JYNA 3AIUA 4E8DA 1E6ZA 3RILA 4C7GA 3WNMA 3SCWA 4JL1A 3AS2A 3F5KA 1US3A 4A3YA 2FHBA 3MV11 2WWDA 1XCXA 4ZE4A 2YJQA 5LA1A 1XSKA 1BG4A 3OLEA 4UR9A 3OGRA 1UWTA 1W1VA 2QF8A 2VURA 1HJWA 3VIKA 1QHZA 2W91A 3AI0A 2ZE0A 3FAXA 4FMVA 4OJYA 1KBBA 1KFWA 4MDOA 3FHQA 1FH7A 2DSWA 5JBDA 3N04A 1HJXA 1V08A 4QLLA 4BQ2A 5ABFB 2JALA 4E2OA 5M03A 1NWTA 1QI2A 3LPFA 1KWKA 1VEOA 1V0NA 3ALGA 3T0BA 3O2LA 2NSXA 4JHZA 3VM7A 3BH4A 3RM9A 2XPKA 4J3SA 4AEEA 4WK9A 5D9OA 4LPCA 3L2LA 1OT2A 1G0CA 3RM8A 5HXMA 4F8XA 3AISA 1WPCA 4U5IA 4S3JA 3WQ4A 3AZTA 1BHGA 2WXDM 4DUVA 2DT3A 1DTUA 7A3HA 3SCPA 3GBEA 3CZEA 4W7UA 3ARVA 2BHUA 3CLWA 4JHOA 2J8GA 6CGTA 3LMYA 1J0ZA 3O9NA 2JE8A 4UQBA 1CLVA 1XYFA 3ARYA 1JD7A 3CUHA 3SCRA 4NF7A 2J7CA 3CZ8A 3BGAA 3WDIA 3AFBA 1HKKA 2WYSA 4GZEA 1MW3A 3CZLA 4GZIA 1KGWA 3BC9A 1WZMA 5A2CA 5EFFA 5JUVA 1C90A 4UFKA 4RE2A 2FH8A 3ARZA 4AIEA 2W63A 1BG9A 1CXKA 4UZUA 4PTXA 4AMCA 1FHDA 4ATWA 1JGIA 1SMAA 1HT6A 3PTQA 3VGGA 2DH2A 2VRJA 3WNLA 5A6LA 3UR7A 5TD4A 4UQ9A 3OLGA 2WVSA 2Y2WA 1V3HA 1ZS2A 4U3AA 4W7VA 3A6OA 4W5ZA 2F2HA 2ZXBA 3KE0A 1W9UA 3GDBA 5BRPA 3UR8A 2GUYA 5IHSA 2BY3A 4AIOA 2WANA 4HOWA 2YBTA 1Y7VA 4N42A 1NH6A 3QHMA 1AQ0A 1TFVA 1UZ4A 1JF5A 2OYLA 4MNMA 4H8HA 3WQ6A 2WMGA 1PIGA 1A47A 4D1IA 3ZT7A 4M82A 5FD0A 1IZKA 2AOSA 3AIWA 3BAYA 5FCZA 4MTVA 4UCFA 5CLWA 3MMUA 2PB1A 1CGXA 4LX4A 5DMYA 1BYBA 3VKKA 4F9DA 1ISXA 1HP4A 4BA0A 1KQZA 3M6DA 1JG9A 3AXIA 1M04A 1D2KA 4HZ8A 5I3DA 2JF7A 1RH9A 5AY7A 4UFHA 2XIIA 1OCQA 4M29A 3WMCA 1QVBA 3FN9A 4PMZA 2DT0A 2WK2A 3AOFA 4ZXLA 1JI2A 4Z2JA 3S6TA 5BXSA 1FFRA 1JNDA 3N1AA 2WHLA 1TA3A 1UWIA 4PSPA 1EQCA 2QMKA 1B30A 3N13A 1MXGA 4NI3A 2J79A 4TTUA 3VDAA 4AIUA 1MQPA 1CENA 3ARUA 3W81A 5I6SA 3ZQ9A 2X09A 3WQ5A 5BXRA 4H8UA 3UERA 4ML4A 3SCUA 2ZICA 3VGDA 3WUBA 1CDGA 4GI9A 3D3AA 2JIEA 1H49A 4AC1X 1JZ6A 1UUQA 3QOMA 2PC8A 2OYMA 1P6WA 3W29A 2QLYA 4ATDA 3PZUA 4DUWA 4ACYA 2YOCA 3B9DA 4OBRA 2CNCA 2V5DA 3B9AA 2XYLA 1JAEA 4OKDA 3WEMA 4CD8A 2B31A 5DF0A 2XVLA 1MYRA 1OINA 2QPSA 3RM4A 5A3HA 1MW2A 2CETA 2DT2A 3WH8A 2WHKA 2J8FA 2W67A 4YHGA 3F5LA 1SR0A 1BQCA 2G3IA 2J7FA 5I24A 3M46A 4HOZA 1KGXA 4XV0A 3WEZA 4B9YA 5C8BB 1ITXA 1KQYA 2V3DA 1JDCA 1XSIA 4RE3A 4JFVA 4UQCA 3GM8A 2ZXAA 4Y7EA 3RO8A 4JCLA 3EDKA 4D72A 5CSUA 1ISYA 2VCBA 4U2ZA 2WC7A 5HDRA 2W5FA 9CGTA 1NM9A 2VX4A 2ZUWA 5AC4A 4PEEA 4M56A 3B8SA 3VIOA 1W9VA 5E6ZA 1JXKA 1B2YA 1UD4A 1Q6EA 4W87A 4QCFA 4OIFA 3VMOA 1OSEA 1GZJA 4M80A 1C7SA 4BS0A 2J7EA 2WWCA 3F4VA 3CHFA 1DHKA 1M7XA 2EEXA 3CZJA 1A3HA 2VVSA 1C8QA 1B9ZA 5GNXA 3AXHA 4CU8A 1GHSA 4X9YA 2X05A 3ARPA 1GVIA 1UYQA 3MO4A 3BSGA 4PMDA 3ARRA 1E4NA 4MADA 2WMJA 4KGLA 4PMQA 1QNOA 4WJXA 4CCEA 4KGJA 1UD2A 4JCMA 2GJXA 4PTVA 4GZJA 3ZSTA 4MNLA 1EIBA 2JIWA 3GBDA 1J0YA 3U5YA 1NOUA 5CQ1A 3GXMA 3K1DA 5JIWA 2WVUA 1CXIA 4GPNA 4L4PA 4ZENA 3DHUA 1H5VA 4AY1A 1AQHA 4PBGA 4GINA 1F4AA 3W82A 4NRSA 3O6AA 5D9NA 2PI6A 3LPOA 5D8WA 4IPNB 3EDJA 1FA2A 1UKOA 1HF6A 3MSGA 1AVAA 3AMLA 3OZOA 3W38A 1B3VA 1C92A 5ECUA 1AMYA 4AZBA 3G6LA 2VZSA 1BTCA 4IUGA 5A6BD 3HMCA 1W3KA 1H0GA 4UTFA 5C71A 2VZTA 3SEPA 3ZT6A 2CIPA 3CIVA 4ZFMA 3WFLA
chains in the Genus database with same CATH superfamily
3DN5A 3RU8X 3DGRA 4Q8QA 4HBKA 1P48A 1SW0A 4K37A 3M0YA 1EZ2A 4O1EA 2LLEA 5A69A 3VIHA 4JDYA 5BROA 3N12A 1VIZA 2FH6A 2MANA 2FQIA 4BI5A 3N14A 3WH7A 3GSMA 2ZX6A 4P5UA 1FWNA 1Z44A 3AYVA 3HV8A 2GPTA 3EMCA 5A2AA 3TR9A 4WKAA 3NQBA 1X8FA 3PANA 3NXFA 1Q6DA 3R12A 1RCXB 3MBDA 3LHTA 3FDKA 1XQLA 3N18A 4MKNA 4HHHA 3V36A 2Z0IA 3PAOA 4GISA 3UVIA 3WLSA 4K36A 1O7AA 4IQJA 2J7HA 1X1ZA 2Y8VA 3WQDA 3L4ZA 1WE5A 1EJVC 5E1QA 4I7WA 5E5CA 4TO8A 3SZ8A 3WMLA 2FB3A 5IHRA 3K4AA 4V1YA 3LLDA 1M7OA 1VRXA 4JFUA 3W74A 2EPOA 3LHZA 2CITA 1R9XA 2E68A 1SPQA 2OGYA 3UJFA 1EJTC 1YE4A 4RXFA 3TYAA 3LXBA 3UESA 2DSUA 5LSMA 4AZIA 4PTMA 1S2CA 3BDKA 1ML1A 1XIIA 3DG3A 1QHPA 3LU2A 1K9TA 4D9PA 1XJBA 4H7VA 2OWWA 3QHNA 5D8ZA 2BOFX 1OD0A 4L64A 1EO7A 5I07A 1BD0A 1N82A 3VIJA 3O07A 2NQ5A 1XH0A 3NO5A 1O5XA 5I5RA 3TAKA 4MFDA 2X0SA 2POTA 2OOFA 3A13A 3ME3A 1RPXA 3DIPA 2Y24A 2ZFAA 4Z2GA 1V6UA 4Q4SA 1UR2A 4GUGA 4UTIA 3H2AA 3S1UA 3N9SA 3ZJ6A 2VVNA 4B90A 3O06A 4HJWA 3V3WA 1FFQA 2PD5A 3SUTA 1JJKA 1BPLB 4LBRA 1UR1A 2ZZ2A 3H2NA 4ICNA 5C2XA 2RDXA 3BG9A 4A8LA 3R4IA 1VC4A 4YCPA 4Q4RA 1Q8JA 2FVKA 1CZ1A 3G3MA 3QPZA 1TIWA 2QUMA 4H8VA 5ENLA 1YIXA 3GY1A 4AHPA 2Z1XA 2V68A 3RYSA 3SECA 1WBJA 4GC4A 2PWVA 4KCUA 2VCAA 4NJKA 4G7EB 2QAPA 1PIIA 2VM8A 4XKYB 4JKLA 5LNWA 2BVTA 2QDHA 4FZIA 1C7TA 2R94A 3DOPA 4IH3A 1TWWA 1JUKA 3RLGA 2NWSA 2HISA 1VPYA 4C6NA 4K39A 2QR6A 3TTYA 1BGGA 3W76A 1E4MM 2CHNA 3MP4A 2MUCA 3WEOA 1KCZA 2GVYA 4PFHA 4Y90A 3AMCA 1XSJA 1QNVA 4P7RA 2Z25A 3IK2A 4MAZA 4U31A 2D0HA 2CC0A 5M17A 4DNHA 3DHPA 1CX9A 3VZZA 2X1SA 1PHWA 3IEBA 2JGQA 8TIMA 3T8LA 1HIZA 1WXJA 1G5AA 2ZZ1A 1XLAA 2BWGA 1VAHA 3EPNA 3EZ4A 1FWDC 5JMUA 1W3LA 3CQIA 3A4XA 3QOKA 2BMBA 2AMXA 1FCUA 3VKCA 1UPPA 4E2VA 4GUIA 2XH2A 1V6VA 3KCJA 5BYWA 2YCJA 4GQ0A 3GC4A 3DYOA 3WNOA 1W5PA 3ZSSA 4WGXA 3CGTA 4W88A 5C7HA 3L4YA 1KRBC 4IX0A 3IARA 1EJWC 3Q58A 4OQVA 2A1YA 1EX5A 4O0ZA 2OEMA 5IDIA 4IGNA 2HROA 2XHYA 1J0KA 1DP0A 1HGYA 3ANYA 1B54A 5C55A 3GTNA 3BLOA 1HTIA 1ITQA 4X2PA 4ECLA 2J25A 2PTXA 3GHRA 1N8IA 3QLLA 3VC5A 3C61A 4IWWA 2PZNA 3RR4A 1UKSA 5JBFA 3IRDA 4HMDA 3DFYA 2ZUNA 1DJIA 4MNJA 2SFPA 4D6DA 3UY8A 1XLLA 2C1HA 2DU2A 1A5OC 1XICA 1W1YA 5K4XA 3LV5A 1R0MA 8XIMA 1RA5A 1F07A 1TTIA 5FL1A 1XUZA 1HGWA 1C8YA 3KDOA 4X0NA 4AZ5A 3VNYA 2O55A 3WF1A 5JBEA 4HTYA 1W6TA 2D3LA 4Z1CA 1SZEA 4O4VA 4LS0A 3KP1A 1OADA 4JIHA 6TIMA 1UR9A 1D7FA 1ZP3A 3EEZA 1KBJA 2AL2B 3UG5A 4XSMA 1E1EA 1JGMA 2GFTA 4LS1A 2G3NA 3VKAA 1EJ7L 3FY1A 2DDXA 4TVCA 4DWSB 4B2DD 4J3VA 2CXEA 2XSAA 3NCOA 1ELSA 1TRIA 4WOZA 2R24A 1L0PA 4E4UA 1JZ5A 3OZPA 4LYQA 3BANA 3LCGA 1V6WA 3ARXA 3MTWA 2QCMA 4IMFA 3NSMA 3PP7A 1DPMA 4HPHA 1L8NA 1H41A 2WLZA 3P2VA 2ZUMA 2VD9A 3HPFA 2DZAA 3HG5A 3SCOA 3TQPA 1OABA 1GOMA 4GNKB 2YZRA 3NTYA 2FGZA 1WNOA 1E9YB 4DLMA 1YMYA 2CYGA 1JCNA 3NZ1A 3CPUA 1R85A 2DEPA 2JEPA 3W6LA 2IPWA 4MUPA 3W1XA 5LIKX 2I9UA 5D4YA 3GR8A 1NARA 2WPGA 5FEZA 3AIRA 3D6NA 4A2RA 1FP9A 1TKKA 2Z1WA 3U2EA 4MG4A 3KEHA 4E2DA 1SW7A 2FZMA 4MJMA 2OSYA 4UTLA 3DECA 1HQTA 4JICA 2YB4A 5BOFA 2UY5A 1TG7A 3SM0A 5H8MA 4XK2A 4D6GA 3VIGA 4HA1A 1H1YA 3TMQA 1FWBC 3AS0A 2DT1A 3CT7A 1E4LA 2V67A 5ABFA 2FTYA 3OGSA 3NQ7A 3H22A 1IXPA 4EVZA 2BASA 2VRQA 2WJDA 1CECA 4UQAA 1GEQA 3OVPA 3CV2A 2DSKA 3CNYA 1J01A 1IZJA 1IT0A 2Y5EA 1G4PA 1B3XA 2IQ0A 7TAAA 4EPBC 3NDYA 1Q6OA 4JQAA 3ENLA 1JL8A 3GH4A 2W9MA 3FA5A 2QCGA 1WKDA 3QV6A 5BXTA 3A4AA 4I7UA 2XWDA 4OBTA 4JFWA 3UD6A 1KRAC 1NP2A 1ZBKA 4TOQA 1F3XA 1REQA 1C3FA 1EC7A 4I6KA 2PWGA 2JKPA 5FSEC 1F74A 3C56A 1VKFA 3THUA 3RHGA 1E70M 1EHNA 4CCZA 3AUJA 1IF2A 1XIBA 2EBNA 1G9HA 2QQ6A 2J7GA 3GXNA 1RBLA 2QXWA 3PSWA 3KX6A 3WD4A 1AZ2A 3M43A 2EPNA 2XFRA 3G18A 5CBJA 3BV4A 5CZ0A 3Q4DA 1BF2A 3B05A 3MVTA 3GUGA 3N4EA 4Q6XA 4F2BA 1X1NA 2DIJA 3CB3A 3BURA 4M51A 1H5YA 4J2MA 5CAHA 1EP1A 4UTWA 2Y63A 4FLOA 4CNOA 1IEXA 5F4XA 4OFCA 1J4EA 1TRDA 1WYIA 4PB4A 3PY2A 1TA3B 2OQLA 1XKYA 3K1GA 1KM5A 4GY1A 1OFRA 1U22A 3JUGA 3LPPA 1VR6A 3T09A 1CB7B 3BOFA 2YCLB 1Z6KA 2C7FA 2XGIA 5BWAA 3T07A 3STFA 4RK8A 2PA6A 4S23A 4UUIA 5MKGB 3WQFA 3P0WA 4E5TA 1E6PA 1RJQA 3OBEA 3AS1A 4WHBA 3WBWA 2ZA1A 2FTPA 1GTEA 2PDGA 4XAFA 2Z4GA 3ZYZA 3W1LA 2KX9A 1RAKA 2YL9A 1AFSA 2VDGA 4TVUA 4XAPA 3KWXA 4L4LA 2NXHA 4HNNA 3WLNA 4KKXA 2WCSA 3LM7A 1X8CA 4ORIA 3UZJA 3GD6A 2VR4A 4Y9NA 3CL6A 3WCZA 4F0RA 4OOUA 3N2BA 4IG2B 3BOLA 4H2HA 5LHFA 1ZJIA 2IW0A 3DESA 1F2JA 3B0UX 3TYDA 1UKPA 1QBAA 5D9MA 3FYPA 4ZTYA 3B4YA 3IGHX 2GGJA 4FNRA 3TTQA 1HW6A 3HFTA 1HNYA 4W4QA 5CGMA 1E3ZA 1XC4A 3JRKA 1XH2A 4CD7A 5FEWA 2OZ3A 1XRVA 2QF7A 5AC7A 3KUMA 4F9JA 3CTTA 2Y7EA 2NSOA 4DJEC 3IPWA 2NT1A 4JS3A 2CZVA 4IGSA 3C2EA 2EPMX 2HEJA 2J9ZA 2CERA 3EMZA 4O11A 4UFMA 3SN1A 1W9DM 4JN6A 1GOOA 2YLAA 2GQ8A 3WQPA 4XO7A 1UMYA 4D1JA 2E9LA 2H9AA 1EUAA 2DQWA 2ZUTA 4G8TA 4TU1A 3IUIA 3HGJA 5DFAA 1J8VA 1W3NA 2PWDA 2DSZA 1VEMA 1PO9A 4TR9A 1GJPA 2GJXB 3G6MA 3UU0A 2DUAA 1QI0A 4FB7A 1XGZA 3RJXA 3T42A 5CSSA 3K8KA 2ZTKA 1Q6RA 4JGDA 4P7NA 1YRRA 1HKWA 4AFYA 4V33A 5KTLA 4UIOA 5FF2A 1I2NA 1W91A 3W53A 3REQB 1LWIA 4ZE5A 2OYKA 3LTYA 3MA8A 2ZX7A 9RUBA 4X2RA 1OIMA 4PRWA 1M7JA 4TTGA 3GVGA 1KRMA 5E6YA 4BCEA 1Q66A 3IACA 5HOSA 1DWJM 3DDMA 4CU7A 3LZ5A 1R7AA 1NF0A 1JEZA 3QW3A 2ZA2A 3ZO9A 3PC0A 1XD0A 1DQWA 1NEYA 3QZ6A 3B8TA 2QW5A 2GQ9A 1RUSA 1DXIA 4DN1A 3KAOA 1WAUA 1GW1A 4GIAA 5IXEA 4RDVA 1XYMA 3HPSA 5DCEA 4Z1YA 3W86A 4AX6A 1FHUA 2Z6IA 1FWJC 4UTTC 3QHOA 4R27A 3S8HA 4H7CA 5CC3A 1W8GA 1ZP4A 3CZKA 3GZAA 3W85A 3RX2A 3JW7A 3TXVA 2ONEA 1AQFA 2C71A 1PS9A 5TF0A 4KEVA 1EEXA 2BY1A 3RPTA 4EK7A 3BZJA 2Y61A 1TE1A 1DOSA 3QLDA 1E56A 5CPMA 3PUOA 4XZNX 4RUBA 1JPIA 3AO0A 1TPDA 4HNVA 1UJPA 3V1HA 3N17A 1QO5A 3KDNA 4E3TA 3BO9A 3W23A 3NURA 4MY9A 1LG1A 4GI8A 5G4EA 1FOBA 3VTRA 1QCWA 1N8FA 4NILA 2IQTA 5C7VA 4QEEA 1MXSA 4YN5A 1O5QA 3AWOA 1KGUA 4LRSA 1QPQA 3QBUA 1WZAA 1AH3A 4GYKA 4E8CA 1SU5A 4UMCA 1K8CA 2P8CA 2BHYA 2D73A 3CPRA 3P67A 3OZMA 2W0UA 2YA0A 4I9MA 1FWHC 3H54A 5BMWA 4RNHA 3ISIX 2QCDA 4U3CA 2ATMA 3HQOA 4H00A 1US0A 2YIHA 2F6KA 4RDWA 2WZMA 1W1B1 3AQUA 3NQ6A 1O5RA 3APYA 4B5UA 2JKAA 4PE8A 4N4PA 3SB0A 4M6QA 2H90A 3AIVA 1A5BA 4KETA 2Y7GA 1A80A 1HKVA 1JPMA 4UOZA 5GNYA 3W1UA 4EANA 1V77A 1HJSA 4PMOA 3K8MA 5A8MA 3LXAA 3UWUA 1KA9F 5C70A 3LHWA 2PLMA 1ME7A 4FLRA 3UP8A 5LHEA 5DT5A 1TMQA 1LBFA 1SZGA 3KRUA 1VFTA 1CGYA 3BPWA 1CGVA 5HR7A 1M1BA 1XUUA 3UYCA 1DWFM 3E0LA 5I3IA 1OZQA 4LVGA 1KLYA 1UH2A 1JDEA 4KMQA 1XCFA 2OVLA 3RGTA 1OF6A 2Q09A 4FLQA 4AAJA 1QW7A 1VCVA 3NSNA 3QZEA 3O3RA 3ZFHA 4TUFA 1YNQA 3IAQA 3MV01 4H3DA 3OO2A 2CKSA 2E40A 1JYWA 4GUJA 2W66A 1TQJA 2NZLA 2DVTA 4JTDA 3S2NA 1BXBA 1LORA 5DELA 3W37A 3M7WA 2PPGA 4XZWA 5D09A 1SO5A 3GB6A 2Y62A 1CBGA 3GE7A 2VJXA 4NVTA 2DZUA 1LM1A 3VKJA 5H8UA 4FIRA 2G3MA 2O4QA 3QGAC 4F3HA 3M7SA 4DJDD 1OWQA 4HCLA 4S2BA 4IIEA 4E6MA 4FX7A 4XZIA 1PZ1A 1KFBA 3A21A 3M41A 3NZGA 4NZ4A 1CEOA 3H2FA 4L6OA 3G0UA 4P8UA 1OCJA 2DQXA 4RPPA 4C7FA 2DZTA 3ZT5A 3L2IA 3C2RA 3LHUA 4RDZA 2OSWA 2PC4A 4KS0A 2R82A 3F7JA 3A3XA 5HMDA 4O1AA 3U5UA 1L6YA 2FHFA 4DPPA 1QJWA 2GGGA 5DMNA 2FZDA 3WH9A 1XR2A 5GQBA 4GC3A 3TP4A 2VZOA 5A94A 5K2ZA 2F9RA 4LGXA 1U1HA 2PWFA 3C2OA 1EEPA 3VILA 3V5FA 4JTHA 3GXIA 3HFYA 4CN6A 1S1PA 3QC3A 3TLQA 4R34A 2AAAA 4N9CA 1RALA 1RR2A 3W1TA 3UCDA 1BRLB 1VEPA 4OE7A 4W89A 3CYVA 2WSYA 4QM1A 3XIMA 3E2QA 3RX3A 4KRZA 3H7UA 4JKKA 4LCRA 3QYSA 1V3KA 3ITYA 3GIQA 4DHGA 3TROA 1XLMA 5HMFA 4KH2A 6TAAA 3MC5A 3DFPA 2ALDA 3NQ8A 4RV8A 3T0AA 5EMYA 3ES7A 4DAIA 3OA3A 1SJBA 1H1ZA 4WKHA 4BZYA 4GJJA 1O5KA 4HPXA 1FWCC 1GKPA 3GDKA 2QHAA 1GPWA 3DYMA 1EO5A 5CPTA 3COTA 1ME8A 4RNIA 2W27A 1E40A 3CQJA 2ZIDA 3VGBA 3S2CA 1L6SA 2V5KA 4W93A 4HSOA 4UFIA 1UP0A 3EX4A 3HJZA 4A3UA 1XPGA 1TV4A 1TWZA 8A3HA 3LI1A 3THQA 1IIHA 4JYFA 1O4UA 2PODA 3UCCA 3SUUA 5AYBA 2F61A 4M6PA 5I78A 3IVSA 3H24A 2HZGA 1T0OA 2ZUUA 3UJSA 3A3WA 4O19A 3O6DA 1SQ7A 2WMIA 1WOBA 3QY7A 4R7WA 1K6AA 3F03K 1PAMA 3S1XA 1R30A 4PMJA 6ENLA 4TVDA 1K7XA 5DLCA 2PP0A 3WQVA 5LNRA 2VGBA 1WX0A 1POJA 2ISFA 3I6TA 1E73M 1KXHA 3KZPA 3TFCA 3IRSA 4HA0A 1E4IA 3BAWA 4WY0A 4A2SA 1ZAJA 4LUYA 3IIOA 4NG3A 2FGLA 3MSRA 5LA2A 2C79A 5LKYA 1VYSX 3EA1A 4XG1A 4S3BA 1W5QA 4GG9A 2OMAA 4KESA 1P1MA 1R47A 3GKFA 4Y9AA 3NQ2A 3QPEA 3OIHA 4REQA 3KWSA 3GXDA 5LA0A 4PZVA 1RD5A 1O94A 2Y4SA 2WKGA 2CBIA 4HZ6A 2FZ8A 3M4HA 2BHZA 2CU0A 3DENA 2E3ZA 5F7UA 2VYOA 4KWVA 2ZA3A 4I8DA 3M5YA 2QPUA 5FSDC 3NDZA 1JPDX 4CVWA 5K9CA 5AOUA 1WKFA 3TN5A 3VZYA 1E6ZA 4F2TA 1ONRA 3AS2A 1US3A 2YXOA 2Z6JA 3N29A 3A22A 4PRTA 1XSKA 5DXXA 1D3HA 4UR9A 1W1VA 1JPHA 2VURA 1R3VA 3G0XA 2W91A 3E0VA 1YX1A 4HNTA 3W7IA 5EBUA 4KIEA 3CWOX 3CUXA 3PNUA 3HV9A 3QV9A 1UROA 3E5PA 1MZHA 5L9FA 1C29A 2FTWA 3WLQA 2GQAA 3LEPA 1UBPC 4ROPA 2J9YA 3DCPA 5ABFB 1UIPA 1PYFA 3LPFA 2CFFA 1V0NA 2PDJA 5TBOA 3VM7A 3EWUA 1LOLA 2XPKA 1H7XA 4YL2A 2VGIA 4LPCA 3XISA 1GG1A 3L2LA 4HSNA 1G0CA 3IJ6A 4GCXA 1JQVA 1F6PA 4IMDA 4NAEA 4FPSA 3CM4A 3WQ4A 2GYIA 3LOTA 1DTUA 7A3HA 1TIMA 4US5D 4L6DA 4DI8A 4C6JA 1PXGA 1JUBA 4LEQA 4DJFD 2Y5JA 4W7UA 1XDJA 3PWIA 2BHUA 3GG7A 2JE8A 4UQBA 1CLVA 1REQB 1XYFA 3GNNA 4IX2A 3BWWA 4DNMA 2J7CA 4IJCA 3BGAA 4GZEA 2BVWA 3DKLA 4Q4MA 1MW3A 5BMXA 4OUIA 4AY8A 2FPVA 1WZMA 5A2CA 5EMLA 5HWMA 2GGEA 2E6YA 3ARZA 2J88A 1IR2A 3EWZA 1FRBA 3ZWSA 3CWNA 4PTXA 5CC7A 4ATWA 1JGIA 1SFLA 4C65A 3U4FA 2VRJA 3MO7A 3UR7A 4ADTA 4LUSA 4UQ9A 3OLGA 2Y2WA 2Z7KA 3CAQA 4ZB0A 1HZYA 4U3AA 1SJAA 2B7NA 3U6WA 2F2HA 3H7VA 3KE0A 2VEKA 3T7VA 3RK8A 1QAPA 1Q85A 5IHSA 4PC8A 4AIOA 3AWNA 2YBTA 1Y7VA 3QHMA 1AQ0A 3WQ6A 1PIGA 2X1RA 2CLLA 3TSMA 4OTKA 3ZT7A 5LIUX 3QTGA 2E5CA 3BAYA 3ITOA 1JCYA 2JGYA 2WZTA 3MMUA 4IGMA 4BA0A 2Z28A 3L7RA 1PVNA 1A5KC 4HYVA 4DZAA 1JG9A 3HB9A 3TN4A 4GYPC 4GYJA 3OTRA 2VP8A 3GIYA 2OX1A 3M0ZA 4JTTA 1OCQA 2W3ZA 5I3GA 2QNEA 2X41A 4LWWA 2DT0A 1QUMA 1H61A 4PL2A 4B5NA 3VKBA 1KV5A 3S6TA 3P7YA 2G97A 1A5SA 1FFRA 3LCFA 1Y5WA 3N13A 1ZALA 4AIUA 3LCIA 3I10A 2VC7A 1BXCA 4QX4A 5AC8A 3M0HA 3SCUA 3WUBA 1E0TA 4GI9A 3CUZA 1X96A 4O1DA 4AC1X 2NQ9A 3LQLA 4AYGA 4B5SA 5FJOA 4RKAA 1UUQA 2TRSA 4GQBA 2VD8A 2WPBA 5U7SA 4V1XA 3OVGA 4DBUA 4ACYA 2PTWA 2YOCA 2V5DA 1ZAHA 2PSNA 3E6EA 2YBVA 4MY8A 3KVKA 3GWQA 5DF0A 5HNUA 3W73A 2V0TA 3RM4A 1MW2A 3R7MA 4AEOA 1N8WA 3INPA 1QO2A 1LOQA 4YHGA 4KWOA 3SQMA 2G3IA 2J7FA 3RNDA 2C14A 1SUXA 1FVPA 3W71A 3NQEA 1LT7A 3CAKA 3A9IA 3D46A 1MO0A 1KM3A 2H9AB 4JFVA 5KZEA 4UQCA 4S3AA 2ZXAA 2G3FA 4UTUA 3EDKA 1R5YA 4IFKB 4D72A 5CSUA 4JIIX 5FJPA 2WC7A 9CGTA 3HG3A 4M56A 3B8SA 3ITXA 4XD5A 1W3IA 2HNHA 4ONVA 4NAFA 4W87A 1OSEA 1Q45A 5EY5A 2A7RA 3PJUA 1H7OA 3F4VA 4RV3A 1DHKA 3GR4A 1M7XA 1XL9A 3KBSA 3MSYA 5JXQA 2INFA 5GNXA 3STPA 3AXHA 4EXAA 3EWCA 4PH6A 4GIYA 4X9YA 3EAUA 4RX0A 3P81A 3IV3A 1ZNNA 2GZXA 4PUJA 2BX7A 2OB3A 4H6KA 4MADA 4PMQA 6ALDA 2P50A 1GGOA 2V8ZA 3UWZA 3F1QA 1VLIA 2DY3A 3DBPA 1J0YA 4Y8FA 3HZ3A 3GXMA 3R25A 4O50A 4FXSA 4L4PA 3TYBA 4ZENA 4AY1A 1TREA 3LNPA 3LI0A 3U2OA 1FWFC 1K7EA 3OG3A 1AVAA 3OQ8A 3ATYA 4JHMA 2FIQA 3S47A 4ZOAA 4HD5A 2VEGA 1W3KA 1H0GA 2ZRYA 4UTFA 1J93A 3SEPA 2CIPA 3NGFA 3WFLA 1UWQA 2GJPA 4GZ7A 1PKYA 3WMBA 1A5LC 3MW7A 3R10A 2ICSA 3EDDA 1U33A 4LQ1A 4MF4A 4IPJA 4AZHA 2C0AA 2YDAA 4Z2HA 1CLKA 4JTUA 4R9OA 3BLEA 1GHRA 3CBWA 1J12A 1YKWA 1NF7A 2QCEA 5KITA 5CJNA 3ITVA 3FKKA 1UMLA 2IPJA 4DWSD 3THAA 5FI8A 2E67A 3TTOA 2Y7DA 2Z1KA 2PF8A 1KRCC 4GNJA 4QLKA 4KT2A 2F84A 4M81A 2VZVA 3QZAA 3VDCA 2BGNE 4LVFA 4D6EA 1NQ6A 1M3UA 1RV8A 3GVVA 3EXSA 1HVXA 4O14A 3PUDA 5FF7A 3GKAA 3KOWA 3VZXA 2OX4A 2PURA 5LXEA 1J10A 1ODUA 3EOEA 2QEZA 2VRKA 2WQDA 4QCEA 2DUZA 3PZOA 1R46A 1B0IA 5A6BA 3EDEA 2VELA 3QQWA 4CD4A 5AYZA 4IZGA 1G6CA 1OC5A 4MKVA 3MPGA 4M6UA 2QKFA 5TQLA 3GTXA 3A47A 5AHEA 4N2YA 1DBTA 3W72A 5I3HA 4XZBA 4PMXA 1BVNP 1WDSA 2PU1A 3KBJA 5HMSA 1KR1A 4YTRA 1UUMA 1JIBA 3WF3A 2VCCA 1IV8A 2E1WA 1AJ0A 1MVYA 1V3JA 1YDOA 3GYCA 5FJUA 4PGLA 4JOMA 5HA7A 3POCA 3GDTA 3PWGA 3C3UA 4WSHA 1NAL1 3TOYA 2RUSA 3GH5A 4QJ4B 5A8PA 3S4TA 4J5NA 4QDMA 1PDZA 3ZR6A 1SJDA 4WIWA 1R3TA 6XIMA 3B8DA 3C2VA 2P0IA 3CTLA 1OGGA 3B0VC 1J11A 3N15A 5MHBA 5CH9A 3LHVA 2C1IA 3OB8A 3GX9A 3WMSA 8CGTA 3CHVA 4WDUA 4X0VA 4YCOA 1Z7AA 3P0XA 3MHGA 3H12A 1GVRA 4GY7A 4WSJA 1CXLA 1E1CA 3RLVA 2BXYA 3VOCA 3GLCA 4N9BA 4B4HA 4WR3A 2J77A 4ZQRA 3CASA 3QVQA 1LQ2A 1RD6A 1VBRA 5F2GA 3PZGA 3SGUA 1XLHA 3FYYA 3TYCA 4XB3A 4D6CA 1Q7ZA 4O28A 5EBAA 3GRIA 3VDGA 1F6KA 1JCMP 5LNSA 1QOPA 4A8NA 1DTNA 4R88A 1SVDA 1LJYA 4D8ZA 1BKHA 3CH0A 4IPIA 5A8QA 1XHGA 1I9CB 4L6HA 4W84A 2CLIA 1LTDA 1M03A 3PS7A 2B7PA 2ZZ5A 4DZHA 1XX1A 4LYPA 1U30A 2NQJA 2RDWA 1D3GA 1V93A 3F4DA 3T40A 3NQGA 4RE4A 2INEA 3IWPA 3LTSA 1QHOA 4DELA 3UEQA 3MKVA 2NUYA 3VO0A 3WQGA 1V0LA 3WD0A 3TTSA 3BW3A 1UR0A 4PSRA 3GNDA 3ZM8A 4CEXC 3L5MA 4IGHA 5E93A 5F2IA 1V6YA 1AZ1A 1Q5MA 2GUBA 3UWEA 3MJYA 4BK9A 3B4UA 2HE8A 3CUIA 3GXPA 5CXPA 4CNPA 1CW2A 4PMYA 4MWAC 4K1GA 3P14A 3UW6A 3W84A 1U5JA 3GH7A 3QV7A 2AQOA 1SGJA 1UW9A 1VJZA 4XUGA 1W3TA 4K8GA 3H21A 4AZCA 2IXVA 3OVRA 4O57A 1XBYA 3W83A 3EOLA 4DZIA 4MB1A 1UKTA 1H51A 4GVFA 5J5DA 3VC6A 1V02A 4M7TA 1AL8A 3CHDA 2WZIA 4LNYA 2AQVA 1W1A1 4NL1A 3CUGA 3QN3A 3B0PA 3WDJA 2XGZA 4UXDA 1JYXA 2QJJA 1EGZA 3ELFA 4YWIA 2WMIB 4HN4A 1THFD 1DJYA 5I02A 4GO8A 1ZGDA 3W7LA 1IEIA 2QCHA 3BAIA 4ML9A 4IIBA 5HAOA 3EEGA 1UPMB 2YGYA 3DFTA 5D05A 4HU8A 4C6OA 1LQAA 2GSEA 4R5EA 3APGA 2YZ5A 1NFPA 3EB4A 4WY0B 1NDVA 2B0MA 3VINA 1I75A 4F0LA 2PDPA 1PIFA 4UZSA 5LGXA 3N9RA 4HMNA 4QR6A 3B04A 5A6JA 5AVNA 3FX4A 3KHDA 3QTPA 4D71A 1M65A 3BQ6A 3FIGA 4LAUA 2F7FA 1KBKA 3SY1A 3TN6A 3HURA 4NASA 4CNSA 2G41A 3DI1A 3HQNA 5CPOA 3H2OA 5CEWA 3CS2A 4J1OA 1TPB1 3UA4A 2YL8A 4XX6A 3UJRA 4UB9A 4LCQA 1ONWA 2FFCA 2GVEA 4JTRA 2F6XA 2PGFA 1AD4A 4AZ7A 5DANA 4EAMA 3DI0A 3AHVA 2BDQA 1UA7A 1D8CA 1WDRA 2C19A 2ZE3A 3PPCA 5F1VA 3ZR4A 4B92A 4Q8MA 4FOUA 2OWCA 3H4WA 4AISA 1B31A 1S3TC 2UY4A 1AODA 4BEQA 4JTFA 5CKSA 1XD1A 3G24A 1NDYA 4Z2IA 2OO0A 2QJMA 7PTDA 2ZXQA 5CG0A 2BY2A 4JQ4A 4LW7A 4CD6A 3NGJA 4ZVJA 2GQ3A 3AALA 3SUWA 2BNJA 5AZ1A 1BYAA 4LY4A 1E0UA 4FF5A 5E09A 4O53A 4GQRA 2YSWA 3MDUA 4YTQA 2YCKX 3CK5A 4GY0A 3U48A 1Q3NA 4LAOA 1ZBVA 3R0UA 1JDDA 3NZPA 4JYEA 4FAMA 4Q4PA 2YA2A 2E6FA 3PSVA 3S9IA 4ZOEA 3RMJA 1TE6A 3URNA 4GKLA 2XVPA 4GJ1A 3QMSA 1LWJA 3ITLA 3OOQA 4RCXA 3BAJA 3DU0A 1G4EA 4QE4A 3NM3A 3T78A 2EPLX 3NR0A 1Q6LA 3FOKA 4HU0A 1X6NA 1H0IA 1EPVA 1EYWA 1TR1A 3WL1A 1DIKA 3STEA 4NT0A 1W5OA 1YBQA 3W6MA 3AXKA 4LYRA 2DZBA 3ARSA 1PCWA 3VD4A 1OFEA 2J74A 3OU8A 1RLCL 2WSKA 3S6OA 4JTLA 3BLPX 2HS6A 2TYSA 4AX7A 1I2PA 4I5XA 2UY3A 1Q6QA 4N9DA 3VMNA 3OHIA 4BQ3A 2WVVA 3S5ZA 3SCTA 3F2DA 5I23A 4A8IA 1CTNA 4I9JA 1WDQA 3S0CA 2X7WA 2CZ5A 3ALFA 3W7JA 3K46A 3K30A 3VMPA 4JBRA 2IS7A 3VNKA 2WHMA 2VEPA 4O0KA 1Y8BA 1OFPA 4JZ5A 1GOXA 2NX1A 3AROA 1FDZA 4MHBA 3ANUA 1E43A 3FSTA 2V3EA 4MZ8A 4CCCA 1GUVA 1RJRA 1R7OA 2NXGA 2WZHA 4JX6A 3HPXA 4HHLA 2X40A 3WIJA 3FXYA 3E12A 1GJUA 3M16A 2X16A 2O9TA 4HN8A 4MNKA 1DV7A 1TPUA 1XLKA 1V8EA 2Q71A 4LVBA 1W5MA 2QDEA 1XFCA 1F7BA 3PZMA 2FGBA 5KEZA 3UG8A 4W86A 3L4WA 1CGTA 2Z24A 2GLKA 1S39A 2P1FA 3H2CA 4WJ8A 3KRBA 1PKLA 5CSYA 1PZ0A 1EF2A 1TUFA 1ZENA 1ZJHA 2VR5A 1V3IA 3SN0A 3N2TA 1WDDA 3TJLA 4LY8A 2GVGA 3WN6A 1ISVA 2ESCA 2YLLA 1XRFA 2YDQA 1EXBA 5A6SA 1YPXA 2QS8A 2WVTA 3GAYA 1UD8A 5KZ6A 4U5KA 2F2KA 3NA8A 3ZJ8A 4GH1A 1W31A 1K9FA 2QCLA 3FJLA 3C5QA 4MB4A 1P0BA 3OVQA 4HOXA 2HVMA 3LRLA 4ZQCA 2C6QA 1PZ2A 1Y0EA 1XF0A 3S5OA 1K1DA 2H3DA 1EPXA 3G1AA 1NP0A 4ENLA 4XQ6A 4V15A 2ACQA 1X6LA 2XIMA 3MKKA 3OEXA 3T6CA 1HKMA 7CGTA 3N6HA 4Y6GA 3UFYA 3LQGA 1RSCA 4XAGA 3V5OA 3DHDA 1RQEA 2XFFA 2WMKA 1E1FA 4MVAA 1A50A 3VVGA 1RQBA 2R14A 2REQA 4H19A 2KAUC 2WQPA 4IP5A 3M07A 4CLMA 3EWWA 3VGHA 1YNPA 2QUNA 3TLLA 4D6JA 4U2YA 3SJ3A 4L5ZA 3NIYA 4QHRA 1LRNA 3G1DA 1XYAA 4QITA 4LUJA 4FOJA 5I7GA 5EYWA 4S39A 3M0KA 4KWWA 3UJ2A 1UR3M 4HKPA 4JY9A 1DWAM 1WZLA 3LCXA 3STGA 4XIMA 2PDIA 5FOOA 2XVNA 4NX5A 3QYQA 3QW4B 3W0KA 3PF3A 2OR2A 1KTCA 2PEVA 3TA9A 2R6OA 2WJFA 1UD5A 3OIXA 4P2VA 1M68A 4G56A 1GQJA 3USBA 3A5FA 4ZOCA 1XP3A 2ZXDA 1RCQA 3PTKA 2QYGA 1M9HA 1CPUA 2WW5A 3CV1A 4JEQA 1Z89A 2X1UA 4S3GA 1DE5A 1H62A 2EPHA 3AHYA 3R43A 4HTBA 3L5LA 3AZRA 2WNWA 1H11A 4IQEA 4RZ5A 2VDIA 3WO8A 1H4PA 4BI6A 4PBFA 3W3OA 1VIWA 4AQLA 4PFMA 5FIPA 1HX0A 3L0NA 3UQNA 4J3TA 3MP5A 1FDJA 3VIPA 3ARTA 2BXZA 3FHAA 3WUGA 1QWKA 3WD3A 3EOUA 1LL7A 5LIWX 3GUWA 3LGDA 1XG3A 3C0LA 1JRBA 4O18A 2OT0A 4N4QA 2FVMA 3MMDA 3TK7A 1IGSA 1TPWA 1NFBA 3PAJA 3ZJ7A 1PX4A 1W56A 3I7SA 1S2WA 4J35A 1T6MA 2WB5A 4YMZA 3AICA 1KR0A 2Y89A 1HXJA 1OZMA 2NUXA 1QT1A 4H6QA 1X39A 1L9WA 2PAJA 1W3HA 2PZ0A 3L66A 1CWYA 3VNDA 1OG6A 4H9VA 1XIDA 3AMGA 4AMAA 3DC8A 1OFAA 4B5WA 1TX0A 5J5RA 3B8WA 2MNRA 2BVYA 4TQTA 3OGVA 2PBOA 4UR7A 3WDHA 3WZ0E 2YDRA 1TZ7A 2TODA 3S46A 2ZWYA 3LS9A 4IPLA 3C2FA 3ARQA 1UC5A 1GQNA 3MHUA 5GNZA 1I45A 1OM0A 2DVXA 1YADA 4NP7A 1MEHA 1HL2A 1K8XA 2FFIA 4PMRA 3MUXA 3B3DA 4S3DA 1A5UA 3MYOA 1O12A 1V79A 4GFSA 1YEYA 4B16A 1VHCA 3II1A 3OYZA 4V28A 1BWVA 1UR4A 3I3EA 2DIEA 2R91A 1VFOA 4NZCA 4L9ZA 2XIQA 3B9NA 4G9PA 3MBFA 1HUVA 1PCKA 3GR7A 4UR8A 3RRXA 1O1HA 5B80A 1K6WA 5A1AA 2Z2BA 1ZL1A 3UNDA 2OOGA 4QJ3B 2BV9A 3WF0A 1LT8A 1LG2A 4MYXA 3WJSA 1S2AA 1XIMA 1UASA 1AUSL 1G7VA 1KLZA 1POKA 4UMAA 1MI3A 2VUNA 1JNEA 3GFYA 3ZWTA 1OBAA 2J8TA 4GX8A 3GHSA 2ZX8A 2A3AA 3M0XA 5J04A 1VFMA 2V2CA 2VX7A 4JYDA 1T8XA 3GHTA 2OWXA 1J6OA 3WBAA 4OECA 1KD0A 2PDHA 3EXTA 2ODOA 3SAZA 4TX9A 4MB5A 5EL1A 1CB2A 3M64A 3NUKA 1V0MA 1VHNA 3UZWA 1PEZA 3TR2A 4ORMA 4MJ2A 1WCGA 4W8BA 2V2HA 1C8VA 2ZKMX 5DCDA 3RCNA 3D47A 1QI4A 4HSHA 4I8YA 1I0BA 4PN2A 1OFDA 1GOKA 2YXGA 3VOGA 2C18A 3KVLA 3VNMA 4RZBA 2OKOA 1IWPA 3W2KA 4DO4A 1E1CB 1KXTA 4GYPA 2CW6A 1QU4A 1GG0A 4GGBA 3P80A 1SZFA 3GNRA 4WRHA 3LX9A 1XLCA 4HZMA 3O63A 1EGVA 1UH4A 3VOFA 1EH9A 3ABSA 3NQVA 3NQCA 2D1ZA 4KCVA 3LB0A 3S42A 4XIAA 3SR7A 4ZOBA 3ID7A 4BF5A 3CQHA 8RUCA 1WO2A 1E0VA 2O4MA 1N2VA 4D8LA 4GJIA 1PTDA 4YTUA 4S3KA 5FEPA 1PKNA 2OG9A 2XIJA 3W24A 3OLDA 5T91A 1B3YA 4QP0A 1XPYA 2I9EA 4NZ5A 1BWLA 1MUWA 2QUTA 3ONCA 4JFSA 3QKZA 3RITA 3LYEA 5DQPA 2PRHA 3CUJA 3WJYA 1ICQA 2YYUA 1LF1A 3PZQA 4N02A 1QI3A 1UG6A 4URIA 3KL5A 3W2LA 3EMQA 2GSHA 4QS5A 1XG4A 4LT9A 2PS2A 4OT7A 2C0HA 3NVTA 2I5IA 5I00A 2NLYA 1IEWA 3NPWA 4KCWA 3PB2A 5CPNA 1LL6A 1D7KA 4XKMA 2G95A 4WZHA 4HZ7A 3GIPA 2DFAA 4I90A 4BWLC 1I2QA 2BY0A 4INFA 3E1F1 2PDXA 2ZRZA 2W61A 5B7ZA 1AJZA 1E6QM 2Z00A 3MZ2A 2QV4A 4B15A 4EP8C 1SO3A 3R0DA 4AC7C 2V81A 5D2WA 3H8AA 1IGWA 3CAVA 3AMKA 4GRSA 4PCTA 3VUSA 4NJJA 4FIQA 1FH8A 5E0KA 4GIRA 4MPQA 3MT1A 2OGJA 5T9CE 4FOKA 1MW1A 2IPFA 2OZ8A 1P43A 5CG7A 4MYAA 4JIRA 2Y8UA 5G1TA 1CXEA 4HMEA 3D5HA 2IPGA 1EA9C 1V02E 2WKLA 3I6RA 1P4CA 4L7ZA 4P7OA 4AWTA 4CQ9A 3KS6A 5CCZA 3H70A 1GVSA 3B03A 3NOYA 4ERIA 2BGQA 1J0JA 2IKGA 1PBGA 1T40A 3M5XA 3W02A 1OC6A 4N6EA 4DBSA 1IEVA 3TN3A 4P8XA 2UWFA 1ONXA 2VL4A 5E70A 4HK7A 3MUZ1 1VJIA 3TYUA 4WEVX 3R8RA 3TVAA 4G2DA 2XZ7A 5A6KA 1DXEA 4GYFA 3RDKA 1QNRA 4UOQA 2OT1A 4FO4A 3MCMA 6REQA 1EDGA 5AKQA 1H7PA 3GVQA 1NELA 1TUXA 1E3XA 3LD5A 1YTDA 1AH4A 2UV8G 2OODA 3NZRA 2A3LA 3AYSA 3KXQA 3GVRA 3KLKA 4QGCA 4D6IA 2NX9A 3W88A 3R11A 3RG6A 1JRCA 3GZ3A 4M24A 3H23A 1O68A 3CAWA 4K8EA 3N11A 3UG4A 2PE4A 4YU1A 4IJBA 2V69A 3HQ1A 3TCSA 2IMRA 4WCJA 1XFBA 1PWMA 3LSBA 2O9OA 4MJZA 3UY7A 5DMLA 1X38A 3P60A 3QSTA 4GI6A 3FDGA 1IWAA 3UXAA 1DJZA 1OG0A 3PUEA 1OFOA 1XYBA 4M1RA 1QK0A 2G8ZA 1KM1A 2G37A 4YPJA 4OV9A 4YTSA 2WNQA 2FDMA 3ICJA 4X61A 2P5NA 2WM0A 3TX9A 3HN3A 3BLLA 3CWHA 1JYNA 1WDWA 1TJRA 2WNZA 3IGXA 3EX6A 3RLUA 3FCPA 4ZSUA 4AVNA 3WNMA 4XSLA 3F5KA 4BHYA 3RAOA 3STCA 2PGWA 3E96A 1BXNA 5LA1A 1DQXA 3OLEA 4PCFA 3VIKA 1KFEA 5EA9A 3IIVA 1OCBA 3MB9A 1KFWA 3M0IA 1HJXA 4IMCA 4QLLA 3SY5A 5M03A 1ZHAA 2Z27A 1QI2A 2X30A 1KWKA 3T0BA 5D2XA 1ALDA 4JHZA 4J3SA 4WK9A 2VFDA 4L1XA 5D9OA 4RE0A 4PEKA 3TSBA 3NXLA 4WGHA 1PSCA 4Q8VA 3RM8A 1YBQB 3A9BA 5HXMA 4U5IA 5FJIA 1MZRA 4HB7A 3E0WA 3MWCA 2WXDM 1TV8A 4LFYA 1ZCCA 4ZFCA 1O95A 4L4MA 3CZEA 1QFEA 3W75A 1BF6A 4XBKA 3L9CA 1KW1A 3LMYA 3WLJA 3O9NA 4GXMA 2FYMA 3DBNA 1TTJA 1JD7A 1GEHA 3SCRA 4G6CA 5AECA 2V5BA 4XTDA 4CQCA 2I56A 6PTDA 4GZIA 1KGWA 1B57A 2H8ZA 4Y9MA 2I17A 3E02A 3O16A 3EA2A 5JUVA 1C90A 1S2UA 2FH8A 2W63A 1BG9A 1CXKA 4Q8PA 4M6VA 5D30A 3S5NA 3UZ5A 4NUWA 5A6LA 5TD4A 1V5XA 3EWDA 2WVSA 1V3HA 1ZS2A 1TPH1 2V6AA 1KFJA 3ITGA 1Q4WA 3A6OA 4WXYA 4D8AA 1W9UA 2GL5A 4IQDA 4O54A 3LCHA 4C1LA 2WANA 1IT8A 4NNCA 3P61A 1LZOA 1TFVA 3UZYA 1MUCA 4AWUA 4MNMA 1A4LA 4ES4A 3CL8A 2DZWA 3T4WA 3CMFA 3M5VA 2PMQA 3VCRA 4UCFA 1FQ0A 3S5YA 1CGXA 2HXUA 1A0DA 2RAGA 4ZO7A 5DMYA 2OFJA 1ISXA 1KQZA 3CL7A 1M04A 5FF0A 4HZ8A 2JF7A 1RH9A 5AY7A 2Z1VA 1YNYA 3FSUA 4UCGA 3PBYA 4F2UA 4LV9A 1SO6A 1G69A 3WMCA 3VFCA 3I4EA 2WK2A 3AOFA 1I2OA 3N3TA 1JI2A 4Z2JA 3GDRA 3HGSA 5BXSA 2Z2AA 1JNDA 3ORWA 2WHLA 1OYAA 2QMKA 1MXGA 4NI3A 4TTUA 4IJRA 4O12A 5FEXA 3S3GA 1MQPA 4NI8A 3ZQ9A 3MWAA 3SRHA 3KBWA 3UWWA 2HVOA 4H8UA 3ABOA 2HVNA 3VGDA 2R9RA 3D3AA 2REQB 3W7PA 3W2NA 5I3JA 1J6PA 3F2BA 4MWAA 4S2CA 3L5AA 4B5TA 2PC8A 3OBKA 3PZUA 2PDUA 4DUWA 4I7VA 1A0EA 4LF1A 4J40A 2EG6A 4OBRA 3B9AA 2XYLA 3V7PA 2JK2A 1JAEA 2XVLA 4CQDA 1OINA 4UTHA 4UC5A 4I5UA 2GDQA 5A3HA 2FB2A 5JH1A 4Q8OA 2DT2A 1NDZA 3MCNA 4B5XA 2J8FA 1SR0A 4IP7A 4KF1A 5HNTA 3ES8A 2XDFA 4K38A 3M46A 1QASA 4W9TA 3GFZA 1KGXA 4XV0A 4B9YA 3DG6A 4F4RA 3W7OA 3N6JA 1UOZA 1JDCA 1FCQA 5BRBA 4RE3A 4YVXA 4PUMA 4JCLA 2BTMA 1ISYA 4U2ZA 3ONBA 2W5FA 1XLGA 3VI2A 2VX4A 4QG8A 4Q7IA 3G22A 1J5SA 4TV6A 2AKZA 5E6ZA 1JXKA 3O05A 3USZA 5ABTA 2DVUA 4QCFA 4QRNA 3W1AA 3G1SA 2FZ9A 1LUCB 2J7EA 4UNLA 3IUDA 3UBPC 2WJZA 3CHFA 2EEXA 1P6CA 2WJEA 1IE7C 4OV4A 1A3HA 4RXGA 4JN8A 3BV7A 1B9ZA 4L1WA 5I06A 2X05A 3PK7A 4EX4A 3BVJA 2PD9A 1GVIA 1UYQA 2DJLA 3BSGA 4PMDA 2A21A 5G1YA 5K9DA 1VBJA 3U8GA 3E49A 4JQ2A 4G7EA 5AHLA 4KGLA 4WJXA 4C90A 5BU9A 2XINA 3EX3A 4CCEA 4DB7A 3SSJA 4JCMA 1Q7QA 1XIJA 1UZDA 4DRSA 3BJFA 4LF2A 3ZSTA 2QJHA 5CZSA 4QIUA 2ZZ4A 5A6TC 2JIWA 2CZDA 3CXOA 3JZEA 1DIOA 2WVUA 5C9RA 1QPOA 3P8IA 1LBLA 4DEFA 4GINA 4GVGA 3S2MA 5CZJA 3R79A 4NRSA 4S3FA 2PI6A 5D8WA 3KCLA 4Z17A 4GGHA 1FA2A 1DYSA 3C3NA 3H55A 3BL3A 3OZOA 1B3VA 1EJXC 5ECUA 3DH7A 2O56A 2OLSA 2V82A 1AMYA 1MEIA 2QGYA 3G6LA 5LIXX 5C2GA 3E9AA 4O10A 4GACA 5LZLA 2VZTA 5HUPA 3CIVA 1A5CA 3W70A 2DPEA 3BLKA 3NYDA 4Q4KA 4RW3A 4FLSA 4JTGA 3U57A 3PBGA 2OEKA 2Q3OA 1VYRA 3G8RA 1OF8A 3RO6A 4KQNA 5H2ZA 4MFEA 4F0HA 5D04C 5LIYX 4B4FA 1XRTA 2PTYA 1YW1A 4C6MA 4Q8TA 4NIRA 1A53A 1B90A 4RLIA 4B9ZA 2V38A 1XLJA 3NQAA 1EWDA 4EKJA 2EO7A 3VE9A 2F6UA 2VENA 3CUFA 5C9XA 3DGBA 5ECVA 4CD5A 4FP1A 4AY7A 2YL5A 3VOIA 1WXYA 3NZQA 4LV4A 4GH3A 1Q13A 5C6MA 2VFIA 1RK5A 3OLIA 1XIHA 3VD9A 1UWRA 4XISA 1K4GA 3PG9A 4R53A 1FWWA 2IKHA 1SO4A 3O6CA 4HNOA 4KFOA 4GXPA 1R87A 1DJNA 1QXLA 1KFCA 4PTWA 2D0GA 1XLDA 4GO9A 1QNQA 1XRSA 2VEIA 5D2TA 3VD7A 4AHQA 3ABXA 4O0QA 1ZSXA 3W7DA 4PMVA 3K2GA 2PDQA 3VIMA 4Q3MA 3C86A 4K7VA 1YDNA 1ZUAX 5I09A 3IIXA 3O6YX 5FAGA 4YVPA 3SSZA 1O6IA 2B7OA 1JCLA 4H1ZA 4ZTXA 3MSDA 3EBVA 5AZ0A 5CAKA 4H41A 1M53A 2J78A 2B7QA 3BUVA 1MFUA 3T81A 1FXQA 2DZPA 3BAXA 4NZ1A 4ZXOA 1S46A 3WK0A 4B3LA 3MU7A 3NYZA 2PDBA 4DWSA 1XV8A 3ZMRA 1S1RA 3DFOA 3N9KA 3PB0A 3EWXA 5E0FA 1HKJA 5HJLA 4UBPC 4J3XA 3TC3A 3H6OA 2IXUA 3U9IA 3UA3A 2OEJA 5AHMA 2FZBA 3GG8A 3G1FA 3ATZA 3MYPA 2INZA 1V3LA 4LNCA 3E5BA 3W9ZA 4JNMA 3TYEA 5U4NA 1U2YA 3ZIZA 4DYKA 3E74A 1TVLA 1XLEA 3PBUA 4HPGA 1C91A 1XISA 4AIBA 5EKYA 3MS8A 3KOYA 1CIUA 2EKCA 4UFJA 4YWSA 2XG9A 2CLHA 2Y1HA 1BFNA 5DXYA 2A7PA 1JAKA 2QVHA 2QIIA 1H7RA 2CPUA 4IIDA 1OFBA 4WD0A 3NO3A 2Y0FA 2Y5SA 5BNKA 2RGMA 1PE1A 1TPC1 1E0XA 2Z2UA 2HK1A 3T4CA 3S1VA 2E7FA 2CHRA 5AVHA 1JZ2A 2E4TA 4FF7A 1TV3A 1JFHA 1R9YA 2QMJA 1XDMA 2FJUB 2NVAA 4J27A 4YS1A 2VO5A 4NX0A 3WENA 3NQMA 3TXZA 4CN4A 1X98A 4ZO6A 2R1PA 1JYVA 5GJNA 3HGOA 3GG0A 1S2VA 4NQ1A 2YA1A 3FNDA 4P8VA 1FHVA 1WB0A 4RJEA 1KWGA 1EOMA 4Z2KA 4FHAA 1EXPA 3LBCA 4M1BA 3KW3A 1KO0A 5DMMA 1SZRA 4ZSTA 3UPWA 4QAIA 2CBJA 1QTWA 3ZLHA 1P7TB 4BR1A 1CLXA 3TV8A 5H6HA 2ADAA 4CNTA 4POCA 1OJXA 3M0VA 3T9PA 1V6TA 3WH5A 4PB5A 3MI2A 4IXHA 1K4HA 2VNCA 5M3WA 1VPXA 4LB4A 4KWUA 5I2UA 1MQRA 4JR5A 3GQYA 3EKLA 1SW3A 4K68A 1J0IA 2W92A 4J3UA 1RLDA 1W1PA 2VHLA 4IMAA 5MF5A 1L2UA 2ZC8A 1BGAA 1XQKA 1JFXA 5EMMA 4A6GA 1DJGA 3WQWA 3DKJA 1F4HA 2HPIA 5A95A 3AIEA 4YHEA 3W7EA 1K7FA 3UR5A 4EWJA 4QJ5B 1XIFA 4E2BA 6REQB 1YQ2A 1ZTVA 3CEUA 4MMWA 2Z1BA 3VD5A 5ABHA 1QNSA 2XM2A 4CGTA 1W0MA 1BAGA 5AYIA 1LROA 4WDTA 2H8XA 4H7ZA 1T41A 1VF8A 1RA0A 3EB3A 4DY1A 3OG2A 3EOOA 3H7RA 5HQEA 4J4KA 3WK1A 3DERA 3P8JA 3UXDA 4IT1A 5A5WA 2GJRA 3A3HA 1AH0A 3F4NA 1DJXA 2YCLA 1GVEA 1QNPA 2J27A 2XU2A 3DFNA 2VC9A 3T2QA 5EGRA 3DC0A 3DAQA 1I1XA 1JVNA 1W1IE 2E9BA 1FP8A 2ZUSA 2IKJA 4EF9A 4ATLA 4EE9A 4QQUA 3B0XA 1MXDA 4LXFA 1EA0A 4I9TA 4FR1A 2HNEA 2FPTA 1OVDA 5CBBA 4QE5A 1DVJA 4Y9OA 3CC1A 4HK5A 2WSQA 2J47A 3FVMA 1XI3A 3GHUA 2D2JA 1OIFA 3SUSA 2QIWA 2X1TA 4E4FA 2AKMA 3DFSA 1ZBCA 2CEQA 3WH6A 1CNVA 1YLVA 2HS8A 4FSAA 4Q8UA 1PZ3A 4XD6A 5DCBA 3KS5A 1NWUA 5H8PA 1Y65A 3URBA 4HNLA 4LOCA 5I3FA 3FFSA 5XIAA 4O52A 4MB3A 3QM3A 3PTDA 1RP9A 1BVWA 4PB3A 2B81A 3TYZA 5FJRA 1AJ2A 3THDA 1VGAA 3QGVA 1MUMA 2NVCA 4GVIA 3LBOA 5HQLA 1Z32X 1X1OA 2E8YA 5JH2A 4Q7BA 2EF9A 3Q45A 5G2HA 2R1LA 2VUYA 4HK6A 3WQ8A 1HG3A 1J79A 1ECEA 4DO5A 2OKTA 1XKJA 1GVOA 5FJTA 5I3KA 3UCQA 3E3HA 1GNXA 3QR0A 3LCWA 4KWSA 3ZLGA 5J8LA 2DGAA 4Q33A 2NLIA 3C8NA 1P0DA 1PDYA 1H63A 3RF9A 3OW1A 1PX8A 2DW6A 5ABEA 4WX2A 1G94A 3B9OA 1OX6A 3DHFA 3LHYA 3VOJA 4ZZ9A 2VFGA 3FW6A 3HPZA 3P6LA 4Z1BA 5KMYA 1M6JA 1I4NA 3NO1A 5HNNA 2OQHA 4YXGA 1TVPA 4IISA 1ODZA 4M5PA 2V3GA 2DSVA 1XDLA 1OGBA 2JKEA 1NFGA 3N4AA 3W7CA 1E6RA 3GDLA 1OEPA 1XYLA 3C0JA 3TQ0A 2E9MA 1A49A 4KFPA 4Y96A 3TDFA 2D2GA 4AHOA 5EFDA 3I3DA 1JZ4A 2X2YA 1UWSA 1VBUA 5FKYA 5HMEA 4DYEA 3E38A 4S3CA 4E38A 3M0LA 1IEQA 4DBWA 3ZOAA 4K8HA 4MY1A 5CPSA 3W87A 3VIIA 5PTDA 3CPGA 1VCGA 4H01A 3I3BA 1R2TA 4FI4A 4HPJA 3VM5A 3PN8A 3DUGA 1DE6A 3W27A 4L65A 2BXVA 2J4GA 3W7GA 3V0UA 1U83A 1GYNA 5FF3A 4GUHA 3LGGA 1V3MA 1ADSA 2C1GA 3SGGA 3H26A 3CO8A 1QWGA 2XZ9A 3VK5A 3KOZA 1F3TA 1Z9AA 1KFKA 8XIAA 3PBVA 2XSXA 4PBEA 4I5RA 1A4MA 5CJMA 3LPGA 4NY2A 4H2CA 2RKXA 4ZGYA 1S5NA 3AXXA 3WUFA 2OCZA 1EP2A 1R86A 3BMWA 3RLHA 3SCSA 1R3YA 3UGVA 3IJ8A 3EWBX 2PWUA 1JZ3A 2GUUA 4ZBCA 1T96A 4DM1A 3ZS4A 3SCNA 1VFHA 4MUZA 3WJWA 1A5AA 1E6SM 2CKRA 4UTMA 3KCOA 2NV9A 4DI9A 1RJPA 4L56A 1PTAA 4UWMA 4AW7A 3VDHA 2BVDA 1E0WA 2XH0A 5KZMA 4DM2A 1XGDA 1SSGA 3WLPA 4MWAB 1XCWA 5C2CA 3H2MA 1XW8A 4K3ZA 7TIMA 4BWLA 1DORA 3EA3A 5EU9A 4QISA 1QW9A 4PODA 1GVFA 3AHXA 1IQ8A 4C6EA 2E8ZA 2EXOA 3ERPA 3WLKX 3T0DA 1DIEA 5DX7A 1QOXA 1RZMA 3KTCA 4MWAE 4G1KA 1R3QA 1BEUA 5D03A 1R38A 3F2CA 3WY1A 4J7RA 5C54A 3TQVA 1CI1A 4R9XA 3QFEA 4QTGA 2W4XA 2ISDA 4AD3A 3PJWA 2AMGA 4LUTA 4FALA 3BLFA 3NQDA 1D8WA 1AW1A 1EUNA 1E5JA 3PNZA 2CXGA 2NUWA 4O15A 4LBUA 1Z42A 2TSYA 4LSBA 5HWJA 4P7QA 3BW4A 3BMXA 1DEDA 3AUOA 3VNIA 1QK2A 4MOZA 5LNUA 1HJUA 3IANA 2XFYA 4M8UA 1K9DA 3T2PA 4AYSA 4F48A 2RGLA 4Q4OA 4RZ4A 1B9BA 4DO7A 1EC8A 5BWFA 4D6FA 3KL0A 5I77A 3I65A 1JCTA 4AU0A 2ASHA 3SRKA 2VWTA 3V1PA 1SFSA 1HL8A 4DJED 4AWSA 5G1MA 2V5JA 3PZ9A 3GVWA 1ZLPA 4YTTA 4W7WA 2I57A 3RUBL 2RFGA 4UQDA 4L4OA 3MZNA 3IJDA 1P0EA 1QPNA 3TONA 2NV1A 4JTSA 2X0YA 3BSHA 2WCAA 1DJWA 4A29A 5BCAA 4BF7A 3HO8A 3WD1A 4XVEA 3VYLA 5M1TA 3T2OA 2H3BA 3BCDA 1KCXA 1W32A 4PTDA 1RQHA 3SURA 2VEMA 3L4TA 4NRRA 3KZSA 2WZEA 2J7DA 1UQYA 1EBGA 2HTMA 3W6YA 5C9ZA 4NZ3A 3RIKA 1UD3A 3TWBA 2XIBA 4PUNA 1H60A 3MY9A 2WBKA 4KW2A 3W07A 4JTIA 4PL1A 1LBMA 3ABQA 2Z7GA 1FWTA 1Y5VA 1S5MA 1BTMA 1DL3A 3S9ZA 2A5HA 3W28A 5AN7A 2FVLA 2EPKX 3TA6A 2R1KA 5E9XA 2G0WA 3ECQA 3YPIA 1P0KA 4QEHA 2D2HA 2DORA 1LLZA 5HANA 4H6RA 3CMJA 3KVJA 5E0CA 4DYJA 1L6FA 4X22A 1OX4A 3L4VA 4O17A 1SZNA 1JPKA 4LB3A 4KBXA 2Z26A 2OJPA 4NZFA 3WF4A 4YYCA 1BRLA 1VCFA 1TMLA 1GYLA 4E0CA 3R89A 4WSKA 3Q2DA 2TAAA 4Y2WA 2E09A 3C52A 3CQKA 3LV6A 2G5WA 1M5WA 1W37A 3V75A 3ZXWA 4LAZA 4GI4A 3W7QA 1TR9A 5GVJA 1JZ8A 3QC0A 3WUEA 4H04A 4Z0SA 1XH1A 3LRKA 1I2RA 2C3ZA 4IUOA 2RH9A 3R2GA 1VJSA 4LYKA 2OELA 1F76A 1EYEA 3PULA 3ANVA 1W2PA 2G50A 2NQLA 1HN1A 3KBVA 3C8FA 1TSIA