4IQEA

Crystal structure of carboxyvinyl-carboxyphosphonate phosphorylmutase from bacillus anthracis str. ames ancestor
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
293
structure length
289
Chain Sequence
b'VVNQSTQEELANRFRALVEANEILQIPGAHDAMAALVARNTGFLALYLSGAAYTASKGLPDLGIVTSTEVAERARDLVRATDLPVLVDIDTGFGGVLNVARTAVEMVEAKVAAVQIEDQQLPKKCNGKKLVTTEELVQKIKAIKEVAPSLYIVARTDARGVEGLDEAIERANAYVKAGADAIFPEALQSEEEFRLFNSKVNAPLLANMTEFGKTPYYSAEEFANMGFQMVIYPVTSLRVAAKAYENVFTLIKETGSQKDALSNMQTRSELYETISYHDFEELDTGIAKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxyvinyl-carboxyphosphonate phosphorylmutase
publication title Crystal Structure of Carboxyvinyl-Carboxyphosphonate Phosphorylmutase from Bacillus anthracis str. Ames Ancestor
rcsb
source organism Bacillus anthracis
molecule tags Lyase
total genus 95
structure length 289
sequence length 293
chains with identical sequence B
ec nomenclature ec 4.1.3.30: Methylisocitrate lyase.
pdb deposition date 2013-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 4iqeA00
4MG4A 2V5JA 3B8IA 1Z6KA 4KCUA 2HRWA 1T5AA 1PKNA 2G50A 1DXFA 3LG3A 4IQEA 1UJQA 1IGWA 4B5TA 4B5SA 1IZCA 1F3WA 1F8MA 4DRSA 1M3UA 1MUMA 4LSBA 1OQFA 3QZ6A 1PYMA 2QIWA 3EOOA 1VBHA 1E0UA 1O68A 1F61A 4FXJA 3SRHA 1O66A 1PKMA 3GQYA 3HQPA 1VBGA 1ZJHA 4WJ8A 2HWGA 2WQDA 1DIKA 4B2DA 1U5VA 3MA8A 3T05A 4KRZA 1E0TA 4HYWA 2XZ7A 2VGGA 4TV6A 3FA3A 1A3XA 1A3WA 3BJFA 2VGBA 3QTGA 3QV9A 2E28A 4IQDA 3ME3A 1OY0A 3SRKA 1DQUA 3FA4A 3HQNA 1XG3A 1A49A 3EOEA 4ROQA 1AQFA 3KTXA 1KBLA 1F3XA 2X0SA 4L80A 2DUAA 3EZ4A 1JDEA 3SRDA 4IMAA 3HQOA 3T07A 1U5HA 3G2GA 3GG8A 4KS0A 4IP7A 4L9YA 2KX9A 3OYXA 3QV6A 4JPGA 4QG6A 4KCVA 1A5UA 4B5XA 4MF4A 5TAOA 4B5UA 2ZE3A 1ZLPA 4KCTA 1M1BA 4L9ZA 1S2WA 3E0WA 1F8IA 1PKLA 4YJ5A 1S2UA 3IS4A 4FXFA 3T0TA 4B5WA 1DXEA 3OQ8A 2XDFA 2VGIA 4B5VA 2XZ9A 3QLLA 1PKYA 2HJPA 3M0JA 1S2TA 4HYVA 3I4EA 1KC7A 3BJTA 2V5KA 4RPPA 2L5HA 1S2VA 3QQWA 2VGFA 3EOLA 2BG5A 2DIKA 3SRFA 3H6OA 2HROA 4L7ZA 3U2ZA 4B2DD 2VWTA 3KHDA 4YNGA 3E0VA 1O5QA 4KCWA 3LYEA 5JVLA 3P0XA 3PUGA 3QV8A 1XG4A 2R82A 3E5BA 3QV7A 1SGJA 3PP7A 4QG8A 4QG9A 2OLSA 3M0KA 1GGOA 3R4IA 3N25A 3GR4A 2VWSA 3OYZA 4TV5A 4QGCA 4G1NA 3VAVA
chains in the Genus database with same CATH superfamily
1MQPA 1SFSA 2WSRA 4NL1A 4JDYA 2VXNA 1L6WA 3IAQA 2J8FA 1DJGA 1E6SM 1NWUA 3E1F1 1IWAA 4D8AA 2V5LA 1KW1A 1XLGA 1C9WA 1FWJC 3G8RA 3QSRA 4NZFA 3VVGA 1JF5A 2JKEA 1KRCC 2CHRA 2VC5A 1FP8A 1J11A 1TFVA 3NQ2A 1DV7A 2C91A 3WJSA 4FLRA 1SJAA 3U6WA 2PS2A 1WKDA 1XIMA 4XZBA 1KKRA 1KCLA 2QGHA 1XG3A 4OHQA 4YPJA 4K8GA 1IT7A 3U7BA 1XRSA 4ILSA 2OXNA 5EY5A 4YTSA 3W84A 4Q4SA 3PBYA 3O7UA 4QCFA 4BFAA 3UJRA 3H21A 1JCTA 1F7BA 2BODX 3BVJA 1PDZA 3F4CA 2PTZA 2XINA 3V1PA 3A12A 5TAOA 5A8MA 1UD3A 2J25A 1Q63A 3A47A 5C71A 3VDBA 4XZIA 3TCEA 3AMGA 1HVXA 2X8RA 5EMKA 1Y7VA 2J7HA 1I0DA 2CLPA 4JQ1A 3MI3A 1XPYA 1K8YA 4F3HA 2A7NA 4OE7A 1UKPA 1ICQA 1VFTA 3ANVA 3RM8A 4FNPA 1F9CA 3DKJA 3PPGA 4J28A 3R0KA 3MUCA 3VDAA 3O16A 5JMUA 4K39A 3RCMA 1E9LA 2GVEA 1CXEA 2DORA 1A80A 3H23A 4GJIA 4KWOA 5AFDA 1VPQA 2W66A 2VFGA 3QQ0A 3GHSA 2WCSA 3HFYA 4LX4A 3S5OA 2XVGA 4PCSA 3M0VA 2Z29A 3II1A 1SO5A 3GXFA 4B5TA 3FXGA 3HA1A 1KXHA 4FXSA 5BXPA 3SRHA 4JKLA 2AGKA 1AZ2A 1OX4A 3VIMA 2QCFA 2YZ5A 1BYDA 3DC8A 4I9AA 4QISA 1FP9A 2D3NA 4ZOAA 3IACA 2PC8A 1J2BA 1JF6A 3UVAA 1LQ0A 4AEOA 1RBOB 3NM3A 1ME9A 3WBEA 4DWSA 3VUPA 4ASTA 3C0JA 3PZGA 1SW7A 4TMBA 4IP7A 5ABHA 3ATYA 3MCNA 4XQ6A 1EF2A 2NWSA 4FR6A 1O1HA 3URQA 3ZJKA 4JY8A 2C6QA 4GZIA 4E4PA 1ZALA 3NG3A 1F4AA 4HVXA 4LGXA 1RK6A 2OWCA 2JF6A 4O15A 3UNTA 4B5VA 3PBUA 3BV4A 1UUMA 1G4EA 5F4XA 3NUKA 4DZAA 4LNCA 1UWQA 3W1QA 1FQ0A 4CU6A 2BY1A 3Q94A 5G4HC 2PEVA 3WEOA 4JHMA 4DVOA 3UA3A 3DZ1A 1ZRQA 1LBLA 1A5KC 3WQ8A 3GLCA 3GZ3A 5BXSA 3F4NA 4V15A 1QWGA 3NQCA 1YDVA 4A05A 6ALDA 2PWGA 4AZ6A 1M6JA 3ABSA 3CUIA 3LCHA 4ATDA 3TYAA 3EYPA 1DHKA 3ARZA 3ITYA 3NQFA 3GE7A 4W93A 4GVGA 1YRRA 4I9MA 5CAHA 2NUYA 1DTUA 4GPNA 4Z1CA 3SCVA 4F0HA 2DT1A 2E28A 2XPKA 2X1RA 3H2EA 3LRKA 3NQMA 1HL8A 1BD0A 1HGYA 4F9DA 4MPQA 2FTWA 4UBPC 4U2ZA 1NOWA 1HKJA 4W8AA 4DAIA 3KRZA 2XHYA 3IV8A 1E40A 3QY7A 1XLJA 1H7WA 4CQBA 1PKLA 4CD4A 4B5WA 1H41A 4DJFD 1U83A 4AX6A 4HOXA 1QHPA 1PKYA 3WD1A 2FIQA 3KOFA 4A6GA 2BHUA 4Y9NA 4S23A 4GINA 1IYXA 3ZO9A 1BAGA 3KTSA 1EOMA 2V3GA 3U2ZA 2VD9A 4TMCA 1J0YA 3WN6A 2A7RA 2X7WA 4ZTXA 5CXPA 4YN5A 4JTJA 3ZQ9A 2JQXA 4PFHA 1ZL1A 2W0UA 3BAJA 4G7EB 1ONWA 1BF6A 4PMDA 1LWIA 5EFDA 4K1GA 2REQB 4J4KA 4RJEA 4EPBC 1IQ8A 4LSBA 1V7AA 4K8HA 3ITGA 2R6OA 3N9SA 4AMCA 2ZZ7A 3K46A 3VZZA 2NXHA 3BL3A 1S39A 3ITCA 2PDHA 5LA2A 4B4FA 2G3FA 2MANA 1SYTA 2PI6A 1QNSA 3ABZA 3HQNA 2VC9A 3H2AA 3GNOA 2DUAA 1PL9A 4WY0F 4NRRA 3KE0A 1FTXA 3SCOA 3CPGA 5BRQA 3EEGA 1WZKA 4OBTA 3R11A 3OYXA 2J88A 3G1SA 4W84A 2V63A 2HBVA 3TOPA 4IIFA 6CGTA 3CPRA 1R86A 5CH9A 1YXYA 4KF1A 4ORIA 2BXVA 2IMRA 3GTNA 4PBFA 4EK7A 3ARYA 3BJTA 3M0MA 4HJFA 1RHCA 3GDTA 4DF2A 3MHUA 3AO0A 3T0BA 1G6CA 4DYKA 4FIQA 1KR0A 4HT3A 3E0VA 3U5YA 4ORMA 4E38A 3AYSA 5CSYA 4H2HA 5DMMA 1BSLA 2CETA 2OOGA 4JGDA 1C91A 4Y6GA 3DKLA 4EANA 3MSGA 3EMCA 4H1ZA 3IJ8A 5HUPA 2B7PA 1G7VA 1KFEA 1K9FA 3TDFA 1F3WA 5HNNA 3FA5A 4DZHA 2DSZA 3AIUA 2DJXA 1N8IA 4NF7A 2R9RA 1Q7ZA 2JEPA 4JNYA 3U2EA 2YBVA 5JU6A 2D0HA 3GU9A 5CG0A 3RJYA 1NF7A 1LL6A 1CGWA 3MMDA 2VGBA 6A3HA 2FDSA 3CZLA 2C7FA 3BZGA 4XZ9A 1DJYA 4C91A 3ITLA 1A49A 3WMBA 1DORA 4FPSA 4DI8A 1XLFA 4H8VA 2PDGA 1V6UA 2A2IA 3E12A 4PCNA 1QHOA 5PTDA 4UTTC 4IPPA 2H90A 2IQTA 1VFHA 2XWDA 3KRSA 3SUTA 1M9HA 2C0AA 2J75A 3KLLA 1E6PA 1UR1A 2EEXA 2J7DA 3CQ0A 3FV9A 4MVAA 3A9BA 1W56A 1EJTC 4AC1X 1E3XA 2BDQA 1A5SA 1UMLA 3CHVA 1XYZA 3MY9A 4CUCA 1Z48A 3R0DA 2DIEA 1W5QA 1OFEA 3VGFA 4QR6A 2QMJA 1OG0A 2NV1A 1S2AA 4ZSUA 4W7WA 4ATWA 1V0LA 3EB3A 4MMWA 5J5RA 2A7PA 2PC4A 5D03A 4PC8A 4OV9A 2QCLA 1F76A 4HNOA 1WO2A 3TJIA 3QC0A 3HGSA 1RD6A 2NQ5A 1E6RA 3W1AA 1SZEA 4W8LA 5CGTA 1OFAA 3MKCA 3E9AA 2J4GA 2BV9A 3C8FA 4GGBA 4D8LA 3G8EA 3ABXA 1EEPA 4MNJA 1EIBA 2GPTA 4LTSA 4V1YA 1RPKA 2R1PA 3CUXA 2C1HA 1XIJA 1GONA 2DVXA 3IRSA 4X0VA 1A3WA 2XIBA 5JH2A 4JOMA 7PTDA 2RH9A 1R38A 1HNYA 4FS9A 3BOXA 4G6CA 4XBKA 2BSLA 2ZE0A 1WUFA 1X1ZA 2IKGA 1CT5A 4UFJA 1US0A 2YLAA 2F7FA 3KL3A 2ZC1A 3PTMA 2OX4A 1EYWA 2HV5A 2EPLX 4C6CA 1OFDA 3K1GA 7ODCA 1OK4A 2PDCA 3N3MA 5D8WA 4PE8A 4JTIA 3QTPA 1KTNA 2RDWA 3S5SA 3PAOA 4Z1YA 2B81A 4LY4A 1ZBVA 4NP7A 4C6DA 4YVPA 1UOKA 5HJLA 3DUGA 5KETA 4LF1A 4GIYA 1KM2A 3OO2A 3RFAA 4B2DD 3CLWA 3VDCA 3W76A 3VIOA 3GDBA 4Q4OA 3C86A 4O28A 3M6DA 2G8ZA 1F6KA 2DZPA 1VLIA 3WLRA 2I57A 3B0PA 3LZ5A 1H51A 1A53A 3KWXA 1BWKA 1XDLA 1QTWA 5AOUA 1EJUC 3W88A 1BYBA 2HE8A 1HP4A 4ZENA 3WQ4A 4PUMA 1DTNA 1EH9A 1EBGA 1V3MA 5C8BB 1JCYA 5LZLA 4Y90A 3WEZA 1NDWA 4GOAA 3WELA 1V79A 1V5XA 3AYRA 1XIFA 3AFBA 5SWUA 3KBJA 4R88A 2EJAA 3L5AA 3C2RA 3VFCA 2FYMA 3LERA 4HMDA 4KBXA 1W8SA 2G95A 4MB5A 1A50A 1VJSA 1A5AA 1ML1A 1UH4A 7TAAA 1B54A 3RLUA 4X3ZA 1DJHA 4UXDA 1W1YA 2YB4A 1VB9A 4LAKA 5KZ6A 1ZLPA 2CU0A 1ONEA 2E9LA 1F3TA 3M5VA 3T4CA 4W86A 3T7VA 2AAAA 1HTIA 3WH7A 4M6UA 4MGGA 1UOZA 1LUCB 3L4YA 3W7RA 4E2BA 2VL4A 3TKFA 3WUEA 6REQA 4NX5A 2E6AA 3MCOA 3NO1A 3BK0A 3WYZA 3VD9A 3U4FA 2Z4GA 3P3BA 4CU8A 4XVDA 4C1NA 4Q8VA 1BXBA 2DFAA 4GKLA 5A6BA 2VX5A 4HNVA 1TVNA 3TYCA 1T8XA 2XH2A 2O7QA 4RE0A 1ISYA 4JCLA 1RLDA 4XSMA 2SFPA 4GBDA 1FDJA 5D30A 4C7DA 2QDGA 2XYLA 4LVGA 3AI0A 1K70A 2NW0A 2WVSA 1S5NA 1BYCA 2DGAA 2I16A 3XINA 3VPLA 3MJYA 3NZ1A 2GUUA 4Q6XA 3R25A 4YWIA 4FLOA 1W5MA 4DM1A 1FKXA 1DYSA 4C6KA 3WD3A 1GCYA 1PHWA 1G69A 1B3OA 1XIDA 3DFTA 4RCXA 3UYCA 3VMNA 5DCDA 2VZSA 4FB7A 3DESA 4NX0A 1I75A 2QJHA 1XS2A 2IQDA 3F4VA 2WVVA 2GK1A 2VVNA 4GA8A 3AJ7A 1J0JA 4NZJA 3I68A 3E2QA 1VH7A 5CZSA 3BLKA 3LI1A 3O63A 2VOMA 3VM5A 3GXIA 1ZZMA 5I3DA 1T99A 4XVEA 5EKYA 4HU0A 4BR1A 2FZMA 2G3JA 5IM51 1PV8A 2WW5A 4HOWA 2EG7A 1MEHA 2HROA 4BZYA 4J1OA 4H41A 4U28A 3PF3A 1CXIA 4ADTA 3CAWA 5AHLA 3ONBA 1Q7QA 5I3IA 1R2SA 3NTYA 1X38A 3OA5A 2OZ8A 3WQEA 4QNEA 5FSDC 4X22A 1SU5A 4FA3A 3HG2A 1VEMA 3B4UA 3QJAA 4GI4A 4OUEA 1CX9A 3BICA 4ZOCA 3QC3A 7XIMA 1R87A 3CM4A 5CZ0A 2Z24A 1QPQA 1RA0A 2YKKA 3IAPA 5E09A 1XW8A 3EKGA 4J3WA 3RYSA 3AMCA 4RZ6A 3U0HA 1VBUA 4LV4A 4IMDA 3UR2A 1AL8A 1AW5A 3WL0A 1OK6A 3P14A 4A8LA 3MS8A 1E4LA 1H3GA 3VI2A 5HQEA 3LUTA 4PMZA 4K68A 3NAVA 3UJEA 3HPZA 4UMAA 1GZ1A 1QXLA 3V0SA 4L1XA 4PH6A 4KS0A 1XYMA 4V27A 2KX9A 2ZUTA 3DH7A 1EA9C 2QEZA 4N9CA 3EWYA 4X2PA 3JU2A 3NZQA 5ABEA 2MUCA 1HKIA 1TZ7A 1DWHM 2TODA 1TIWA 3R12A 1W0MA 1EPVA 3MUAA 2ZRXA 3TC7A 3OQ8A 2OSWA 4HA0A 2CBVA 4D2JA 4QFUA 1W5PA 4O12A 3TJ4A 5E5CA 4L4OA 4MB4A 2D2JA 3QQWA 4R27A 3EOLA 1GYNA 1P6CA 4M29A 3WZ0E 4UUIA 1PTDA 2OZ0A 1HKMA 3T0AA 3JZUA 3QOMA 9RUBA 1GVIA 3NURA 1Q13A 1TVPA 1TPDA 3P2VA 4DLMA 1DBTA 4MFEA 1YBQB 1F8MA 5K7JA 1F61A 4HA4A 3NPUA 1RR2A 1KFCA 4WDWA 1Q2RA 3I4KA 3C52A 4BQ3A 3FYOA 1T40A 5J8LA 1CDGA 1FCBA 2CBIA 5LNUA 3B03A 3KVMA 1DQUA 2OWXA 4JIQA 2VX7A 4DJED 4RNJA 2YFNA 4RDVA 4RNIA 1XC6A 4NSBA 2ODOA 1TYGA 4MF4A 4H4IA 3W1MA 1HKKA 3FN9A 1V6WA 2WZMA 4LB3A 4JTHA 4UOZA 2PF0A 4PRWA 1HP5A 5AHIA 3M16A 2VC6A 4GC3A 4MIMA 1L8NA 1WX0A 3DEQA 4JFWA 2QIIA 3TNOA 4KH2A 4PCTA 4TVDA 3APYA 4PR4A 3OA3A 3BAKA 4KWWA 4WDXA 4UMBA 3TN6A 4CQ9A 3LMYA 3GG1A 1DWIM 2JFEX 1SGJA 3CO8A 3C0SA 3NQDA 3U7VA 1PS9A 2PRMA 1TQXA 4Q8OA 3LRLA 4U10A 3WNKA 1E72M 4FHAA 4DJFA 3RILA 4DO4A 5CKSA 4ZXOA 4XAFA 3WF4A 4A3RA 1TZZA 1Q6CA 3TWAA 1XLHA 3CB3A 3ZZ1A 2UY5A 3V16A 1K8CA 3L7RA 2BY3A 3R13A 2EPHA 3CB8A 4JX4A 2PCQA 2Z2BA 4IPNB 3VZXA 1SJBA 4H6RA 5HWNA 2J47A 3CMGA 1UIOA 3G6MA 5E0CA 4JYFA 1WKFA 3VX1A 4MKNA 1DJNA 1ZAHA 2ZYFA 3K5XA 5EU9A 1MI3A 2GSHA 4GRSA 1VYSX 2I56A 5J5DA 5XINA 3GDRA 2GYIA 1VBRA 3IIOA 1UR3M 4CQAA 1OGSA 2ZZ4A 4DEFA 1EXBA 4ZTYA 1KM6A 1ITQA 4JNMA 4IJRA 2I17A 4M6VA 4P7QA 4L9ZA 3W7PA 3W27A 1K7XA 2J7EA 4IJCA 4L6HA 5DO8A 5H2ZA 2VFHA 3AYVA 3K4WA 3IVSA 3GTIA 3W6YA 2Q6ZA 2WAGA 3XIMA 4NXKA 3NVTA 1TJRA 2QR6A 1OFQA 3CUFA 2ZZ3A 4IGSA 1Q65A 1KR1A 1E6ZA 5B80A 4PSPA 2CZDA 5IHSA 1XPGA 3TA9A 4GISA 4WVXA 1KM4A 1IXNA 1GWJA 2QUUA 3LOTA 1W31A 2GGJA 3WQGA 1ZS2A 1PYFA 3UGRA 2HBXA 4OOUA 4G7EA 1H4PA 4L4PA 4D6HA 3K2GA 3UFYA 5T9CE 3JS3A 4HHLA 2REQA 4QLKA 4JZ5A 2XIOA 4D8ZA 2CXGA 3PAJA 2EPKX 4FX7A 4DPPA 3NXFA 3ZLFA 3CHFA 3LV6A 4GQBA 4CNPA 3CQJA 3UPWA 5CG7A 4O1CA 4S3AA 1WA3A 3CQKA 5E9AA 3FX4A 3NSXA 1FFRA 4H7CA 5I3FA 3NM1A 2ZX8A 2J8TA 2CCRA 1X1NA 4NNAA 3WFZA 2HISA 4ZB0A 3VDHA 3N9RA 4OT7A 2XFYA 2H3DA 5AYBA 5C9RA 2J78A 3VK5A 2HMCA 4FOJA 2H6RA 4L64A 5IDIA 4KESA 2CC0A 2A85A 3IJ9A 3VUSA 3OLIA 4J9JA 1KLZA 3UBPC 3V36A 4LY8A 1BXCA 1EC9A 4DUWA 2EGZA 4GVHA 1J10A 4DO5A 3TN3A 1B3ZA 3MSDA 3VM7A 4NRSA 4AD2A 1JVNA 5C0QA 1Q66A 3UJ2A 1NQKA 3BW3A 4FO4A 4GGHA 3YPIA 1DJWA 1E0TA 4J3UA 3QGVA 3KDOA 4ZOBA 1PBGA 1AW2A 4WHBA 4YVXA 2ALDA 2VFIA 4LV9A 5I77A 2XIMA 4BF5A 1GKPA 1KM0A 2FVLA 1TPC1 1JDEA 1S38A 1I2OA 1JPHA 3N18A 2ZVIA 5IOBA 3CEUA 1U5HA 2ZUNA 5FEXA 3W2KA 1SW0A 4I5UA 3B8SA 1Q6RA 4EWJA 1EDGA 1NSJA 4WOZA 1LOSA 2ZZ6A 3LD5A 3RRXA 2GQ8A 3UGVA 1O5RA 4IQJA 2OB3A 3AICA 1HIZA 4RDWA 3WLJA 2R91A 3K30A 4D9PA 1MEWA 2YBTA 6XIMA 2CPUA 3QMTA 1EJSC 1WYIA 1KFKA 1J5TA 3MSYA 5F7UA 2WLZA 3S9YA 2O56A 4W7UA 4LYKA 3WDQA 3M5XA 3LHUA 8A3HA 2GGHA 4IG2B 3N2XA 5I3GA 3IWPA 4JQ4A 4RZBA 2OZTA 1ISWA 2ISSA 2NV2A 4P8VA 5E9XA 2CLIA 3RPTA 1S1RA 2DZTA 4ZZ9A 1UWUA 3PZTA 3BCFA 4L1GA 2YCKX 4B2DA 4PTVA 1RV8A 5FEWA 1JDAA 3PZMA 3EMQA 2DU2A 1DE6A 1I6NA 1W1B1 1ZB5A 3GFXA 3UCCA 2ZX7A 4ML9A 2BVYA 2DQWA 1AH0A 3I6EA 4AYSA 2VCCA 1E73M 3TC6A 1FOBA 3TYDA 4N42A 3TC3A 1B2YA 4BI7A 3KOWA 5TIMA 1EJXC 1XLLA 3MSRA 5A1AA 4GUJA 5I5RA 4JN7A 5T91A 1W1A1 4QSFA 2CLHA 3SQSA 5U4NA 3GG0A 1AD4A 2V38A 4PZVA 1NFGA 1X96A 2EPOA 4A3HA 3AIVA 3ZMRA 4U3AA 1HF6A 2VENA 2ZOXA 4YTTA 1UKTA 4I7WA 2UBPC 1P1MA 2ONEA 2DSWA 4BWLC 1A5LC 3BGGA 2ZXQA 3IK2A 2ZRWA 4EP8C 2GFTA 3JZEA 2NSXA 1UP2A 3HPSA 4DJDD 3PWAA 1RY0A 2YA2A 3W37A 3LGGA 1IR1A 1PWMA 2QT3A 4GYJA 3RCNA 4FR1A 3PNZA 4CNNA 3ZOAA 1RJPA 4JNZA 4O57A 2J7CA 2V6AA 3B9EA 3LB0A 5HNRA 4KRTA 3OG2A 4FNUA 2CKRA 3UERA 1H50A 1DWAM 1U33A 3CEPA 4G8TA 2YL8A 5EBUA 1Y5XA 3W00A 3W1PA 3W2UA 4KRZA 2J74A 1DWGM 4ZB5A 3N1AA 1IEVA 1CZ1A 1MZRA 3USBA 3KWSA 4ML4A 3TWBA 3H4WA 1WXJA 3CV7A 1QT1A 3BG9A 3OVPA 2CZEA 1H7OA 3R1ZA 4KMQA 3VKCA 3OIHA 1D8CA 3EPOA 5D8ZA 4M51A 5G1YA 4JTSA 2F6XA 1TZ9A 1CI1A 4D6GA 1E56A 3FEQA 4UCFA 4TVCA 1VCGA 1UD2A 4FNRA 2ZZ5A 3S9IA 1HJWA 2R1NA 4E8CA 1FWBC 2NVAA 1RP9A 5C9WA 4M1BA 4H9XA 2JALA 1DXEA 3P80A 3AJXA 3VINA 2NT1A 4G5DA 4Y9OA 1B90A 2YBUA 2DY3A 3FJ6A 3QMSA 3VO0A 1EXPA 2W6RA 2VEPA 2OGYA 3E0IA 1DQXA 3OLDA 1M68A 1N2VA 1X7FA 2VMFA 1FA2A 1A3HA 4NZCA 1OVDA 1RJQA 4IPLA 1RCOB 4MWAD 2OYLA 3GNNA 1K4HA 2GDVA 4Y96A 1YQ2A 1W3TA 5H6HA 1FVPA 4AD0A 1UPMB 4NT0A 4UIOA 3P8JA 5KTLA 4R3UA 2QAPA 5BRPA 1KV8A 2YL6A 3PJTA 3WCZA 4U4MA 1GT8A 1H5YA 1XSKA 2QDEA 3TSBA 1GVYA 2FFIA 2Z6IA 4CNTA 1WOBA 5DFAA 2TMDA 2XZ7A 3LV5A 3NGJA 1R3YA 1I45A 1UMYA 3FJ4A 5G1TA 1XC4A 1R3VA 3GR7A 2HPIA 3GS6A 1H7RA 1YHTA 2DUXA 3EOEA 5L9FA 2WJZA 1T96A 4XKMA 1O1ZA 4O8RA 1HXJA 1L6YA 3EMZA 1VS1A 3N6QA 1K7FA 1W1VA 1H5VA 1GYMA 3M5ZA 2OKTA 1JD9A 2RDUA 4PUJA 1YPFA 2VRKA 2R1LA 3P82A 4D6FA 5A95A 2XDFA 3J7HA 4RE4A 1OG6A 2GJLA 3WLPA 3HV8A 4O10A 1AL7A 4IGMA 3GIYA 2FPYA 4UTMA 2ZKMX 3ARRA 3LHZA 1VFMA 5FI8A 2G0WA 3H4XA 3IGSA 5EPDA 1L6SA 4UFKA 2D2HA 3O9NA 2OPJA 1YDNA 1O5QA 4GC4A 2GJXA 5FEZA 5KZEA 2IXUA 3UG5A 2EO7A 3QV8A 3ZXWA 3QV7A 1V4YA 4NY2A 1NAL1 4AY7A 4IPIA 3SFKA 3GFZA 1TTQA 2ZTJA 5C9UA 1JCJA 4HBKA 3NQ6A 4N2YA 1SW3A 2A6NA 4QROA 2POTA 1JQVA 3N2TA 2I1OA 2IPJA 3ZT6A 2WHKA 1VFFA 3QFWA 5HBFA 3PJXA 1Q6FA 5M03A 3E49A 5A8OA 1A5CA 3VA8A 2P0OA 3GY1A 5LA0A 3AIWA 2FJKA 2NQJA 2PDXA 3ABQA 3MVTA 3WMSA 2GZXA 1MZHA 2UY2A 1J0ZA 3I7RA 2QUMA 1TUXA 1DIOA 1ZAJA 3DIPA 3GVQA 1IV8A 4UR7A 3LEPA 2V3EA 3TV8A 3M7WA 3RAOA 1UZDA 4IISA 3PZVA 1R6WA 3MQTA 1DPMA 1HVQA 3G0XA 5FAGA 2X40A 2V9DA 3ANYA 4XKYB 5BRBA 4JKMA 3U57A 4AIOA 1IIGA 1ZP4A 5KMYA 4Q3MA 4ZMGA 1BXNA 1UD5A 3DU0A 1XX1A 1DJQA 1EEXA 3SZ8A 3UY8A 5JIPA 5FCZA 4C6JA 3PPCA 3TFCA 3M46A 1NY1A 4Z0SA 4GYFA 2HK1A 3DI0A 1NDVA 3MKVA 3S2MA 2ZC8A 4U2YA 1KRMA 3IEBA 4BF7A 4DBEA 4FX8A 5HJYA 4IGNA 4Q22A 3CV1A 4FXJA 4C60A 1S3TC 2NVCA 4S2BA 4HYWA 3MMUA 1E4IA 3EWWA 1BTCA 5K9CA 3GWQA 1GEQA 3NPWA 2NX1A 3VOCA 4GXMA 1MRQA 2QCNA 4PB4A 2DZUA 1JZ6A 1YBQA 2E9MA 3EKLA 1DJZA 4XZNX 2O7SA 4IT1A 1KFWA 1IR2A 4BEQA 2XTKA 1WOAA 1B3XA 5CJMA 1VHNA 2PD9A 3AIEA 1E6QM 3M6YA 4Y9PA 3NVDA 1WDWA 4ZA0A 1UW9A 4IP4A 3V5FA 2VURA 3BWWA 3VKKA 1GG0A 3EWDA 4XK2A 1QBBA 3VGDA 4Z42C 2VDGA 5FSEC 3G1FA 1AJ2A 1S5WA 6TAAA 3IIXA 1F07A 3M41A 4E3TA 4HJWA 4BS0A 4KCWA 3WLNA 1GVFA 1CNVA 5HULA 5M1TA 3NXLA 1M03A 3A13A 1YYAA 1GOXA 3AS1A 1XKYA 3DYOA 3M1ZA 4K2SA 3O8AA 1SJCA 1T5AA 2CITA 5A6TC 3GNPA 2YDSA 3DYMA 4YVVA 4B5SA 4Q4KA 4DRSA 4ZEPA 5EMYA 4HHPA 2V2HA 1DJXA 1W3KA 1L0PA 3POHA 4UFMA 1JZ2A 4OECA 2DDXA 4EF8A 2AAMA 3AC0A 4QXIA 3AS0A 5CLWA 4D71A 4CLMA 2XSBA 3QHOA 3BQ6A 1YPIA 4PTMA 3S1XA 4QJ1A 3UD6A 4S3JA 3HG3A 3S83A 1IF2A 5AC4A 4Q8TA 3LGEA 2QF7A 1B3WA 3WEMA 2A3EA 1J6PA 1XSIA 2E09A 3UVIA 3D3AA 3SCWA 1BRLB 3CMJA 4HCDA 5CPTA 3IARA 1WNOA 2DZWA 1TWIA 1GZGA 4AU0A 3E2VA 4MDOA 3ARSA 3QHMA 2WB5A 1XV8A 3HN3A 4PB5A 5BU9A 1WUEA 1QW8A 4Q4RA 1GVOA 4I5RA 4QS5A 4NU7A 4IMEA 4RX0A 3QVQA 2XFWA 3HGOA 3CV6A 1MW2A 1GKQA 4UB9A 3WY1A 2W63A 1XG4A 3ZVHB 3VNJA 2RDTA 4QG8A 4QQUA 3CXOA 1XLMA 2HNEA 4OU1A 5LNRA 3WLKX 4D72A 5D4YA 4I90A 5CBIA 2JEQA 4C7GA 3AUJA 1XIHA 1LG2A 3D46A 3D5HA 1HT6A 2D1ZA 3ECQA 3S1VA 4GX9A 4QE1A 2P76A 3LHTA 5C6MA 1YTKA 4A3YA 2HWGA 4GE8A 4Q6JA 2PDMA 3COTA 3R8GA 4C1KA 4W7VA 1JI2A 3VNDA 3C4UA 1FWSA 1UD6A 3EDEA 4GUGA 4XV0A 5LIWX 3R0UA 1W54A 4WR3A 1RP8A 1OJXA 4WXYA 2A21A 3CK5A 3LK6A 3FVMA 2Z26A 2C8NA 5AVNA 4GO9A 2DW7A 1Z3NA 3CHEA 1P0BA 4AQLA 4MNMA 1H09A 3W2NA 1GW9A 4FOKA 1LROA 3W9ZA 3CMFA 3T2QA 1YDOA 1TPEA 4H9TA 4HCHA 1VRXA 3I6RA 3VD4A 1MYRA 1XISA 2I5IA 2IQ0A 4DWSB 3CUHA 4DXVA 2ATMA 3O6YX 3RU6A 1Q6DA 2DW6A 3PP7A 2IPWA 2VX4A 3INPA 4DJFC 4FNSA 1OCNA 4ERGA 5XIAA 4M24A 2V3FA 2Z27A 4Z1BA 2JKAA 2VTFA 4I5XA 2PSNA 4FI4A 1MFUA 5T26A 3ZSSA 1KM3A 2XSAA 3P84A 1O6IA 1W5NA 4X0NA 2ZBTA 3A5FA 3KAOA 1KBJA 2KZHA 3LLXA 4OQVA 2YA0A 4KEMA 1M7XA 4O52A 3QR3A 3W6MA 4HPHA 2OQLA 3F2CA 2AQOA 3GVWA 1LORA 2W79A 3CAQA 3IRDA 1KQZA 5IBXA 3VD3A 4AZHA 2F38A 1XQKA 4PRTA 3SRKA 3IUHA 1OYAA 3TAKA 5ABTA 1S1PA 1JRBA 1OF8A 3L0GA 1YDYA 3KVKA 4K8EA 4MLJA 3WLHA 3A6OA 3SUUA 3S5YA 3HQ1A 2QMKA 4GXPA 3CGTA 1AQHA 4M7SA 4LRTA 4IM4A 5AZ0A 1TJ1A 4LU0A 3KCOA 3SR7A 1S2UA 1XIGA 3MWCA 3G18A 5I02A 1DIEA 5JBDA 4D1IA 3KW3A 3DX5A 1UCWA 2X41A 3WMCA 3KVLA 2LLEA 1FCQA 3GR8A 4EX4A 3ZSTA 5FJJA 4L6DA 4EXBA 3PZIA 2ISFA 3DFYA 1UR0A 2NUXA 5DANA 2Y7GA 1AMKA 2ACSA 2J79A 3S0CA 3NFUA 1RVGA 3EDKA 3NDOA 3AHZA 1DXFA 4HMNA 3CLMA 3G1XA 1G0CA 2CZ5A 4V2XA 1E9YB 2J6VA 2B31A 4OKDA 2HE5A 3MWAA 4LUTB 3MKKA 3NQAA 2O9RA 2EF9A 1CGTA 1XUUA 4DJDA 1JXJA 4IG2A 1UKSA 4M3PA 2Y24A 4PUEA 3PJWA 2Y4SA 4LCSA 4KKXA 6ENLA 3WF2A 4PSRA 5EMLA 3VNYA 4HNUA 3GYCA 1TQJA 1TPVA 2B7OA 4JL2A 4M82A 4MZ8A 4LBRA 1KCKA 3TLQA 3IANA 5DN1A 4P7OA 4LRSA 3TH6A 5KITA 4TX9A 5M17A 4KPLA 4ZGYA 1XH1A 4TUFA 2HCVA 1MDRA 4HSOA 3W75A 3B8DA 2PLJA 3DXIA 2ZICA 4DBUA 1JYVA 3MI6A 3EX6A 4Q8UA 1S3HA 3M7SA 4LT9A 2ESCA 3KXQA 3TTYA 2NLIA 3AZTA 2WJDA 2PA6A 4AX7A 3EDJA 1P0KA 1M53A 5A8GA 2YA1A 4M80A 5HWMA 5CPLA 4UC5A 3SDOA 1BVWA 3K4DA 1XD1A 2YL9A 1XBYA 2PGEA 4JTAA 4ZFMA 1AJZA 2HRWA 1MO0A 1OZQA 4FIRA 4JXCA 5I00A 1A5BA 1R2TA 1Y5WA 3V0UA 4PULA 2P5NA 2OKOA 5GJPA 4JTEA 1FWNA 3T05A 4GQGA 1G1YA 2OOFA 2GVYA 1LM1A 3SN0A 1D9EA 2CLKA 4MWAA 3NOEA 1GPWA 3FYYA 3FA4A 3TYEA 2XGIA 5ENLA 5FL0A 2PURA 2WV8A 1YW1A 1QI5A 4QHRA 3ARXA 2CBJA 2WMIA 4N6EA 4MNKA 1I2RA 4V33A 4KWVA 5D2XA 2O9TA 1GOOA 4UFHA 5IXEA 3KBNA 2ZUSA 3SCSA 4C6QA 1E0XA 4UQEA 1TX0A 4XBSA 1QPNA 1TWSA 3VILA 4OGZA 3G1VA 3KOYA 3KBWA 1R5YA 3HOJA 3W2LA 3C2EA 2AMGA 3THDA 3VE9A 1KWGA 1E5JA 1HJUA 3SGZA 5FF2A 1UC5A 4KIRA 4G2DA 4WSKA 2PGRA 4PODA 2DIJA 1LYXA 4BF9A 3P0XA 1EJRC 3ZM8A 3M64A 1V0KA 3Q65A 2PTXA 3E5BA 4HMEA 5D05A 4AXNA 1DWJM 3ES7A 3EWUA 2ZXAA 1J96A 4EOUA 1PE1A 5HPCA 3VE7A 2O9OA 3B3DA 3N3TA 5BMXA 3LQGA 3FK4A 3B8IA 9CGTA 3WMLA 9XIAA 3KL0A 4Q8QA 1GG1A 1J93A 1IGWA 3ITOA 3PFMA 1C9DA 4FF7A 2OLAA 1JG9A 2PDQA 3FHQA 1JPKA 4N9BA 2CBUA 2OMAA 3SGUA 5A6SA 4J3ZA 1Y65A 3MUIA 3W29A 2E77A 4D1JA 4US5D 4AIEA 5BNKA 1NH6A 3DAQA 2G5WA 2GJPA 4OFCA 2YYUA 3UG3A 3EDDA 4RE3A 1XHGA 4C6MA 3TEVA 4HB7A 1BVZA 4JTKA 4D6DA 1CEOA 4BK9A 3B0XA 4EWND 1NFPA 3PUEA 4B9ZA 3R89A 4N0RA 2G96A 4LCRA 4GLEA 3WQOA 5I23A 1WDDA 4YJ5A 1QCWA 1ME7A 3GXTA 4O0ZA 2VT0A 4CN6A 1AH4A 1UUOA 2XIQA 3LPPA 2A5HA 4GIRA 3OBAA 2WBKA 3GUGA 3BCDA 5JVLA 3CWNA 4PMNA 2ZCGA 4QJ5B 1FWTA 3SCQA 3CHCA 2P8BA 2HVOA 4ZB2A 1FWFC 1TE6A 1Q2SA 2DV0A 4G56A 1IXPA 3MBDA 4Z2JA 3RIKA 3A64A 4JTDA 4DPQA 4ZQPA 3OPSA 1ZAIA 4BY3A 2YIHA 4XWUA 4RZ4A 3E6EA 3B9NA 1FWCC 3HTWA 2VR2A 4G9PA 1XDJA 3GU1A 3L23A 4LPCA 3WJXA 3ANUA 3NNTA 4IWWA 1ITCA 1ZBKA 1UR9A 4NJHA 2QDDA 4JN8A 3WNOA 1ZJAA 4C5YA 4AD3A 4DAFA 5CPSA 2PDWA 1U1JA 3W7KA 5AHEA 5DY3A 5CLTA 3OBEA 2ZRYA 1IEIA 4H9MA 5K2ZA 2GOUA 4NILA 4CCEA 1B5TA 3C8NA 4QG6A 3RLVA 1UQYA 1V0NA 3W71A 3GNXA 4XD3A 5IFPA 1V3HA 3W1LA 3CZGA 1QW7A 3STFA 2J62A 1B1YA 1LRNA 5MKGB 3W3OA 4IGHA 1OIFA 2VYOA 2ZUUA 1D3GA 4Q7NA 1ECQA 3BE7A 1CBGA 3A21A 3WQVA 2BG5A 3G5EA 1XLEA 4UOQA 2OT1A 1CXKA 4FAMA 3OBKA 3RDKA 3WJZA 2CW6A 3V18A 3ATZA 3GTFA 3ZT7A 3R4IA 4XBJA 4NNCA 2WCAA 4EPDC 2A6LA 4MLRA 4K7VA 4XKYA 1I60A 1RXOB 2WPGA 3VZYA 1PHQA 6REQB 4LEFA 1IZKA 1ZTVA 1E1FA 3LHYA 4X9YA 2QCDA 1UKOA 2WKGA 3V35A 2EKGA 4O0KA 1B3VA 1UA3A 4C1NB 3MUY1 2GUBA 1U5VA 1Z9AA 3GIQA 1JYNA 5AC7A 4TV6A 3QKEA 4AY1A 2GSEA 3BJSA 2VJXA 4GYPA 1KRAC 4S3DA 3VXGA 1MSSA 3WH5A 1H7PA 1XP3A 1MUWA 2GVJA 4HNCA 1Q7MA 1Z7AA 2XGBA 3QZEA 5JBFA 4LFYA 3FIGA 2PDNA 7TIMA 3BO9A 3S4TA 1JGMA 1JCLA 4FX6M 4JICA 3LRMA 3PZUA 3RO6A 1QOPA 5I79A 1JUEA 4PMQA 2UY3A 1PO9A 4GZEA 2JGYA 3L0KA 4H6QA 1W3JA 5CGMA 2W61A 5FKYA 4RLIA 3TROA 3MZNA 3REQB 1NF0A 1DXIA 1YE4A 2WSQA 1OGBA 3RITA 3PULA 2A0NA 2V68A 2OEMA 3TYBA 1QFEA 1W2PA 1P48A 2WVVB 3PG8A 2GK1B 4F0MA 1VFUA 2D20A 3KOXA 4GMEA 3TIMA 1KGWA 4WSJA 2A1YA 3E5PA 2XN2A 1I4NA 2ACQA 3ABRA 1XLIA 1FWIC 1ISZA 2WMJA 3O6DA 4K7YA 1UJQA 3SEPA 1NEYA 1PYMA 4UTJA 1X97A 1VRDA 1ZNNA 4DF0A 1OT1A 2PTDA 1PTAA 1VZWA 1C93A 1QNRA 1I2PA 2NV9A 2OVLA 4AD1A 3AISA 3LCXA 3PPHA 4CKQA 3NPVA 4PMJA 1ZUAX 3TQKA 3FOKA 4AMAA 1QASA 3N73A 3ZR6A 5I03A 4Y9AA 1B57A 3BOFA 4OVXA 3P74A 3RX3A 4U5IA 3T09A 2WK2A 5F2MA 3CL8A 4AUBA 3NZRA 4F8XA 3VABA 4JL1A 2BHYA 2GWGA 1TWDA 3QH2A 3K4AA 1NOFA 1H7NA 2Z28A 3VIHA 3UZ5A 4WKAA 4JIIX 2E4TA 1YXDA 4XO7A 3WJWA 3FHAA 5HK4A 3GVGA 2HJPA 2XWEA 4XIAA 2ZDRA 2W3ZA 3RM4A 2NVDA 5I24A 2FTYA 4GXWA 3RF9A 5I0DA 3P5ZA 2ZX6A 2HEJA 2XIIA 1IGSA 3T44A 2BWGA 1RBLA 3UCQA 4WCJA 4XAYA 3WQPA 4GQ0A 3TE9A 1R9XA 1BRLA 5A6KA 2FJUB 1HZYA 1YKWA 3S2LA 1WZMA 2QJNA 3Q37A 3WK1A 4NVTA 3OIXA 5F4WA 2WANA 8XIAA 1ITXA 4UQ9A 3QHNA 4LVBA 1UWSA 4WJ8A 3FXYA 4GYKA 4N7QA 1JGIA 1AODA 2PP3A 4ACYA 3ZVHA 2WZEA 5LHEA 4RNHA 2DH2A 4Q8NA 1QNPA 3EWXA 1KBBA 4KGJA 2Q3OA 4N9DA 4GJ1A 5HMFA 3KP0A 5FF7A 1G01A 3JR2A 2O4QA 4H7ZA 5EMJA 3RRAA 1QBAA 3FGCB 2YDQA 4Y8FA 4EXQA 1VLWA 5HAOA 1HN1A 4O1BA 4YCPA 3HM7A 5BU6A 2ABAA 4ZXLA 3H2MA 3GDMA 2V3DA 2ZVRA 3LS9A 1OCBA 4D6IA 3W1UA 1ODUA 1BG9A 3U2CA 4R9XA 1JAEA 3DFHA 1PSCA 1QU4A 2XUCA 3EWZA 4JQ3A 3K1DA 3FKKA 3H55A 3S2CA 4FK9A 3CPUA 2DSVA 1KTCA 1VP5A 1JFHA 3BSHA 3OG3A 1US2A 4HYRA 2ACUA 5I09A 1XBZA 2PLMA 4YLWA 4RXFA 1BVNP 2YCEA 5FOOA 5CC3A 1XGDA 1SR9A 4QJ4B 1DJIA 2Q3RA 1E0WA 3A23A 1CLVA 1US3A 2WC3A 2X42A 4DX3A 4W5ZA 5GVJA 1DHPA 1CW2A 3GC4A 3SM0A 4GD0A 4L61A 4ICNA 2Y1HA 3BAIA 5G2WA 4IIHA 4HNLA 3AXKA 1AQFA 2VM8A 5KZMA 4I6KA 3T0DA 2RDXA 4IMGA 1P4CA 2VELA 4MFDA 3W24A 1GTHA 5BOOA 1NDZA 4JTQA 2WM0A 4MB1A 2WCGA 4D6EA 2DT2A 4DIAA 3O2LA 3GC2A 4O13A 2C18A 4O1AA 2CWXA 3TTQA 2J27A 3LTYA 3L4TA 3I4EA 2HNHA 3DYPA 2ZADA 2QLYA 2WSPA 3TOYA 4X61A 5FJTA 1KRBC 1P0NA 3DG3A 4Q7IA 2QCGA 3FY1A 4RR4A 2YJQA 3KX6A 1KD0A 1DP0A 3FW6A 5D2YA 4A3UA 1T0OA 2F6UA 1KXTA 1LBFA 1DOSA 2E6DA 2I7GA 4PMXA 1CXFA 1LDCA 2C71A 4S3KA 4TR9A 3H54A 2O0TA 3NL5A 2XM1A 5H8UA 4ERIA 4AFYA 1E9IA 3BSMA 2VEIA 4W4QA 1LLWA 5FA5A 1YNPA 2WOQA 2GDQA 2NT0A 3KS6A 1IT8A 3DFOA 3GD6A 2ZIDA 3KUMA 4B9YA 3OP2A 3G0UA 1RCXB 3BURA 3NL3A 3G0SA 3SUSA 2NLYA 4WLCA 4L80A 4LUIA 1NP0A 1GTEA 3AQUA 2ZUWA 2CYGA 2VP8A 1BKHA 2OTDA 3BDKA 5GNXA 2I9UA 1UWRA 4GCXA 4B3LA 5AC5A 1FY6A 3E38A 4LUTA 4LYQA 5DBTA 1RCQA 1JL8A 4CN1A 2ZX5A 3W22A 2CLMA 1BYAA 4BQ2A 4AIBA 1LCOA 2GJNA 2FZBA 5L6UA 3PVFA 4EAMA 4KWUA 3L4WA 3URAA 1EDTA 2ZRZA 1GUVA 4QX4A 4CCDA 2EAWA 4YHGA 5GJNA 3N11A 5CSUA 2RHGA 3SIMA 4DUOA 3CQHA 5GJMA 4RW5A 2YCLA 3LY0A 4CQDA 4YWSA 5CC7A 1QNQA 3N9KA 4WRHA 4YYCA 3HV9A 4W89A 1K8ZA 1W3NA 2XVPA 1B9ZA 3SJNA 3OHMB 2YPIA 1O4UA 3T8QA 2Z1XA 3BMXA 2VFFA 4TOQA 2FFCA 1GQJA 1LP6A 1MRAA 1ZHAA 4ZO7A 2NUWA 3WDJA 1OADA 3L2IA 4Z0JA 4F0SA 2Y5JA 2E5CA 4QDPA 3HMCA 2PDKA 1H61A 1HUVA 3IVTA 4TXEA 5FF4A 2QCEA 2QF8A 5AVHA 3WUFA 2VUNA 4GQQA 3NPXA 3W87A 4NQ1A 4DHGA 3M43A 4PL2A 2R94A 4I8YA 3UETA 4XSLA 4I7VA 4AHPA 2E1WA 1SO3A 5M2FX 4LOCA 2RUSA 3W7LA 1BKSA 1R47A 4PTXA 4YHEA 4US5A 2O92A 4X2RA 3TAOA 2HK0A 1FKWA 1BSIA 1U1UA 1EO5A 2G3IA 1GVSA 4LB4A 3GTHA 3C2VA 2J6XA 4HZ7A 4RV8A 1TMQA 3GHUA 3EB2A 3ONCA 4XX6A 3VMOA 3RR1A 3K8MA 4P2VA 2H9AA 3L4ZA 3QW4B 1Q3NA 4UNLA 5I78A 5HA7A 5HMEA 4IFOA 3LSBA 2WMKA 5CC5A 2D0FA 2FKPA 5KEZA 6PTDA 5HNTA 3H7VA 3W53A 3STPA 4F0RA 3HJZA 3QQ1A 4V1XA 4WZHA 3TLLA 3JRKA 4KW2A 4LBUA 3S2JA 4CEXC 1LL4A 4IFKB 1ELSA 1QJWA 4TO8A 2ADAA 3Q67A 1TV5A 1ZU8A 1JUBA 3QBUA 4WY0A 5HXMA 5XIMA 4H2CA 4HTYA 1G4TA 4GI6A 1XM3A 5HQMA 5ABFB 3KVJA 3OGVA 2DVTA 1IE7C 3VOJA 3UA4A 4HSHA 1GVRA 2Y61A 4J2PA 4B5UA 1FCUA 4KCTA 4HSNA 3AU6A 4BKNA 4GIAA 1L2UA 1Z32X 4LUJA 5A2CA 2F84A 1NARA 2BASA 3NL2A 4AWUA 3OODA 3DGRA 5LIYX 1LQAA 1HFBA 2EXOA 3WFAA 3ITTA 4UTTA 3WBWA 2DT0A 1W1IE 1RALA 2QCMA 3KZPA 4LVAA 1YNQA 2QNEA 3QOKA 1QO2A 2VEGA 1VIWA 2R82A 5A6LA 1X8CA 2PGFA 2G4JA 4JTTA 1OD8A 2D3LA 3W07A 4DUVA 3E2SA 2F2KA 3RLGA 2A3LA 3RHGA 2G4FA 2NQLA 1YADA 5D2WA 1ZCOA 3F4WA 2NWRA 4ATLA 2R24A 3T4WA 4ZQCA 3GKFA 3RO8A 5C7VA 1UWAA 2AOSA 3NYZA 2CLLA 1DIKA 2E6FA 1UWTA 2D22A 1Q6LA 4JX6A 1ZENA 5G4EA 5HMSA 1FHLA 3MO4A 3H7UA 3PNUA 4REQA 4K3ZA 4K1WA 5CZJA 2GVGA 3WQ6A 3MHGA 1SZNA 3RMJA 4J5NA 5TNVA 4Q7BA 2X2GA 2VFDA 1GZJA 1QAPA 1VF8A 4NNBA 4NI8A 1KO0A 1T41A 5A8PA 3DHFA 4OZOA 3TN4A 5BOFA 3ZR4A 2GQ3A 3NJ3A 1LOLA 5HJXA 4C5ZA 4E8DA 3LPGA 3JW7A 5DXYA 3VD7A 1XBVA 4RL3A 4Q4QA 1A47A 4PCPA 2V5KA 1UASA 2FH6A 4GUIA 3LBMA 1DIDA 3O15A 4PBEA 4F66A 3FKRA 4L1WA 4IMFA 2IKJA 1YXCA 3PWGA 3C2OA 1MW0A 2A3CA 2WHLA 1F73A 3S9ZA 1UG6A 2INFA 3M47A 4MAZA 1ADSA 3CV2A 2VEMA 2CNCA 4RPQA 1R3WA 3L5LA 2ZWYA 1TRDA 1XCXA 3CZEA 5MKGA 2X0YA 2PBOA 3PHAA 3N6HA 2WMFA 3M4HA 1U5JA 1E5NA 3CC1A 5D02A 3U3HA 4MZYA 4MJZA 2VUYA 1FWAC 3CH9A 1I2QA 5HOSA 3URBA 1E0UA 1O68A 1GQIA 2X1TA 4F0LA 3WLTA 1OCJA 1OIMA 4IJBA 3ZT5A 4NHVA 1FFQA 3LCWA 1JNDA 3QPYA 3F1QA 2Q71A 2AKMA 3SBFA 4J3XA 4S38A 2PUZA 3WH9A 3CL6A 4BQ4A 3L4VA 1D7FA 4Z2LA 3P67A 5BCAA 2VZOA 3PB2A 1UROA 4DWDA 3VIGA 2POZA 2FVKA 2GOKA 4ZL1A 4UTWC 2NXGA 2PWVA 2ZE3A 4HP5A 2AKZA 2Y0FA 3U9IA 3L67A 4OIFA 4JCMA 1MWOA 4CVUA 1D7KA 3PTKA 1TWZA 1ZFJA 1MMFA 5D33A 1JXKA 3FLUA 4QM1A 5J04A 3LHWA 1RVKA 3FFSA 3GVRA 2ZZ2A 1D2KA 3B9OA 5LYRA 1BGGA 4B3KA 4K38A 3TMLA 4PMVA 4FOUA 2IPGA 3UZYA 2XVLA 4DNMA 2QHAA 3C2FA 2PWHA 5A94A 3LTPA 4OBSA 3W7DA 4AG0A 3NSNA 4RZ5A 3F5JA 3BUVA 3R6IA 3TJLA 4B3ZA 1Q6QA 1LLZA 3KS5A 4RDYA 5AYIA 1CGYA 3REQA 1EQCA 3G22A 1YNYA 1XYBA 3SN1A 1C90A 3UNDA 3KHJA 3WQCA 1FDYA 3GW3A 2WNWA 3NQEA 2GJXB 2QYGA 4IICA 3S46A 4AZ7A 1QI3A 4I3GA 4JR5A 3E96A 4RDZA 3AMLA 3AMDA 4OJYA 5CQ1A 5M5DA 2QJIA 3VGEA 4D6JA 2QKFA 4KWSA 3BLDA 3W7HA 1O12A 3I7QA 2INEA 2DVUA 1GQKA 1HQTA 4IIEA 4G7FA 4DBDA 2XISA 3WQWA 3G24A 5A6JA 3RCYA 1TX2A 2PODA 1OINA 1B9BA 2WYSA 3VIFA 2BX7A 3WKZA 4MWAE 1VPYA 3SY1A 3M44A 1EGMA 3BLLA 3I3DA 2OEKA 4ZO9A 4E3VA 2OFJA 2Y63A 3B8TA 3NWRA 1A4LA 4Z1AA 2J7GA 4PEEA 3OB8A 4XTIA 2VZVA 5CBBA 1TREA 3KP1A 3CYJA 3T9PA 2Q09A 3A4XA 1JI1A 4I6VA 1WQ5A 3TUUA 2I5GA 1C3FA 4AAJA 5BMWA 1SSDA 3NQ8A 1K7EA 3CASA 3H2NA 3TU9A 1HO4A 1B30A 1TPB1 4TV5A 3WDHA 2W62A 2GGIA 1XR2A 2TRSA 1J0HA 4AW7A 2WVTA 3B04A 4LF2A 3UWQA 3QGAC 4GUHA 1BGAA 4B15A 1KV5A 4CNOA 1UUQA 3N2OA 1F6YA 4WQ6A 3NO3A 4GYPC 1BG4A 3OZOA 3UWWA 2DZSA 4C6PA 1OX5A 3C0QA 3QGKC 3H12A 2C79A 4ZQRA 5TQLA 4PTNA 3NQVA 4AEFA 4GHRA 5ABGA 4PA8A 3TTOA 5LNVA 3EWCA 2J24A 1PTGA 3URNA 1YLVA 1CGUA 3KLKA 4JHOA 3CU2A 4JX5A 3LNMA 1F3EA 1E9ZB 1YTDA 2DZBA 4ZE4A 1JIBA 2XJ7A 5I3KA 1VKFA 1OSEA 1MW1A 1JPIA 2ATSA 4O53A 5JUVA 2CFFA 1UP3A 3S8HA 1TO3A 2PDBA 3TMQA 2JIEA 1MEIA 3APGA 3S47A 2YCIX 3EXSA 2CWNA 5E6YA 4KETA 3T81A 3RR4A 3OZMA 3FGCA 4HN4A 3JUGA 1N8WA 5HQLA 3P62A 3GHRA 3IJQA 1MFVA 2QCCA 3AALA 1OC7A 2BNJA 1EWEA 1BPLB 1B0IA 4KFNA 2Y7FA 2VR4A 1UB3A 2OO0A 1WDQA 3TQPA 3MZ2A 4WGHA 4DXKA 3VAVA 1IIHA 1KQYA 3CL7A 3UCDA 3LPFA 1ENUA 3SN4A 4J40A 1UH3A 5IDZA 2EKCA 2W92A 4J7RA 3ICJA 1JZ5A 3T0CA 1OBAA 3LBOA 3A5VA 2VDHA 1HO1A 2FZNA 1RQEA 3AAMA 2YGYA 4MJ4A 5AN7A 2FMOA 3CUJA 3F2DA 2GSJA 1CENA 3EA1A 3B8VA 1TPUA 3ME3A 4XAZA 4DF1A 4H04A 3WLSA 3OOQA 4QLLA 1POJA 2X0SA 4A8IA 4UQBA 3W1NA 4F2UA 4JTFA 1CXHA 4GUFA 1KKOA 4B90A 2X7VA 3CQIA 4HKPA 5AYXA 4PUUA 1NTHA 4A2SA 3CJPA 3E3HA 1EIXA 1V77A 1X8FA 2IW0A 3W28A 1JUKA 1F8IA 5JBEA 4Y7EA 1M01A 3QLLA 2PTYA 3P61A 3SUWA 3FYPA 1UZ1A 4R9OA 4UR9A 4US6A 5G2HA 2TYSA 3T1GA 1V03A 2JGQA 3STGA 3BMVA 1OFOA 1PUDA 1QWKA 4YNGA 3NDYA 1HKWA 1EBHA 2QDHA 3VKAA 3PUGA 4NIRA 1I1XA 5A2AA 4ACZB 1TPH1 3C3NA 5EL1A 4W87A 3M0XA 2E8YA 4ADUA 1PIIA 4E4FA 3ARQA 4P61A 4GG9A 1Y5VA 4C6IA 3OGRA 3ZWSA 4HNNA 3PTDA 3UYIA 1OQFA 1V6VA 3CIVA 2DPEA 4WJEA 1GNXA 1LRQA 4UWMA 2QULA 1AA1B 2RGLA 3PY2A 5EMMA 4X9SA 1KFLA 2Z1BA 4MNLA 3EXRA 2XH7A 1MDLA 2R1MA 1UWIA 3BG5A 1A3XA 3VTRA 2F61A 5CJNA 4QDWA 4S3EA 3BGAA 3ZLGA 2NQHA 1L2QA 4ICMA 2AGTA 3KOZA 3V7PA 3THAA 3KTXA 3ID7A 3L66A 3S1WA 5HATA 2ISDA 2J9XA 5D32A 3WD2A 3WL1A 5AKQA 4M8UA 4MTVA 3RJXA 1J5SA 3V5CA 1IEXA 3WBYA 1FH9A 1EC8A 2E9BA 3GFYA 3FDGA 3HIJA 4GI8A 1EX1A 2C0HA 3BTNA 3GAYA 1SFJA 4LUSB 1HKVA 5AHNA 3WQFA 3FS2A 3Q58A 5A6AA 4INFA 2ON3A 3EX3A 2G3NA 4XZMX 1Q8AA 3S1GA 1XICA 3CZJA 2ZFAA 4C90A 3KBSA 4M81A 2BFGA 1SR0A 2AL1A 4KQNA 3GXDA 1HG3A 4H01A 4O1EA 2JE8A 4RE2A 1U30A 3IUIA 2HDJA 1L6FA 4GNJA 3B0UX 2WZTA 3L21A 3L5MA 4MG4A 2OODA 2IXVA 1F74A 3MYOA 1LRTA 4KCUA 3W7EA 3W4RA 2B7NA 4DWSC 4F0KA 4CN4A 1IZCA 1BF2A 1YPXA 3QZ6A 1KXQA 4KERA 1KFJA 2VZUA 3AIQA 4UQAA 4UQDA 2PP1A 3C0LA 4A8NA 3EX4A 3UR8A 3WD0A 1I9CB 3NDZA 1A5NC 2CKSA 4R5EA 3LHVA 1HJXA 2QW5A 1UP0A 2PRLA 3IPWA 1C92A 4H6EA 3VOIA 1NWSA 4O54A 3G2GA 2C15A 3MO7A 1R0MA 1QVBA 3ALGA 1JDCA 1OGGA 4HU8A 3H4GA 1SFTA 1XQLA 5REQB 1M1BA 1XIEA 1EFZA 1XD0A 3G3MA 4B16A 3SIZA 3IGXA 3S6DA 3DOPA 2D23A 2AMXA 1KXVA 3FDKA 2JBMA 3QPZA 1Y8BA 1X7IA 2HTMA 4WX2A 5A6MA 4AIUA 2EG8A 4FNTA 4QAIA 2AL2B 3B9DA 4DNHA 2VWTA 4HQVA 3LQLA 4GVFA 2ZZ1A 5B7YA 2H3BA 3AMKA 3DGBA 3TQ0A 3AHTA 1UD4A 2ISVA 2RGMA 4KRUA 4F79A 4WK9A 1VCFA 3HGJA 3M0IA 2V5BA 3PZOA 5BXTA 4GFSA 3D3FA 1V51A 3W1RA 1B4KA 2W67A 4DELA 1CECA 1PCKA 4MY9A 5CAKA 1C7SA 3NQ7A 1VBGA 3GC5A 3E0LA 3S6OA 3STCA 3UU0A 3VYLA 3SCPA 1GQNA 4R33A 3QTGA 1TTJA 1JDFA 2OELA 4UTIA 3UWVA 2G97A 4DI9A 3WK2A 1ZY9A 1WZAA 4UZSA 2CXEA 1W6TA 5IFTA 2D2OA 5EA9A 1A0EA 1I0BA 1OYBA 4PUWA 3VNZA 1V08A 2PF8A 3BGJA 4KCVA 3U5UA 3IIZA 2BY2A 4I9JA 4QAWA 1FWEC 2B4GA 1HL2A 3NEVA 1U22A 2V0TA 3ELFA 3TW7A 2W9MA 3HFTA 4IFKA 4QEEA 4Q32A 1JFXA 4JIPA 2BOGX 4N02A 3KBMA 4A22A 1R3TA 4HYVA 1IHIA 5MHBA 2ACRA 3USZA 5FEPA 3A3WA 2OYMA 2L5HA 4NAFB 1XLCA 3KCJA 4Q4MA 1TTIA 5ABFA 3LLFA 3V5OA 3P60A 3R43A 5CBJA 4RNFA 4RK8A 1G4SA 3CNYA 1XIBA 4LALA 3LM3A 5EMUA 4UTKA 1ME8A 3R2GA 3WDPP 2PGWA 1E4MM 2VEFA 4YU1A 5ECUA 3GVVA 4HNTA 3P8IA 2DSUA 1V3KA 4HPNA 3GXMA 1OFPA 3W26A 5FJOA 1IEWA 3B8UA 2FPVA 1OB0A 3R58A 4QNWA 1JZ4A 1HL9A 1PZ3A 2OLHA 4JFSA 3FVDA 3PC0A 4PN2A 3FJNA 1O60A 2PU0A 1R3RA 1R7AA 4PMRA 3RN6A 1F05A 2KAUC 1GJPA 2WWDA 3MBFA 3R5EA 5CJ5A 4Z2HA 5DLCA 4A4AA 4WIWA 1TB3A 4E5TA 5LSMA 3G1AA 1XF0A 4GZ7A 4H19A 1VD6A 4MWAB 1DL3A 2WZHA 1KM1A 3FJLA 4HA3A 4WF7A 1EGZA 3H6OA 3W7IA 4JBRA 3TW9A 1NVMA 4IPJA 5FJRA 3GG7A 2WMIB 2ISWA 4H83A 2CESA 4R7WA 3RPDA 1H60A 5I07A 4H9YA 1K1DA 4X63A 1PCWA 3NQGA 1V02A 4ZSTA 1MXGA 4UOJA 5EGRA 2WPBA 4YIWA 2EPMX 3CHDA 4HHHA 3S3GA 3BG3A 4BWLA 1LT7A 4C6EA 3VOHA 2BOFX 3VD5A 3MPGA 1OM0A 3MA8A 1LG1A 4P8UA 1XYAA 3GYEA 1WAWA 3B0VC 4OUIA 3RLHA 3C61A 1C7TA 2C19A 5LHFA 4AXKA 1ODZA 3BSGA 5F1UA 2PDYA 1VJZA 4ROQA 4PMYA 3N19B 1ZJBA 4UFLA 2CHOA 1HJSA 4Z2IA 4JEJA 2D24A 4TTUA 2H8ZA 1W2VA 2FMNA 1WKYA 2Z7GA 3CO4A 2QQ6A 2XGZA 3IJ6A 4XUYA 4BI6A 3TCSA 1TMLA 3T0TA 1TV7A 3WDRA 4AVOA 4MADA 4JEQA 2D2GA 2Q01A 5H8PA 4OBRA 3QRHA 1EB3A 3GM8A 1HGWA 4RKAA 4LXFA 1H11A 1AZ1A 2FB2A 5I2UA 2HXTA 3UXDA 3MCMA 1PEZA 1XKJA 1MNSA 1J12A 1CXLA 1CLKA 1SPQA 3LMZA 3W02A 4DZ5A 3N25A 3GR4A 4IH3A 3H7RA 3MI2A 2WJEA 1CB7B 3GZAA 1QI4A 5F2IA 4LYPA 4HOZA 4WDTA 2ZTKA 2BMBA 3WLIA 3L4XA 1OYCA 1OFRA 3CZ8A 3T2PA 1V93A 5FIPA 2FHCA 4F48A 1W9VA 1KWKA 4IX2A 1JEZA 7REQB 3NIYA 3GDKA 5RUBA 1OY0A 3KEHA 2HVNA 3BAWA 1AFSA 1XLDA 1TV2A 4Q8MA 1NP2A 2D0GA 1R85A 4UR8A 1X6UA 4KGLA 4AWEA 3ES8A 3JVAA 2XFRA 4XAPA 4AD5A 1M5WA 3OGSA 1W1TA 1LWHA 4CQCA 4MUZA 3EKZA 4I8DA 5FJIA 3UXKA 1WXYA 1TV8A 4MHBA 4IXHA 1VEPA 1S2TA 4WXZA 4CD7A 1VFSA 2G41A 4WDUA 1B31A 3I7SA 2P50A 3F2BA 1JCXA 3RX2A 3WDIA 3ARUA 1TJ2A 4L7ZA 1E55A 2V2DA 3O06A 1EF3A 2W4XA 2BS9A 4EF9A 4A35A 3LN3A 1PWLA 2F9RA 3EGJA 2UY4A 1EZWA 1CIUA 1S5MA 3B40A 5C9XA 1H1ZA 4WGXA 5DELA 4CD5A 3W7JA 4M5PA 2B0MA 3CZKA 4MSSA 2RFGA 1ESWA 1R9YA 1MUCA 4P8WA 2J9YA 3MV01 1DQWA 1O5XA 5DMNA 1IT0A 5BZAA 2HQAA 1QO5A 2VCBA 4O8AA 2CZVA 1PAMA 4YYFA 2E8ZA 3QY6A 2QAFA 4O17A 3UF9A 4IUOA 4UTHA 4XZWA 1RUSA 1LTDA 1XRVA 4PBGA 2RJGA 2VI0A 5HMDA 5LIXX 4NG3A 1OFBA 3G3DA 3UJSA 5HUOA 4N4PA 5FL1A 1E6XM 4DJEA 4GY7A 2QCDB 4EVZA 3CT2A 3B97A 3HMJG 1I8JA 4E2DA 4U3CA 3VCCA 1Z44A 1AVAA 1S2WA 1FCVA 4AZCB 4U5KA 3G1RA 4UTUA 3GH7A 2Z1VA 4GK8A 3M5YA 5DF0A 1B4EA 1XCFA 2CZFA 4MOZA 3TTEA 5MF5A 4ALDA 4FLSA 4DBSA 3MJMA 3UWEA 3N4EA 1UPPA 3SCTA 3MTWA 5A2BA 3C3UA 5I6SA 3FSTA 4QDMA 1J2WA 2NZLA 2VZTA 2OWWA 3MUXA 3WH6A 1RAKA 4O16A 1CLXA 1Y0EA 3NO5A 2I14A 1F2JA 1X39A 1YTEA 1XBXA 2BTMA 1SQ7A 3GH5A 1T6MA 2BVTA 1RA5A 1Z69A 2WJFA 3NR0A 2A4AA 2FTPA 2HVMA 5D38A 2QUTA 3AWOA 1KM5A 4DLFA 5CPQA 2GJRA 4QIUA 5DXXA 3VGGA 1N8FA 3TYZA 1GOMA 3ALFA 3LU2A 1GKRA 1LL7A 1K4GA 1GOWA 3BCJA 3QY8A 3M07A 4PUKA 1L9WA 2ZA1A 4O11A 5CGQA 3SI9A 4N6FA 4KIEA 1K77A 1W91A 4M0XA 3AIBA 4FP1A 1ICPA 3UR5A 3MMTA 3PG9A 5F4SA 1XDMA 5E0FA 4ZQMA 2C3ZA 4IMCA 2Y6ZA 1W9XA 3OW1A 1KB3A 1F6PA 4GWEA 2RJHA 4E2VA 1GYLA 5JQ9A 1KNWA 4XTDA 2E40A 2FZ9A 3ZWTA 3QF0A 1TPFA 1P0EA 3EX1A 3KFTA 1OT2A 4ROPA 3W82A 3SQMA 4S2CA 1SMAA 4P5UA 5GQBA 1G5AA 1OD0A 1R3SA 4Y9MA 3UWZA 4PGLA 3AOFA 2GVLA 3A4JA 4UNKA 2WC7A 4NYYA 4CD6A 2Z25A 2Z2AA 1E70M 1CGXA 1W8GA 5LIKX 3WUBA 4EACA 4AHQA 1CB2A 3SURA 4G1NA 3DECA 3THQA 4JDBA 1QNOA 1Z42A 4O0QA 3W0KA 3CAVA 1K3UA 1GHRA 1CTNA 4GBUA 2GUYA 2QIWA 1EQPA 3HQPA 1UBSA 2F8QA 2OG9A 4LNYA 4DY1A 1BQCA 3FA3A 4ACZA 4XD4A 1IWPA 3QEZA 1ZBCA 4J3SA 2V2CA 3T78A 1GQLA 4S3CA 3TNBA 3E0FA 5JIWA 1TELA 4OTKA 1ALDA 2IPFA 4LS0A 1SZRA 3AXMA 2PTWA 3AIRA 5DX7A 3LZ3A 1OZMA 3RPMA 2FGZA 2Y7EA 3VMPA 4AF0B 1K9EA 3O0KA 4RW3A 4NUWA 1V7YA 3IS4A 1RQBA 3D0CA 4HTBA 3WBXA 2PZ0A 2WHMA 3SY8A 3VC6A 5K4XA 4HZMA 3IVUA 2PWUA 3SW6A 2VNCA 3DG6A 3OZYA 3KCLA 4Y8EA 4IIBA 1DVJA 2Y8UA 2DIKA 3P0WA 4NJIA 1DWFM 3HG5A 1JDDA 3ZFHA 1XH2A 3O05A 2P0IA 3THUA 4X60A 3EOUA 1OWQA 3WF1A 1GGOA 3TZNA 2DSKA 2JK2A 5CSSA 3W6LA 4RV3A 3LXAA 4L9XA 4LUSA 3AXHA 2Y8KA 1L6GA 4M6PA 2WNZA 1P1XA 4C6FA 5A8QA 2NX3A 1JCNA 1J01A 3G77A 3GBDA 2VHLA 4ZCWA 5C9ZA 4NZ5A 4EPKA 2INZA 3DBNA 4LYRA 2YDAA 1XRFA 5DMYA 3H2OA 1JD7A 3TQVA 3OLGA 4ZQNA 3V75A 3TTSA 1KTBA 3A9IA 3B06A 4H7VA 1BWLA 2VD8A 3GSMA 2FHBA 1AQMA 3C56A 5DY2A 1CYGA 1WB0A 4IMAA 5C2CA 3C2YA 1C8YA 3QW3A 3MUZ1 3NCOA 3QV6A 5D2VA 1THFD 4MDPA 1TJ0A 5BOEA 2YZRA 5AYZA 3L0NA 4JIEA 3SADA 4W9TA 2WMHA 3C6CA 2FH8A 2PCEA 2XZ9A 3CTTA 1NOUA 2DZAA 3AS3A 3L12A 4TQTA 1AK5A 4XD6A 3N12A 1G7UA 1S2VA 1LJYA 3ZR5A 2ZUVA 2PFHA 4E2OA 3ZYZA 1GOIA 4HMCA 3M0ZA 2RAGA 3QSTA 3M9YA 1MQRA 1RPXA 1U2YA 3QYQA 1QPKA 4E4UA 1K6WA 2DP3A 2YOCA 3AXXA 3UESA 1V3LA 1ONXA 4LCQA 5REQA 1LT8A 2Q8ZA 1A0CA 1FWGC 5DCEA 3TXZA 3H53A 1AG1O 3KBVA 3UZZA 1AW1A 4F4RA 3Q4DA 1EGVA 1M3UA 5DCBA 1PKMA 1R2RA 2J13A 2AL2A 1AD1A 3PWIA 3D47A 1OC5A 3SECA 3XISA 3SQLA 1P7TB 4NZ4A 3OTRA 3Q2DA 1J0IA 1YX1A 1X6NA 3KL5A 4QLJA 4AB4A 3VIKA 1XCWA 2V67A 1O95A 1CPUA 2PWEA 2E5BA 3UXLA 1E4NA 2ZXBA 5T8GA 4HPJA 1G4PA 3BC9A 1JYWA 3W7OA 2OR2A 3F03K 4YL2A 1XWYA 4UZUA 1W9BM 3MP4A 1XJBA 1PB0A 4GQRA 3W25A 4QJ3B 3WENA 4LEQA 1NJJA 3P7YA 4QEHA 2E67A 4ERAA 3MB9A 3EX2A 4TU1A 4HD5A 3FAWA 4JFVA 2OQYA 4YTRA 3ARVA 3BMWA 3PZ9A 4JY9A 3DERA 3AHVA 4LC8A 1PIGA 4EKJA 3CTLA 4RUBA 3UXAA 3PS7A 3LYEA 3EPNA 3IJ7A 4UQCA 3GHTA 3QN3A 1M04A 2X05A 3LM7A 1NFBA 3IJIA 3O6CA 2PU1A 4IF2A 3UG8A 4ZO6A 3W38A 1GW1A 2V5JA 4W85A 3W86A 4E6MA 1SFLA 1C29A 1PKNA 3N13A 4UNIA 4NAFA 1H63A 4C7FA 3WFLA 1TTPA 4JTGA 3VCRA 3KZSA 3RM9A 3TSMA 1VEOA 3SCUA 1FH8A 2FQIA 1HJQA 4R53A 3L68A 1EC7A 3HPFA 1UJPA 1WE5A 4O50A 2Z7KA 4A21A 4GIEA 4QP0A 3L65A 2P53A 5TBOA 3VGBA 2YXOA 1QDSA 3PJUA 3R8RA 1UC4A 3U8GA 2YCLB 1WBHA 4MUPA 1OEPA 1EYEA 1TIMA 4H8NA 3EDFA 1JPDX 4IFRA 1EJ7L 1EUAA 3NYDA 2PDFA 4HPXA 1YMYA 8XIMA 4KEZA 1AUSL 1OHLA 3VC5A 3NZGA 4GJJA 5C2GA 1AJ0A 2G37A 2BVWA 2JKPA 5AC8A 4WD0A 4WJXA 1SO6A 5AZ1A 2OCZA 2XM2A 4W88A 4XO6A 1F4HA 5CZTA 3W81A 1YE6A 3DBPA 3OU8A 4IQLA 1XL9A 3UPBA 1AQ0A 1FWHC 3WNLA 3CUZA 2Y85A 3TZFA 4PTWA 3FSUA 1F5ZA 1EUNA 5A3HA 1TRIA 3TN5A 1P6BA 3VOFA 5E6ZA 3LCLA 1NM9A 1S2CA 4AZ5A 3W83A 5I3HA 3VIPA 3VGHA 3B05A 2QJJA 3KRUA 4QTGA 3FCPA 3B4YA 3DFPA 3VKBA 4K37A 3E02A 1VYPX 1Q6EA 1UKQA 4XG1A 2YSWA 3I65A 4F2BA 3CUGA 4MY8A 4HPGA 1SO4A 1V6XA 1ECEA 3DG7A 1A4MA 1N82A 1RK5A 3EOSA 1GVQA 1W5OA 3RGTA 1TG7A 2H9AB 1OABA 5FF3A 4GY1A 4PB3A 3UPMA 1E3ZA 4R7OA 2VOTA 2C1GA 2XH4A 4L9YA 4YTQA 4PFMA 3WJYA 1IXOA 4NJKA 3SJ3A 5C5YA 3VIIA 1ONRA 4HGXA 4K6AA 4H9VA 3MP3A 3PB0A 4LS2A 3SY5A 4B4HA 1XI3A 3V3WA 4QBXA 4WY0B 3GXNA 2VFEA 3VDGA 4YTUA 3E2RA 4JIRA 4GCAA 1VFOA 4CQ8A 1PJ9A 2H8XA 4S3BA 4FXRA 4NAEB 4Z2KA 1V6TA 4AVNA 1Q6OA 4EIVA 4BCEA 2X0HA 3CBWA 2ZRUA 1TE1A 3OEXA 3MHFA 2PAJA 3OYZA 4WSHA 4I9TA 3RG6A 4M19A 1BHGA 5E0KA 3AZSA 2QV5A 1PVNA 4DB7A 1UR2A 3UY7A 4IQEA 1O94A 4J35A 4BJHA 2P10A 4JTUA 1VBHA 1ICSA 4PTDA 3UQNA 3CIXA 3LLDA 4LAOA 3DFSA 1REQB 2VRJA 5DBUA 5I3JA 5JH1A 2Z2UA 3DENA 4XIMA 3MDUA 3SB0A 1H1NA 4KFOA 2OQHA 2V8ZA 5LGZA 2E3ZA 2CIPA 4EXAA 1X6LA 3PBWA 4NJJA 2PZNA 2D73A 1T8QA 1R30A 1OX6A 1XUZA 4FALA 1TWWA 1RY8A 1UR8A 7REQA 4REQB 4J3TA 1XYFA 4NI3A 2FB3A 1XYCA 3STEA 2EBNA 3QZAA 4QE5A 4C65A 3OLEA 1XYLA 2XU2A 3RMEA 5A5WA 1Z8AA 3N15A 1SZGA 3BLFA 4B91A 3L9CA 2BOEX 3T2OA 1XGZA 3OVQA 2QS8A 3HZ3A 1Z41A 4QQ3A 1QW9A 2R14A 4NYUA 1AH3A 3W2JA 2WC4A 2FGBA 2OO6A 5G5IA 4XZLX 1J6OA 1JRCA 3HU7A 1RQHA 3N2MA 5EBAA 4O4VA 3GQYA 3FEMA 2TSYA 4LAMA 3N2BA 2WKLA 3IIPA 4F40A 3HPAA 3BARA 3BJFA 3WK3A 4MKSA 3AROA 4ZBCA 5H8MA 4POCA 3ARWA 2PDJA 2C1IA 2ZA3A 3W23A 2ZRVA 3SUVA 1NDYA 1SJDA 3BLPX 2CLOA 5ECVA 1E43A 1TR9A 2HXUA 5HNUA 5H1WA 5D09A 3PBVA 5E70A 3RNDA 3EWBX 4LBSA 1WP6A 2BVDA 4L6OA 4JTRA 4A29A 4UCGA 4DM2A 4JN6A 4C1LA 3PBGA 3GH4A 3PANA 1FWRA 1D3HA 2YFOA 4ZFCA 3T42A 1QOXA 2X1IA 3T55A 3WUGA 3KRBA 5FESA 2Y8VA 5GNZA 4N9EA 1SSGA 2FVMA 4C6LA 3CT7A 4YXGA 4LC6A 4HZ8A 4AZCA 3F7JA 3LXCA 1W17A 3SGGA 3W7QA 1VCVA 3MV11 5AB3A 3N14A 3W1XA 4CCZA 3QLDA 1V3IA 1ZBWA 4GNKB 2PD5A 3WH8A 1QK0A 1TUFA 2TAAA 5AHFA 3EOOA 3BOLA 3N17A 1ZSXA 1O66A 8CGTA 4JQ2A 2FDMA 2WQDA 3TVAA 3V0TA 4DZIA 1B3YA 4BA0A 3WG6A 3A22A 3WNPA 1LUCA 4TTGA 1KLYA 1A0DA 2GGEA 1R7OA 2PP0A 2ABBA 1FWWA 2V5DA 3D6NA 3W7NA 5LGXA 2Y70A 3R79A 4AHOA 1TV3A 3MVIA 4FNQA 3HQOA 3TR9A 1N7KA 4HU3A 3WF3A 1CGVA 3NOYA 3K8LA 3P93A 1H62A 1JZ8A 1D8WA 5IRPA 3TX9A 2PDPA 4NKCA 4O19A 4CNUA 3SCRA 1W3HA 4M1RA 4EE9A 3M0JA 1KC7A 4Q33A 3RXZA 4AD4A 1PPIA 3E74A 1H7XA 4DXXA 2VGFA 2VQUA 1UD8A 2VKZG 5HWJA 1AMYA 4NZ3A 2J66A 1MW3A 3RUBL 3N04A 4RXGA 5BW6A 4J2MA 3NSMA 4XAGA 3ITVA 2OLSA 3GIPA 1PZ0A 1W9PA 3VNIA 3W85A 3UZXA 1ZPTA 1P6WA 3O1NA 5LA1A 1J4EA 1X1OA 2VX6A 3R10A 5DQPA 5HPOA 4MJ2A 3BZJA 1W9UA 2OGJA 3PUDA 3HJEA 1FDZA 1YIXA 1XSJA 2ZA2A 4PL1A 4J27A 1KA9F 2I5QA 2P3EA 2YDRA 3AYTA 4O1DA 1FXPA 2VO5A 1T7LA 4ONVA 3P81A 4A2RA 3WO8A 1TPWA 1R9ZA 1GJWA 1BEUA 1FBAA 7A3HA 1W3IA 5DRIA 3QV9A 3NL6A 4JHZA 1V02E 1E6NA 4AWSA 5B7ZA 3AWNA 1KBLA 1F3XA 1PZ2A 1A5OC 3DHUA 3WSUA 2O9PA 1UHVA 4DJEC 3RU8X 1FX6A 5T9BG 4PMOA 3WNNA 3O07A 3IK4A 2O55A 1DE5A 4JYEA 1UBPC 1A5UA 1WPCA 1GEHA 3DFQA 2PDLA 3GU2A 1FHUA 3U48A 1VPXA 3H2FA 3BLEA 4S39A 2Z00A 4MYAA 4B92A 1SMDA 3O6AA 1ZJIA 3P5YA 5FJPA 3WLQA 3LENA 4JQAA 3EB4A 3C5QA 3G6LA 4MY1A 3U2OA 3W73A 3BAYA 3W7CA 1TA3B 3KM8A 4URIA 1DEDA 3H8AA 1EL3A 3QR1A 4R7JA 2D69A 5K9DA 4W5UA 2PWFA 3GTXA 1WDRA 1D3CA 1JJKA 4Z2GA 4AF0A 4CVWA 3OVGA 1M7PA 2GQAA 1XH0A 2Y62A 3KTCA 3LPOA 1PIFA 1JULA 1XFCA 2Z0IA 4U31A 1EP2A 4CD8A 3PM6A 4NASA 3B8WA 1IWBA 4KFPA 3HF3A 1VFLA 4L65A 4AWTA 1BQGA 3EEZA 4GH1A 1RZMA 2BGSA 4FZIA 1QHZA 2WXDM 3A3HA 3CS2A 2FHFA 2WZIA 3WLLA 2EJ1A 2DEPA 4XZHA 5H91A 1TR1A 3IV3A 1K9DA 3LGDA 2YB1A 4FF5A 3PZNA 2JF7A 2EQDA 4NZ1A 3WK0A 1FXQA 1PDYA 2XVNA 3LXBA 4BEUA 5HINA 4QS6A 3APTA 2OZ3A 2G3MA 2P1FA 4NJGA 2CHNA 2WO5A 3IJDA 3NEHA 3IJLA 2VQTA 3GO2A 4AY8A 2WNQA 2X09A 5TF0A 4H8HA 1VQTA 2OX1A 4O14A 2ZWZA 1J0KA 2E7FA 2BBFA 2XN1A 4HN8A 3KHDA 2CEQA 4Y2WA 4F9JA 5BYWA 3S5NA 2WLYA 2PB1A 5HR7A 2YW4A 5CEWA 1WBJA 1WKEA 3N4FA 3T6CA 2Q8XA 3UWYA 1TCDA 5AYYA 2I9EA 5FF0A 3PPFA 4OOZA 1SUXA 3OQEA 4WOQA 3LNPA 8TIMA 1TKKA 3TSDA 3LX9A 1QR7A 1ZJHA 3A4AA 5GPRA 1PX8A 2WHJA 5D9MA 1GOKA 3IGUA 2ZX9A 4O18A 3CYVA 4P8XA 3UG4A 1VIZA 1P0DA 2DZXA 1FUYA 4P7RA 1IEQA 4IXXA 3S6TA 4AZGA 4HU4A 3ZJ7A 1I1WA 3R7MA 2QUNA 3AUOA 4ES4A 3BQ5A 3GG8A 5E93A 1QOQA 1S5VA 4GX8A 2PDUA 3MT1A 1E1CB 4JTLA 1QUMA 1WDSA 3MC5A 1C8QA 1MXDA 1P7TA 2CERA 2WNNA 3GRIA 4I7UA 4C6BA 3PUOA 4QCEA 2V82A 2GLKA 2YR1A 3BH4A 1EP1A 1R46A 4ZVJA 5DT5A 3BLIA 3B9AA 1R3QA 4LAUA 3CWOX 4EPEC 3GX9A 2QVHA 3QYSA 4QSHA 3H22A 1M7JA 4L5ZA 4TVUA 1Z89A 4QG9A 1TJPA 1EKOA 3M0KA 4OV4A 3VOGA 3M0LA 1VAHA 3W01A 1EX5A 4WEVX 1V8EA 2EPNA 1OF6A 4LWWA 4AVFA 2GQ9A 1MUMA 3MDWA 1VR6A 4IOTA 1A5MC 4YMZA 4K36A 3ENLA 4JFTA 3I3EA 3S5ZA 4JAWA 1S5TA 3TK7A 1QRQA 5K4ZA 3HO8A 2E1DA 2WWCA 2B7QA 1ZGDA 3RX4A 4AEEA 3TP4A 3WQDA 2IKHA 1NWTA 2BXZA 2DT3A 1GPFA 3ORWA 3A24A 1FRBA 1V0MA 3NGFA 3Q45A 4TX6A 4BHYA 5G4WA 2DQXA 3ZLHA 1WDPA 3WD4A 4MZ1A 2BY0A 3QXBA 3ZJ8A 4HK6A 5KSWA 1K8XA 1HX0A 1KGUA 1TSIA 1G67A 4ECLA 3QMRA 4E0CA 3H70A 4PYSA 1JAKA 4JFUA 5AY7A 1C8VA 4MYXA 1E51A 3SFWA 3DHDA 4HK5A 1BFNA 1ISXA 2NQZA 4UFIA 2W5FA 2CLFA 1OX4B 3SSZA 5KINA 2NX9A 3V4BA 5D9NA 3G1YA 2Y89A 3M0HA 4IUGA 4Z08A 4JIHA 5FJUA 5CCZA 5IBXC 1E71M 3ZJ6A 4QGCA 4R85A 4V28A 1Z6KA 2V69A 3GK0A 4AZIA 3VCNA 3LG3A 4GACA 3M0YA 2Y7DA 3G1HA 5CSRA 2WM1A 1JZ3A 1E0VA 2BXYA 9XIMA 3GNDA 3BXWA 5A69A 4KEUA 2FLIA 2FZDA 1OC6A 2PLKA 3GUWA 2A79A 1XINA 3BLOA 3CAKA 1E15A 2YLLA 3G1DA 4BI5A 5FD0A 5DT7A 3EZ4A 3TJXA 2OEJA 1FHDA 2HZGA 1L8PA 3W7GA 1WZLA 3F5LA 3W1TA 2BGNE 1EWDA 4FSAA 3DCPA 3T8LA 5D2TA 2VVSA 1JYXA 3K13A 5I06A 1PX4A 1Q4WA 1Q5MA 1QMLA 2VDIA 4FXFA 2ZQ0A 1EJWC 1GK8A 5HR6A 3U4AA 3T08A 4EAYA 2X16A 4TX8A 5EFFA 1C8XA 3SO7A 3BPWA 1FHVA 3NZPA 4CCCA 2VEKA 3N2CA 1M41A 2OSYA 1BTMA 4GFIA 4MM1A 3TR2A 1RSCA 1ZP3A 5C54A 4ZQOA 4CEUC 3EXTA 3DI1A 3WIJA 3DHPA 3FAXA 4A3QA 4ZOEA 3KDNA 4DJDC 6XIAA 2J7FA 3DDMA 3WBAA 2DUZA 5BROA 3WF0A 3P6LA 2VC7A 4DWSD 4IIGA 2VCAA 4HA1A 3N34A 1QATA 3MP5A 3IGHX 4LVFA 1P43A 1ITUA 4NAEA 3VNLA 1EDQA 3MYPA</