3F1QA

Human dihydroorotate dehydrogenase in complex with a leflunomide derivative inhibitor 1
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
364
structure length
361
Chain Sequence
GDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase
publication title Structure-based design, synthesis, and characterization of inhibitors of human and Plasmodium falciparum dihydroorotate dehydrogenases
pubmed doi rcsb
source organism Homo sapiens
total genus 140
structure length 361
sequence length 364
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3f1qA00
2NWSA 4FO4A 4NNCA 4A29A 5CG7A 1UCWA 4IPIA 5DCDA 3G0SA 2O7QA 1L6SA 3GLCA 3OBKA 3HQ1A 1GEQA 4DQWA 1G6CA 1OX5A 3N19B 4Y96A 4M6PA 4IUOA 2ZZ5A 3EXSA 1XL9A 5K4XA 5DBTA 1FUYA 4JTEA 3SFKA 3TAOA 1GTHA 3M5YA 4Y6GA 1T0OA 3DFOA 2C1HA 5EL1A 3DI1A 4RK8A 3F1QA 5G2HA 3EX4A 4LY8A 3W85A 1LLWA 4DPQA 3KRUA 1XKYA 4LRTA 5CSSA 4GNJA 4K6AA 3UWQA 3M7WA 3W73A 2E77A 1H1YA 1Z42A 4WUIA 2O7SA 2DZVA 3BK0A 3W1RA 4QITA 3NQ7A 5G2IA 3S6DA 3OEXA 4YXGA 3LCXA 3ZWTA 5AHLA 1W0MA 1XCFA 3GNDA 3TMLA 1LLZA 3TCEA 4RX0A 2V81A 2GVJA 3W2UA 2ZA2A 4P61A 3M5ZA 1W5NA 5T26A 5EYWA 4GFSA 1JJKA 4D2JA 4L4LA 4UC5A 3W1NA 3HPZA 3ZR4A 3CWOX 4U4MA 1EP1A 4EOUA 5FF2A 4KFNA 5D30A 5TQLA 4IXHA 4AB4A 1XUUA 3CEPA 4MZ1A 3DHDA 1RR2A 2VC6A 1KTCA 1J2WA 1F2JA 3W9ZA 1FDJA 3HBLA 3NQAA 2YXGA 1KBJA 5BOOA 2Z6JA 3B4UA 4UNKA 4JTSA 2ZTJA 3OVPA 1JCYA 2Z2UA 1FDYA 2BTMA 2WSYA 4YCOA 3E12A 1NF0A 3GK0A 1H63A 1TPUA 1UB3A 3DHFA 1LBFA 3LTSA 2A7PA 3EXTA 4K8EA 2YW3A 4BK9A 1XXXA 3C0JA 2Y89A 4OHQA 3I7SA 2FIQA 1XM3A 2NXGA 1E51A 3NPUA 4JTHA 1VYSX 4FNTA 4ZVJA 1LTDA 1XC4A 3G18A 3G0UA 1SFLA 3WJYA 1KM5A 4UR7A 1F5ZA 1OFOA 1VYPX 2DZWA 3E9AA 3ANYA 4IOTA 4WOZA 2X1UA 5I3FA 3SZ8A 3S8HA 5HWMA 3UWZA 2TPSA 2PRHA 1QCWA 2C18A 4IGHA 2NXIA 1QO2A 1RQEA 5D2TA 1F73A 1ZJIA 2ZTKA 3W7PA 4AHPA 2R91A 1FBAA 3TH6A 1NF7A 1TTPA 3NA8A 2VKZG 4XTIA 3L21A 1JULA 4K39A 3M5XA 1YTDA 1SZGA 1LDCA 1XBVA 5DCEA 2LLEA 2WJZA 4O57A 2ZRVA 4UMBA 1QPRA 2ALDA 3QSRA 5FEZA 3LCIA 3CLMA 2EHHA 1K7FA 5HR7A 4ZMGA 2DJXA 4FX8A 1SZFA 3INPA 4O8RA 1YXYA 1CI1A 5E1QA 2FDSA 1MSSA 4OBTA 5D32A 1TPC1 5KZMA 1TV5A 4UTWA 3A21A 4GE8A 1TQJA 3P67A 2ZBTA 2TSYA 3ELFA 4GUGA 3C2OA 1FXQA 2BWGA 2F7FA 1TPDA 2X30A 1QFEA 1OG0A 3W7NA 2RKXA 4MUZA 3SSJA 4UUIA 2PE4A 2VEIA 5F2MA 2W0UA 3MWAA 1QAPA 3QZEA 4DEFA 5D33A 4RKAA 2W6RA 3GNNA 3QC3A 4AEOA 1PE1A 1I8JA 1QNVA 2B7OA 3DZ1A 3OHIA 1LCOA 4UTWC 5KINA 5EBUA 5D2YA 4HIBA 3NR0A 3G1YA 5DBUA 1F6KA 3G8EA 1K8ZA 1DV7A 1FCQA 1LROA 1G7UA 5HWNA 1FDZA 3M43A 1OFAA 4H3DA 1OABA 2E5CA 3LDVA 3A9IA 3SR7A 4GJ1A 4PL2A 1L6WA 3GR7A 1H7RA 4JD4A 2BX7A 1FX6A 3FYPA 3LM7A 2DZTA 3GVGA 1GTEA 2A5HA 4Z1BA 3LTYA 1JCXA 3P61A 3QMRA 1EP3A 1M6JA 3R5EA 2EF9A 4CQ8A 5HMSA 4NX0A 1UUOA 3RLVA 4QSHA 3P60A 3B0VC 1JQXA 3TNOA 1PCWA 3MHUA 1RQBA 1KW1A 4LC8A 4UTTA 1P5BA 1L2UA 1V7YA 3EWYA 2CLHA 3W7RA 1K8XA 4LVFA 4O1BA 3IIXA 3IIOA 4IMEA 2YSWA 3W3OA 2YPIA 2Y7GA 3CC1A 3W1LA 4WQ6A 2NUWA 2V8ZA 5DXYA 3FA5A 5K9CA 1EIXA 3W83A 3N73A 4O19A 3W2NA 2B7PA 4Z0SA 1AL8A 2X16A 2DORA 3KRZA 3MI6A 4HPJA 3N3MA 4UTTC 1M7PA 5EKYA 4E38A 1JRBA 4JYDA 3RNDA 4ICNA 3MP3A 1L6YA 3ABQA 4NNBA 5SWUA 3WJWA 3HB9A 4FX7A 1ICSA 3QEZA 4Q32A 1J5TA 5DLCA 2EKCA 5AHMA 2HS8A 4TO8A 5FEWA 1W5MA 4LUIA 3L0GA 1EEPA 3PUEA 3SECA 5AHNA 1IXPA 2H3DA 2CLMA 3K30A 1W8SA 3VNDA 1Z41A 4L4MA 4IMCA 3IIVA 2ZYFA 5KZEA 3LERA 4O28A 1TSIA 1Z44A 1W3IA 1LBLA 4AVFA 1QO5A 3G8RA 3WJZA 2VFGA 3S1UA 2X2GA 4WY0A 3FEMA 5CPNA 3M9YA 1IXQA 1GZGA 1LYXA 1OX4B 3WK0A 1B4EA 4A21A 2VXNA 3EWWA 3BG3A 4XKYA 3QYQA 2V0TA 4O17A 3PBUA 4NNAA 4DBDA 4NU7A 5LKYA 2XN2A 3W22A 2XN0A 5AHFA 5F4XA 4LS2A 1EPXA 2QAPA 3MUXA 2ATSA 2YZRA 4Y90A 4IMGA 3SGZA 4I9AA 2J27A 3W7OA 3G24A 3DH7A 3O16A 1H62A 1PV8A 2EPHA 3M5VA 1ZAIA 4IPJA 1ZHAA 1H1ZA 2QCDA 4ZQNA 1TTQA 3B05A 4BWLC 3TQVA 1VLIA 2G97A 1LOQA 3GXTA 3S5NA 4Z1AA 1X8FA 3H54A 4JTTA 3CU2A 4O14A 3LHYA 1IXNA 3SW6A 1Q6RA 2XN1A 4MZYA 1Q3NA 4O16A 1OYAA 2YX0A 4N9EA 5HWJA 4EIVA 4ALDA 4HPXA 4E2DA 2QCEA 3C56A 2R94A 1T8XA 4NJJA 1UUMA 3DAQA 4ORMA 3BG9A 1DL3A 1I2OA 2ZZ4A 5D2WA 3JRKA 4MJZA 3Q94A 1CX9A 3UNDA 1VC4A 2OT0A 5I3IA 1G4EA 4IQLA 1QOQA 3FLUA 3NPVA 1TV7A 3T55A 1H61A 4KKXA 4WX2A 4MJMA 3NDOA 5FEXA 1GJPA 3TC7A 1XDLA 3BLIA 1VS1A 3S42A 5IBXA 4P2VA 1N55A 2V5BA 2QKFA 3UY8A 3JR2A 3NGJA 1F74A 1DVJA 4UTMA 3BW4A 4BFAA 1OFQA 1EX5A 1WAUA 1EP2A 3HF3A 5CZ0A 4DF1A 3P8IA 3S5ZA 5F2GA 5LNVA 5AYXA 2YCEA 3THAA 7TIMA 4FXRA 1ZCOA 1A5AA 1GG1A 1LRNA 3MI2A 4IWWA 4MPQA 3LV6A 3GB6A 3MBFA 1WBJA 4CQ9A 2Z0IA 4S2CA 1O5KA 4R7JA 3TJLA 2FLIA 3TU9A 2PCQA 2ZRWA 4PTNA 3L5MA 4TMCA 3L65A 3LCLA 2WSQA 4GUJA 4K7YA 4JYFA 4WJEA 3S1XA 1VHNA 3M16A 3RF9A 3HGOA 1RQHA 5BMXA 3LLDA 1A5SA 1K7EA 4C1LA 5H2ZA 1G4TA 1KFKA 1TPFA 2JKPA 5F4SA 2FQIA 5F2LA 2Q8LA 3W1UA 1P0KA 2GJNA 1ICPA 3H55A 1TV8A 1H7WA 3C2FA 2A85A 3THQA 1LBMA 3EWBX 1UASA 3BO9A 3CIWA 4UFJA 2CZDA 2QF7A 2PURA 4KFOA 3TXZA 3G1DA 1PCKA 3LV5A 3PBYA 3FOKA 2ZZ2A 4KFPA 5K4ZA 3DI0A 1L9WA 3HG3A 4POCA 5D2VA 3A23A 3L67A 1KM2A 1QWGA 3OIXA 4M6QA 3EX3A 1JQVA 3P74A 5CPLA 1YPIA 1K7XA 2G96A 4OWGA 2J9ZA 1FCUA 1KV8A 2CLEA 1EWEA 5EA9A 4R33A 3H53A 2QDHA 5FF4A 4LOCA 2CWNA 3GR8A 1LORA 1HTIA 2NX9A 2QCLA 4UFKA 2JGQA 3TC6A 1SW7A 4RJEA 2Y6ZA 4EVZA 2WNQA 1YXDA 1KM4A 3AJXA 3QMSA 1ML1A 4LUJA 1W54A 4QJ1A 1OJXA 5AC7A 4K7VA 3WK1A 2HMCA 4JN6A 4E2BA 1EB3A 1TB3A 2IQTA 3PG8A 2Y61A 3MYPA 2V82A 3DBPA 4JXCA 3R12A 4AH7A 1W5QA 2C16A 4Q33A 2VENA 3GKFA 3OG3A 2GVGA 3QW4B 1SPQA 4H4IA 3IVUA 1GYNA 2KZHA 3O15A 1NEYA 4WXZA 5FESA 5LNWA 2EGZA 6TIMA 1JVNA 4QAIA 5C2XA 4FNQA 1W1ZA 1XUZA 4W9TA 3FIGA 3W71A 1R2RA 1AMKA 3PB2A 5HR6A 1K8YA 3D0CA 2P1FA 4ORIA 4RR4A 3WJSA 2E09A 4CCCA 4GBUA 3S1VA 1W31A 1ME7A 2C6QA 3NQFA 5J5RA 4UTLA 2H8XA 1DOSA 1VLWA 4C1KA 1GVOA 3W6YA 5LGZA 1H5YA 3LOTA 1P0NA 4DPPA 2QCCA 4PL1A 1TQXA 3W84A 3RU6A 3U6WA 2G5WA 4HNNA 3CPRA 5FF0A 2NV1A 3GAKA 1I2RA 1WOAA 1KV5A 3MHGA 3NVTA 1TPEA 2V5LA 3LB0A 4AWSA 5G1YA 2JKAA 2VFHA 3GXNA 2WKJA 2V2CA 4PH6A 3NQVA 3W07A 2GQ8A 1YPFA 1DQWA 5HJLA 3P82A 2ZA1A 3BVJA 3NQ8A 4M6VA 3LCWA 2VFEA 3IVSA 1JUKA 4X2RA 3NO5A 4LW7A 3IEBA 3GKAA 2NUXA 2J24A 3G3MA 1TMHA 3W2JA 3MO7A 5D04C 5E0KA 3NQEA 4M7SA 1O94A 4CQAA 2V9DA 1ZNNA 4YLWA 4LRSA 3CQ0A 4AF0A 3W76A 1JCNA 4M5PA 1H51A 3M0ZA 3PC0A 3EWXA 3EB2A 2CW6A 3DFPA 3EKLA 4MYAA 1VYRA 3P62A 4IX2A 2P0OA 4AAJA 3DGRA 4HNTA 1DBTA 1GVFA 2RDUA 3NYZA 1TPB1 2VELA 3FKRA 5AYYA 4WD0A 3C8FA 1JRCA 1G7VA 4JY9A 5CPMA 2WNZA 1W3NA 5DCBA 1JCMP 2NWRA 3B06A 1S5VA 1S5WA 5K2ZA 1FWSA 5C54A 5I3KA 4AXKA 4GWEA 1KFEA 4J9JA 3F4WA 3B0UX 1TRDA 3DFSA 1YDVA 1OFDA 4DO5A 1O5XA 5D03A 3TW7A 1QPNA 1X1ZA 1OFPA 4FHAA 3GX9A 3N9SA 1GT8A 2GPTA 4OT7A 4FIQA 1I2PA 4MKNA 3PSWA 3C2EA 2RDTA 1VPXA 1MXSA 4NVTA 4ONVA 1OF8A 3LHZA 3C61A 5D02A 3NL2A 4I7VA 4O4WA 1H7PA 4B5NA 3EXRA 1J4EA 4M19A 1AG1O 4A22A 1G4SA 3W7EA 4I7UA 5LZLA 3QF0A 3G0XA 1QPQA 5G5IA 3P80A 1I2NA 4OV4A 5CGQA 5H91A 5EMUA 4CLMA 5DY3A 3O6CA 4RZ6A 3TJXA 4CCDA 4FNSA 1MEIA 3TFCA 3N14A 1FXPA 5D38A 4JTFA 4NZFA 3HG5A 3HGSA 4FF7A 2GVLA 4IMDA 4IXXA 3STCA 1KTNA 1OK4A 2B7QA 3P5YA 3S1WA 3CB8A 2FTPA 4QIUA 2Y70A 4IMFA 1YYAA 2QUVA 4XBKA 3SGUA 4JY8A 3QRHA 1R46A 1WDWA 2JBMA 3W2MA 1IGSA 2DZXA 1DKWA 4UTUA 4BF9A 4EWND 2PRMA 5DXXA 4KWWA 3VKJA 1MO0A 4QQ3A 3ABSA 3R13A 4YCPA 1FCBA 1YLVA 5EPDA 2A7NA 3Q37A 1VH7A 2C3ZA 1NVMA 3FYOA 4HSNA 2CZFA 3NQGA 2JGYA 4BI7A 2WQPA 4O12A 3S5YA 1Q6QA 1KM3A 3HJZA 3W7HA 2RH9A 3FKKA 5G4EA 5AHIA 1F7BA 1O95A 3MI3A 1LZOA 2TMDA 5DELA 4XWUA 2A21A 4OE7A 4AWTA 3NZ1A 1QR7A 2X1SA 3Q58A 2JKEA 4LVDA 3W1TA 5AC6A 1GWJA 4O0ZA 5LSMA 3QH2A 2RDWA 2CLIA 3MMTA 4N4PA 1P1XA 3L0NA 3GDLA 2YFOA 1Y0EA 1KTBA 2V2HA 4IJBA 3G1VA 4UR8A 3W7GA 3UQNA 1I45A 3R2GA 3IGXA 1WOBA 3M41A 1QDSA 4CNPA 5KSWA 1FY6A 3IGSA 4JTKA 3V1PA 3NXFA 4QNEA 5DN1A 4FXSA 5KMYA 2FFCA 3CT7A 4XTDA 2X1TA 3W86A 2Y7FA 1HO1A 1N8FA 4YMZA 3PY2A 1YDNA 2QJGA 3YPIA 3GZ3A 2A6NA 1GVRA 1YTKA 3QJAA 2GJLA 3W1XA 4LS0A 5BNKA 4MY1A 5C5YA 4HNVA 3CWNA 1THFD 3NAVA 4CNNA 1HFBA 2C19A 3PULA 5HNRA 2QEZA 3RMJA 4DF0A 1W3TA 2A6LA 4TIMA 3FFSA 3WK2A 1W56A 2CLLA 2QJHA 3NQCA 1F05A 5FI8A 1WBHA 1PVNA 2CZEA 3NG3A 1GQNA 1BWLA 5K3VA 2BXVA 3E0IA 1ICQA 3R89A 3M1ZA 3KAOA 4BWLA 1MEWA 4NXSA 3B04A 4A2SA 3RFAA 3NM3A 1F6PA 3BPWA 1T99A 4JTLA 2FPVA 3UXDA 3LXCA 3PBWA 3TDFA 3KVKA 4PA8A 3BGJA 2ISSA 1YADA 1AL7A 2I9EA 3LRMA 4Z08A 1KFLA 3PR2A 2E1DA 1G67A 4LU0A 4HT3A 1VJIA 1Q6OA 3TIMA 5L9FA 3I65A 3GDMA 3LI0A 2YYUA 4MFEA 4ZQCA 1BEUA 3I7QA 3O63A 3HGJA 1QPOA 3W72A 4NJIA 2XFWA 5GVJA 1SSGA 2CU0A 1FQ0A 1Q45A 2QCGA 4UTIA 1TTIA 4FX6M 1XDMA 1QMLA 4HN4A 4N9BA 3C6CA 3CTLA 1KA9F 1FWNA 3SJ3A 3O8AA 3L9CA 1SFJA 5D37A 4JGDA 3G3DA 4PODA 2DZUA 2Y85A 4X22A 3TSBA 2Q3RA 3LCFA 1HUVA 3LHTA 2OT1A 4JX5A 3PAJA 3NPWA 3IV3A 4RXFA 1YDOA 3HOJA 3STGA 2WPBA 3TXVA 3TK7A 1G69A 2H8ZA 1W5PA 2V2DA 1GVSA 1VRDA 3G1AA 1G4PA 2WSRA 1A5BA 4RZ5A 3N9RA 1OFBA 2A4AA 2HS6A 2CLFA 4O18A 3I68A 3W7LA 1ADOA 1H50A 2CLKA 4XUGA 4UTKA 5D05A 4ZQMA 1SO4A 1D3GA 1VCFA 1WXJA 1BWKA 2FPYA 1I4NA 1HL2A 3W1QA 5C6MA 1IIHA 3A24A 4JTJA 2V30A 4K8HA 5D2XA 4DO6A 3ZWSA 1IF2A 4DBEA 1DJQA 3UD6A 3UY7A 2UV8G 3PB0A 1R2TA 1H7XA 3L68A 1SO3A 3QMTA 3TA6A 3L5AA 3W7MA 1VR6A 3OVQA 1MZHA 3CM4A 4PCFA 5LGXA 3QPYA 1KM6A 4JR5A 5HINA 2YFNA 1A53A 2AGKA 2J88A 4JICA 2I14A 1H60A 1JUBA 3OVRA 4JIQA 1PS9A 2NUYA 2YYTA 1SUXA 2FPTA 1D9EA 3WJXA 1TJPA 1P4CA 3Q2DA 1ZENA 4QM1A 3N34A 3W2KA 2ABAA 2E5DA 1AW5A 4YL2A 2ZZ6A 4UIOA 4N9DA 5DY2A 1NFBA 3SY5A 3CHVA 4RV8A 3UPWA 1GYLA 3N2MA 3W2LA 4O1DA 4HSOA 3TQ0A 2CZ5A 2ZRXA 2HTMA 2ZCGA 4WXYA 3G1XA 3KFTA 1TPVA 4DELA 3A5FA 3NZRA 5I3HA 1XBXA 1SSDA 1V5XA 2FB3A 1Z48A 1ONRA 4FNPA 4R34A 1NSJA 1WA3A 3BV4A 1A5CA 3BW3A 4AMAA 1R30A 1B3OA 3UWYA 2RHGA 4WOQA 1FWTA 2E6YA 2J9YA 3EX6A 2A7RA 1KFBA 3VE9A 3PWAA 4OQVA 1C8VA 2A2IA 2E5BA 1RV8A 5BMWA 1LP6A 2Y7DA 2AAMA 3DKJA 5LNUA 4FB7A 3SI9A 3HIJA 2B4GA 3L2IA 4OGZA 4UFMA 1XFBA 3T40A 3O1NA 4GUFA 5D09A 4HKPA 3LRKA 1HO4A 4PEKA 2VEKA 2OCZA 1ME9A 4I7WA 5E93A 1BTMA 2J9XA 1VCVA 2G95A 4BI6A 3TV8A 4PC8A 3LX9A 4MY8A 2C0AA 1BKSA 1TTJA 2QCNA 1ZFJA 3PUDA 2NX3A 1EA0A 3HG4A 3W88A 1SW3A 2GQ9A 3CEUA 4JTGA 4NUWA 4UNLA 3W7IA 4FEZA 3ATZA 2CLOA 4XQ6A 3C2VA 1OX6A 4GUHA 1DJNA 3NQDA 1U5JA 4O53A 4FNUA 3E02A 4O0KA 3VCRA 4Q4KA 1WQ5A 1XBYA 3BLFA 3LCHA 4Z1CA 2ZZ1A 3EKZA 3PG9A 2Y63A 1K03A 3UZ5A 3GIYA 5IM51 4N6EA 3TSDA 4TMBA 2EAWA 1LM1A 4R53A 3UXAA 4AHOA 3W75A 1RVGA 2VOMA 3GYEA 5FEPA 2PRLA 3UWVA 3KX6A 1JUEA 1SO6A 2QCMA 3W7CA 5HQEA 1C9DA 3QM3A 5CSRA 3EWZA 3TX9A 2Z1BA 4U28A 3PSVA 1K02A 4JS3A 1TO3A 4AHQA 3KRSA 3NNTA 4NJHA 3RK8A 2W79A 1SW0A 5AOUA 1VHCA 3STEA 3ABOA 4A3UA 1X1OA 3UPBA 4NZJA 3M44A 3NQMA 3ABRA 5AFDA 4NJKA 1YXCA 1FCVA 1DORA 2NZLA 3JS3A 2ISVA 3DFNA 1S5TA 4O13A 1OVDA 3NM1A 2GUUA 1A50A 3LCGA 5BRBA 3RLUA 1TRIA 2QDGA 3LHUA 4LC6A 3P7YA 3KVLA 3KVMA 5L6UA 1OF6A 3W7DA 3LHWA 3QPZA 4RCXA 1S3HA 3W23A 4XBSA 3W7JA 3ZS4A 3V75A 1NAL1 3LTPA 5U4NA 1R2SA 2VFFA 5F4WA 3NL3A 4O54A 2WNNA 5I3JA 2TYSA 2D73A 5HULA 3ATYA 3TMQA 4Z0JA 3P84A 1SZEA 1I2QA 1LOLA 3UYCA 1KLYA 2B7NA 1T96A 4G1KA 1PL9A 5LHFA 1YTEA 4ADTA 8TIMA 3EEGA 1OK6A 2CFFA 2E6AA 4JDYA 3T78A 2VEMA 5G2WA 3USBA 4WZHA 5HUPA 4AF0B 1PHQA 3KVJA 3W87A 3S0CA 5I3GA 4ADSA 3N2XA 1TYGA 3PUOA 3WK3A 4K36A 5CZTA 2H3BA 4ZZ9A 3L5LA 2DZPA 3DXIA 3GDRA 3MHFA 4UMAA 3T44A 2QCFA 2ZA3A 4MLJA 3TW6A 4A2RA 3VI2A 1C29A 1D3HA 1B9BA 1DHPA 4JX6A 5KITA 4GC4A 2GQAA 2BLEA 1UBSA 3LRLA 1CW2A 4O50A 5CKSA 5TBOA 4UMCA 4OV9A 4NT0A 1SZNA 4JDBA 2BSLA 2QAFA 3W70A 4HNUA 2JK2A 2OMAA 3MJYA 3W1MA 4BI5A 1ZAJA 4MYXA 1SU5A 1GG0A 3UWWA 2QCHA 3U2OA 4O1AA 1X7FA 4JIPA 4MFDA 1QOPA 3AO0A 2P10A 1HG3A 4WY0F 2FJKA 2NX1A 4Y9AA 4MIMA 2QUUA 4ZL1A 3GDTA 2J6XA 2ZRZA 1OFRA 1OFEA 2H6RA 3KXQA 4O52A 3S5OA 3HG2A 2NLIA 4MVAA 3MYOA 3PS7A 3UWUA 3O07A 5G4WA 3A22A 3C3NA 2YR1A 1ME8A 4LVGA 3W74A 3DFTA 2TRSA 1N7KA 3L0KA 4TR9A 1W37A 4O15A 3TROA 4N9CA 2F84A 4O11A 5K9DA 1AK5A 2QR6A 2YGYA 3M47A 1GPWA 1KFCA 5LNRA 1RPXA 4N2YA 2HSAA 2OZ0A 3IRDA 3R8RA 3VE7A 3P81A 5C55A 5A5WA 2Q8ZA 1PIIA 4CNOA 1KFJA 3LXAA 3QFEA 4ADUA 2E6FA 5U7SA 3PVFA 2E68A 4IX0A 4DO4A 4AWUA 1OX4A 1ZALA 1U83A 3GAYA 1LRQA 1RD5A 3EX2A 3NQ2A 1B4KA 4GRSA 4N02A 3W1PA 3BGGA 4K38A 3PBVA 3DENA 3C52A 3SIZA 2VEPA 4JEQA 2ZFAA 4UFIA 3O6DA 2VFDA 2ZZ3A 4FNRA 3B03A 3B8DA 2YDAA 3IIPA 4YWIA 3NL5A 1LOSA 3VFLA 3NOEA 1LRTA 1EUNA 3LBCA 1O4UA 4DXVA 1KM1A 1AW2A 3C2RA 4EF8A 3MW7A 3NPXA 1TIMA 2WO5A 4MLRA 4N4QA 4N6FA 2WOQA 3MP4A 1UJPA 3IGUA 5LHEA 3O06A 1WYIA 4RXGA 4O4VA 4LV4A 1DQXA 4ZQPA 5FF7A 2WV8A 3GDKA 1JR1A 4LNYA 3NEVA 3M6YA 4Y8FA 3T7VA 4XZ9A 5AC8A 4NX5A 5AYZA 4S2BA 2H90A 1SO5A 3DFQA 5FF3A 4S1FA 3TSMA 2ZRUA 1OHLA 2NV2A 3GXPA 3TR2A 4TU1A 3TE9A 3U8GA 4LVBA 2PC4A 3TUUA 4O10A 1ZAHA 3LGEA 4GUIA 5KZDA 3HMJG 4UXDA 3NL6A 1IXOA 5A8GA 4KWVA 3BW2A 1TCDA 3G1HA 2A1YA 4O1CA 5CZJA 5KTLA 3UZJA 1KLZA 1KM0A 4UTJA 1IIGA 4JTUA 2ZDRA 1VGAA 2C14A 2Q3OA 2FB2A 1F76A 2AQWA 3OA3A 4UCGA 5AHEA 3HPXA 3BG5A 1SQ7A 5BW6A 4RZ4A 5CPOA 2E6DA 3G22A 1O60A 3LXBA 3LHVA 5ABTA 3MBDA 4PFMA 4NQ1A 2Y88A 2C15A 3BARA 3EWUA 4E0CA 3DU0A 1FWRA 1R47A 4WY0B 3FJLA 5J5DA 2QUTA 3T4CA 3B0PA 3QW3A 1XI3A 2B0MA 3TAKA 5G1TA 3PF3A 1RZMA 3O6YX 3KHJA 3WFAA 3HO8A 3TKFA 4XKYB 4K37A 3I7RA 3ZFHA 4EF9A 4NXKA 4ML9A 4OU1A 1H7OA 2ZQ0A 1MEHA 1ALDA 1XBZA 1K3UA 5EY5A 1X6UA 2R8WA 3EX1A 3NQ6A 1WV2A 1EWDA 2I1OA 1JCLA 4H6KA 3LI1A 3G1FA 5TIMA 3FJ6A 1KBIA 4JX4A 3CIXA 2QCDB 4HHPA 4NJGA 2OX1A 2Y7EA 3QSTA 4UFHA 2DU2A 4MY9A 1Q6LA 4QNWA 4LS1A 2YW4A 3E96A 1M5WA 2C13A 4X3ZA 4RLIA 3P5ZA 3MP5A 3KOFA 5AN7A 2Y62A 3TFXA 3P8JA 2ISWA 2ABBA 5IBXC 2DZSA 4GXMA 1WX0A 1VZWA 5K9XA 5CZSA 3F4NA 4LVAA 1GOXA 3W7KA 1M7OA 1TREA 4FIRA 3FS2A 3QQ0A 4Z1DA 3LBMA 4MOZA 2OJPA 1TJRA 4BR1A 3PM6A 1ZY9A 3F03K 4LV9A 4UFLA 1H7NA 2R14A 2ATMA 4MZ8A 4TX9A 4LT9A 3A5VA 4JTIA 5F2IA 2DP3A 3HGRA 1TPWA 3STFA 1W5OA 1TPH1 3W7QA 1VQTA 2VFIA 1EUAA 5F1UA 3O05A 1VCGA 2GOUA 3TQKA 3S9YA 3DKLA 5HUOA 3W1AA 1AW1A 5AB3A 4DF2A 3G1SA 1PHWA 4UTHA 4JNMA 1GVQA 3IIZA 5K7JA 3E49A 5F1VA 4QISA 1FWWA 1SR9A 2X1RA 3C4UA 4X9SA 4ZQRA 3BLEA 4JYEA 5LNSA 2QJIA 1OYCA 3LLFA 2Z6IA 4CCEA 1B57A 3HPSA 3I6RA 4M7TA 3IVTA 2BZNA 3QQ1A 4LTSA 2NXHA 1JCJA 1OYBA 2ZZ7A 2ZRYA 4ZQOA 2DJLA 3L66A 6ALDA 2A0NA 4LWWA 2RFGA 5MHBA
chains in the Genus database with same CATH superfamily
2GGJA 4FO4A 2V5DA 3Q45A 4HOXA 1UQYA 3G0SA 3AMDA 4PRWA 8A3HA 2CKSA 1JPDX 1G6CA 7REQA 1OX5A 3N19B 2UWFA 3WQVA 1FH9A 1US2A 2GLKA 3NSMA 3QZAA 1LWJA 3T2QA 3VKBA 3ITGA 3BJTA 2EG6A 2DY3A 4JTRA 4LUSB 3T4WA 1JG9A 4DPQA 2GDUA 3SRDA 3DC8A 4H8NA 1XKYA 4LRTA 4IIFA 1U2YA 1FKXA 3UWQA 3VUPA 2WK2A 2JIEA 1H1YA 3MWCA 1YE4A 2GVYA 4AD0A 2R1LA 4F48A 2DZVA 4MB3A 3W1RA 5H6HA 4QITA 3AMKA 3NQ7A 5G2IA 3S6DA 4YXGA 2P8BA 5AHLA 1UD5A 1XW8A 5HNNA 3TCEA 3W2UA 3MMDA 3FW6A 3ZJ8A 2YL6A 1K9EA 3MO4A 4AFYA 2F6XA 4JFTA 2ZUTA 4ERAA 1JJKA 1E6PA 4UC5A 3W1NA 3HPZA 2YDRA 3CWOX 3I3EA 5D30A 2HJPA 3VGFA 2G50A 3WCZA 1E0VA 4MZ1A 2VC6A 4ICMA 3F7JA 4RUBA 1GOWA 5D9MA 2VUNA 3NQAA 2YXGA 3K46A 5BOOA 2OEJA 4PCSA 3DECA 4J3UA 1EJ7L 1JYWA 4DWDA 4R9XA 1F61A 1JCYA 4YNGA 2BTMA 1DYSA 1SJCA 5I24A 1NF0A 3GK0A 1TPUA 3GO2A 1LBFA 3EXTA 2HNHA 4BK9A 3C8NA 4QDPA 3TZNA 3I7SA 1K77A 2DSUA 1E51A 3WQ6A 3NPUA 4GLEA 1VYSX 4ZVJA 3G0UA 4DM1A 2DW7A 3R0UA 1P43A 1SFLA 1UH4A 4BEUA 3E9AA 4WOZA 1W8GA 1BHGA 4Q8OA 5HWMA 3UWZA 5F7UA 2PRHA 2PGWA 3C0QA 3TOPA 4IGHA 2NXIA 5IDIA 1QO2A 5D2TA 1XX1A 1ZJIA 1JDFA 4GYFA 3A3XA 4XTIA 3L21A 4DLMA 1CIUA 4U31A 4HA3A 1ECEA 3GXMA 3FHAA 2PDGA 1XBVA 4XAYA 1JDCA 4G7EB 4IP4A 3W29A 3O3RA 2QJNA 2WW5A 2ALDA 1KWGA 3LCIA 1IR1A 1K7FA 3DG3A 1ZS2A 5HR7A 4ZMGA 4O8RA 1EDTA 3WQDA 5E1QA 2YCLA 3UVIA 1X8CA 4D6FA 2PF0A 1TQJA 3P67A 2TSYA 1W17A 3CQJA 2BWGA 2X30A 3D3FA 4Q8WA 3QV6A 4AG0A 4YVXA 2W0UA 3BJFA 3GC2A 3QZEA 4DEFA 1UPPA 1E0XA 5B80A 3KUMA 1JL8A 3N29A 2Z1WA 3OHIA 4B3ZA 3HFYA 2ZX9A 2VGFA 4GK8A 1FCQA 1GPFA 1E6RA 5HWNA 1JD9A 5C9XA 4H6RA 6PTDA 3BWWA 3LDVA 4HMDA 1UBPC 3U3HA 1H7RA 2GGHA 2BX7A 1FX6A 3UZWA 4GYPA 3WH7A 2JFEX 4Z1BA 3LTYA 2IQDA 1MRAA 3EAUA 4QEHA 3SUUA 3T2PA 1H1NA 4LY4A 4CQ8A 4B15A 4NX0A 4B9ZA 4UTTA 1B3ZA 4QFUA 1V7YA 3EWYA 2CLHA 5CC5A 2WYSA 4LVFA 1A3HA 4IMEA 2Z1XA 4XD4A 4F9JA 4RE4A 2Y7GA 5I00A 3CC1A 3T08A 4WGHA 2NUWA 3GUWA 5DRCA 3PZGA 1QK0A 4XBJA 1EIXA 3SB0A 3W83A 3N73A 1AL8A 3MI6A 1HVQA 4TV5A 3RNDA 5FCZA 4ICNA 3AHZA 3MP3A 1L6YA 4W88A 3WJWA 1J10A 3HB9A 1ICSA 9CGTA 3FYYA 1UR9A 2GYIA 3WF2A 3VNJA 5FEWA 3M0XA 1BYAA 1EEPA 3SECA 3HFTA 3D3AA 1IXPA 3EMQA 2ZC1A 1CGVA 3V36A 3UCDA 5A6SA 4L4MA 4PUNA 1NP0A 3IIVA 3WDIA 2J4GA 4XAFA 4E4PA 1WO2A 4WY0A 3B8TA 3VOGA 2QNEA 5CPNA 3M9YA 2XVLA 1IXQA 1OX4B 1PXGA 4XZWA 4A21A 4GJJA 4XKYA 2V0TA 4NNAA 4DBDA 1MW2A 4E8GA 4AQLA 4C6DA 1W9BM 4C5YA 2FZBA 1R0MA 1EPXA 4AYGA 1YW1A 3SGZA 1C3FA 1XIIA 2O4MA 4DB7A 1JCTA 2PLJA 3MANA 2W66A 3G24A 3DH7A 1Y8BA 3GYCA 4IJCA 6XIAA 2VVSA 1TTQA 3T8LA 1MQRA 3B05A 3S6OA 1VLIA 2G97A 1LOQA 4AU0A 4Z1AA 3MV01 1X8FA 2F61A 4JTTA 3LHYA 1XSIA 1Q6RA 1Q3NA 1OYAA 4N9EA 4EIVA 2DVXA 2P53A 4E2DA 2Z25A 3BG9A 4QRNA 2ZZ4A 1VC4A 2OT0A 5I3IA 1G4EA 1Q8AA 3KP1A 1ZUAX 1TV7A 5A69A 4KKXA 5I5RA 1QW8A 3QGAC 2WZEA 3A47A 4KH2A 3GU9A 1XDLA 3BLIA 4FLSA 3NGJA 3ARQA 4BFAA 1WAUA 2CBJA 3P8IA 1QNOA 5F2GA 5LNVA 3BAXA 3DG7A 3B8SA 3LV6A 3AS3A 3GB6A 1QU4A 4CQ9A 2OSWA 1GVEA 2V63A 4R7JA 1BQGA 4Q4SA 3L65A 2BP1A 2WCAA 4GZ7A 4D8AA 2E0PA 4GUJA 3RAOA 1EHNA 2H9AA 4WJEA 3S1XA 3HV9A 1ELSA 3RF9A 1S38A 1CTNA 3KEHA 5BMXA 1A5SA 1K7EA 1RP9A 2V5CA 2JKPA 4ZFCA 5F4SA 3XINA 3RIKA 3H55A 1TV8A 3AS0A 2A85A 1LBMA 1UASA 3BO9A 3CIWA 4UFJA 1PBGA 2CZDA 2XIQA 2ZC8A 1XGZA 2O0TA 2VGGA 3A12A 1UOZA 3CL6A 3N13A 3Q4DA 3KWSA 3VNZA 1E1CA 4G5DA 3TZFA 1EO5A 4V2XA 3L67A 5CGTA 2CBVA 4HB7A 1GQIA 2OYLA 3I10A 3AIUA 4PUEA 3BL3A 3P74A 1EBGA 1K7XA 2G96A 4LUSA 1FCUA 1KV8A 2CLEA 3M0KA 1CGUA 1JYXA 2CWNA 1HTIA 1NJJA 4IMAA 1D2KA 4DZHA 2F2KA 5A3HA 4KWUA 3LUTA 3K4AA 4AY1A 4MPKA 1W54A 1OJXA 2J7FA 3WK1A 2PLKA 3BCFA 1O1HA 1W5QA 2C16A 1W9UA 1H11A 1OINA 3EPNA 4AISA 4C5ZA 1GYNA 1TWDA 3O15A 1NEYA 2PCEA 5LNWA 2FGLA 3MKKA 1WDRA 1XUZA 2RJHA 2E25A 3W71A 3UG8A 4KW2A 3P3BA 1R87A 2XGIA 1O7AA 2WBKA 1I0BA 4J1OA 5A8PA 5IHRA 3KTXA 3S1VA 1ME7A 2C6QA 3QTGA 1NWTA 4UTLA 4AEFA 1VLWA 3VD7A 4GA8A 4N42A 2WMHA 4C1KA 3U57A 1PKYA 3R10A 1S2VA 2Z1SA 5CGMA 4LEFA 2W63A 3AU2A 3B8IA 3C2YA 4QG6A 3W84A 1WDDA 1EH9A 3U6WA 1Y5XA 1E4NA 4HQVA 2NV1A 4TUFA 1AJZA 4LEQA 1WOAA 2V5LA 2E9LA 3VAVA 4H19A 3MDUA 1KQYA 1V0MA 3EBVA 1EEXA 3G2GA 5A6BD 3ZT5A 4F0RA 3LCWA 3TYCA 3EEZA 3LGGA 3UNTA 3IVSA 2BVWA 4BZYA 3VMOA 3GKAA 3M64A 3WENA 3G3MA 3W2JA 3MO7A 2XZ9A 2L5HA 4GMEA 3NQEA 3IPWA 4DNMA 1ZNNA 2XSBA 1UMYA 4YLWA 4UQBA 4LRSA 3CQ0A 4JTCA 4AF0A 1JCNA 4M5PA 3KW3A 1A3WA 3M0ZA 5XINA 2OQHA 4Q8NA 3EB2A 3EKLA 3UU0A 2WQDA 4CD6A 3P62A 3FXGA 4AVOA 1GVFA 2RDUA 2XH2A 2VELA 5M17A 3SN4A 3FK4A 4XK2A 3VCCA 2XG9A 1YDYA 4IPNB 1V6TA 1JRCA 3IARA 3ZIZA 4CD5A 1VIZA 2XVPA 1O68A 3GVVA 3W27A 1SJAA 1S5WA 3CMFA 5FJOA 3SRHA 1LG2A 1DE5A 4XZBA 4JFWA 3PUGA 1M7JA 3TW7A 2ACQA 3B9OA 3WX7A 1QPNA 1X1ZA 2GPTA 3OU8A 4TVCA 1I2PA 3PSWA 1S46A 3C2EA 2RDTA 3E74A 4NVTA 1T6MA 2OZ8A 2VCBA 5D02A 1UWSA 4I7VA 2IXVA 4O4WA 1H7PA 3H7VA 4B5NA 4A22A 3W7EA 1PX3A 3GC5A 4AVNA 4CD4A 3G0XA 1QPQA 5G5IA 3VOFA 1BRLB 2GFTA 5EMUA 2UZ9A 1NH6A 1GZ1A 3WNMA 2P76A 5DY3A 2ZWZA 4RZ6A 3TJXA 4Z2JA 5AECA 4DXKA 5I6SA 3L4ZA 5IHSA 4IXXA 1FWIC 2YA0A 3STCA 2GL5A 4B5UA 3BCDA 1WP6A 3PZ9A 1FWEC 3RPMA 3CB8A 1XLJA 3TWBA 3MJMA 3MCMA 1E71M 4IMFA 3T0BA 2ZX5A 4JY8A 4O8AA 3SY8A 2JBMA 3M4HA 1IGSA 2DZXA 1AMYA 5DXXA 1BG4A 4ILSA 3ABSA 2OR2A 5HANA 1MNSA 1R3YA 5EPDA 2KAUC 1NVMA 3EYPA 3W82A 2R9RA 3VCNA 1MUCA 4BEQA 2WQPA 2J7CA 3LNMA 2RH9A 2OX4A 1LZOA 2TMDA 4LSBA 3HZ3A 4XO6A 4UTFA 4AWTA 1ISXA 5BXPA 3CYVA 1DP0A 1ZBWA 3Q67A 5A2BA 5AC6A 1UPMB 4N4PA 3L0NA 3I4KA 3WMBA 1JD7A 1OM0A 3S46A 5XIAA 2W27A 1I45A 3IGXA 1WOBA 1E3ZA 3WEZA 3V1PA 3NXFA 1JGIA 4QNEA 4FXSA 3CT7A 1VENA 4DO7A 3A13A 4FXFA 1IQ8A 4YTSA 2XIJA 1XLEA 5C9WA 4JN7A 1UOKA 2PDNA 1NOUA 5HBFA 1YTKA 3HM7A 1SGJA 5BNKA 2CXGA 3CWNA 3NAVA 4CNNA 1EJUC 5HNRA 3MZ2A 5CC6A 1CBGA 4DF0A 1CLVA 1XR2A 1EZWA 3JZEA 3FFSA 3F5KA 4U10A 3NQCA 4D72A 1WBHA 1XLDA 4HTYA 1R9XA 1WXZA 3E0IA 3CZEA 3KAOA 4BWLA 1MEWA 1ENUA 4FA3A 4M6UA 3N4EA 4PEEA 2C1IA 3NDZA 1YADA 2AL1A 3T2OA 4PUWA 1WDPA 4Z08A 2YL8A 1EJTC 3ANUA 1ZZMA 3H4GA 3PZIA 4J3VA 1QW7A 1P6BA 4MFEA 4CN1A 5J8LA 1AD4A 1BEUA 5ABEA 4PB5A 3O63A 2ADAA 2OO0A 4C6IA 2QVNA 5HNTA 1DWIM 4Z42C 3EPMA 1XIFA 1FH8A 2XFWA 1V6VA 1Q45A 2I17A 3AYRA 1QOXA 3A6OA 3BH4A 4HN4A 1KA9F 1PTGA 3SJ3A 2GQ3A 3L9CA 1SFJA 1F8MA 2DZUA 1D3CA 1V3KA 1EKOA 3B9DA 4X22A 1PWLA 5CXPA 1PX4A 1HUVA 4XZNX 1NY1A 2PWEA 2YBUA 4RXFA 2IPGA 4B5VA 1G69A 2H8ZA 1YPXA 1ISZA 4PZVA 1LQ0A 2MANA 1G4PA 3NDYA 5FJRA 2DUZA 5FAGA 3N9RA 1BQCA 2NV9A 5JIWA 4C6BA 2XINA 1V79A 1TG7A 2HXUA 4UTKA 4P7OA 4ZQMA 1EJVC 4F0LA 2D0HA 4HMNA 4JTJA 1RHCA 4DO6A 4H7CA 4EXQA 1QI2A 3PB0A 3N6JA 2BODX 4NHVA 1SO3A 3F4CA 3BJSA 5FJTA 3OVQA 1MZHA 4PCFA 1J0KA 1XIMA 2AGKA 4JICA 1A80A 1JUBA 5JH1A 4KWSA 1CDGA 1PS9A 2D2HA 1NOWA 3WJXA 2I5QA 4ROPA 2CYGA 3N15A 3HU7A 3W2KA 1QXLA 4L9ZA 3KTSA 3K8LA 3FN9A 3L2MA 4RV8A 3R0KA 5CC3A 3W2LA 4GY1A 3LU2A 3TQ0A 2CZ5A 4WXYA 2ZCGA 3KZPA 1TPVA 5FA5A 3NZRA 2XSAA 1GKRA 1ZJBA 4LB4A 1XBXA 5I3HA 3GXIA 4YPJA 1SSDA 2FHFA 2FB3A 2IXUA 1Z48A 4GIRA 1ONRA 1NSJA 1WA3A 3BV4A 4GI4A 1B3OA 1SVDA 1XIHA 4L9YA 1S2WA 3D6NA 1KFBA 3PWAA 2RGMA 3V16A 5EMJA 4OQVA 1C8VA 4E2VA 4LCQA 1E72M 4XSMA 1UKOA 2WXDM 1LP6A 1ZSXA 2JEPA 3MQTA 4AZ5A 1E9YB 2PDQA 3KZSA 4HU3A 2AAMA 5LNUA 4DJDC 3HIJA 4URIA 3IJDA 3O1NA 4Q4RA 2O92A 3IRSA 4R85A 4H2HA 4HKPA 1QNRA 3LRKA 1HO4A 1VEPA 5FSDC 2YOCA 4W7VA 3KM8A 1MNZA 1E6ZA 4I7WA 4HPHA 3GNXA 1VFHA 4Q8VA 1YHTA 5IFTA 2X7VA 4PC8A 3LMZA 5A6MA 2TODA 4ZSUA 3AC0A 1Z69A 3PZNA 4U5KA 3W88A 5D4YA 4DWSD 4JTGA 3P0XA 1LL4A 3OA5A 3U4AA 4HHMA 4FEZA 1PIGA 1OX6A 1W1A1 1B0IA 1KFWA 5E6YA 3AIEA 3EWCA 1NWUA 4F3HA 4L1GA 3GW0A 1XBYA 3ABZA 3LCHA 4Z1CA 3DYMA 4LQ1A 3PG9A 3GIYA 4N6EA 3TSDA 4P5UA 4TMBA 1LM1A 3UXAA 1RVGA 4KRTA 3LPGA 3LN3A 2PGRA 3KX6A 4E4FA 4G56A 3FA4A 1Y5WA 1LQ2A 5HQEA 1WUFA 3TX9A 3PZVA 3AQUA 4D6IA 1DXIA 4JS3A 3SCVA 3RM9A 3VOIA 3UCCA 4MJ2A 2W79A 1SW0A 3MUY1 4S23A 1VHCA 3STEA 3UZYA 4A3UA 2C7FA 3GVQA 4DI8A 1UHVA 1XG3A 3PAOA 1FCVA 1DORA 4HYVA 4F40A 4DBWA 1RUSA 3CWHA 2ISVA 1S5TA 1OVDA 3LCGA 3RLUA 1UWQA 4LC6A 4HTBA 3RG6A 3TN4A 5L6UA 1F3XA 4HOWA 2GJRA 1ZP3A 1BYCA 1XRSA 3W24A 4RCXA 1S3HA 3W23A 2PPGA 3RU8X 4LAOA 5E70A 3VZZA 2AKMA 5DT7A 1I6NA 3NL3A 2E9BA 1XSKA 3QLDA 2WC7A 1TZ7A 3WDRA 5HULA 3ATYA 3BICA 4PMNA 1SYTA 5ABHA 4LYRA 1SZEA 3AXHA 5TAOA 1KLYA 4GQBA 3A64A 3GG1A 1YTEA 1XGEA 3EEGA 3PBMA 4RDZA 1CB7B 3BAKA 3W53A 3WY1A 3QKZA 3T78A 1PPIA 3USBA 1P7TA 1KBLA 1MQQA 1A5OC 5I3GA 4PUMA 1GGOA 4IP7A 4EPKA 3KBJA 3DXIA 4J28A 3T44A 4LXFA 4MLJA 4MF4A 4PMQA 2P3ZA 3BTNA 1V03A 3WLRA 4GC4A 2VOTA 4PTWA 4GGBA 3W28A 2RDXA 5AKQA 4ASTA 1CW2A 4FR6A 5TBOA 3NSNA 4OV9A 4JDBA 4IFOA 1AODA 3G5EA 2EBNA 2OQYA 2YLAA 4BI5A 4HMCA 5BU9A 1SU5A 4GXPA 2FHBA 3WLJA 1HXJA 1E0TA 3OBAA 4ZOCA 1QOPA 2P10A 3B4YA 3V4BA 4KEUA 4D6EA 4ZL1A 1BGAA 5HJXA 1OFRA 3MYOA 1EQCA 1JPMA 3O07A 3QQWA 3JUGA 4DYKA 1ONWA 2TRSA 1ZP4A 1WZLA 5CJMA 1YEYA 3TROA 5AZ1A 4N9CA 5I06A 2F84A 3F4VA 3JU2A 4YTTA 5K9DA 3EDFA 2QR6A 1TUXA 2VRJA 1GHRA 1RPXA 4N2YA 3UXKA 2O9OA 2O9RA 2PDIA 2Q8ZA 4CNOA 1KFJA 2OEKA 3MS8A 4ADUA 2VRQA 5AY7A 3CPUA 2WHLA 3EX2A 3WLNA 3BGGA 1XIGA 1CXIA 3CPGA 3GTIA 3C52A 1JF5A 3GWQA 3NURA 2D0GA 3O6DA 4FNRA 3T0DA 3B8DA 1XGDA 4G6CA 1YBQB 2YDAA 3NL5A 3NOEA 4B5TA 5B7ZA 5DMLA 3THUA 3LBCA 1O4UA 1DTNA 4DXVA 2BVDA 3MW7A 4AZCB 4MLRA 4S38A 3QOMA 4I90A 3WDJA 3WNPA 2WOQA 3O06A 4ZO9A 5HMFA 1UZ1A 3VFCA 3OTRA 3T7VA 3AIWA 4JTDA 1JAKA 5AC8A 3NSXA 3WH5A 1SO5A 2ZRUA 3SCPA 3TR2A 4P8VA 3TE9A 1Q8JA 1TX2A 4CU6A 1LG1A 4O10A 2ASHA 1Q6DA 4GUIA 3SAZA 1IXOA 5A8GA 4DJFA 1TCDA 2J47A 2A1YA 4O1CA 4OTKA 4P7NA 6REQB 3WF1A 1GONA 3WQGA 1KLZA 2OPJA 4PE8A 2C1GA 3KRBA 4C7FA 3VGHA 2AQWA 4IPPA 4X2PA 4RZ4A 5CPOA 1HKJA 3L4UA 3CHDA 1T40A 2CKRA 1O5RA 3NYDA 3KDNA 4P7QA 3DU0A 1VF8A 3U2EA 2QUTA 3T4CA 4OUEA 4B3KA 1BVZA 1K6WA 2OG9A 3QW3A 3K4WA 2X7WA 4JAWA 5CAKA 1BTCA 3O6YX 3BE7A 4GVHA 3NGFA 2NQZA 3TKFA 1NP2A 3DGBA 4K37A 3I7RA 3ZFHA 1HJXA 3ALFA 3AZRA 1CWYA 1ALDA 1XBZA 1K3UA 2OKTA 2PWGA 3DIPA 1XH1A 2R8WA 3CAQA 3UPMA 1AD1A 4XKMA 1WV2A 3VIJA 3LZ5A 3LI1A 4AIBA 3G1FA 5TIMA 1FP8A 3IJ7A 4AIOA 2QCDB 2POZA 2OX1A 1OT1A 1DIOA 3CASA 3VK5A 3E96A 5JIPA 1GYMA 3PTMA 2DH3A 3OB8A 2G3NA 3AXIA 3TFXA 3V18A 4GX9A 5IBXC 3VU2A 5DMMA 4NSBA 4GXMA 1DJYA 3WBWA 2HBVA 9XIMA 1FTXA 2PF8A 2ZICA 4GX8A 3W7KA 1JZ4A 1M7OA 4N7QA 1JFXA 1CYGA 3K13A 1XLHA 3LBMA 4UQCA 1TJRA 2OSYA 2AAAA 2PB1A 3W38A 2R14A 1VFSA 1GVIA 1MUWA 1PX8A 2DPEA 4JNZA 4TX9A 3MSYA 2R1PA 2VT0A 4JTIA 4REQB 5A2CA 4X0NA 3STFA 1TPH1 1EUAA 2BXYA 4PMYA 1N2VA 4IQEA 3KBWA 3NTYA 4B4FA 1HIZA 3G1SA 3IANA 1GVQA 4OBSA 2E67A 3GD6A 3UGRA 1SR9A 2EPOA 4X9SA 1E5NA 2R1KA 2QJIA 1OYCA 1NQKA 2X0YA 1E9LA 3I6RA 4LTSA 4ZQOA 2DJLA 3L66A 4ZE5A 4F8XA 4D1JA 1YNQA 2PTYA 5DEZA 2AMXA 3AISA 3VD4A 5DCDA 3UF9A 1SZRA 1WB0A 2O7QA 3OBKA 1RLCL 1TR1A 4G9PA 1GEQA 3VNIA 5FJIA 2X8RA 2HEJA 4E4UA 3GTFA 1UR0A 4PTVA 2FH6A 2ZXQA 5K4XA 3RO6A 5DBTA 4JTEA 3SFKA 1W3JA 3FAXA 4MMWA 3M5YA 3RR1A 3H23A 4D8ZA 4C65A 2DT2A 1A4MA 3F5LA 4LY8A 3W85A 1LLWA 3ARTA 5LIKX 3BZGA 4X61A 1IWPA 5CSSA 1MI3A 4GNJA 4ZOEA 1FVPA 4Z2KA 3M7WA 3DFYA 2E77A 4UNIA 1XLKA 4WUIA 1FWCC 1RH9A 2RGLA 4TXEA 4M56A 2D2GA 3IUDA 3TTYA 2Y1HA 1W0MA 1NFPA 2OO6A 1XCFA 3GNDA 2ZUSA 1LLZA 1EGZA 4RX0A 2ZX7A 3SCUA 4QQUA 1K8CA 5I2UA 5EYWA 4P7RA 4GQGA 4D2JA 4PB3A 2QMKA 4EACA 3ABXA 4U4MA 2QW5A 1DWAM 5JH2A 1UR1A 3OVGA 1K9TA 3N11A 4XUYA 2YCJA 5AYBA 2XFRA 2AMGA 2V3EA 1XUUA 4W8AA 1J2WA 1F2JA 1FDJA 3HBLA 4J2PA 1KBJA 4XISA 4AZ6A 1U33A 1RJPA 3PANA 4UNKA 3OVPA 2DZBA 2GWNA 4YCOA 3S2CA 1UB3A 3DHFA 3DOPA 2A7PA 3IUIA 1A0DA 4H9UA 1OG6A 3HPFA 1GKQA 4LNCA 3LZ3A 4BF5A 3C0JA 2Y89A 4KGJA 3OLIA 2NXGA 1TZZA 2OLAA 3VGDA 4JTHA 4FNTA 3VIMA 5FJPA 1LTDA 4US5A 1FWBC 3VDCA 4UR7A 4LBSA 1O1ZA 2DZWA 2J74A 2X1UA 3S8HA 3SZ8A 2TPSA 3B8VA 1QCWA 1FOBA 1R38A 4Y8EA 1W1IE 4LCSA 3V3WA 2PP3A 4WJ8A 1H2JA 3TH6A 4PMJA 1TTPA 3CBWA 1XDJA 2XISA 3LD5A 4H6QA 4C91A 4CN4A 1UWTA 3WUGA 4F0KA 4K39A 2R1MA 3CHFA 4GC3A 1YTDA 2PLCA 5HOSA 2PDMA 2WJZA 1EF2A 3AHVA 4UMBA 2O55A 3GHTA 1VPYA 5FEZA 1K9FA 3CLMA 1V6UA 4DI9A 1VP5A 1CI1A 3LM3A 2FDSA 1MSSA 5E9XA 4RV3A 4UTWA 5CBJA 7PTDA 1NELA 2BOGX 1BYBA 1F3TA 3OIHA 1OG0A 1FRBA 3W7NA 3ZVHB 3BMXA 3URNA 3KCOA 5F2MA 3MWAA 4KCWA 1ODUA 1A4LA 5D33A 3CQKA 3VC5A 1XLBA 5KZ6A 3DZ1A 3N2BA 3OLDA 1J0HA 2MUCA 4BQ4A 2FZMA 5KINA 5EBUA 1JZ7A 5D2YA 1UC4A 5DBUA 1L8PA 3ARPA 1DV7A 3BSGA 5T8GA 3FXYA 1FDZA 4JTQA 3M43A 1GORA 3B9AA 2YJQA 1OABA 5DO8A 4JCMA 2E5CA 4PBEA 3NZQA 4U2YA 3AXXA 4JD4A 3FYPA 3UJEA 3LM7A 1YBQA 2VR4A 1GTEA 2A5HA 2CPUA 3P61A 3FJ4A 2WVVA 3SFWA 3QXBA 3R5EA 3VINA 3WD2A 1UUOA 1C8YA 3DC0A 4QSHA 3P60A 3B0VC 4AZCA 3MHUA 3KLKA 1RQBA 3H21A 1P5BA 1V6XA 4S3JA 3N3TA 3PZUA 2XUCA 4Q7IA 4M8UA 3W1LA 4WQ6A 2YL9A 3BDKA 4IGSA 4K8GA 3AIBA 3C0LA 4JFSA 4JQAA 1H09A 4O19A 3W2NA 2B7PA 4Z0SA 1XS2A 3M7SA 4UTTC 3V0UA 1JRBA 3RM8A 3RX3A 2BVTA 4NNBA 5SWUA 1VEMA 4FX7A 3QEZA 4Q32A 1QNSA 1U22A 2EKCA 1IYXA 4K1WA 3UZXA 5LXEA 5H8PA 1Q6CA 2WVSA 4JN8A 4J3ZA 3FEQA 3GBEA 2BS9A 1ZBKA 4ICCX 8CGTA 3TYEA 3U2ZA 3S83A 4D9PA 3LERA 3SQLA 4Q4PA 1QO5A 3IAQA 4KIEA 1I1XA 1T7LA 4L61A 4S3DA 1KRCC 3FEMA 4EXBA 1J9YA 4ZO8A 4FPSA 1GZGA 3WK0A 3EDDA 3BG3A 3UVAA 4YU1A 3S47A 2J25A 4NU7A 1Q6GA 1XYLA 4GKTA 2XN2A 3W22A 4XAZA 1XLIA 5LYRA 4NI8A 3BSHA 4Y90A 2W61A 4F2UA 1XF0A 2J27A 1H49A 3W7OA 2Q6ZA 3GHUA 4A3RA 1H62A 1YMYA 2EPHA 3M5VA 1FWAC 1ZHAA 2QCDA 4ZQNA 3M07A 4R9OA 1FWJC 4FZIA 4LJ3A 1F3EA 3CU2A 4O14A 3URQA 4HZ8A 4MZYA 4O16A 2YX0A 3F2DA 1B3VA 4ALDA 3C56A 4CKQA 2FFIA 4MWAC 4NJJA 4I8DA 1UUMA 1QI0A 3LSCA 1I2OA 2BHUA 5D2WA 3JRKA 3EGJA 2XWEA 4MJZA 1CX9A 3UNDA 4YYCA 1QOQA 3NPVA 4DHGA 1ZCCA 3WNOA 3T55A 1H61A 3REQB 1PZ2A 3RUBL 3W4RA 3NDOA 3L12A 4YHGA 5FEXA 3ZLHA 5TF0A 3JR2A 3AHXA 1DVJA 4LANA 1H0IA 1UKQA 1XD1A 1MQPA 1EX5A 1EP2A 3HF3A 3OODA 5CZ0A 2G3JA 1E40A 3N18A 4DF1A 3S5ZA 4REQA 3QY8A 1SMAA 3WLSA 3THAA 7TIMA 4FXRA 1ZCOA 1GG1A 1LRNA 4GABA 4IWWA 1O66A 1RAKA 4GVIA 1EPVA 2WJDA 2YCKX 2G4FA 3TJLA 2O4QA 2PCQA 1MRQA 1JPIA 1J96A 1FHDA 1WUEA 5EFFA 3LCLA 2WSQA 5HATA 4K7YA 1HVXA 1DE6A 4JYFA 1IWAA 4BJHA 3OZMA 4L80A 1VHNA 3HGOA 2PA6A 3WEOA 3DCPA 5H2ZA 1KFKA 2G8ZA 1TPFA 4WSKA 4HOZA 4FLOA 5F2LA 2Q8LA 1P0KA 2GJNA 3HQPA 3C2FA 4PTMA 3EWBX 5I03A 3S3GA 2PURA 4KFOA 3TXZA 3G1DA 4C6PA 1B9ZA 3LV5A 2PMQA 2PP0A 4KFPA 1HGYA 1A3XA 2VUYA 2FZDA 3A23A 2GZXA 3FVDA 2CC0A 4S3CA 2VURA 1XV8A 3KBSA 3EX3A 1JQVA 4L1XA 1YPIA 2J9ZA 3OHMB 2WZIA 4R33A 3H53A 2J8FA 3TONA 1BXNA 2NX9A 4IIBA 4UFKA 4UWMA 3TC6A 2Y6ZA 4EVZA 2WNQA 2JF6A 2I56A 4RNHA 2IW0A 4NZCA 3UZZA 4JTAA 2OQLA 4LUJA 2HMCA 1MW1A 4E2BA 1EB3A 2VTFA 2IQTA 3MYPA 5A8QA 4AH7A 3CNYA 3OG3A 4MNKA 2GVGA 3T05A 3OZYA 1SPQA 4H4IA 2CEQA 5FESA 2EGZA 1JVNA 4QAIA 4DJED 4FNQA 1W1ZA 3OGSA 3FNDA 5BWAA 2HZGA 1AMKA 3AIQA 3EOLA 1TMQA 5HR6A 1Q66A 3D0CA 2X1IA 3GC4A 6CGTA 4WSHA 2HV5A 3W37A 3AMLA 2CHNA 3O6AA 2E09A 4NIRA 1QHZA 1ZB5A 2OKOA 3ARSA 3NQFA 1WKFA 3VIGA 2DIKA 4ZOBA 3H22A 2FTYA 2BMBA 1RLDA 2ZUUA 2OXNA 3UEQA 3CH0A 3A4JA 4PL1A 1TQXA 3WQ4A 3FCPA 2Z24A 1GOOA 3RU6A 1UZDA 1Q13A 2HE5A 2G5WA 4HNNA 4AC1X 3VNYA 1ZRQA 7CGTA 3LB0A 5G1YA 4PMDA 2VFHA 3WF3A 3U7VA 1HX0A 5I02A 4PH6A 3NQVA 3UR5A 1AH3A 1DQWA 2J7DA 3EZ4A 1RCOB 2ZA1A 3RM4A 3NQ8A 2VZOA 3QV9A 1S2AA 2VFEA 4FOKA 2NVCA 2FVMA 3GG8A 2J24A 5HPOA 4XVEA 4NILA 3H2MA 1PZ0A 4UQAA 4IIDA 5D04C 4CQAA 4Y9MA 2OU4A 1RJQA 4AX7A 1H4PA 1BLIA 1O5QA 4GVGA 2HVOA 2F9RA 4QLJA 4GISA 3C86A 4WSJA 4MYAA 1OGGA 3WH6A 1BAGA 4C6JA 4DJFD 3SCWA 3DGRA 1IZCA 3APYA 1C91A 2ZVIA 3SUWA 1DBTA 4HNTA 5LIYX 3IK4A 3PHAA 4LF2A 3ZVHA 4J27A 2PU1A 1QJWA 1G7VA 2W5FA 2V3FA 3N6QA 2WNZA 5DCBA 5BYWA 1VFOA 1JCMP 1HW6A 2NWRA 3B06A 3U0HA 2WJFA 5K2ZA 5C54A 5I3KA 2QIWA 2DW6A 3AUOA 1KFEA 1KCXA 3MU7A 3VA8A 4JFUA 3B0UX 4W93A 2WJEA 4DO5A 4FHAA 3GX9A 2ZVRA 3N9SA 3UJSA 4E6MA 4RW3A 3WL0A 4QR6A 3P0WA 2WSPA 1PAMA 1YNYA 1VPXA 1MXSA 4KBXA 1XG4A 4ONVA 4H9XA 3B3DA 3C61A 3NL2A 4PMVA 3VDGA 1AG1O 4L7ZA 1G4SA 4I7UA 1UP0A 4ZGYA 3OZPA 3ONCA 4C6OA 1BXCA 3P80A 1VBRA 5EB8A 1HL8A 4GKLA 4CLMA 2X41A 1MEIA 3TFCA 1MMFA 3SQMA 1OCNA 4NZFA 3HGSA 3N12A 1L6GA 4L6DA 3N9KA 4MDPA 4B5WA 3T81A 4GH1A 3EOOA 3VD3A 3S1WA 3AXMA 3P5YA 2X42A 2GSEA 1ONEA 2FTPA 4HYRA 1KCZA 2Y70A 2PSNA 2QUVA 3TN6A 4TVUA 1RCXB 2I5IA 1WDWA 4FXJA 3ARXA 3W2MA 4UTUA 4BF9A 7TAAA 1Z89A 4KWWA 4LPCA 1KRBC 2VGBA 3ORWA 3ZJ7A 1YLVA 5JXQA 3Q37A 3TLQA 1VH7A 2C3ZA 3FYOA 3FSUA 1VFMA 2ON3A 4B4HA 2EPLX 3CV6A 4O12A 2G3FA 1Q6QA 3W7HA 3FKKA 4I5XA 5AHIA 2NSOA 1F7BA 3HV8A 1B31A 3QGVA 4XWUA 2NW0A 3ARVA 3LPPA 2IPJA 4OE7A 3AYVA 3NZ1A 2P8CA 2EO7A 4Y9OA 1JGMA 5T9CE 4Z2LA 1E70M 4I9MA 3QKEA 3SJNA 4ERGA 5LSMA 3QH2A 2RDWA 1Q2SA 3VGBA 4PYSA 4YJ5A 1HKIA 2DV0A 1Y0EA 2ZUVA 3W7GA 1ITQA 3NVDA 1MDRA 2Y5EA 3BUVA 4CNPA 3UYIA 4JTKA 5KMYA 2FFCA 4NRRA 1UP2A 3TN5A 3VDAA 2Y7FA 1E6QM 4YMZA 1A0CA 2WHMA 2ZWYA 4M81A 2A6NA 2WZHA 2PEVA 5A6BA 3W1XA 2GJLA 4LS0A 1JAEA 2FJUB 1S2TA 5C5YA 3GQYA 5HQMA 5FL0A 4JHOA 3PULA 1UKPA 4EE9A 2O9TA 2BB0A 3GH7A 2IKJA 1YX1A 4HVXA 4DWSB 3WK2A 2CLLA 1WKDA 3ZLGA 1F05A 1PVNA 4W86A 3WBEA 1BWLA 3TTQA 2BXVA 2XH7A 3T9PA 3B04A 2OFJA 3H7UA 3R25A 4MNLA 1F6PA 3BPWA 4FI4A 3NUKA 4I6KA 1DJWA 3KVKA 3WUBA 5FOOA 3EA3A 3REQA 1Z32X 1J12A 4D6CA 3UT0A 4XX6A 3S2NA 2CHOA 1KFLA 3T42A 2E1DA 4TX8A 3N17A 2V38A 4KCTA 5L9FA 4JHMA 4UQEA 1Y65A 3TYBA 4ZQCA 3H4WA 3H2EA 3FDGA 2YCIX 3HGJA 3W26A 1P0DA 3KDOA 4NJIA 1NDYA 3A4WA 3H2NA 2QCGA 4UTIA 5I7GA 1TTIA 3CAVA 1XDMA 1OADA 3KOXA 3C6CA 3POHA 1PEZA 4QHRA 4W8LA 4E3TA 4Q8MA 3WF4A 4HU4A 1OCJA 1PKLA 1P6CA 2OT1A 4H04A 3IV3A 5FJUA 3AMGA 1YDOA 2WPBA 3QVQA 4LYKA 3TK7A 2ODOA 2V2DA 1GVSA 1VRDA 1OB0A 4GINA 4DN1A 2A4AA 1LL7A 2HS6A 3JVAA 4O18A 1H50A 1ODZA 2CLKA 2Y5JA 1SO4A 3IJQA 2D2JA 4QE1A 2GJXB 1WXJA 1BWKA 2FPYA 1I4NA 4ERIA 4IP5A 3W1QA 3GFYA 3A24A 2V30A 5D2XA 3ZWSA 1XQLA 1FHLA 2BY1A 3L68A 3TA6A 3L5AA 1OBAA 3CM4A 3SO7A 4WCJA 5LGXA 5AC5A 3H26A 4LAMA 3WF0A 1G94A 4NZ1A 2I14A 1DWGM 4DIAA 2PDPA 4ZCWA 2ZIDA 4QS5A 2CLPA 3PPCA 1XCWA 4CQCA 4LYQA 1E56A 2VX5A 3N34A 1Z8AA 2ZX6A 4Q8TA 1NFBA 5I78A 4DZIA 3CHVA 3N2MA 3ALGA 2ZRXA 4Q3MA 5C2GA 3A5FA 3MSRA 2IMRA 3IAPA 1QBAA 1V5XA 1K6AA 2D23A 4H9VA 3B40A 1BF2A 4ZB0A 3BW3A 3UWYA 3HURA 4IUGA 4IG2B 2C8NA 1ISYA 4EK7A 4M24A 1DPMA 2Z28A 3VE9A 2Y8KA 2OODA 3RN6A 4FF5A 1OWQA 4HD5A 1RALA 2FZ8A 3OBEA 3V7PA 3OGRA 2PDWA 3EOUA 2ZE3A 1UMLA 5LA1A 4GUFA 1E1CB 4E5TA 4PEKA 3T8QA 3LK6A 2OCZA 4WGXA 1SJDA 3WLMA 1E5JA 4G8TA 3DG6A 4BI6A 2HK1A 4MY8A 3MB9A 3P14A 2C0AA 4GQRA 2CBIA 2PDYA 1XLGA 2XIOA 1PWMA 2QCNA 2QYGA 4FR1A 1QBBA 1ZFJA 2NX3A 3HG4A 4NUWA 3WL1A 1EJXC 4NZ4A 5CZKA 3W7IA 1AQ0A 3C2VA 4GUHA 1DJNA 5AC4A 1W9XA 2E40A 1RBLA 4AX6A 4FNUA 3G6LA 4O0KA 3GFXA 3VCRA 1DWHM 3BLFA 2ZZ1A 3EKZA 3N6HA 3SQSA 1RXOB 3GR4A 4AHOA 1HJWA 2XM1A 5FEPA 2PRLA 1JYVA 4INFA 1JUEA 1SO6A 2CIPA 2QCMA 3W7CA 1C9DA 2FMNA 3D46A 5CSRA 1DIEA 4HA4A 4U28A 5A6KA 2YDSA 1W1TA 3AS2A 3ME3A 3ZXWA 2HVMA 4AHQA 3KRSA 3WD4A 4R7OA 5HJYA 3NOYA 3VX1A 3RPTA 3NIYA 3NQMA 1B90A 1UKTA 3TLLA 2NZLA 3JS3A 2IS7A 4QLKA 3LMYA 4J5NA 4P8WA 1TRIA 3WDHA 4G1NA 1D8CA 2EQDA 3MCNA 1NIUA 1HP5A 1J0YA 3VOHA 3QPZA 4Y7EA 4XBSA 3W7JA 4AUBA 4H7ZA 1NAL1 2WKGA 3UJFA 1EF3A 2VWSA 3LTPA 4L1WA 4OIFA 5U4NA 2OWWA 1CLXA 4RW5A 2E4TA 2BGNE 4GZIA 4F79A 3ZVIA 2TYSA 4Z0JA 4QJ4B 3P84A 3EDKA 5FSEC 3TA9A 3UYCA 4JFVA 4QEEA 5LHFA 8TIMA 4QDWA 1NTHA 3RX4A 2E6AA 4JDYA 4CD7A 5B7YA 4AF0B 2EEXA 1PHQA 3S0CA 5GPRA 3TCSA 4LGXA 1W9PA 1WKEA 3WK3A 3WMLA 5CZTA 2H3BA 1WDSA 4GG9A 4ZZ9A 3VM5A 4FAMA 2DZPA 5ENLA 3GDRA 3MHFA 4ZFMA 3RYSA 4A2RA 1JYNA 3ZSSA 1D3HA 3WN6A 4UMCA 2POTA 2BSLA 3BLOA 2OMAA 3BAYA 3CUFA 1R3RA 1VD6A 4AD5A 2P5NA 3ID7A 4KMQA 3U2OA 1M68A 4WDUA 4JIPA 4FSAA 2VRKA 1FHVA 4JQ3A 2DVTA 4MSSA 2FJKA 4MIMA 1QTWA 3GDTA 4AY8A 2G3IA 1NOFA 1OFEA 2H6RA 1M53A 3VABA 3HG2A 1RY8A 2NLIA 4MVAA 3PS7A 2DT3A 3OG2A 1K1DA 3VD9A 5G4WA 4LVGA 3W74A 1N7KA 3L0KA 4O15A 5BRQA 3BLPX 1PB0A 1AK5A 3EA1A 3OJGA 1GPWA 5HDRA 1QNQA 2WSKA 3ITCA 4MAZA 3P81A 5C55A 4DM2A 2D69A 3QFEA 2E6FA 4MWAE 4WRHA 2FKPA 2V6AA 4AWUA 4DWSA 1MYRA 3V5CA 4AIUA 3WFZA 3F2BA 2VCCA 4N02A 4K38A 1E3XA 4QROA 3PBVA 3DENA 2PWDA 2VEPA 1TWSA 1V6YA 3UR7A 4UFIA 3VC6A 4BF7A 3B03A 4YWIA 3E2RA 3VFLA 1VJSA 4RPPA 4NYYA 4D6GA 3VZYA 1VFLA 3RMEA 1TIMA 1M3UA 3VOJA 2OZ3A 4PMZA 1VBJA 1GOKA 4RXGA 4JEJA 3W6MA 3B8WA 4LNYA 1JR1A 3NEVA 3M6YA 2QPSA 1IV8A 4XZ9A 2XM2A 4PUDA 3WEMA 4DAFA 3TWAA 4ML4A 4S2BA 4BA0A 3ZOAA 3GXPA 4B92A 3VGGA 2PC4A 5D8WA 4LAUA 3N2TA 3LGEA 3U2CA 4C6MA 3HMJG 4UXDA 4DUVA 1E6NA 2REQB 5DRIA 1KD0A 2Q01A 3WH8A 2PFHA 3IK2A 3ZQ9A 5BXTA 4PSRA 2VYOA 3WQCA 1KM0A 1IIGA 3N2OA 3URBA 2HCVA 2ZDRA 4KIRA 2OYKA 2HQAA 5AHEA 4B90A 2FB2A 1F76A 3LS9A 3THCA 2E6DA 1O60A 3LHVA 4U5IA 3MBDA 3SCOA 1Q6EA 2PDHA 2IKGA 4LH8A 4E8DA 2Y88A 2C15A 3BLLA 3BARA 5AYIA 1FWRA 1R47A 3FJLA 3RITA 3ECQA 2GJXA 3ZJ6A 2Y8UA 2A79A 2B0MA 3TAKA 1CGTA 5CBBA 1V3JA 3WFAA 3VMPA 4ZA0A 4I5UA 3KS5A 4OU1A 1OQFA 4M0XA 4KQNA 1F8IA 4HHHA 4H6KA 1XLCA 1W2VA 4F0MA 1AQFA 4I9TA 3P2VA 4Y9NA 1KBIA 5H8UA 1I0DA 1JNDA 2NQ9A 4RE3A 2DU2A 2VQUA 1Q6LA 2XYLA 4LS1A 2YW4A 4WKFA 1M5WA 1NWSA 2C13A 2C0HA 2DQXA 1AQHA 4HPGA 1XIBA 1EL3A 2ZOXA 3B97A 3MVTA 1FWHC 4WDXA 3B9EA 3MP5A 2Y62A 3CUIA 4O1EA 2ISWA 3KCLA 1UC5A 3L7RA 4GO9A 1VZWA 5K9XA 4R3UA 4K2SA 3FS2A 3UCQA 3I6TA 4IG2A 5LA0A 2OJPA 2QV4A 2Z1KA 2UY3A 4KRUA 1ZY9A 1G01A 3QLLA 1ONXA 4LV9A 4UFLA 2F6KA 4MZ8A 1NM9A 5AVNA 3GNOA 1UYQA 1L8NA 4LT9A 3A5VA 1RPKA 1EC7A 1VQTA 5EMKA 5F1UA 2GOUA 1GEHA 4K1GA 3S9YA 1BD0A 3FA3A 4MKSA 3W1AA 2YL5A 2PWUA 1S5MA 3OYXA 2XFYA 4UTHA 3M0LA 4JNMA 3IIZA 1W1YA 5HPCA 3ZYZA 2YIHA 4ZQRA 3N25A 5DF0A 3BLEA 4JYEA 2BGSA 4DJDA 3U5YA 2PWHA 3LLFA 3SDOA 4CCEA 3EKGA 3E0VA 4M7TA 3CUJA 3R8GA 3BSMA 4Q4QA 2BZNA 5CSYA 2ZZ7A 5XIMA 3H2OA 5M03A 5MHBA 2Y5SA 2NWSA 3CS2A 3E5PA 3I3DA 4A29A 1R9ZA 5CG7A 4IPIA 3I3BA 2HDJA 5BZAA 3KLLA 4Y96A 1WCGA 5M3WA 4IUOA 2VM8A 1W3HA 1GOIA 4D1IA 2HE8A 3RGTA 3CXOA 1GTHA 4W84A 4Y6GA 4YN5A 1T0OA 3J7HA 3IJ9A 5EL1A 3DI1A 3F1QA 5G2HA 4J35A 4YTQA 3GTNA 4GCAA 4K6AA 1YQ2A 1G1YA 3TYDA 2PTZA 3W73A 1PKNA 5M1TA 3K8KA 2HROA 2O7SA 1S2UA 3GDBA 3BK0A 4HP5A 5IOBA 4EKJA 2BHZA 3OEXA 3LCXA 3E2VA 3TMLA 3OGVA 2EG8A 2AQVA 2V81A 2GVJA 2BY3A 4CEXC 3M5ZA 1W5NA 1XPYA 4GFSA 3K1DA 2D20A 1V3MA 3F4DA 3ZR4A 4EOUA 1POJA 5FF2A 5TQLA 5A6JA 3CEPA 2P0IA 1RR2A 4ZODA 1KTCA 4GNKB 3W9ZA 5CEWA 2UY5A 4QAWA 1UW9A 1JFHA 1XRFA 3B4UA 3R58A 1UWUA 2AL2B 3V0TA 2ZTJA 2DH2A 4QDMA 4MUPA 4O1FA 3SEPA 3E12A 3H70A 3M0HA 4E2OA 3LTSA 2WC4A 4GYKA 2YW3A 4WEVX 4TTGA 4JIIX 1UWIA 3H2AA 1XXXA 3OLGA 2WPGA 4OHQA 3MMUA 1Z7AA 4KETA 2YZ5A 2FHCA 3G18A 1I1WA 1XC4A 5HNUA 1CENA 2HRWA 1HL9A 3WJYA 2VNCA 1F5ZA 1OFOA 3P6LA 4IOTA 3ANYA 2FDMA 2PUZA 5I3FA 4LALA 1BVNP 4KEVA 4L56A 2QDDA 2QZRA 4CNUA 2Z7GA 1X98A 1F73A 2ZTKA 3W7PA 4AHPA 2C71A 4K68A 2VKZG 1LUCB 3PFMA 5KETA 3T0AA 1JULA 3GU1A 2E28A 3M5XA 1SZGA 3S2MA 1NQ6A 4PBGA 5DCEA 3BANA 4O57A 3WQ5A 2ZRVA 2VD9A 3B0XA 4BQ5A 2EHHA 2QVHA 2DJXA 4FX8A 1SZFA 3INPA 2EPKX 1X96A 1CB2A 1YXYA 4S3EA 1HKWA 4OBTA 3VTRA 5KZMA 1TV5A 2GUYA 3A21A 1WXYA 5E0CA 2QXWA 3ELFA 3C2OA 3AALA 5DANA 1TPDA 1TV4A 2RKXA 2PE4A 2VEIA 3AIRA 1QAPA 2EJ1A 4AEOA 4QTGA 2B7OA 1XLFA 1LCOA 4UTWC 4DUXA 5LA2A 4HIBA 3NR0A 1Q85A 3G8EA 1LROA 1G7UA 1X6NA 4CN6A 1HJQA 3SRKA 1OFAA 4H3DA 4IFKB 3Q65A 3A9IA 1KCKA 4GJ1A 2QLYA 1XIEA 3GR7A 2I57A 2JALA 1P7TB 2DZTA 2ACSA 1C9WA 3GVGA 1UR4A 3QMRA 2EF9A 3MV11 3OP2A 3MUIA 3WO8A 1D8WA 2DSKA 4LC8A 2EPMX 3GVRA 1ZTVA 1C92A 3BMWA 3WQEA 4O1BA 3IIXA 3IIOA 1J01A 1F3WA 4EXAA 2YPIA 3GIPA 1V02E 5DMYA 5M2FX 3N4AA 1HN1A 2V8ZA 5DXYA 3LQLA 2PDKA 4Q22A 2X16A 3KRZA 4HPJA 4CU8A 3N3MA 1M7PA 5EKYA 4JYDA 1YIXA 1GNXA 4PSPA 5D9OA 1T5AA 1JIBA 3GG7A 1NWRA 1OZMA 2REQA 1J5TA 1RSCA 5PTDA 5AHMA 4AD2A 4B5XA 3GU2A 3O7UA 4TO8A 5ECVA 5C7HA 3VGEA 4I5RA 3BAJA 3URAA 2H3DA 3K30A 3VNDA 6TAAA 4CU7A 3IJ8A 1ADSA 3DX5A 1IR2A 2MNRA 4NL1A 3TN3A 3MUZ1 1YKWA 3MKCA 1TFVA 3ZR5A 1W3IA 2J75A 1LBLA 3LY0A 3CGTA 5A6TC 4AVFA 4QLLA 3G8RA 2J6VA 2VWTA 3WJZA 4TX6A 2VFGA 3S1UA 2PAJA 4MDOA 4LCRA 4NAEB 4GNVA 1EGMA 1MW0A 4LF1A 4H7VA 2INEA 4KS0A 4GZJA 3ARWA 1G9HA 3R43A 2I9UA 1LYXA 3PNUA 3A3WA 3VILA 1MZRA 4YVVA 3QYQA 2BGQA 4O17A 3PBUA 2OSXA 5JVLA 4Z17A 4IGNA 5LKYA 1ZBCA 3SADA 5AHFA 4LS2A 2QAPA 3MUXA 4I9AA 3CUZA 4OECA 4Z2IA 4H41A 1U5HA 3O16A 1PV8A 1ZAIA 4JQ2A 4IPJA 3MZNA 4B5SA 4UZUA 5C9UA 2ICSA 3A4XA 1KXQA 1R3VA 3GXTA 3S5NA 3H54A 3CMGA 3GRIA 1R85A 2ACUA 3DEQA 1IXNA 4J40A 1K4GA 5KEZA 3ZSTA 3NFUA 5HWJA 4HPXA 4YVPA 4WF7A 2QCEA 4PCTA 2R6OA 1B54A 3DAQA 3PJTA 1KBBA 1DL3A 3WYZA 4JKKA 4IQLA 3FLUA 2CWXA 2HPMA 1QUMA 2V69A 4G2DA 1IEXA 4PGLA 4GIYA 4HHLA 4WX2A 4RZBA 2J77A 2OYMA 1CGXA 3TC7A 1UR2A 4MWAB 1CEOA 3S42A 5IBXA 3CO8A 2QKFA 1V3HA 1F74A 4UTMA 4R7WA 4PUKA 3UETA 4IGMA 4M1BA 3R6IA 1NARA 5AYXA 2YCEA 4DUWA 1V0NA 1A5UA 1QI4A 4D6DA 4HCLA 1A5AA 3MI2A 3FSTA 4QGCA 1GUVA 1YRRA 3OZOA 2PWFA 2J7GA 4S2CA 1XFCA 1O5KA 3T0TA 2VEGA 3SCSA 3WNLA 2ZRWA 3SUTA 2GWGA 3L5MA 1POKA 3M16A 4JOMA 1CXHA 1SR0A 2W91A 2DZAA 1KNWA 2CITA 1IHIA 2FQIA 3CZLA 2IKIA 1J8VA 1H7WA 1KO0A 4WK9A 3QHMA 3THQA 4H8UA 5EMLA 1RP8A 1JZ3A 2GUBA 1ISWA 3BAIA 1E1FA 2WHJA 1PCKA 1UD3A 1V6WA 4DX3A 1C93A 4IZGA 1L9WA 5D2VA 2DUAA 5DT5A 4NF7A 2NLYA 3OIXA 1MUMA 3HJEA 1UA3A 4M6QA 1SFTA 1IZJA 2ZE0A 5CPLA 4NASA 2YKKA 4OWGA 3BV7A 1E43A 2FGBA 1US3A 1KRMA 3H2CA 2SFPA 3DHPA 1EO7A 4CVUA 2AGTA 5FF4A 2R82A 4LAKA 4LOCA 2Y2WA 5HMDA 1LORA 1R3SA 2JGQA 4WDTA 3ZZ1A 3VVGA 3KCJA 5GNYA 4X60A 1KM4A 3WLIA 1UH2A 2CNCA 4QJ1A 1E1EA 3MY9A 4GIEA 4JN6A 3CLWA 3KBNA 3IS4A 4X9YA 5FIPA 3R12A 4Q33A 2VENA 3GKFA 4DXXA 2F8QA 3QW4B 1GQJA 1A5MC 2KZHA 4WXZA 3R0DA 4AYSA 6TIMA 1DWFM 4EWJA 3QTPA 5BOEA 5C2XA 2OGJA 3R11A 3PBGA 1XLLA 1N8WA 2CXEA 4Q7NA 1ITUA 4ORIA 4RR4A 3WJSA 2XTKA 3BLKA 1UIPA 3GZAA 5I0DA 2AL2A 4G7FA 4GBUA 1W31A 1QNPA 1HKKA 5J5RA 4GI6A 2H8XA 1DOSA 4NRSA 4CVWA 1SM9A 4ACYA 3W6YA 1M41A 1H5YA 1UJQA 3LOTA 1P0NA 4DPPA 4YTUA 3GIQA 4UBPC 5FJJA 2BV9A 4IICA 2WWCA 2E8YA 4FP1A 4EAMA 3GAKA 3EMZA 4DBSA 4AWSA 1P0EA 1L0PA 2JKAA 1IEIA 1XRVA 4HMEA 2V2CA 1MFVA 2GQ8A 3DHUA 3PFRA 4HNLA 1YPFA 8XIAA 1T8QA 5HJLA 3BVJA 1XP3A 4M6VA 4MADA 4ECLA 5I07A 2YDQA 2ZUNA 1LUCA 2X0HA 4X2RA 3IEBA 1JZ8A 1TMHA 2YBTA 1NDWA 5TNVA 4GCXA 1O94A 2V9DA 3FV9A 5LIXX 1RY0A 2ZKMX 5GJMA 1AH0A 4PFHA 1SMDA 3W76A 3WLOA 2BOFX 4R27A 1PZ3A 4GY7A 4FLRA 4Q6XA 3ZLFA 2CW6A 2UBPC 4OKDA 1VYRA 1BG9A 4AAJA 1NDVA 2ONEA 4E8CA 3IWPA 1TPB1 3W25A 3FKRA 4WD0A 5AVHA 4JY9A 4H00A 5CPMA 1W3NA 4Y2WA 3RXZA 1GJWA 2PDJA 1FWSA 4R5EA 4AXKA 2WNWA 1CT5A 4GWEA 1YE6A 4ENLA 3QR1A 1IEVA 3CZKA 3S2LA 2QGHA 1LL6A 3DFSA 4GYJA 1MW3A 3G1RA 1OFPA 2WKLA 4J4KA 2G41A 4OT7A 5E6ZA 4GBDA 3B9NA 4IFKA 4FIQA 4MKNA 4M82A 2WZMA 4E3VA 1E6XM 4QBXA 1FKWA 3UW6A 2PDFA 3BCJA 1IE7C 3EXRA 3RRAA 1JDAA 1DJHA 3TYUA 2BHYA 5CGQA 4M1RA 5E0FA 4UOQA 3DESA 1REQB 3COTA 4JTFA 3HG5A 4FF7A 2GVLA 5M5DA 4BCEA 1TWWA 4QIUA 4RNJA 3AZTA 4XBKA 5D9PA 1R86A 3QRHA 3RX2A 2XWDA 2DIJA 1IEWA 4EWND 3WBYA 3QY6A 1E55A 2OWXA 1MO0A 1TJ0A 2A3HA 4QQ3A 3WG6A 3R13A 1FCBA 3CAKA 4DJEA 1CCWB 4A3HA 5A6AA 1B3XA 2CZFA 2JGYA 4QE5A 2D24A 5CG0A 3H6OA 3HJZA 2OEMA 1O95A 1I9CB 1J0ZA 4XV0A 2A21A 4IPLA 2X1SA 3SUSA 2AOSA 1B1YA 2JKEA 3W1TA 4NAEA 4O0ZA 1X7IA 2VZUA 1N8IA 4XIMA 2F6UA 4L65A 3GDLA