3H2NA

Structural studies of pterin-based inhibitors of dihydropteroate synthase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
273
structure length
265
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFGSYNEVDAAVRHAKEMRDEGAHIIDIGGESTRVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydropteroate synthase
publication title Structural studies of pterin-based inhibitors of dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis str. a2012
molecule tags Transferase/transferase inhibitor
total genus 92
structure length 265
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3h2nA00
4DJFD 1Q7ZA 2OGYA 3TZFA 3H2NA 4S3EA 3H2FA 3TYCA 3K13A 3TYDA 4S3DA 3H22A 4S3CA 4S39A 4MWAA 1Q7MA 3H21A 2YCIX 3H2OA 3MCNA 2BMBA 3MCOA 4CCZA 4O1FA 2H9AB 2VP8A 2H9AA 1AJ0A 1TX0A 3TZNA 4C1NA 1AD4A 4DJDD 4HB7A 2DZBA 4O0QA 4PZVA 4DJEC 4MWAB 2YCKX 5JQ9A 3V5OA 4DJFA 1TX2A 4D9PA 4NILA 4MWAE 3TYUA 3BOFA 3TYAA 4DAIA 4MWAC 4DJDA 1TWSA 2YCLA 3TYEA 4DJED 4DB7A 2VEFA 3NOYA 4C1NB 3MCMA 4S23A 2E7FA 4NIRA 2DZAA 3BOLA 1Q7QA 2DQWA 2Y5SA 4O1EA 3H23A 3H2CA 3H2AA 4MWAD 1AJZA 3H2MA 3TYBA 3TR9A 1AD1A 1TWZA 2YCLB 1Q8AA 2Y0FA 1TWWA 4S38A 3TYZA 4DJFC 2Y5JA 1Q85A 3H26A 4NHVA 4D8ZA 2VEGA 1EYEA 4DJDC 4D8AA 1AJ2A 2YCJA 4NL1A 1Q8JA 3H24A 4S3FA 3H2EA 4DAFA 4DJEA 1F6YA 4S3AA 4S3BA 4G9PA
chains in the Genus database with same CATH superfamily
2FB2A 4MLJA 4UCGA 1XXXA 2KAUC 3AHYA 8TIMA 3N17A 2CKSA 1X96A 4LC8A 4AXKA 2FJKA 4L9YA 4RV8A 4FA3A 1NOUA 4S1FA 4LV9A 3CL8A 3CC1A 4L4LA 3GNPA 1XGEA 4Q4QA 1VYRA 1ME9A 3CV6A 1CGXA 1XPGA 1V7YA 4W85A 4TIMA 3PZVA 3CH0A 1J10A 2UY4A 4W5UA 4HPXA 1K8CA 4QDPA 3S9IA 1XLLA 1B4KA 5M17A 4DI8A 1W9XA 3WDQA 4ADTA 4JAWA 2ZRXA 3G1XA 1FDJA 1QW9A 3M9YA 1XC4A 1UH3A 2GJXB 5CSUA 4IP7A 4MB5A 2R82A 2IS7A 1FDYA 1MEWA 4J2PA 5I3HA 2ZWYA 5BXPA 4GGBA 4FI4A 4J3XA 4WVXA 2DZPA 2FTYA 3BLIA 3MPGA 4LVGA 3EKZA 3QZAA 3KW3A 4YL2A 2TRSA 2RDUA 1TR1A 1I8JA 1X1OA 3ENLA 3T7VA 2DP3A 1UZ4A 4N4QA 3C2EA 1UQYA 3HB9A 4WY0B 3R8RA 1EBHA 4H8UA 2PU0A 4PCPA 1ITXA 3VOJA 2CLMA 4LPCA 3VDBA 7TIMA 2J8GA 3FY1A 5FEWA 4WCJA 1GG1A 4FF5A 3SFKA 1HKVA 3ZYZA 3F03K 1R30A 3DKLA 4PGLA 3E6EA 3QC0A 5BWFA 2GSEA 1NP0A 4CGTA 1JPKA 3P0XA 1Q13A 3VMPA 2JKPA 1BXNA 4IJCA 4GE8A 2A6LA 3ICJA 3T8LA 1XIJA 2VWTA 2X16A 2NX1A 1VBUA 4LS1A 2HNHA 4JFVA 3I4KA 3TYAA 1VFHA 4LB3A 5A2BA 3N29A 2W3ZA 1IGSA 3BDKA 2PWEA 4TU1A 3AHTA 2DPEA 3AMLA 4HJWA 2GJPA 1KD0A 1W0MA 4DYJA 2GSJA 3CV2A 1VP5A 3PNZA 2PDMA 1J8VA 3VA8A 2YIHA 3M7WA 2XHYA 4Q4SA 4XO6A 4K38A 1RR2A 1V5XA 1H62A 7XIMA 5C9UA 4H9MA 2OX4A 1DIOA 5KZ6A 3GSMA 4JFTA 3NCOA 1XHGA 2QJNA 3PJWA 2Y24A 1P0EA 1DWGM 5FEXA 2XN2A 3PFRA 4H8NA 1UR2A 4WOZA 4FF7A 5FJTA 1JR1A 1A47A 4POCA 2Q09A 4CD7A 3KRBA 1KRBC 3WLMA 1C8YA 1EJSC 2QUUA 5TD4A 4DNHA 4FIRA 5HNTA 4AHOA 2EKCA 2FPYA 3C86A 1E9LA 3IVSA 1UC5A 3OLGA 3NDYA 1H7XA 1GOWA 3ZQ9A 4LCQA 3S46A 4GQRA 3LMYA 3CTLA 3TMQA 5H8PA 3G6MA 2ZUWA 1PDZA 2QF8A 1GONA 3VO0A 3WF4A 4BEQA 1S46A 4LY4A 4MOZA 3WJZA 4Z2GA 3DG7A 4LALA 4LV4A 3HPAA 2ZX7A 4GVGA 1CGYA 3ITYA 3ZLGA 1UP3A 3W87A 1ICSA 1UOZA 3WQPA 5FL0A 3KOZA 2HEJA 4ENLA 1P6CA 1YW1A 3HQPA 1V6TA 3S47A 4RZ6A 1SO6A 4QDWA 5GVJA 1A0CA 1NOWA 1HGYA 1OF6A 2WC7A 3RU6A 3EPOA 3LCIA 1OB0A 3WBXA 4DUOA 2OVLA 3CIVA 3VGDA 1F07A 3VNKA 3N6QA 1XL9A 3O0FA 4MNJA 5HUPA 1KM0A 2Q8ZA 1WPCA 2QPSA 3VMOA 2RDTA 4A3HA 4W88A 1ISYA 1VAHA 1R6WA 1XCWA 3L0KA 3T0DA 1NWTA 1UR9A 4AY8A 1P7TA 4F9DA 2PTZA 1O1ZA 3CXOA 5C2XA 3W7CA 1D3GA 4D6DA 3GNDA 4K1GA 2CHRA 3G0XA 4GISA 1QMLA 1W17A 5DXYA 1YTKA 1W56A 3WG6A 2PTDA 2PDYA 2V82A 1Z41A 3I6EA 4MZYA 1M1BA 3LG3A 4ZTYA 3LHYA 4W86A 4WX2A 2BXVA 3DBNA 4GMEA 4ATDA 1IEQA 4GUHA 3C52A 2WWCA 3AU2A 2YCKX 2VDHA 1TTJA 4FIQA 1K7FA 4O1CA 2F6KA 2JF7A 3G1FA 1V3IA 2NZLA 4IT1A 5G1YA 4IP4A 4C1NB 2H3DA 2X05A 2Z27A 4PMOA 4Z2IA 2X40A 4J7RA 1EJWC 1R85A 3PZIA 2I57A 3TR9A 4HCLA 1LRTA 3WH7A 1Q2SA 1L8PA 1M6JA 1U2YA 3GIQA 4YCPA 5GPRA 1QOXA 1XFCA 1TG7A 1Y7VA 3GXMA 4O8AA 4DXVA 4GD0A 3VD3A 2DW6A 2P5NA 2VCCA 1MQPA 2NWSA 2NUYA 1CENA 4KGJA 4NQ1A 2J47A 4Y9PA 4P8UA 1FWHC 3HU7A 3NIYA 2ZA2A 2VQUA 1JYWA 3TWBA 4N9BA 7TAAA 3UXDA 1UOKA 1FWSA 4O13A 4O53A 4KCTA 3ZJKA 3KCLA 1E71M 4YYFA 2Q02A 2E68A 5TIMA 3QKEA 1FCQA 2C1GA 3ZSSA 1TB3A 3I7SA 5AC6A 3N2OA 5LXXA 1N82A 2YCIX 3H2OA 1ONRA 4ML4A 4A6GA 5A6AA 3FK4A 2R1KA 4P7OA 2PWUA 1E15A 3QW3A 3U4AA 3ABQA 2HMCA 4CD8A 4N6FA 1CGUA 3CUZA 4QX4A 1FA2A 1CXLA 2ZIDA 1ZJHA 3OLEA 4LC6A 5CBIA 3HPFA 2C1IA 5HMEA 5DCDA 1P4CA 1VHCA 4H9XA 4O16A 3B97A 5F2LA 4E38A 1HJSA 5HMFA 4XTDA 1R7AA 2E40A 1MW3A 1RA5A 1R2TA 3POCA 2PTXA 5TAOA 3MWAA 2JGQA 1J01A 3DFOA 1PAMA 3N2TA 3WL1A 1ECEA 4UNKA 2X41A 4MB4A 5D30A 4NJGA 2CEQA 4C6BA 3XIMA 4KEZA 6REQA 4IPNB 4B92A 1W1A1 4J35A 3NXFA 3NR0A 5XIMA 1V93A 4JGDA 2PA6A 1XYLA 2DU2A 3VOCA 2QHAA 3EDDA 3MUAA 2ZTJA 2I5GA 1PPIA 5GJNA 2QMJA 4FB7A 2DVTA 5CH9A 3ZSTA 2J6XA 2XFYA 2VYOA 1PZ3A 2ONEA 2VMFA 1GWJA 3GRIA 3STGA 4JYFA 4WKAA 3THAA 1ALDA 3TSBA 4C6IA 4Y96A 1OK4A 2YA1A 4P7RA 4BWLA 4CN4A 3KL3A 1GORA 5C7HA 3AS3A 4QJ3B 1XD0A 3G1DA 4MM1A 2QCFA 1ZUAX 3GC2A 2Y63A 3HQNA 3MC5A 1R9YA 3B9NA 4A4AA 3GNRA 1KCZA 1AL7A 1GW1A 4DBSA 1J79A 4RR4A 2OJPA 9RUBA 1W3IA 3UG5A 2O9OA 4JIIX 4RKAA 5REQA 1F2JA 5DRCA 4ADSA 4V28A 1JZ2A 1X7FA 4NZ4A 4CNOA 5T91A 2BY2A 4ROPA 2IPFA 3GVWA 2PGWA 3W71A 4US6A 3BTNA 3STPA 4KRZA 4FXJA 5JMUA 2CLLA 1I9CB 4GGHA 4IMDA 1Y5VA 4YWSA 4CQCA 3OQ8A 1F61A 4KCVA 2ZDRA 5A69A 1BAGA 1LUCA 4NYYA 3KLKA 4Z1BA 3MMTA 2FGLA 1KFWA 3P0WA 3C0LA 1FCUA 1M04A 2IKHA 4PMYA 4I9MA 1XYFA 1SO5A 4UNLA 4A35A 2DZSA 5CGTA 3BLLA 3E2QA 5CXPA 3FJ6A 2PDUA 2XGIA 1J11A 2VC9A 4IGMA 4CQDA 4JCLA 4ZFCA 3RCNA 3HURA 1ODZA 1F3EA 1GOOA 1TUXA 2Q3OA 3FA5A 4IQLA 3OEXA 2R6OA 2W66A 3PULA 3UZZA 2X0HA 4I90A 1YHTA 3N2XA 2E5DA 2PPGA 3QBUA 4YHGA 4IIFA 4PL1A 4JTUA 4HNCA 2QCDB 2PC4A 4INFA 2PCQA 2A1YA 4J28A 3E2SA 4N9DA 4JN7A 2FYMA 3AISA 3W0KA 4GO9A 4ONVA 4HK5A 5FKYA 3B4UA 2ZCGA 4LTSA 2BVTA 1SZEA 1E5NA 1QI0A 3A4AA 4GFIA 2EPLX 3NO5A 4W7WA 2DEPA 3AQUA 1UCWA 2YZ5A 4JTSA 4PCTA 1VLWA 5E1QA 3EZ4A 4HMDA 2CXEA 4OTKA 4GQQA 3A4JA 5FJIA 2CWNA 3P14A 1CDGA 2GVLA 4DBWA 4S3FA 4MYAA 4WXZA 4X22A 2FJUB 3TTSA 2PBOA 4QNEA 1W3JA 2C71A 4GI9A 5IFTA 4UOZA 5LNWA 4UTHA 1Q45A 4RDYA 4DO7A 3DC0A 1IWBA 1LCOA 1NWRA 4OJYA 3GTIA 2J66A 1BPLB 4WY0F 3AS2A 1CNVA 2RGLA 4O1FA 3SUTA 1EDTA 1PB0A 2J25A 3UWQA 3CLMA 3DAQA 1E5JA 4JDBA 1AH0A 3RMEA 4BQ4A 3LCLA 3QY6A 3WLQA 2Q3RA 4H19A 1VPQA 1UC4A 3CO4A 1MZRA 1Q66A 4DWDA 1HW6A 1XLHA 4R5EA 3WK0A 1GOQA 3BICA 4L4OA 1W9BM 2WHLA 3KOYA 4GYKA 1DWIM 1MRQA 3VD7A 2D69A 2W0UA 1O5RA 1K3UA 3W2NA 1S2WA 1VFSA 4C7GA 1AW5A 3W1UA 1DIDA 3EOOA 1XRTA 3UXAA 1CCWB 3P81A 1RAKA 2QJMA 5CJ5A 3R94A 3VGBA 1XW8A 4US5A 4XO7A 4LAOA 2A4AA 2XIQA 3BZGA 5FEZA 5DQPA 4LX4A 5CSSA 3QSTA 1CXHA 2WKLA 4NZFA 1DJNA 2V2CA 3IVTA 3U5UA 4LSBA 3W6YA 2NQ9A 1J5SA 1HGWA 4U3AA 1B31A 3E74A 4IMGA 1E0XA 2WMFA 5KITA 2D0HA 2O9RA 3XISA 3S4TA 2EG7A 4V1YA 3NGFA 1TPH1 3VABA 3VZZA 2H3BA 2I9EA 3BAJA 4H6KA 3ABOA 4YHEA 1JFXA 2FHBA 3VOFA 4FX7A 3W84A 3WY1A 1KRAC 4AD5A 4JL2A 2TAAA 5BRQA 1KCLA 1L2QA 3B03A 4R3UA 1DQUA 4H9YA 4DWSB 4LANA 2NX3A 3P84A 2XSAA 2EHHA 3FDKA 5C9WA 3PPCA 2Y88A 2PS2A 3WBAA 3URAA 5G4HC 2VX4A 3GVGA 1ONEA 2PB1A 4KETA 4EXQA 1V0MA 3WLRA 4A8LA 4UOJA 4B4HA 3TW9A 3TOPA 5DBTA 1RUSA 4QNWA 5FAJA 1GNXA 1E0VA 3IJ8A 4V15A 4AZCA 3LERA 2E1DA 3PNUA 1TTIA 1H41A 1SZRA 2CWXA 2QCLA 4JQ2A 1QW7A 1ISXA 2ZRUA 1EDGA 3KOWA 1E3ZA 2PDFA 3RILA 1KNWA 4GKLA 2BXYA 1JDCA 3LHWA 1SVDA 4F0RA 1M7OA 2Z2UA 4J2MA 5LIKX 2NT1A 1MXDA 1W3LA 2PRMA 2VP8A 1R2SA 4HA0A 4E3VA 5K3VA 3OW1A 3RPMA 4QLLA 5E70A 3Q4DA 3W7IA 1BKHA 2XWEA 3IAPA 4B91A 1UKPA 3NM1A 3VNJA 1FWCC 3VNYA 1XH0A 3GTHA 4FZIA 2XIMA 3BSMA 4B2DA 3DGBA 4QGCA 2YLLA 4LUSA 3UPWA 1PCWA 2HPIA 4IP5A 2G3NA 1RP8A 3OG2A 3HBLA 4Q4RA 1GQNA 1FH8A 4F9JA 4I5XA 3GD6A 2GVJA 3AZTA 5C54A 3HG2A 3NZPA 3BGAA 1ODUA 3GC5A 3E2VA 4HVXA 2V5JA 1VBHA 3BV7A 2WNNA 5K9XA 1YPXA 1MFVA 5HJXA 4K6AA 4AG0A 1OEPA 2A0NA 1S1PA 1FVPA 3MKKA 1OG0A 3O15A 4FEZA 1EP2A 5C9ZA 3TU9A 5DN1A 3WLPA 2WPGA 4IUGA 3RITA 1NFBA 5XIAA 1SJBA 1XQLA 2Y8VA 1IWAA 2I5IA 1XSIA 3SCQA 4JTQA 3UCCA 5I3KA 1WP6A 1TQXA 4UTLA 1P7TB 4AYGA 2HCVA 3WELA 3K30A 3G6LA 4IXXA 4L1XA 3S2MA 3DFPA 4MJ2A 4S3GA 3AIWA 2NW0A 4AVNA 2E6DA 1E4LA 1HJWA 2XH0A 4IMFA 4K37A 4O28A 2PDQA 1RQBA 1HXJA 3WDHA 1JXKA 2BV9A 1UD6A 2WB5A 1WDWA 3G1RA 3C8NA 3KTCA 3RIKA 1LQ0A 4IMEA 1DJZA 2X7WA 2YW3A 1YE6A 3OG3A 3KBSA 1ISVA 3LQGA 4NIRA 4M80A 1WDRA 3A23A 5EMLA 3T2QA 5HMSA 1DWJM 4CD6A 1VIWA 3LTPA 1R3WA 4B5TA 3S3GA 5CAHA 2YXGA 1NF7A 3W1NA 2A3CA 4B9ZA 4UWMA 3VFLA 6CGTA 3KS5A 3N9KA 1GZJA 4B4FA 1RP9A 4XBKA 1P6WA 4L1GA 4A2SA 2Z2AA 1SQ7A 4ZE4A 1LP6A 3R0UA 3GR8A 1V3JA 4JKLA 3AU6A 4CNTA 4XKMA 5CGMA 4WLCA 2GVGA 1EQPA 1F8IA 4DVOA 2XZ7A 5C8BB 2FZBA 3KHJA 2HZGA 3H2NA 2CLIA 4GUIA 2ZZ6A 4F0KA 3AHXA 1RJQA 5I6SA 1QPQA 3QGVA 3AC0A 3WF2A 1JZ8A 1UPMB 1JUBA 1XD1A 4KIRA 1JCYA 3T08A 3W7JA 4IPLA 1T40A 3PHAA 4WKFA 4KWVA 2CBVA 3UG4A 1ONWA 4FLSA 3N15A 4EPKA 1CI1A 4JTFA 1JPDX 4QROA 4F0LA 2V5DA 1PZ1A 4CEXC 4J3TA 3IPWA 5BYWA 2FH6A 1SW0A 1Y0EA 3E12A 4N7QA 4UQDA 2C19A 4OWGA 3AXXA 3ITCA 2HPMA 4E4UA 4DYKA 4GWEA 3EA1A 1PTAA 2VOTA 4DF1A 1JUEA 1LLWA 3PBUA 2EXOA 3PZMA 1ZB5A 1TJ1A 2QIWA 3S2CA 3B9DA 4XX6A 3RHGA 2FVLA 1LL4A 4GC3A 5G4WA 2JIEA 3BLFA 5DMLA 3AYVA 5FSDC 4ZQRA 5C5YA 4FR1A 3CHEA 1Q85A 1F4HA 2INZA 2PWHA 3DFYA 5CLTA 4KRUA 1R86A 3L0GA 1JVNA 2Z1XA 1G4PA 2VX7A 4YXGA 1V3KA 2X7VA 1ML1A 2GJLA 2Z1BA 4UMAA 1QNSA 2E3ZA 5AC5A 6REQB 4GBDA 7REQA 3VINA 1E0UA 3IJQA 1GCYA 3GZ3A 5AC4A 1AQMA 3MYPA 1QXLA 1XF0A 2V5LA 9CGTA 3UWVA 2JEQA 4MMWA 4JTAA 4UCFA 3E49A 1UP2A 2GZXA 3TKFA 4C5ZA 4GVIA 3TZNA 2NQLA 4HB7A 2DQXA 2WMHA 1JCMP 1ENUA 1AZ2A 4NRRA 4QDMA 3KP0A 2VGBA 3SN1A 4LQ1A 2C15A 2J79A 4YMZA 1O1HA 3ZWTA 2P3EA 1VFLA 4GK8A 2WHKA 3GBDA 4W8BA 3TYEA 3NNTA 4HYVA 1H63A 2DZAA 1FWDC 1IEIA 1M3UA 1LT8A 3THQA 3AHVA 1DXEA 3R12A 4LH8A 2Z0IA 3I4EA 4PA8A 3S5ZA 1B1YA 5D09A 4RXGA 3C2FA 3EB4A 1BRLA 1AODA 1F3XA 1A3XA 1RSCA 1SMAA 3NWRA 1YTEA 5REQB 2IKIA 3MP5A 3MW7A 2QGYA 3SCSA 2PWGA 1GZ1A 2VJXA 2BY3A 2GUYA 2Q8LA 1TR9A 3T81A 3N11A 7ENLA 4MIMA 2V9DA 4QM1A 5IHRA 2EJAA 2Z4GA 4YCOA 2VZVA 4EF9A 5ABHA 3QSRA 3DKJA 5I3JA 2ZWZA 2OX1A 5CC7A 2CERA 2BTMA 2NQZA 2J9YA 2Q8XA 4FLRA 1LUCB 1TMLA 3P74A 3OP2A 4WEVX 1FH9A 4TTUA 3CUIA 4UQAA 1WKEA 3L9CA 1DQWA 2D22A 3EEGA 3NQDA 4IPPA 3A3HA 1MDRA 2Y2WA 3GH4A 2YA2A 1BWLA 4JL1A 4KFOA 1K7EA 2Y8UA 1PHWA 3URQA 1DTUA 2WMIA 4C5YA 1JAEA 5E9XA 3T55A 4F3HA 4NI8A 5G4EA 2D0FA 2Y89A 3WDPP 3LCXA 1JRBA 1W3KA 5I79A 2Y7GA 3AIEA 1GOXA 4CCDA 3P80A 3VIGA 3BCJA 1DJIA 3R79A 3KM8A 3PB0A 1ZZMA 4C6NA 1E4NA 1PBGA 1WCGA 2WVVA 4E0CA 1EKOA 2CLPA 4LXFA 1J6PA 4MY8A 2WXDM 2P3ZA 3SUUA 2VGGA 5CPMA 1AMYA 1NDWA 3M0LA 3OLIA 1R47A 4PODA 1UKOA 3CZGA 4JEJA 1FDZA 1R3RA 3UWUA 2JFEX 1P0BA 3ZT7A 4Q7NA 4NSBA 3BSGA 3EDFA 1Z6KA 4JFUA 4P2VA 1A5SA 2NV2A 5HMDA 3HV8A 4GH3A 3W3OA 4HQVA 3VIPA 1VGAA 3CB8A 3BG9A 1EUNA 4V2XA 5DMMA 2A7RA 1XJBA 1T96A 2J4GA 3IV8A 3VNIA 4UIOA 1RLCL 3M0HA 2BASA 1XDLA 4D6FA 3EDJA 4Q8WA 5A6JA 2VZUA 2E5CA 1NY1A 1VC4A 2I5QA 4AMCA 3ARVA 3ORWA 4A29A 3T8QA 3ARXA 5E6ZA 3G77A 2YBTA 5HJYA 1SR9A 3QM3A 5CPTA 3C2VA 3W22A 3E02A 2NLYA 1IXQA 2DT2A 3NJ3A 4JNZA 1TQJA 1UUMA 2XIIA 1QCWA 4ZXOA 1KFCA 3WD2A 2EPKX 2QMKA 1QASA 2WLYA 1IXOA 1X8FA 1GJUA 2VL4A 2Z26A 2C6QA 2J6VA 5B7YA 4PUWA 3JZEA 2IPWA 3KLLA 2GL5A 1XC6A 4BFAA 2VC7A 2OO6A 4Y9MA 2BBFA 1ONXA 3R8HA 1JPMA 1K03A 4NU7A 1B3XA 3AYSA 1SZFA 3F4CA 3W1AA 3OZOA 5JIPA 1Y5XA 5CBJA 4P8XA 1NF0A 4MKNA 5TBOA 1DE6A 4FP1A 4PMUA 3SCWA 1ADOA 2IXUA 4LVAA 4RPQA 3MMDA 4U2ZA 5AHNA 1HIZA 1VFTA 1IR1A 3PSWA 1OVDA 2FKPA 3GG0A 3BARA 2VNCA 1DBTA 2H9AA 2ZXDA 5BXTA 2FFIA 3S0CA 4EPDC 1AD4A 1B3YA 3DECA 4ICCX 3LU2A 3NDZA 1UKSA 3L4VA 1MZHA 2C13A 4Y9OA 3UJSA 4XK2A 3FN9A 1XLAA 3UR5A 2O0TA 4N6EA 2WNWA 1TJ2A 3E3HA 2CU0A 4GO8A 1QBBA 3O0KA 1WO2A 3WUFA 3V35A 3VD5A 2J24A 4BS0A 4NG3A 1KBLA 2WM1A 1TV5A 3QOMA 1JEZA 4AIEA 4HNTA 2PP3A 4F48A 3MS8A 5F7UA 4MNLA 3GU1A 1VYPX 5ABFA 3IRDA 4PSRA 3BCDA 3F5KA 4DZAA 1DOSA 4ZO8A 3LGDA 1HJUA 5E9AA 1A0DA 4IMCA 5C9XA 4FO4A 2WYSA 1Q6FA 1XBYA 4UB9A 4F0MA 1QDSA 3CIWA 1T6MA 2OGYA 3WFZA 3PBMA 1DIKA 1GKPA 3FOKA 3RX2A 5CCZA 5M03A 3AOFA 2OQHA 4ZQMA 4F0HA 1R9ZA 4MFDA 4AZCB 2QCHA 4N2YA 2R9RA 2B81A 4LYRA 1T99A 4A3QA 1PV8A 1W1TA 4H6RA 3P2VA 3NOEA 1FWTA 2Z7GA 2V38A 3QEZA 4W8LA 5HQEA 2YL9A 1JZ3A 1OFEA 1ZAIA 1W1VA 2A3AA 3B8DA 4GNKB 3ZT5A 3SURA 5LIXX 2ZXQA 3SI9A 3VDHA 3IUDA 1XLGA 3OTRA 3RAOA 4H2CA 1O6IA 5AY7A 3EEZA 3P3BA 1EQCA 3ATZA 4PMDA 5LSMA 3M4HA 4QCFA 3NL2A 2D2GA 4KPLA 5CGQA 3LYEA 2PZNA 3PZQA 1AD1A 3EMCA 1A0EA 4LUSB 4UOQA 3P5ZA 3GO2A 1O68A 2BVDA 4HHLA 5EB8A 5LNSA 4L9ZA 4Q4KA 4MAZA 3G5EA 4YPJA 2YCJA 2AL1A 2F2HA 1TE6A 3WF0A 2ZZ3A 4O52A 4DJFD 2BDQA 2V0TA 3WQWA 1KLYA 1JCTA 1A5MC 4R9XA 3B0YA 4KFPA 4V27A 1VD6A 3QW4B 1I4NA 3CWNA 3W07A 1UR1A 3GQYA 3I6RA 3WBYA 3K1GA 4AD4A 1SJDA 5IHSA 3SZ8A 1S5VA 3WJWA 1E6PA 3D3AA 3NQMA 4AZIA 1R3YA 1LLZA 3STFA 4B5XA 3EB3A 3SN4A 1FFQA 5HOSA 3HPSA 3UJ2A 3FXYA 3QMSA 1J0YA 2AAMA 3CB3A 4IJBA 3JVAA 2E09A 1H1NA 1MUWA 3KXQA 1X1ZA 3HGSA 4CNNA 4ICNA 1VFOA 3ARYA 5GNXA 3BMVA 1LBFA 4XAPA 1GYLA 3A4WA 2HJPA 3FHQA 3QQ0A 1TPFA 3QTPA 1YIXA 3OVQA 4K39A 3AMKA 4M6VA 3TXZA 5ABGA 4FMVA 5FEPA 2QEZA 1DORA 5E93A 1XLIA 4BQ5A 2ACSA 2VEGA 1HQTA 2V69A 4UNIA 2J27A 3C2RA 2BGQA 3H24A 2QPUA 3W26A 3LXCA 3F5LA 1TZ9A 4ZODA 1E6QM 2WVUA 4YNGA 1QPNA 1W1ZA 4XAZA 4ERGA 4LU0A 3T09A 3TC7A 5BCAA 1LQ2A 2G4JA 2PZ0A 1HKMA 2GVYA 1JXJA 3GFYA 3VE9A 2J75A 1LORA 1GVRA 2IKGA 4IIHA 2VELA 3RK8A 5HULA 3IARA 3KHDA 4GRSA 2C14A 1OX4A 4FNPA 2OFJA 3W7NA 3BMXA 4G6CA 4LEFA 1KLZA 2NQHA 3PWIA 3BCFA 5SWUA 1KB3A 4U33A 1KFBA 2F61A 2GDQA 1CB2A 4Z1CA 1KXVA 4AEEA 3TR2A 2BODX 1KBKA 2CLEA 2A7PA 4DJED 3ZS4A 2XVKA 3GH7A 3W81A 4P8VA 4OOZA 5AHIA 2PBGA 3VX0A 4ZZ9A 3RXZA 3BLOA 4D6EA 2R8WA 4R53A 1EX5A 3Q94A 3W7MA 1NELA 4K2SA 3RU8X 4GUJA 3KTSA 4O1BA 2YL6A 1BXCA 4PB4A 1DWFM 2PSNA 2W91A 3QQWA 3WK3A 1YBQA 4NHVA 4EWND 2ZUNA 2YFOA 2PDIA 1X6NA 5H6HA 2BOEX 4D2JA 3L2MA 2HXTA 1D8WA 1YNQA 4GVHA 2DZUA 3FV9A 4PMJA 3UJFA 2WQPA 4M7TA 3CZJA 3GXPA 3QGAC 2VR2A 4G7FA 3ISIX 3BJTA 3DH7A 2YL5A 3W83A 1VJIA 3K8LA 4DX3A 2OQLA 1Q6DA 4XAYA 2VRKA 1IEWA 3QVQA 3AWOA 4AQLA 4YTRA 4G2DA 1XRVA 1GTHA 7REQB 5I7GA 4P7NA 1QPRA 4PZVA 2X30A 2D24A 1EPVA 1ADSA 4ZB0A 4FSAA 3U2CA 1QWKA 3NG3A 2VUYA 3OBEA 4ASTA 1K77A 1BYAA 1KM1A 3CYJA 1MDLA 2WSPA 1G67A 1UW9A 4O57A 4H41A 3EXSA 3GB6A 4LT9A 5IDIA 2Y4SA 4KGLA 2FZDA 1W54A 1V08A 2QAPA 1XH2A 2EEXA 2CZFA 5EA9A 1VJZA 5MF5A 1VCFA 3PK7A 4IPIA 4D1JA 3CU2A 3S2NA 1XCXA 4NAEA 4PE8A 1VHNA 4JZ5A 3B9AA 4QLJA 2ZUTA 3AXIA 1ADDA 3UXIA 1THFD 1HL8A 4C65A 3AXHA 3LCGA 2E1WA 2KX9A 3HM7A 2VRQA 1O4UA 1DJHA 1JYNA 3W76A 3VD9A 1RCQA 1DXFA 2HSAA 4O17A 4MZ8A 4GABA 5AYYA 3UWEA 5AHEA 2ZICA 3NGJA 4IGNA 3ECQA 3SGZA 2GGIA 3K13A 2QDDA 2MANA 2IKJA 1I45A 3IJ9A 5EFFA 3KBJA 3PSVA 3LK6A 1OCBA 4QAWA 3PC0A 3DERA 3W2LA 5LGXA 1N8FA 2OU4A 3NO1A 3QR0A 3LA4A 4ERAA 4OT7A 4M81A 3O8AA 4HYRA 3RYSA 1X7IA 3FA4A 2VFGA 5XINA 1DJQA 1OJXA 1UJPA 3GBEA 4XD5A 2F38A 1F05A 1OX5A 3COTA 4D9PA 1XFBA 4K36A 4Q8PA 4Q8TA 2G8ZA 2ZVIA 4DAIA 5K2ZA 4X61A 1A3WA 4HNNA 3UZXA 2WANA 1XX1A 2QJGA 4NZ5A 4QFUA 5TQLA 2YYUA 3LCWA 3QV9A 3PN8A 1EDQA 2WMIB 1UIOA 1IIGA 5AHLA 1FRBA 3G0UA 5JVLA 2AOSA 4D6IA 4C6LA 3F7JA 2C1HA 1J0ZA 2GUUA 3MZ2A 1OGSA 3NPUA 3GE7A 1GKRA 4Q4MA 1RPKA 3U7VA 2AAAA 1OCJA 4CNUA 5MKGA 1OQFA 2W62A 3ITLA 2WCGA 3LM7A 1BYBA 2Z6IA 4GVFA 5G5IA 2PDWA 3QRHA 3WZ0E 2WVVB 5C2GA 4PRWA 4UZSA 2PCEA 4A3RA 2GJNA 2GK1A 3OVPA 3AROA 4XKYA 4PYSA 2Y5EA 1ZSXA 4ZQOA 1UBPC 2POTA 1OHLA 1UP0A 2V5KA 4AD3A 2C8NA 4PMXA 3PZGA 1KRCC 3M1ZA 4QS6A 4UTTC 4KEVA 1C7SA 1EZWA 1QTWA 3KDNA 3W01A 3BK0A 3GW0A 3EPMA 3SCOA 3I3BA 3BW3A 3WQ5A 5I06A 4RZ5A 5KTLA 2ZYFA 4O10A 4QJ1A 4CD5A 5M3WA 5LIUX 1SM9A 3MUIA 5DMNA 3MCMA 2AMGA 3WQGA 5I2UA 2V5CA 5EKYA 4X9YA 2CZEA 1QNRA 2VWSA 3LHVA 2ZRYA 2XGBA 2ABBA 3RUBL 2P50A 1I2PA 4LF2A 3W82A 1K8XA 3U4FA 1EP3A 4J9JA 3WN6A 4AAJA 1Q6CA 4GNJA 2DW7A 4LCRA 1UROA 1J2BA 1LT7A 1TTPA 4C1LA 5FJOA 3S1UA 5H2ZA 3HGJA 3AFBA 1K7XA 5F1VA 2XFWA 5D2VA 3WK1A 4E2OA 1JNDA 4AY1A 2OYLA 3FKKA 1K9DA 2BG5A 4MPQA 3K46A 1B4EA 8CGTA 2DT3A 4QG9A 1KFKA 1UQZA 4FOKA 4Q6JA 3UA4A 3SDOA 4P7QA 2YDRA 4JBRA 1EGZA 3MP4A 3GTXA 3KEHA 5HUOA 4HU4A 2ZUMA 4IICA 2OYKA 3OYZA 4QAIA 1KXQA 3KZPA 4UFKA 4DM1A 2QT3A 3GFXA 4YTTA 2CC0A 4N0RA 3CMFA 4GFSA 4W93A 4CVWA 5JH1A 4PR4A 2PURA 3BLEA 3AMDA 3MA8A 4JS3A 2ICSA 4Z17A 4PBFA 1TV4A 4BKNA 4JICA 1E9YB 8XIAA 1J5TA 2H8XA 1KQZA 4S3JA 4FLQA 3TONA 4ZEPA 2XUCA 1VPXA 1REQA 3BWWA 4A3YA 1OBAA 2BGSA 8XIMA 1EO7A 2EG6A 4IIEA 4UTUA 4ZXLA 3GDKA 1YPFA 3KBNA 3T0TA 1OYCA 2J78A 3O6DA 3A64A 4UQCA 4DLMA 4YVXA 3G0SA 3LBOA 5CZSA 1XLDA 5E0KA 1GVSA 4J3VA 3GXIA 5FI8A 4H6EA 3UZ5A 1H61A 1I0DA 4IWWA 2BXZA 1RK5A 3WQ4A 4B5SA 2WW5A 4GLEA 1WYIA 2VKZG 1UMYA 2ACUA 1H1ZA 2Z7KA 1JGIA 1G69A 1RA0A 1TMHA 4IQDA 3U2OA 1HKWA 4BF5A 1UZ1A 4W9TA 4WSKA 5M2FX 2QCEA 4AEOA 3WLOA 5LA2A 3B9OA 3U5YA 1L6FA 3W1QA 2HK1A 2XTKA 4PB3A 5ABFB 3NQEA 1S3TC 1FQ0A 4XZBA 3R0KA 5AC7A 4CQAA 2ABAA 1GQKA 4QBXA 5CG7A 1OYAA 1UB3A 5K9CA 1HKJA 2J8FA 1GPFA 5T9BG 5L9FA 4M29A 3VD4A 2J9ZA 2W9MA 3V16A 3G3MA 1JRCA 2DZBA 5AC8A 2GOUA 3IK2A 4JQ3A 2CLHA 4AHPA 5C0QA 3ARRA 4UFJA 2JBMA 4I7VA 3PTKA 3U2ZA 1Q6LA 2HVOA 1KW1A 4HSNA 1VENA 2G3FA 4EXAA 1Y65A 3TSMA 5J5DA 5D9NA 1IZJA 1W31A 5F2MA 3WMCA 4UFMA 1J4EA 2HWGA 5AVHA 4PULA 5CLWA 3BAWA 5KZMA 1TRDA 3DFQA 3VC5A 3H2CA 1TJPA 2VZSA 3WQEA 2EO7A 2QUNA 1DXIA 2WK2A 4H7VA 1BF6A 4GINA 1JPHA 3DYMA 1ZBVA 1X6UA 3VM7A 3EWUA 3BAYA 2OEJA 3GG8A 4GJJA 3TTEA 1SO4A 4Q33A 1XUZA 4DJFC 3HIJA 3GKAA 2XPKA 3M0ZA 3HTWA 1F73A 4OV4A 3VNLA 3MBDA 5AB3A 3ZVHA 1RD5A 3W2MA 3N04A 1R9XA 5E6YA 3A12A 4N9EA 3LSBA 1DJWA 1PKLA 3RGTA 4OZOA 2PMQA 3MDUA 3L2IA 4MHBA 1KCKA 3IUIA 2CPUA 1QHPA 3AS1A 1GK8A 2ZKMX 3SQMA 4JQ1A 1R2RA 1CZ1A 1KXTA 4N4PA 1UR0A 3N6HA 2P0IA 4DNMA 2MUCA 3O16A 2QZRA 1JQXA 1HVXA 4JKKA 3SCNA 1AJ0A 3LN3A 1Q65A 4E3TA 2UWFA 1TVNA 2DVXA 3SIMA 3UGRA 2Z24A 4EWJA 3T0AA 1T0OA 3INPA 1JAKA 1KM5A 3ZO9A 1EFZA 2PWDA 4LCSA 1K6AA 3BOFA 2E6YA 4JXCA 2QLYA 1W5NA 2V67A 3TTYA 4XZNX 1XBXA 2G50A 1C8VA 4ZVJA 1GOKA 1JCLA 1IF2A 2PWFA 3W88A 4JTIA 4ATWA 3VCRA 2QDGA 4LNCA 3GTNA 3OA3A 5FJPA 5I00A 1S2UA 1DP0A 3GXNA 2VCBA 2TMDA 4HD5A 3V1HA 4Q22A 5AZ1A 4HK7A 1FWIC 3EMQA 3WSUA 4GCXA 4C6QA 4FNQA 1US3A 2PF0A 3GHUA 4BI5A 2E28A 1AQFA 1NDYA 1FWGC 1QW8A 3RM9A 3BMWA 3UNDA 1TPVA 4K8HA 1H7OA 5DANA 2DVUA 2NQJA 4N9CA 4Q32A 1P0DA 5DT5A 3ARPA 3T0BA 5LHEA 3W7DA 3MO4A 2VRJA 3CQ0A 1E6ZA 1H0GA 3CK5A 3M0XA 4TMCA 1J0KA 4DYEA 2BY0A 1WBJA 4AZ7A 1BG4A 3W25A 4FS9A 2HV5A 3NQVA 3W72A 1WA3A 4DJEC 5CJNA 4E4FA 4O50A 1OADA 1TV8A 3W1TA 2XFFA 3B8TA 1BWKA 4PSPA 1OX4B 3RRXA 2HTMA 4JCMA 4F79A 3REQA 1CB7B 3ABRA 3VX1A 4GUFA 3SRKA 2G0WA 4IGSA 3I68A 1SYTA 3RO6A 4ZO6A 2BHUA 3S2JA 3ONBA 2QW5A 4H1ZA 3B8VA 4UTFA 3O1NA 1TJRA 3KCJA 2QUTA 2Z29A 3MUCA 4KWOA 3CWHA 3WF3A 1UD8A 4D6CA 5A6LA 1EYWA 4Y9NA 3R2GA 1KM3A 5EBUA 4E2VA 3LLDA 1DV7A 4CU8A 3JR2A 2ESCA 2Y7EA 2V6AA 4QCEA 3L65A 4KCWA 3RRAA 1YBQB 5FD0A 3LMZA 1PXGA 1HG3A 2WVTA 4HZ8A 5HQLA 1SR0A 2J77A 5CZ0A 5DX7A 4IQJA 4DWSD 3RM4A 4DEFA 1BGGA 3IJ7A 1XLCA 3MJYA 2NWRA 3VKAA 1TKKA 1LWJA 1YEYA 4BQ2A 5FF0A 3VGHA 4OECA 2YX0A 4RZBA 1B9ZA 3MZNA 3A3WA 2YDAA 4QTGA 4B3LA 3FSTA 3OZMA 2QUMA 4PUEA 3GDRA 4JYDA 2GDVA 1RJRA 1XG4A 1V03A 2QIIA 1Q6OA 3II1A 5A6KA 4DPQA 2ZXBA 1KCXA 2VFEA 3TW6A 4TV6A 3E0VA 2PODA 2PDXA 2CXGA 2TYSA 3H7RA 1B3OA 4J3ZA 3AZRA 4GIRA 1J12A 3E2RA 1BD0A 1FWJC 1HJVA 5FIPA 4D8ZA 3E0LA 1XBZA 2IQ0A 2YCEA 5T26A 5CKSA 4AISA 4QJ5B 1MRAA 3HJZA 1UWQA 4QSFA 1BSIA 4P5UA 4KCUA 4NAEB 3QV6A 3VM5A 4UTTA 5LYRA 1QR7A 1TVPA 3IGHX 3Q58A 2YYTA 4MGGA 3VIFA 5A94A 3STCA 2QJIA 5AOUA 4MB3A 4B5NA 1W5OA 1E73M 4LAUA 4PBGA 5E0FA 7CGTA 1G94A 3ARZA 3UWYA 4Q7IA 3GX9A 2C3ZA 4C6MA 4ZA0A 1EL3A 3L23A 1W9PA 1NOFA 4CKQA 4C91A 1OIMA 3NL3A 4RNHA 3IIZA 3TJXA 1K9EA 3DBPA 1ZP3A 4WSJA 2D73A 4MKVA 4WXYA 4E8DA 2X1UA 1GQIA 4YS1A 3MJMA 1QRQA 3V75A 1SO3A 3F4NA 1ECQA 2QR6A 3CBWA 1FHUA 2YCLA 2AQOA 1K70A 2WV8A 4ZR8A 3FAWA 4RE0A 3NEVA 3WLKX 1UPPA 3SUVA 1FKWA 1CGWA 3E0IA 4KWUA 2VVSA 3B0UX 4B5WA 2QCCA 1YKWA 2X8RA 1LROA 2OZ3A 1XUUA 4IXHA 2J7EA 2Z1SA 3A6OA 3H6OA 3M64A 4P7LA 4ZE5A 4CQBA 2CESA 4MDOA 3G1HA 4R9OA 1YXYA 2YGYA 3W28A 2FPTA 1DQXA 1Q8JA 1FP8A 4ZO9A 5A1AA 2DSKA 4K1WA 1JULA 4AC1X 1U83A 1V6UA 4M19A 1AL8A 3FYPA 4D71A 4XSLA 2FDMA 3W7OA 2OLAA 3WD0A 2BP1A 2DIEA 1O95A 1EIXA 4CLMA 3VNDA 1KBBA 3PUOA 4ZL1A 1HKIA 4RE2A 2GQ9A 5LNVA 4KKXA 5MKGB 1XRSA 2WO5A 5K4XA 4G8TA 2I17A 2QJHA 1QHOA 3OU8A 1XIBA 3DG3A 3WK2A 3CJPA 4XZIA 4JTGA 4RDWA 4TVUA 1YTDA 4XKYB 2OKOA 3QHOA 3ZMRA 2I14A 2VC5A 4UFHA 1P48A 3NQ7A 5ABTA 3APYA 4HP5A 3SJNA 3CYVA 3U57A 9XIAA 2WBKA 5CSYA 3L4TA 3Q65A 1PL9A 2RJHA 1JI1A 3GAYA 4HN8A 1KBIA 1WUFA 3TJLA 4QR6A 4Q7BA 3RR4A 4CVUA 1L9WA 1VBGA 5LKYA 2ZE3A 1MSSA 3IJLA 4PTDA 2X1TA 3KX6A 1IE7C 1TVLA 3D6NA 4LAZA 2A3EA 4HZ6A 5HAOA 1A5CA 2DZWA 5A8MA 4DJDC 1UUOA 3EKLA 1JZ4A 2ISSA 3VUSA 2OMAA 1EJ7L 3C0QA 3LPFA 4KEMA 2VR5A 3KRZA 2XJ7A 1KTBA 2W61A 4HU3A 1TCDA 2WJEA 5BRPA 1GT8A 3H22A 4O14A 1GYMA 2VQTA 4PUDA 3QOKA 2UBPC 2OKTA 4XSMA 2HS8A 1V3LA 4K8EA 3TLQA 3NSMA 1ZBKA 4MY9A 1BHGA 5D05A 5LNUA 3TNBA 1IT7A 4PUUA 2ZXAA 1L6SA 4Z0SA 5CAKA 1A5LC 1V3HA 3CEUA 3PG9A 2J74A 4C6JA 1FXPA 3WNPA 5EMKA 3K5XA 1UD3A 2HXUA 4KWSA 1PS9A 4P8WA 3FGCB 5HNUA 4HNUA 4DJFA 1XLBA 4URIA 4GY1A 1OFBA 1T5AA 2ZX9A 3S6DA 3VKBA 3LB0A 4KFNA 1RXOB 2CKRA 4DXXA 3CUJA 2FB3A 3T6CA 3VNZA 4GBUA 3EWDA 1QOQA 2ZQ0A 3BGJA 4NY2A 2DJXA 3NXLA 3MUXA 2V3EA 1SZNA 2J9XA 3TVAA 3PZNA 4NAFA 2R14A 1YYAA 3PG8A 1OD8A 1GQJA 1J93A 1W9DM 2EPOA 5HATA 3USZA 4RX0A 3P8IA 3CPRA 3OJGA 1ZY9A 1WB0A 4Q8QA 3GYEA 1REQB 4DO6A 3BJFA 1N55A 1OC6A 3NQFA 2D0GA 3PWAA 4BHYA 3NYDA 4B5VA 2EPMX 1MW0A 2DZXA 4KQNA 5D38A 4JDYA 4LAMA 1A50A 3WJXA 3IGSA 3PBGA 1EC7A 1POJA 1LM1A 3QYQA 1JDDA 4W5ZA 3UR7A 3MVIA 3NYZA 4FNSA 3A9BA 2OLHA 2FH8A 1Z69A 4JNYA 1X1NA 3CHVA 1KWKA 3MP3A 4LUJA 3UD6A 2ZX8A 2YFNA 3UR2A 3BPWA 3QF0A 4QLKA 3EX6A 4PEKA 4MUZA 1UYQA 5G1MA 4ZB2A 2VCAA 2I9UA 1YLVA 5BZAA 2O55A 2WSYA 1WOBA 2OEKA 2YLAA 2PLJA 3WH6A 1NVMA 2VX6A 3OPSA 3JS3A 4LBRA 1MW1A 2WSKA 3OVRA 2QYGA 3GXFA 3M47A 3M5VA 1KV8A 1BLIA 4ZTXA 1MNZA 1QT1A 1B0IA 2E25A 4GIEA 3WNMA 3B9EA 3IJDA 5C70A 1TWSA 4S2BA 1OZMA 4RLIA 3EYPA 4Z2HA 3G1VA 3NFUA 1GTEA 3NAVA 2XSBA 4J27A 3TNOA 3MSGA 6ENLA 3TN6A 3BJSA 4K68A 3LOTA 1PWMA 4HZMA 3UJRA 3LXBA 2OSXA 1WAWA 5A95A 3URNA 1L8NA 2VVNA 2WMJA 1LBLA 3NVDA 2F6XA 2HDJA 2BOGX 2XG9A 4GY7A 4HKPA 4HMCA 2XIJA 3CT7A 1WZKA 3FSUA 4UTIA 4GJ1A 5C71A 3WQ8A 1E51A 3MMWA 2WNQA 1HTIA 2C16A 4DJEA 1F6YA 4MNKA 3G1YA 1TPDA 4TXEA 5CZKA 1F3TA 2ON3A 4MFEA 3PZOA 3ZVHB 4H3DA 1W3TA 4A8NA 5EMUA 5D37A 1V51A 4EE9A 2V2DA 3M43A 3MCNA 1BVNP 1WZAA 4UZUA 4GKTA 3W4RA 4KESA 4R85A 1XDJA 1US2A 1VR6A 1AZ1A 6A3HA 1ITCA 1O7AA 3MI6A 4I8DA 3GDBA 1UR3M 3TX9A 1MXGA 5ECVA 3E5PA 3UPMA 3P7YA 1QU4A 5F4XA 1AH4A 1NIUA 5HDRA 1E0WA 5BROA 3V3WA 3M0KA 3PJTA 1EH9A 3UWZA 3AYTA 1RPXA 2WNZA 2ZZ1A 1EJVC 1HX0A 1IT8A 1NFPA 4WGHA 1XYMA 3APGA 3LLFA 3D0CA 3HPZA 2VEMA 4UQBA 2X2GA 4Y9AA 3SR7A 2Z2BA 1EIBA 3W38A 1BG9A 1YXCA 4AYSA 2ADAA 3ONCA 4IFKA 1TIMA 3B8WA 2Y0FA 3BL3A 1JZ6A 5EMMA 1U30A 1XR2A 3ARUA 3HA1A 5CJMA 4EK7A 2NVDA 3JU2A 3QN3A 1HF6A 2DGAA 2VM8A 3OQEA 2V3FA 3DGRA 4U10A 3D5HA 3EDKA 1JYXA 1GEHA 2CNCA 4WF7A 4JHOA 3DUGA 2DH3A 1GVFA 1TREA 3GVVA 3CPGA 3GU2A 4W7UA 1U22A 4HOXA 3T4WA 3V36A 1LQAA 2F6UA 4JTTA 5DO8A 1HL9A 4LYPA 1CT5A 1JNEA 2CBJA 1G0CA 3W2KA 3U48A 3SJ3A 4HYWA 5EYWA 1UR8A 3KUMA 4IG2A 2G41A 1ZTVA 2W92A 3E1F1 3CAKA 3RLGA 3PB2A 1RQEA 3W6LA 1HFBA 1V79A 1Z89A 4Y2WA 1HVQA 3TOYA 1J2WA 4GPNA 4PUNA 3LS9A 3T9PA 3LHUA 4A8IA 2VHLA 2EGZA 1EHAA 3V5CA 3HFTA 1KV5A 1WNOA 5D33A 4DF2A 2TSYA 3VFCA 1CYGA 1G9HA 4ZO7A 1XRFA 1WKDA 1B5TA 4GH1A 3VKCA 1AJZA 2E9MA 3T4CA 1C8QA 2AKMA 2VDIA 1I0BA 3MHUA 1C9WA 1XQKA 4O19A 3REQB 2CBIA 3N14A 3GW3A 1Z9AA 3P67A 2J7FA 3MQTA 3P6LA 1PX3A 1UKTA 2EPHA 3T42A 3CUHA 2RGMA 4HNOA 1Y5WA 2XZ9A 4L4PA 3DHDA 1CXIA 2ZZ2A 1V6VA 4NL1A 3KRUA 1E4MM 2VEPA 1WDPA 1PE1A 2OEMA 4KH2A 4DWSC 3IWPA 1F3WA 3NSNA 4S3BA 1M03A 1VKFA 2INEA 4XB3A 4BF9A 3U7BA 3VDGA 3UY8A 4EP8C 4C1KA 4LYQA 1D3HA 1EUAA 1H50A 1F4AA 4TTGA 4O0ZA 1QATA 1VEOA 2WKGA 2V5BA 1PZ2A 3WIJA 5FACA 4GYFA 4U2YA 4LBSA 3S5SA 3C0JA 2YL8A 1QUMA 1XDMA 1GJPA 4DI9A 1JD7A 1LZOA 4O0QA 5A2AA 3VNMA 3GIPA 4GA8A 4B3KA 4K8GA 1K4GA 1XGZA 2WJFA 3AXMA 2C0AA 1TV3A 1UWSA 4J3WA 3ITTA 2ZC1A 5IOBA 5BMWA 5D32A 2FVMA 1TPC1 1P0KA 4XTIA 4I7WA 4MYXA 3WH8A 4BY3A 3RNDA 2E8YA 3SB0A 2YBUA 1HN1A 3V5FA 1HP4A 3TA9A 1G4TA 4XD6A 3V7PA 2SFPA 3NQBA 4CNSA 3DIPA 3WLLA 1PSCA 3M44A 3GVRA 4GI8A 3WEZA 2HK0A 1ZL1A 4XVDA 1DEDA 1J18A 2ZUUA 1XCFA 3O6YX 3WLJA 3NQCA 4AD2A 1W32A 1CIUA 3SQSA 4LOCA 4HIBA 1EJXC 1FWBC 4NZCA 1VEMA 2E9LA 4I6KA 2ZUVA 3W74A 1WV2A 3TWAA 2JKAA 3TC6A 2R24A 4HZ7A 3BLPX 2FZNA 4L65A 1SUXA 3WKZA 2WSQA 1QNQA 2G37A 3F4VA 5D9OA 4AUBA 3RJXA 3NZGA 4E8CA 2PAJA 3VOGA 1EA9C 2WZEA 4HPJA 3TJIA 3AXKA 1EEXA 3GK0A 5K7JA 4XISA 2OSYA 1CLVA 4DPPA 1DHKA 1C9DA 1KM4A 4DJDA 1XBVA 3OB8A 2RAGA 1TPWA 3QMRA 2CW6A 4HOWA 4QP0A 2ISVA 3DYOA 5LXEA 2CHNA 4BA0A 2JE8A 4MF4A 1BFNA 4IIBA 4MWAD 3IAQA 3N6JA 3QH2A 3LRMA 3UVIA 3HO8A 5FL1A 2DSUA 2YCLB 2HVMA 1H60A 1ITQA 4JIHA 2G95A 3DHUA 4E2BA 1Q6EA 3TDFA 4M0XA 4AWUA 4NKCA 1WDSA 3W73A 2FDSA 3KOFA 3VC6A 2VD8A 3RMJA 3SY8A 3AUOA 1N8WA 4PMQA 2OSWA 4Y7EA 4JQAA 3PUEA 1BWVA 3ES7A 4KERA 5F2IA 5BOEA 5DBUA 3VI2A 3HQ1A 1E6SM 5CPQA 3EWXA 3WLSA 1G5AA 2ATMA 3WFAA 4CCCA 3W1PA 1W91A 1AUSL 4RW5A 3GHRA 4O1DA 3V0TA 4OUIA 6XIMA 3FVMA 1EOKA 2VTFA 1PUDA 3OVGA 3TROA 1H7PA 3G24A 1YNPA 4GQ0A 3SRHA 4MWAE 3GAKA 4JX6A 1ESWA 1IQ8A 3WMBA 3R7MA 3KFTA 3TTOA 5AYXA 1NFGA 3W85A 3ME3A 1WX0A 5EMJA 3T44A 5F4WA 3D3FA 3EX1A 3IS4A 1JDFA 3E5BA 3M0MA 2F84A 1TSIA 3M6DA 3TSDA 4K7YA 3TJ4A 3NURA 4CUCA 3TW7A 3E0WA 4XWUA 3IJ6A 5CSRA 4OUEA 3QKZA 1P6BA 3MSDA 4C6OA 3IGUA 5D2TA 1A5BA 5FF2A 4H83A 3PPHA 4XBSA 4M7SA 1UUQA 4L1WA 1D7KA 2NV9A 1VPYA 3UXKA 1LJYA 3RO8A 3UQNA 2FMOA 2WPBA 1AW1A 1OFPA 5I09A 3EX3A 2Z25A 1YQ2A 4NZ3A 5LGZA 1LWHA 5F1UA 1FFRA 2AGKA 1H3GA 3FS2A 2CLFA 1G7UA 1S3HA 5CBBA 5E5CA 1TYGA 4JIPA 1WKYA 1M68A 4OHQA 4LBUA 2V30A 3MHGA 4XD4A 1EJUC 4AX6A 1T7LA 3AAMA 4E4PA 3GXDA 3O3RA 2POZA 3WLIA 2VT0A 3GG1A 3M0YA 3KP1A 3FFSA 3TUUA 2X1IA 1TPEA 5U4NA 4PMNA 1LTDA 3ZLFA 1Z44A 4LRTA 2QCDA 1KTCA 3L0NA 1AMKA 2ALDA 4HJFA 3DEQA 2DIKA 1O12A 2VEFA 3WH9A 3ARWA 5FF3A 3RFAA 3EX4A 3WNOA 3UZYA 4A8RA 4PCNA 3AS0A 1S39A 4HHMA 3H2MA 4JY9A 3P82A 4AEFA 1ZBCA 4M1RA 4ECLA 3F4WA 1G6CA 3RPTA 4GCAA 1A4MA 4PUKA 2Y62A 4RJEA 4TR9A 2CZ5A 3GDLA 3ZJ8A 1LOSA 3TEVA 2PP0A 4PUMA 1A49A 2O7QA 1VJSA 1XIDA 1L0PA 4D8AA 1SW3A 3KDOA 4UBPC 1US0A 2OELA 2Y8KA 3BURA 1MEHA 4YN5A 4NAFB 1K8YA 1NQKA 4DIAA 3TC3A 5DF0A 3F4DA 1G7VA 3RPDA 3L5MA 1PTDA 3S5YA 3H55A 3MV01 3TTQA 1UWRA 2BX7A 3W1MA 3RM8A 1T41A 4E6MA 4G1NA 4XZWA 2VFHA 3SUSA 1GW9A 1D8CA 3R10A 3VVGA 5CPSA 3E96A 2D2HA 3HMCA 4GZ7A 4XZHA 3CZEA 4L7ZA 4RNJA 3MCOA 1B54A 3S6OA 4HTBA 3SSZA 3NQ6A 3W7EA 4OKDA 4B15A 3LENA 3SFWA 4PB5A 1RVGA 4NF7A 4JQ4A 2PDNA 1PX4A 2VD9A 4JFSA 3UCDA 1W5MA 3S6TA 1IR2A 3H4WA 2BNJA 4Z0JA 2AGTA 3WJYA 3AO0A 1UBSA 4MUPA 2BHZA 1NDZA 4GG9A 3NZQA 2XGZA 2XIBA 5CPOA 5H91A 4JY8A 2NUWA 7PTDA 4JHZA 2J88A 1EJRC 3N19B 2DT0A 4WJEA 5AECA 1RCOB 2JKEA 1FY6A 3TFXA 3FJLA 7ODCA 5KETA 3N12A 4XUGA 5D04C 2GSHA 3R0DA 2AMXA 1DTNA 2VFFA 4GXWA 3ALGA 3G2GA 2WZHA 3N13A 1O94A 1E56A 3TZFA 1POKA 1PZ0A 4GYPC 5JXQA 2I1OA 3LPOA 2QV5A 4I9TA 4C6KA 2R91A 4FK9A 3P8JA 4U5KA 1EGMA 1ICQA 1W3NA 1CWYA 3VK5A 3S2LA 2ZRZA 1M9HA 5DELA 2XVGA 1QNVA 3A13A 4UXDA 5CC6A 3JZUA 3N1AA 4IFRA 1SFJA 3DHPA 5HK4A 1GVIA 2GOKA 1JIBA 3AMGA 2LLEA 1TPB1 3PZUA 2PGRA 1NARA 1DVJA 1VYSX 3BH4A 3WD4A 3TQ0A 1GG0A 4HA4A 2GGJA 1E1CA 4DWSA 5T9CE 4M8UA 5EL1A 3AZSA 4F40A 2R1MA 3ZJ7A 2C0HA 3ZT6A 4M1BA 1M5WA 2D23A 5BU9A 3WNLA 2V3DA 3RLUA 3MV11 3IRSA 2OZTA 1A3HA 1TWZA 4MJZA 2DORA 1A53A 4DUVA 4RE3A 3CZKA 3W7PA 4LUYA 2QKFA 3GNNA 3HMJG 4G5DA 4ZOAA 1V6XA 1MUMA 4Q8OA 1E72M 3R6IA 1JZ5A 1WZLA 3L5AA 4DUXA 3PS7A 4IFKB 2JALA 5D4YA 1A80A 4HPHA 5LA0A 3EBVA 4NJKA 3SCVA 2ACQA 1EZ2A 2WVSA 4X60A 1K6WA 1XLKA 4RNIA 5A6SA 1TWIA 4XG1A 3BAIA 1OM0A 1PIIA 2A3HA 3SCPA 4H9TA 1C29A 5D2XA 4FR6A 3TQVA 1WUEA 3NQ2A 2UY5A 2VOMA 4RV3A 3B8SA 3UA3A 3QHMA 2J7HA 4A2RA 3M7SA 2DJLA 1EXBA 4IG2B 3TN3A 1FWWA 1H4PA 2FPVA 3DC8A 3VYLA 2OT1A 1MQRA 3BUVA 4LRSA 1DJYA 3W02A 1VB9A 1TWDA 4AF0A 2O4QA 2CZVA 4HMEA 1YPIA 4GZEA 4YVPA 4MB1A 4U4MA 3L4XA 3M16A 1KFEA 5CPLA 1N2VA 3OBKA 1DWHM 2Y85A 4R7OA 4M6QA 4EX4A 2C18A 1Q8AA 3TH6A 4K3ZA 1K9FA 3AIBA 5IFPA 4CU7A 5BXRA 1XLJA 2FTPA 2BWGA 1LDCA 2QGHA 1EHNA 1A5KC 3ZIZA 2VURA 3NTYA 1I75A 1FHLA 3QFEA 4UTKA 3SAZA 2AQVA 1HNYA 3FLUA 3OGSA 1E6NA 2PRLA 2YDSA 3KVJA 2WAGA 3W53A 2XM1A 1X39A 1LRNA 1JYVA 3W27A 1YDNA 5FCZA 2CLOA 2AL2A 2WJZA 3PUDA 3C4UA 1YMYA 3B0PA 3ITXA 2XH2A 4WQ6A 4L6HA 1VBJA 4UFLA 3TMLA 3UZJA 1D9EA 3VUPA 2X1RA 3BV4A 3C0SA 1OZQA 2ZDSA 4H9VA 3S5NA 4FHAA 4QISA 3PZ9A 4WDWA 4PBEA 1GVQA 1RH9A 1LBMA 5A8PA 3TQPA 3W2JA 4C7DA 2FZ9A 4O11A 3TV8A 1ZP4A 1ME8A 4FLOA 3UG8A 3WEMA 5GNZA 3QV7A 3W23A 4O54A 1GZGA 9XIMA 3CHFA 3NA8A 4UMBA 4C6DA 4GHRA 2BY1A 3MU7A 3U3HA 6TIMA 4LB4A 3O2LA 3ANYA 3GXTA 4H4IA 1B90A 3L5LA 1TUFA 1D7FA 2RKXA 2REQA 1E0TA 5M1TA 1OX6A 5D2YA 2P1FA 1PDYA 2ZRWA 3TYZA 1PX8A 3KZSA 4ILSA 3TCSA 4DBDA 1W37A 3DFSA 3SIZA 2ZADA 3NZ1A 2QJJA 3GTFA 4EIVA 4AZ6A 2DY3A 1FOBA 2QNEA 1OYBA 4FOUA 1RZMA 1L6WA 3H2FA 2OWCA 2ZX5A 1TIWA 5AYIA 3EB2A 1JDEA 2YB1A 4GZJA 3NPWA 2INFA 1J0HA 2YR1A 3B04A 5BWAA 3AIUA 4DQWA 1OABA 3VIHA 5DY2A 4KIEA 1D3CA 4HU0A 3P62A 1P43A 4OV9A 3VZYA 3MKCA 5A6BD 1VCVA 3WEOA 1SW7A 5FJRA 3BO9A 4H6QA 3NPXA 4XZMX 4WOQA 2PP1A 4Q8VA 4MWAC 3N3TA 2GWNA 4OQVA 2XWDA 2JEPA 4DN1A 3EWWA 2O56A 3ZFHA 2BZNA 4OFCA 3M6YA 3S9YA 4Q6XA 3IV3A 4UR9A 5HANA 1ZPTA 3GHTA 2E4TA 3IACA 5G1TA 4OVXA 2BSLA 3BXWA 4Y6GA 3VOHA 5CC5A 4MKSA 3DXIA 3KBWA 3QY8A 4TQTA 3S5OA 3ANVA 1XWYA 3MBFA 3WLHA 2FZMA 4FXFA 4IQEA 4IIDA 1F5ZA 5IRPA 1Z3NA 4PTVA 4JTEA 5KZEA 4OE7A 1BF2A 4D8LA 4XZLX 5D8ZA 1JCJA 3SQLA 3EDEA 4RDZA 4PN2A 4O1AA 4JD4A 4J5NA 1KGWA 3OHIA 3LDVA 3W70A 3QZEA 3VDAA 3EX2A 2B4GA 1PKMA 1OSEA 3GS6A 1A5OC 4EVZA 4R33A 2VR4A 3RX4A 1OIFA 3UR8A 1W1IE 3TK7A 4IM4A 4GXMA 1R0MA 2RHGA 4HGXA 2W67A 4L4MA 3F2BA 1FHVA 4S2CA 1KFJA 1UJQA 2I56A 1SU5A 4AZBA 3W75A 4BR1A 1ME7A 1QNPA 3ABSA 5AHFA 1QHZA 1JG9A 3IIVA 2XH4A 4LVDA 2WKJA 2ZA3A 2RJGA 4QIUA 4D72A 2D2OA 2E9BA 4B9YA 2A21A 4NUWA 2Y7FA 2O9PA 2PDHA 4HK6A 2VC6A 4OIFA 2XM2A 5HXMA 2PF8A 1P1MA 2BB0A 3FJ4A 3VU2A 3BW2A 5CG0A 4C6EA 2QAFA 1CGTA 1NTHA 2E6FA 2PDJA 1Q5MA 4O4VA 2FVKA 4QRNA 2D20A 3GR7A 1E40A 4MPKA 1BTCA 5KSWA 2OLSA 1KM6A 1Z48A 2DZTA 3GKFA 5RUBA 3E38A 3ALFA 4O18A 5T8GA 4WZHA 3WLTA 1Q6QA 1X98A 3IANA 2WJDA 4NJIA 3VTRA 3QLLA 3SY5A 3BC9A 1QBAA 4LNYA 1EBGA 1MMFA 2RUSA 3AIVA 4AVOA 1BSLA 1H5YA 3KTXA 4K7VA 3EMZA 4N42A 1NWUA 3UXLA 4AXNA 3PY2A 1LWIA 4HMNA 3WUGA 3M5XA 3TN5A 2GQ8A 3UU0A 5AN7A 1O60A 1OG6A 4Q4OA 1XIGA 1F74A 1GYNA 4NILA 4GIAA 3H4XA 1AA1B 1J96A 3LTYA 1QPOA 3G8EA 1VH7A 2EJ1A 3AICA 5AYBA 3W1RA 4WK9A 5D03A 2PLKA 1UWTA 4GYPA 3H2AA 3L4WA 3OA5A 4ZOCA 1G4SA 4EOUA 4LY8A 1KXHA 3L21A 2V8ZA 2ZX6A 3RX3A 3B4YA 1QWGA 4KEUA 2QCNA 1SJCA 5IXEA 4XBJA 1FHDA 4D6GA 4OU1A 1TCMA 3WMSA 4NZJA 1Q7ZA 5DCBA 4FOJA 3WDRA 1OY0A 2ZC8A 4AVFA 4Z08A 3TYCA 4QG8A 4E5TA 2D3NA 3VKDA 1UKQA 5LIYX 3EAUA 1Q7MA 4HN4A 2F9RA 3FKRA 3DFTA 1K1DA 3THDA 3CZ8A 4XAGA 2DH2A 3LPGA 4XVEA 4BJHA 3PZTA 3OBAA 4YWIA 5A6MA 4C60A 2VEKA 1B3VA 1KQYA 4Z2LA 3S42A 3VCCA 3CUXA 1B9BA 4GX9A 1QK0A 5EFDA 3OODA 1V6WA 3TLLA 3WX7A 1WDDA 2HBXA 4MADA 3AIQA 5AVNA 4AIOA 1KM2A 1SFTA 2OXNA 4JIEA 3SEPA 2QPXA 4O1EA 1A5UA 2GFTA 3AWNA 1BXBA 4JN6A 4IHCA 2FFCA 1WOAA 2FHCA 4B16A 1PKNA 5G2WA 3T78A 3BOXA 2WSRA 4DBUA 1E3XA 2F7FA 3PAJA 5JBDA 1ZFJA 1F8MA 4XZ9A 4V1XA 4ZFMA 4YJ5A 3SGGA 2FGBA 3MYOA 4LVBA 1MQQA 1CEOA 2UZ9A 2OZ8A 3NO3A 1WAUA 4I9JA 3BVJA 3G1AA 5HR7A 2G3JA 1AFSA 4DZIA 3M0JA 4HSOA 2PDLA 4M56A 5G2IA 3LHTA 5I02A 2ASHA 2PC8A 1IEXA 2QULA 1A5AA 5I23A 3JW7A 1GEQA 1PYFA 1TELA 3PTDA 2BHYA 2VZTA 1H7RA 3R5EA 2NLIA 1V7AA 1G01A 3LZ5A 1JD9A 1KA9F 1OINA 3MTWA 1E1FA 3JUGA 2WWDA 3CT2A 3NQ8A 2CITA 4GX8A 4S3KA 3IVUA 1NP2A 5A3HA 2EG8A 3PVFA 3UYCA 4MVAA 3UZWA 3DI0A 1M7JA 3N2BA 3DYPA 2EPNA 1KR0A 1TJ0A 1KKRA 4IIGA 3D46A 3R25A 1V4YA 1MW2A 1YNYA 3BOLA 2OCZA 1XYBA 2JIWA 1H5VA 3UEQA 4PH6A 2G97A 2Y5SA 3CAVA 2GQAA 3DCPA 1JDAA 3VIIA 5MHBA 3MB9A 2HBVA 1R87A 5LNRA 1NM9A 3KL0A 3HGOA 4U28A 4LS0A 3CM4A 3HPXA 3QXBA 4F66A 3C3UA 1CXFA 4M3PA 5D9PA 1E1CB 4BI7A 4QEEA 4G1KA 3HJEA 4X0VA 3SN0A 3G8RA 1GHRA 2E67A 5E09A 4RK8A 4TX6A 3QJAA 3LZ3A 2P76A 1E6RA 3KL5A 4R88A 3L12A 1C91A 8RUCA 3UWWA 2OG9A 2H90A 4ERIA 3GLCA 2V68A 1Z32X 3FEQA 2FMNA 3WYZA 4S3DA 3L67A 1EC9A 1Q4WA 3CQJA 3GFZA 1R5YA 1E4IA 3CNYA 3CEPA 4H8HA 2QF7A 4HCHA 4L80A 2EAWA 5KZDA 4QJ4B 4NYUA 1TV2A 5BXSA 4Q8NA 1W1B1 2CHOA 1W2PA 4HU8A 6PTDA 3W7QA 4E8GA 5LHFA 4GOAA 1EGVA 3B0VC 3ARQA 4BI6A 1Q3NA 2BVYA 3N9RA 1TFVA 4Z42C 1NJJA 3VIMA 4XIAA 3KS6A 4ROQA 3M0IA 3QZ6A 3T40A 5ABEA 1RVKA 1E43A 4OOUA 3UNTA 1VF8A 2ZVRA 4DB7A 3DFHA 4JR5A 5H8UA 3A3XA 1EO5A 3VDCA 4LGXA 4XUYA 3AI0A 1W1YA 2WCAA 3PUGA 4W89A 4PTNA 3I6TA 4AMAA 1RBAA 2XVLA 3H23A 2HS6A 1LYXA 4PTWA 2VGFA 4RXFA 2HE5A 1BRLB 1KWGA 3CQHA 1Y8BA 1GVOA 3EXRA 1VFUA 4LF1A 2ODOA 4PFHA 3U2EA 1YDVA 4AF0B 3LHZA 4CU6A 1BVWA 2IUZA 1TZZA 4DY1A 2XISA 2PGEA 4RZ4A 4EANA 3VPLA 5JBFA 4QE4A 4S3AA 4JKMA 1ZRQA 4ADUA 2WMKA 3NL6A 4L64A 1JJKA 2GVEA 3V4BA 3GDMA 1UD5A 3B0XA 1UH2A 4MWAA 1R46A 2ZOXA 1GQLA 1M7PA 4JPGA 3CV7A 4IF2A 2X42A 5AYZA 3V0UA 1LG1A 5JH2A 4IL0A 3CWOX 1UMLA 2NXHA 1QJWA 3C6CA 3OIXA 4ML9A 2EKGA 4ZBCA 4UTWC 1QO5A 3WD1A 1ZALA 4FALA 5A8QA 2WC4A 4ZSTA 3S1XA 4UQ9A 5M5DA 3LQLA 4QE5A 2AL2B 3W24A 3K1DA 4AZGA 2Q01A 2G96A 5I5RA 1H2JA 4JIQA 1PO9A 1WKFA 1UASA 4ZCWA 1K4HA 3UERA 1ZGDA 4L56A 1BEUA 3P93A 2FTWA 3PF3A 3DFNA 3H12A 4I8YA 2QQ6A 3USBA 5A8OA 3HG5A 3B3DA 1NQ6A 1BYDA 3W29A 1S1RA 1S5MA 3HQOA 4Y8EA 1OFDA 4AD1A 1H1YA 2E6AA 3PJUA 3NSXA 4JTDA 3A21A 3C8FA 1FBAA 3CHDA 2OWXA 1V02E 3N3MA 4PC8A 4UMCA 1L6YA 4YYCA 3O7UA 1M65A 1W6TA 4MNMA 3SCRA 1XIEA 3CL7A 3A5VA 3EKGA 1SPQA 4W4QA 3H8AA 1HT6A 1MEIA 2REQB 4DZHA 1RBLA 4HNVA 2Z6JA 3DOPA 4DF0A 4S3EA 1EB3A 1BQCA 1V3MA 4AIBA 2GPTA 3TYDA 1GHSA 2YXOA 2E77A 2QXWA 4YVVA 1O66A 4PUJA 3W7GA 1LG2A 4X2PA 4U3CA 5I3IA 1N7KA 3G1SA 3UY7A 3P60A 2IMRA 1ZHAA 4CCZA 2HVNA 1DPMA 3J7HA 3FYOA 3N2MA 2ISDA 3ITGA 3M46A 3URBA 1C7TA 1SGJA 2CCRA 3C5QA 2ISFA 2HISA 3CAQA 2PGFA 3GUGA 4GZIA 2PE4A 2R1LA 2PLCA 1TE1A 4PCFA 3W9ZA 1NAL1 4CN6A 3UVAA 4QHRA 2UY2A 5D02A 4WDXA 5EMYA 4I3GA 3IUHA 1CXEA 4FNRA 1U1JA 2WCSA 1HZYA 3B8IA 1DYSA 4R27A 3MI3A 3S9ZA 2Q71A 1YXDA 4KWWA 4HT3A 3FNDA 4ZOBA 3CZLA 2P53A 3ZLHA 4NNCA 3FHAA 2VFDA 2YZRA 3CGTA 3G3DA 2WZMA 3FCPA 2DIJA 4TUFA 3PBVA 3G22A 1XIMA 1KKOA 1VBRA 1VRDA 5BU6A 2VGIA 4L5ZA 4QE1A 2H8ZA 2G3IA 3UGVA 2FZ8A 1X6LA 3SCTA 4PRTA 3VZXA 5A8NA 4ATLA 4G9PA 2I7GA 5JU6A 1VLIA 2OTDA 1W8SA 2DUAA 1B57A 2ZZ4A 5A5WA 4MLRA 1KGUA 3LNMA 1AH3A 1XYZA 2HRWA 3O6CA 3A47A 3CO8A 1XISA 1L6GA 2G3MA 2H9AB 2Z1VA 3AUJA 4GC4A 1FWNA 1JF6A 3BAKA 1QO2A 4JX5A 1E9IA 3L4ZA 2NX9A 2OB3A 5DMYA 1IGWA 2TPSA 4IZGA 4IX0A 4YU1A 3MVTA 5DFAA 1PTGA 4KF1A 1Z42A 1TX2A 2Z00A 1JUKA 3MT1A 3QR3A 2J62A 3BQ5A 4BQ3A 2Y7DA 2ATSA 4M82A 2ZE0A 3CQIA 4FX6M 3C61A 1V0KA 4AD0A 4AY7A 1EWDA 4CQ8A 3H54A 3IEBA 1B3WA 3NZRA 2JF6A 4W8AA 3NM3A 1F76A 3R11A 2I16A 4EPBC 3AIRA 3L4YA 4HHPA 2D1ZA 2PLMA 3ZR6A 4JFWA 4Y90A 3W1LA 3BLKA 4IISA 3EWBX 4GNVA 4QITA 1I6NA 2TODA 3CH9A 3LUTA 4TOQA 3ZR4A 4D6HA 1ZJIA 2G4FA 4A22A 3VGFA 2V2HA 2YXXA 1LF1A 2ZRVA 3WBWA 3LXAA 1I2NA 2QS8A 3QC3A 3UPBA 3KBVA 4AU0A 2DT1A 4CNPA 4ZQCA 7A3HA 2OR2A 2D2JA 4G7EA 4IGHA 5FSEC 1C92A 4MSSA 1AQHA 3WMLA 4NP7A 2B0MA 3OGVA 1WE5A 4REQA 2IW0A 5D9MA 2DFAA 5KINA 5JUVA 3MHFA 4PMVA 4LUTA 4X63A 3TFCA 3PFMA 3KE0A 1UWUA 2GUBA 1Q6GA 2X09A 1V0NA 1IEVA 2OT0A 4GQGA 2J7GA 2NXGA 1B3ZA 1D2KA 2OZ0A 3C3NA 4RPPA 3LRKA 5HPOA 1FUYA 1ZENA 2BFGA 2GGHA 3TE9A 1C3FA 1YX1A 2CYGA 3RLVA 2Z1WA 2A5HA 4E2DA 3TYBA 2G5WA 1VFFA 3P5YA 3K2GA 4S38A 5DT7A 2O9TA 4WUIA 1U33A 1XKJA 5HWJA 3L68A 2NSXA 4QQ3A 3F2CA 3H7VA 2B7QA 1TTQA 3RDKA 5L6UA 4TVCA 1S2CA 2XH7A 1OFRA 4ALDA 3AALA 3DN5A 4C7FA 4EAMA 3ANUA 2J7CA 3T2PA 5IDZA 1FWAC 2PDCA 1TA3A 5DEZA 4R7JA 1B2YA 4FXRA 3PBWA 1RY8A 1S2TA 2BOFX 4GY0A 3LD5A 2FGZA 2W79A 4IUOA 1V77A 1QAPA 3L4UA 5EPDA 2OWWA 1RALA 1FH7A 2J7BA 5IBXC 5B7ZA 1JPIA 3GYCA 5FOOA 2PDBA 1RBOB 2JQXA 2B7OA 3CS2A 5D2WA 2EBNA 3RCYA 1AK5A 2B31A 5KMYA 2J8TA 2CIPA 3FDGA 3GG7A 4F0SA 3FVDA 1IT0A 4O0KA 2O4MA 1MXSA 1FXQA 2A2IA 3HV9A 2X0SA 1P0NA 1LOLA 3WNKA 5BRBA 4W87A 2X1SA 3W7HA 5LIWX 3BLDA 3K8KA 4ZENA 1ZAJA 1AW2A 4Y8FA 3R89A 1A4LA 1W5PA 2DDXA 4FNUA 3PPGA 2RFGA 1C93A 2BLEA 5CZJA 1XSKA 1MNSA 2GDUA 2NVCA 4LS2A 2OQYA 4JEQA 3B05A 1IYXA 3FAXA 1XYCA 1EYEA 2XFRA 3BW4A 2J13A 4RE4A 3WUBA 2WQDA 5FJJA 2A6NA 3EOEA 3R8GA 5LA1A 4R7WA 5JIWA 4JYEA 2H6RA 1HJXA 2AKZA 3CUGA 3WDIA 3EA3A 3LX9A 1CTNA 4AH7A 5PTDA 1OF8A 4MAVA 1ZCCA 4CCEA 3BANA 3ARSA 1R3QA 2ZBTA 3HFYA 1UG6A 3JRKA 3TCEA 4AX7A 4QXIA 1M53A 3QY7A 1FKXA 3W7KA 2CBUA 2YW4A 2F2KA 3WD3A 2NUXA 2O7SA 1WBHA 3NEHA 1FCBA 4S23A 3A9IA 1PWLA 2WHJA 2ALRA 3LV6A 3LRLA 1XPYA 3C2YA 2OPJA 4LWWA 1DJXA 4CN1A 2GLKA 3I7QA 1QI3A 4I9AA 4IMAA 3ZWSA 2YA0A 4IOTA 1S5NA 3G18A 3F2DA 4DZ5A 3RLHA 2Y6ZA 3HGRA 5EGRA 3FW6A 3A22A 3KVKA 3T07A 4JOMA 3LGEA 2WZTA 2DUXA 1OT2A 2L5HA 1NU5A 2QCGA 4GI4A 4YLWA 3SCUA 3EWYA 4B5UA 4XV0A 2C91A 2FLIA 3GDTA 1AJ2A 3AMCA 1W3HA 2QVHA 4F8XA 3H2EA 4UTWA 1MYRA 2ZZ5A 4UC5A 2OOGA 1FP9A 4TV5A 3GWQA 1QOPA 4BF7A 1PIFA 3SY1A 1A5NC 3OZPA 4XQ6A 1K02A 1WXZA 5FF4A 1KFLA 3TAKA 4NX0A 4FXSA 3PPFA 2FIQA 2YDQA 3BQ6A 1HO4A 5CQ1A 4J40A 5HA7A 3FX4A 1CBGA 5I3FA 3K4DA 1DJGA 1ZU8A 5HNRA 4J1OA 3PR2A 1FX6A 4DELA 3CMGA 1AVAA 2BS9A 3EPNA 1EC8A 3EOLA 4EACA 1W5QA 3WENA 2NVAA 4X3ZA 3QMTA 4JN8A 3TN4A 5HNNA 1H7WA 3THUA 4ICMA 1XIHA 3WUEA 3TQKA 4C6FA 2E8ZA 4WDUA 5I78A 2ZTKA 1X97A 2PDKA 1XP3A 1ISZA 4JTRA 5KEZA 1E9ZB 4NNBA 3MANA 4Q4PA 1Q6RA 1V8EA 1ICPA 3O63A 4DXKA 3WL0A 2ZA1A 1UHVA 3IJIA 2DQWA 3A5FA 3AJ7A 3L66A 1QVBA 3GHSA 1LL7A 4WSHA 2AQWA 2ZUSA 4AWSA 2J7DA 3CPUA 1DWAM 4LVFA 5I3GA 2W6RA 3ES8A 1SFSA 4Q8MA 5I77A 1VFMA 5FF7A 1ZBWA 5DLCA 5D8WA 3ID7A 3N34A 1MI3A 5A6BA 1DHPA 3R43A 1ELSA 3NQGA 3CQKA 3GM8A 3PM6A 5BMXA 3CL6A 1Z7AA 4BCEA 1KC7A 1FCVA 1XIFA 3VKKA 4AW7A 1IWPA 2YPIA 4AZHA 5EBAA 4X2RA 2XINA 3EWZA 1F6KA 2WC3A 4PEEA 3N2CA 5F4SA 3WJSA 4KT2A 4UR8A 4UTJA 4LJ3A 4AWEA 3RN6A 1XS2A 5TNVA 3T2OA 3H21A 3WQFA 1F6PA 4HPGA 1HP5A 2C79A 4Z2JA 5DCEA 4HA3A 5BOFA 3S1WA 3Q2DA 1SSGA 3EOUA 5AHMA 4MWAB 3CAWA 1E70M 5JQ9A 2NSOA 3QPYA 2D3LA 1LL6A 3NQAA 3BSHA 1O5KA 1W8GA 3S8HA 3UG3A 3B8UA 4QG6A 3K4WA 4L9XA 3GR4A 2W63A 3IK4A 1OGGA 3NOYA 1CGVA 2E7FA 3HG3A 3QHNA 2P8CA 1VRXA 3N25A 3MI2A 2A3LA 3O9NA 1U1UA 5C9RA 3VIJA 2RDXA 1G4EA 5LZLA 4EAYA 1YRRA 3T1GA 2W5FA 2XVNA 1EF3A 5HWMA 4QQUA 3GC4A 3SM0A 3EGJA 3KWXA 4KS0A 3T0CA 3VAVA 1UWIA 4B90A 1XINA 3C56A 3UBPC 3KCOA 1TPUA 5E0CA 2PRHA 5CZTA 1PKYA 1R8LA 4L61A 1RJPA 4PMZA 3SGUA 2DSWA 3MUY1 4GIYA 3OYXA 3CIXA 5HJLA 1KR1A 5I0DA 2XN1A 4ACYA 1EWEA 2DV0A 5ECUA 3DHFA 4ORIA 1L2UA 2GK1B 3HZ3A 5GQBA 3VOIA 1XG3A 4EF8A 1EPXA 5AKQA 1UIPA 1IXNA 1EEPA 2O92A 4PRRA 1OFQA 3VXGA 4WHBA 4MDPA 1UD4A 1ZLPA 2CLKA 5I24A 5CPNA 2ZFAA 4CD4A 1MWOA 3PBYA 1FTXA 1MO0A 2V81A 3ELFA 1U5HA 1IV8A 1H51A 1ITUA 3I65A 1UZHA 4FNTA 4MY1A 3NUKA 1PJ9A 4A05A 1E55A 1UD2A 1EOMA 4NASA 5BW6A 3GIYA 1XLMA 2XU2A 1EF2A 1B30A 4AB4A 4KRTA 3TP4A 2HQAA 4WR3A 1KBJA 3BE7A 4UQEA 2WHMA 2V3GA 3MDWA 5DXXA 2ACRA 2OGJA 4PMRA 3S1VA 4EPEC 3EXTA 6TAAA 1JGMA 4H2HA 4AIUA 2XVPA 2MNRA 1OFOA 4YIWA 3OOQA 5I07A 3MKVA 4JTKA 1FWEC 1XLFA 2GJRA 3O05A 2Z28A 4DO5A 3M5YA 1P1XA 3LM3A 5CC3A 1I60A 3LBCA 1BKSA 2OODA 4U5IA 3AYRA 4QEHA 5HINA 1QI2A 3LGGA 1EA0A 1PEZA 4BEUA 3IIOA 3WF1A 5GNYA 3W6MA 5C2CA 4RCXA 1QPKA 4F4RA 1IXPA 3S1GA 1TMQA 1DIEA 3LLXA 2Y70A 3OLDA 4IX2A 1U5JA 1JF5A 3R4IA 3SO7A 5I3DA 1CW2A 1PHQA 5HBFA 3PTMA 5BOOA 4XAFA 1S5WA 2VZOA 4H9UA 1BTMA 2A7NA 2B7PA 3MSYA 1GPWA 4FPSA 4ACZA 1Q2RA 2A3BA 1CX9A 1XYAA 3VGEA 2PD5A 3Q67A 1NDVA 3ATYA 5HPCA 3T05A 3GNXA 2E5BA 3VKJA 4RDVA 4TVDA 3QV8A 2WBGA 1GVYA 4OBSA 3HOJA 2X0YA 4JX4A 1WDQA 1TZ7A 4UR7A 4ZGYA 2C7FA 2QV4A 3MSRA 4WKHA 3LY0A 3QFWA 1R3VA 1K8ZA 4IJRA 4ES4A 3BGGA 1X38A 3U0HA 6ALDA 4MTVA 3RR1A 3GY1A 3BZJA 4ZOEA 2RH9A 2PTYA 2W27A 4JHMA 1R3SA 5IBXA 3OGRA 4WDTA 1XH1A 1XIIA 3ITVA 3N4AA 4PCSA 5FAGA 3FYYA 3WLNA 4GACA 3LCFA 2PDGA 1E1EA 2GGEA 4JTLA 1GGOA 3BG3A 4F2UA 1RLDA 1KO0A 5GJPA 1SJAA 4J3SA 2XDFA 4I7UA 4NRSA 1U1HA 4H8VA 5HWNA 1RD6A 3E9AA 5K9DA 3DI1A 6XIAA 1YE4A 4M24A 2GJXA 1R3TA 3HN3A 3D47A 5FESA 3DZ1A 1NSJA 2FHFA 4RUBA 1QI4A 4O15A 3N18A 1AG1O 4G7EB 2IXVA 3WH5A 1W1PA 3P61A 3TYUA 3AHZA 4KBXA 4REQB 3H4GA 1OC7A 4LUTB 5A2CA 4A21A 4GJIA 3VILA 3QPEA 3EWCA 4MJ4A 1WQ5A 2Y1HA 3DENA 4LYKA 4WY0A 4MG4A 4DLFA 1UR4A 5EY5A 5CEWA 3WQCA 4NXKA 4AFYA 3FEMA 4N02A 2PU1A 2ANUA 4FX8A 1O5QA 4F2TA 1H0IA 3DDMA 3IIPA 4W84A 4XD3A 4D6JA 1I2RA 3I7RA 5C55A 5J5RA 3H70A 4O12A 3TIMA 1MFUA 3R13A 4WRHA 3H7UA 4S39A 3ZOAA 2VDGA 4ZB5A 1PVNA 3B06A 1WXJA 2PWVA 4R34A 1X8CA 3RG6A 4I5UA 1GKQA 1N8IA 1MUCA 1RY0A 4Z1AA 4HA1A 1YDOA 4ZMGA 1PIGA 1VS1A 1H11A 1J0JA 3LPPA 1TA3B 1XKYA 2CETA 3WFLA 1ZJBA 3CMJA 3TAOA 4IFOA 3RJYA 5U7SA 3L2LA 4RW3A 1JQVA 1GJWA 4H00A 3E0FA