3H2NA

Structural studies of pterin-based inhibitors of dihydropteroate synthase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
273
structure length
265
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFGSYNEVDAAVRHAKEMRDEGAHIIDIGGESTRVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Dihydropteroate synthase
publication title Structural studies of pterin-based inhibitors of dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis str. a2012
total genus 92
structure length 265
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3h2nA00
3V5OA 3NOYA 4DAIA 4O0QA 2DZBA 3TYBA 1Q7QA 3TYCA 1TX2A 2Y0FA 2Y5SA 4S3FA 3H23A 2DZAA 4S3EA 3TZNA 3K13A 4S3CA 1F6YA 4NILA 2OGYA 3TYAA 4NIRA 1Q8AA 4DJED 3H2FA 4O1EA 1Q7MA 4S3DA 4DJFC 2DQWA 4HB7A 4DB7A 1AD4A 4CCZA 4DAFA 2Y5JA 3TR9A 3TYEA 4D8AA 1TX0A 3MCNA 4MWAE 4D8ZA 2YCKX 3MCMA 3TYUA 4D9PA 1AJZA 2BMBA 3H2CA 1TWSA 1EYEA 3H22A 3TYZA 1TWWA 2VP8A 1AJ2A 3H2NA 3BOFA 2H9AB 4NL1A 4DJDC 1Q85A 1AD1A 4DJFA 1Q8JA 4S38A 3H26A 2E7FA 2H9AA 3H2EA 4NHVA 4O1FA 3TYDA 4C1NB 4DJFD 4S3AA 4MWAB 4C1NA 4S3BA 2YCLB 4MWAC 2VEFA 3H21A 2VEGA 3H2AA 4MWAA 4S23A 2YCJA 4DJDA 4S39A 2YCLA 1TWZA 1Q7ZA 4MWAD 4DJEC 3MCOA 4DJDD 3H2MA 4DJEA 3BOLA 3H2OA 3H24A 4PZVA 1AJ0A 2YCIX 3TZFA 4G9PA 5JQ9A
chains in the Genus database with same CATH superfamily
1TELA 4NNAA 2YBVA 1GW1A 4FX6M 2DZBA 3S5NA 3SR7A 3W28A 3WCZA 1YLVA 3PUOA 1EIXA 2V38A 4FF7A 3WF3A 3PG8A 3GY1A 2XIOA 4QG8A 2WLYA 1XYLA 4A8IA 1XM3A 1ICSA 3V1HA 4ZQMA 3HZ3A 5D9NA 1TPDA 3TSDA 3AU2A 3A9IA 2YL6A 3EOUA 1C91A 4WHBA 2ACUA 1JPMA 2YGYA 3W84A 3EDEA 4QEHA 1EUNA 3HTWA 1M53A 3UD6A 3VIPA 4XD4A 3ME3A 3KWSA 4H2CA 4Z1YA 1OBAA 5AVHA 3WD4A 4AF0B 3TONA 4KWSA 3GNOA 3U5UA 4NT0A 1Z41A 3VNKA 2PWVA 3GKFA 2BDQA 4YXGA 2AQVA 3C5QA 1YDNA 3WYZA 4FK9A 1QRQA 2HTMA 3FX4A 1IR1A 4O11A 4RDZA 4NJJA 3FKRA 3K30A 4PB4A 1KBKA 3K2GA 1XDMA 3LOTA 4BZYA 2WSKA 3BH4A 3PBGA 3T78A 1OZQA 3OLIA 1Z48A 4FXFA 3PJWA 1JDFA 4QJ1A 5A8GA 5TBOA 4JN7A 3UQNA 1RH9A 2VFDA 4UQAA 3F4WA 3VTRA 1J0ZA 1RHCA 2BY1A 1XLIA 2YR1A 5I00A 2IXVA 3OQEA 5AC8A 1UIPA 4PL1A 4BF9A 3GUGA 2BX7A 4EX4A 3GXIA 1ZP4A 3LSBA 3R58A 2CESA 1CXIA 1AW2A 1KCKA 4IGMA 2X1RA 4XVDA 3AXXA 1MYRA 2XZ7A 4O0ZA 1P0EA 3Q65A 4P8XA 1SGJA 2EPMX 4UTWC 3RAOA 2D2OA 3DG7A 2JF6A 3WSUA 2FYMA 3GG1A 1ML1A 1LBLA 1X97A 1K7FA 4L9XA 1TYGA 3LPGA 1B1YA 3TC3A 4WSKA 1W9VA 3Q94A 4OUEA 1ZB5A 3MMUA 3CLMA 4QJ5B 4BQ4A 3NZGA 1BFNA 4H8UA 1YE4A 1GK8A 1I2OA 3DGBA 3E49A 4MLJA 2WSQA 1DPMA 3H21A 5HA7A 5FEZA 2YBTA 1V3KA 3FHQA 3L66A 3EEGA 1VHCA 5BXPA 4I5XA 3BLLA 5CQ1A 1HIZA 2GVJA 1YNPA 2XN1A 3TZFA 1L6GA 5F2GA 2NUXA 2FMNA 1ZBKA 1LRQA 1UKQA 3G1DA 2QMKA 3IGSA 1W5NA 3VX0A 3U57A 2EPNA 3GVWA 2AMGA 3UJSA 3WEOA 2IPWA 4JXCA 2VUNA 1SUXA 3HPAA 4JIQA 3QYQA 2C19A 4PC8A 4FOKA 3ANYA 3I3DA 3CU2A 3I3EA 4LS0A 1KCZA 4GC4A 1FP8A 4KT2A 2XTKA 3GDKA 1V77A 2PBOA 1QTWA 2O0TA 3S2LA 1UOKA 1BWLA 1E0TA 3W83A 4NZCA 4JDBA 3K1DA 3S1GA 2P5NA 2X2GA 4L4MA 4PTVA 2PP3A 1AQMA 2CZFA 3PTQA 1VYRA 3CQJA 4GA8A 4DBDA 3S0CA 1BG4A 4PCFA 2FTPA 4PB5A 4REQB 1MRAA 4NJHA 5KINA 4MB4A 5D33A 3UZXA 3NO1A 3HPSA 4NVTA 1QOPA 1OHLA 4RZ4A 3W71A 4ZVJA 5D9PA 2ZVIA 3QRHA 1RCQA 2ON3A 1BYCA 1UG6A 4K39A 4I8YA 3B97A 4IUOA 2TRSA 2PTXA 3PWAA 1WOBA 3LGGA 3SEPA 3RM9A 3PK7A 1N82A 2WJDA 4KRUA 5CC5A 3WLLA 3O2LA 1Q4NX 4K37A 4YL2A 4QEEA 1YXYA 1DJXA 5JQ9A 1KQYA 4UFJA 5DEZA 4DAIA 1LUCB 3MVIA 4AD4A 4MMWA 1JD7A 1PS9A 4IZGA 4PMXA 2WXDM 3V16A 5CCZA 1JCJA 2WOQA 1UZHA 1Z42A 2F6KA 5CPLA 3T8QA 4CN1A 3HG3A 1CENA 3IK2A 4E0CA 3L12A 1Q4WA 3NJ3A 3UG8A 1HJVA 5FJJA 4NQ1A 1SFJA 1JAKA 4DXXA 1PPIA 4ZODA 3GU2A 5DRIA 3WJWA 5HWNA 1VYSX 1UCWA 3IJ6A 4AYSA 2GUYA 1XQLA 3LHZA 2Q6ZA 1LBFA 3PPHA 2E6FA 3BJFA 1V02E 3IVUA 4L7ZA 4NASA 3WBWA 4BI6A 3T42A 3VKKA 2OSWA 1X8FA 3VGEA 1DJIA 2FZ9A 4UCFA 3H53A 1O68A 1IEIA 4KEVA 2BXZA 3HG5A 2PWGA 4MAZA 3MV01 1CZ1A 1VJIA 4UR8A 1SFSA 3SUVA 4UR7A 4JEJA 3G1YA 4Y9NA 1MQRA 4HCHA 1A5AA 4OFCA 2Y89A 1MQPA 1TUXA 1UZDA 4H7CA 1TWZA 3O63A 5BCAA 3EOOA 4GIYA 1NDZA 3KL3A 3PBUA 3IGXA 2O7QA 3JU2A 4X0VA 4E3VA 4UFLA 3AROA 1R2TA 1AQ0A 4O17A 1CGTA 4WY0B 4PRWA 2DZVA 4Y7EA 2RFGA 1XYZA 1P48A 3WO8A 5C2XA 3B06A 3WLPA 2ZKMX 2ADAA 4HD5A 4C6BA 1AW5A 4AZ5A 5EMUA 1CI1A 4TTUA 1D2KA 3VYLA 4DBUA 4WR3A 4PTNA 1D9EA 3BLKA 4JTDA 3NA8A 3S47A 2EKCA 2Z2AA 1EUAA 1TIMA 5A2CA 2V82A 1J2WA 1E4IA 2X1SA 1ADDA 2BSLA 5I03A 3TOYA 2OKOA 4AXNA 3QC0A 1QK2A 1DWHM 4FX8A 4LUYA 2I5QA 4O1FA 1RA5A 3VGFA 3OIXA 3LRMA 3TWAA 5EMYA 2CLEA 3W7NA 5G5IA 4JS3A 4XD6A 5BU6A 3LXCA 1WDSA 5G4EA 5DXYA 1W3IA 4QJ3B 3WQGA 3UVAA 3NIYA 3IGHX 4XAPA 1XSJA 3SBFA 3PBYA 4NAFA 3DHUA 2P50A 4C5YA 4HA4A 1EO7A 3OBKA 3HA1A 3JW7A 2NSXA 6ENLA 1MMFA 2H3BA 1KGWA 2YJQA 4PCNA 3DHFA 3SN4A 3EOLA 3P2VA 2HS6A 2BVDA 2WMIA 2Y5SA 2CNCA 5A8MA 3CUFA 1RY8A 1NY1A 1ISWA 1F76A 4JKMA 1E0VA 3QW3A 1EJSC 2HDJA 3RLUA 4MFDA 3AC0A 3OTRA 4MM1A 3GAYA 1IQ8A 1PIFA 3LMZA 3AHTA 4JTCA 4LFYA 4W7WA 2X16A 2J6VA 4W8AA 2ATSA 4LJ3A 3UZJA 5LA0A 3GFYA 3THQA 1KKRA 3EXSA 2PDYA 2BVYA 1P6WA 2UWFA 3FXYA 2J7DA 3II1A 3GH4A 2H9AB 2VYOA 1MO0A 2DU2A 3CMJA 5XIAA 1DYSA 2O4QA 4UFKA 3SCOA 1ZU8A 2PD5A 4NXKA 2ZX5A 4C6LA 2OELA 3G6LA 2XH4A 3AXHA 3ZVHA 2CLIA 4IHCA 1J96A 2ACRA 3A3XA 4IP4A 5CPNA 1OABA 2AAAA 2DY3A 2QCHA 1FDYA 2XGZA 4DJEC 2OQHA 3WJSA 4DJEA 5C9UA 3F2BA 1K03A 3C4UA 1W9PA 2XFFA 3PBWA 3T4WA 4M7TA 3BZJA 4GBUA 4XQ6A 1N55A 1HTIA 1S2VA 2YDSA 4MNJA 4ZE5A 1J2BA 3ZQ9A 9RUBA 1C90A 4U5KA 4GKTA 1BXBA 3CPGA 1GZ1A 1KBBA 3UERA 3M5XA 4MB5A 4GY0A 1XUZA 4JTUA 3P60A 3TN6A 1UC4A 1X8CA 4AB4A 2Y70A 4F3HA 5B80A 4U28A 2RGMA 2Y61A 4IXXA 3VOGA 3DUGA 1OGSA 3GHUA 4EF8A 3S6DA 5IHSA 1YTDA 2ZRXA 3BMWA 3CIWA 2PU0A 4GX8A 4NY2A 5CJNA 4C6DA 3L2LA 4ZQRA 4HNCA 3E96A 3BAWA 3PHAA 5BOFA 1KFLA 2JQXA 3BQ6A 4EF9A 3B8WA 3ZLGA 4K2SA 1S38A 4Q7BA 3WEZA 1XSKA 1HX0A 3IV3A 3KOXA 3BLIA 4JQAA 2WV8A 1A3HA 1TZ7A 5A8NA 4OTKA 1F3XA 1EQPA 2FHBA 2V69A 3VD4A 8XIAA 3OGVA 4KCTA 3MSGA 1QI0A 1KRAC 4B9ZA 1GT8A 1JFHA 5F4SA 2HVMA 3P7YA 5D03A 2GGJA 3U0HA 1H09A 1VRXA 5ABFA 3G1HA 1H1NA 3H2AA 3M0LA 3NG3A 5FJRA 2HQAA 3QZ6A 4MAVA 1A5LC 1K8CA 2YIHA 1Q7ZA 1CXKA 1KRMA 2ATMA 1GYLA 1LG2A 1WOAA 4W4QA 1UP0A 5IBXC 1CTNA 1FBAA 3BXWA 5IBXA 1QI3A 3T0TA 4GXMA 5HNNA 4CN4A 3ARUA 3C0LA 1AODA 3PZUA 1WDPA 5HATA 4UTMA 3H23A 3N4EA 2FZ8A 3KW3A 4S3CA 4RPPA 2PDQA 3TVAA 3N73A 1ZALA 4QAWA 2EBNA 1EDTA 2REQA 4XKMA 1AMKA 3WLTA 4NX0A 2D2JA 1Z3NA 1JIBA 4DBWA 2ZRZA 3MUAA 3FOKA 1QHPA 3KOYA 2TSYA 2OEJA 3CV1A 4L1GA 1OG0A 4JIIX 3WQOA 4NJIA 1RD6A 2PLMA 3CIXA 2VZTA 1TPUA 1TMLA 3IK4A 3BW2A 5A3HA 2PS2A 1WE5A 3BSGA 3MI2A 1W1A1 3BPWA 1C8VA 3UVIA 3D3AA 5AB3A 3VDCA 1AQHA 4ZTXA 4N4PA 4OT7A 3EWZA 1DTUA 2ODOA 2YCLA 1R2RA 2FKPA 4HYRA 4A29A 4FA3A 4ADSA 4GI4A 4UQBA 2V5JA 1GVRA 1ZJBA 2ESCA 2J7BA 4OBTA 3V18A 1EXPA 3GYEA 4NJKA 3AYTA 3U2EA 2QNEA 3DFTA 1AW1A 1B3ZA 4LAZA 1DWGM 2CHOA 4LANA 2DZAA 2W61A 3BAYA 1QWGA 1XKYA 3QV9A 5LGXA 1SO5A 2DIKA 3NEHA 5I3GA 2JGYA 1F61A 4QBXA 4PODA 1Q7MA 2IKHA 2VJXA 1QVBA 3A4AA 3VCNA 3S9IA 4GK8A 3MUY1 3GB6A 3GNXA 4DPPA 3DC0A 5CKSA 3UJFA 1H1YA 3CXOA 2PDWA 2Y62A 3UWEA 4DWSD 2WPGA 1BTMA 3EA1A 3EX3A 2V81A 1MW0A 2ZVRA 3ITCA 4ICCX 3AICA 5LNWA 5KMYA 3S8HA 2PP1A 5GVJA 4UR9A 3N2TA 3TC7A 3WMBA 3M7WA 3GTHA 4HMNA 2ZYFA 4B4HA 5D9OA 3ES8A 4DZ5A 2E5CA 2H8ZA 1O60A 4QGCA 3MMDA 1BKHA 4DQWA 2PC8A 4O50A 3N9SA 2VDIA 1A80A 1IE7C 2ZZ1A 2QPUA 1FKXA 5TIMA 2E09A 3TJIA 3PY2A 1QNVA 5MHBA 3FJNA 2ISVA 1V02A 1GYMA 4ZQNA 1ZAHA 4IIHA 1C29A 4QCFA 2OR2A 3ZWSA 1GVSA 4O15A 2H6RA 4LYKA 5KEZA 4UFIA 3SCSA 2UV8G 3SB0A 1H7XA 3S5YA 2WWDA 1ODZA 1ZUAX 4FNPA 1NDVA 5BWFA 4Q7IA 7A3HA 1Q6GA 2DZXA 5CZ0A 2J77A 3PP7A 3WLMA 1PZ1A 2B7OA 3UZ5A 3FAWA 5D38A 3T05A 1KM1A 2OT0A 3QV7A 4GY7A 4JR5A 2XIBA 4G2DA 4Z17A 2QCEA 1QPNA 2G5WA 2HPMA 4PRTA 4UTTC 1D3HA 3OYZA 1E9YB 3UJ2A 2HXTA 4DI8A 4JX6A 1HKWA 5DO8A 4QE1A 1W0MA 3CUIA 4K1GA 2WHMA 1X6LA 3G8EA 2X40A 3PZTA 2PGFA 4G7EB 1S46A 3Q4DA 1Z89A 2J24A 4EXAA 1L6SA 3QH2A 4ROQA 4WEVX 2DUXA 3H22A 3BMVA 3S2JA 1C92A 3AYVA 5ECUA 5AC4A 3GFXA 4UQEA 1E6ZA 1F3EA 2OX1A 5MKGA 2ZBTA 1HQTA 3HGOA 1EP1A 1N8FA 3BTNA 4XTDA 3TLLA 1J5TA 1ZRQA 3WG6A 5FIPA 3UFYA 4PCTA 2ZQ0A 3B8TA 3UG4A 2BGSA 4CD7A 4NNBA 1OJXA 2V5KA 3CL6A 1LF1A 2QYGA 3HG4A 4M6QA 5EFFA 2BXYA 4PH6A 4AEOA 2DV0A 3G1VA 1FWIC 2WM1A 4EPEC 5A6BD 2ZZ3A 1JUKA 4ZQOA 3F03K 4N2YA 3GC4A 1XCFA 3LHVA 3WZ0E 1BVZA 1IF2A 2WZHA 3THUA 4ICMA 4GACA 4POCA 1THFD 3AZRA 4DY1A 2WJEA 4GCAA 1FHUA 3QC3A 1W3LA 1XI3A 3IIVA 3BK0A 4HN8A 2GGHA 4HBKA 4IPNB 1MUCA 3S4TA 3IJ8A 3MKVA 4M7SA 2OO0A 2H3DA 1SW7A 3WENA 2JIWA 4IG2B 3N17A 2JK2A 3GTIA 4DEFA 1K8ZA 2XVNA 4H41A 3SCUA 2GSEA 3BJSA 3CZEA 5HDRA 1UROA 2NV9A 4I7WA 5EMMA 2FPVA 1QO2A 2YW4A 2OZ3A 1MI3A 1MXSA 3EX2A 2VVSA 5FJTA 2C15A 1GKRA 4PCPA 1DWIM 4LW7A 4MKSA 3ITXA 3N9RA 1P0BA 2FTWA 4GJIA 4D2JA 1UD4A 4JPGA 1Z7AA 3KVJA 1UHVA 3NQVA 3VIKA 3V5CA 2VOMA 4B4FA 4WDXA 1WDRA 3UJRA 4LUTA 2DJLA 3LPPA 1UD5A 1BVWA 2YX0A 4TUFA 3G1FA 4L4PA 2IQDA 3MP5A 2XN2A 4KFOA 2DT2A 4Z1AA 4XZWA 3A4JA 4W7UA 1WNOA 4O0QA 3IIOA 4PUEA 1UKOA 3LGDA 2A7NA 2GJNA 3SSJA 3OO2A 2GJRA 3LQLA 2CXGA 3GU9A 4WSHA 1JPHA 5GNXA 3M0JA 4XKYB 3KVMA 3AQUA 9CGTA 1G7VA 3LBOA 4IFKB 3VIIA 4ZQPA 4DJED 1XDLA 4M80A 4F0LA 1OIMA 3CH9A 4MSSA 3WL0A 3SCWA 5AZ0A 4EPDC 2O55A 3V0SA 4H9TA 4F0SA 1NVMA 2L5HA 3OLDA 4PL2A 3W81A 1LQ0A 3FVDA 3PNZA 1AJ2A 2TODA 2RDTA 5I0DA 3LB0A 2E67A 4DJFA 2WBKA 3QR0A 1G6CA 3W27A 1GEHA 3KBSA 1H5YA 2WC3A 4IUGA 2YYUA 4MKVA 5AYBA 2G8ZA 4LY8A 3BMXA 1L6WA 2POZA 1Z8AA 4L65A 2INFA 4UNIA 4XK2A 2XUCA 4NZJA 5T8GA 4L56A 4TOQA 3LDVA 4L1WA 4CUCA 1JPIA 2JE8A 3OU8A 1RBAA 1FWBC 1TTJA 3BCJA 3C86A 2V3DA 3GIQA 4CCCA 1JGIA 1HGWA 2OU4A 5J5DA 2XSBA 3OOQA 4C6PA 4Q4SA 3TYBA 1CGXA 1R5YA 2WO5A 2G41A 3SSZA 3U6WA 3VINA 1H62A 3K4DA 1V0NA 2Y63A 2Q02A 4DXKA 1OB0A 1W2VA 3WMCA 4C6OA 4LT9A 2QV5A 3U7VA 4DVOA 5CC3A 1AZ2A 4EVZA 1VFTA 1OT2A 4QRNA 3T1GA 3UT0A 1JZ5A 5D09A 1N2VA 1XIIA 3WLHA 4BQ5A 3VKBA 4PUDA 8RUCA 2OVLA 4CVWA 2I16A 5E5CA 2WVVB 4S2BA 5D8WA 3C61A 1KGUA 3JR2A 5TD4A 3OQ8A 3SECA 1EF3A 3BLDA 2NWSA 3CNYA 4ZR8A 3LD5A 1SJAA 1DQXA 1O5KA 3FLUA 4G1KA 3W7MA 1HO4A 1EDQA 3V0UA 3AIEA 2PTWA 2BHYA 2R14A 4IQDA 4MFEA 4OWGA 4K7VA 5TAOA 4BFAA 1UZ4A 3RLVA 2OZ0A 1PX3A 4MJMA 2EKGA 4C65A 3VGHA 1IV8A 1ZGDA 5F2LA 5FESA 1FRBA 3PZVA 4NAEA 3UPBA 1DIKA 5AN7A 3VOIA 1GKQA 2V30A 5HNTA 1EXBA 3LG3A 1H7NA 1FXQA 3OVRA 4M6VA 4V33A 4AC7C 3U4AA 2YL8A 4QQUA 3TQVA 4JFUA 2Y24A 3W1PA 1YDVA 5GJMA 3SQLA 1W56A 1UQYA 4WGXA 3OW1A 3OVQA 6REQA 5HQEA 5G2HA 4HZMA 3KWXA 1G4PA 3DGRA 4UXDA 4R53A 1SSDA 2WKJA 3OZPA 3OLGA 3WQ4A 3QQ1A 1O5QA 2QCFA 3L2IA 3EMCA 5HINA 4Q4OA 3GFZA 4QE4A 3G1AA 4HA3A 3FSTA 2WMGA 4LGXA 2Z2UA 4CNOA 5E1QA 1TPFA 1TVPA 3RLHA 3W7DA 3WK0A 1FWDC 2VC5A 2VP8A 1TQJA 5H2ZA 1KM0A 4BF7A 4FNSA 4IJRA 3LSCA 3W87A 5H8MA 1UD8A 3F7JA 4YLWA 4LC6A 5CAHA 5HQLA 1EOKA 3PN8A 3E6EA 2QF7A 3PAJA 1LLZA 5G1TA 1XLDA 3TN3A 2IKIA 3GXPA 3UY7A 2INZA 3QOMA 3F2DA 3SDOA 3GYCA 2PE4A 3E0VA 4PBFA 3TUUA 2WKLA 2QCDB 3QYSA 2DW6A 5D2VA 1F74A 1B3YA 1XRSA 3W88A 3TAKA 1F3TA 2NWRA 3V5FA 1AH3A 4G5DA 2QJNA 4LF1A 1YBQA 2NW0A 4NZFA 3NOYA 4UTJA 1A5MC 3LCFA 1W9XA 5HPCA 2DDXA 1VHNA 4CVUA 3TYCA 4NF7A 1HKJA 4GE8A 1MZRA 4NNCA 3SRHA 1P7TB 4TQTA 5E09A 1KTCA 1X38A 2BB0A 3HB9A 2HE8A 1ZNNA 2BP1A 3SY8A 1JQXA 2V63A 1GQLA 1MUWA 2GDQA 3N13A 3HF3A 1H4PA 4D6CA 4IP7A 3BG3A 2DZUA 1XD0A 2ACSA 3PFRA 3SW6A 5K2ZA 5CSSA 5GQBA 2BMBA 2BHUA 3UR7A 2CBVA 1J18A 2YKKA 2BNJA 1VLIA 2D3LA 4AF0A 2H8XA 2DFAA 2EQDA 2CLFA 2J78A 1WUEA 2CLHA 1KV5A 1POJA 2PCEA 3CTLA 3QGKC 2VCAA 3RNDA 3U2ZA 2ZUSA 1XCXA 3ZJKA 1OCBA 4LNYA 4AISA 2X1TA 2ZE3A 1WAWA 3DFQA 4XIAA 1EKOA 3S3GA 4P61A 3NSXA 1K8XA 1LWIA 1BYBA 4EANA 4XAFA 5D2YA 1JDDA 1O66A 5LNUA 3MTWA 4NYUA 1AG1O 3WNMA 1XLLA 1KR1A 2XWEA 3MB9A 4MPQA 1XRVA 2WMJA 2WSRA 2INEA 1UD3A 1KTBA 2O9RA 3ZR6A 2DUZA 1KM4A 4N9DA 2RDUA 2W27A 3W07A 4K38A 4P7OA 3KRUA 3HM7A 1QPOA 4QS6A 3RCNA 1EDGA 1XC4A 3KZPA 4FEZA 4Z2IA 2POTA 4QDWA 1W91A 5I3DA 3SRKA 1XLKA 2V5LA 3GW3A 3VNDA 1J6PA 2B7NA 4JYFA 4MY9A 4QLLA 3BQ5A 1GTEA 1OSEA 2DT3A 4H8HA 3EPNA 2WVSA 2OG9A 1Y0EA 4XAGA 4BY3A 1EB3A 2Z24A 4NZ4A 3DYMA 3VGBA 1PZ3A 1VBGA 4QJ4B 3LGEA 2HEJA 4O52A 3E12A 3W37A 1DL3A 4BQ2A 3WDQA 1OYAA 4M3PA 4GWEA 7TIMA 4ATWA 4Q3MA 3G0UA 3WH9A 5AC5A 3EWXA 1KRCC 3EDFA 4OBSA 1E6NA 4A2RA 3SCVA 3EOEA 3GH7A 4IPPA 3XINA 2FFIA 3C2EA 1XIMA 2XSXA 4JY9A 4LCRA 2NX3A 3DHDA 3HJZA 2NQ5A 3TROA 4D1IA 3UZZA 1P0DA 1W6TA 1XWYA 3IS4A 1HKMA 2NX9A 5MF5A 1TR9A 3ZT5A 4DO4A 5DBUA 1D8CA 3GXNA 2HVNA 5DF0A 2EG8A 1UH4A 3CO8A 2A3LA 4FMVA 3OZMA 4WVXA 3CS2A 4K7YA 4IPLA 3R8GA 3GDTA 4JKLA 4Q6JA 3VD3A 5LSMA 4A3YA 1GHRA 1JULA 1MZHA 1YQ2A 4CQ8A 4BWLC 2AQWA 1TV5A 2QCCA 1IEVA 3RU6A 2A3EA 1U1HA 4N7QA 2WKGA 2X42A 4DM2A 2EEXA 2IQ0A 3SCTA 2GGGA 3C2YA 3EZ4A 4DAFA 2NLIA 1JCMP 1TJ1A 4M29A 4AZCA 1TE1A 1E6XM 3BURA 3DKLA 3UW6A 1U1JA 5T91A 1ALDA 1XW8A 1TWWA 3RRAA 2J9YA 5AHEA 3TNOA 4ZFCA 3CB8A 1GQNA 1WDDA 2PLJA 5CBBA 1PL9A 5DFAA 3KE0A 3RHGA 2Y2WA 3VKAA 4REQA 4CNPA 4Y6GA 3TTQA 1PE1A 3W1XA 1FWNA 1QNRA 3CUHA 2HZGA 4LOCA 1EPXA 2GSJA 3LLXA 3FCPA 7XIMA 4MUZA 4S3KA 1N8IA 3GAKA 4RK8A 3VZXA 3LLFA 2J9ZA 1I75A 1L9WA 2JFEX 4OBRA 3L23A 1VP5A 2QUUA 2CPUA 2XWDA 3S6OA 5BYWA 2PTYA 1A3WA 2NZLA 4GISA 3PUGA 1C8QA 4Y8EA 2YFNA 1FHVA 1GPWA 4FXRA 1XRTA 1GQIA 2E8YA 3WBAA 3QHNA 1LUCA 2NXHA 5HOSA 3AMDA 4FLSA 2PDCA 3QSRA 1S5NA 4A3UA 1ECEA 4NILA 4QAIA 2OGYA 3FYOA 5M5DA 4KGLA 4R7JA 1E9LA 2WQPA 2YA1A 4XO6A 4LBRA 3WMSA 3LUTA 4DB7A 1AH0A 5GPRA 2ISSA 4JHMA 1K6AA 3A5FA 5CSYA 1S5TA 1TG7A 3GG8A 2V68A 3S2CA 4LH8A 5ABHA 1WKDA 4FNUA 1H0GA 5M17A 1AJZA 3IEBA 1WAUA 2RJGA 3M0KA 2A7PA 1H7PA 3G77A 4LCSA 2VQUA 4YVXA 4ACYA 4CNNA 4XIMA 4MNLA 4NAFB 5LIKX 3TA6A 1C9DA 3NPVA 1Q65A 1DTNA 2QIWA 2CIPA 2KX9A 2XFWA 1WBJA 1QHZA 3R0UA 4Z2JA 3W7IA 2Y7GA 1VEMA 1PKLA 4UIOA 4MWAB 5HAOA 3C8NA 1BGGA 1JAEA 3SADA 3RXZA 4LVFA 3FYYA 3CEUA 5F4XA 2CZVA 2PDGA 3I3BA 3FJ4A 3QMRA 4Z42C 5C9ZA 2EO7A 4KCWA 4O0KA 2P3EA 3M0IA 3MYPA 1XQKA 5DMYA 4J3SA 1HL8A 1RAKA 1U5HA 3WK1A 2CWNA 1P5BA 3QJAA 1J5SA 2Z1VA 4JTGA 2WZMA 3S46A 1KLYA 1YTEA 1I60A 3PZMA 1OX4B 1VRDA 3ENLA 3V0TA 1UR0A 5JIPA 3FIGA 1O1ZA 1W37A 3AUJA 3B8VA 1UR2A 2JALA 4XUGA 5LA1A 3O3RA 1Q13A 2OFJA 4WY0A 4I6VA 1UBSA 3STEA 1LOSA 4W5ZA 3GS6A 5CZTA 4ZO6A 2PDHA 3AIRA 4I90A 4RW3A 3IWPA 3CZ8A 5E70A 5HBFA 1V7YA 4ML9A 1E6PA 4D9PA 4JCLA 2E8ZA 2I14A 4F40A 2UY2A 1AL8A 1I9CB 4QIUA 3VMPA 4X22A 4CD5A 2PTDA 1CDGA 3T55A 2Z1BA 5BW6A 5U4NA 3ZZ1A 1XIBA 2ZZ2A 3NNTA 2H90A 3QF0A 4JTIA 4AY7A 3KFTA 1AK5A 4HYWA 1RA0A 2WMHA 1TPB1 1DWAM 2AOSA 1SM9A 3E74A 2QVHA 3WNLA 3N04A 4I6KA 1K9DA 1F4AA 1ZP3A 4ZBCA 3W7JA 3GDBA 3UYCA 4I3GA 1SJBA 2QJIA 3VZZA 5A2AA 3LNMA 2UY4A 3O9NA 2CLPA 2Q71A 1O5XA 3GU1A 4OV4A 4IX2A 1ITXA 2W3ZA 4GINA 1FQ0A 2F6UA 2WC4A 4CEUC 4QS5A 1KRBC 1MDLA 4GOAA 2VFGA 1BPLB 1TIWA 2W91A 3QSTA 2PURA 3U3HA 4PUUA 1CGWA 1U83A 1EZ2A 4FXJA 3IPWA 1OQFA 3MA8A 3OPSA 1W32A 3TDFA 3W75A 3QPZA 3NVDA 4ZO7A 3TLQA 3PTDA 1KXQA 5EPDA 2VL4A 2QF8A 2VFFA 1HZYA 1V7AA 3DDMA 4IIEA 2O9TA 5AZ1A 1TWSA 4W86A 5GJPA 3O8AA 4QISA 4HZ7A 3SRDA 2WNQA 2Z7KA 2E40A 3AMKA 1Q85A 2EPKX 1AD1A 2CHNA 1E9ZB 3MANA 4MOZA 4GVIA 1EHAA 1OZMA 1SMDA 2H9AA 3RMJA 3O1NA 1UASA 3CHEA 3LCIA 3OBEA 3VDGA 1R3YA 1RBLA 5FJUA 4EXBA 1WZAA 3B0PA 4HCLA 5LXEA 2QGHA 1G4SA 1FWTA 4L6HA 3AS0A 3C6CA 4IMAA 2R1KA 3B8UA 2VD9A 4KIRA 3H70A 2REQB 2V3FA 1EEPA 2YLAA 3WQ8A 2IW0A 1MDRA 1CECA 1NF7A 5C7HA 2YCIX 2PC4A 3UZYA 1AH4A 2GJPA 4N9EA 5DQPA 3AOFA 3QTPA 5CG0A 4E8CA 3OZYA 4KWWA 5CLTA 4WJ8A 4AWSA 3GNNA 2O9OA 1QASA 3WLNA 3HJEA 3VIFA 4YU1A 3VE9A 5GJNA 4NG3A 3AAMA 3H4XA 3U5YA 2A3BA 1H61A 1IXPA 3BOXA 3NQGA 1TPWA 2DQWA 1K9FA 4LVBA 3VVGA 3KBJA 1TWDA 3TYEA 2C18A 3CZLA 5CPTA 3PTKA 2IMRA 1FH7A 1Y5WA 3EX4A 3UR8A 4B92A 3UP8A 4KFPA 2VKZG 1O6IA 1EGMA 3TTEA 4PA8A 4B90A 1W1TA 6ALDA 4J3UA 3NM1A 5CSRA 1PVNA 1C93A 4HTBA 4JNYA 1V4YA 1BAGA 2C0AA 5I3JA 2Y8UA 1VIWA 1IXQA 3CPUA 2DPEA 2D24A 4KGJA 5KITA 4I7VA 2OT1A 3MBFA 3IJDA 2Y6ZA 1SQ7A 2ICSA 3IAQA 1O95A 1F8MA 1EGVA 1K9TA 2Z28A 1NFBA 1NJJA 5F7UA 3T4CA 1HP4A 4NZ5A 1O94A 4H9YA 3S1UA 1RUSA 2PDBA 4UMCA 1TR1A 3WQCA 4R27A 1TTQA 2R6OA 1EYWA 1OK4A 2V9DA 5DY3A 1AFSA 3NFUA 3DZ1A 1EZWA 4FR1A 1NTHA 3SIZA 3VI2A 3VDAA 3FJ6A 4GIEA 1W8GA 4U31A 2ZXAA 5JH1A 3AFBA 3CQ0A 2WLZA 4GUJA 2LLEA 4N42A 1H7OA 4MHBA 3R89A 1OD8A 1E0XA 4CCZA 2J66A 2OSXA 3GKAA 5M1TA 3KXQA 3CZJA 1J4EA 2ALRA 3QZEA 3VM5A 1UR8A 4I9JA 4IPJA 1EBGA 2PZ0A 3QZAA 3H2NA 1MEWA 1G69A 3CUJA 2GGIA 1RR2A 3EMQA 1QPRA 3HURA 1TWIA 4G8TA 3EWUA 3F4VA 1QMLA 2VEIA 4RXGA 4JTLA 3G1XA 2P1FA 3TK7A 5G4WA 4YN5A 1LZOA 3B8IA 4LS1A 2Z4GA 2PWHA 2X2YA 2VWSA 9XIMA 5CAKA 1LWJA 4WDWA 1SFLA 4LRSA 3MY9A 2ISDA 1IEQA 1M68A 1G01A 1TJRA 1H5VA 4D6HA 2BVTA 4B16A 3NL2A 3RYSA 4LYRA 3GDRA 3H12A 1W8SA 4PUNA 1ZTVA 4YTUA 5A2BA 3JZUA 1SZFA 2VX5A 3XISA 3BLOA 5A6SA 3N18A 3ISIX 4S3JA 3RMEA 2VC7A 4NRRA 2P8CA 4R88A 4PB3A 4UB9A 1YYAA 1M03A 1J10A 3WDIA 4TX8A 3MVTA 4F8XA 3UWZA 3NQAA 4KW2A 4G7FA 2OYKA 2PRLA 2QV4A 3ABZA 4YMZA 4C60A 2J88A 2E1WA 1L2QA 1FWEC 1NP2A 5KETA 2EPOA 1BYDA 3NDYA 1E1CB 1OYBA 5BROA 4LYPA 2WM0A 2WYSA 1AVAA 2ZXBA 5A69A 3ABQA 1WB0A 4GH3A 4RE0A 2EJAA 1BSLA 1MEIA 3HPZA 1VF8A 4NSBA 2QCLA 1YXDA 3CV2A 4WIWA 1T41A 1HKIA 2WHLA 5D32A 1MW1A 4INFA 3BSHA 3FS2A 4H6RA 3KUMA 1PCWA 3M0MA 1K7XA 2QEZA 1XINA 3F5JA 3WK3A 1BQGA 3PVFA 2J79A 5AECA 1PTAA 3V1PA 1UJPA 1QATA 3DXIA 5EBAA 5DT7A 1UA7A 4ZB2A 2X0YA 1R3TA 3MSRA 3W2LA 4F9DA 1UA3A 2P8BA 1ONRA 3GG7A 4WRHA 6PTDA 4TV5A 3VNZA 1TTPA 3NQ8A 2GQ8A 3N3MA 4FB7A 5IFTA 1ZBWA 4MVAA 3WL1A 2XN0A 5AHLA 1CBGA 3R43A 3GHRA 1V0KA 5BRPA 3UBPC 4UZUA 1KFJA 1XFCA 3AZSA 4FNTA 4GYJA 4C1LA 5HPOA 4FIRA 1JYXA 1KNWA 3O06A 4XISA 3LCGA 3DOPA 3GHSA 1UP3A 3HQNA 5C5YA 5FSDC 2F61A 3VKDA 4NUWA 4F0MA 4W85A 1OFDA 1CLXA 4KH2A 4X3ZA 1IYXA 3DI0A 2DQXA 2BY2A 1GTHA 2VGIA 2QUTA 5FSEC 2NV1A 1DE6A 1WZMA 4R9XA 1E43A 5HANA 4E3TA 3NGFA 1KM6A 5CGTA 2MUCA 1TRIA 1O12A 4UQ9A 4IMFA 3RK8A 4Q8VA 4H1ZA 4ONVA 5E0KA 1MXDA 3WH6A 2ZXDA 4J2PA 5C54A 4OJYA 1DQWA 3DC8A 2G3FA 1BWKA 1FWFC 2R24A 3VDHA 2HNEA 1W5QA 3FFSA 3DFNA 1ICPA 3I7RA 1V3HA 3L4VA 2YA2A 1CGVA 1K70A 2AAMA 1I2QA 4EOUA 3EBVA 4GIAA 1XICA 3VGGA 1RVGA 1XIGA 2WAGA 3ZT7A 2RAGA 3N34A 3A4WA 1HO1A 4H9XA 3W7QA 1VEOA 4IISA 3EX1A 4MGGA 2OKTA 5F2IA 3UCCA 7REQB 4LV9A 3H4WA 3K13A 2E28A 5I3HA 1XIFA 4O4VA 1LBMA 4OOZA 2QHAA 1UP2A 3L4XA 2NQLA 2PA6A 3LRKA 4C6JA 4JCMA 4QROA 2Q01A 4IMGA 3MCMA 1HJWA 4ADUA 3RX4A 4JIEA 4KETA 4A8LA 1KLZA 1GORA 3L67A 4JHOA 1WKYA 1ZFJA 2J13A 3ARXA 4RW5A 4WKHA 3GIYA 2A21A 2O9PA 4MY8A 2J9XA 1OCQA 3W22A 3W38A 5IM51 3ONBA 4FO4A 5XIMA 2TYSA 1CT5A 1DJHA 3TW7A 4JTQA 3SCQA 1ITQA 5LIXX 4NX5A 3BAJA 4JTAA 1V6TA 3WLQA 3AS3A 3DBPA 1WX0A 3FW6A 4U2ZA 3N29A 4GQRA 4LPCA 1QW7A 3S9ZA 5FA5A 1VZWA 4MNMA 4D6JA 2EGZA 3MMTA 1W1ZA 1TV7A 1FX6A 3B3DA 2VELA 2W0UA 3ZVIA 3OG3A 2YZRA 2G95A 4XZBA 3R94A 5AFDA 1GJPA 3AMLA 4GJJA 1LL6A 1JXJA 3MO4A 4E6MA 3INPA 3TKFA 4C6CA 3MWAA 1TJ0A 3MWCA 3PWGA 5D8ZA 1LP6A 3N12A 3W74A 4XKYA 2D0GA 3UXIA 3FAXA 5KTLA 1GVQA 1GVFA 3GTNA 4IH3A 2I9EA 3RO8A 3D0CA 4IFKA 4FLRA 2QCNA 3R4IA 4HVXA 1OD0A 1X7IA 2FZMA 5F4WA 4Q8WA 5AKQA 2UY5A 2V67A 3WEMA 1UD2A 3BG5A 3WFLA 2WZEA 2OEKA 4NAEB 2HPIA 4P5UA 4PR4A 1U22A 1R3SA 2PCQA 2NQ9A 3LENA 3VGDA 1GQJA 5D02A 4C1NB 1W3JA 5EA9A 3WD1A 4HNVA 1EJVC 1EH9A 2Z26A 4IMEA 2A7RA 2BVWA 1JDCA 3DEQA 5FL1A 3G3MA 4S23A 4O10A 3VKJA 1EGZA 1XF0A 1ODUA 1XIJA 1PEZA 3GNRA 1E71M 3N4AA 4DI9A 1GJWA 3SCRA 1E72M 1XGEA 4B5WA 4W5UA 4PGLA 3RN6A 2PUZA 5I09A 2OEMA 4Z2LA 1M65A 3GM8A 1XIHA 4GYPC 3BW3A 1S1PA 1GW9A 2PTZA 3LCLA 3PJXA 5BXRA 1R9ZA 2BHZA 3T07A 5J8LA 2QAFA 1VFOA 2RDWA 4DWSB 3VILA 2OOFA 4O18A 4Z0SA 3USZA 3TR9A 4MWAE 5DCDA 4EWND 1JI1A 3APTA 4LAUA 4UZSA 1NEYA 1JF5A 4DUOA 1EJ7L 1QPQA 2G4JA 4AIOA 3GRIA 3KRZA 2F38A 5D4YA 2WVVA 2WHJA 1B5TA 2CFFA 3F5LA 1X6UA 1UR4A 1LOQA 1R3RA 3AXKA 3H7RA 2VM8A 1YBQB 1H7RA 1MEHA 1LT7A 3B0XA 4JQ1A 3QR1A 1H7WA 2PGWA 4X9YA 3BCFA 2C0HA 4C1KA 4WXYA 4AIUA 1UIOA 4GGBA 3AHYA 2FVMA 5FJPA 1QXLA 1V0MA 3BV7A 3G24A 3W2NA 4KFNA 3EKZA 3BZGA 1PHWA 2Y85A 4LCQA 3E5PA 1S5WA 4Q4KA 5LGZA 4GYKA 2Z25A 3AS2A 1TPEA 4EE9A 2R8WA 5AHMA 5T9BG 4J27A 3HQ1A 4Y9MA 4MDOA 3EB2A 4AD5A 4CQDA 3NQBA 3BC9A 3ITLA 4X60A 3XIMA 5C9WA 4HP5A 4WXZA 1BF6A 4S3EA 4WOQA 2QR6A 4JNZA 5DXXA 3PFMA 3SCNA 3UZWA 5EFDA 1H51A 3QMSA 3VUSA 2WMKA 3OIHA 3MYOA 1AD4A 1Q45A 3M16A 3CQIA 4LUSB 2PDLA 4DRSA 2RJHA 3MJYA 4B2DA 3WFAA 3MUCA 1WDQA 1A49A 4HHMA 5EMLA 3N2MA 2VFIA 4PUWA 4HSNA 4HZ8A 3STFA 4Q8NA 4UTLA 2ZOXA 1XH1A 2Y7FA 3WF4A 3KEHA 1AZ1A 1XR2A 3R0DA 2YDQA 3GC5A 4HNLA 2C71A 1KFWA 4KRTA 4JTSA 5I02A 1REQA 2VO5A 3QBUA 3QW4B 2VX4A 1PKYA 1X7FA 4C5ZA 3UWUA 4RE2A 4EPBC 1OG6A 2QCDA 5REQB 3H24A 4L9YA 2IKGA 2VFHA 1GOQA 5JIWA 4ENLA 3PTMA 4JYDA 4A21A 3KRBA 4U10A 3CASA 4WJXA 2ZUMA 2CKRA 3UWYA 5C2GA 4TMCA 4J28A 4I7UA 3N2XA 2CU0A 3I68A 1DJYA 1ZJAA 1EJWC 2HK0A 1WP6A 2AKMA 4N9CA 1CX9A 3F4NA 4HOWA 3ZIZA 3HPXA 1P7TA 6CGTA 1S2CA 4PMYA 5IHRA 3W2JA 3B9DA 4HCDA 1CXHA 2V5DA 2OLHA 4CEXC 4JIPA 3LTYA 1YKWA 4K1WA 4PN2A 1NWRA 5E9XA 2NQHA 4UMAA 3NAVA 4ZXOA 5E93A 2YW3A 3A4XA 1T8XA 3ANVA 1L8PA 2HBVA 1ITUA 1DXEA 4QDMA 3LM3A 3MDWA 1BQCA 3UWWA 3ANUA 2AMXA 4HPJA 4PULA 3QLDA 1EO5A 3A24A 1M7JA 1VGAA 1ZLPA 1KM3A 3P84A 3NDZA 4ZMGA 1XJBA 4O19A 1Q6QA 1R0MA 1UR9A 1J8VA 2YLLA 4OVXA 1EOMA 2ZADA 4ZCWA 3I7QA 1ZY9A 2VQTA 3MMWA 3S1VA 4LVAA 2E5DA 1KBIA 1VBJA 3BOLA 1QFEA 3MZNA 3NPXA 3BAIA 2YZ5A 5TF0A 6TIMA 1HT6A 4TVCA 1RQEA 4BI5A 4AZCB 3BCDA 1IXNA 1MXGA 3N6JA 3ARSA 3R8RA 4HOZA 1X1NA 2PDUA 1LG1A 3FVMA 1GOOA 3ITVA 3S83A 1UKSA 3LCXA 3POHA 3PJUA 3M47A 2O92A 3CV7A 3VFLA 2OLSA 3UPWA 1X1OA 4GQ0A 1P0NA 3UXAA 1OX5A 3TAOA 1JDEA 3ITTA 4QCEA 5E6ZA 2R82A 5EMJA 1EEXA 4RE3A 2ZRUA 1JI2A 2YXGA 3LN3A 1FY6A 5FJIA 1QCWA 2ZUWA 4DUVA 4V28A 4S38A 1XP3A 4ZXLA 1TKKA 3BGAA 3T0CA 3AXIA 2QW5A 4GVFA 3T0DA 2E1DA 2EF9A 3L0GA 1RVKA 3N25A 4GO9A 3T2OA 3AHZA 1WKEA 1PBGA 1HKVA 4ORIA 4H9ZA 4KCVA 1FCBA 2GL5A 2DSWA 3THCA 2QQ6A 2Y1HA 3LK6A 2C79A 3LA4A 3WUFA 4D6GA 1TRDA 2ZE0A 1EJTC 1S2WA 1UH2A 2PAJA 4O1AA 4HQVA 1V51A 3SFKA 1ISXA 5A6KA 4IIGA 3UY8A 3A3HA 5A8PA 3R7MA 4Z2HA 4YS1A 3FN9A 3PF3A 2RUSA 5LIWX 3GWQA 5CZJA 4XAYA 3WLJA 4RPQA 3COTA 3EA3A 4XD3A 1QBAA 2X0SA 2Z1KA 3N1AA 4O8RA 1VEPA 3CZGA 4B3KA 2F7FA 2W9MA 4YNGA 4H2HA 3W26A 3LHTA 2E3ZA 3ABOA 1TB3A 4RL3A 3LLDA 5CGQA 1LL7A 1CB7B 2Y7DA 3B05A 3G0XA 1DWJM 3CC1A 2PDNA 2WCAA 3F4CA 1L0PA 1ZCOA 2GDUA 2I9UA 1RD5A 3ZO9A 3H26A 4YTTA 1DE5A 4E38A 1WZKA 1YW1A 3MI6A 2F2HA 4AXKA 5EU9A 3KLKA 4UC5A 4AVNA 3D6NA 1QOXA 5KZ6A 2VGFA 4RE4A 5I5RA 3K46A 1TSIA 3K4WA 3WBXA 3O07A 1XLCA 4DJDA 5AYIA 3WF0A 4RLIA 3KBNA 4H9UA 3DFHA 3UXDA 2TAAA 2GK1B 5XINA 1K3UA 1WZLA 4G56A 6A3HA 1EJUC 2PDJA 3C2OA 2ZDSA 2VEKA 2YB4A 1HFBA 2ISFA 4K36A 5FF2A 3M44A 4BHYA 2OODA 3UR2A 4I5UA 2QJGA 3EPOA 4GMEA 1KWGA 3W1MA 4JFTA 3RF9A 3EA2A 4D8LA 3ELFA 4WX2A 4N0RA 1IGSA 1OY0A 3ATZA 3PG9A 3TTSA 4F0RA 3P14A 4RR4A 2R94A 1TE6A 4TVUA 1NFGA 4J4KA 3PZ9A 1FWCC 2PMQA 3PZQA 1I1XA 1QW9A 3UWVA 4M56A 1I2RA 2CBUA 1RPXA 1MFVA 2WSPA 1GVEA 4UTUA 2NV2A 3KX6A 3W00A 1KC7A 1A3XA 3M0VA 4U3AA 5BZAA 1FH8A 2XDFA 3RLGA 7ENLA 2VWTA 3O16A 3BLPX 3WQFA 2YA0A 3AIQA 4AHPA 4N6EA 4MWAC 2VEFA 1W2PA 4ICNA 2VEGA 2ZIDA 1EA0A 4MWAA 3UYIA 5JBDA 3WQPA 2Z7GA 4S39A 1U30A 3GBDA 3WNPA 1XIDA 1XYMA 4IOTA 4ZB0A 1CXEA 1RXOB 4FOJA 3HFTA 1DHKA 5I23A 4N4QA 3CL8A 4M1RA 1SO6A 4HOXA 4ALDA 1W31A 2JKEA 1R9YA 3G1RA 1XV8A 3TJLA 1OX4A 3RU8X 3OGSA 1Q8AA 4IX0A 5CBIA 3A3WA 3R1ZA 1UQZA 3W6MA 3RCYA 5JU6A 3LTPA 4JNMA 7ODCA 3ZR5A 1M04A 1US2A 4E2DA 3L5LA 1NOUA 2Y8KA 3VIMA 2VNCA 1UZ1A 1JVNA 1Q6DA 5A6TC 4XD5A 5DBTA 2P10A 4FI4A 3W2MA 1W1VA 3H7VA 1ZAJA 1HL2A 3MQTA 4MTVA 1B3VA 1PX4A 4KBXA 3W02A 4YTRA 3KZSA 3E3HA 3TA9A 2V0TA 1GUVA 1AL7A 1DXFA 1G5AA 4X2PA 3VD7A 3DU0A 4F48A 4UTFA 1BEUA 3P6LA 2CYGA 4B2DD 2EG7A 4KERA 2QZRA 1E6SM 1T40A 4Q8UA 4BR1A 1V3LA 3WDRA 3DFSA 1PSCA 2BOEX 4CD4A 1XXXA 1Q3NA 3H4GA 1UB3A 4G6CA 3IUDA 3IACA 3LY0A 1TPVA 4AZIA 1PWMA 1HJUA 4OGZA 1YMYA 4D6DA 5CSUA 3V5OA 1S3HA 3T44A 1BRLB 3BLFA 3U48A 1IWBA 2X41A 1GCYA 2Q09A 1IXOA 5D9MA 3W23A 4M8UA 2G3JA 5AHNA 3W73A 3ARYA 1P1MA 2A5HA 2XG9A 3QHMA 4GKLA 1GZGA 2DVXA 2C8NA 1ECQA 2FIQA 5FD0A 3CQHA 3LYEA 3P0WA 1W9UA 5DANA 1E40A 1U33A 4GZIA 1QI4A 2CITA 3WQ5A 1V3IA 3B9NA 2GJLA 1VS1A 4X63A 1QWKA 8XIMA 3SUSA 3V36A 4E4UA 2FHFA 4HTYA 1I0BA 1UD6A 5I3IA 2DZTA 1OT1A 3LQGA 2BODX 3B0VC 4L9ZA 3TYZA 1RV8A 1W5PA 2PWFA 4MJ4A 1UC5A 1TVLA 2GQAA 2C14A 3W0KA 1JFXA 3T7VA 3UGVA 1TJ2A 3FA5A 4QSFA 3MUIA 1FA2A 3MHFA 4HHHA 1XBXA 3VNLA 3D3FA 1RQBA 5B7YA 7PTDA 1I2NA 1M3UA 3R12A 2C91A 4MY1A 3FSUA 2FZBA 1OCNA 3WLKX 3GC2A 3DAQA 2VZUA 3QPEA 2NT1A 1FDJA 2D0HA 1CGYA 4LYQA 3WQ6A 3TXVA 4Q8OA 5HWMA 2WCSA 3POCA 4DWDA 1N8WA 2Y8VA 4JD4A 2VOTA 4CU7A 1C7TA 4PFHA 1WO2A 3URAA 3GHTA 3B04A 2QUNA 3M43A 1XSIA 3QOKA 2DEPA 5F2MA 5K4XA 4PEKA 4ATLA 3UEQA 2QUVA 4GFIA 3HMCA 4UNKA 2R1NA 3NZPA 5BXTA 4JN6A 1OADA 3PSVA 3QKEA 4QR6A 1DBTA 3O6DA 1EWEA 2XJ7A 3AWNA 2GOKA 3SGGA 2X09A 1WXJA 3QQ0A 1OK6A 5K9DA 3TOPA 4PCSA 1UPPA 2V5CA 3I7SA 3KOWA 3RX3A 1DORA 2VFEA 2NVAA 1R47A 4LWWA 4LB4A 3ONCA 5D2XA 4GQGA 3WH8A 3W1LA 1A53A 3OEXA 1TCMA 1EC7A 3R79A 1PXGA 2G37A 3AMGA 3E2VA 4HYVA 3JRKA 1Q2RA 3I10A 5GNYA 4H83A 1D8WA 2C3ZA 3ALGA 1YX1A 4Y9PA 3WNKA 4UBPC 3MUXA 1F5ZA 2CKSA 4Z2KA 4CNUA 3GDMA 2VCCA 4YTQA 3GDLA 1TMQA 2YOCA 3WLSA 1PDZA 4NYYA 2WNWA 3M0HA 1UR3M 2PU1A 4C6NA 2FLIA 4BEQA 2Q8ZA 3S5OA 3HFYA 4PZVA 2X30A 4E2VA 4P7RA 4OUIA 2HISA 3L4TA 4X9SA 4FNRA 3ARPA 1C9WA 1GONA 2IUZA 1KV8A 1TX2A 4H8NA 2DZSA 3SIMA 1M6JA 5HR6A 1IZJA 3RILA 1R6WA 3PS7A 3PANA 4WKAA 2R91A 3S5SA 3ARZA 2ZA3A 3LM7A 3HQOA 2HMCA 4GI6A 1OINA 3GH5A 1VBHA 3GXDA 3CAKA 1ONXA 4LVGA 3L9CA 3BUVA 3OYXA 1P6CA 3CMFA 2PLKA 2HJPA 4JICA 3RR4A 4D72A 4P8UA 4HPXA 1J11A 1GVIA 4OQVA 1UR1A 3P82A 4DBSA 2Y4SA 3I6RA 3IJ7A 5DMMA 1UPMB 2HV5A 4ZA0A 4DZIA 3AALA 4B5TA 4S3AA 1VBRA 4WQ6A 2BY0A 4ILSA 4KWVA 2RHGA 1FTXA 2XIMA 1FCVA 4YIWA 3QN3A 4AEFA 1MNSA 1TV8A 4AD3A 2GFTA 2J8TA 5KZDA 2EJ1A 1OC7A 1VFSA 1H11A 1RCXB 1NWSA 1QJWA 4P7NA 3VNJA 1GYNA 3WUBA 3TWBA 1V6YA 5EMKA 3T8LA 4JBRA 1I1WA 4MZ1A 3VUPA 4C7GA 1SMAA 3KHJA 4CCEA 4DZAA 1ZCCA 1OC6A 4Y9AA 3KCOA 1TVNA 4IGSA 2C13A 4W93A 1B3WA 1LLWA 4MKNA 3CUZA 3E0FA 1L8NA 1E5NA 4RNJA 1OM0A 3UXLA 4ES4A 2GVLA 1X1ZA 5JXQA 2JGQA 2E6DA 1K8YA 2ACQA 2QJHA 4M5PA 1NQKA 4DF0A 3WN6A 1C3FA 3NZ1A 4HU3A 3QV6A 4IQEA 1B9ZA 4E2OA 3T0BA 1FHLA 1J0HA 1VLWA 2OTDA 1NU5A 3B9EA 3UWQA 1EP2A 2D2HA 4AYGA 1OFEA 2ZUNA 1E1CA 3P81A 4GZJA 4HNTA 4OIFA 4MIMA 1B0IA 2Z00A 3M0XA 3AIVA 3HGJA 4PSPA 5B7ZA 1HVXA 3ZXWA 3TN4A 2W62A 4IFRA 1TQXA 1RK5A 1HN1A 1D7KA 5HMEA 3QM3A 5FF3A 5I79A 1YADA 1PTDA 3P74A 1G7UA 4K68A 5J5RA 3LTSA 4EAMA 4K3ZA 4BJHA 4Q4QA 1GVOA 3UA3A 4TMBA 3H2OA 4WJEA 1OIFA 2J47A 3PWIA 2VMFA 3PJTA 2X1UA 2B0MA 1P1XA 4HK5A 1S2AA 4IQLA 3QKZA 2FTYA 3DFYA 3TV8A 2YL9A 4HMDA 2RH9A 2PWUA 3VIHA 2JEQA 2F8QA 1SVDA 3QR3A 2ZWZA 5C8BB 4D1JA 1VKFA 2GJXB 2PRHA 5I2UA 2FH6A 2V8ZA 2G3MA 5I77A 1BKSA 4KKXA 4Y9OA 2IQTA 3LRLA 1VCVA 3BGJA 3SCPA 3LHWA 3V35A 3PBMA 4ACZA 4Z08A 1V79A 4PMNA 2BOFX 4XBJA 2DSUA 3QFEA 5CBJA 4HSOA 3S2MA 3B8DA 4MLRA 4MYXA 3MBDA 4WZHA 1IZCA 1NELA 3D47A 4CGTA 5BMXA 4JIRA 4HGXA 1XHGA 4GUGA 4S2CA 3VZYA 2PI6A 3RDKA 3SRFA 4E5TA 4I8DA 4M24A 1ZBCA 3KTCA 4AZ7A 5LNRA 1LT8A 3L5AA 1DJQA 1MNZA 5EBUA 4PUJA 4GBDA 4HPGA 1OFOA 5LNSA 1EPVA 5LA2A 5FF4A 2C16A 3GNDA 3MCOA 4UQCA 3FXGA 4Q33A 3VMNA 2Z0IA 4F2TA 2I56A 3TTYA 3CLWA 1VCGA 2O56A 4LU0A 4C7DA 1QU4A 2QULA 1FUYA 3QGVA 4Q6XA 1B4EA 3RCMA 4GX9A 2W5FA 2GVGA 3NO3A 3N2CA 3U2CA 4AMCA 4J3TA 2C6QA 3GVVA 4ZOAA 3AZTA 4B5VA 1XLBA 3UJEA 3V3WA 3LHUA 5K4ZA 2PDKA 5AOUA 7REQA 1NOFA 3GZAA 3NQMA 4DJFC 1WUFA 3KAOA 3UGRA 2UY3A 3R0KA 1S5VA 4PE8A 3W7EA 4B91A 2D2GA 4DN1A 1PIGA 4KPLA 5D2WA 2J62A 3GLCA 1B57A 3FK4A 1JYWA 4DLMA 4Q8TA 4EK7A 2E9MA 3ZJ6A 3UU0A 1B30A 2BGQA 4MB3A 2W92A 4QP0A 3URBA 5JH2A 2X05A 4RUBA 1AQFA 2XSAA 3N6HA 4RDWA 3LBCA 1LCOA 3LHYA 4WDTA 4UTWA 3DI1A 5G2IA 3REQB 5SWUA 1ISZA 4E4FA 3DCPA 4ZOBA 3IUHA 2WC7A 3W86A 1EJXC 1ZAIA 4FALA 3PUEA 5ENLA 1CXLA 5C9RA 1NQ6A 1CCWB 3A13A 1LQAA 1J12A 1XFBA 3NZQA 2GSHA 3B40A 3OZOA 2ZFAA 6XIMA 4UFHA 4EXQA 1YHTA 1PUDA 1F9CA 4ZB5A 4F9JA 1KFKA 3Q58A 1XPYA 4AU0A 1JRBA 1JEZA 2IKJA 2ZCGA 1A47A 3EDKA 2IXUA 3SGUA 4IJCA 4AY8A 4FAMA 3GO2A 3NSMA 3R6IA 3GR7A 4KIEA 1LTDA 1QAPA 2OCZA 3VXGA 5DELA 1S2UA 3C2VA 3W76A 1SZGA 3CB3A 3KCJA 1TZ9A 4R9OA 5M3WA 4QLKA 1VB9A 2WCGA 3M41A 3ZFHA 2HE5A 4PMZA 3RGTA 4GD0A 3KOFA 3TW9A 5FEPA 2PDFA 5HWJA 4PYSA 2CERA 4KEMA 1D3CA 2QGYA 4J3VA 4UFMA 4L6OA 1U2YA 3ZWTA 3STCA 1KM2A 3NQCA 3W1AA 1XG3A 3WQDA 2KAUC 3H2EA 1FDZA 5M03A 3LMYA 3QGAC 3VD9A 4YCPA 2VC6A 3N19B 3FYPA 4C1NA 3NQFA 3CHFA 4H4IA 1PB0A 1UWUA 1SZRA 3WMLA 1IT0A 3BLEA 1XYAA 2WZTA 3F5KA 2QMJA 4W89A 4GIRA 5AYYA 4AX7A 3L5MA 1KD0A 3M1ZA 5IRPA 2DZWA 2ZTJA 3GIPA 3EDJA 2OWCA 3EXRA 4H9MA 2FZNA 4JIHA 1JPDX 2F84A 3U2OA 3M5YA 2WW5A 5F1VA 1VFFA 4DLFA 4A8NA 3MHUA 1KM5A 4GNKB 1QR7A 3G22A 4OKDA 1W3HA 4E8GA 3NPUA 1UWIA 2PPGA 2QT3A 4O1EA 3IJLA 6XIAA 3JUGA 5JVLA 3KL5A 3WUGA 4DWSC 1AMYA 4GVHA 3WK2A 4DWSA 5CZSA 4FF5A 2XGIA 1PTGA 4LTSA 1YPIA 1NH6A 1XGDA 4XZMX 1REQB 2BV9A 1DJWA 4ROPA 4UUIA 2KZHA 1XLGA 1RK6A 1XD1A 3FHAA 3WQWA 1ZENA 3W7RA 1QNSA 1MFUA 1XUUA 3U9IA 3WF2A 3T08A 3E2QA 1Z9AA 3OVGA 3B9OA 5HR7A 2W6RA 4WY0F 4C6IA 4MF4A 2WPBA 4RXFA 1IWAA 1UWQA 3SM0A 5CGMA 4IIDA 4L4OA 4HT3A 1O1HA 2QUMA 1GWJA 3UA4A 3MO7A 1YPFA 1CEOA 1OFPA 4XZIA 2DZPA 1R85A 3RM8A 2FVKA 1MSSA 5H91A 4B3ZA 1Y7VA 4GZEA 2YXOA 1OGBA 1TA3A 4P7QA 1VH7A 4O1DA 1R3VA 4YVPA 4LS2A 3R2GA 4JFVA 4DYJA 4K6AA 4MJ2A 2FVLA 2I5IA 2QJMA 1D7FA 1Q6CA 2PWDA 4IIBA 2BFGA 1EJRC 3ARVA 3T09A 4W9TA 2ZUTA 4QG9A 4C6MA 3TSMA 4NJGA 2JKPA 2GQ9A 3TC6A 1QOQA 1ONWA 2A6NA 2F6XA 8CGTA 2JKAA 1K02A 4L64A 3TXZA 3DYOA 4QE5A 2QS8A 2DW7A 3TR2A 1HJSA 3KHDA 4H00A 4RV8A 3MKKA 3RX2A 4IGHA 4LUSA 2DH2A 4DF2A 1VC4A 3ABRA 4JKKA 3JS3A 3W4RA 4CLMA 2J7FA 4A22A 3GUWA 4AZBA 1K77A 4LBSA 1TV2A 1XC6A 4NZ3A 2FGZA 2CCRA 1MQQA 2ZC1A 5HUOA 3E5BA 1V6WA 1BLIA 4XZHA 3IGUA 2ZX8A 2SFPA 2V2DA 1V3MA 2OGJA 3SFWA 3DYPA 1VFLA 4HU0A 3DECA 1E56A 5LHEA 1MRQA 3BW4A 1V08A 3THDA 3GTFA 3W01A 3JVAA 2J7HA 4GHRA 4H04A 4Q32A 1JNEA 5A6BA 1QT1A 2E77A 1I45A 3ZLFA 3DIPA 4ECLA 1G67A 3M9YA 2GLKA 4V1XA 5FF0A 3CH0A 5REQA 5AY7A 4CNTA 1XLJA 1K1DA 1QNQA 5D30A 1OGGA 4IWWA 4XZ9A 4BF5A 1KFBA 4J3XA 4CQCA 4F2UA 4JAWA 5I07A 3BGGA 2Z1SA 4Y2WA 4Y96A 3L4WA 3GBEA 4XZNX 4HNUA 3GNPA 2PSNA 4C6EA 1TX0A 3PZNA 3TYUA 1KW1A 1L6FA 3CM4A 4QITA 4DBEA 3H2CA 2XFYA 4RZ6A 3VMOA 3LCWA 2YFOA 2J4GA 1VYPX 5CEWA 4ZTYA 3VE7A 1NWUA 4AEEA 2QDDA 1EP3A 3AXMA 3VA8A 1PYFA 3CAQA 4PMJA 3H55A 2QKFA 5CJ5A 2DP3A 3QLLA 4AIEA 1SYTA 1Q5MA 1R87A 1T7LA 4DELA 1XKJA 2AL2B 3DX5A 4C90A 1HXJA 4GI9A 4A2SA 2I17A 2XINA 3E0IA 2DVTA 4CQBA 2DSKA 4F2BA 4M19A 1XRFA 3EWYA 3NR0A 3NXFA 1DVJA 5G1MA 2CC0A 1BVNP 1H63A 3NYDA 3CHCA 4QSHA 7CGTA 3WBYA 3AHXA 2XHYA 3DERA 1H49A 3UF9A 1IT8A 1Y5VA 3RO6A 3NURA 2GWNA 3HGRA 3IANA 4RNFA 2I57A 4CD8A 1A0EA 4ERIA 4FSAA 3GQYA 3BV4A 1YTKA 2XU2A 1JZ3A 1V6XA 3KLLA 3W6YA 3G2GA 1SW0A 3A5VA 4V27A 3ZR4A 4A3HA 2C1HA 3AIWA 4QDPA 4ZEPA 1ZJHA 1JDAA 2G96A 4WKFA 1E1FA 3GSMA 1VAHA 4ASTA 3AYRA 5BOOA 2PFHA 5A8QA 4OV9A 3I6TA 2CBJA 3EOSA 3LV6A 1R9XA 4NL1A 5CPSA 1TJPA 2PDIA 1E70M 3DFPA 4JL2A 2QJJA 1XCWA 2IPJA 5A6JA 4DJFD 2ZDRA 3P0XA 1KWKA 5IDIA 2DVUA 5AC7A 1FOBA 4Y90A 4UCGA 3BWWA 4H6KA 1JUEA 2BXVA 1JZ4A 2XYLA 3AISA 3PAOA 3AMCA 5A6AA 5C55A 5AHFA 4DHGA 1OFBA 1Y5XA 5IFPA 4ZOCA 2QDHA 1W1IE 5CH9A 1A5UA 1W3TA 2YXXA 1G0CA 5K3VA 1YDOA 4XWUA 1XH0A 3MUZ1 4NP7A 1RY0A 4D6EA 3VIJA 1XH2A 4TU1A 3NO5A 1J6OA 4K8EA 2XIQA 1C8YA 5CPQA 1UUOA 3KBMA 4RV3A 4IT1A 1EBHA 1W17A 2EG6A 3FEMA 1B3XA 1R2SA 1JD9A 4XBKA 3PB0A 4B3LA 3SURA 3TN5A 1DKWA 1A5KC 1XIEA 4DUXA 1ZJIA 1E55A 4JTJA 2GOUA 3EPMA 1ZSXA 4C91A 3P3BA 5HXMA 1XLFA 1UYQA 1Z69A 4JQ3A 1GOWA 3FY1A 3G3DA 3CJPA 5DMLA 3HIJA 4HA0A 4GC3A 1E15A 4R33A 3NUKA 1RPKA 5EKYA 2A85A 3ARQA 4QNEA 3BDKA 3EKLA 3BG9A 1R38A 3AUOA 5CC6A 1XL9A 1NF0A 1FWGC 1GJUA 1QI5A 4PTMA 4HPHA 3UESA 1N7KA 1Q6FA 2GVEA 2WVUA 1TZZA 2VX6A 1V8EA 3P5ZA 4QX4A 3WBEA 1W9DM 5DMNA 5CPMA 3NGJA 3ERPA 1JCYA 1QHOA 3PUDA 2CXEA 1GEQA 3B03A 3R25A 5FEXA 5LZLA 1JCLA 3GX9A 4XX6A 2A3CA 1UBPC 4IM4A 4R34A 4AWEA 1EFZA 1SR9A 2Z2BA 4HJWA 3ZT6A 3VABA 3L65A 3UCQA 2R1MA 2GK1A 2NXIA 1WA3A 3A12A 1BTCA 4WDUA 5T26A 2Q3OA 3N15A 4S3FA 5ABGA 4PSRA 1WXZA 2BG5A 1EX5A 2R1LA 5AC6A 4AZHA 4O53A 4O13A 2IPFA 1M5WA 3MDUA 4MUPA 3NL5A 1FFQA 3SQMA 4J9JA 5A95A 1VIZA 3WH7A 4IGNA 1W54A 3RPTA 5FI8A 3VCCA 5G4HC 1Q6OA 4RZBA 3NQDA 4DO7A 4JN8A 4AY1A 5A1AA 1QDSA 1G4TA 3T2PA 5FAGA 2Z6IA 1V0LA 5H6HA 4IICA 3F4DA 1S3TC 4GY1A 3FGCB 1KXTA 2X8RA 1OWQA 4J40A 1O7AA 3APYA 1HW6A 4JHZA 5LYRA 4NHVA 3T2QA 1IGWA 4XO7A 1T96A 2PZNA 2F9RA 2VRJA 4AWUA 5DY2A 4ZSTA 1M7XA 3E9AA 4KF1A 3P62A 2XISA 4AH7A 1GOIA 1X96A 3UETA 4WUIA 4B15A 1Z44A 4U4MA 1TCDA 1J0YA 3OJGA 3VDBA 2UBPC 3KOZA 2ZRVA 1PV8A 1T99A 4O28A 1XDJA 2OO6A 3KM8A 3PPCA 3UPMA 3GD6A 3PC0A 3M64A 1UOZA 3WD3A 5EGRA 2X7WA 3TJXA 1IHIA 2HK1A 4M0XA 2ONEA 8TIMA 2HS8A 4GNJA 5KZEA 4UNLA 4I5RA 3IIXA 4NIRA 4IFOA 3WELA 3RIKA 1JXKA 5E0CA 3VNIA 1DHPA 1JUBA 5L9FA 5FAJA 3O6AA 3T6CA 4KWOA 1GOKA 3BARA 2GYIA 3CUGA 4PUKA 1E0WA 5D04C 3TJ4A 1H50A 3SAZA 3LX9A 3MV11 2HSAA 2Y5EA 4ZZ9A 4GLEA 1DOSA 1W3KA 1W1PA 3RPDA 1UWTA 2AKZA 3FDKA 3O15A 4UTTA 2I5GA 2ZUVA 3P93A 4Q22A 2IPGA 2I7GA 4KEZA 4S3GA 4V15A 3GG0A 2ZZ5A 3K8LA 4RX0A 5E0FA 4HZ6A 4GG9A 4KS0A 2EAWA 2EXOA 3L2MA 2VDHA 2Q8XA 1J9YA 4JQ4A 4IL0A 2F2KA 1RLCL 2ZX9A 4GQBA 3NL3A 5HMFA 1DEDA 4HKPA 1XBVA 1OFAA 1PZ0A 4Z1DA 5D37A 4IQJA 2DUAA 1BHGA 4CNSA 1GG1A 1WXYA 4CQ9A 2GUUA 3N6QA 1E4NA 2CLMA 4H6QA 2D69A 3KDNA 1BRLA 1ZHAA 1RP9A 3CGTA 2ABAA 3UNDA 1R86A 3I4KA 1T5AA 4F0HA 2QAPA 4JFSA 1CPUA 1E73M 2VRKA 2W63A 3A9BA 5DCEA 2CHRA 5EY5A 2RGLA 1YDYA 1PO9A 1KR0A 5CZKA 3GVQA 4R7OA 3AU6A 1H3GA 2DT0A 1JF6A 3SY1A 2HCVA 3QPYA 3N2OA 1TV3A 2NVCA 3EB4A 4QG6A 2DIEA 3VK5A 3C0QA 1SR0A 3EB3A 4J5NA 4CU8A 4DO5A 1MW2A 3D5HA 2NLYA 1ME8A 3LI0A 1NP0A 2ZZ7A 3BOFA 2CWXA 4H9VA 1HJXA 1I4NA 5DT5A 1EHNA 1IEXA 3AO0A 2X0HA 2Z29A 1BXCA 3CV6A 4W84A 3W82A 2E9BA 3ZLHA 2UZ9A 3IAPA 2J7EA 1FP9A 1LRTA 3SJNA 4GUFA 3NL6A 1OFQA 4RKAA 1BF2A 3IJ9A 3HN3A 4BI7A 3P5YA 1ISVA 4EAYA 3QY8A 1I2PA 2J25A 2BLEA 4TO8A 1Q6RA 4EWJA 2VZVA 2A6LA 2G3NA 1W5OA 1BD0A 1FHDA 3GXMA 3HOJA 2OZTA 3BSMA 1J01A 2XH7A 3NPWA 4F66A 3L4UA 1TO3A 3S1WA 1UH3A 3OHMB 1F8IA 4N9BA 1NAL1 5CG7A 3LU2A 3VKCA 4OE7A 4J35A 1PZ2A 2FDMA 2X1IA 3WH5A 3GXTA 5I3FA 2EPHA 3CUXA 1B54A 2J8FA 3MT1A 1H2JA 2HBXA 4GZ7A 4GXWA 3NTYA 4GNVA 1JL8A 2YL5A 4US6A 1P4CA 3F1QA 4D8AA 2FPTA 3MCNA 3PPGA 1XGZA 5FEWA 2OB3A 5DCBA 1VCFA 2J75A 4DNMA 2YYTA 4CKQA 4FLOA 3MP3A 1EYEA 4AVOA 1NIUA 4AW7A 4PMVA 2ZX6A 3KP0A 1JYNA 2Z1XA 4YTSA 2A3HA 3W1TA 1RP8A 1R3QA 4AWTA 1B90A 1A0DA 2GGEA 3CT7A 3BVJA 2A4AA 3W7PA 1XYFA 2VEMA 4TX6A 3AI0A 3EWBX 3MSYA 3OODA 4UOJA 3RITA 3VOHA 1X39A 2NVDA 3GXFA 4P2VA 2QPXA 1NOWA 3BO9A 3FNDA 4IL2A 1LYXA 3DN5A 2OLAA 1T6MA 4H3DA 3VAVA 1OC5A 4AUBA 4Q8MA 4CD6A 4PMQA 4XB3A 2G0WA 4AZGA 3LI1A 4UOQA 4PRRA 4Z1BA 4P8VA 1BG9A 3A21A 4TXEA 4NRSA 4DYKA 4FNQA 4S1FA 4IP5A 3H2FA 3CEPA 4M1BA 3T81A 1UKTA 1J79A 2QDGA 1B3OA 4GQQA 5H1WA 4XBSA 3TEVA 3SUUA 3G18A 2WVTA 2XVGA 3PM6A 4ERAA 4DX3A 1XLMA 2OSYA 3L4YA 4GH1A 4UTIA 3ZM8A 4JYEA 3TE9A 3LZ5A 2P3ZA 2HNHA 1YRRA 2EPLX 4FLQA 4XVEA 4TX9A 2PGEA 3W1UA 1GHSA 4H6EA 1RSCA 4GUHA 2RKXA 3L7RA 5CJMA 4GGHA 2A0NA 3KRSA 1PAMA 1XYCA 3WF1A 1OCJA 4S3BA 1SZNA 1UWAA 3W85A 3VCRA 1OF8A 1CW2A 2E25A 1HGYA 3SJ3A 2QVNA 3MKCA 4A6GA 1UUQA 5LIYX 2GQ3A 4AMAA 4J7RA 1HKKA 3QVQA 1R46A 2OYMA 4G9PA 4H19A 4EIVA 3PPFA 1JCNA 2YPIA 1NDWA 4DF1A 4ACZB 3M4HA 4US5A 1M7PA 2ZX7A 4P8WA 3NVTA 2ZA2A 3MI3A 3N11A 2OQYA 3B9AA 5H8PA 2WANA 1F6YA 3QQWA 4HMEA 1WBHA 3O6YX 1G1YA 3W7OA 4BEUA 4Z1CA 4Q8PA 4HNNA 1H60A 4H7ZA 5LIUX 5IXEA 2P88A 3UXKA 4FX7A 1D3GA 3I65A 1XLEA 3APGA 2VENA 4GVGA 4LALA 1J0IA 2NXGA 1S5MA 4O54A 4JY8A 2GDVA 4OHQA 3EWWA 1GOMA 2C1IA 3ITOA 5C0QA 3L68A 3NYZA 4DXVA 5D05A 4KWUA 3O0KA 4PBGA 3VD5A 3DH7A 3W53A 2ZRYA 4H01A 4HSHA 2NQJA 4KRZA 3E0WA 5JMUA 1QK0A 1EF2A 3C2FA 2CLKA 3N14A 5BMWA 3OGRA 4A35A 1V93A 1F73A 3OVPA 4CCDA 3LPFA 5DX7A 2PF8A 3M6YA 3SN0A 4MG4A 3GVRA 1SO3A 2D0FA 4LRTA 2PLCA 4UWMA 2WBGA 1ONEA 3KTSA 5JUVA 4RZ5A 3EWDA 3CAWA 1FH9A 3GTXA 3OP2A 3OLEA 2FMOA 3AHVA 1CIUA 4XSMA 5GNZA 3W2UA 4D6FA 1U5VA 1RQHA 5BNKA 2A3AA 4GUIA 1QNOA 3OA3A 5M2FX 4FHAA 4GO8A 3HU7A 1K4HA 3BAXA 3LV5A 4C6QA 4CQAA 4JTHA 1QUMA 2P0OA 4GXPA 5H8UA 2E0PA 3S1XA 3DHPA 3ZYZA 2X7VA 2AQOA 3M46A 1CNVA 2GJXA 4IJBA 4OOUA 1E3XA 4HNOA 4LNCA 3PNUA 3WD2A 2PGRA 4A3RA 4F79A 2MANA 1F3WA 3TSBA 1S39A 3C0JA 4WSJA 2DH3A 4JX4A 1FVPA 1WKFA 3AS1A 5ECVA 4K8GA 4I9AA 1KO0A 3UR5A 5IDZA 3S5ZA 5LHFA 3N3TA 2CZ5A 4LEFA 4W7VA 3NZRA 3AIUA 4LB3A 3V7PA 1CB2A 1ISYA 1UMLA 4DUWA 1KFEA 4GPNA 1A5SA 4H7VA 5I06A 5TNVA 1XG4A 4AFYA 4XSLA 4FOUA 5K7JA 3SZ8A 3VIGA 3E02A 9XIAA 1JCTA 2Z6JA 4AVFA 1KBLA 2O7SA 1KGXA 4ZENA 2A2IA 3EWCA 3HMJG 3SUTA 2NUYA 4U3CA 3EAUA 3HGSA 3G6MA 4WK9A 3QY7A 1A5BA 3DENA 3STPA 1RJRA 3IUIA 1DQUA 1VPQA 3K5XA 2WQDA 2PEVA 1B9BA 1TV4A 2FZDA 4XUYA 2VEPA 2J8GA 4BQ3A 4J3ZA 4ORMA 2VUYA 5J04A 2EHHA 4M6UA 2R1PA 2WK2A 2PODA 2TPSA 1DJZA 2D22A 4OECA 3CHDA 1PYMA 3C2RA 4YVVA 2B81A 2O4MA 1FWJC 1NWTA 2FH8A 3SUWA 4QTGA 1DXIA 3KS6A 3FV9A 5A8OA 3TTOA 3WIJA 3WJYA 2JBMA 5EB8A 3ZMRA 2PRMA 3REQA 5HULA 4NU7A 3MS8A 5IOBA 3W7GA 2P53A 1YNQA 5BRQA 1ZS2A 2A79A 3M7SA 1DWFM 4FIQA 1GG0A 3WJXA 5HK4A 3S9YA 1C7SA 3FA4A 3CAVA 3IV8A 1AJ0A 2DGAA 3ZS4A 2DJXA 1SSGA 1VQTA 3URNA 5G1YA 3Q67A 3U8GA 1Q7QA 3Q2DA 1J0KA 3EYPA 3P61A 3W3OA 1KA9F 3DG3A 1T0OA 1P6BA 3GK0A 5AYZA 3VNYA 4HHPA 4PMDA 3WDJA 1V5XA 3K1GA 4EP8C 2BOGX 1EL3A 3USBA 1ZPTA 3TYAA 4JOMA 3H6OA 4KQNA 5FF7A 3Q45A 5ABTA 1PX8A 4UMBA 1XX1A 1PJ9A 4TTGA 4ERGA 2VI0A 1F05A 3NQEA 1WCGA 1S1RA 3ID7A 1VD6A 3QXBA 4XTIA 2ZC8A 1KXHA 4JTKA 4WGHA 3ZSTA 2JF7A 3CYVA 4WF7A 4AX6A 4DM1A 1NARA 4RDVA 4W8BA 4RNIA 3PB2A 4BWLA 1VR6A 2NSOA 4QM1A 5HQMA 1TA3B 2E6YA 1OVDA 5U7SA 2W67A 3VU2A 4TR9A 1MWOA 1O4UA 3A64A 3R8HA 4ADTA 1DV7A 1BSIA 4XV0A 3TQPA 3MZ2A 2PDXA 2WSYA 1UKPA 1UMYA 4ZL1A 2D3NA 4B5NA 4B9YA 1FKWA 3IVTA 4YPJA 1FWSA 2ZICA 4KESA 1VFMA 2DSVA 2XIJA 1Y65A 3MHGA 2J74A 1XISA 2HROA 1JR1A 1GKPA 1Q6EA 4YWSA 1IWPA 4WOZA 3ABXA 3TZNA 2CBIA 3ZJ7A 4JGDA 3IRDA 2ISWA 2V6AA 2B7QA 3N2BA 1IR2A 2QIIA 3H7UA 3SO7A 3WDHA 4M6PA 3M0ZA 3WD0A 4HK6A 2V3GA 2Y5JA 3ATYA 1DP0A 3B0UX 3T0AA 1E4MM 4U2YA 4ATDA 1BYAA 3MSDA 3W7CA 1B31A 2CLOA 2OZ8A 2CEQA 2IS7A 5C7VA 5C2CA 4TVDA 1A4LA 2QXWA 1S2TA 3SY5A 3GR4A 3VFCA 2BZNA 4LY4A 3KCLA 3HQPA 4ZQCA 1CYGA 4B5XA 3TCEA 2Q8LA 5C6MA 2BTMA 3R5EA 4W88A 1FFRA 2BGNE 3MW7A 1G94A 3N4FA 2VCBA 4BA0A 2WJFA 3IJIA 2VVNA 2FGLA 3O05A 1QW8A 4PTDA 2XIIA 2E68A 4QQ3A 4CN6A 5CXPA 1VJSA 4B5UA 3H2MA 3MU7A 1HF6A 1R3WA 2XVLA 2WMIB 2PF0A 3S42A 1EIBA 3TW6A 2D73A 3ORWA 1YNYA 3S2NA 4BCEA 3NEVA 3DESA 3ICJA 3EGJA 5LNVA 1Q63A 5K9CA 3RR1A 3NM3A 3EXTA 4WCJA 4YHEA 4LC8A 4QHRA 3LPOA 2E4TA 4DZHA 2VGBA 3AYSA 3O0FA 3TIMA 4W87A 3J7HA 2Q3RA 1TMHA 3KP1A 1L2UA 3SN1A 2V5BA 1KCXA 3KDOA 1Q2SA 3W72A 4S3DA 3M6DA 3VOCA 1U5JA 4FS9A 3ITYA 2ANUA 3I6EA 1QNPA 2ALDA 5FL0A 2NT0A 3T9PA 4LUIA 4US5D 4Z2GA 4MJZA 1V6UA 3EX6A 3MP4A 4AC1X 4MZYA 4F4RA 3WKZA 3THAA 1E5JA 3PSWA 5RUBA 3W7LA 5E9AA 2DIJA 3CIVA 3CWOX 5FJOA 4UTKA 3KTXA 1Y8BA 4OZOA 4IIFA 3ZVHB 4AG0A 2E7FA 3N9KA 3EDDA 4CU6A 4YWIA 5AHIA 1GOXA 1LLOA 4Q4MA 3L0KA 2B31A 1GVYA 3T40A 2ASHA 3P67A 5A6MA 3CL7A 1AA1B 2GVYA 2FHCA 1I0DA 4L6DA 1F2JA 1W9BM 3KS5A 2P0IA 2YCEA 2PP0A 4N6FA 1DIDA 4EPKA 4UTHA 1EC9A 5I78A 2CZDA 3LERA 3HG2A 3RUBL 1C8XA 1KTNA 2XH0A 1M01A 3EKGA 2HXUA 1ZQ5A 2JIEA 4LSBA 1IIHA 3K4AA 2FB2A 4HHLA 1UJQA 3W70A 2VT0A 3C52A 5AYXA 4PMRA 1HL9A 2W4XA 3GW0A 5A5WA 3W9ZA 1JZ2A 4AZ6A 3OA5A 2TMDA 2MNRA 4I9TA 1EC8A 5C9XA 1NM9A 1A5NC 3UNTA 5LKYA 1KXVA 3HBLA 4YJ5A 1PIIA 2B7PA 3C8FA 3OBAA 1MW3A 4URIA 2C1GA 2XM2A 3IARA 4LAKA 4I9MA 1VPXA 3H8AA 1JCXA 1KFCA 2DSZA 3DBNA 2P76A 1A4MA 4UQDA 1LOLA 2W79A 2Z1WA 5DRCA 4C6FA 4PTXA 3G5EA 3PZGA 4AAJA 3LNPA 4QLJA 1KB3A 2J27A 8A3HA 4MADA 4A05A 5D2TA 3QEZA 4HMCA 1QPKA 3ITGA 4AD1A 2E9LA 3URQA 3IRSA 2BS9A 3CK5A 2PBGA 5BRBA 5ABFB 3GR8A 5DN1A 1FWRA 4O57A 3W1QA 5BXSA 5HMSA 3VM7A 3TX9A 1HNYA 5DLCA 2VGGA 1PKNA 1F4HA 1XBYA 4JL1A 1POKA 2OYLA 1WPCA 4NI3A 1ZZMA 3IJQA 1ADOA 3NQ2A 4Q8QA 2AL2A 3B4YA 3A23A 1I6NA 2B4GA 2FFCA 2GWGA 3WX7A 1IEWA 2YDRA 4MB1A 4TIMA 2WMFA 2OWWA 3M5VA 4J1OA 4U5IA 5BOEA 3H54A 4JEQA 3P8IA 2Y0FA 4UOZA 1FCUA 1V6VA 4HA1A 1OF6A 5BU9A 3VX1A 5C71A 4ZSUA 4HN4A 2PDMA 2QDEA 1A5OC 3TU9A 1H41A 4O14A 3BE7A 1A50A 1HVQA 3C3NA 4M82A 1UWRA 1Z32X 2AL1A 1F6KA 2FB3A 3TFCA 1RJQA 3GE7A 5I6SA 3NDOA 4A4AA 3NCOA 3HO8A 1BGAA 1VPYA 4KEUA 4PBEA 1P43A 4D8ZA 4WD0A 3D46A 3QFWA 3GVGA 1FWHC 1TFVA 2ZRWA 1B2YA 3C0SA 3C3UA 3WNNA 3STGA 2QLYA 4DJDC 2VX7A 2ZA1A 4BS0A 1Q8JA 1QBBA 2FQIA 4W8LA 1JNDA 4WLCA 5JBEA 1B4KA 3CO4A 4JQ2A 3KBVA 1W3NA 4YYFA 3QTGA 3ARTA 3FDGA 3ARRA 2YCLB 4AHQA 1JPKA 1Q66A 4C7FA 2OQLA 2QCMA 3M0YA 3VOJA 3VC6A 2AGTA 1IT7A 2XFRA 2XZ9A 4EACA 2CLLA 3E0LA 3TQKA 4JTRA 3PZIA 1PDYA 2XH2A 2OXNA 3TFXA 4DNHA 3L4ZA 2J7GA 4Q7NA 1JJKA 3RFAA 1KCLA 1X98A 3AJXA 5I7GA 1SW3A 2J6XA 4IF2A 3WLRA 1EWDA 1PHQA 1F7BA 1QI2A 4QNWA 3NQ7A 1E3ZA 4LQ1A 3WUEA 3ECQA 3O7UA 3R11A 3G1SA 2VR4A 3LS9A 2YB1A 4R5EA 4JX5A 1K6WA 1Q6LA 3FJLA 1RCOB 4M81A 3CTTA 1P0KA 1LWHA 3CQKA 4L80A 1A0CA 2VDGA 1OYCA 2AGKA