4IQEA

Crystal structure of carboxyvinyl-carboxyphosphonate phosphorylmutase from bacillus anthracis str. ames ancestor
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
293
structure length
289
Chain Sequence
VVNQSTQEELANRFRALVEANEILQIPGAHDAMAALVARNTGFLALYLSGAAYTASKGLPDLGIVTSTEVAERARDLVRATDLPVLVDIDTGFGGVLNVARTAVEMVEAKVAAVQIEDQQLPKKCNGKKLVTTEELVQKIKAIKEVAPSLYIVARTDARGVEGLDEAIERANAYVKAGADAIFPEALQSEEEFRLFNSKVNAPLLANMTEFGKTPYYSAEEFANMGFQMVIYPVTSLRVAAKAYENVFTLIKETGSQKDALSNMQTRSELYETISYHDFEELDTGIAKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Carboxyvinyl-carboxyphosphonate phosphorylmutase
publication title Crystal Structure of Carboxyvinyl-Carboxyphosphonate Phosphorylmutase from Bacillus anthracis str. Ames Ancestor
rcsb
source organism Bacillus anthracis
total genus 95
structure length 289
sequence length 293
chains with identical sequence B
ec nomenclature ec 4.1.3.30: Methylisocitrate lyase.
pdb deposition date 2013-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 4iqeA00
4B5SA 3N25A 1U5VA 2HJPA 4QG9A 4TV5A 4IQEA 2V5JA 1PKNA 4L9ZA 1S2UA 1VBHA 3QV8A 3EOEA 3LYEA 2VGFA 3OYXA 4KCVA 1A3WA 1A3XA 1KBLA 2KX9A 4JPGA 3P0XA 3SRHA 4L80A 1PKMA 3OQ8A 4KRZA 2DUAA 2VGGA 3IS4A 1S2VA 1DXFA 1XG4A 4MG4A 2XDFA 2E28A 3E5BA 1Z6KA 3HQNA 4B5VA 1O68A 4QG8A 4ROQA 2XZ7A 3T0TA 4WJ8A 4KCWA 3GR4A 2BG5A 4L7ZA 3EOLA 1S2WA 3VAVA 3FA4A 4B5WA 4L9YA 1A49A 3BJTA 4YNGA 2OLSA 3FA3A 1IZCA 2VWTA 3PP7A 3QV7A 1O5QA 4IQDA 1M3UA 3U2ZA 4LSBA 3T05A 1F8IA 2X0SA 1KC7A 2QIWA 2R82A 2HWGA 3B8IA 3R4IA 2HROA 1OY0A 5JVLA 1OQFA 4B5TA 4B2DA 3BJFA 1ZLPA 3SRFA 1E0UA 3E0VA 3KHDA 1PKLA 4HYVA 4QG6A 4IMAA 2HRWA 3QTGA 3H6OA 1PYMA 3OYZA 1SGJA 3G2GA 1ZJHA 1GGOA 3HQPA 3QV6A 1VBGA 3LG3A 4IP7A 3SRDA 3EZ4A 1F61A 1IGWA 4FXJA 1S2TA 3SRKA 3MA8A 1F3WA 4KCUA 1T5AA 4G1NA 1U5HA 3HQOA 2VGBA 2WQDA 3E0WA 1MUMA 2VGIA 1AQFA 2G50A 2ZE3A 2VWSA 3QQWA 4B5UA 4QGCA 1E0TA 4YJ5A 4B2DD 2DIKA 3EOOA 1PKYA 1M1BA 4KS0A 4FXFA 1DQUA 3KTXA 1JDEA 4B5XA 4DRSA 2V5KA 1A5UA 2L5HA 3M0JA 3QV9A 3T07A 1XG3A 1DIKA 4KCTA 3I4EA 1O66A 4HYWA 3GQYA 4MF4A 3QZ6A 3GG8A 4TV6A 2XZ9A 5TAOA 3PUGA 1UJQA 1F3XA 1F8MA 3QLLA 1DXEA 3M0KA 4RPPA 3ME3A
chains in the Genus database with same CATH superfamily
3WLSA 1BEUA 4UFMA 1PKNA 5XIMA 3EPOA 3FKRA 4XUYA 1JNDA 5DLCA 3W7RA 4I9MA 4JY9A 4S3FA 2A3CA 1V6WA 2ZYFA 3VMOA 3F7JA 3W2LA 4CD5A 3F2DA 1C90A 4JZ5A 4ZO9A 4GIAA 3U48A 4NVTA 2Y1HA 1RD5A 3FGCB 1OFEA 3W38A 3UCDA 1JPMA 4UTFA 4JBRA 3MTWA 4LS2A 2D23A 1XIBA 3P8IA 1J18A 3L66A 4N9DA 3TYBA 4XD4A 4S23A 1IQ8A 2QCHA 3DGRA 3NL3A 4E38A 4EE9A 1KFEA 5BU9A 1EF3A 1OG6A 2WHJA 3L5MA 1CX9A 5BYWA 4GZ7A 2PAJA 3EXSA 1X1NA 2J8FA 3NDZA 3QN3A 4ACYA 1QNSA 1OX4A 4KIEA 5F4XA 4AQLA 2YL8A 4XAYA 2XH7A 1SZRA 2QQ6A 5FA5A 4FNQA 4UIOA 1HN1A 3AUOA 3C0JA 1IIHA 3W88A 4MF4A 2BV9A 4XD3A 2XIJA 3FJ6A 2W5FA 1JD7A 3BAYA 2YPIA 2XVLA 1YXCA 4UNKA 3W2MA 1NF0A 4Z0SA 4Z2GA 1I4NA 1XUZA 5CG7A 3UXDA 3DFHA 2WHKA 1S5NA 1E4MM 1GQNA 5BRQA 2F6KA 5CZJA 1KGXA 4QEHA 1VGAA 1GOIA 2B7NA 3ZYZA 4AIUA 2WZTA 5F2LA 1WCGA 4ROQA 1B0IA 2Y85A 4B3KA 4UFIA 1XIMA 2CLIA 4D6FA 4ECLA 4EPBC 5JH2A 3BCFA 4C6DA 2DZXA 2YCEA 2VR2A 4EPKA 3WD4A 4GI8A 4WUIA 4S3DA 3UPWA 3UP8A 4CUCA 2Q8ZA 5DMNA 1OFBA 4L4LA 4LUTB 2FH8A 1GVYA 2NQ5A 2X40A 2OEKA 4G5DA 4ICCX 5IM51 4PRTA 1ZJHA 3UZYA 2ISWA 3WBYA 4QX4A 1P6BA 1WKFA 3J7HA 5D8WA 4WHBA 3LCWA 4O1DA 1K8ZA 2ZICA 3GX9A 4Q33A 4EF9A 5K9DA 4OVXA 2NSXA 3TVAA 2I56A 1XICA 4EPEC 2XVGA 4GWEA 4IZGA 1YE6A 1UC5A 3O9NA 4FNRA 2FFCA 1R3TA 1R2TA 2NVAA 2Z2BA 4X61A 5EB8A 4DWSA 3M0XA 1QW9A 3HB9A 4FR6A 2CESA 4M29A 5F2IA 1VC4A 2J8GA 1JYWA 3N15A 2DSVA 3K1GA 2C71A 3IJ7A 1L0PA 1SVDA 3B8VA 1D3GA 1JIBA 2Z6IA 4JKLA 1X6LA 3TTOA 2VEFA 3TW6A 4NX0A 1Q3NA 3NL5A 5LZLA 4GC3A 3GW0A 1NWSA 2FB3A 2Q02A 1AQMA 1FWIC 3CUFA 3RX3A 4UMBA 3ARYA 5EA9A 3GAYA 3M0YA 3KFTA 4LSBA 3EMQA 3WQDA 5A8PA 1VQTA 5I3FA 4W5UA 3RK8A 3W23A 4R33A 1A5SA 1MXGA 3R43A 4QLJA 4M80A 1R6WA 4AZIA 4B2DA 3GFXA 3MI6A 7REQB 1KCKA 3LBOA 2YDSA 4NYYA 2I16A 3GH7A 4W8AA 1VYSX 5HJXA 1QATA 3MT1A 5I23A 5KZEA 1KM2A 1GPFA 3NG3A 3NL6A 1V3MA 3STGA 1F4AA 1LRTA 3ABZA 4LYKA 1JF6A 3S1GA 3QBUA 5FJRA 3IANA 5ABFB 4GNKB 2XGBA 1DJZA 5EFFA 2JE8A 3H70A 1BPLB 2ADAA 3RRXA 2G3FA 2YZ5A 4AWSA 3VKJA 3OVRA 4DJDC 4IT1A 4IG2B 3DUGA 5F4WA 4AMCA 4R7WA 2PC4A 3VCNA 1RBAA 2P5NA 3SUSA 4RK8A 3QM3A 4O8RA 3U5YA 2HE8A 3PM6A 5I3GA 4M6UA 3EOEA 1BXNA 3W1LA 1JGIA 4AYSA 1LUCB 5CKSA 1FCQA 3BMVA 1QU4A 2IPGA 3VGHA 1H1YA 3C0LA 4S39A 2XIQA 1V02A 3W2UA 5AHFA 1DWHM 3W7OA 5F1VA 2PDJA 3BDKA 1FOBA 7TAAA 1U1JA 3EBVA 1FKWA 4IQDA 3ZT6A 2C3ZA 1ZRQA 3ITTA 1DPMA 4GFIA 5G1TA 4ZB2A 1GYNA 3MCOA 3GLCA 2HS8A 1Z41A 3W7NA 4AD5A 3WENA 3GTXA 1VBGA 3RPMA 4TQTA 4XD5A 4Y9PA 1AW2A 4CN6A 3MZ2A 4MZYA 3OGRA 4MJ4A 5BOEA 3ZQ9A 5AC8A 4J2PA 5HULA 3GR8A 1VCGA 1J0KA 2A3LA 2FFIA 2VR4A 3W7JA 1G67A 3BAKA 1CYGA 2OZ0A 2PWUA 2IUZA 1OFQA 4KCTA 3O1NA 1EHNA 1M5WA 3PBGA 4XZIA 1ZALA 2DH2A 2RH9A 3RX2A 3WLOA 3NIYA 2E40A 2PDWA 3BCDA 4F9DA 3LRKA 1O7AA 2V5JA 1VYRA 1VCVA 5HMSA 4WIWA 4F79A 2HSAA 1MFUA 1VRDA 2F61A 3DKJA 4YHEA 3WQPA 3VCCA 4NL1A 3IK4A 3SUVA 5H8MA 4GRSA 1FWWA 2NQHA 4NRSA 4CN4A 3ECQA 5GNYA 1OK6A 2G3IA 2RAGA 4OBTA 3MV11 2R1PA 3VIHA 1NEYA 2VTFA 3WX7A 2YYUA 2D20A 3R2GA 3LLDA 4RNJA 1LCOA 4BKNA 3GNXA 3FJ4A 1DTNA 3L4UA 3C86A 1SW7A 4NAEA 4KWWA 1T0OA 2XUCA 2HRWA 3T0CA 3MY9A 3NA8A 1UR8A 3CMFA 3L7RA 5DFAA 1W2VA 2WKGA 1CLKA 4OOZA 3CAQA 3BLIA 4UOJA 1R7AA 1AD4A 3GRIA 1W3HA 3WQ6A 1YXYA 5EU9A 5A6LA 3RMEA 2RJHA 1OIFA 1CXLA 2ABBA 2PDIA 3SY5A 5CJMA 1ZB5A 4GPNA 3VA8A 1KBBA 4E4PA 4DEFA 1XWYA 4DUVA 3LXAA 4PRRA 4FSAA 3CNYA 1EEXA 1V8EA 4HSOA 1RJQA 4O1FA 4IX2A 3WBXA 3H2CA 2FVLA 3QYSA 5AHNA 3RHGA 3TV8A 2WW5A 1LBLA 4X60A 3KBMA 2VZSA 1PKMA 1RCOB 1ZBVA 2GL5A 3I3BA 1G9HA 3H4WA 4U4MA 2DSZA 1Q5MA 1AMKA 4ZQOA 3EDKA 2QCNA 4X63A 1QTWA 4JIIX 5CBJA 4YYFA 1G01A 3QC0A 2G95A 1Q7QA 2WHLA 3VNYA 3CL7A 1TCMA 3H2NA 5CZ0A 1NM9A 1ZS2A 3THCA 3D5HA 3FY1A 1O60A 4PBGA 1TTPA 1D3CA 3DHFA 5HANA 4AG0A 1PYMA 2EPOA 1KFWA 4JHMA 1RJPA 3M0VA 3LHYA 4ZR8A 4RPQA 4WEVX 3VOGA 2GJPA 2VOMA 2D69A 1GKQA 2NT0A 1LQ0A 4J40A 5AB3A 5LNRA 5C8BB 1UOKA 1F73A 1TVNA 1TJRA 2Z25A 3UNDA 1UD3A 3UNTA 3W7DA 1OYBA 3WEZA 4D6DA 2VURA 3OIXA 3GBDA 3K5XA 2CHOA 1XLAA 1DL3A 4UQDA 1V0MA 4KH2A 1EZ2A 4WY0A 2PDYA 4BCEA 2GSEA 2AL2B 2IPJA 3GXIA 1VBHA 1B1YA 2YIHA 4ZA0A 1W3KA 2OLAA 3GKAA 4TTGA 3PZNA 1IEWA 1W5NA 3TUUA 3DBNA 3S83A 2KZHA 3GBEA 3RCNA 3G0SA 2R24A 5JU6A 2OCZA 1S2WA 3OLIA 4AZGA 1IV8A 3LXCA 3I4KA 4IMDA 2OQYA 2W63A 4BWLA 5E0CA 2A4AA 4UFKA 5I24A 3SM0A 4ZE4A 3AYSA 1U33A 3WNLA 2FQIA 4ZE5A 1OQFA 3S9ZA 3G1HA 3BQ5A 1SFTA 1XL9A 1OZQA 1ODZA 4MJZA 2QJJA 4EWND 3CAKA 1BWKA 1TZZA 4JYDA 4PUEA 1JCNA 4Q8UA 2YL9A 5FAGA 1LL7A 4OE7A 2BHUA 4TUFA 5A69A 2WNZA 4AZ7A 1HGYA 1PTGA 1PTAA 3VGGA 6ENLA 3ATYA 2XU2A 3ARWA 2CIPA 3O16A 2AAAA 3TH6A 3G24A 2FTYA 4P7OA 3TYEA 1ZNNA 4EP8C 2R1LA 4PBEA 1HNYA 4UMCA 3GTNA 1FWTA 1PX8A 3H21A 1C9WA 4IGMA 3NJ3A 5H91A 5HQLA 4L6OA 4MVAA 1IEIA 2WMJA 1R2SA 3GG0A 3KL0A 3CMJA 3VC6A 7XIMA 4LOCA 3UXAA 5G2WA 3EA2A 4IQEA 1RPXA 3HM7A 3T08A 5CGTA 5D02A 3OYXA 4LT9A 3PZVA 2GVYA 3OLGA 2BB0A 3TXZA 3A6OA 1YW1A 4FHAA 1H1ZA 3H54A 3WLHA 4AC1X 5FOOA 1GVQA 4M6QA 4JHZA 3BLOA 1H4PA 4Q6JA 3NNTA 1E56A 4Z17A 3HZ3A 3W7HA 4RZBA 2WQPA 2Z00A 4O11A 3DHUA 3H7UA 3M0HA 4B5WA 4L9YA 5E09A 3A4JA 1NQ6A 1LL6A 3UY7A 2AL1A 4K8GA 1P7TA 4XAZA 2BDQA 4DBDA 4AX6A 4NG3A 1Z8AA 2DJLA 3W7CA 1OFDA 2O56A 3VIFA 3SFWA 4FIQA 2YL6A 1TQJA 3N2OA 1SZEA 4D9PA 4B5TA 1KXVA 4HTBA 5JUVA 5J5RA 6TIMA 3UWZA 1VZWA 2ZXBA 2J47A 2PRLA 2WC7A 2DT1A 3Q65A 1H51A 4RE0A 2CCRA 4US6A 4YHGA 4EAMA 5BXRA 3OGVA 2G50A 4UFLA 1V6VA 1H50A 3AWOA 3FAXA 4I7VA 1BYCA 2WMIA 2BXZA 3LI1A 3K8KA 4QISA 1PX3A 3HMCA 4NY2A 4NILA 3IACA 2X1RA 5FD0A 3LV6A 3KS5A 4HT3A 1WZKA 3BUVA 3PJXA 4AY8A 3FXYA 2QCMA 3WEOA 4DUOA 2C8NA 3PTKA 3HO8A 4LV4A 4JFVA 1XW8A 1DE6A 4MUPA 1TO3A 1R86A 3NZGA 1NU5A 1UUOA 2OO6A 4JEJA 1I9CB 2FHFA 3UJSA 4KCWA 3MVTA 4NZCA 5E93A 4DLMA 3W7IA 4GC4A 3OLDA 3WBWA 3VZYA 5HMEA 1CXKA 2NVCA 4KWUA 2PWHA 2BLEA 4RZ5A 2FDSA 4I5UA 4PCNA 1LOLA 3FYOA 4RW3A 1E9ZB 1KFLA 1UKQA 2YXOA 3EWYA 1EGZA 4Q7NA 2PDPA 4XZWA 1UZ1A 3QGKC 1LT7A 3JRKA 4PMDA 4I9AA 2E3ZA 3L9CA 5I3HA 2GK1A 3EDEA 1BYAA 2VMFA 1GGOA 2ISDA 2E67A 3VNIA 3IVTA 1EH9A 3L2LA 2Z0IA 1UR4A 2Z7GA 1AZ1A 3HQOA 2XINA 4IFRA 2VNCA 1OINA 3IGUA 1TWZA 1KRBC 4ZO6A 4JIHA 1DQUA 2R94A 3E3HA 2GUYA 4PB5A 4CNPA 4A3UA 2O9OA 2QCCA 4F9JA 1S46A 2RFGA 1J8VA 2DVXA 2IXVA 3PUGA 2WAGA 3M7WA 3AMDA 3G0UA 1CXEA 2HJPA 1FP9A 3TA6A 3K8LA 4P8WA 3GUGA 1W1ZA 3V4BA 3P3BA 2WSKA 2XG9A 1KBLA 3RU6A 2ZZ5A 2REQA 3CH9A 1JXJA 2PTYA 3LK6A 4OV4A 1RH9A 3TNBA 3ZVHB 2H3DA 1M03A 3CHDA 2I5QA 3TN5A 1E40A 1ZL1A 4YTUA 3PANA 3NR0A 2PA6A 4H00A 1GOMA 1UMYA 4PTDA 3ZSSA 1CXIA 2VM8A 1HP5A 4S2BA 4AISA 3W75A 4PBFA 5DCEA 2VENA 4KWOA 5DELA 1K9FA 1IWAA 1XCFA 1BLIA 3LHUA 1FY6A 3H6OA 3MSGA 4AAJA 4US5A 3ZLHA 4FP1A 4PMUA 4O1BA 6CGTA 3KOYA 3VNZA 3L2IA 3RXZA 3GDKA 1V08A 2VX6A 2G3JA 1H09A 4ALDA 3DDMA 4UTKA 4DBEA 2PWFA 3AU2A 3GXNA 3BPWA 4LFYA 1TR1A 3AICA 4LXFA 1E6SM 1G7VA 4I6VA 1T8XA 1FWHC 2BY1A 3N25A 2GOUA 1HT6A 3R11A 3P80A 3F5JA 3CS2A 3WQOA 1N8WA 3GU1A 2E7FA 4HQVA 1S2VA 1R8LA 3RR1A 3MANA 1JI1A 3T4CA 1EUAA 3P67A 5D2WA 4ZQPA 1ZJBA 4PEEA 4Z2KA 3U6WA 2WSYA 2NVDA 3M0LA 2F84A 3N9RA 1QMLA 2W92A 1R2RA 3QV7A 5CPMA 1LT8A 2QIWA 4MIMA 4D2JA 4CQAA 3E0LA 1ZBCA 1B3YA 1SM9A 2JF6A 1DJYA 1VPQA 3NPUA 1ICSA 1MZHA 4CD6A 2PWEA 4DM2A 2H9AA 4NZ1A 1Q4WA 4J3VA 2ZWZA 2ZBTA 4KCUA 5FL1A 3F03K 5I02A 4ES4A 4Q22A 2VGIA 2Z1SA 1IZKA 4JNZA 4KRTA 1DHKA 4B5UA 3PZOA 4CD7A 4NRRA 1B57A 3W1RA 3EWCA 3EOOA 4LNCA 3GZ3A 1BWVA 3FOKA 3O63A 1TREA 4LY8A 3MW7A 4Q7IA 4JTDA 4JTRA 1HJVA 1LZOA 1Q6CA 2O0TA 2WCGA 4LAZA 1AZ2A 3BG5A 5CJ5A 5B80A 1G4EA 3D47A 1KTNA 2Y5SA 4LVAA 4U5KA 2FPYA 4X2PA 1QWGA 4XO6A 5D30A 2VFFA 4FK9A 5EMLA 1HKWA 2QZRA 2CEQA 4UMAA 5FJIA 5HNNA 3CLMA 3PTDA 1CEOA 3UZWA 5FIPA 4XAPA 3W70A 4H6EA 2WBGA 2WKJA 2WCAA 3OJGA 1NAL1 5FF2A 4Q4OA 4C7GA 3D3FA 2E5BA 1DV7A 3JW7A 4YTQA 3WLIA 5CGMA 2F38A 4RV3A 3S4TA 2WZHA 1NF7A 1R7OA 4PMXA 2IKHA 3IUDA 2J8TA 3PZGA 3I6RA 1DJNA 3ES7A 5AN7A 1X97A 4V28A 3QJAA 2Z2AA 4CCCA 2A79A 3CLWA 1QI0A 3TC3A 2PUZA 3TK7A 5K7JA 4RXFA 2XM2A 3EZ4A 3ZXWA 5AYBA 3TYZA 3W4RA 1W32A 2I57A 3V36A 3UXLA 2WZMA 2XIOA 3M07A 4M7SA 3NYDA 5FF0A 2WC3A 4LUYA 2X1TA 1BRLA 4K1WA 5AOUA 1LQAA 2WWCA 1F3TA 4W86A 3VIKA 3FEMA 3IVSA 2XJ7A 4DXVA 4BY3A 3WJXA 4PCPA 3BXWA 3EKZA 1EHAA 3MYPA 1MUWA 1XDLA 3LUTA 2QXWA 3B05A 4LUSA 3NEHA 4IGHA 3JS3A 5C2XA 2OSYA 1B3XA 3LSBA 4H8UA 4H19A 2OT0A 3SJ3A 2NV2A 5H1WA 3G18A 3BG9A 3KOWA 3UWUA 1DJQA 2ZTJA 4TX8A 2YA0A 3ZJKA 2UY2A 3AHZA 4DJFD 3T6CA 2YKKA 1S5VA 1UWRA 4YCOA 2I5GA 4S3BA 1BSIA 2ZX9A 4M56A 3WDRA 3TWBA 1GG0A 3OHMB 2E4TA 5T26A 1R46A 5A6KA 3B0XA 3MUY1 5CPLA 1FVPA 2IKJA 1PKLA 1XYFA 3DFQA 3OZOA 2OEMA 1XYLA 1JZ5A 3PTMA 3REQA 6XIAA 5HUOA 3N9SA 1UKOA 4ZQNA 1E1EA 1J0YA 4H2HA 5LSMA 1D2KA 4AF0B 3H2EA 2ZUUA 2VZTA 3ABXA 5BW6A 2YDAA 5A8MA 4QGCA 3TROA 1CZ1A 3MSYA 2OTDA 3MKKA 5T9BG 4J4KA 2PTZA 1K1DA 2DIJA 1QAPA 1D7FA 3GTHA 3IUIA 1RPKA 3SCSA 3WMSA 5I2UA 3N13A 4HZ8A 4RDWA 1QCWA 1AL8A 1GNXA 2PRHA 5IBXA 5F7UA 1CGYA 2UWFA 4G56A 2PF8A 1O5RA 3QFWA 1QHPA 3AHVA 3W1XA 3R7MA 5AFDA 1KCXA 4KEZA 4GQ0A 1KNWA 3EX3A 5E1QA 4JTEA 3WFLA 4AVFA 3RLHA 1T96A 2QCDB 2XDFA 4CKQA 1G6CA 1KTBA 4LVGA 1GOOA 4BK9A 4K8HA 1UHVA 5JBDA 4HK5A 2OLSA 2Q8XA 3LBCA 4HGXA 4KERA 4XBJA 4K1GA 3B0YA 3ENLA 1TUFA 3BH4A 2EBNA 3CO8A 1ZTVA 1Z32X 3EX2A 3TE9A 5I07A 1MVYA 3N12A 1WKDA 4D1IA 1W5OA 3DENA 5FSDC 3M43A 3S2CA 4CVUA 1Z44A 4HHHA 3ONCA 3IAQA 2ESCA 3UQNA 2DZTA 4XK2A 3UA4A 5LHEA 4GI6A 4IHCA 3PBWA 5JBEA 4Q8TA 1P5BA 2YX0A 4GBUA 1XC6A 4P8VA 2VZVA 4MB4A 2QIIA 4AD1A 3WELA 3BZJA 2OWXA 1RQBA 1JI2A 3ALGA 4HZ6A 1A0DA 3NFUA 3T1GA 1RZMA 1KM1A 2RDXA 1VR6A 3WQWA 2O55A 3L0NA 2PDNA 1Q6RA 2ZRZA 3ALFA 1W9UA 2PCQA 3DG7A 2YL5A 5D05A 2BP1A 3TC6A 2GJRA 4YLWA 2ZWYA 3N34A 2WMGA 1P0DA 3M44A 4UR7A 2GGEA 2VCAA 1XFCA 5C9RA 4MWAD 1CBGA 3E2QA 3AXHA 3GNOA 3PZUA 4M7TA 3H26A 2Y2WA 4LCQA 3CB8A 3WNOA 3T8LA 1QO2A 2FTPA 1JQXA 1EX1A 2RGLA 4GNJA 2TYSA 2YCIX 3SJNA 9XIAA 3BSHA 3P6LA 4ZB5A 3SCUA 4DNHA 5BZAA 3EYPA 4A3QA 3L4XA 4O1CA 1POJA 1NSJA 2PBGA 1FWFC 3P8JA 1FDJA 4NNBA 3SN0A 4YWSA 2F8QA 2ZRUA 3PY2A 1JCMP 3LI0A 3DHPA 5LNSA 2PGEA 1H7RA 3GXDA 1SYTA 1K70A 2A85A 2X7VA 3TKFA 4AWUA 3UCCA 4OV9A 2OR2A 3NZ1A 2W61A 4HA1A 1OEPA 1ICPA 2PLKA 4OTKA 1EYEA 3MS8A 3QTPA 3B8WA 1KQYA 1XLKA 4YN5A 1HQTA 2JIEA 3M1ZA 3GB6A 2J9ZA 3BK0A 4C6IA 3NL2A 5CBBA 3B9AA 4POCA 1Q8JA 3BC9A 4WOQA 1XG3A 3SADA 3DIPA 2CZ5A 4HHLA 5LGXA 2RHGA 4GY1A 2H8XA 1WDQA 1OX6A 5DBUA 4CLMA 3K46A 3DYOA 1KM4A 1ZJAA 2OO0A 1XD1A 4FB7A 3UESA 4D8ZA 4AWTA 7A3HA 1EKOA 2QUTA 4ZQMA 3IJ6A 4JTGA 3VINA 3HURA 4AZCA 1X1ZA 4HNLA 3N9KA 2Z2UA 1LORA 3VGFA 3CWHA 2X1IA 3AJ7A 1VHNA 3ES8A 1LWJA 3PAJA 1EGVA 1NWUA 2R91A 3VC5A 3EWDA 3WLQA 1E6QM 2NUYA 1W1IE 2ZDRA 3TA9A 4JR5A 3TR2A 1PXGA 2VDGA 1HO1A 4NQ1A 5CLWA 5KZ6A 4ATWA 2VD8A 3VZXA 4R88A 3JU2A 3YPIA 3PN8A 4RUBA 2BY0A 4JTTA 4UOZA 1OB0A 3UYIA 4JIQA 2C6QA 2FGBA 4ZMGA 4C7FA 2V2CA 3TN3A 5K9CA 3WNNA 4D71A 1S2AA 3FDGA 3G1FA 5HA7A 4FNSA 4JTQA 5CPSA 1PZ1A 1H7NA 4GUFA 3O15A 1UPMB 4UQAA 4AC7C 2YB4A 2XH2A 2DZAA 4UOQA 3WFZA 2C79A 2ALDA 1WDPA 1TQXA 3A21A 1EDTA 3M0KA 2BMBA 2P8BA 1UD4A 4H6KA 3GHUA 3B8SA 3O3RA 3W71A 4GX8A 3EA1A 3PB0A 1HKKA 1TG7A 3OPSA 1GONA 1SFJA 1WUFA 4ZO7A 3TWAA 4S3EA 3EMCA 2WV8A 3VNKA 3KRSA 1ADOA 2P0IA 4WR3A 3KDOA 3ANYA 2VUNA 1NFPA 2QW5A 4CN1A 3EGJA 4ILSA 3RGTA 1WX0A 2QJMA 2GJXA 4IFKB 1YHTA 3EWWA 4AMAA 5IOBA 3BV7A 3G1VA 3GH5A 1ZGDA 4PUWA 4K7VA 4JXCA 3NGFA 1OCBA 2AMGA 6REQB 2WK2A 2CYGA 3KHDA 2VUYA 3L23A 1HJQA 1TVLA 2ISSA 5BXSA 1PV8A 1Y65A 5ABGA 1QBAA 1XC4A 2XSAA 4A3YA 3SRDA 4GVFA 1ZAIA 3A5VA 2B7OA 1RHCA 3NTYA 4ZODA 1TE6A 2V9DA 2ZA3A 3KWSA 1YRRA 3QR3A 4IMGA 4N9BA 3U7VA 3WK3A 3O07A 1SUXA 1W5QA 3KM8A 4I5XA 4L4OA 4UTMA 4QR6A 5FI8A 4HNNA 1WA3A 3IGHX 2P50A 4JX6A 3A22A 3O6CA 2I5IA 3E12A 2E0PA 1UKTA 5D8ZA 3UZJA 1UIPA 5HOSA 4Q8NA 1ZJIA 4KEUA 3TYAA 2CXGA 2G37A 4ZENA 4B91A 2Y5JA 4IUOA 2VEGA 1K7FA 2ZXDA 4FPSA 1O5XA 3SGGA 1YBQA 2DUAA 4CCEA 1C3FA 3UCQA 3KOZA 4H9XA 4HN4A 2YR1A 4MM1A 2W66A 3UWWA 3WUGA 8RUCA 3R8HA 3GXTA 3WK1A 1AUSL 1TR9A 3VFCA 3OHIA 1QPRA 1J0HA 1K8YA 4ERIA 4JD4A 3CO4A 4IJCA 3ZT7A 1TV7A 5GJMA 4IOTA 2HVMA 1JCLA 4AWEA 4GBDA 1I45A 3G1XA 4PUNA 5MF5A 3QW3A 4XKYA 3W26A 2DU2A 4G7FA 2VD9A 3IAPA 3AAMA 1JRCA 1JF5A 4BQ5A 1ZPTA 4UFJA 3P5ZA 3ARTA 1S3TC 4KKXA 2Q01A 1W1B1 4HNVA 5FESA 3NURA 1KRMA 4R34A 4E8GA 1HUVA 2CLPA 3O06A 3TW7A 4C65A 4ICNA 3VOCA 3UPMA 5DXYA 1FWSA 4J3WA 5CZSA 1FWEC 5D38A 3NPVA 2P3ZA 4PH6A 3NQFA 3EX6A 1J9YA 1BGAA 3P0WA 4HD5A 3MO4A 3T0BA 2BODX 2KX9A 5CSUA 3PPCA 4PMYA 5LIKX 5E9AA 4I7UA 3QHOA 1Y5VA 1WUEA 2PDGA 4DZHA 3QC3A 2AQVA 3D46A 1P0BA 4XVDA 1KV8A 5HQMA 3ZFHA 4H04A 2WKLA 2F7FA 3KBSA 3EWZA 1XBYA 3MUAA 4L4MA 3D0CA 2XWDA 1TSIA 4LRSA 3T8QA 4I9TA 4LX4A 4NYUA 1JCTA 4QCEA 1OGGA 3IJIA 5D2TA 4K36A 1PB0A 3OVPA 4MY9A 3UETA 1J01A 3FFSA 5U7SA 3KLKA 3W7GA 4F2BA 1J96A 3QY8A 1LWHA 3DEQA 1DJHA 4K7YA 3M5XA 2PLJA 3ZVIA 1F3WA 3H55A 4N6FA 3UW6A 3W28A 3C56A 3R10A 4ERGA 5KITA 2Y89A 1VFTA 4JKMA 3UA3A 3NDYA 2BASA 2PEVA 4ADUA 3CU2A 3TR9A 2O9TA 1H1NA 4GG9A 2CZEA 3MKVA 3KCOA 3TAKA 4G7EB 5E70A 2GVLA 2D3LA 2C91A 2ZX7A 3AZRA 1BYDA 4LC8A 2WMHA 2NWSA 5AC4A 1KCZA 2UY4A 3W2KA 4HPXA 1ADSA 1BVNP 3WH7A 1ZZMA 3V0UA 1PWMA 4E6MA 3UJEA 2QPXA 1A3WA 1D8WA 2CWNA 1V03A 3P0XA 4PN2A 3QQ0A 4AZHA 3B9DA 3FGCA 3CYVA 3STFA 2HPIA 1BF2A 3V35A 2Z1VA 3ICJA 4H2CA 2QDGA 1FCBA 4NAFB 1V51A 2X30A 2A3AA 1EDQA 5DMLA 3RG6A 1A4LA 3W9ZA 3WQGA 3G6LA 1GJWA 4ML9A 1XRVA 4UUIA 4FA3A 3NQCA 3C2FA 4MJ2A 2VX4A 1BQGA 1HGWA 3Q67A 1PUDA 3OBAA 4IUGA 4UNIA 4JEQA 1EB3A 3MCNA 3TLLA 4LVDA 3IUHA 1QOXA 5RUBA 1PZ2A 2X09A 1XX1A 1TV2A 1TIMA 2WBKA 3TTYA 4A6GA 1T8QA 3KVKA 4HVXA 4WF7A 2O92A 4RZ4A 3R89A 3KVLA 1S3HA 2V5BA 5ECVA 3QY7A 2OMAA 3PG9A 4A8LA 3BICA 3OQEA 3U2CA 4GQRA 5K9XA 3G1AA 1O1HA 3FS2A 3SCQA 5HMFA 2ON3A 1E51A 3QV8A 1TPFA 3F2CA 4MSSA 4TIMA 4JTSA 4Y7EA 4GXMA 2QR6A 1F7BA 1RBLA 5AY7A 1ME8A 5XIAA 1JG9A 4L9XA 4BJHA 1WXZA 5GNZA 4PR4A 4F2UA 1VEOA 2EJAA 4JNMA 5E5CA 3KAOA 3A9BA 3GW3A 1MNSA 3WN6A 4LYQA 1CGUA 4LUTA 2P0OA 4H9VA 2V0TA 2ZUVA 2NQZA 3P74A 1EPXA 4TMCA 3BVJA 1KO0A 4DXXA 1TV8A 3T78A 3DESA 4L5ZA 3URBA 1XSKA 4R53A 2VO5A 3GTIA 1SGJA 2VRQA 2OYKA 5H8PA 5FJOA 2QMJA 1PDZA 3AIUA 1QI4A 5KSWA 2OB3A 3IJ9A 5IRPA 1UH3A 3FIGA 4O28A 5FJJA 2PLMA 3PJUA 4G9PA 4B4FA 4CGTA 4CQBA 4JIPA 4A2SA 3QYQA 3ID7A 2DT0A 5CC7A 3PHAA 4NXKA 3DX5A 3M47A 3NO1A 3N18A 4IISA 3U4AA 4KFPA 4JTJA 2OSWA 4O52A 2Z26A 1K9DA 2FZDA 2V81A 1WZAA 1QO5A 3S2LA 4GNVA 1F4HA 1NOWA 3GHSA 1YYAA 5I6SA 3I65A 1E1CB 4UTIA 4FX6M 4G1KA 4DJDD 5C9UA 2IKGA 2J13A 2WANA 3W85A 1CECA 1ZUAX 1KBKA 4NZ5A 1XYAA 4WJEA 2QEZA 1NARA 1RLDA 2E6DA 4IL2A 1TZ7A 3FKKA 3P82A 7REQA 4R3UA 5ECUA 4P7QA 3II1A 4MNJA 5I3DA 3VIPA 5FAJA 2CLMA 2H3BA 3VYLA 3DECA 4MYXA 2GWNA 1FH8A 4X2RA 3GNPA 2PWDA 3W1UA 1US0A 2HTMA 3CZGA 2E68A 1UP0A 3LHVA 3QGAC 4QBXA 5ABFA 1J6OA 3THAA 4ZQCA 2HK0A 4NASA 2MNRA 2O4MA 1GTEA 3MA8A 3SGUA 5M3WA 4JIRA 2WJFA 2WO5A 1TPVA 2FDMA 1E6RA 1A5OC 1BG4A 4HOWA 4IG2A 4ZSUA 3HPXA 2TSYA 4YXGA 2V5KA 2PMQA 3BGJA 3GC2A 2JKEA 3GDLA 3TSBA 1LUCA 5C9ZA 4Q4RA 1QPNA 1TMHA 4UTTA 1A3XA 5A6BD 1CCWB 1FQ0A 2C1HA 4UZUA 1AL7A 2OU4A 2Q3RA 1XRFA 1J79A 1XKYA 3V5OA 1UW9A 2QUVA 4HKPA 1Q2SA 1VS1A 3SSJA 3UT0A 3BJTA 3FA3A 3WK0A 3I6EA 1X6NA 4GIEA 1PYFA 4BWLC 3WL1A 3KOXA 3QW4B 1N82A 5LXXA 4XVEA 2ZKMX 3OIHA 1EXPA 3IGXA 1X38A 3HU7A 3O6AA 1LF1A 1MDLA 3LS9A 1EA9C 1YDYA 4X3ZA 5D4YA 5CZTA 5MKGB 1L6YA 3QTGA 3W7PA 3RF9A 3QQ1A 3I7RA 3QHMA 4D6HA 3GFZA 4XWUA 1XBXA 3F4VA 2ZUMA 1OC6A 3IRSA 3U57A 3WG6A 1HJSA 3ITYA 2WQDA 4LRTA 3N2XA 3CV6A 1H61A 4UR9A 3LEPA 5AC5A 1WE5A 3O8AA 5D03A 2JBMA 3FSUA 4W88A 3BW4A 4QHRA 3T07A 2WVVA 1OSEA 1OK4A 3RO6A 2X2GA 1WZMA 1V6UA 2NV1A 5K4XA 3ZR4A 1D8CA 1SQ7A 1QK0A 3SUWA 2QV5A 4AFYA 2PODA 1EEPA 1HXJA 1ZFJA 5LGZA 4Q32A 4WOZA 1AH0A 1B9BA 4AIBA 8CGTA 1EOKA 1RBOB 3C3UA 4TVCA 6A3HA 3DERA 3SECA 1WV2A 5A6TC 1E4IA 1NDVA 1WAUA 4MKVA 1FDZA 1AODA 2YCJA 2V69A 4LBUA 1E70M 1XPGA 2Y61A 1AJ2A 5FEZA 2DVUA 3MHFA 1DJXA 4DB7A 5DCDA 3VAVA 4PUKA 1BKHA 4D6JA 1ISXA 4BEQA 1A47A 5D37A 4ADTA 2YFOA 4YU1A 4ZVJA 1SZNA 1NP0A 3GXPA 3F4WA 2FKPA 2RDTA 4DX3A 1R47A 3N04A 1HJXA 3BMWA 3IIOA 4HSHA 3SN1A 2HISA 1UD2A 1A80A 4UTWA 3H2OA 3VDGA 4WRHA 3TXVA 1FHUA 2ASHA 4WXZA 3LPGA 4O12A 4Q3MA 5FF4A 1R3YA 4ML4A 1E0TA 2D2HA 4F0RA 3GHRA 1MW3A 1MSSA 3IIZA 3M5VA 2W3ZA 3I7SA 1C91A 1FFRA 1W54A 3CPGA 2NSOA 3TQ0A 4Z2LA 2J75A 5CC3A 5BWFA 1P0EA 3A9IA 1CB2A 2ZZ7A 3VDBA 4KRUA 1JDDA 1JZ8A 1DHPA 2JIWA 5CC5A 1QNPA 2PD5A 5LIXX 4O53A 2ZUNA 4LH8A 1UP2A 3JZUA 3DI0A 3W84A 5K3VA 2ICSA 3A47A 4L1WA 1X1OA 4NUWA 3SCNA 3WLRA 4HA4A 4XAFA 2Y7EA 4OHQA 5REQB 1ITUA 4CQCA 3CAVA 4C6LA 5BROA 3WUFA 4QG8A 4GVGA 4JCMA 3LNPA 1UQYA 4QLLA 2PDHA 2HMCA 1S5MA 1UMLA 3G1DA 4AZ5A 2QJHA 4WY0B 2A7NA 3WLPA 4PMQA 4JTFA 1QFEA 4BFAA 3PG8A 3E9AA 4GQBA 4TR9A 2XSBA 3STPA 2J66A 4B3ZA 4GO8A 2EO7A 3W1AA 4N4PA 1T6MA 4LANA 1U30A 1O5KA 2YYTA 1A5CA 3VUSA 2GQ8A 1DYSA 2YBVA 3WF4A 2LLEA 3ZSTA 3S1XA 3LRLA 1JAEA 2XGIA 4G2DA 3RIKA 3W24A 3DU0A 1GKRA 3IJ8A 1QW8A 3VILA 3ZT5A 3GUWA 4HZ7A 4AY1A 3IWPA 3CL8A 4NNCA 4XX6A 3SW6A 1GTHA 1C9DA 3GVVA 3U8GA 1EBGA 1JXKA 4ADSA 1JZ6A 1UKPA 4GH1A 1QRQA 4BEUA 3N11A 1ESWA 3VMPA 4IJBA 3P62A 5ABEA 2F2HA 4U2YA 5GQBA 1XSIA 1BVWA 4MWAB 4Q6XA 4KFNA 2XN1A 4CU6A 4IIGA 4PUJA 3CZLA 4LS0A 4NSBA 3E74A 4IP4A 1YIXA 4XZLX 1A3HA 3D6NA 4KEVA 5I78A 2FZBA 1KGUA 3HIJA 2DFAA 2B31A 5LA2A 3STCA 4ORMA 5G5IA 5ABTA 1DWAM 3H4GA 3PZMA 3TQVA 3BANA 3WQ5A 1FDYA 4E8DA 4ZEPA 2R82A 3NXLA 2A7PA 4J7RA 2HS6A 5JVLA 4PCSA 3VGDA 4F3HA 3GXMA 5EFDA 1XIGA 1UIOA 4AH7A 2MUCA 1TMLA 3WDJA 3CIWA 2PWGA 2X16A 4HA3A 2EPNA 4O50A 3E0IA 2QNEA 5A2AA 1N2VA 2BXVA 4Y9OA 4IFOA 3WJSA 1U5HA 4L4PA 3S9IA 3G22A 3LENA 4AY7A 3ANUA 3C0QA 3L4TA 4LPCA 2FYMA 8XIMA 1E9LA 3FJLA 2Q8LA 3HG2A 1MRQA 3W00A 2YCLB 4D8AA 4B3LA 1OG0A 4K8EA 4HJWA 3CWNA 3ZWTA 5I03A 4QRNA 1WBHA 2WJZA 4PMZA 1ADDA 4H4IA 4FXRA 2NX1A 3G1SA 3PZQA 2XVPA 2IS7A 1LL4A 2J9YA 1QI3A 3N6HA 3TYDA 1W3LA 3NOYA 1GJUA 3RM9A 2YB1A 1PHWA 4TOQA 3RYSA 5G4WA 4K37A 1TJ0A 1M3UA 2YA2A 4FF7A 3NZQA 2YXGA 3CQHA 1C7TA 1J0IA 4X22A 1J0ZA 4P2VA 4HCHA 4E3TA 3K1DA 2DUXA 3DYPA 2D24A 1R9YA 2QCEA 4M1BA 1OD8A 2XIBA 2WMFA 4ZBCA 1OZMA 1EA0A 2Y0FA 5IHSA 1FHDA 3KCJA 5L9FA 2C19A 3S0CA 1TUXA 3LG3A 1TPEA 4DJEA 2NV9A 2X05A 4F40A 2ZDSA 1DXIA 3RFAA 5KMYA 2ZA2A 1WDWA 2HNEA 3QQWA 4ZXLA 4BHYA 3DC0A 5AVHA 1JEZA 2XTKA 4RCXA 1O1ZA 3B8DA 4PUDA 3BLKA 3NPXA 2BY2A 2ZUSA 4O57A 5EYWA 1JAKA 3UJFA 1XIEA 5IDZA 4BF9A 3LCGA 3PNUA 2JF7A 5HPCA 4RDVA 4L9ZA 3WYZA 2B0MA 4EX4A 3LLFA 4QP0A 4PE8A 4KCVA 3DCPA 1ITCA 2Z4GA 3LX9A 4GYJA 2QVHA 2VQUA 4FF5A 3HPSA 1WDSA 1WOAA 1L2QA 2GLKA 5AHLA 3FV9A 4DI8A 3BWWA 2V5DA 1Z9AA 3UXKA 3W07A 2YW3A 4BR1A 3EB4A 1H3GA 1ZBWA 2DJXA 2E5DA 1P6CA 3SZ8A 3N17A 3I6TA 4WZHA 4BF5A 3MZNA 4LB3A 1WP6A 1B3OA 4NZFA 1W9DM 3EKGA 5CPNA 3R0DA 2HPMA 3WDIA 4QXIA 3GS6A 4GINA 2NQJA 4DQWA 4QFUA 3WD3A 4PCFA 3TJXA 1AQHA 5C54A 1JUKA 2ACRA 2FIQA 2J7DA 4YWIA 1A5BA 3DHDA 4S3GA 1TV4A 4UFHA 1J10A 3ZIZA 3I7QA 1MWOA 3M9YA 2OSXA 3DKLA 4I3GA 3IK2A 2OZ3A 1HTIA 2PP0A 2NXHA 4MPKA 4XTDA 3QPYA 3R12A 3NSXA 4M3PA 3TIMA 3VD5A 2Q09A 1UP3A 3UR5A 5LA0A 3LXBA 4GE8A 1V6TA 1JFXA 3GNRA 1DKWA 3NEVA 4GI9A 2DH3A 4B5NA 1Q8AA 1X39A 1C93A 1UOZA 3RJXA 3R0UA 3ZVHA 2IMRA 4JX5A 4JQAA 1W1VA 3BMXA 5EMYA 5C70A 3GXFA 1W9XA 3OODA 4IIBA 5G1YA 2W67A 3ZR6A 3B97A 5M03A 1HW6A 1UBSA 4IPJA 4UC5A 1VYPX 3NVTA 1W31A 2FB2A 3ARZA 2WSQA 3DZ1A 3F4CA 2GQ9A 1UZDA 1L8NA 1HKJA 1KKOA 4C6FA 1XGDA 3UG8A 1F74A 3BV4A 2DQXA 3MO7A 3U2ZA 2CETA 1V3LA 2Y8VA 3TTSA 3W6MA 4U28A 4YTSA 1OY0A 1KB3A 4PZVA 1RK6A 4GHRA 2OX1A 2B81A 1PIGA 1RQEA 2WZIA 1W5MA 3ZO9A 4P7RA 1MW1A 2X42A 3FVMA 2OX4A 3C52A 3LBMA 1MUCA 2OEJA 5BXPA 2CBJA 1NVMA 3AS0A 1K4HA 5KEZA 3KE0A 2C13A 2Y8UA 3AMKA 4DY1A 5HNRA 3WKZA 1XGZA 3UWEA 5IBXC 1RJRA 3O05A 3VOHA 3G5EA 4LALA 1CGWA 4HIBA 4PTWA 4Z1CA 1DJWA 4FX7A 5AYIA 5DN1A 4J3SA 5ABHA 1J5SA 3CTTA 3PBVA 4KF1A 3N4EA 1NWTA 1G69A 5EGRA 3TQKA 2Q71A 3WF2A 3AQUA 1OGSA 3E5BA 1XSJA 5JH1A 2OOFA 3P14A 3WEMA 4HU4A 4AUBA 3LPPA 3MSRA 4DI9A 2RDUA 5FF7A 1CXHA 1UWAA 1HFBA 1E73M 3AXXA 3V75A 2YLLA 4PTVA 1DEDA 4PGLA 4P7NA 3WD1A 2AQOA 1J11A 4IMEA 1IEXA 1ISZA 1NP2A 4C6BA 3E0VA 3KBVA 2CFFA 4QSHA 4DZAA 3OYZA 4A3HA 3UERA 4CQ8A 3CASA 4MWAE 1H41A 2G5WA 1HP4A 3MUZ1 1XLGA 4UQBA 4DYJA 5A8NA 3WBEA 2ZE3A 1SJDA 2ACUA 4GCAA 3L4YA 1X7FA 3ZR5A 2CZVA 2BFGA 3UWYA 3HN3A 3ARRA 1BXCA 1VD6A 3NO3A 4JFSA 5CGQA 1X6UA 3ARQA 3LV5A 3ITLA 3EB3A 1XIDA 1PX4A 5EMKA 2OG9A 2RUSA 2WOQA 3ARPA 3GC5A 4QS6A 1V3KA 3PSWA 1IR1A 2V3GA 4MDPA 1QOPA 4FNPA 1DVJA 1KCLA 2AMXA 4KRZA 2OPJA 3FAWA 3L12A 3EX1A 2GSJA 1W3IA 4WDXA 4IP5A 1BRLB 3ELFA 3N3TA 1L6FA 5D2XA 3EDFA 1KQZA 3MVIA 1JZ3A 5I7GA 1RCXB 4PTNA 3A4WA 3M41A 5I00A 1E9YB 1EFZA 4JCLA 3TZNA 2DZUA 4REQB 3APYA 2C14A 5A5WA 1RAKA 4AD4A 1XIHA 5C0QA 3IVUA 2QUNA 2GVJA 4CVWA 3BLPX 1XLFA 5LYRA 3RPDA 3AZTA 3LD5A 5BOOA 1AMYA 4FAMA 2P8CA 1M6JA 1WQ5A 4RR4A 2DIKA 4P8XA 3VCRA 2H6RA 1IZJA 2YXXA 4QNWA 2QF8A 4E2VA 3AUJA 3UVAA 4YVVA 4AVOA 1UYQA 5DANA 1GYLA 4TTUA 4WK9A 2QDEA 3ARSA 5E9XA 5A94A 4GZIA 3OA3A 1SO6A 3U2EA 3VNJA 4H9MA 4W8LA 1EL3A 1FKXA 3HJZA 4XBSA 3IV8A 1OFPA 3MBDA 4HPGA 1LM1A 5GNXA 4M6VA 4XAGA 3REQB 5DCBA 2IW0A 4FXSA 3CZEA 3PBMA 2VX7A 2TPSA 4GACA 3O7UA 4UR8A 3MI3A 1XLDA 1AH4A 3WH6A 4EAYA 2ZUWA 3DG3A 1M41A 4HPHA 4JDYA 3ZM8A 5EMJA 1QUMA 1DQXA 3WQ4A 3FHAA 2OQHA 4CNNA 3PK7A 3VMNA 5HWMA 2PGRA 4E4FA 2E6YA 3FDKA 3FA5A 3UU0A 1A5MC 2HVNA 2QHAA 2QV4A 4AF0A 3UXIA 3WQFA 1Y5XA 3TCSA 4UCFA 4BI5A 1JYVA 4Q8MA 5DMYA 1EP2A 3NZPA 3KL3A 4GA8A 4XZHA 1IYXA 3RCMA 6ALDA 3V18A 1PJ9A 3NOEA 4B90A 2ISVA 4XZBA 2C0HA 4DIAA 3BGGA 4AYGA 3PJTA 4U5IA 4Q8OA 1P1MA 5MHBA 3DFSA 3ZWSA 3WJYA 2P53A 4YPJA 1O66A 1HL8A 4Q8QA 3AXKA 3UG3A 1O95A 2VRKA 3UPBA 1Q7ZA 3GSMA 5AHIA 1FH9A 4CQDA 1J0JA 1A53A 5CJNA 1LRNA 2JKPA 2VGGA 4QEEA 4FLOA 3N6JA 5C9WA 1RA0A 3ITGA 2E1DA 5A6SA 1OCJA 4PMNA 1IXOA 3IIPA 3SURA 4JTKA 1VKFA 4U3CA 3OBEA 1E6ZA 1VFUA 1W17A 5FJUA 4DBSA 3KBJA 1M9HA 1F05A 4J3XA 4WSJA 3BURA 1UA3A 4XG1A 2INZA 3LM7A 2VJXA 1KA9F 2Z24A 1W3NA 4E2OA 3NYZA 3OZMA 4PFHA 3V16A 1SR9A 3MP3A 3PF3A 1HX0A 2VXNA 3CGTA 3UY8A 2JK2A 3TN6A 3RRAA 2RGMA 4LF1A 5LIYX 1TPDA 4PULA 4DBUA 4Q8WA 3N2MA 4RDYA 5CLTA 1QI2A 1LLWA 4F2TA 3OP2A 1MXDA 4E0CA 4CNUA 4FS9A 1KWKA 3B4UA 4FXFA 4TXEA 3WQVA 5I09A 4X9YA 4A8NA 3S1UA 3W7MA 1E4LA 4PTXA 4NP7A 5BOFA 2J62A 4QE1A 2CLLA 3VABA 2WCSA 4MYAA 2BGSA 1XISA 3U9IA 1GW9A 4W7WA 3QMTA 4ZL1A 3IGSA 2ANUA 3GAKA 4JTAA 2CU0A 3SRHA 4Y2WA 5T9CE 1KGWA 4K38A 3COTA 4ZSTA 3S2MA 4M6PA 3Q94A 1TKKA 2QCGA 2NUWA 1O68A 3VD9A 2BBFA 1O4UA 3C2EA 4BS0A 4C6NA 3PUEA 1TMQA 1D3HA 2YJQA 2VZOA 3TFXA 2GVGA 3L4ZA 3C5QA 2Z1BA 4IIHA 2WWDA 3CHCA 1PWLA 1GEHA 3TAOA 1JPHA 3ABOA 1Z89A 5GJNA 2V68A 2WSRA 1X98A 4GYKA 3AIRA 3AIVA 1KBJA 2NQ9A 4CNOA 4ROPA 4IP7A 3EPNA 1L6WA 2XVNA 1K7XA 3VE9A 3A5FA 2NX9A 3G8EA 5CPOA 3TONA 3S6OA 3FHQA 1V6YA 4DHGA 1YDNA 1PZ0A 1M65A 3V5CA 1ITQA 3P93A 4NJJA 1TPB1 1F5ZA 4KS0A 3T0AA 3G0XA 1V3IA 1L2UA 1OFRA 2E6FA 1G4SA 1LYXA 3OZYA 1HKVA 3AS2A 3TNOA 1IT7A 1QI5A 3AALA 2CERA 5GVJA 1W5PA 4K39A 3MU7A 1W9VA 1GHRA 1M7PA 2EPHA 3WDQA 2XSXA 3VXGA 3MV01 2CLFA 2DVTA 1UB3A 4UCGA 1DBTA 4RE4A 1FP8A 5HJYA 4IPNB 3LCHA 2ZXQA 5HAOA 4ZTYA 3W7EA 1I60A 2OGYA 2WSPA 5FJTA 1N7KA 3U0HA 5A3HA 1GORA 1KXHA 2PU0A 4PMRA 4YVPA 2FVMA 4C6EA 3SSZA 1SO4A 1QPQA 1OD0A 3GTFA 3CQKA 3KZPA 1EX5A 1SZFA 1E4NA 1H11A 4R27A 3KW3A 2BVWA 1VFLA 2FGLA 1LROA 4GQQA 1VH7A 2BSLA 1FCVA 1JL8A 4QROA 2A0NA 5HQEA 3VPLA 3IIXA 2V30A 4H8HA 1BWLA 4JAWA 3FXGA 4C60A 3WF1A 4QCFA 1L6SA 3TFCA 3TOPA 4DRSA 3HGSA 1KFJA 1J4EA 4PA8A 2YSWA 4AD0A 3V3WA 3AWNA 4PC8A 3CHVA 4TMBA 2I9EA 4CD8A 3AO0A 1YEYA 3FNDA 3QZ6A 3EXTA 4CU7A 1LJYA 4C1NB 3GD6A 4HU0A 1MI3A 1GEQA 4B9ZA 2W6RA 2Z28A 5C9XA 1V4YA 4FR1A 3NQ2A 1UR3M 3K4AA 3OO2A 3I68A 4MG4A 3VOIA 2PBOA 4IFKA 5AC6A 1NJJA 1PAMA 1R85A 4PL2A 3EDDA 2AOSA 4W8BA 3KVMA 3L5AA 4DO7A 3AYTA 6REQA 1K6AA 3NXFA 3Q58A 2PTDA 2RKXA 4LU0A 5KZMA 4KWSA 1HJWA 2PZNA 3T9PA 3UZZA 4IMFA 1A4MA 2HXUA 1YNYA 1CENA 3T44A 3THDA 1H0GA 2V2DA 3G2GA 3B06A 3QV6A 1YDOA 3UYCA 3H53A 4I90A 2IXUA 1Q7MA 4LB4A 1GVIA 4OJYA 4M8UA 3UFYA 4KIRA 4GIRA 3W6YA 4YJ5A 2NLYA 4B9YA 4UTJA 5CH9A 3JVAA 3KHJA 1A5UA 1SW3A 3AZSA 1HVXA 3AXIA 5I5RA 2BOEX 1O12A 3L4VA 4Z08A 4BI7A 1JYXA 1PIIA 3MWCA 2WNWA 3W01A 4XB3A 5JIPA 5I3IA 2VVNA 4EVZA 4H6QA 4H01A 3W72A 1SJBA 3A3HA 3VKKA 1S2UA 4MNLA 3TN4A 4Q8PA 2V63A 1YE4A 2R8WA 2ALRA 4GISA 1VEPA 3AMGA 2GDUA 4W7UA 4V1XA 1AH3A 3KRUA 2GQ3A 1UROA 3SUTA 1PTDA 3DFPA 3WH8A 3T0TA 1ICQA 4DWSD 1E6PA 5KETA 4ERAA 3GVQA 5A8GA 4DBWA 2GVEA 4MMWA 3W3OA 5G4HC 4IX0A 1UC4A 4M24A 4HSNA 3W22A 1XYBA 2HWGA 1UJPA 3H4XA 1Y7VA 3L21A 2XM1A 4QDPA 4JS3A 1HZYA 4F0LA 2FPVA 3AMLA 2VP8A 3PFMA 1Q6GA 1TA3B 3PUOA 1JZ7A 1XLMA 2ZCGA 2WLYA 1A5LC 1ME9A 1K03A 1YTEA 4MB1A 1R3RA 2Q6ZA 3V5FA 1YTDA 3BGAA 2PDUA 5EPDA 4B2DD 3GFYA 1DOSA 3V7PA 1JDEA 1VFSA 3VIJA 2FGZA 3RMJA 1RY8A 1XR2A 2ZC1A 2CW6A 1Y0EA 4LW7A 3UD6A 3UGRA 4DYKA 3AROA 2V67A 3RJYA 1KM5A 3FLUA 1CIUA 1V0KA 4R9OA 5FACA 3UWQA 1XQLA 1POKA 4MLRA 2OWCA 2HCVA 3WFAA 5KZDA 1B3ZA 4DELA 4NX5A 1Q63A 2G4JA 2ZUTA 1JPKA 4BF7A 3GO2A 2J7BA 2FZ8A 4WKHA 1QNOA 3NVDA 4B5VA 4OZOA 2HVOA 2EAWA 2EPMX 2V2HA 4PRWA 3IIVA 2PWVA 4F48A 3PULA 1F8IA 1JVNA 4NJIA 2A6LA 4LYRA 4N2YA 3WJZA 3FCPA 4XZNX 4DYEA 3OU8A 4YL2A 2R1MA 3EDJA 4U33A 2QCLA 2V5LA 2OQLA 2ZZ1A 1S5WA 4G7EA 4S2CA 4HOXA 4Y9AA 3QKEA 1E55A 2QVNA 3PWAA 4WKAA 4WVXA 1EBHA 3L4WA 3PBUA 1NDWA 2ZIDA 1S2CA 5A6AA 2Y7DA 4D8LA 1XRTA 2GJLA 3A4XA 3FSTA 1ITXA 7CGTA 1QASA 5TAOA 3BAJA 3G77A 1VBUA 5AYZA 3GU9A 1N8FA 1EUNA 1HL9A 4Z2HA 3PB2A 2TMDA 4PUMA 1W9BM 3MMTA 1NQKA 2PURA 3W7KA 4O14A 4HK6A 1THFD 1LBFA 4UTTC 4NAFA 2J27A 1PBGA 3UR8A 3LGEA 2HV5A 3DFOA 4YCPA 3MPGA 5FSEC 3M0ZA 2PDFA 2VC9A 3TSDA 3B3DA 1BTMA 1V3HA 1GCYA 2RJGA 4AD3A 4ZFMA 4AW7A 2PZ0A 4AHOA 2DZWA 4H83A 1W6TA 1B54A 3T2PA 3U2OA 1W1TA 3ITOA 3ZLGA 4OBSA 4AXNA 4A3RA 5FEXA 2PLCA 3MWAA 2MANA 2ZRVA 5DO8A 4DN1A 1GT8A 3TZFA 1OCNA 1DIEA 9RUBA 2OZ8A 3IPWA 5D2YA 1U1HA 4PODA 3W86A 4MNMA 3NQ8A 4TVUA 3WIJA 3FVDA 1W91A 3HV9A 3SIMA 2FVKA 4PMVA 4U2ZA 4GFSA 4JX4A 4C90A 3AHTA 1BGGA 3UR7A 1G7UA 1DWFM 1F76A 1K77A 1EP3A 1WPCA 3O6DA 1NOFA 3I10A 2PU1A 5I3KA 4KGJA 3OW1A 3L0GA 1V0NA 2INEA 1N55A 3M46A 3WLJA 1R0MA 1XYCA 3VDAA 3BW2A 4RPPA 1CGXA 2ZXAA 2Y7GA 2Y8KA 1F2JA 3CPUA 1NFBA 2AGTA 3CC1A 1FWDC 1P0KA 2PTXA 8A3HA 1EWEA 4DO4A 3VNMA 1VHCA 3S47A 1UD8A 4BQ2A 2VC6A 3C8FA 3C2YA 4AXKA 3QOKA 4YMZA 2VDIA 1QHOA 2Z29A 3E02A 1OFAA 2V38A 1KWGA 1EJRC 5SWUA 2BVTA 2X0SA 3CXOA 3DFNA 4PUUA 3POHA 1X96A 3KRBA 2VZUA 3WMCA 4OECA 1T41A 2PSNA 2BXYA 5CSSA 1BSLA 1K9EA 1H5YA 3WBAA 2J7GA 4V33A 3TEVA 2CBVA 1TWSA 2CXEA 2IQDA 4UTWC 5IDIA 4LGXA 3MKCA 2EG8A 1GOXA 2FHBA 2E25A 4Q4SA 1HKIA 3WD2A 4W4QA 3GDMA 1EGMA 4EF8A 1WDDA 4GQGA 4TX6A 1AW1A 1AW5A 4LNYA 4WQ6A 1CTNA 1MFVA 4HMDA 1I0DA 1HKMA 2E1WA 2CPUA 5HPOA 1B90A 1E1CA 1AQ0A 1MQRA 3GG8A 3ZZ1A 2QGHA 3CHEA 2WYSA 4N7QA 3HPFA 3U5UA 4DUXA 1QT1A 3TYUA 2V3EA 4LAMA 2WHMA 2GSHA 3MJMA 4LBSA 1UWUA 4DF2A 1S1PA 4JYFA 1EWDA 5C71A 3OGSA 3R0KA 3HFYA 2DIEA 2GZXA 4CU8A 4B92A 4MB5A 1LRQA 3CUIA 4JFTA 3RM4A 3S5YA 4IMCA 2J6XA 2YZRA 3N2BA 3L0KA 1VAHA 4O19A 5EBUA 4RKAA 3MCMA 1IWBA 4F66A 1FX6A 2BS9A 4O54A 3HF3A 1TX0A 5AKQA 1MYRA 3ARUA 4HYVA 4WKFA 3B0UX 4IIDA 2OKTA 1TWIA 1Q4NX 4GMEA 1CLVA 3RLUA 5C2GA 1RLCL 5FF3A 3UZXA 4IICA 3W1MA 3S8HA 1QVBA 2QDHA 1NDYA 4JN8A 3FEQA 3PVFA 2XFRA 3JUGA 4D1JA 1EJWC 1G1YA 3A4AA 4A22A 4HU3A 1OM0A 3S2NA 5D32A 2CWXA 3T55A 5CG0A 2J4GA 1UBPC 4Y9NA 4GJJA 2D2GA 3C6CA 1GZ1A 1ECQA 2OYMA 2OXNA 3N4AA 4R85A 2CITA 3PS7A 2VFGA 4AEFA 2X2YA 2FJKA 2OWWA 4I8DA 5JQ9A 1U5VA 1I2PA 4MAVA 4QJ3B 2JFEX 4HYRA 2NT1A 1H0IA 1N8IA 1MEWA 1Z42A 3NAVA 2W4XA 3HQNA 3FW6A 4EKJA 4A2RA 2YGYA 2KAUC 2WVVB 4R9XA 3SY8A 1L8PA 2XHYA 5MKGA 1W8SA 1EIBA 1XLJA 3VD4A 3C8NA 3CM4A 3HOJA 2JKAA 4UWMA 4BQ4A 4J5NA 1GKPA 1TWDA 1G4PA 5HMDA 1GQJA 2VHLA 2WPGA 1VCFA 4H9TA 3LN3A 2OT1A 5ENLA 5H8UA 2PCEA 1CWYA 5CXPA 4AEOA 3KP1A 4CQ9A 5M1TA 2CLHA 3HQPA 1OYAA 3M6DA 3FYYA 4C5ZA 4GJ1A 5B7ZA 3TTEA 1EYWA 2ZRYA 4JTCA 3RLGA 3OVQA 2WNQA 3EAUA 2QDDA 4ACZB 4CNTA 3BQ6A 3WJWA 4OKDA 1ENUA 4FNTA 2XIIA 1XLLA 3VKAA 5EKYA 4M0XA 3KEHA 1SO3A 1IHIA 1MDRA 2D1ZA 1QXLA 2VT0A 2C15A 4AHPA 5AHMA 1JGMA 3ABRA 1F3XA 4MGGA 1DXEA 3UEQA 4DJFA 2VCCA 1XHGA 5HWJA 1CLXA 3NQ6A 1C29A 3CZKA 3GVGA 1OGBA 4MLJA 3TJIA 2D2OA 3VK5A 5LHFA 3TX9A 8XIAA 3QEZA 1QBBA 1SPQA 3CEUA 3W87A 4KMQA 3W37A 4IGNA 1S39A 4ZGYA 4YNGA 1TX2A 2PGFA 1NOUA 4GH3A 2BWGA 3LPOA 1XQKA 1QNVA 3AHXA 4AB4A 2EPKX 3C61A 4A8IA 3KVJA 4NJGA 5FKYA 1RVKA 4GABA 2SFPA 2VCBA 3KLLA 4GYPA 5J5DA 4YS1A 2D3NA 1TCDA 3OEXA 1JPIA 1DE5A 2CKSA 3W2JA 4HN8A 3BLLA 2DSKA 1QDSA 3DGBA 4I7WA 1G5AA 3AC0A 3ITXA 4DJEC 2GGGA 2DZBA 2YCKX 4LYPA 1IXQA 4JTLA 2JEQA 4C1KA 1FH7A 3QH2A 4WSKA 2J7EA 2PDXA 3B0VC 4RXGA 2FHCA 4HU8A 3CUXA 1VENA 1SZGA 4GVHA 1EJSC 4U3AA 5FEPA 3R1ZA 1V93A 3PZTA 3MUCA 3OOQA 1OWQA 2FPTA 5REQA 3A12A 3EMZA 3TQPA 4TX9A 4Z1AA 3SO7A 1VFFA 3VOFA 2ZZ4A 1R38A 1Q6OA 1I2QA 3QHNA 1B30A 3U3HA 3EOSA 1SMDA 3LGDA 1KM0A 4NKCA 2ZQ0A 2QAFA 3M64A 4CCZA 1EJTC 1FTXA 3QY6A 3BSMA 3PFRA 4DVOA 3E2VA 1FWGC 3WCZA 3VKBA 3VD7A 5D9MA 2CZDA 1FCUA 3S1VA 4ZOAA 3S6TA 1DWIM 4JQ3A 3MHGA 2YFNA 4FMVA 4AZBA 1Z7AA 2WVUA 3BTNA 2EGZA 3TJ4A 3QRHA 3V1PA 7ODCA 3RDKA 5H6HA 3BLFA 1E72M 4LY4A 1XD0A 1US2A 2NUXA 4GXPA 2VI0A 3R8GA 1REQB 1ME7A 5CBIA 2GJNA 1KLYA 3INPA 2WZEA 2AGKA 1I2RA 2JGYA 2X8RA 2TODA 3VIIA 1JDFA 3GC4A 4P5UA 1I75A 1SJCA 3QGVA 4PMOA 4LS1A 1GVRA 2HNHA 4US5D 2CC0A 4MWAA 2OJPA 3H8AA 5TIMA 1OC5A 1KBIA 4Y6GA 1AJZA 3AS1A 4MFDA 3TMQA 2BOGX 2Y62A 5EBAA 1UR9A 5LKYA 5A8OA 3WH5A 2X0YA 5EY5A 4A8RA 5A8QA 4Y9MA 4L80A 2QUUA 4ZQRA 2Y7FA 3SAZA 1HL2A 2PDCA 3QMRA 3W81A 2JGQA 3NQGA 4OQVA 4GD0A 4GZJA 3NQDA 1R5YA 2J7FA 1FWBC 3MHUA 3NQAA 1KRCC 4L64A 4QDMA 1TIWA 2GFTA 3USZA 2AAMA 1R3WA 1EXBA 1IE7C 5AECA 4QLKA 4TVDA 3DXIA 2EEXA 1DJGA 1K8XA 2WJDA 1ONXA 1SO5A 3W1QA 1PVNA 5IXEA 4N9EA 1B2YA 4A4AA 1UASA 4S38A 1TV3A 2EHHA 2EPLX 3LB0A 5CQ1A 4N42A 3F5KA 3B9OA 4Q4MA 2OOGA 1RALA 3GNDA 1DP0A 4DWSC 4FI4A 1GW1A 3B40A 2YCLA 4A21A 5H2ZA 3S6DA 3ITCA 1QNQA 3MUXA 3PSVA 1VFOA 5DY3A 4D6IA 4JTIA 3A23A 2O4QA 1E0VA 3FX4A 4NI8A 1XKJA 4ZXOA 4FIRA 5E0KA 1X7IA 1B31A 1V79A 4MB3A 4HCDA 4LEFA 3M6YA 1F6KA 4S3AA 3URAA 4MADA 4JHOA 3E2RA 2ABAA 1C92A 1HIZA 3K2GA 3W27A 3CUJA 1EJVC 3CEPA 1VPXA 1A50A 3VZZA 3C3NA 4J1OA 1H62A 5J8LA 1E6XM 3B8UA 1JR1A 5T91A 2WVSA 2BG5A 3NDOA 2BGNE 1OX5A 3P5YA 4O18A 4ASTA 3T2OA 5D33A 3KP0A 3CTLA 4GOAA 2F6XA 3PP7A 1XUUA 2WLZA 3RN6A 1XCWA 1TTJA 4V15A 1AVAA 3PNZA 2V3FA 4GUGA 4GGBA 4Y96A 3KL5A 3FYPA 1KTCA 3PWIA 1WNOA 1U1UA 1TPC1 1E5NA 1UWSA 4F0SA 2VR5A 2DEPA 2BVYA 3HPZA 5A95A 4QJ1A 2QUMA 2OKOA 1VJZA 4LC6A 2VGBA 3E0WA 3DOPA 2PDMA 4E4UA 4U10A 3DAQA 3XISA 2BTMA 4ZZ9A 1FWRA 3POCA 4MZ1A 3BG3A 4MKSA 3G6MA 1XIJA 3CT2A 3QV9A 3ARVA 1CI1A 4QDWA 2FZMA 2X1SA 3C2VA 2D22A 5A6JA 5JIWA 1OX4B 1XIFA 2WMKA 1IXNA 4R7JA 5A1AA 3UVIA 1XLHA 4C1LA 1DIDA 4O10A 3GY1A 3GWQA 3TSMA 3NQ7A 4UTLA 2DSWA 3A3WA 2I14A 3CJPA 2ZX6A 3TCEA 1GOKA 2VOTA 2BY3A 1RY0A 4HPJA 1MO0A 3NQBA 3R25A 1XG4A 1F6YA 3LOTA 3F2BA 4ZB0A 5D9OA 1I8JA 2DY3A 4DNMA 2C7FA 4LWWA 1UA7A 1PS9A 2BVDA 3MP4A 4C7DA 1A49A 5FJPA 3VI2A 3BJSA 2YW4A 3V1HA 3Q45A 1PO9A 5HUPA 2XN2A 3C4UA 2GDQA 3EWUA 3K4DA 4QE4A 4Y8EA 2Z6JA 3T2QA 3HMJG 1GVOA 2J25A 2F2KA 1ZBKA 4MHBA 2G3MA 4K2SA 4GVIA 4S3CA 2POZA 4GUHA 4GLEA 4FLQA 4PSPA 1B3VA 1F61A 4JKKA 4LEQA 1GUVA 1JZ4A 2GUUA 5TQLA 3SB0A 1FFQA 2CBIA 4IQLA 4DZIA 1FXQA 3GHTA 2Z1WA 1BD0A 1UUMA 3OB8A 1U83A 3QZEA 3I3DA 4Z1BA 2CNCA 5C5YA 4KPLA 1ZP3A 3CZJA 3M0JA 4H7CA 2W62A 3S9YA 2X41A 3CV2A 2IKIA 3UF9A 1H63A 1IEQA 3BLEA 3ABQA 7PTDA 1TFVA 3T81A 4QSFA 2PP1A 4KGLA 4PFMA 3LGGA 2Y24A 4LJ3A 4J2MA 3S5ZA 3LY0A 1TJ1A 2PRMA 5G2IA 3KRZA 1JUBA 1YPFA 4IL0A 3CPRA 2R9RA 4NZ4A 1E15A 1WB0A 4DF0A 2QF7A 3KS6A 3NZRA 1V6XA 3R94A 4DWSB 2IPFA 1S1RA 3VFLA 3W83A 5A2CA 4GKLA 4E3VA 1OIMA 1WYIA 3QLDA 3PZ9A 4DO6A 4Z42C 2HEJA 2ISFA 4PMJA 3W73A 2OFJA 5BRBA 1CW2A 1NY1A 3WDPP 3Q4DA 3RCYA 3GYCA 3TJLA 4NIRA 5C7VA 4FX8A 2I9UA 3EPMA 1SSGA 2Z1XA 1G0CA 1QK2A 3NQEA 3QKZA 4IPLA 4U31A 1EIXA 4GUJA 1OVDA 1R30A 3NM3A 3LTPA 1Z48A 2B4GA 4WGHA 2R1NA 4OT7A 1E71M 2P1FA 3WQ8A 2EQDA 1MQQA 3DYMA 1TB3A 2DW7A 4NJKA 3N4FA 1J5TA 1S2TA 5HBFA 1A5KC 1GJPA 4GXWA 5CSRA 3AHYA 3WMLA 2H90A 2VWSA 1XS2A 3GZAA 1JCXA 2E8ZA 3CL6A 1E0WA 4NXSA 2O7QA 1ZENA 1VPYA 3OLEA 4MTVA 2DP3A 4D6CA 1PZ3A 3LQGA 3LSCA 4WJXA 3AFBA 2QGYA 3LMYA 1JNEA 3S3GA 1WBJA 2DGAA 4DZ5A 2XZ9A 1GZJA 4H41A 1PCWA 5HK4A 4O8AA 1XDMA 4GI4A 1H5VA 4RLIA 5I3JA 2OGJA 4C5YA 7TIMA 7ENLA 3E2SA 1TRIA 1JULA 1XJBA 2EJ1A 5CPQA 2E9MA 3HV8A 3GR7A 4PB4A 3BAXA 2ZOXA 3RILA 4RE2A 4C6CA 1T99A 4JTUA 1Z6KA 4JN6A 2B7PA 4WJ8A 1EJUC 4D6GA 4RJEA 2YA1A 3WD0A 1SSDA 2X1UA 4IIEA 4DXKA 4LQ1A 1DJIA 5EMUA 2G8ZA 3S46A 2C1GA 1LBMA 1QHZA 2GGJA 1RA5A 3MYOA 1Q6EA 2BHYA 4HMEA 2OELA 2G41A 5DEZA 4EIVA 2F6UA 4H8VA 2VFDA 2HZGA 4QG6A 3T7VA 4ZOCA 2QPSA 1OHLA 4H9UA 3GIQA 4K68A 4EOUA 1GK8A 4MDOA 3D3AA 4KT2A 4Z2IA 3P81A 4J28A 1S5TA 3VTRA 4G1NA 2QS8A 3MP5A 4IXHA 5T8GA 1HF6A 4HTYA 1KR1A 3IARA 1M1BA 1OABA 4XKMA 2DORA 9CGTA 4B5XA 4WSHA 4NHVA 1Y5WA 2PDLA 1S38A 3RU8X 4JFUA 1W9PA 2J7CA 2J24A 5DXXA 2QMKA 1B4KA 3QOMA 4WCJA 1FBAA 1EC9A 1Z69A 1GQLA 3IEBA 1R3QA 1NWRA 4P61A 4O17A 4HNOA 1KD0A 1E9IA 1Q6FA 4YTRA 2XGZA 4UQEA 1XM3A 1VJIA 5L6UA 3DH7A 3SCPA 2PB1A 4X0NA 2PC8A 5BMXA 1B3WA 4WLCA 1JYNA 4C6PA 5CCZA 2AKMA 4EK7A 4AIEA 4REQA 4DPQA 2XN0A 5D9PA 4J3TA 3URQA 3GDRA 1BKSA 1O5QA 3WUBA 2VX5A 4IH3A 1R87A 3VIMA 3AJXA 1KM6A 3LHZA 1FWAC 4Q8VA 2DT2A 3QXBA 3KWXA 4OIFA 3WLKX 1K6WA 3EEGA 5D09A 3M16A 3HG3A 2NX3A 5IFPA 1RUSA 3H2MA 3LHWA 3VE7A 4MY1A 1GYMA 5J04A 4NAEB 2PE4A 5TF0A 4JNYA 1H49A 1OCQA 2P10A 4XIAA 2DQWA 2J88A 3W0KA 1B4EA 1K4GA 4IWWA 5F2MA 2WNNA 2HDJA 3AXMA 3HG4A 2DZSA 4QNEA 3SI9A 3GG7A 2GDVA 2QULA 4HHPA 1LP6A 3WLNA 1OFOA 1YQ2A 3K30A 4TV6A 1M7XA 4DAFA 2HE5A 2ZFAA 3GKFA 4QM1A 2VQTA 2UV8G 3H22A 5TNVA 4QJ5B 1SR0A 2YDRA 4Y8FA 4MY8A 4URIA 1LG2A 4JQ4A 4YTTA 3MQTA 3IS4A 4KWVA 3F5LA 1OYCA 2QT3A 3W76A 3H7RA 1LTDA 6XIMA 1EPVA 4XV0A 5HXMA 4LUJA 5LIUX 4C6KA 3RPTA 4S3JA 4LCRA 2ONEA 3G3DA 4ZOEA 1EF2A 3RO8A 3ATZA 1HO4A 1HVQA 1PHQA 4FEZA 1GOWA 3N19B 3CV1A 3ARXA 1QJWA 1UKSA 1WZLA 2G96A 3EWXA 3SRFA 3RR4A 1VJSA 4F4RA 3USBA 2G4FA 3RUBL 1FA2A 4QJ4B 4F0KA 1M68A 1M7JA 3CWOX 4J3UA 2ZZ6A 4QTGA 3C0SA 4KEMA 1W0MA 1VIZA 2TRSA 3DG6A 4YVXA 3LLXA 4C6JA 4I8YA 3WY1A 2QLYA 3LCFA 4A35A 3QZAA 4IPPA 1PKYA 2POTA 3CHFA 4PSRA 3L5LA 4XQ6A 1J93A 5DX7A 2Q3OA 1ZHAA 4IXXA 3I4EA 4I6KA 4DJDA 5HATA 3O0KA 4RV8A 4LAKA 3PPHA 3F4NA 4KESA 1H7WA 1CXFA 1RXOB 3HA1A 3LU2A 1KV5A 3WLTA 3G1YA 4HK7A 1SFLA 2Z27A 1RSCA 1KR0A 1RQHA 3C2RA 4CCDA 1DORA 4DAIA 3CUZA 2D0FA 2E28A 1UZHA 1IR2A 1W1YA 3APGA 4R7OA 3W7LA 2XZ7A 1RP9A 3GG1A 4HNCA 5JMUA 3KZSA 2G3NA 1TZ9A 3DC8A 1TTQA 1W1A1 3H2AA 3SBFA 1Q85A 3PWGA 3TDFA 2A21A 3W02A 2PF0A 1US3A 3AOFA 3A13A 1ONRA 1WDRA 5CAHA 1OBAA 4W5ZA 1KLZA 1HG3A 5TBOA 3CIVA 5CC6A 5BNKA 2AL2A 1KW1A 4UNLA 3NQVA 1ZCOA 1XI3A 1TJ2A 1Q6QA 3WUEA 4W93A 2X0HA 4DM1A 4GGHA 5A6BA 3SCTA 1J2BA 4RX0A 1ZU8A 3ANVA 1LDCA 3QF0A 5G1MA 1I1XA 2CBUA 2A6NA 4EXQA 1ISYA 3VM5A 2GUBA 3QPZA 1ZQ5A 4GYFA 2ACSA 1UH4A 4K3ZA 2OYLA 2UBPC 1RVGA 5BU6A 2CZFA 1XPYA 1JDAA 4TV5A 2R14A 1I0BA 1XBVA 4M1RA 4BZYA 3CIXA 4FLSA 4M82A 3UG4A 3W2NA 2EKGA 4JL1A 3URNA 1O6IA 4GZEA 5E6ZA 3BOFA 2ZC8A 3EA3A 1XINA 1DWJM 2A7RA 2PTWA 3LHTA 4JN7A 3MMDA 1VLWA 1YNQA 2EG7A 1IZCA 2ATSA 4O0ZA 3VU2A 5PTDA 1YMYA 2I1OA 4L1XA 1C8VA 2ZX8A 3B4YA 4S3KA 1W2PA 3W7QA 1PCKA 5D9NA 4QE5A 2ACQA 3LQLA 3SY1A 1YX1A 1GVEA 4GKTA 3UJRA 2VFIA 2XYLA 2PD9A 1P7TB 3H24A 3N14A 4JICA 1YPIA 3EX4A 2XH4A 3CH0A 3ISIX 4O0QA 3LZ3A 2EF9A 5HDRA 5IFTA 4FO4A 1ML1A 1U5JA 3ZJ8A 1VEMA 2PGWA 4AIOA 1GHSA 2GGHA 3R58A 3LMZA 3AU6A 1LG1A 1J12A 1MRAA 1DIKA 4HHMA 4JQ1A 2EG6A 1EJ7L 4HYWA 3ERPA 1MMFA 4ZFCA 5KTLA 1V02E 1OF6A 2GGIA 2VEMA 2WMIB 1E43A 2ATMA 1NIUA 4IM4A 3Q37A 1XRSA 1XP3A 1I2OA 5AYYA 3S42A 4JPGA 3KCLA 2VC7A 4N9CA 4WDTA 2DPEA 3UJ2A 4W89A 2OODA 4Z1DA 1ALDA 1LLZA 2CLEA 5M2FX 2W79A 2V6AA 4MZ8A 2PFHA 3ABSA 1DTUA 4J3ZA 2OVLA 2J78A 2V82A 3H2FA 1EDGA 1FRBA 4RL3A 2V8ZA 3LCLA 4J27A 1EZWA 1F3EA 1L9WA 6TAAA 3UR2A 2VWTA 4CEXC 1RR2A 3V0SA 3FK4A 3GNNA 3P7YA 5C2CA 1TELA 3E49A 3T4WA 4HNUA 2R1KA 3KUMA 1J6PA 1UQZA 1LWIA 2O9RA 1BF6A 5AYXA 1E0UA 1RP8A 3HG5A 4IMAA 4KFOA 1TPH1 3LM3A 1CGVA 2VEPA 3SUUA 3CT7A 4OBRA 3WLMA 1IGWA 1JQVA 1KM3A 3GVRA 1CNVA 4HBKA 1TTIA 3PC0A 3CQIA 1IT0A 5G4EA 2E9BA 2GK1B 3W1NA 1NDZA 1Q45A 3FJNA 2ZRWA 4O16A 1JJKA 3O2LA 2VKZG 2HQAA 1VBJA 4C1NA 5AHEA 1TJPA 4QS5A 3BCJA 3ZLFA 1UUQA 3LZ5A 1DWGM 1QOQA 3AYVA 1XFBA 1X8FA 3K4WA 1A0EA 1RCQA 4XSMA 4ENLA 3VM7A 4C6QA 3CQJA 1ONEA 5U4NA 1JCYA 3QSTA 5DT5A 4K6AA 2XH0A 4BA0A 2BX7A 4DF1A 2GYIA 2FZNA 3LYEA 3VOJA 2PDQA 3K13A 4JGDA 1VFMA 1VLIA 4MJMA 3VGEA 4B4HA 1P4CA 5AZ1A 2WM1A 1DXFA 1QW7A 3Q2DA 2XIMA 1W3TA 3KX6A 4GO9A 4JDBA 1P6WA 4XSLA 3AISA 4M19A 3VNDA 5LXEA 3K8MA 4N6EA 1X8CA 2REQB 2NQLA 4JOMA 2YBUA 4PB3A 3WNKA 1QPKA 1YNPA 5HNTA 3NWRA 2W9MA 4ATDA 2HROA 1ZP4A 5BCAA 4C6MA 3VGBA 1LOSA 2DT3A 1UD5A 1H2JA 3P2VA 5HR7A 1MNZA 3SCOA 4HB7A 1M01A 4MKNA 2BNJA 3E5PA 1BFNA 1P43A 1VB9A 4O4VA 1CB7B 1ODUA 4P8UA 1T5AA 6PTDA 3ZJ7A 1CGTA 1VP5A 1R3VA 1JZ2A 2P76A 3NSNA 1U22A 2VYOA 4LAUA 3HJEA 1V3JA 1XCXA 3RLVA 4HP5A 4PTMA 2J7HA 4AEEA 5GJPA 3KTXA 4LVFA 3W6LA 4FLRA 1I6NA 2YDQA 4QQ3A 4UXDA 4ZCWA 2XWEA 2DW6A 3UGVA 2QJGA 5BRPA 3N29A 2Y88A 1PDYA 2HBXA 1P48A 2D0HA 3HTWA 2E77A 1Q13A 4KW2A 4XIMA 4D72A 3LTYA 2R6OA 2FZ9A 3G8RA 1MZRA 2VELA 1H7PA 1B9ZA 3B8TA 3NO5A 3RM8A 3VX0A 2HK1A 5AC7A 1YADA 2OZTA 4O13A 4RZ6A 2DZVA 5I06A 4MFEA 2ZTKA 4B15A 3WSUA 3SCRA 3OVGA 2NLIA 4JY8A 3VD3A 4W9TA 2W27A 5IHRA 3MUIA 4RNIA 3VKDA 3T05A 5LNUA 1TA3A 3M5YA 1WKEA 1D9EA 3M0MA 3T0DA 5I77A 2Z7KA 4LVBA 1U2YA 2CLKA 2Y70A 4IF2A 1ECEA 4NJHA 4MUZA 1EP1A 3FN9A 4Y90A 1A5AA 4AHQA 4ZTXA 4UBPC 4OU1A 3W82A 4H7ZA 1JDCA 3AIWA 4ATLA 1KFCA 3P84A 3O6YX 4XD6A 3IJDA 1FHVA 4O1AA 3TTQA 3BZGA 1SMAA 4JFWA 1V0LA 3KTSA 4ZO8A 4PYSA 3S1WA 5FEWA 4V27A 1MUMA 2Z1KA 4EANA 4H9YA 1PE1A 2Y63A 2H9AB 1SJAA 1A0CA 5DT7A 3A3XA 4CD4A 2DV0A 3E1F1 4DWDA 4LUIA 1Z3NA 4O4WA 2D2JA 5DY2A 5DRCA 1E6NA 4IGSA 4MOZA 3THUA 1UJQA 3OTRA 3ME3A 5DMMA 4OGZA 4NI3A 1JCJA 1XLCA 4I9JA 1BTCA 2ZE0A 1VRXA 2WXDM 2WVTA 4OWGA 2FTWA 1AG1O 1TWWA 1I2NA 3WNPA 5HWNA 1VIWA 3N73A 3WF3A 1I1WA 3NUKA 3W1TA 2D73A 1TRDA 1GVFA 5I0DA 2UZ9A 3CBWA 5F2GA 3EB2A 3UBPC 2HXTA 5BXTA 1NH6A 1E1FA 1TVPA 1EQPA 5HINA 3VO0A 2C1IA 3CB3A 3HQ1A 1UR1A 1VBRA 3WMBA 4MNKA 5K4ZA 3R6IA 1VFHA 1H7OA 1DQWA 4EWJA 3OZPA 4GK8A 1GQIA 3WK2A 3NM1A 4I5RA 4W87A 3GYEA 4ZOBA 5HR6A 5LNWA 3TMLA 2EKCA 4C6OA 9XIMA 1ZY9A 1PPIA 3VNLA 4KETA 1UR0A 2ZADA 1VF8A 1LQ2A 3A64A 2A3HA 5CSYA 1K8CA 2WJEA 1MW0A 4AX7A 2EXOA 4JIEA 1OT2A 1XV8A 5K2ZA 3E96A 4W7VA 1WXJA 3PPGA 1AFSA 1XF0A 2E6AA 3GQYA 2G0WA 3PUDA 3MMWA 2GPTA 3QLLA 4WDUA 3TW9A 2ZZ3A 4NNAA 3W74A 4QITA 3TLQA 1CDGA 1XLIA 5A6MA 3LCXA 1M53A 4O1EA 2VGFA 3BOLA 4FZIA 1W37A 1EOMA 4INFA 3APTA 1RV8A 4LAOA 3H7VA 5M17A 3S5SA 5EL1A 3BL3A 2XFYA 1E0XA 4EACA 4MPQA 4LUSB 2WM0A 2VRJA 2DDXA 3W53A 3MBFA 3MSDA 3IJLA 4IJRA 2C18A 3RITA 1AA1B 5E6YA 3KDNA 2O7SA 1T7LA 4NF7A 3W25A 4S1FA 3R4IA 4ICMA 5DF0A 4Q4QA 3KTCA 3CMGA 2XVKA 4GY7A 2AKZA 4BQ3A 1H60A 3QMSA 3THQA 3F1QA 1CT5A 5HJLA 3VUPA 3BW3A 4Q7BA 3MDWA 4OUEA 3L68A 4LCSA 3B0PA 1OT1A 4JL2A 1GWJA 4L6HA 1EO7A 3WZ0E 2YBTA 1UWIA 2DUZA 1LOQA 3AIQA 3SIZA 1DIOA 1KRAC 4FALA 3MB9A 1MEIA 4FOKA 4IPIA 1UH2A 3SGZA 4HPNA 2QPUA 5GPRA 3R13A 4A29A 4W85A 2L5HA 1QWKA 4QAIA 4L65A 2FH6A 3OBKA 2V5CA 1WKYA 5DBTA 3B9EA 3G3MA 3QSRA