4PMRA

Crystal structure of the mycobacterium tuberculosis tat-secreted protein rv2525c in complex with hepes (monoclinic crystal form ii)
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
204
structure length
202
Chain Sequence
SLGTLLDYAAGVIPASQIRAAGAVGAIRYVSDRRPGGAWMLGKPIQLSEARDLSGNGLKIVSCYQYGKGSTADWLGGASAGVQHARRGSELHAAAGGPTSAPIYASIDDNPSYEQYKNQIVPYLRSWESVIGHQRTGVYANSKTIDWAVNDGLGSYFWQHNWGSPKGYTHPAAHLHQVEKRKVGGVGVDVNQILKPQFGQWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies suggest a peptidoglycan hydrolase function for the Mycobacterium tuberculosis Tat-secreted protein Rv2525c.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Unknown function
molecule keywords Tat-secreted protein Rv2525c
total genus 79
structure length 202
sequence length 204
ec nomenclature
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08924 DUF1906 Domain of unknown function (DUF1906)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4pmrA00
2ZUWA 3EDDA 1EOKA 5CLTA 1KCKA 3VGDA 4GO9A 1M53A 3SCRA 4H04A 4XV0A 3UESA 4CGTA 1U33A 3WDRA 3VD4A 3DECA 3BXWA 5BWFA 5DMYA 4YPJA 3RM8A 2WANA 1JL8A 3B8SA 1WDQA 1GNXA 2CBIA 4PMUA 3SCUA 4N42A 1R85A 5DT7A 4DWSD 3TTYA 4TOQA 1PEZA 4MADA 6A3HA 4W86A 1VFFA 4ACZA 2C8NA 2A3HA 1ODZA 2CETA 2J8GA 2WK2A 1QHOA 1BF2A 1F4HA 4GZJA 2VX7A 1VFUA 2W62A 1LWJA 2ZX6A 3L2LA 2EQDA 3A4WA 1J0YA 1CNVA 2DH2A 1BFNA 2CKSA 1I75A 2WXDM 2OWCA 3KZSA 5CG0A 3AIUA 3NDYA 2VQUA 1MQQA 1CLVA 1E0WA 1HJUA 2W4XA 2DPEA 4UFHA 2ZXAA 1KQYA 5AYBA 4EAMA 4W93A 2E9LA 4C7DA 5ABFB 4ZFMA 2WVTA 1XH1A 2Z1KA 1EO5A 1JAEA 3GBEA 3EMCA 3L4ZA 4PMRA 3AFBA 4CCEA 5M03A 3ZM8A 1PX4A 5HBFA 4MJ4A 5AYIA 1S46A 1GVYA 1K9TA 4UFMA 1HJSA 2C0HA 3OGRA 1SMDA 2EEXA 1GPFA 1W32A 4CD6A 4LYQA 3WNOA 3WDIA 3WQ8A 5FKYA 4TUFA 3BAXA 3VGFA 1PAMA 1K9DA 2J78A 1CENA 1C93A 5JIPA 3A47A 2GK1A 1HKIA 2BVYA 1JFHA 1BQCA 4TX8A 4PMVA 4OOZA 3NSMA 4MDPA 3A4XA 1M01A 3WH9A 1VRXA 5CPQA 2RGLA 1GHRA 2CITA 5A69A 3ZT5A 3SCWA 1HVQA 1VEMA 4M82A 3VPLA 1FH8A 3BC9A 5IFTA 3OGVA 2CESA 5FCZA 4UFJA 2Y2WA 3GXFA 2J75A 4H7VA 5E0FA 6TAAA 2Z1SA 1VB9A 2PBOA 3POHA 2VZTA 1UR4A 1BYBA 1WP6A 3VU2A 1EXPA 1JXKA 3ALGA 2JEQA 4HMDA 1JI2A 1BTCA 4CVUA 1CGVA 3VO0A 1W9DM 1J0HA 3CGTA 4W84A 2X1IA 1C7TA 3SEPA 3QOKA 1JDDA 2DSKA 4NSBA 1UR9A 1R87A 1XHGA 1UKTA 1W1TA 2D0HA 2BS9A 4A4AA 4EANA 3W27A 8A3HA 2V3EA 2YBTA 1Q6GA 3VVGA 2PWDA 4XZBA 1FHDA 2VURA 5LA2A 1ISWA 4JFUA 4WSJA 3DHUA 2WMIA 4NRSA 4JFWA 3W82A 1HN1A 5DEZA 5GQBA 4EKJA 3L4VA 3VNYA 2VX6A 2WMFA 4JCMA 3WF4A 1UKSA 3L4UA 1UZ4A 1P6WA 1NOUA 1XGZA 3WD4A 4CD7A 4GI6A 2XGIA 3RDKA 2PF0A 1EO7A 4DWSB 1XYFA 2V3DA 1JZ6A 3BAIA 3CZ8A 3TOPA 5ABFA 4YHGA 4DM2A 4MB5A 3UCQA 1NWUA 2WHKA 2YDSA 1DWAM 3EMZA 3L4WA 3AIRA 5GNYA 3W81A 4JKMA 5I2UA 4P8UA 3AHYA 3WQVA 2Y8KA 4CCDA 5GNXA 3L2MA 2D1ZA 1OT1A 1HVXA 3TONA 2GVYA 2JALA 3NIYA 2UWFA 5EBAA 1ISVA 3WNPA 1W91A 4HP5A 3WBEA 5A3HA 5BCAA 3AIWA 2EJ1A 2ZUMA 3EDKA 4PTXA 1FHLA 2NW0A 2A3CA 4Q7NA 4BQ4A 4UOJA 1WE5A 5FL0A 3PTQA 3QHNA 4D6FA 3PZQA 4W8LA 4DUWA 2GJRA 4U2YA 1BYDA 3EYPA 1CTNA 4TVDA 1VFOA 2DEPA 3IANA 1CGWA 4CUCA 2J7DA 1UD4A 4QLJA 3GXIA 1UWIA 2EPKX 4CKQA 1E3ZA 4DWSC 3KL5A 2BHUA 1UOKA 2DT1A 1NM9A 4Z2JA 3WMBA 3F4VA 5DO8A 2GDVA 4ZE4A 1UH2A 1MQPA 1HP4A 2ZXDA 4E8CA 1KXHA 1UZ1A 1PBGA 1CEOA 1QHPA 2FGLA 7A3HA 4AD0A 1W9UA 1OT2A 3WL0A 3AXXA 1G94A 4AIEA 2UY4A 3VGHA 1OGGA 4L4OA 2X8RA 4W87A 3VUPA 2BY1A 1KBKA 1MW0A 5M17A 2W63A 4UZUA 2PWEA 4FLOA 3AIVA 4LXFA 1CZ1A 2X2YA 4FLRA 2V3GA 4D6IA 2WMJA 4OUEA 4UQAA 2PC8A 2XGBA 3U57A 1GZJA 4HU8A 2BVTA 3WH6A 1DEDA 1DWFM 1CECA 1ZJBA 1XD1A 1HKMA 5CSUA 3CTTA 5A1AA 3WSUA 1V0NA 2VZSA 2AAAA 3ZMRA 3UETA 3VOCA 2WWDA 4QDMA 4OIFA 3OG2A 2WBKA 1HJWA 3AOFA 3VM5A 4AZCA 3SUVA 1E4IA 2EPNA 3GNOA 2VL4A 5KZ6A 2VTFA 4P7LA 4QCEA 3PHAA 1JZ4A 1W9BM 4HZ8A 3VIGA 2WCGA 5D9OA 2CPUA 1V6UA 2JIWA 2VUYA 5DFAA 4B9ZA 1E6XM 2WKGA 1MW3A 2OYLA 1W1YA 2ZIDA 2GUYA 1DWIM 2ZWZA 4NI3A 2UY2A 1E55A 2DT0A 2OWWA 4WKFA 3BCFA 1H11A 1V0MA 5A6SA 5HNNA 1OWQA 3WFLA 2VX4A 1K9EA 3G6MA 3W37A 4C7GA 3VGBA 2CIPA 5FL1A 2VR4A 1FA2A 1NARA 1OIMA 2BXYA 4AD4A 1JZ5A 4BQ5A 1HKJA 4RL3A 1FOBA 2VJXA 5D4YA 2J74A 2A3AA 4PTWA 1V0LA 1C8XA 1G5AA 1GW1A 1MXGA 1NOWA 2OSWA 2XSAA 7CGTA 3NSNA 5A8OA 3WH7A 2G4FA 3EDEA 4LQ1A 1E5JA 2CKRA 3OBAA 1GONA 1JF6A 1EH9A 3SURA 2QV4A 4M1RA 2B31A 1E0VA 2X05A 3OB8A 5A8PA 4J3TA 3MUZ1 2BHZA 1W3LA 3RMEA 1BGGA 2WVVB 3WIJA 3MO4A 1ZU8A 2IXUA 1H3GA 3AS0A 3CHFA 1BGAA 1JYNA 5A2BA 3SUWA 4X9YA 3I3DA 2D2OA 1E5NA 1HX0A 3T0DA 3VDBA 1GOOA 5A2CA 1Z32X 2WPGA 3L4TA 4HZ7A 1RPKA 4E4PA 1B3YA 3RJYA 3CUJA 1E6PA 4GXPA 4JL2A 4Z2KA 4AW7A 3AZSA 2VCCA 2J7GA 2VRKA 3SCNA 2UY5A 3LPPA 3WDPP 4WIWA 3VIIA 3TTOA 2PI6A 3FY1A 2VZUA 1HF6A 1BG9A 5D9NA 1MW1A 1HJQA 3VIOA 5IFPA 1W9VA 3AQUA 4RE2A 2G3IA 1G1YA 4M24A 4MJ2A 3QHMA 4YHEA 4H8UA 2CYGA 1YQ2A 3ALFA 2VRQA 1MW2A 3EMQA 4CN4A 1UWQA 4LGXA 1J0ZA 2XFFA 1CXKA 2GSJA 1E0XA 5I3DA 1ISZA 1GOKA 1A47A 4BQ3A 1CXIA 4DUVA 5ABHA 3BLKA 4WK9A 4D1IA 2ESCA 1BAGA 3S2CA 1DTUA 4W8AA 3HJEA 2XTKA 2XVNA 1CXFA 3BLPX 2AMGA 4PMYA 4U3AA 4W7WA 4S3KA 2XVKA 4RE3A 1M03A 1UWUA 4Z2LA 2JIEA 4H8VA 2G3MA 3T2PA 2D23A 3OIHA 1C7SA 5D9PA 3VX1A 3WF3A 3ARWA 3TA9A 1ISXA 2EPLX 4W5ZA 1OD0A 1I1WA 3LPOA 3AS1A 1E4MM 1UKOA 1L0PA 2VZOA 1E6NA 3VIMA 2JFEX 5CZKA 3AISA 3PZUA 1RP9A 2WSKA 4P8VA 1PIGA 1CDGA 3WBAA 3PZOA 1JYVA 1PZ2A 4PUDA 3DC0A 4PSPA 4AD1A 1JIBA 1UR0A 4BQ2A 3TTQA 2DDXA 3WDQA 4OBRA 2WMIB 2ZUSA 1JZ8A 3VIFA 4HPHA 3WNMA 1C8QA 3U5UA 1OD8A 2GJXB 5CPSA 4FLSA 1JFXA 2ZX9A 1TMQA 5FD0A 4OJYA 3AROA 4PCSA 5GPRA 1CXEA 2J47A 2W91A 2MANA 3NJ3A 3PZNA 5M3WA 2WAGA 3L4YA 1GQKA 1HJXA 5DT5A 2J7CA 2WYSA 4F79A 1SR0A 2VC9A 3WDHA 4J3WA 1CLXA 1AQMA 1O6IA 2ZX5A 4AZIA 2PB1A 4MNJA 1E1FA 3VINA 4J27A 4UNIA 1NOFA 4CN6A 2WMKA 1KR1A 1B0IA 1IT0A 1J0IA 1V02A 1GQLA 2VOTA 1J12A 4AMCA 4OOUA 1SYTA 2W66A 4U5IA 3O6AA 2G3JA 2Y5EA 2CBJA 3BAJA 4PMOA 3EBVA 2QMKA 3CUIA 1D3CA 1ZBCA 3SCVA 1OINA 4AYSA 2FHCA 3I3BA 4GZEA 2YJQA 3KEHA 3W4RA 3OZOA 3BAKA 4MNMA 1UKPA 3WENA 3M6DA 4M8UA 3VGGA 3EDFA 2GK1B 2OWXA 1E9LA 2CHOA 1XYZA 1UWTA 5CSYA 3PTMA 2E8YA 1H09A 3BAYA 1ISYA 1E6SM 1OSEA 2HISA 2ZX8A 1WZLA 1LL4A 2OSXA 5I6SA 3B9EA 4B16A 3BAWA 4ZXOA 3W29A 2QMJA 4W7VA 3WF0A 1ZB5A 4XZWA 1LL6A 1J18A 5E09A 2F61A 2E8ZA 1OGSA 2GFTA 3PZ9A 2BY2A 4M56A 3VIHA 3UG3A 5F7UA 3VMNA 4D1JA 4D6GA 3UEQA 2WB5A 2YOCA 2FH6A 3IJ9A 5BRQA 1MVYA 4WKAA 3CHDA 5A2AA 3WDJA 4H41A 4AWEA 1FH9A 5I79A 3PZMA 3NDZA 4AZCB 2A3BA 1AQHA 3M7SA 2DSVA 2FH8A 3K8LA 4HTYA 4J7RA 4JZ5A 2EBNA 5AY7A 1M7XA 3D3AA 2WM0A 3ARRA 5C70A 4MNKA 1EOMA 1UD6A 4F9DA 3FNDA 4BA0A 2XIIA 1V6YA 2YA0A 1E71M 3WN6A 1EHNA 2CHNA 3W38A 2BHYA 1WPCA 1CPUA 3MV01 5BXSA 5A6BA 2G41A 4WLCA 2XG9A 3OGSA 4BF7A 1E6RA 5I5RA 5AC4A 1XRVA 4Q22A 3VIJA 3LMYA 1L8NA 6CGTA 1UWSA 1BYCA 2V38A 1B3ZA 1FP8A 3CH9A 1E3XA 4PTVA 3RPMA 4AZBA 1SMAA 3CHCA 1KXVA 5ECUA 3K1DA 4MDOA 3VX0A 1R7AA 4UOQA 1JZ2A 2AOSA 2VCAA 2QHAA 3SCSA 3GZAA 2D3NA 4AEFA 1ECEA 4BZYA 1DWGM 4MNLA 1HNYA 4AC1X 2DIEA 2E9BA 2J77A 1U30A 4M81A 3T0BA 4AZ6A 5CPTA 1V3MA 4PTMA 1IZKA 1W3JA 3AICA 3D5HA 3WEZA 4QCFA 4HA3A 3DYPA 2DSUA 1JXJA 2J4GA 4JHOA 3WUEA 1QNRA 4CU6A 3CO4A 1MFVA 1CGYA 1V3KA 1V6WA 1KGWA 3WELA 3MSGA 1GJWA 2EPOA 4KGLA 1YHTA 1XCWA 2YL9A 2C7FA 3VIKA 1EDTA 2YKKA 5E0CA 3DHPA 1V6XA 3AHTA 1E6QM 1H1NA 3PN8A 1B90A 3UR7A 1V08A 2O9RA 1CBGA 5E70A 4LYRA 1W3HA 2CNCA 2DH3A 4JFSA 4E8DA 2W61A 3W0KA 3MMWA 5HDRA 5IHRA 3GH4A 3THCA 3FXYA 3VD3A 3N1AA 1G0CA 1DWJM 1QBAA 4ATWA 2BV9A 1US3A 1RP8A 1VJZA 3NUKA 1OM0A 1J9YA 2J8FA 3VIPA 3W53A 5I78A 3GDBA 3T2OA 5C71A 5FIPA 3ARUA 3SUUA 1ODUA 4JFTA 4OBSA 3UG5A 1LL7A 4ZXLA 2BNJA 2JF7A 2WCSA 3ZQ9A 4LX4A 2XWDA 3CZJA 1UR1A 2YA1A 3S6TA 2DIJA 4D71A 1EQCA 1HL9A 4JAWA 4GI9A 2WC4A 1G9HA 1Y7VA 2WC7A 1BVZA 2WLZA 1HKKA 3THDA 5JBEA 1UHVA 3ZJ7A 3W24A 1W9XA 3ARPA 1W1PA 4PEEA 1V3LA 1O7AA 3QOMA 3FAXA 4FK9A 1W9PA 5ABEA 4MAZA 2UY3A 1JD9A 1LF1A 1PX8A 2VO5A 5KEZA 2OLHA 3WNNA 3LPFA 5CGTA 4MTVA 3IJ7A 1J0JA 1DP0A 2DSWA 1KGUA 1QNPA 1NWSA 2BY0A 3GNPA 1WCGA 4LPCA 4L4PA 3NCOA 3LPGA 1UUQA 1M04A 3AZTA 1HJVA 5A6AA 4UFLA 2V5DA 1TR1A 1JYWA 1GUVA 1KB3A 4P7RA 1V02E 4V28A 3M46A 1KGXA 4URIA 7TAAA 2J25A 4F9JA 3J7HA 1EQPA 4K68A 3MUAA 4CD5A 1V0KA 4UTFA 3O2LA 4AY1A 4HOWA 3BMVA 1E4NA 3AMLA 4GQRA 2DT2A 2E9MA 1QNQA 1BVNP 4JKKA 2BVDA 3WY1A 4Z2GA 4UZSA 2X0HA 3ARTA 4J28A 3UR8A 2F2HA 4AZ7A 1H41A 1WNOA 3VD7A 3WEOA 2XHYA 4B3KA 4X0VA 4UQEA 3AJ7A 4UFIA 4X0NA 3N18A 1ZL1A 1ZBKA 5E6ZA 5JBDA 3ZT6A 5HPCA 1J0KA 4HMEA 4UOZA 4EK7A 3F5JA 3VDAA 1ZBVA 4W85A 3SCOA 1JNEA 2CBUA 1FFRA 4AIOA 1NWTA 1QNSA 1PJ9A 4UCFA 1D7FA 1LJYA 2VT0A 2FGZA 3UG4A 2CEQA 4F66A 1UD3A 4ACYA 1TG7A 1ZJAA 5BROA 1R7OA 4D6HA 2QF8A 4P7NA 3WQ4A 1VBRA 4TTGA 4ZENA 3T2QA 5A8QA 5E6YA 4KRUA 5A8NA 1BSIA 1OCQA 4S3JA 5AC5A 4AXNA 3AYSA 1BLIA 1Q6DA 2WBGA 4CCCA 3MKKA 1UA3A 1ITXA 2E3ZA 3AIEA 1B2YA 1XSIA 3BGAA 1KQZA 3GM8A 3HN3A 1NQ6A 1VENA 2IXVA 3WF2A 1CGXA 4P8WA 3PBGA 2XM2A 4H8HA 2D22A 9CGTA 3W25A 3KL0A 3KWXA 4OZOA 1X6NA 4JKLA 1UKQA 3CZKA 3FHQA 3VMPA 5BRPA 2XVPA 2ZICA 2V3FA 3T09A 5LYRA 1WZAA 3UERA 1DHKA 1JG9A 3CZEA 4J3SA 3AXHA 2W92A 3MUIA 1X6LA 2E0PA 3FN9A 2YIHA 3OLEA 1MXDA 3BSHA 4IPNB 3IK2A 3CPUA 2YBUA 3ZIZA 1KWGA 1WB0A 2VX5A 4W7UA 3WD0A 1JZ3A 3DYOA 2WHLA 3AHZA 1B30A 3OLIA 4Z2HA 4GIAA 1C92A 4DUXA 4OKDA 4JFVA 3CUHA 4QAWA 2VMFA 2FHBA 3WUBA 2XUCA 2PBGA 1FH7A 1H4PA 3AS3A 2WMHA 5IHSA 2EXOA 1KXQA 2XYLA 1QI2A 1VAHA 3F5KA 3RO8A 1LG1A 3WUGA 1VF8A 1MQRA 3G6LA 2WHJA 1LQ0A 1R8LA 2WZIA 1TZ7A 3N11A 3W26A 2ZUUA 3BCDA 3MV11 5A6KA 3AMDA 3ZT7A 3VD5A 2ZXQA 4AZHA 1JDCA 4AEEA 4FMVA 4HOZA 3VILA 4PUEA 2JE8A 4BCEA 2JEPA 1ESWA 3ARXA 1JAKA 3HMCA 4F8XA 3WNLA 1JD7A 1JI1A 5IDIA 1QPKA 2O9PA 1QI5A 4P7OA 3U7BA 3AHXA 4CU7A 5I24A 1J01A 2G8ZA 1GCYA 3MMUA 1HIZA 1QBBA 1EDGA 1QW8A 5A6BD 1C3FA 2CERA 3CZGA 2E40A 1QVBA 4DM1A 3IAQA 5I0DA 3M07A 4FLQA 2YL5A 3N17A 1OGBA 3B9AA 1R86A 3CIVA 2XIBA 1MWOA 2DGAA 4JCLA 2J7HA 4M29A 3WF1A 4E2OA 4U33A 3VM7A 1NP2A 1TUXA 3ZO9A 1JYXA 4J3XA 3CHEA 3PZVA 2TAAA 3WFZA 4ATLA 1TA3B 3ARYA 4V2XA 2ZWYA 4D6CA 5C8BB 2Q8XA 3MUY1 2XWEA 1CIUA 2XSBA 5CQ1A 3SUSA 4C7FA 3WUFA 2OYKA 3ZJKA 1JDAA 2XVLA 3T08A 1W1VA 4HA4A 3VDCA 2QLYA 4UQDA 2EO7A 1KBBA 1BG4A 1EDQA 2NT1A 5LA0A 1WO2A 3TP4A 4ACZB 2CCRA 1C91A 2WC3A 5CGMA 2X09A 3QR3A 4HMCA 2WMGA 1DWHM 1VIWA 3ARQA 3I3EA 3RIKA 3VGEA 5FOOA 1E43A 3CUFA 4GQQA 4P8XA 3WD2A 1I1XA 3N15A 4M80A 1X1NA 2EPMX 4PMNA 3WQ6A 2XFYA 2W67A 2J7EA 1UQYA 3WKZA 3ZJ8A 1JF5A 1UD8A 3ZOAA 2WHMA 4CVWA 1GVIA 1UQZA 1US2A 5JBFA 1WDRA 2CXGA 2J7FA 3WQ5A 1UD5A 4AD2A 4B3LA 3WH5A 4JHZA 3VKKA 1IV8A 4A3YA 3AHVA 3POCA 4U5KA 1HT6A 1SFSA 4AD3A 1B1YA 4YN5A 3CMGA 1CGUA 2YLAA 5I77A 2XVGA 4GZIA 1XC6A 4QLLA 1UR8A 2QPSA 3MS8A 3ZR5A 1GOIA 2BXZA 1EGZA 4MB3A 2WCAA 1QNOA 1FFQA 3CZLA 2WSPA 4QP0A 3CUGA 4KWUA 4UQCA 5EB8A 1N82A 1WZKA 3MMDA 1G01A 4HA1A 4CD4A 5EFFA 1BYAA 1EIBA 1QI0A 3GXDA 3IAPA 2V5CA 5BYWA 3SCPA 3EDJA 1OIFA 1EA9C 2Y8VA 1J11A 1WKYA 3WD3A 4AISA 2VR5A 2YA2A 3GNRA 2WWCA 1H0GA 4IUGA 1E6ZA 1A3HA 3WH8A 1UA7A 2GJXA 1H0IA 1BPLB 5BXPA 1XD0A 2WVVA 4KMQA 2WVSA 3II1A 3ECQA 4MAVA 2FHFA 4WSKA 4PMXA 2PWFA 4WJXA 1VEOA 1E40A 1UG6A 4PYSA 4AIUA 2X0YA 2WZEA 3AXIA 2ZOXA 4D72A 4N0RA 2O9TA 2XM1A 1CXHA 3QHOA 4MB4A 4J3VA 3SCTA 1TE1A 1B3VA 5BXTA 4R5EA 3SUTA 1GOQA 3AS2A 1QI4A 3F5LA 2G3NA 4AZ5A 1H5VA 2Y24A 3OZPA 4HPGA 3VNZA 4XX6A 2D24A 5D9MA 1UH4A 3A4AA 1UYQA 1C8YA 1F4AA 2GJPA 1VFMA 1K6AA 2JF6A 4LYPA 2VVNA 3VTRA 1MYRA 2Y4SA 4QLKA 4H2CA 1UR2A 1LLOA 1W3KA 1E15A 4XB3A 1NWRA 2DSZA 2PWGA 3KE0A 4V27A 1VJSA 5ABGA 1W2VA 2HVMA 1V3IA 2WKLA 4A3HA 3GXMA 1E4LA 1H49A 2D0FA 4U2ZA 3NYDA 4BS0A 1GQJA 2J79A 1D2KA 1H2JA 4XUYA 4PCTA 1TCMA 1XH2A 3A3HA 1KCLA 2VQTA 5A6LA 1B31A 2ZUNA 3WNKA 3T0AA 5DF0A 3APGA 3W6LA 2E4TA 1XCXA 2YL8A 1PZ3A 3AMGA 4J3UA 4PRWA 5A95A 5LA1A 2VVSA 4NF7A 3U7VA 3IJ8A 4GKLA 1V6VA 1HL8A 2VNCA 3GH7A 3U5YA 1B3WA 1WAWA 1AMYA 1QW9A 3OLDA 5CJ5A 2D0GA 1B3XA 3WMCA 4ZEPA 3PZGA 3K46A 1V03A 1QOXA 2WW5A 4U31A 4MB1A 3WL1A 1VEPA 3JUGA 1TVPA 1XSJA 4D6EA 1KXTA 4CU8A 4D6DA 1OBAA 1V3JA 2O92A 1FP9A 4CN1A 1GORA 4P7QA 1KFWA 1GJUA 3O9NA 2XPKA 4ZE5A 5E9AA 4AZGA 5A6MA 4AD5A 3N13A 1OB0A 1IZJA 3TTSA 3W28A 2ZE0A 1GQIA 4IM4A 2BFGA 1W2PA 3AMCA 3OA5A 3BH4A 2YLLA 4GINA 1ZBWA 2ZXBA 1KWKA 3VDHA 2FDMA 1CGTA 1Q6FA 3CLWA 3K4DA 5CXPA 3FW6A 1HXJA 4ML4A 3DYMA 1PX3A 4TXEA 8CGTA 1WZMA 1BHGA 1E72M 3PZTA 4CD8A 2OSYA 3N9KA 2VCBA 1JZ7A 3BMWA 2WZHA 1WDSA 5I23A 3SIMA 3GBDA 1KR0A 1ZS2A 3A6OA 5IXEA 1Q6CA 2YL6A 2NSXA 1CYGA 2D20A 4B15A 5HXMA 1NH6A 4EE9A 1JNDA 4UQ9A 1XV8A 3WQWA 4KRTA 3PTKA 3HU7A 1PIFA 2GDUA 5D8ZA 4HOXA 5JUVA 1JGIA 3E1F1 1AQ0A 4TVCA 5CLWA 4B9YA 1EHAA 3K8KA 1UH3A 3GH5A 5GNZA 2OYMA 3RM9A 3AIBA 3ARVA 1GOWA 3GYCA 2YDRA 2F8QA 3RJXA 5BXRA 2WVUA 2ZUVA 2NT0A 4W89A 4JIEA 3K8MA 4WF7A 4NRRA 3CMJA 4GO8A 4IISA 4TX6A 1WDPA 2PWHA 2WNWA 3NSXA 1RD6A 3MSDA 2RGMA 4UR9A 3KL3A 3CBWA 4PSRA 2XJ7A 3ZSTA 4PMDA 1HP5A 4W5UA 3BSGA 2A3EA 1K9FA 3AI0A 4KGJA 1UD2A 5JIWA 5D8WA 5TD4A 4GPNA 2D3LA 2J62A 3VD9A 3OLGA 3ZR6A 2VZVA 3ZJ6A 4U3CA 2DT3A 3AYRA 4W8BA 1TVNA 3MANA 3VMOA 3MU7A 4UQBA 3FHAA 3WD1A 4DWSA 2CBVA 1CXLA 4D6JA 1TA3A 3FAWA 2WLYA 1B9ZA 4MPKA 1AVAA 4PN2A 1CWYA 2J7BA 4RE4A 1XSKA 2BY3A 3B9DA 3SCQA 4Y7EA 1PPIA 3ARZA 1C90A 1MFUA 3AZRA 1GHSA 3QGVA 4HU0A 2XFRA 5EFDA 4HZ6A 2VRJA 5EMYA 3RM4A 1U2YA 4W88A 3N04A 1E73M 3W6MA 1QHZA 4FF5A 2O9OA 1E56A 1QI3A 3AIQA 4GI8A 1E1EA 3ZSSA 4JL1A 2DQXA 3L4XA 3GTNA 5HOSA 3RCNA 3RILA 1ITCA 4IPLA 2QPUA 2VI0A 4PMZA 5HPOA 1LWHA 1VBUA 3N12A 1V3HA 4PMQA 5A8MA 3K4AA 1UWRA 2ZX7A 3AMKA 4Z2IA 5A6JA 2ZUTA 4WKHA 4TVUA 2YDQA 3ARSA 3WMSA 2IUZA 1Q4NX 1NP0A 1LG2A 5M5DA 1GOMA 4TTUA 3PZIA 4R27A 4UFKA 4KH2A 4NZCA 3WEMA 1E70M 4ATDA 1XH0A 1Q6EA 1TFVA 1J10A 1RH9A 4QFUA 5A94A 2W5FA 4PBGA
chains in the Genus database with same CATH superfamily
1KCKA 3GX9A 3VGDA 3NYZA 1O95A 3SCRA 4H04A 4F0SA 4CGTA 3WDRA 4GQ0A 4DF0A 3VD4A 3VOFA 1H51A 2HRWA 3HBLA 3BXWA 3HQPA 3CC1A 1XI3A 1GK8A 1A5LC 1MNSA 4KT2A 2WANA 1JL8A 5BU9A 9XIMA 1SW0A 2Y85A 1AMKA 5CPLA 4NJKA 3G8EA 3RLVA 1NF7A 4EWND 2C8NA 4C6FA 2C71A 3MHFA 4KCTA 3ZWTA 4ERGA 3I7SA 4GHRA 4GVHA 5ECVA 3PWAA 1LWJA 3UXDA 4JTHA 1WDDA 4JYEA 1S1RA 3UZXA 3PC0A 3LOTA 1TPUA 3FJ6A 1BFNA 2CKSA 2OKOA 4LUTB 3NDYA 3E2SA 2PDUA 3GVWA 2J6XA 3V4BA 5LHEA 2W4XA 1MEWA 3W07A 2Q3RA 1KQYA 4EAMA 4W93A 1XH1A 2Z1KA 4LAZA 3UR5A 3G1DA 4GC4A 1FHUA 1PX4A 3U4FA 5HBFA 1S46A 4ADSA 1DTNA 1K9TA 4UFMA 4PRTA 1HJSA 2DW7A 1NAL1 1F2JA 5CC7A 1OX5A 1WKDA 1SMDA 4C5ZA 4PCNA 2EEXA 4WEVX 1KCZA 3A3XA 4CD6A 3G0XA 3I10A 3H2AA 3BAXA 5HWMA 3GNNA 1C93A 5JIPA 5J8LA 1HKIA 3M0JA 1JFHA 3PG9A 4TX8A 1XLMA 3S1UA 3W2NA 1VRXA 2BOFX 4LNYA 1HVQA 5D30A 2X41A 1FH8A 3BC9A 5IFTA 4KERA 3T8QA 2DZAA 3WBWA 4PFMA 4PUKA 2ZE3A 4GLEA 1VB9A 4HBKA 2PBOA 4CLMA 1UR4A 1BYBA 1WP6A 3PY2A 1EXPA 3H2EA 3ALGA 5JXQA 1BTCA 3E38A 2EF9A 4XBKA 1C7TA 1JDDA 2DSKA 4ML9A 1OC7A 5J5DA 1UR9A 1W1TA 3MBFA 2BS9A 2ISWA 2YBTA 1FUYA 3E0LA 1FHDA 1ISWA 1TE6A 4JFUA 4WSJA 3E12A 3F2CA 3UD6A 3IIVA 5XIMA 4NRSA 4O1FA 5DEZA 5GQBA 3E3HA 4EKJA 2X1UA 2WMFA 4JCMA 3SY8A 2B7PA 3LCGA 4YTQA 1NOUA 1N8FA 4L9YA 1A4MA 2PF0A 1O68A 3CZ8A 5ABFA 1A0CA 3UA4A 2GVGA 3UCQA 1NWUA 3N6QA 2WHKA 3NG3A 1SQ7A 4KFNA 1AH4A 4JICA 2QUUA 1FWIC 3LRMA 5GNYA 1JRCA 3WQVA 4JTEA 2Y8KA 3WLMA 4H8NA 3TONA 2V2HA 2JALA 4X3ZA 3LSCA 3PFMA 5AHLA 3FYOA 5C9ZA 3MJYA 4K39A 5A3HA 2AGTA 2EJ1A 2ZUMA 1T6MA 2NW0A 2OO6A 3QQ0A 1EXBA 2CZ5A 4UOJA 1RJQA 4JD4A 2Z24A 2FB2A 1GKPA 3IANA 4QM1A 3VKAA 1F8MA 2I5QA 5U4NA 3BLLA 4ZTXA 1UWIA 4N9DA 2E5CA 3M0KA 3HGJA 3LGDA 4DWSC 1Q7MA 4LY4A 3NOYA 1SSDA 5HULA 3AU2A 5KZMA 3F4VA 5DO8A 1KFBA 2QDGA 3G0UA 3V16A 1MQPA 2YX0A 1HP4A 3SSJA 2ZXDA 4E8CA 3MVIA 1VLWA 5CPMA 3H2FA 3S5YA 1PB0A 1W9UA 1VZWA 4JX4A 3WL0A 1X39A 4R7WA 5HWNA 4UUIA 4WY0A 1G94A 4O11A 4AIEA 1SSGA 1OGGA 3P0WA 4IMAA 1MW0A 3W87A 2W63A 2PWEA 3R11A 1CZ1A 4FLRA 4UC5A 3GQYA 4D6IA 2WMJA 2J8TA 1KKRA 2ISSA 3QH2A 3UXAA 2JK2A 4HU8A 3WCZA 1FX6A 5DMLA 4I90A 1PDZA 4P5UA 5CSUA 5A1AA 3LD5A 1V0NA 2ZDSA 4UMAA 1J93A 1P6CA 2HNEA 3UETA 3BDKA 3A9BA 3OG2A 4ZQNA 1W1A1 3PJTA 4GCAA 4LRTA 2DZUA 2VL4A 2QF7A 3HPSA 1GZGA 1WOAA 3VIGA 2OO0A 1V6UA 4IGSA 1ADDA 2JIWA 4B9ZA 3TMQA 4EAYA 3TX9A 1ZY9A 2ZWZA 1RBOB 1E55A 4NXSA 5FF7A 3TZNA 4GNVA 3DFPA 3WFLA 3DHDA 3EZ4A 4O0ZA 5HQLA 4G7FA 3VGBA 2QCDA 2CIPA 4XIMA 5FL1A 3R89A 1TYGA 3M0MA 4IGHA 4Y6GA 3BE7A 1OIMA 2IKIA 3BOXA 1HKJA 1FTXA 5JMUA 2VJXA 1XL9A 2A3AA 3FYYA 1V6TA 1G5AA 4LV9A 1GW1A 1MXGA 4PB4A 2OSWA 1QOQA 2VFHA 3NSNA 1PCKA 3NVDA 5AVNA 1B4EA 1XG4A 3NO5A 3HPXA 4M1RA 3OYZA 1F6KA 3V5OA 3OB8A 3N4EA 2NWRA 3IARA 3RMEA 1BGGA 2WVVB 5CZJA 3P3BA 1R3SA 4MZ1A 2F84A 5LNRA 2WZTA 4AVFA 1JYNA 5A2BA 3SUWA 2QS8A 2ABAA 1QTWA 1HX0A 3KBJA 1XLGA 4N6EA 4HZ7A 1B3YA 3CUJA 1E6PA 4GXPA 5HMSA 4JL2A 2J7GA 1BXNA 1JCLA 2A79A 3OBEA 3VIIA 1BG9A 3MSRA 1W9VA 4RE2A 2AL2B 3C2FA 1G1YA 4KCUA 4MJ2A 1X1OA 5HNTA 4YHEA 3S42A 2CYGA 1NFBA 1XLAA 1EJWC 2VRQA 3EPOA 2WJZA 4Q4PA 4PEKA 5IM51 2NV2A 4N2YA 4E38A 1F74A 2XFFA 3CPRA 3H7RA 1A47A 4RPPA 4BQ3A 1CXIA 2QCLA 3QLLA 5DQPA 8XIAA 4WK9A 4D1IA 1DXIA 4L80A 3MPGA 2Z29A 1CXFA 2AMGA 4U3AA 3RYSA 4S3KA 3JW7A 3S2LA 4H8VA 2H8XA 1X96A 3WF3A 1QAPA 3ARWA 4YWIA 2VFDA 4PUUA 4JTAA 2A3LA 1ZCCA 3S2MA 1OEPA 5LNUA 3H2NA 1ADSA 5KITA 2VZOA 1OX4A 3H23A 2NQLA 3KBVA 3FKRA 4OECA 2YCIX 2BX7A 1XX1A 2VDHA 3VFCA 3AISA 3I7QA 4RDYA 2WSKA 2VUNA 1CDGA 3RGTA 4O15A 3PZOA 3WO8A 4PUDA 3DC0A 1XLKA 4AD1A 1FVPA 3W75A 4JTRA 4OBRA 3LCLA 2WMIB 3HA1A 4IPJA 2ZUSA 2ZYFA 1DIOA 1I2OA 3TC7A 3VIFA 3WNMA 3CQHA 4O50A 4AF0B 4I3GA 4RV8A 1HO4A 3LQLA 2DQWA 3B03A 3DFQA 4RZ6A 2XIQA 4C60A 5FD0A 5HNUA 3NPWA 2VP8A 4PCSA 5LGZA 5GPRA 5RUBA 1CXEA 2IMRA 5M3WA 5T26A 4XZ9A 2P8CA 3ABQA 1GQKA 2J7CA 5K9XA 4J3WA 4QG6A 2QAPA 2VWSA 2FZDA 2HJPA 3W7EA 1E1FA 2WPBA 1UP2A 4UNIA 1NOFA 2WMKA 1B0IA 4KWVA 1IT0A 4POCA 4H7CA 3N4AA 2QNEA 4HMNA 2INEA 3NO1A 4ZQMA 1FWTA 1W8SA 3R2GA 2G3JA 3EX3A 3LLDA 2CBJA 4PMOA 1LBFA 4NIRA 3M41A 3L5LA 3QPYA 2HTMA 5LNSA 3SCVA 2PFHA 2YJQA 3OZOA 4MNMA 3IVUA 3U2ZA 9XIAA 3M6DA 4JTFA 4M8UA 1EWDA 3KTXA 1E9LA 1XYZA 2HS6A 4NJJA 2R82A 3NO3A 1Y65A 1E6SM 4LCSA 2XZ9A 1OSEA 2ZX8A 5CJNA 5I6SA 3WQFA 4S3DA 3WF0A 5CC6A 1S3HA 4FIQA 2PD5A 3EOSA 2F61A 3LCWA 3UYCA 3R8RA 3HV9A 2GFTA 3PZ9A 4QGCA 4RNJA 4JTSA 3VIHA 6XIAA 3UEQA 1H1ZA 2WB5A 2AKMA 5CAHA 3VC5A 4W4QA 2FH6A 1PS9A 4IJRA 2I1OA 1SW3A 4DEFA 2HPIA 3FJNA 1FH9A 3BW3A 3PZMA 1LROA 1WBHA 2FH8A 1GW9A 2DIKA 2QDDA 3D3AA 2WM0A 5C70A 4B5UA 1BKHA 1KFEA 1JCMP 2XIIA 4UTTA 2C6QA 2YA0A 4X63A 1EHNA 1AG1O 2P3ZA 4MG4A 1TV5A 2H8ZA 3JRKA 1GQNA 1CPUA 3MV01 2VR2A 1M68A 2G41A 4WLCA 1PKLA 4LU0A 1L6SA 1E6RA 4IIFA 3W83A 5HR7A 5AC4A 5D09A 1XRVA 3VIJA 2OEKA 2PPGA 3LMYA 4FEZA 6CGTA 1YPIA 1UWSA 4CNOA 1O1HA 3RPMA 2LLEA 4WQ6A 3CHCA 4WRHA 4ROQA 3W1RA 2VDIA 3C52A 4MDOA 1R7AA 5K7JA 4DZAA 3P60A 2QDEA 3TZFA 2D3NA 4A8NA 4GYJA 4GCXA 3VE7A 4BZYA 3LS9A 5HWJA 5FJJA 4J2PA 1SZGA 2DIEA 4Q32A 5F2MA 3DC8A 3MP3A 4JDBA 3U3HA 1EPXA 5CPTA 4PTMA 2CZEA 4DF2A 4WSHA 4K37A 4Y9AA 3DYPA 2DSUA 3EAUA 1JXJA 5E9XA 1QNRA 2QEZA 1AW5A 1I45A 1V3KA 3PK7A 1KGWA 1R2RA 1DJGA 4LBRA 1GGOA 1KV5A 3WELA 3M9YA 1XGEA 3TOYA 1SFTA 1GJWA 4E3VA 2C7FA 4FNRA 3V7PA 3C8FA 4LEQA 3DFOA 1H1NA 1OHLA 4UWMA 2OELA 5EGRA 1W3HA 2UBPC 4JFSA 4CQ9A 1FWRA 1F3WA 1RP8A 3MYOA 4RZ5A 4O1DA 5BU6A 3UNTA 3V35A 3W53A 1VBHA 3QN3A 2O0TA 3RR1A 2YPIA 1D3HA 2BNJA 5I3FA 1U1HA 5G4WA 3MC5A 3CZJA 2UZ9A 2YA1A 1EQCA 4JAWA 3A64A 1HKKA 1TPH1 3ARPA 2OZ0A 4PEEA 1W9PA 4RDWA 1CW2A 1A3WA 4R53A 2ZRWA 4N4QA 2VO5A 5KEZA 4Z08A 3MY9A 3ITGA 3RLGA 3K30A 4S3AA 5C2CA 3HG5A 4MTVA 5HQMA 1WA3A 1VFTA 4FNUA 2P0IA 3TMLA 3GNPA 2BY0A 3GC2A 1OX4B 1HZYA 1UUQA 1IXPA 2VC7A 1HJVA 5A6AA 2V5DA 4DJEA 1FHVA 1RY8A 2JGQA 1V02E 4V28A 4ADTA 4IG2B 3KAOA 3J7HA 3UWWA 3GIPA 3S3GA 3WLIA 3SI9A 4CD5A 4UTFA 1W54A 4AY1A 3GC4A 3I7RA 5G2WA 4Q8MA 3BMVA 4Z1CA 4R9XA 4GKTA 4GQRA 4F4RA 3VFLA 2E9MA 4ZO9A 1ITUA 1BVNP 4BKNA 2BVDA 5AC7A 1R9ZA 2C18A 4KCWA 4GGBA 4QE1A 2F2HA 4O28A 4AZ7A 1H41A 1C9WA 4EPEC 1TO3A 4X0VA 5I09A 3N18A 4XBSA 4U28A 4RKAA 1ZL1A 4QG9A 4HMEA 5FF4A 4EK7A 1KFKA 1ZBVA 5FAJA 1JNEA 1EA0A 1NWTA 4UCFA 2VT0A 4GC3A 5ENLA 4IJCA 1XLEA 1PWLA 4ACYA 4BI6A 4IH3A 3LHWA 3HV8A 3BV7A 3NZ1A 6ENLA 2OGYA 1K3UA 3GDRA 4ZENA 5LZLA 1S5MA 1HUVA 5AC5A 1J96A 1Q6DA 2V69A 1OFQA 3SQSA 1UZHA 1ITXA 1AW2A 3GM8A 3L0KA 3LNPA 1NQ6A 4HT3A 5DY2A 5CC5A 3PBGA 1TJRA 1J2WA 4H8HA 2D22A 3KWXA 4OZOA 4XUGA 4CQDA 1JRBA 4L9ZA 3NXFA 5BRPA 2D2JA 2V3FA 3K2GA 3QSTA 3UERA 4DXKA 3SQMA 1XWYA 1VHCA 4O1AA 1DHKA 4Z1YA 3VUSA 2ZA1A 3MUIA 1X6LA 4DZHA 3FN9A 3OLEA 4IQJA 4N7QA 4K3ZA 1TWZA 3LHVA 3MWCA 2TPSA 2Z1WA 4LS2A 3NA8A 4Q8WA 3DU0A 4Z2HA 2XFWA 3IGXA 4BEQA 3S2JA 3BLOA 1UZDA 3PUDA 2V82A 4JFVA 3PF3A 3USZA 5I3IA 3CL8A 1A49A 3WUBA 2XUCA 2PBGA 4HA0A 4F3HA 5AKQA 5DMMA 2PTYA 5LHFA 4GVIA 1W5MA 3N6JA 1QI2A 1VAHA 3F5KA 5FESA 3MT1A 1LG1A 3UWYA 3S6DA 3GDKA 4S3FA 1R8LA 5IDZA 3THQA 3AMDA 4TX9A 3W7DA 4HK6A 3FSUA 1F5ZA 1JDCA 2I57A 4BCEA 3KRBA 3GYEA 2IS7A 4E2DA 3P5YA 3EX6A 4O18A 2G8ZA 1HIZA 3MZNA 3GTXA 2Z0IA 4UNLA 5AHIA 1KRCC 4B2DD 2BSLA 1IEVA 5I0DA 3M07A 3NL2A 3EEGA 3PWGA 3B9AA 3CIVA 4IF2A 4CEUC 3HG2A 4OUIA 4L61A 4E8GA 3MI2A 3MQTA 4M29A 3CAKA 1V77A 2B7OA 3ZO9A 4J3XA 2C79A 1DJQA 1Q2RA 3WFZA 3S5ZA 4V2XA 1VR6A 2Q8XA 3MUY1 2BOGX 2XWEA 3SUSA 2GGIA 3WUFA 2E6FA 1Z48A 4OHQA 4ADUA 3H2MA 3T08A 1T5AA 4UQDA 5G2HA 2EO7A 3W74A 5LA0A 1ZSXA 1WO2A 3N3MA 1Q2SA 4FA3A 3W1AA 3FLUA 1SO4A 5KTLA 3WMLA 3G1HA 3L9CA 4MY9A 3QR3A 3DKJA 1I8JA 1D7KA 2YGYA 1OFAA 1MDLA 3Q45A 5FOOA 6REQA 1I1XA 1TPDA 3N15A 4KESA 4OT7A 5EBUA 1X1NA 2WJFA 2X1SA 4GFSA 3S8HA 3QV6A 4MVAA 1VGAA 2J7EA 2PEVA 1UQYA 4H9XA 3LCHA 3IGSA 3P67A 2V2DA 1IXOA 1NJJA 1KO0A 3ZOAA 2WHMA 3QMRA 5G5IA 2PDNA 2CXGA 3ANYA 1UD5A 4IZGA 4AD2A 1T41A 4HJWA 3WH5A 2ACSA 4G5DA 3VKKA 4RUBA 1SFSA 1B1YA 3M5VA 5DRCA 3RF9A 3NTYA 2Y7EA 2XVGA 4GBDA 4GZIA 4KCVA 3P82A 2QPSA 4ILSA 1VYPX 3LGGA 3O05A 2IW0A 1FFQA 4QP0A 3MYPA 3CAQA 1KRAC 3MMDA 4S39A 2ZTKA 1G01A 5EFFA 4EWJA 2CC0A 3KBWA 2I5GA 3R0DA 3EDJA 1EA9C 1WKYA 2Y8UA 4AISA 2VR5A 4DJDD 3SJ3A 1EUNA 4UB9A 1ZP4A 1IGWA 4IUGA 4IICA 1E6ZA 2HK1A 3AU6A 1FQ0A 3AALA 1I0BA 4X61A 4MUPA 1H0IA 2PP3A 4C5YA 3GDTA 3GKAA 2PRHA 2A7NA 1I2NA 3II1A 1NEYA 4JQAA 3M44A 4JY9A 2WO5A 4WJXA 4PYSA 4A21A 4LF1A 4AIUA 4IIDA 4UTWC 2TSYA 2WZEA 4NNAA 2ZOXA 4D72A 4ORMA 2ZRYA 4XK2A 1FCUA 2OU4A 3QHOA 3PBUA 3L7RA 7REQA 4C6DA 4QROA 1KFCA 3F5LA 3RLHA 2G3NA 3ANVA 4TV6A 2Y61A 4EPDC 5CJMA 3NPXA 2JF6A 4PUJA 4REQB 3EX2A 4M19A 1MYRA 2Y4SA 1RBAA 4QLKA 1UWAA 3I6EA 3GUGA 3GSMA 2OPJA 4EVZA 2CWNA 1TX2A 3KZPA 4Y9NA 1UR2A 4O0KA 2I9EA 1LLOA 1NWRA 2DSZA 3KE0A 2VXNA 4V27A 3OZMA 2WKLA 5E1QA 1H49A 3JS3A 1O5RA 1W37A 3TJLA 1TR9A 5AHNA 3GE7A 3ITCA 3UPWA 4JN6A 1KV8A 3TNOA 3A3HA 1KCLA 1DJHA 4A6GA 4ZOCA 2VQTA 3VI2A 5HK4A 1YKWA 2ZUNA 3WNKA 4UTTC 2QCDB 3TR9A 1PTDA 3APGA 1EEXA 1ZQ5A 2FMNA 3TW7A 2VOMA 4E4UA 1XCXA 2DVTA 4PRWA 3E96A 3DDMA 4ORIA 3GW3A 5DELA 2PLKA 2VVSA 3U7VA 3IJ8A 4GKLA 3H8AA 4N02A 3UJEA 1V6VA 1YNPA 1HL8A 3NPVA 1L2QA 3GH7A 3U5YA 3BG5A 2PURA 2PDXA 3W86A 1QW9A 1VPQA 3OLDA 1TB3A 2J9YA 3PZGA 1DXEA 2OG9A 4GJIA 1V03A 1QOXA 4LVDA 3S5OA 3PPCA 3W7GA 3WL1A 1EZWA 3ATYA 4RDVA 1XSJA 3V0UA 4D6DA 1OBAA 4F0MA 3ICJA 4F40A 4P7QA 4PFHA 3PR2A 3R94A 1S5TA 1GJUA 3O9NA 2BVWA 4AZGA 4AD5A 3LZ5A 3CJPA 3DI0A 2GSHA 5FI8A 3I6TA 1XQKA 3M64A 5CBBA 1RBLA 1RVKA 3AMCA 3OA5A 3PSVA 2YXXA 3GHSA 2DZVA 3B3DA 3VDHA 1Q7QA 1CGTA 1Q6FA 3CLWA 3V18A 4V15A 3IUDA 2CLFA 3LV5A 4TXEA 3PBYA 4WY0B 8CGTA 1NF0A 1ZP3A 2C1IA 5CZTA 3PZTA 3WJXA 2OSYA 1D8WA 1JZ7A 4FR1A 2WZHA 4QG8A 3SM0A 1ZS2A 4G1NA 4H9UA 3C61A 4QJ3B 1Q6CA 2A7RA 1DJIA 2VEGA 1EJUC 2D20A 4OWGA 1W1ZA 1QXLA 2PZ0A 2PS2A 1U1JA 3OA3A 4LT9A 3W2MA 5AZ1A 5LGXA 3N4FA 5C9XA 1VKFA 4NU7A 1MUWA 3SO7A 1W5OA 3GVRA 3N25A 1LOSA 1XLBA 2RDWA 3C2YA 1L2UA 2JQXA 3ARVA 1GOWA 2D69A 3GYCA 1XLCA 3LHTA 5BXRA 1WBJA 1K8CA 1R46A 2EG8A 2G97A 5BRBA 1RQBA 3CMJA 4TX6A 5A6TC 1WDPA 2PWHA 3AUOA 3NSXA 5HMDA 5D32A 2XJ7A 5C2XA 4PMDA 2RKXA 4IP7A 2NXGA 3OQEA 1UD2A 5JIWA 5TD4A 1UBPC 3RUBL 3PBMA 4Y9OA 3VD9A 1EPVA 2L5HA 4LFYA 5I02A 3F03K 1IEIA 1TVNA 3G1XA 3GWQA 1V8EA 1ML1A 3SN0A 4F0LA 1CXLA 2QQ6A 3SSZA 3FAWA 3A3WA 1QASA 4YS1A 2ZZ4A 4MPKA 2J7BA 1CWYA 3B9OA 3QXBA 1GHSA 3TW9A 1QMLA 3F1QA 5EFDA 3VNMA 1Y5VA 3SR7A 3G24A 1ALDA 1E73M 1KM2A 3W6MA 1QHZA 2O9OA 2CLHA 5JVLA 3IJ6A 5LIYX 2AKZA 4CNSA 1FWNA 1W5QA 3WLTA 1OADA 3ZZ1A 2PDFA 2QPUA 1JJKA 7TIMA 2POTA 4M6VA 1UWRA 3ZS4A 2GGEA 4XZLX 5ABTA 1NP0A 1VHNA 3W7NA 1JVNA 1LG2A 2OEMA 3S1XA 5M5DA 3PNUA 2Z7KA 1GOMA 4TTUA 1XCFA 3NL5A 3WYZA 3LG3A 3LHYA 3WEMA 1E70M 4Z1BA 1DOSA 3HJZA 4NKCA 3QW4B 2W5FA 3EDDA 1EOKA 3BZJA 4TV5A 4GO9A 5TQLA 5FEZA 5AFDA 2E6YA 5C54A 1W3IA 2JKAA 1I6NA 1Q85A 1VCFA 4UR7A 5BWFA 4LALA 1A4LA 1LUCA 5DMYA 5L9FA 4D2JA 3TYZA 3RM8A 3B8SA 4REQA 3SCUA 1R85A 2FMOA 4TOQA 6A3HA 1TPEA 3D6NA 4H83A 2A3HA 2WK2A 1BF2A 1QR7A 3NNTA 2Z1XA 1PHQA 1YE4A 3O1NA 2ZX6A 4I7UA 3N9RA 3L2LA 2EQDA 1CNVA 1Q4WA 2A7PA 3KZSA 2GJNA 5CG0A 1YXCA 1MQQA 3T1GA 1U22A 4X2PA 1HJUA 2ZXAA 3IRSA 5AYBA 4A05A 1QJWA 4C7DA 3TWAA 1W3TA 2CU0A 5ABFB 1T40A 4ZFMA 4K2SA 2HBVA 2WVTA 4LUSA 2PGEA 3EMCA 3L4ZA 4CCEA 3ZM8A 1TX0A 2HSAA 1YIXA 1X6UA 3DOPA 5BZAA 3R7MA 4RCXA 3SRDA 3UZJA 3P80A 2FZMA 3LYEA 3F4CA 1P7TA 2HROA 1M6JA 3LTYA 4LYQA 5J5RA 3WQ8A 5FKYA 1R0MA 3RPDA 1CENA 3A47A 2E25A 5IBXC 4QJ1A 3HGRA 3NSMA 3BV4A 1O4UA 2OZ3A 3BUVA 4MDPA 1M01A 4PGLA 1US0A 1GHRA 2CITA 2BBFA 5A69A 3SCWA 5AB3A 1VEMA 4GNKB 4IMFA 3VPLA 3LHUA 1XR2A 1A5OC 2CESA 1XW8A 2Y2WA 1K8ZA 2J75A 4Y90A 4N4PA 2Z1SA 3POHA 3L0NA 4M6QA 2NUYA 1J2BA 3O07A 2PRMA 4HMDA 4NX5A 1JI2A 3GDLA 2Y63A 4J9JA 5MKGA 3MBDA 3SEPA 2IKJA 2FPTA 3QOKA 5H6HA 3HGOA 2NQ5A 4L9XA 1OFBA 3DEQA 1K1DA 2D0HA 4CQCA 4A4AA 4JEQA 3AC0A 8A3HA 3TCEA 3VVGA 5F4XA 3I6RA 1N2VA 2KX9A 3EKLA 2PWDA 3R0UA 3O7UA 3BMXA 3BQ5A 3IRDA 4CQAA 4ALDA 3KP0A 1KFLA 3MCNA 1FXPA 3E5BA 5HMFA 1OYAA 1BD0A 4JFWA 2P8BA 4QXIA 2Z28A 3VNYA 4WDXA 3CEPA 3MTWA 4D8LA 4KWSA 2QW5A 1ZUAX 5AYXA 1JDFA 3SQLA 3L4UA 1P6WA 2Q6ZA 3WD4A 2XGIA 3RDKA 3UPMA 2FJKA 4YHGA 4DM2A 4MB5A 4A35A 4G2DA 2BXVA 3GW0A 1DWAM 1IEWA 3EMZA 4OQVA 4EOUA 1XLJA 3RX3A 3W81A 1SJDA 1H5YA 1H61A 1YTEA 1S2CA 4I8YA 3RO6A 4K8HA 1WAUA 4JIQA 3PM6A 5GNXA 3QTGA 1GYLA 4X2RA 1RK5A 3NIYA 1XFCA 4HSOA 3WK3A 1W91A 1IWAA 2YCLB 3AIWA 1XUZA 3DAQA 3TXVA 3M16A 2IQDA 1FKXA 1B3OA 5FL0A 2NQHA 1EF2A 3LXAA 4D6FA 3PZQA 1U5JA 4W8LA 2GJRA 4U2YA 2QGYA 1GVSA 1BYDA 1GZ1A 2DEPA 4YYCA 1Z9AA 2PDQA 2V63A 1CGWA 3B8DA 2J7DA 1UD4A 3FA3A 4PRRA 2EPKX 5GJMA 3DZ1A 3P8JA 3NAVA 2EG7A 3KL5A 4RNFA 3E0VA 1UOKA 1R6WA 2DT1A 1NM9A 1YTDA 3FIGA 3WMBA 3WQOA 5LXXA 2INZA 3QGAC 1VH7A 5CCZA 4I9JA 3O16A 1D9EA 4OV9A 1UZ1A 2FGLA 1XFBA 3B9NA 3CQJA 3QFWA 3TA6A 1M5WA 2UY4A 3PUGA 4NILA 4FHAA 2X8RA 1WKEA 3ISIX 4LH8A 1YXYA 4UZUA 4DPQA 1EBGA 4LXFA 4C91A 2X2YA 2BMBA 1FKWA 4KEMA 4OUEA 1HKVA 3TN5A 2XGBA 1IGSA 1GZJA 4DB7A 3WH6A 2VEIA 3HM7A 3TFXA 4WOZA 1JQVA 1JQXA 4Q8UA 4DI8A 1F3EA 3CTTA 4GH3A 2VZSA 2AAAA 1LWIA 4YU1A 2WWDA 1V4YA 4QDMA 3AOFA 3VM5A 4CNTA 4AZCA 3LXCA 4DJEC 1R3TA 5KZ6A 3TYAA 1NFPA 3KS5A 1W1IE 3KCOA 1W9BM 2BZNA 3NEHA 3OO2A 2C13A 2G0WA 2VUYA 4IP5A 1L8PA 1E6XM 3P8IA 5DFAA 2OYLA 2ZIDA 1EFZA 4PULA 3BCFA 3S5SA 5HNNA 1PWMA 1F76A 1DKWA 3W37A 4C7GA 3DG7A 1VPXA 2BP1A 3U2CA 1FA2A 5F4SA 4BEUA 1NARA 3WJSA 4L5ZA 9RUBA 1S38A 4UTMA 1YYAA 2WV8A 1JZ5A 1DJWA 4RL3A 1FOBA 5D4YA 3TVAA 1BEUA 2BOEX 3BURA 1P0KA 1H7WA 7CGTA 4R85A 3WH7A 3M47A 3BZGA 2CKRA 3WLLA 2Z00A 3B8IA 1JF6A 1EH9A 2R1MA 4O19A 3SURA 2QV4A 2ZBTA 5G1YA 3KW3A 1E0VA 2X05A 4J3TA 4HB7A 2BHZA 3W1XA 3V5CA 3MO4A 1ZU8A 1A0EA 3QC3A 3AS0A 3F2DA 3I3DA 3K5XA 2D2OA 3VDBA 2R8WA 1UC5A 2WPGA 1WV2A 4E4PA 4FNSA 3UJ2A 3GZ3A 2PA6A 4Q8PA 1W1B1 3LGEA 3AZSA 3LPPA 4O0QA 4WIWA 3WDPP 2PI6A 1HF6A 5D9NA 1B9BA 4NI8A 4M24A 2GOUA 3M5YA 1TELA 2ACUA 3GHTA 1MW2A 3EMQA 4CN4A 1UWQA 3MA8A 1VS1A 2XH4A 4YTUA 5AN7A 1ISZA 4B90A 1TJ1A 3KLKA 3SFWA 1XGDA 4I9AA 3RXZA 3PPHA 4WUIA 2XTKA 2XVNA 4AQLA 3EWYA 2FPYA 4PMYA 4A3RA 4XD6A 3LMZA 2NQ9A 1MSSA 2Y1HA 2XVKA 1M03A 4Z2LA 3KCLA 3QY6A 3T2PA 2D23A 3UWEA 1C7SA 3KVJA 5D9PA 1EYWA 3F4NA 2WKJA 3TA9A 1ISXA 2EPLX 2VD8A 1BWVA 3LPOA 3H70A 4A3QA 4R7OA 3AS1A 2OGJA 4ZSTA 5AVHA 3HMJG 2CLIA 1A0DA 1E6NA 4Q3MA 4BJHA 3N2OA 1TV7A 3PJXA 2A0NA 3B8TA 3PZUA 1RP9A 1PIGA 3WBAA 2BWGA 2OR2A 3HPAA 2AL1A 4HU4A 3TTQA 3TYBA 3W88A 2E1DA 1JZ8A 3S1WA 4HPHA 2ACRA 4LUIA 4DX3A 5A8GA 1XRTA 3P5ZA 4DAFA 4FLSA 3RITA 1JFXA 4FX7A 2ZX9A 1QU4A 4ZGYA 2J47A 1X1ZA 4GVFA 1FCVA 1K77A 1O1ZA 1T96A 2MUCA 1OFRA 2P88A 2VC9A 3PJUA 2R24A 3WDHA 4JIIX 4AEOA 1CLXA 1AQMA 1O6IA 2FZNA 2PB1A 3SY5A 2VC5A 1GKRA 3G8RA 2ABBA 2Y6ZA 4I5RA 2OXNA 3W1QA 1E9ZB 4OOUA 1ZAHA 2W66A 3B0PA 4U5IA 3O6AA 2P10A 3EBVA 2A5HA 4MHBA 4NAEB 1D3CA 2TMDA 2HVOA 1ZBCA 1OINA 3NZPA 3KEHA 3V75A 1UKPA 1NVMA 2V5BA 2FFIA 2CHOA 2Y88A 3ME3A 1ISYA 3LI0A 4MMWA 3BWWA 1KRMA 1XPYA 2FFCA 2AMXA 5LNVA 1AA1B 3B9EA 4L6DA 1CX9A 2YR1A 1ZRQA 4W7VA 4XZWA 4JNZA 5E09A 3N2BA 3AO0A 1W8GA 2P0OA 1OGSA 3HQ1A 2O7SA 2BY2A 3UG3A 4HSNA 3VMNA 1AK5A 4D6GA 3ERPA 2YOCA 2HNHA 1MVYA 1QATA 4Q6XA 5MF5A 4A8RA 3M4HA 5A2AA 2GVJA 2OTDA 4H41A 2E77A 1JR1A 5CKSA 1EF3A 4AZCB 5H8PA 3K8LA 4Y8FA 4MY1A 2EBNA 4GIYA 1M7XA 5AY7A 2QCGA 5HINA 3LX9A 4W9TA 1ZCOA 3BL3A 5D33A 2VGIA 4BA0A 2CZFA 3W7KA 3B04A 4GIRA 2BHYA 3C2EA 4JQ1A 1TMHA 1ME8A 1Q8JA 3KM8A 3OGSA 3IV8A 5I5RA 1L8NA 1TSIA 1AL7A 2V38A 1G67A 1E3XA 4EPBC 2XN1A 2BGQA 4AZBA 1KXVA 2GUBA 5ECUA 4ZB0A 1LRTA 3ZLHA 3K1DA 2Z26A 3NR0A 1ONEA 4UOQA 2DZSA 2QHAA 3SCSA 4HGXA 3EWXA 4MNLA 4KRZA 4XAZA 2G4JA 2GWNA 4EP8C 3G0SA 4PE8A 2ISDA 3HFYA 4X9SA 4M81A 4LAKA 2QCEA 1W3JA 4OVXA 2Y62A 4WDTA 3WEZA 2E6AA 2J4GA 2W79A 3WZ0E 4LWWA 1MRAA 4H9YA 3TAOA 1K7FA 4RW3A 2PGFA 3HF3A 3MSGA 4KGLA 1XCWA 2YL9A 2QR6A 2C3ZA 1EDTA 2YKKA 5E0CA 1QO5A 2BTMA 1V6XA 2HK0A 4HCLA 3N2CA 1B90A 3RLUA 2RJGA 3EB4A 1EC7A 3KUMA 2CNCA 4KS0A 4IP4A 2DH3A 3LCXA 3IIXA 2FTWA 2W61A 2RHGA 4EXQA 3THCA 4RV3A 5KINA 5C55A 1G0CA 1DE5A 4GYPA 4LYKA 3CEUA 4ATWA 2R91A 3O0FA 1VJZA 4GX8A 1J9YA 1IZCA 2J8FA 1HW6A 3HQNA 3QSRA 5I78A 1OYBA 3GDBA 5C71A 3ARUA 3SDOA 1ODUA 4JFTA 3VNDA 1EJ7L 2WCSA 1LQAA 2XSXA 3B8WA 3DBNA 1V51A 1HL9A 3IUHA 2WC4A 3THDA 3TWBA 3GK0A 3N9SA 1W1PA 1V3LA 2CXEA 3QOMA 1H7PA 4L4LA 2CFFA 2UY3A 1LF1A 4MF4A 4KETA 5EMLA 1MMFA 4NL1A 2PDCA 4JN7A 1MUCA 2G5WA 3WNNA 5CGTA 3WLRA 1DJZA 1YBQB 4US5A 4XIAA 4XWUA 1KGUA 2E7FA 3JU2A 3GO2A 4JTIA 1XP3A 4LPCA 5CSRA 3DFNA 2PCEA 3E0IA 3OEXA 3NCOA 3LPGA 2GYIA 3VNIA 3NZGA 3AZTA 2DUAA 4UFLA 1TR1A 2YYUA 3F2BA 2A21A 1MZRA 3VKDA 1SZNA 3M46A 1KGXA 5FF2A 4E5TA 3OVPA 5FJOA 4J40A 2C16A 5F1UA 1E9YB 2WNNA 4Q8NA 2VELA 3CT2A 1VPYA 2DT2A 2PDJA 1S2VA 4YLWA 4R88A 3OJGA 4IIBA 4JKKA 1AQFA 3WY1A 1KD0A 1XYMA 1DL3A 4GUGA 2Q02A 1KRBC 4EX4A 3UR8A 2CZVA 3SAZA 1OK4A 2P3EA 4N9CA 3WEOA 5C0QA 4B3KA 1YLVA 4MSSA 4QEEA 3MDWA 3SGGA 2WSQA 3SADA 1ZBKA 3GR4A 5HPCA 1YADA 1J0KA 4V33A 3DBPA 1TREA 1VP5A 3MVTA 1AW1A 4W85A 2CBUA 4XD5A 1FFRA 4JQ4A 4XAPA 1K03A 1EP1A 4AB4A 4IL2A 2YYTA 1PJ9A 2IQ0A 1D7FA 4IL0A 4NJHA 2FGZA 3UG4A 4JOMA 3DFHA 5AZ0A 1BSLA 1XIGA 5DY3A 2PZNA 3P84A 1H7OA 1DYSA 4ECLA 1UD3A 5CZ0A 1TV8A 1WXYA 1TG7A 1R7OA 4D6HA 3T8LA 1VBRA 3UCCA 2EHHA 1BQGA 5E6YA 5A8NA 3OTRA 1ELSA 4S3JA 4JYDA 4LAOA 3VZZA 4CCCA 3MKKA 2KAUC 1UBSA 2E3ZA 1B2YA 3CO8A 1KQZA 2Z6IA 3WLHA 5AHMA 3QMTA 3P7YA 4LSBA 4O57A 1VENA 3WJZA 2IXVA 3CNYA 4C6QA 1CGXA 1P0DA 4P8WA 4O8AA 4KWWA 2XM2A 1RUSA 3TCSA 3W25A 3KL0A 4LCRA 4AX7A 3FHQA 4D8ZA 1KLZA 2Q71A 1O5XA 1WZAA 4XAGA 5LYRA 4J3SA 3CZEA 3OW1A 2E0PA 3A24A 1MXDA 3CPUA 4XZHA 3ZIZA 3WD0A 1JZ3A 4JTCA 3AHZA 1M1BA 3EOLA 4GIAA 1R9XA 1C92A 1OK6A 4DUXA 1ME7A 4C1KA 3LRLA 3C0SA 3T44A 3MI6A 3PS7A 3VNLA 1G4PA 1G4SA 3AAMA 4H9MA 1FWCC 4MUZA 2X7WA 3VNKA 3AS3A 3LM7A 5IHSA 1KXQA 1MXSA 4J3ZA 1N55A 4I6VA 3BG9A 3RO8A 4O13A 4K8GA 1Q45A 3WUGA 3LQGA 2WHJA 1BKSA 4NG3A 2WZIA 5A6KA 3FX4A 3MV11 4GUIA 3VD5A 1GEHA 4GACA 4HOZA 3VILA 4PUEA 2JEPA 3CL6A 4F8XA 1AD1A 3DH7A 3G1FA 3WNLA 3KTSA 1EJTC 3AJXA 1JI1A 3ZFHA 1QPKA 1I60A 4P7OA 3U7BA 4IG2A 5I24A 1QBBA 5A6BD 1QW8A 4JTKA 3CIXA 1QVBA 3UCDA 3FS2A 3IAQA 2Z1BA 4FLQA 1VFLA 2YL5A 2J9XA 1OGBA 3NEVA 3VK5A 1R86A 4HQVA 3R25A 1MWOA 3CV2A 2YW3A 2DGAA 3S9IA 4XVEA 4JCLA 2J7HA 1YPFA 3W02A 1K7XA 3R12A 3E2QA 3TAKA 3VM7A 1BF6A 3ELFA 2IPWA 1XIIA 1FXQA 3CHEA 5I00A 2HPMA 4ATLA 2DORA 3ARYA 4BI7A 1S39A 3R8GA 3IACA 3BANA 4NZ1A 2XSBA 4C7FA 5HR6A 4CNUA 3H4GA 4F0KA 4QJ5B 3GHRA 1TV4A 4JR5A 4DJDA 1KBBA 1GVOA 2OZTA 3KVKA 4ACZB 2F6UA 2CCRA 2P1FA 1S5VA 2DFAA 3PPGA 3G18A 2OODA 1C91A 2ZQ0A 5FJTA 4TIMA 3XINA 3H4XA 2WC3A 1DORA 2WMGA 4QS6A 2AQWA 4QHRA 1XLHA 3ZYZA 3GB6A 2RFGA 4PL1A 1S2UA 3I3EA 4R3UA 3VGEA 3EWCA 1ICPA 1ZALA 3CUFA 4GQQA 1UC4A 4IMGA 4M80A 3LM3A 4JS3A 4NZFA 3DX5A 3PUOA 3P0XA 3TSDA 2YDAA 3M0HA 3H22A 1ZJHA 2OLSA 2XH7A 3WLPA 3IV3A 3TXZA 3ZJ8A 2I7GA 4DWDA 3TYDA 3O6YX 1UIPA 1PL9A 3STPA 1VCGA 4BF5A 2VGFA 1AD4A 4L6HA 1GVIA 5TBOA 1WDRA 4FXFA 3Q65A 3SRHA 4BY3A 1IV8A 4HVXA 4YN5A 2MNRA 1CGUA 1PHWA 2VDGA 1KLYA 2YLAA 4ZO8A 4QE4A 3I68A 1XC6A 1UR8A 4G9PA 4IFOA 1TMLA 2WCAA 1EGZA 2BXZA 2PDMA 1QNOA 2Q3OA 4PBEA 4MB3A 1Z69A 3CZLA 3W1LA 1LDCA 1GG1A 4GI4A 2GWGA 1NDWA 1KM3A 1WZKA 5D2TA 2FLIA 2HS8A 4EXBA 1SO6A 3BO9A 4E2BA 4U4MA 4HA1A 1LZOA 3RRXA 2HE5A 2ACQA 3IAPA 2V5CA 3SCPA 2XISA 4HHPA 4M5PA 3FGCB 4NNCA 1OIFA 2EJAA 3BOFA 2YA2A 3GNRA 4DJED 5H91A 3S4TA 1J4EA 2DU2A 5G4EA 1RCOB 1A3HA 1H50A 1WOBA 4PL2A 4GYKA 3WH8A 1JPMA 4JX5A 2GJXA 3MW7A 4PCPA 3MKCA 3S9ZA 2P50A 1XYLA 4HK7A 2WVVA 3FFSA 2CLOA 4F48A 3GTFA 3ECQA 4WSKA 1XIDA 1Q7ZA 3U4AA 3NOEA 3TYEA 3LK6A 1UG6A 1CLKA 4KEVA 1QK2A 3D3FA 1PSCA 1EP3A 2PTXA 1AL8A 5DXYA 4ZOEA 4MB4A 1RALA 3SCTA 3MJMA 2V5KA 4HHHA 4RZBA 3KOYA 3SUTA 1GOQA 1QI4A 2Y24A 4XG1A 4XX6A 1O60A 4PR4A 4Z0JA 1UROA 4LY8A 1C8YA 2ZZ7A 5HUPA 3GG0A 3VTRA 3KFTA 1SVDA 3UVIA 1RA5A 4H2CA 4DQWA 3ES7A 2FGBA 3LERA 2OOGA 5FJRA 1GTHA 1H62A 4IGMA 4C6PA 1W3KA 4XB3A 2PWGA 2G95A 1TIWA 2HVMA 4A3HA 5AYYA 3GXMA 4FF7A 1E4LA 2IPJA 3TIMA 4BS0A 2POZA 4JIHA 2J79A 3WLNA 3NDOA 2R1KA 3MB9A 3USBA 1B31A 4GUFA 2ZADA 1K8XA 2ZVRA 5DF0A 2F7FA 5T9BG 4L56A 1NTHA 1DJYA 4B5WA 3WG6A 2X16A 1LUCB 4J3UA 2ZRZA 3E74A 4LRSA 4NF7A 2X1RA 3EEZA 2DVXA 2Y5SA 2VNCA 1TKKA 1JPKA 3UJSA 2G37A 1A80A 4FO4A 5EMUA 4F0HA 3W1PA 2R14A 3UJFA 4RX0A 1MRQA 1PV8A 3N34A 4RW5A 4ONVA 2WW5A 5H8UA 3O6CA 3IIOA 1TVPA 4XBJA 2O92A 4EF9A 3LENA 1VYRA 1XISA 3LBCA 4EF8A 4Q8OA 3DCPA 1KFWA 2XPKA 4NY2A 5CPNA 5E9AA 3THAA 3N13A 1IZJA 3TTSA 4IMDA 1F3XA 2ZFAA 4IM4A 2BFGA 3SY1A 5LSMA 4HYRA 4FB7A 1W2PA 1F3TA 4UCGA 3QBUA 1HKWA 1NDYA 3NM1A 1E9IA 3K4DA 2PU1A 4PBFA 4GJJA 1ITQA 2CZDA 5TAOA 4K38A 1BHGA 1E72M 3A9IA 3LUTA 4JPGA 7XIMA 4CD8A 2FKPA 3N9KA 4A22A 1AJ2A 2EG6A 1KR0A 3GFYA 5IXEA 1ZGDA 2YL6A 3PAJA 3R10A 3CAWA 3RMJA 1H7NA 4E0CA 1VQTA 3TDFA 3W1NA 5G4HC 1DIDA 5EMKA 4HCDA 1VD6A 1PIFA 2GDUA 4HOXA 1IHIA 3E1F1 2UV8G 5CLWA 3KRZA 1EHAA 2ZC8A 3SN4A 4ICCX 3B97A 3QY8A 1J6OA 1ONRA 1VCVA 4IGNA 1NSJA 1KC7A 3LV6A 3NQAA 3RJXA 2WVUA 3E2RA 4W89A 3C86A 3K8MA 4WF7A 5AOUA 4GO8A 2ODOA 3RG6A 1RD6A 3QZEA 5HJLA 1RLCL 3F4DA 4B92A 2Z2UA 3ZSTA 3WLJA 2WZMA 4AF0A 4MJMA 4S23A 4H3DA 1UJQA 1WQ5A 4GPNA 2D3LA 2NXIA 1K8YA 3ZR6A 3ZJ6A 1ZJIA 2DT3A 3NQEA 4W8BA 2YW4A 3QEZA 1JPDX 2YZRA 3O8AA 1R3YA 2R9RA 2VENA 2C1GA 2PDGA 2CBVA 1UB3A 1TPB1 1TA3A 4C1NA 1O12A 2WLYA 4O1CA 1P5BA 3H2OA 4IUOA 3IK4A 3UY7A 4Y7EA 1PPIA 1MFUA 4Q4QA 3AZRA 4BWLA 2XFRA 5BNKA 3N04A 1KTNA 3NVTA 1RY0A 1M7OA 5C9UA 3TYUA 1YEYA 3ZSSA 5CBIA 4JL1A 5I3KA 4QISA 3H12A 3GTNA 4LC6A 4HNLA 1YDNA 2PCQA 1ITCA 4IPLA 4TR9A 5GVJA 2VI0A 2D73A 1HTIA 1XRFA 4FXRA 1VBUA 3N12A 3NURA 3K4AA 3GVVA 2ZX7A 3AMKA 4IPPA 3CT7A 2E28A 3MP4A 3AXMA 1RQHA 4MLJA 3DKLA 5KZDA 3BICA 4I5UA 4EACA 1P1XA 3HTWA 3H26A 1QWKA 1Q6EA 1TFVA 1J10A 1Q66A 3WBXA 5A94A 1V6YA 2ZUWA 1TWDA 5CLTA 3W7CA 4JTDA 4K1GA 3SN1A 3UESA 3R79A 3U6WA 3UYIA 3DECA 2G50A 5D2XA 3WX7A 1XYCA 4YPJA 4ZO6A 1DXFA 1UP3A 4AWTA 3U8GA 1LM1A 1GNXA 2CBIA 4PMUA 1QUMA 1DIKA 2DY3A 5DT7A 4DWSD 1SO3A 4LC8A 1PEZA 2NWSA 2OCZA 4RNIA 4ZOAA 4W86A 1JCNA 3PPFA 1B5TA 4ACZA 4AXKA 4LVAA 1ODZA 3QY7A 2QUNA 3T07A 2DVUA 2J8GA 1QHOA 3TYCA 1F4HA 4GZJA 2GQ3A 1REQA 1XICA 4B4HA 2VX7A 2V0TA 2W62A 3TN3A 1XUUA 4Q7IA 2XU2A 3A4WA 1J0YA 2R1PA 3RU6A 2DPEA 4UFHA 4MYXA 4DY1A 4Z0SA 1PCWA 2E9LA 5HMEA 2E5DA 2OX4A 1WDWA 2PSNA 4GABA 5FF0A 5DMNA 3FGCA 4PMRA 3S47A 3AFBA 5D2YA 4NYYA 5HJYA 2TRSA 3TQ0A 4H7ZA 4IJBA 4MJ4A 2XIOA 3G5EA 2C0HA 1W31A 2DV0A 1LBLA 1XPGA 3TC3A 3NXLA 3WDIA 3ANUA 3G1SA 1GVQA 3VGFA 1IEXA 4FNQA 1K9DA 2J78A 3S83A 5DCEA 1RVGA 5KSWA 1AZ1A 3A4XA 1TTPA 2RGLA 3EXTA 5I3HA 1Q63A 1R3VA 4GK8A 4M82A 5BOEA 1K7EA 4NASA 3OGVA 4I7VA 3WBYA 4PH6A 4UFJA 1RV8A 6TAAA 5E0FA 1F61A 2WQDA 3PVFA 2VZTA 5D02A 1QT1A 2QUVA 4WGHA 5U7SA 3VU2A 1XIFA 5D2VA 4LVGA 4CVUA 1CGVA 3O15A 7PTDA 1J0HA 4GGHA 4W84A 2X1IA 4KKXA 3KVMA 2QULA 1R3QA 4UTKA 4LF2A 4NSBA 2FPVA 1QDSA 4NAFA 4B91A 1UKTA 3WQDA 2H3DA 3U48A 4EANA 3GG1A 3W27A 3G77A 2PDWA 2Q8ZA 2V3EA 3G3DA 4Q7BA 3G1VA 1Q6GA 3TJ4A 3WJWA 2YB1A 4ASTA 4JGDA 4NHVA 3M0ZA 4XZBA 4H6EA 2OMAA 4KW2A 2VURA 3C6CA 3SFKA 1VFSA 2G3FA 3DHUA 1W0MA 3UGRA 3CAVA 4OBTA 3W82A 1HN1A 1CT5A 3L4VA 1JCYA 3WF4A 1UKSA 2TODA 4WJ8A 4CD7A 3UVAA 4DWSB 1XYFA 1JZ6A 3ABSA 3BW2A 3UR2A 3A4JA 1NY1A 3W7PA 3QV9A 5JU6A 1LRQA 3AIRA 4OE7A 3E6EA 4JKMA 5I2UA 3L68A 3K4WA 4J4KA 1TWSA 1LTDA 2QJMA 1XRSA 2D1ZA 1OT1A 2ZA3A 1HVXA 2HV5A 4HSHA 3G1YA 1BRLB 3H53A 5FSEC 3E2VA 1J5SA 5EBAA 3WNPA 3AYTA 4HP5A 3FVDA 2NZLA 5BCAA 4OV4A 4ZA0A 3CU2A 4PTXA 3FA4A 4DELA 4B5SA 2A3CA 4BQ4A 3PTQA 3QHNA 3QZ6A 4DUWA 4KEZA 1YNYA 4TVDA 1CTNA 2Q09A 4L4MA 2OVLA 3NQ2A 3KX6A 4YCOA 4QLJA 3GXIA 3BW4A 3OBKA 4JYFA 3N73A 4DZ5A 3KVLA 4PC8A 2YCEA 2BHUA 4GFIA 1YTKA 1LOLA 3TK7A 2DZPA 4FXSA 2QCHA 4WVXA 1E0TA 4ZE4A 5CGQA 4HNUA 1UH2A 3GS6A 3NQ6A 4YMZA 3TSMA 4IXHA 1KXHA 4FOKA 4QNWA 2FZ9A 3XISA 7A3HA 4ZODA 4ZMGA 4AD0A 1R47A 4Q33A 3AXKA 4L1XA 3PAOA 3R6IA 2FVKA 4YVVA 3B0XA 2H3BA 4DXXA 1DV7A 1G4EA 1NFGA 4W87A 3VUPA 2BY1A 1DPMA 5M17A 3TU9A 3T4WA 4DYKA 4O8RA 4RR4A 3M0IA 1AFSA 3U57A 2QCCA 2QPXA 2PE4A 4B4FA 3QLDA 1TQXA 1TUFA 1IIHA 2BVTA 4IHCA 4J1OA 3B40A 4L1WA 1ZJBA 3LTSA 3ABZA 2YFNA 2EGZA 3ZMRA 3QYQA 3VOCA 4OIFA 1E4IA 4P7LA 3EPNA 4QCEA 5T91A 3VYLA 4HZ8A 4UBPC 1O66A 4AWUA 1CCWB 5T8GA 5CZSA 4DNHA 3M0LA 1THFD 4NI3A 2UY2A 3M0YA 2DT0A 2OWWA 4WKFA 4CCZA 1OQFA 1H11A 1V0MA 4GY0A 2XN0A 5A6SA 4PB3A 1OWQA 5BMXA 3EWUA 4NJGA 1K9EA 3CWNA 3G6MA 2ZRVA 3LCFA 4S3BA 1KM4A 2FTPA 2J13A 1HQTA 2BXYA 3W72A 4NQ1A 2INFA 5C6MA 2J74A 2EPHA 3G22A 4PTWA 1W6TA 3MKVA 3CB3A 3GIQA 1ZPTA 3OHIA 2G4FA 1E5JA 1Z7AA 2ZRUA 3OBAA 3C8NA 1P7TB 4G7EB 1F8IA 3W6YA 5A8PA 3NPUA 3MUZ1 4UTJA 3Q94A 1RJRA 4YVXA 4HKPA 2IQTA 4M7TA 4PUMA 4BF9A 2IXUA 1KW1A 4FS9A 4E2VA 1UOZA 3TUUA 1E1CA 3T0DA 3LEPA 1GOOA 4LUSB 1DBTA 1RPKA 3RJYA 3B0YA 1FWGC 4Z2KA 4AW7A 3GY1A 2VCCA 2VRKA 3SCNA 2RDTA 3IGHX 1YRRA 4M7SA 1BWLA 3TTOA 2F6XA 2VZUA 1KM0A 1KNWA 1XIMA 3IEBA 1R3WA 3VOJA 3EGJA 3BPWA 4GA8A 3UBPC 1ME9A 1C9DA 1NQKA 4FOUA 1YQ2A 3NGFA 3ALFA 5DCBA 5FSDC 3LU2A 3O06A 5PTDA 5B7ZA 1J0ZA 2GSJA 2IPFA 2NX1A 4JEJA 2ZZ2A 5FJUA 1MUMA 3BLKA 3Q37A 1GVFA 2ESCA 4RLIA 4F2BA 1BAGA 3S2CA 4W8AA 3HJEA 1F9CA 3BLPX 1XXXA 1NELA 4W7WA 1UWUA 2G3MA 2VEPA 3VX1A 3OODA 1SFLA 6ALDA 2HEJA 1M7JA 2HQAA 2A2IA 1QFEA 1I1WA 1UKOA 4FI4A 1L0PA 4GWEA 5HATA 4ROPA 2DUZA 1UCWA 3LLFA 4KBXA 3LN3A 1TV2A 4P8VA 5LIXX 3RX2A 4J35A 1PVNA 4GUHA 1PZ2A 4PSPA 2VM8A 3PSWA 5K3VA 5K2ZA 1JUKA 3FEMA 4MWAC 3GFXA 2X7VA 4NZJA 1RK6A 3G1AA 2Y7FA 1OD8A 3GXPA 3IJLA 5K9CA 2E5BA 1TMQA 2ATMA 4N9BA 5F2LA 3AROA 3NJ3A 2MANA 2WAGA 3L4YA 3SIZA 2GL5A 1RHCA 1FCQA 1OFOA 2ON3A 2V5JA 1SR0A 1DQWA 2X30A 4LUJA 1BTMA 5TNVA 2QAFA 4XD4A 4FNTA 3E02A 2OQHA 4MNJA 3VINA 1KR1A 4INFA 2CLEA 3HURA 3NGJA 4FX8A 1KCXA 1J12A 4AMCA 3ITYA 4RE0A 1GEQA 3CS2A 4HNNA 1VFHA 2QMKA 2D2HA 1XBZA 4LTSA 3TNBA 4XAYA 2P53A 4AYSA 3GDMA 4GZEA 3NQVA 3HZ3A 5HAOA 5FF3A 1JPIA 3EDFA 2GK1B 2OWXA 1MNZA 5CG7A 5CSYA 3T40A 3IJIA 2E8YA 2NUWA 4MLRA 3EOUA 3H2CA 1RR2A 1H09A 2NUXA 3BAYA 1T0OA 4O1EA 5DX7A 2HISA 3UXIA 1OF6A 1WZLA 8RUCA 2A6LA 3BAWA 1ONWA 1EX1A 2QMJA 3W29A 4LS0A 1PKYA 2OT0A 1LL6A 1J18A 4M6UA 4YL2A 5IOBA 4D8AA 3PB0A 4M56A 2I9UA 2V9DA 1K4HA 1X97A 2E68A 4WKAA 3QYSA 3W2LA 3RAOA 3PWIA 2ZZ6A 1E0UA 1QO2A 4AWEA 3Q2DA 4WR3A 3E9AA 3CMFA 3NDZA 4M1BA 3QR1A 1AQHA 2DSVA 4HTYA 4JZ5A 1R2SA 1TRDA 4MNKA 1EOMA 4LUTA 2V30A 4IFKB 1G4TA 4F9DA 4FR6A 3C0LA 1E71M 1NIUA 3V36A 1LBMA 2CHNA 3W38A 1XYAA 2Z4GA 1X7IA 1Z44A 1G6CA 4IX0A 4B2DA 3OU8A 3NWRA 3N14A 3FOKA 4LANA 2OQLA 1A5BA 3UWZA 4I7WA 3CH9A 3B4UA 4ZFCA 1IEQA 2QJGA 4L65A 2DUXA 1SMAA 3KP1A 3EWZA 4BFAA 3GU1A 2QJNA 5DCDA 1RAKA 1JEZA 1JZ2A 2AOSA 2VCAA 3LCIA 4AEFA 4QX4A 2PGRA 3HGSA 4AC1X 3N2MA 4IXXA 4FPSA 4AX6A 1HGWA 1U30A 2Z27A 3T0BA 4AZ6A 3WQGA 4HPXA 3AICA 1RQEA 3D5HA 3B05A 3R5EA 1XQLA 1W17A 3E49A 3S6OA 3WUEA 5C5YA 1A5NC 1R38A 3NL3A 2PMQA 4DXVA 1IQ8A 2V8ZA 3CO4A 1CGYA 3R43A 3EX4A 2CLLA 2EPOA 3VIKA 3AHTA 4LEFA 1E6QM 1R3RA 3IVTA 1V08A 2O9RA 3QQ1A 4DRSA 1G69A 3VZYA 4E8DA 2V81A 3VE9A 2PDKA 5IHRA 1XJBA 3KOXA 3VD3A 1VC4A 1QBAA 1XS2A 2FB3A 2BV9A 3KBNA 3NUKA 1OM0A 1ADOA 3T78A 3BJSA 1OG6A 1A5MC 3T2OA 3ITXA 5FIPA 4LCQA 1DQUA 3UG5A 4OBSA 2XH0A 3TQPA 2PC4A 4TMCA 5SWUA 3JZEA 1ZAJA 1UR1A 3S6TA 4D71A 4GI9A 1G9HA 1Y7VA 2REQB 1TPWA 4JY8A 1UHVA 5DLCA 5BW6A 3W24A 1W9XA 4MIMA 4Q8QA 3E0FA 3EXRA 4MAZA 1Y8BA 1F07A 4O17A 4H6QA 2PDLA 2PGWA 3V0SA 1IXQA 2ZRXA 1J0JA 1A5KC 1DP0A 1QNPA 1NWSA 1WCGA 3KWSA 5CEWA 3PP7A 3UPBA 4C1NB 4QRNA 1W56A 1OJXA 3HO8A 4DNMA 5G1MA 1A5CA 1KB3A 4R9OA 1RXOB 3R4IA 4URIA 1XLFA 1HL2A 1PZ1A 5REQB 4K68A 1WXZA 1IR2A 3MUAA 2GPTA 1A3XA 4DUOA 1EWEA 3REQB 1LCOA 3O2LA 4HOWA 3AMLA 4PTDA 4AYGA 3ONBA 1Q8AA 4Z2GA 1FDZA 4UZSA 4O54A 2O4MA 3S46A 3ARTA 3PNZA 5C9RA 4UTUA 1OFDA 3CUXA 3W1UA 1AH0A 3HG4A 4X0NA 2NV9A 5E6ZA 1F73A 5JBDA 3ZT6A 4WZHA 4KIRA 4UOZA 3F5JA 4X60A 4HU3A 4JTTA 2V6AA 4AIOA