3H2NA

Structural studies of pterin-based inhibitors of dihydropteroate synthase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
273
structure length
265
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFGSYNEVDAAVRHAKEMRDEGAHIIDIGGESTRVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies of pterin-based inhibitors of dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis str. a2012
molecule tags Transferase/transferase inhibitor
molecule keywords Dihydropteroate synthase
total genus 92
structure length 265
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3h2nA00
4DJDA 1Q7QA 4MWAB 4S3EA 4DJDC 2VEGA 2YCLA 3H2EA 4C1NA 1TWSA 2H9AA 4MWAD 2DZBA 1TWWA 2VEFA 3K13A 3TR9A 4NIRA 2DQWA 2H9AB 4O0QA 1TX2A 3H2OA 4C1NB 2Y5JA 3H22A 4DB7A 1Q8JA 1Q7MA 1TWZA 4DJEC 1AJZA 4DJEA 2Y0FA 4S3BA 1Q8AA 1EYEA 2Y5SA 2VP8A 3H26A 3TYBA 3V5OA 4G9PA 4O1EA 2OGYA 3MCOA 2E7FA 3H2NA 3TYCA 4DAFA 3H2CA 4D9PA 1Q85A 4S3CA 3NOYA 4DJFD 4D8ZA 3H21A 3TYDA 3BOFA 3BOLA 3TYUA 4S3DA 4NILA 4CCZA 5JQ9A 4NL1A 4MWAC 1AD4A 3TZNA 4NHVA 4PZVA 4S3AA 4S3FA 2YCIX 4S38A 3MCNA 4S39A 3TYZA 4MWAE 4D8AA 2YCKX 3H24A 4MWAA 2BMBA 4DJED 4DJFC 3H2AA 4O1FA 4DJDD 2YCJA 3H2MA 1F6YA 1AD1A 4DAIA 3TYEA 4HB7A 3H23A 3H2FA 4DJFA 2DZAA 1Q7ZA 3MCMA 1AJ0A 4S23A 3TZFA 3TYAA 2YCLB 1AJ2A 1TX0A
chains in the Genus database with same CATH superfamily
1FCUA 5F1VA 2UZ9A 3KBSA 2D73A 3K4WA 2PD9A 4Q22A 1XL9A 4NUWA 3TWBA 3E2QA 1H1ZA 4XZLX 4L7ZA 3JZEA 3S2CA 1GUVA 1POJA 1Q63A 1JCYA 3BAWA 5M03A 4JN7A 3QGVA 2FJUB 5AC4A 1TPDA 4BQ2A 4CQDA 5CZSA 4L1WA 3EX6A 4N4QA 3WQ6A 4AISA 5EB8A 3UWQA 5CZJA 1G67A 3S1GA 5CC5A 3OIHA 3TN4A 3PZGA 5I7GA 3RX4A 4FNTA 4UTTC 1SO3A 3G1DA 1JF6A 4XWUA 5I77A 4PCNA 3URQA 1EOKA 2PRHA 2J8GA 1X98A 2DZTA 3L4XA 4PFMA 1IEIA 4PTNA 4NL1A 4J4KA 4AZGA 5MKGA 1FWDC 2ZX5A 1ZBVA 3GSMA 1EJVC 3MJYA 2WKJA 2G8ZA 3OP2A 2VENA 2WWDA 3ARQA 3I10A 3U4FA 3GXPA 4RDWA 4AUBA 3A12A 1VBJA 5DF0A 2J74A 1U1HA 4LUJA 3OU8A 4WXZA 3TN6A 3WDHA 2F9RA 4NU7A 1VFMA 4E8DA 3LGGA 3VZXA 2DZPA 4JQ1A 3E02A 4J3ZA 3REQA 1W3HA 4JCMA 2HZGA 3WLKX 1JCNA 1LP6A 2V5CA 4H2HA 1KBJA 3PULA 3WK1A 5BOFA 4W8BA 3PZVA 3CU2A 2BXVA 5KZDA 5XINA 3BSMA 2H9AA 3DOPA 2WSRA 5AFDA 4ML4A 1J5TA 2A3AA 3M47A 3B4YA 3WFZA 3KS5A 5A8OA 1CGUA 2PDGA 2W27A 5CEWA 2VC9A 3TEVA 5FEZA 3WLJA 3GU9A 4YVPA 5ECUA 1E3ZA 3G6MA 3AROA 4RZBA 1J0KA 1OD0A 3MYPA 5D05A 2OEKA 3IJ7A 1XGEA 2RDXA 4PTXA 1JCLA 4O14A 4OBRA 2Q6ZA 4A05A 1W1TA 4P8WA 4JDYA 1XWYA 2BODX 3QHNA 1A3XA 3SDOA 1DQWA 1VFTA 3W81A 1XP3A 1A5UA 3NSXA 2VD9A 2GGEA 2H6RA 1SFSA 5LXXA 2YJQA 4EWND 1UH2A 4E3TA 4CQAA 1Z44A 1HKKA 1K9FA 2WC4A 3M5ZA 2Y88A 1GORA 1VQTA 4LUYA 7PTDA 3AIWA 1PIIA 2ZXAA 4PMQA 3W22A 4XAFA 1Q7ZA 4GOAA 1VFLA 3VGGA 4Y9PA 1XLLA 4GKTA 5D9OA 2YCLB 4X0NA 4D1IA 3UA4A 1JDEA 1OZMA 5CJ5A 4G7EA 2QF8A 2W3ZA 1UA7A 3MDWA 3MY9A 3FY1A 4QR6A 2XWDA 3AS3A 3N6QA 3WDJA 3GXTA 2CZDA 5A6JA 1KWKA 3QOKA 1FDZA 2XG9A 3N4EA 2HBXA 3IJLA 4Q4PA 1RJPA 5CSUA 1US3A 4PRWA 2O92A 4XZMX 5A8PA 5CSSA 4C1NB 3BSHA 4D6HA 4H9XA 1SSGA 3Q94A 3AJ7A 3HFYA 1DXFA 2EPMX 1THFD 1A5LC 1H09A 4H04A 3TYCA 2EJAA 1OJXA 2DSWA 4WJXA 3VINA 2GVYA 3DFYA 1RAKA 3N9KA 3CAKA 3OHIA 4KFOA 4MUPA 2V5KA 5AC7A 1GOIA 4HK6A 3T0TA 4TX6A 4HZ6A 4RPQA 2DSUA 4EXQA 3H24A 4LJ3A 3EDKA 4K36A 4JKMA 4GD0A 4O1FA 3LLDA 2PDLA 4J3UA 3RK8A 1BRLB 2FHCA 5LIYX 2ZBTA 3E5PA 2RJGA 2UWFA 1XINA 4IIGA 3TSMA 4HCDA 5RUBA 1B90A 4GO8A 3TFCA 1X8FA 3MYOA 3HJZA 2JKAA 1IYXA 2FZNA 3NQGA 4FNSA 4HNNA 3NPXA 4AZ5A 1CLXA 1FH7A 2PMQA 1AH3A 2GL5A 2CLIA 3KRZA 3QZ6A 4HPJA 4CVUA 1RY8A 1DE5A 1E9LA 3VC5A 1I2RA 3UU0A 4GXWA 3BMVA 2RHGA 1PDYA 3GQYA 1CXEA 1KRAC 1OFRA 5CH9A 5HQEA 1QNRA 3B0VC 1XLMA 3GTIA 1KFWA 4QJ3B 2AMXA 2ZX7A 4MPQA 4K1WA 3BZJA 1UWSA 2XIBA 2JEQA 1DIEA 2QCMA 3G1RA 2EKGA 2HVOA 3W2MA 3MBFA 3W7HA 1W5NA 1J0HA 1G1YA 1NDZA 3GYCA 4MYAA 4GRSA 3SJ3A 1PL9A 1LLZA 1VGAA 4QDWA 3B8IA 1YEYA 1YX1A 3UJ2A 3UWYA 2PU1A 3WJYA 3THQA 3BDKA 2JF6A 4L56A 3QKEA 1H11A 1XUUA 2IQDA 2E8ZA 3SZ8A 1OFEA 3GC4A 4INFA 4DI9A 2CZFA 2XVPA 3B0YA 1T8XA 4LC6A 2VEMA 3V35A 4ZVJA 1ISYA 3SY5A 4J27A 4W8AA 1IV8A 3BARA 5A8QA 2D23A 1ZZMA 2QCDB 2VFIA 2IXVA 3TJ4A 1XCFA 4R7WA 1XSKA 1DTNA 3VKAA 1DIDA 3TA6A 5E5CA 3QR1A 5AN7A 1W3KA 3AXXA 1O5XA 2GJXB 2ZRVA 3LHVA 1KM3A 1K9DA 4LXFA 2GGGA 3CZLA 4GISA 2ZUVA 4P7RA 5EFDA 3DIPA 3BCJA 1TPFA 3WQOA 1MRAA 1JZ3A 2WAGA 1P7TA 2CPUA 4GYFA 1DJQA 2A3CA 4M1BA 2PDBA 2ZWZA 1JUEA 1Q85A 4B91A 5LIWX 1YPFA 4D8ZA 1C92A 3VOHA 3VFCA 1RK5A 2VDGA 4NJGA 2AKMA 3BG3A 1ITQA 1UPPA 3VD3A 3W53A 2ZKMX 2RUSA 3QHMA 4AD5A 2YB4A 3LG3A 2C1GA 2WNNA 2WCGA 1C93A 1A0DA 2OOGA 1S2CA 3KDOA 1QNPA 3RLHA 1M7OA 3NVDA 3E12A 2WQDA 2VL4A 3NIYA 3C86A 2I17A 4GVIA 3VOGA 1W1IE 2WOQA 2OX1A 1B57A 1UKSA 4MY1A 3EDJA 1GVYA 1PXGA 3S3GA 1J10A 3BJTA 4LT9A 4JICA 3TOYA 3BMXA 2H3BA 1NP2A 1AL8A 2WLYA 1NJJA 3CYJA 3TMLA 2RAGA 1CT5A 1W0MA 2GJXA 3VCNA 2EPHA 3OBKA 3URBA 4HNVA 4JXCA 1CPUA 4QG9A 3UJEA 2VFFA 2C19A 3UXAA 4PTMA 5K9XA 3GUGA 3C0QA 4KIRA 4LYQA 4NJJA 3GD6A 3FXGA 1SJAA 3M0ZA 4GYPC 1EPVA 3DGBA 2ZOXA 4BF9A 3M6YA 2GK1A 4H8HA 3ZXWA 1XLAA 1XG3A 2DSZA 3BLEA 2FB2A 4QJ5B 3PZNA 1WYIA 2YXGA 1EA9C 3FJ6A 3OTRA 3UA3A 3W7JA 3OYXA 4K2SA 1D8CA 3GIQA 5ENLA 4QHRA 3W7MA 5D38A 1Y65A 4M56A 1M7JA 4NVTA 3GLCA 3A22A 3STCA 2PTZA 3AHTA 4KEMA 4B15A 1GOOA 3F4NA 3VAVA 3MI2A 4IL0A 4W7UA 1DJYA 1S1RA 5A95A 3AU6A 2OSXA 1DORA 4F4RA 5A2CA 2AGKA 4I8YA 2OQLA 2EG7A 3OZPA 1GHRA 4GZIA 3ABSA 4GXMA 4U3AA 3TZFA 2NWSA 2OB3A 3TN5A 2EHHA 1DHPA 4NYUA 3II1A 1A5AA 4I7UA 3EZ4A 4NYYA 4CQ9A 2WVUA 2HXUA 4OOZA 3VOCA 1KCXA 2Z7KA 4BWLC 3GM8A 3WUEA 3B8SA 3C3NA 3FDKA 3T78A 2NV9A 3NL2A 4FIQA 3NO3A 1EJWC 1ZS2A 3R43A 4LALA 1QI5A 4HBKA 3E96A 3SRKA 3U2CA 5T26A 1W32A 2Y85A 4AHQA 1SZNA 2WC3A 1XKJA 4LUIA 5C7VA 4HHPA 2VHLA 4K1GA 4HZMA 4DNHA 3SUTA 3SCNA 5AHNA 3H21A 3KWSA 4R53A 3VGEA 3VMOA 3UEQA 3PZTA 3NO5A 1KM6A 4FZIA 1HQTA 3O3RA 5FF4A 3KL0A 2VEPA 3UD6A 4H6KA 3UZYA 3CM4A 1K4HA 5HINA 1IHIA 2IS7A 3SIZA 3FAXA 3NAVA 3O8AA 4NRSA 1ZAHA 3VGBA 2IPWA 4I8DA 5AZ0A 2VVNA 5CXPA 3VU2A 5T9BG 4LCSA 4CN4A 1QK0A 3BAKA 3LERA 1JI2A 2PP0A 4Z08A 4OKDA 4XX6A 4RK8A 1ADOA 1NDWA 3P80A 3OPSA 3MMDA 4IOTA 2ZZ3A 2NT0A 2VGBA 1FA2A 3ATYA 3LD5A 3QHOA 3GHTA 4R33A 1UP3A 2BY3A 1B54A 3U0HA 1YE6A 3G3DA 5BMXA 3IVTA 1M1BA 3CMJA 4Z1DA 2XYLA 4IICA 4YU1A 4I6VA 3YPIA 5A5WA 4QRNA 4XKYA 2JIEA 3QPZA 5G2IA 4JTAA 3S2LA 4NG3A 3WH7A 4FALA 1GVSA 5IDZA 2ZTKA 9XIAA 4TVDA 2OKTA 3FA3A 2QVNA 1UOKA 2XFYA 1TSIA 2R24A 1RA0A 3AS0A 5JMUA 4DO6A 3G3MA 2VMFA 4LB3A 3L4UA 3STPA 2QCEA 3MW7A 4MY9A 4C7GA 2HQAA 1E56A 1BRLA 2P88A 3UY8A 4BK9A 3H70A 3QV8A 1JYWA 3VGHA 1XHGA 1VD6A 4RJEA 4JX4A 1ML1A 4S3FA 2DP3A 4I9MA 5D03A 4UFMA 4ZOBA 1SZGA 3RNDA 5I78A 3RYSA 2DDXA 4B90A 1E43A 3N9RA 1GCYA 2YOCA 1AZ1A 1EHNA 2BHZA 3WQCA 1BGGA 2Q71A 2V5DA 3CLMA 1F3EA 4XVEA 3Q65A 4CN6A 3UFYA 4W84A 2D2GA 5CZ0A 4WK9A 2WHLA 1XDLA 3OQ8A 1CGYA 1V08A 4I5RA 3SUWA 3C0SA 1IEQA 2FPYA 1MO0A 3T9PA 4WKFA 5DLCA 3T2PA 5LGXA 1EOMA 1UKPA 4XZIA 1QPRA 3W2LA 3RCNA 2PU0A 5FEPA 4FA3A 3ZMRA 1BKHA 2YXOA 3XINA 3WQVA 2BY0A 3LMZA 3LN3A 4KRUA 3MWCA 2BOGX 1HKJA 3UZXA 1V6YA 2BBFA 4XAYA 3VKJA 5F1UA 3NNTA 3L2LA 4F3HA 4R34A 1A3HA 1KGUA 3EDDA 4C6PA 3WZ0E 3JR2A 4UZSA 2G5WA 3TYBA 3W1UA 1UWUA 2D2JA 3UXDA 4EANA 2PDWA 1L8PA 2CKSA 3EOLA 3S1VA 3OHMB 1DQXA 4DM2A 2WHKA 1JYVA 1QT1A 3LI0A 3TYDA 4FX8A 1QO2A 3EOEA 1VZWA 2C18A 2Z00A 4A2RA 3F2DA 1HIZA 2ZZ2A 4JS3A 2FMOA 3E49A 5FSDC 5JU6A 1VH7A 4D8LA 3QZAA 4KKXA 2MANA 4CU6A 6TIMA 1IF2A 4RNHA 1MUWA 2BB0A 3FGCB 4IP5A 1O12A 3OZMA 3PBUA 4P7QA 3UPBA 4WRHA 3IGXA 1LQ2A 4KPLA 4A6GA 3ARTA 3WBWA 3KWXA 1LT7A 4UUIA 4ROPA 4IJBA 3AZRA 1Q6QA 5D32A 4EOUA 2NLYA 2G3NA 4KRTA 1ZAIA 2QULA 1A0CA 3WQWA 1EGZA 1S38A 3LQLA 4C7FA 3MHGA 4LS1A 3SM0A 3DFPA 4AU0A 4O0ZA 1L6SA 3RIKA 2J78A 1YDOA 2X2YA 3W37A 1JR1A 2HNHA 5FF7A 2PAJA 3ZO9A 1EWDA 4DJEC 1TCMA 1F4AA 3NQ7A 1P6CA 4I7VA 3R79A 4QGCA 2Y63A 1ZNNA 3H26A 3V36A 3B9DA 4HTBA 1OGBA 4JQ2A 2QIWA 2F61A 3ITVA 3G77A 1W3TA 4IQLA 1IZKA 2Y8KA 3WEZA 1FWAC 3VE7A 1UUMA 4GGBA 1IZJA 4MFEA 3W0KA 2PE4A 4QAIA 4GWEA 4UFHA 3NPUA 3E2SA 1C3FA 5A3HA 2FGZA 2FTYA 1B9BA 4AIEA 4DWSC 5C9WA 1Z8AA 3CZKA 4JTDA 2ZRWA 4H01A 3UZ5A 5BRPA 2QGYA 3P0WA 4ZXOA 3NUKA 4FSAA 1PCWA 4MNKA 1T40A 5EL1A 3GR7A 3JZUA 1V7AA 4DJFA 5BWAA 1KFEA 5B80A 4WSHA 2YBTA 6ALDA 1R3QA 1GOWA 3LA4A 2YKKA 3ZR4A 4Q8VA 1FHDA 4B5TA 2PTDA 3OVQA 1IEVA 2XH4A 3W72A 3B05A 1FDYA 4L4MA 3ARPA 2QJJA 2HS8A 3V3WA 3E38A 1FWBC 3WF4A 2E9MA 1F05A 3LPOA 4ADSA 1TA3A 2EAWA 3G0UA 4FXJA 2YW4A 1E0WA 3DHUA 3GG7A 1XM3A 2CETA 2PGWA 4HHHA 4M7SA 4OWGA 5IBXA 4XTIA 1TO3A 1AJZA 2BY2A 3SRFA 3PTKA 4IH3A 3C2YA 4DPPA 2CLKA 4M82A 2G3IA 4J2PA 4J3XA 4XD3A 3IVUA 3IRSA 3QMTA 3ICJA 2ISWA 2O4MA 3AU2A 4MAVA 4EF9A 3L2IA 3B97A 4LF1A 1TMHA 3KBNA 1OF8A 2IPFA 1WPCA 3FN9A 2E40A 1D3HA 3KOYA 1NOWA 4MB1A 1TJRA 4Y96A 5I3JA 2PDCA 3TCSA 5M17A 3CT2A 3WELA 5D30A 3AWNA 4WKHA 2XN2A 1W17A 2GYIA 1VC4A 3RM4A 3L5MA 1KBBA 1WA3A 4JHZA 2EF9A 3MP4A 7REQA 4LS0A 1RALA 3S5NA 4C1KA 5D2WA 2Z24A 2GWNA 4DPQA 1JEZA 3LCGA 3NURA 1BQCA 5LYRA 3RO8A 1PWMA 3C2RA 2DGAA 2QPXA 2X2GA 1W2PA 3T0CA 2V6AA 5DBUA 2G97A 5K4XA 2WBGA 3LV6A 1MMFA 2VWTA 3R94A 3SN0A 3ZVHB 3CK5A 1WZAA 1QJWA 1RVGA 2VR2A 3CIXA 4D2JA 3A47A 2Y5JA 7TAAA 1C7TA 3EDEA 2P3ZA 4ZQCA 4WR3A 3C52A 3ES8A 2P50A 1Z7AA 4O28A 4POCA 4ICNA 3T8LA 1H1YA 5AHLA 4J1OA 2MNRA 3GNPA 5CGTA 5LNUA 2QPUA 5DX7A 4DWDA 5C54A 5AB3A 3TE9A 1ADSA 3TJLA 4F9JA 1OF6A 4CD5A 1OFPA 4V1YA 2FHFA 3O06A 2EPNA 4CCDA 4KRZA 4NILA 3ARVA 2Z6IA 1SFTA 3IJ9A 5BCAA 3NQFA 2NSOA 2PTYA 1JYNA 3HIJA 3WLRA 1KB3A 3CL7A 3GFYA 3RR1A 1CLVA 5CPQA 4YVXA 3IARA 1JQXA 3MSDA 2DQXA 3WY1A 3L2MA 2XFWA 3OQEA 1W9DM 4JL2A 5TF0A 1UB3A 3QPEA 4LS2A 2YGYA 2OTDA 1V03A 1JAEA 1VLWA 4TX8A 1KM5A 3CAVA 5DY3A 3R58A 2NQLA 4XD5A 4AC7C 2CLHA 3AIBA 2XHYA 1JYXA 5EKYA 3A23A 1LZOA 3KEHA 2R6OA 1U33A 4CNTA 3AI0A 3VDBA 1ZCOA 2PA6A 4IXHA 4HU0A 1H7XA 1B2YA 3GY1A 1BYCA 3FCPA 5DMYA 3LCIA 1QFEA 2OO6A 1PEZA 3EOSA 4AZIA 1KD0A 5FIPA 3GH4A 4XIMA 3AIUA 2PDIA 2F38A 3CL6A 5C9UA 4C6OA 5JBDA 5LIUX 5L9FA 3WFLA 2KZHA 1L9WA 4YTTA 1E1EA 3W9ZA 3ZZ1A 3UETA 1P0DA 1N2VA 2TPSA 2NQHA 1HNYA 4FR6A 5HNTA 2BGQA 2XH0A 5FCZA 1DWHM 5CJNA 2Y7EA 3UG4A 2ZZ6A 3M5VA 1W5PA 2BGSA 3LGDA 3EKZA 1SFLA 4GIRA 2DSVA 1Q13A 1FY6A 2C7FA 3BAXA 4FF7A 3H23A 1WXJA 2XH7A 3K8KA 2AKZA 1PIGA 3MP3A 2ADAA 2PDXA 8A3HA 1BPLB 4MMWA 2AQWA 2D0GA 4MKVA 1CX9A 2R1NA 4G2DA 3QSRA 4RZ4A 1FFRA 4P2VA 1JZ2A 3ZR6A 2Y61A 4PMYA 3WNLA 5D2TA 3G6LA 3THAA 1Y5WA 1EQPA 1R3VA 4PMUA 4KF1A 1EGVA 2XVNA 3S5OA 4UCGA 1BSLA 4ENLA 4UFIA 4UQBA 1KRCC 3ENLA 1M65A 1OCJA 4US6A 4GNJA 4PMVA 3ZQ9A 1W8SA 4JBRA 4KCWA 4GYPA 2ALDA 2P76A 1KRBC 5E09A 3F4WA 3BUVA 1RH9A 4MYXA 3O16A 1GWJA 2BOFX 2DVTA 3CIWA 4YHGA 3W7GA 4UB9A 3LUTA 2R9RA 1UWAA 4GI4A 2Y7DA 4GNKB 5A2BA 1WNOA 5TNVA 1ODUA 4TIMA 1XRFA 3IWPA 4U3CA 4Q8TA 3ITCA 4BEQA 6XIAA 4AYSA 3P8IA 1CWYA 3DYMA 1D7FA 2JKEA 2ZADA 4UCFA 5GJMA 1ZB5A 2GUBA 3M0VA 4D6EA 2FPVA 5ECVA 3GKFA 3CMGA 4QG8A 4O1DA 1R3YA 2D69A 5HMFA 1H60A 2Q8ZA 4XO6A 3WDIA 1NQKA 4AWSA 2PDFA 4UTUA 1H49A 4TMCA 3OLEA 3EKGA 3GNRA 2H8XA 4C6CA 4IFKA 3O07A 2HVMA 1HP4A 3VDCA 3OVPA 4M6QA 3KL3A 2WCSA 1H0GA 3PTDA 1QHPA 4D71A 1IE7C 2WB5A 1EWEA 1XC4A 3N73A 3P60A 1YPIA 4LY8A 5FACA 4UNLA 1EPXA 3MKVA 2Z2AA 1RJRA 4KWVA 4NASA 3G0XA 4OUIA 4OV4A 2WVVA 4MDPA 1KBKA 4QLLA 3WH8A 1H61A 1R3TA 3UXIA 4S3CA 3TDFA 3DHFA 2AMGA 2R82A 3TVAA 4ZFCA 5JIWA 1FFQA 1GVOA 3GK0A 1XH0A 4MB3A 3W7QA 1FHLA 1TTQA 1GTHA 1W3NA 5AY7A 4GVGA 4S39A 2X05A 1SZFA 3TYZA 4B5WA 8CGTA 5LNRA 3M5YA 4JX6A 2VR5A 1A5SA 2E6DA 4U5KA 3ZJKA 3DUGA 3S5SA 4UTJA 4DN1A 3AXMA 3VILA 1YMYA 4E4PA 5HR7A 4JEJA 4O0KA 4OE7A 1L2UA 2ODOA 4MB5A 4MHBA 3R1ZA 4EP8C 1N8WA 3R0DA 4IIBA 3Q58A 3C61A 1W37A 3IGHX 4ZTXA 3CPRA 4L6DA 2GOKA 3GU2A 3F5JA 3N1AA 1P4CA 4ZR8A 3LS9A 4WDXA 1QRQA 2VEKA 3AS2A 5CSRA 2NVCA 4ILSA 2IQ0A 3HG2A 4PB3A 4FX6M 3FIGA 4TO8A 2C91A 5G4EA 1A3WA 4Q7BA 1EJUC 3AUOA 2GDQA 4Q3MA 1OWQA 3P14A 1WDDA 4JTIA 2ABAA 3IJ8A 3S8HA 4FOKA 5J5DA 1MFUA 3MMUA 5CJMA 3GTNA 1O94A 2Y5SA 2J47A 2HISA 3DFNA 1ZP3A 1H5YA 3FJ4A 5XIAA 5DRIA 1XLCA 2Y7FA 3OA3A 1QNVA 6REQA 1J12A 1L6YA 4NNBA 2J8TA 4B4FA 3ANVA 3LRLA 3BOFA 4HA1A 2X7VA 4P7NA 4KWWA 2Y8UA 3TC3A 3ZOAA 3G18A 1KKOA 3KBMA 5GNZA 2D0FA 3BLOA 5EY5A 1Q5MA 5C8BB 1WE5A 4RV3A 1L6GA 3RAOA 3QY6A 5REQB 1W1B1 4MNLA 1CXKA 3P0XA 1EO5A 4XSLA 1XYAA 4XUGA 5LNSA 4QNEA 2EPOA 5CG0A 2WVSA 4HYWA 3L65A 4AVOA 4D6JA 3EOOA 3LSCA 2ZA3A 3AHYA 3RF9A 4WSJA 1QBAA 3LNPA 2PTWA 4LVFA 1VPXA 1OABA 4XK2A 3TU9A 1HF6A 4KFNA 3LXBA 3P62A 4REQA 4RLIA 5I3IA 2WZIA 1U2YA 1ZALA 3LPGA 5KINA 3A9IA 5IDIA 3RCMA 4A3YA 5BYWA 3EKLA 3OGSA 4AQLA 1BF2A 4TVCA 1VEMA 2PURA 3LCHA 3DYOA 4GJ1A 3STFA 4ECLA 4UQEA 4BHYA 3OGVA 4HNLA 1OSEA 3VVGA 4U33A 1XLIA 2DSKA 4IGSA 1I1XA 3HN3A 4RE2A 2J24A 4KGLA 4MDOA 2OZTA 3D47A 3MUY1 2WMGA 4CVWA 4AVFA 4KIEA 5CPMA 4D9PA 1P0NA 1GOMA 6CGTA 1BXCA 2DH3A 1XDJA 4URIA 1ONEA 2Z6JA 1HJUA 2HTMA 5AZ1A 2NQ9A 1OBAA 3W1MA 4KBXA 1JCMP 4LUSB 3SFWA 4RXFA 3RM8A 3W38A 2Q8XA 4ORMA 4WDWA 1UBPC 2FVLA 2OSWA 3SURA 1W1A1 4UQAA 2W4XA 4Q8QA 1CB2A 2WLZA 3BL3A 4PBEA 3SY1A 4C6KA 1E4MM 3KOXA 4HK5A 4I9JA 2WJFA 1RCOB 4W86A 4PEEA 1TE1A 4FHAA 1ODZA 1QASA 3WH9A 3MUAA 3WK0A 5BU6A 2DQWA 2WBKA 1BYBA 3IJQA 1VJZA 1ITCA 4RL3A 1R86A 1WDQA 1EBGA 5D9PA 1PZ2A 1J0YA 4OVXA 1FWNA 1K6AA 4N9BA 4XZHA 1CTNA 3O63A 1SW0A 1ZJBA 2NXGA 4GY7A 5M1TA 2J13A 5FJOA 2QMJA 2DFAA 1H62A 2CLMA 3PJWA 4F40A 4AB4A 2QHAA 3EB4A 3B0PA 5AHEA 3B03A 1SR0A 3VUPA 1P5BA 3LTPA 5FAJA 2YL9A 1D9EA 1I60A 3L9CA 3O05A 2A21A 3DFOA 4WOZA 3UZJA 5CKSA 4LC8A 4QM1A 4EACA 3IGSA 2JBMA 4AZBA 3W7NA 2QUTA 2TYSA 2I16A 4PRRA 4PL1A 3CUZA 1TELA 1OCBA 4Z2GA 1JRCA 4P7OA 3UR2A 4C6QA 2ZA1A 3P5ZA 3CHDA 4HU4A 4Y9AA 3E9AA 4EAMA 4DIAA 1E40A 1AODA 4X63A 1Q4NX 3SRHA 3VCRA 4WEVX 3TTOA 3B8WA 1NFPA 2E28A 3APYA 1HJXA 2J9XA 4DO4A 4S3EA 1I8JA 3QVQA 4QCFA 1V6WA 1JGMA 1LG2A 2Y1HA 3H2EA 4IX0A 4DQWA 2QF7A 1LWIA 3MQTA 1DXEA 4Z42C 1SYTA 5ABFA 1AQMA 1F2JA 4FEZA 4LB4A 3O2LA 1XLGA 7ODCA 2QV4A 4GQBA 1VBGA 2VFEA 3N2MA 4AIOA 1PJ9A 1KCZA 1KXTA 2F8QA 3ONCA 4O16A 4UTFA 5BXRA 1TUXA 1S5TA 1CGXA 3GBDA 1S46A 1L8NA 1TR1A 3UCDA 1ENUA 4V33A 3JVAA 3NDOA 5AC6A 1LBLA 4R7OA 5A6LA 3T0AA 2HSAA 2CIPA 3W84A 3ANUA 1XIGA 3IANA 1FH9A 4GY0A 2XVKA 4Q8PA 3V5FA 1XYMA 4XIAA 4QIUA 1CGTA 4IX2A 4ZOCA 3WQ8A 4MM1A 3GVRA 1X97A 5H8PA 3WD4A 1GZJA 1KM1A 4PN2A 2CESA 5CQ1A 2RKXA 4H7VA 3K2GA 2BASA 3JS3A 3WNNA 2WPBA 5CGQA 2VFDA 4N0RA 2IW0A 4ZE5A 2WZHA 3PFMA 1C29A 3TYAA 1A5OC 1QW9A 1UD5A 3I65A 1QI3A 2WCAA 2V81A 3GZ3A 4Z1BA 2GSHA 5ABFB 2HJPA 3AALA 1IXQA 1V8EA 1KV5A 5D37A 3NM3A 2J6XA 2FHBA 3HB9A 3USBA 1XRTA 2EJ1A 4YNGA 3GDBA 1UQZA 4Q8NA 3W1NA 1VBUA 2UV8G 5FL1A 2VRQA 4B5SA 3PPGA 3B9OA 2PDUA 3I7SA 4QQ3A 3RUBL 3FGCA 2DW7A 5E93A 2DV0A 5I03A 1PS9A 1O1HA 3LENA 3GG1A 1UMYA 3HURA 3TR2A 4HMCA 2WVVB 1TPH1 2WSKA 4NJIA 1JCTA 2BFGA 3D6NA 1XYCA 3LCLA 4CNPA 3S2MA 1KGWA 2V68A 1DWJM 3W28A 4JQ3A 1RA5A 4R9OA 4H8NA 1J2WA 1FKXA 2GZXA 1PHWA 3GVGA 1VJIA 2CEQA 1TZZA 2PBGA 3RXZA 1VPQA 4NAFA 3B40A 1ZQ5A 2D0HA 2QUMA 2GJPA 2YL5A 4HIBA 1UR1A 3LM3A 1DIKA 5LA2A 5HJLA 1QOPA 4K7VA 2OYLA 4IT1A 3VNLA 2X40A 3RLVA 5C9XA 3W1RA 3E5BA 2VGIA 4PUMA 2PGRA 4NZCA 6PTDA 1LM1A 2BY1A 1B3VA 1VRXA 3KE0A 3PNUA 2YLLA 1MZRA 3DKLA 4PGLA 4PUKA 2DZWA 4IIFA 5A2AA 3WMBA 4AMCA 5KZMA 1PZ0A 1N8IA 2ZIDA 3FVDA 1AVAA 1NF7A 1E5NA 4JFVA 1IXOA 3W01A 4IMCA 3MUIA 4R85A 4EK7A 4A3UA 4O1EA 5BWFA 1WDSA 3A9BA 4Q33A 3N4AA 2CC0A 4XD6A 2RGLA 1EF3A 1ICSA 4PRTA 4R3UA 4B5VA 4GVFA 4H9VA 3NGJA 3WBYA 1CXLA 3O6YX 3VMPA 3WLLA 4CCZA 1JFXA 1LQ0A 1TMQA 4WCJA 4FNRA 4G8TA 2NV2A 3WD2A 3WK2A 2DZVA 3Q37A 4R7JA 4L6HA 4N6EA 2YA1A 3G1SA 4W87A 3UY7A 3K8MA 4DUVA 5HOSA 4EPDC 2YCJA 2GDUA 1E73M 1CDGA 8XIAA 5HXMA 5FF2A 3CWHA 4C91A 4AVNA 3H2FA 1E6QM 4PUUA 2I9UA 5C6MA 2V3GA 4FOJA 3N2BA 3DCPA 3MB9A 4HPGA 3W7EA 4AC1X 7A3HA 3SCVA 3PVFA 2PDKA 1Q3NA 3MUCA 3L4WA 1AH4A 2G95A 3HPZA 2DVXA 4O57A 1B0IA 4P61A 4E2BA 5DMMA 5C2CA 1V6TA 1NH6A 4K6AA 1HJSA 4C6JA 1XI3A 4QQUA 2NV1A 1HT6A 2O9OA 4UIOA 1GVRA 1OFBA 4GIAA 1VRDA 3T0BA 2CBVA 1V0KA 4LV4A 2PWGA 3ARUA 3NSNA 5F2GA 3BC9A 1US0A 4DUWA 3PFRA 3WBEA 2CLEA 2YFNA 1PYFA 4OQVA 2TAAA 4O12A 4HU3A 4U4MA 1F3TA 5A69A 2R1PA 4H7CA 3PJUA 1OCNA 2NXHA 5KITA 3T81A 3GIPA 4RNFA 3P5YA 4PUEA 3PPCA 1F8IA 3THDA 3S2NA 3W1PA 3W26A 2FTWA 1CW2A 3AXKA 1GOXA 2XTKA 3G1YA 3NR0A 3C0LA 5G2WA 2J7FA 1TJ2A 4NHVA 2E6YA 4NZ4A 5E0KA 2PB1A 3WNMA 3LBOA 4CCEA 3UWVA 1CCWB 1E9IA 2VGGA 3MHUA 2CITA 1FRBA 2GVLA 3QKZA 3AHXA 3ATZA 3CASA 1VJSA 2HK0A 4LF2A 5HWNA 4EWJA 3NJ3A 3LLFA 1SPQA 1UD3A 4GH1A 1MW2A 1T41A 4QEEA 2G41A 3ZWTA 3M16A 4J3VA 1MDLA 4O13A 3PC0A 3SCWA 4PMNA 2ESCA 3H6OA 3T44A 4YCOA 4LWWA 4MNJA 4FXRA 4XUYA 4NI3A 3L5AA 3PR2A 3DH7A 5EA9A 1MFVA 4NI8A 1CEOA 4QDPA 2DEPA 4KS0A 2Q3RA 3ECQA 4B5XA 1Q8JA 4NY2A 1IXNA 1WV2A 1JZ8A 1PV8A 1EZ2A 3UGRA 3TONA 3PTQA 3FKKA 1M3UA 2D2OA 1N7KA 1GKQA 2FFIA 1LOSA 4UR9A 3H2NA 4L80A 1HL8A 1J8VA 1LWHA 1UPMB 1MEHA 1XV8A 1V0MA 3PBMA 2VX7A 4D6DA 4JDBA 4ACZB 4ZO8A 1MQPA 5A6AA 4ZBCA 1KBLA 1H7OA 3CHFA 2O0TA 2QYGA 3S6OA 4UMCA 2MUCA 4JNZA 4DUXA 1VBHA 4TQTA 4BQ5A 2X1RA 1Z69A 4UTTA 1WKDA 1E4IA 3OA5A 4PH6A 1TV7A 3N4FA 1U5VA 1W1YA 2VR4A 3SUUA 3TNOA 3IACA 3DC0A 3CEPA 3F1QA 4Q4QA 2JGYA 3NG3A 1HGWA 1GPWA 1I75A 2R91A 1YRRA 4DYJA 1ZFJA 1QUMA 4P8UA 4U28A 1GVIA 3GXNA 3BJFA 4DJDA 5A8MA 3UPMA 2Q09A 4PR4A 1Q6RA 2OGJA 4Q7IA 3GO2A 3B8VA 3UT0A 2WM1A 1DWIM 4PCFA 1A4LA 1G4PA 3M46A 3SSZA 3QRHA 4Q7NA 4MIMA 1P1XA 4J2MA 3GR4A 3HG4A 3MVTA 3QN3A 4M80A 5MHBA 3HQPA 4GBDA 1UOZA 4IZGA 1EQCA 3Q2DA 3G24A 3HPSA 3G2GA 3UJSA 2PDHA 5BRQA 2O7SA 1W1PA 3K1DA 1OB0A 4L65A 5I23A 2ACUA 3W83A 5FSEC 3WJSA 1QWGA 1Q6FA 3AZSA 5LXEA 2PCEA 2QV5A 1E3XA 5DEZA 3L7RA 4GG9A 2PWFA 2VDIA 2F2KA 1Q4WA 1W31A 4MAZA 1LWJA 1C8QA 2INZA 3SIMA 2ISVA 3A64A 1J11A 3MU7A 2BZNA 1GPFA 1OC7A 3QW4B 3GDMA 1Z41A 4R27A 4J7RA 3SO7A 3PG8A 2R1MA 3OG2A 4EIVA 1X1NA 2GQAA 1AUSL 1KM2A 3IRDA 1RCQA 4HCHA 1AL7A 3GH7A 4P8XA 3C3UA 1WAWA 1XYFA 5A6BA 3OG3A 5IXEA 2FZDA 5DCBA 3ZSSA 3N29A 3SQLA 3W1XA 2XUCA 3LCXA 1F9CA 1TWSA 1UR4A 2CWNA 2D2HA 3QLDA 4JIEA 3C2OA 5EFFA 1DWAM 3TLQA 5CAHA 3SBFA 3O6CA 4RW5A 4BJHA 1LL7A 3GDLA 4Y7EA 4OHQA 4ZEPA 5B7YA 3CQIA 4FS9A 2VFHA 1UJQA 3U9IA 3F5LA 3NZPA 3TXVA 3E6EA 3ITTA 1SW3A 3V5OA 3EWDA 4F2BA 3P74A 1Z6KA 2C1HA 4TV6A 3VNJA 1O5KA 1MI3A 3W76A 3SCSA 3ZLFA 2VD8A 3T2OA 2XGIA 2Q8LA 3SECA 3GE7A 5AVHA 2AQOA 1TPUA 4JCLA 4C5YA 3LRKA 5F2LA 1OT2A 2X0SA 4S3AA 1EP3A 2YCIX 4DXXA 5FKYA 4GUFA 3GKAA 3OEXA 2ZX8A 1ZSXA 5BXPA 3CNYA 4FX7A 1I4NA 3FW6A 1CECA 4HNCA 2OQHA 1OVDA 5AKQA 3EX1A 3W3OA 4WGHA 4CNNA 3L4VA 3ARZA 1WBJA 3RN6A 3MC5A 3KCJA 1S5VA 1AJ2A 3NZGA 3VX1A 5CGMA 1JGIA 1R3WA 3BLDA 3GH5A 3WUFA 4CNSA 4RDVA 2YCLA 1HKWA 1JULA 4YHEA 5CZTA 2DT1A 3UCQA 3TAKA 4UOQA 4I9TA 3SGUA 3AISA 4IF2A 2DVUA 2NQ5A 3P7YA 2FLIA 3ITGA 5A6SA 1R7OA 2WMHA 3NA8A 1VYSX 4CU8A 2OXNA 3KBWA 2FQIA 3A13A 2GGJA 3QQ0A 5CLWA 3HMCA 1X6NA 3VDGA 3TH6A 1KO0A 3EOUA 4PB5A 1TPEA 3DFTA 2QAPA 1FWJC 3PG9A 5F2IA 4V15A 1GQNA 3GHRA 3MT1A 2ZUTA 2WVTA 1XSIA 3R13A 3TNBA 3R11A 3BW3A 1Z42A 1JUBA 1XICA 1WZMA 3SSJA 3CC1A 3GAKA 3ERPA 2E9BA 3SCOA 4H9ZA 4LCQA 1F6KA 4WLCA 2IKHA 2ZDSA 2IPGA 2F6KA 4DJDD 4WJEA 1YTEA 1ISXA 2C0AA 2VOMA 2X16A 3GX9A 1OD8A 4CKQA 2VWSA 3MCMA 2QKFA 1VFSA 3LGEA 1RV8A 2C16A 1BVWA 3NL6A 5CC7A 1A5NC 2WWCA 1UYQA 4FK9A 3DECA 4QSHA 1A5BA 3L4ZA 3IAPA 3ISIX 3CAQA 3VIIA 4W7VA 4XAGA 4J3WA 4BWLA 1M6JA 6REQB 5HBFA 1XKYA 1AW2A 1GJPA 5M5DA 3C8FA 3H4WA 1A5KC 2F6UA 3I4KA 2BVWA 3LQGA 3N11A 2QR6A 1A47A 1XD1A 3EA1A 3VZYA 1DVJA 2BXYA 4F0RA 4PTVA 1YQ2A 1DEDA 1UBSA 4JX5A 3K4AA 4O54A 3SUSA 4N42A 3CLWA 1NEYA 4QCEA 3M5XA 2WHMA 3WUBA 4ZFMA 2GJLA 3G1FA 3BPWA 4HYRA 4LX4A 4HN4A 4EF8A 3A4AA 2XN0A 3WH6A 3SN1A 1E1FA 1ZBWA 4UMAA 2A3HA 3F4DA 2CXGA 3TJXA 2PTXA 5K2ZA 3RILA 4NZJA 4ASTA 1WAUA 1J79A 1C8XA 1S5NA 2W66A 4GPNA 3BLIA 1V6XA 4FLQA 3TQPA 1GGOA 3WIJA 1K9TA 1E0XA 3WKZA 2X09A 2DPEA 3PBGA 2A4AA 1ESWA 3KLLA 3CEUA 3DEQA 1FVPA 4KT2A 4DBWA 3NPWA 4UTWC 4AEOA 4DXKA 3ZFHA 2HNEA 4Q6XA 3NQAA 4V28A 3L4YA 4KCVA 4M5PA 1R47A 4NZ1A 4ROQA 3WENA 5EU9A 1M7PA 2XU2A 4C6EA 4H9MA 4O11A 2PZ0A 3K30A 4H41A 3CWOX 3K8LA 1QNOA 2WM0A 3RR4A 5EMJA 1EXBA 4AY1A 3UXLA 5H6HA 1U22A 1Y0EA 3VGFA 4YL2A 3HJEA 1QBBA 5FF0A 2X0HA 4A8IA 3WDQA 1R0MA 3PSVA 1WKYA 1XD0A 3UWUA 2F7FA 5CLTA 4GQGA 3WLTA 3C56A 2J7BA 2NUWA 5CPOA 5A6KA 2VQTA 2CBIA 1B4EA 3AYRA 2GVEA 4L4OA 3HZ3A 1FHUA 4JIPA 4O10A 2C15A 1TUFA 5HAOA 2PDNA 4QE4A 1BWVA 2G3FA 1YNYA 3L67A 1XS2A 4JYEA 5A94A 2ASHA 4IMGA 4XKYB 5D9MA 4NAEA 4ATLA 4A4AA 2YCKX 4NJHA 3SAZA 5HMDA 1OG0A 3IPWA 4LANA 3AJXA 4UFJA 1NDVA 4J9JA 2W9MA 2ISFA 3CZ8A 1PAMA 3EPOA 3DI0A 5TBOA 4N7QA 1H5VA 2OELA 1ICQA 2YIHA 3KZPA 3U4AA 4XSMA 3SFKA 3HQ1A 2PWVA 4GK8A 3TC7A 4AMAA 7CGTA 4JQAA 1XR2A 2PDPA 4B5UA 2DZBA 4DBUA 3BJSA 1XH2A 4E8CA 4UTMA 5I3GA 2PP3A 1V51A 3A5VA 3PBWA 4GX8A 1LL4A 1M41A 3UNDA 1FH8A 3GXDA 5SWUA 4MTVA 1MQRA 1N8FA 4O15A 5DCEA 1TQJA 2P53A 3LRMA 3NQ2A 3S46A 4GC4A 4H6RA 1E5JA 1SMDA 2Z2BA 2XISA 3WJZA 3URAA 1DL3A 3B9AA 1IQ8A 4PYSA 3S6TA 4UC5A 1FP9A 3GHSA 4LUTA 6A3HA 1KXVA 4PMXA 1JL8A 4Z2HA 3NEVA 3KRBA 3M4HA 5HK4A 3VD5A 2Z26A 4HD5A 4YLWA 1KNWA 2E5CA 3EX2A 4ZCWA 3VPLA 5EYWA 3OIXA 4S3GA 1JAKA 4IP7A 1QO5A 2YX0A 1D3GA 3H7UA 5K9CA 4AFYA 1UZDA 5TD4A 1ISVA 1C90A 4Z2KA 1WZLA 3TX9A 3UNTA 3S9ZA 1VHNA 3WLPA 4RE4A 3S6DA 2VZSA 4IFKB 2OZ3A 3H7RA 3W1TA 5D8WA 1IT7A 2A7NA 4IPNB 3VIGA 1DWGM 1EH9A 3S0CA 4DHGA 1J6PA 1IIHA 1XPYA 3TTQA 3NFUA 1P48A 4OT7A 3ZIZA 2ZC1A 5T91A 4FPSA 1A5CA 4ADTA 1XIJA 1TX2A 2FTPA 4UNKA 3KCLA 3U3HA 1XBVA 3PUOA 2W92A 2X8RA 5HANA 3HM7A 1RP8A 1A0EA 4DO7A 1R3RA 2BXZA 1G7VA 4PMZA 5IM51 4JN6A 1QPOA 1V02A 3W1AA 2NVAA 3TC6A 3GBEA 1FXQA 3BOXA 2E1WA 1EUNA 2VCBA 4FIRA 3CPGA 3QFWA 3LCWA 4LU0A 2YXXA 1GTEA 1E0TA 4K8GA 4RV8A 2DUXA 4ZB5A 2A6NA 2J77A 4JOMA 1ECEA 2PD5A 3T4WA 1TYGA 5IFTA 1VFOA 2ZWYA 4TTUA 5KEZA 2ZTJA 1JPKA 3OLDA 4QE5A 3WYZA 2Z1WA 4PCSA 4A3QA 5DXXA 3KVJA 3O9NA 2OLAA 1QHZA 1OIMA 4OU1A 3M1ZA 3GDKA 4YJ5A 3IJ6A 3EX4A 3F4CA 3W71A 5AHFA 4DXVA 3IJDA 5KMYA 2YFOA 3A4XA 3W88A 4WSKA 5EMLA 4B4HA 4C6DA 3ZSTA 3W7PA 3O1NA 2PRLA 4JZ5A 1KWGA 3FDGA 1DOSA 1UWQA 4GJJA 3IUDA 4GVHA 4HP5A 3D46A 4JTSA 3NZRA 2DW6A 3W4RA 3VM7A 1HP5A 4IMEA 4DWSB 4LSBA 2HS6A 2VGFA 1TWZA 3K1GA 3W27A 4NZFA 4W7WA 4AIUA 3LMYA 4CEXC 4H6QA 3VNKA 4ORIA 5C0QA 2Z25A 1DKWA 2YDAA 3U5YA 1PKMA 1ONXA 3NOYA 4M6VA 2J25A 2QGHA 3BK0A 4M7TA 2O7QA 1KTNA 2E5BA 3FLUA 3V1HA 1F4HA 4Z2IA 1EB3A 2W91A 3V4BA 3IIXA 3UESA 2DJLA 4LBUA 3HQNA 3SY8A 1Y8BA 3AAMA 3UCCA 4WDTA 4WQ6A 3ME3A 3BW2A 3EXSA 1NIUA 2DH2A 3WD1A 3QYSA 4DYEA 3BGJA 3GUWA 1G4EA 4TMBA 4WVXA 3J7HA 2CHNA 2EG6A 2EO7A 2Z1XA 3CH9A 2A1YA 4N4PA 2XM2A 4UQDA 4UTWA 4S23A 2XZ9A 4GCXA 1VIZA 3PZ9A 4EPEC 1PKNA 2XIMA 1E6PA 2QJMA 4JTGA 3W70A 1Y5VA 2B0MA 1ZBKA 4F48A 3N14A 3RLGA 1YLVA 2DZSA 3AMKA 3M0XA 4GO9A 2ZFAA 3EMQA 1BG9A 3UYCA 4Q4RA 3DBPA 4GABA 2CBUA 1DE6A 1VPYA 3RMJA 1BHGA 3VIOA 1PVNA 4JKKA 3GR8A 3WMLA 4AWTA 2E9LA 3QMRA 1FXPA 1VFUA 1XG4A 3W2JA 3BAJA 2RDWA 3NWRA 1QWKA 9CGTA 4G9PA 1IGSA 2CW6A 3TTSA 3HV9A 1UKTA 4LH8A 2NVDA 1V93A 3CGTA 4JTCA 1Q6LA 4GUJA 4JAWA 5DQPA 4AIBA 3UYIA 1E71M 1TVLA 1VIWA 4XBJA 4DF0A 3M07A 1R85A 3AYSA 3LK6A 1JZ7A 4Y9OA 2H90A 1N55A 1AA1B 4L5ZA 4AD4A 2E4TA 1IWAA 4S3JA 1Z3NA 1Z32X 4QAWA 3QC0A 4MJ4A 2Y89A 4W8LA 4WOQA 4X60A 4MY8A 3EMCA 3WJXA 1R2TA 3OBEA 1R7AA 2PDJA 3WF1A 1C8VA 5G1MA 1S5MA 5CBJA 4GQ0A 2WKGA 1K8YA 3SCUA 3VA8A 1MVYA 4V27A 3USZA 4NNAA 1UH4A 1KM0A 4AG0A 3VIKA 1FWEC 1R38A 2B81A 3L21A 1C9DA 1R3SA 4DX3A 1J2BA 1LYXA 1D7KA 4GI9A 1BAGA 5GJPA 3RJYA 2YCEA 5E9AA 2OWWA 2QUNA 4CLMA 1KCKA 5BNKA 4S2BA 1UQYA 3PAOA 3FEQA 1NVMA 5HJYA 3SRDA 1RJQA 3KOFA 1XYBA 4JY8A 5CPTA 3GTHA 1SJBA 1NWTA 5GPRA 1KA9F 4DJFD 4W4QA 4U2YA 3APGA 2DIKA 4GKLA 4G1KA 3U48A 3W1QA 3SGGA 1MEIA 3E0WA 1IEWA 4HCLA 3CBWA 4WUIA 1PZ1A 3WMSA 3FYYA 1F7BA 2YBUA 5AYIA 4DJFC 1YHTA 4MOZA 2E6AA 2IPJA 3PHAA 1HXJA 1U83A 4GGHA 1SVDA 2V9DA 2REQB 3D3FA 2QZRA 1XIEA 3H12A 3W87A 5CCZA 1HGYA 4EPKA 4NSBA 3WF3A 4AX6A 2VELA 1X39A 2JKPA 3B8DA 3LPFA 4GZEA 1T99A 2F84A 1V3IA 3VDHA 2CNCA 4N9CA 1NSJA 4YWSA 2OVLA 3B3DA 1G5AA 3GIYA 1DHKA 2TSYA 4F0KA 4FAMA 1JNEA 2VNCA 4HN8A 1CXIA 2J75A 1G6CA 2NUYA 1GYNA 2ON3A 3RG6A 4YTQA 2ZUWA 3N6JA 2ZICA 4UWMA 1NM9A 4QITA 1POKA 4AZ6A 4ZQOA 2ABBA 3MBDA 4IPJA 3CH0A 1GZGA 4M29A 4FOUA 4H6EA 1B3OA 4H9TA 3BE7A 4EXAA 3URNA 1EO7A 3CWNA 1YKWA 4LYKA 3O6DA 1WXYA 4AY8A 3G8EA 1LF1A 1OFDA 1B3XA 4KERA 2VEIA 3FAWA 4KEVA 4RDZA 3OZOA 4FLOA 1AQ0A 1OK6A 2OYKA 2LLEA 1V79A 1XGZA 4L9XA 3CTLA 4MLJA 2OWXA 1NTHA 2GJNA 1RVKA 4BEUA 3NQCA 1WXZA 3RPDA 1ALDA 5BW6A 3AXHA 2CWXA 4LV9A 4IFRA 4OV9A 2KAUC 4DM1A 3A5FA 3PM6A 2C1IA 4O18A 2Y62A 4KEUA 4ZE4A 4HZ8A 4UZUA 1HL2A 1VBRA 2PRMA 4GXPA 3CHEA 1ZJHA 3B4UA 1QOQA 4AZ7A 1IWBA 2ZRUA 2OFJA 3MMWA 5EMYA 5CPNA 2A7RA 4K68A 1ZRQA 3H2OA 3AIRA 4Q4OA 4DEFA 5DXYA 1KFKA 2QUUA 3SCQA 1T5AA 3DAQA 4GJIA 1OYBA 1FWSA 5F4XA 4GIEA 3L68A 5FA5A 2FKPA 4QXIA 1US2A 3DYPA 3WLIA 1JI1A 5I5RA 2ACSA 2VQUA 3JRKA 4Y9NA 4GZJA 4NZ5A 3BO9A 3AYTA 3AQUA 4H8UA 4O19A 4XKMA 2XVGA 3CV6A 1WBHA 4UFKA 3MDUA 4MF4A 3O0FA 2X30A 4LBSA 4B3KA 1OFAA 1JDDA 2AL2A 5I6SA 1RPKA 1DYSA 1S1PA 1OK4A 2BMBA 4AEFA 3VNIA 2DUZA 3F03K 1UUOA 2OR2A 3FEMA 3WBXA 4JTQA 1GW1A 4XZWA 3WQ5A 1AD1A 4HB7A 2BG5A 3M43A 2Y5EA 3LBMA 1FCBA 3GS6A 1XBZA 1HJQA 3SEPA 3UG5A 1ZP4A 1XH1A 2X1TA 2VZUA 5ABGA 3NGFA 1XQKA 3PY2A 1TV5A 4E3VA 5BOEA 3HGRA 4JFSA 1DXIA 3QW3A 3EPMA 4QBXA 2OZ0A 2FDSA 1W9PA 3RLUA 4J35A 1RBOB 2L5HA 3VNYA 4MWAD 1K77A 1LQAA 1MUCA 4WY0B 1OADA 4CD6A 2PWHA 3CUHA 1HO1A 3IIVA 4MKSA 4RDYA 5ABEA 1TJPA 1AMYA 1S2VA 2EPKX 2VJXA 4US5D 4GUIA 3RDKA 3WF0A 3S1XA 2GPTA 5DY2A 1J96A 4TUFA 5I3DA 5FJIA 1TTIA 1VLIA 2E8YA 3W24A 1GOKA 3AHVA 4JGDA 2J66A 3VI2A 2CHOA 1LCOA 3MO7A 1HTIA 1H50A 3CB8A 4ZOEA 1ECQA 4Y8EA 4S3DA 3HA1A 3L23A 3NQ8A 3M0IA 3SUVA 1MNZA 3C0JA 4I5UA 1M01A 1H7NA 3WLNA 3MCNA 3E2RA 3FXYA 3WLQA 4JHMA 4C60A 3N15A 1GYMA 3VNZA 3ID7A 3WD3A 1PPIA 4Z0SA 3CQ0A 2D20A 2PPGA 3LXCA 1G01A 1O4UA 1WDPA 4IQJA 3AOFA 4M3PA 3H53A 4IISA 3U2EA 5TAOA 1ME8A 5LHEA 3PUDA 1SO5A 1J6OA 3WX7A 4KESA 3GW3A 3RRXA 4C6IA 2Y8VA 3CXOA 4HHMA 3LPPA 2G4JA 3GVVA 1CGVA 3PSWA 2HPMA 2NX3A 1I1WA 2OOFA 4Q4KA 4WX2A 2VCCA 4E6MA 2NSXA 1PE1A 2BP1A 1K9EA 1TR9A 1R87A 1RSCA 2HRWA 4PMOA 3TR9A 3K46A 2CZVA 3ZVHA 2HDJA 4F79A 4LTSA 3LHWA 1UWRA 4S2CA 4OZOA 5KZEA 1ZHAA 1XUZA 4AWEA 1Z48A 3GFXA 2FGBA 5HUOA 3CUGA 2BVYA 4JFUA 3PANA 3ZYZA 1XPGA 3L0GA 3W2NA 3CMFA 4QLJA 1O95A 3MCOA 3N3MA 1EDTA 1T6MA 2O55A 3UERA 4DZIA 4IPLA 2E09A 1R2RA 1AFSA 1YTKA 3VKCA 2PUZA 4GNVA 4HA4A 3E3HA 4PUDA 1QNSA 3WDPP 2WQPA 2OSYA 1WKFA 1W1ZA 1S5WA 4L1XA 3LB0A 1XYLA 3BVJA 1NU5A 2INFA 1Q2SA 2XH2A 3E0LA 4FNPA 4DJED 4J40A 1O68A 2OX4A 1V6VA 2I57A 5IFPA 1J5SA 3VDAA 1KTBA 2QPSA 3BCDA 5LNWA 1FWTA 2WNQA 3V0SA 1AJ0A 1OC6A 1TPC1 1VS1A 2PGFA 3PS7A 4Y90A 2PWEA 3TWAA 4ES4A 3CTTA 2PF0A 4UTHA 3C4UA 1RLDA 3I68A 1V4YA 4TV5A 3RU8X 4P5UA 1MWOA 1LJYA 1W1VA 2JFEX 4E2OA 4F9DA 3STEA 3C2EA 4IPIA 3F5KA 3KS6A 4PEKA 4B9YA 3SGZA 1W9UA 3PUGA 2JK2A 5A6BD 1JJKA 1XCXA 3CYVA 3FHAA 3M0MA 3LHYA 4J28A 2ATMA 3KTCA 3R4IA 2Y0FA 1W3JA 3DDMA 3Q67A 4AAJA 5KSWA 5GNYA 3PJXA 3VX0A 4DELA 1OZQA 4O4WA 4DAFA 4AF0A 5IHRA 2INEA 3BQ5A 2OQYA 2Z4GA 1U30A 3EPNA 2REQA 4AXNA 2ZXQA 2CLPA 2OT0A 1M9HA 4IG2A 3NZ1A 3VKBA 5DRCA 1BWKA 3MZNA 5AC8A 4A8NA 1JCXA 3N2TA 3W7DA 2GWGA 1Q6EA 1WOBA 1I2NA 3T07A 1TQXA 1ZJIA 4XQ6A 5T8GA 3PPHA 5J8LA 4LVAA 4DY1A 3S42A 3LSBA 4F2TA 1RP9A 4FO4A 2OZ8A 4PFHA 4O4VA 1B3WA 5EMMA 3TIMA 4JTUA 3DENA 4M8UA 3ZT7A 4WHBA 6ENLA 1EIBA 3R7MA 1O7AA 4J3TA 1JFHA 3P2VA 4UQCA 4LVDA 4HKPA 4ZQPA 3TN3A 3EWCA 3S9IA 1R5YA 2O56A 3GYEA 1PX3A 4IUGA 1HJWA 3TW9A 2HBVA 2ZQ0A 3VOFA 3GTFA 2CFFA 3UP8A 2CXEA 2WKLA 3NQMA 4MFDA 2WMKA 4ATWA 1RR2A 3QZEA 1BTCA 2QS8A 3JUGA 4J3SA 4EAYA 4KCUA 2CHRA 1VF8A 3IV8A 4HNUA 4MZYA 4PCTA 4IJCA 4NP7A 1T96A 1I6NA 2QDDA 2GGHA 1E6ZA 3P8JA 1QI4A 3ARRA 1OIFA 2OMAA 4B5NA 3F7JA 3PBVA 5HPCA 4MJMA 2NZLA 4A3RA 3HPXA 2HMCA 4WY0A 5G1YA 4YPJA 4JEQA 4RE0A 4CCCA 3KDNA 3QV9A 4XBSA 1TVNA 1V77A 1TPVA 3C6CA 1X38A 1LUCB 3WQ4A 4PTDA 4CQBA 1K6WA 4N9EA 2XGBA 5HWMA 4GI6A 1SMAA 4JKLA 4QS6A 3NYZA 1K8XA 2HWGA 4MJ2A 3LM7A 3V16A 4D72A 3EWZA 1CI1A 4RE3A 3HO8A 4LQ1A 3W2KA 3ABQA 1D2KA 3UR7A 3GVWA 3SN4A 3WL1A 2I7GA 4O0QA 2J7CA 3PWIA 4GQRA 3LX9A 1NELA 3L12A 1Q7MA 3OBAA 1JG9A 4E8GA 2CLOA 2BDQA 1QPNA 1IR1A 3RCYA 4IFOA 4GA8A 1LROA 4S3BA 4G56A 2AL2B 3DC8A 1I2OA 2CZ5A 3ABRA 3IIOA 2HE8A 3L0KA 4RZ5A 2ZZ1A 1EP1A 5FOOA 3A4JA 8XIMA 3P3BA 3CHCA 4Q8WA 3LZ3A 4QDMA 3BWWA 4XTDA 5MKGB 4ZB2A 3B04A 2Y2WA 3FX4A 4Q8OA 2ALRA 2EBNA 1ZGDA 1FP8A 4YMZA 4UQ9A 3DX5A 4MWAE 2X0YA 4U5IA 4Y9MA 3KBJA 1B30A 3O15A 1K1DA 3SR7A 2ZVRA 3CZEA 3EWBX 3WLSA 2A3LA 4LW7A 1UKQA 1P0KA 4FR1A 1TZ9A 5L6UA 3BLKA 4LCRA 1JXJA 1VENA 4BI7A 1UA3A 3VXGA 3I6TA 1JCJA 3OJGA 1UCWA 1FTXA 4QFUA 4LNYA 4JTRA 1X8CA 1LRTA 2EG8A 1J01A 2G96A 2RFGA 1TG7A 3CHVA 4LAKA 1E72M 4RNIA 3KM8A 1E6RA 1QMLA 3HPAA 2Q3OA 1W56A 4XG1A 4V1XA 4XB3A 9RUBA 4QEHA 1XLFA 1VEOA 4OJYA 1VCFA 2RDUA 2GVGA 5EMUA 2WJZA 4AW7A 1TIMA 1AQHA 3R89A 1EJ7L 3QF0A 1M7XA 4HTYA 5E1QA 4PODA 4EXBA 1KQYA 4W88A 2OYMA 4L61A 1BQGA 5FD0A 4K8EA 2FYMA 1J0ZA 1X96A 1K03A 2PSNA 3VC6A 1MW3A 3P93A 4GQQA 2E67A 3LNMA 2YDRA 2PWUA 3NXLA 3TJIA 2V5BA 1Q6DA 3KTXA 4RXGA 1XSJA 1D3CA 3EGJA 3GDTA 3QV7A 4PSPA 1AQFA 3NQEA 4TR9A 2YL6A 3AYVA 2PP1A 4I7WA 1EX1A 3I4EA 4P7LA 6XIMA 1SZRA 2QUVA 4ADUA 3V5CA 2VRKA 3QY7A 1Q7QA 1Y7VA 4NXSA 2P0IA 1KXHA 3PWAA 3R10A 4IMAA 4QJ4B 1K7XA 2ZCGA 3W23A 4NNCA 2YDSA 3FHQA 4BCEA 1A80A 1ELSA 4WDUA 1VAHA 3QOMA 5I00A 2SFPA 1OFQA 3W1LA 3U7VA 4IUOA 1UASA 2ZC8A 2XPKA 4KWOA 2EPLX 2V82A 5HQMA 4EE9A 2VDHA 3MO4A 2KX9A 3CS2A 5C5YA 3DG3A 5F4WA 4OFCA 2HROA 4UTKA 5LA1A 1TJ1A 3G0SA 5FJPA 1P0BA 1B3YA 1DPMA 2WSYA 1IZCA 3AIQA 3IK4A 5E9XA 3EWUA 4ICCX 3M44A 1MNSA 3TOPA 1IIGA 1LL6A 2XFRA 4L4PA 3ZT5A 3GXIA 3KBVA 3LEPA 2PDYA 4XO7A 1ICPA 3WSUA 3V0TA 1E6SM 3A21A 4QE1A 4AD0A 1E1CB 1EFZA 4HSOA 1QI2A 1CB7B 4XBKA 3EB3A 2O4QA 3GAYA 1XIFA 1QATA 3PZUA 3R5EA 4LOCA 4O50A 1PWLA 5A8GA 2WZTA 1E6XM 5G4HC 3VIJA 1G69A 2XJ7A 3EX3A 3HMJG 3M7SA 3WN6A 1IWPA 1DJZA 1MZHA 1H41A 4AF0B 2NX9A 2Y6ZA 4PUJA 2WANA 1GONA 1NWRA 3VNDA 4UTIA 1O1ZA 4LRSA 2A79A 2J7HA 3XIMA 3W07A 3QYQA 2XIOA 3MUZ1 1EIXA 4H1ZA 3EA2A 4IGNA 1OYCA 3T1GA 3VNMA 4W5UA 2B31A 4V2XA 1UHVA 5TQLA 3EEGA 4X0VA 4MZ1A 3LHZA 4PUNA 3KRSA 2FZMA 4U31A 1XIHA 5GQBA 1ZCCA 4YWIA 2QW5A 1OGGA 2B7QA 3NPVA 4O17A 2G4FA 1IR2A 1BYDA 1KKRA 3BTNA 1EGMA 3MTWA 3F2BA 2D3LA 4NAEB 1ZU8A 4L4LA 3DHDA 3GXMA 1GVQA 3MHFA 4MJZA 1VFFA 5JUVA 1XLEA 3RX2A 2PLMA 2E77A 1EC8A 5HMEA 2XM1A 1BSIA 2I1OA 2D22A 1HUVA 3L0NA 4KQNA 4E4UA 1VR6A 3S9YA 1UR8A 2Z27A 1B3ZA 3QSTA 3F2CA 2W5FA 3TW6A 3HPFA 2AAAA 2WPGA 3DU0A 2XIIA 1UROA 2BTMA 3L66A 2VCAA 3NSMA 1O60A 3NL5A 1FUYA 1RUSA 2QCDA 3KAOA 3B8TA 1FOBA 4ACZA 4O52A 2O9RA 3DFSA 1BTMA 2FZ9A 4XZNX 3EMZA 4C1NA 5IHSA 5BXSA 4D6IA 1A4MA 1L6FA 1N82A 2BSLA 2OPJA 5CPLA 3CUXA 1RCXB 1SSDA 4ZL1A 3WLHA 4MKNA 3ES7A 1M5WA 2JQXA 2ZUNA 4JIHA 5C2GA 4DYKA 3MKKA 5AYYA 3FA4A 4H8VA 3VIFA 2ZE0A 4QS5A 2UY4A 3RGTA 3QTGA 4HSHA 2I14A 3OB8A 1SQ7A 1HKMA 1K7FA 1TVPA 3LLXA 1KXQA 1YNQA 4XISA 4HMNA 2QMKA 1HO4A 2VC5A 1S3HA 3S1UA 4JHOA 4QP0A 3CAWA 1SR9A 1FWRA 5G1TA 3LHTA 1JF5A 1JPHA 3OZYA 3TZNA 3SADA 5F7UA 2I56A 3N17A 3AMCA 3OGRA 2XWEA 5JBFA 3UGVA 4M6UA 1YYAA 4ZSTA 1JIBA 2OKOA 2QCFA 1WQ5A 2NT1A 2DIJA 3NQ6A 1ZBCA 3CUJA 3N34A 1GEHA 3RU6A 2DT2A 1O5RA 1E55A 3G8RA 4Q8UA 3EEZA 4C5ZA 4DJDC 4IHCA 1PSCA 4LAOA 4AY7A 2WJEA 3CT7A 2HV5A 3FSTA 1SUXA 1E9YB 3VGDA 3HV8A 3D0CA 3N18A 2YZRA 1LORA 2C0HA 3H22A 5HMSA 4K8HA 3S2JA 2P10A 4IM4A 4Z0JA 1BFNA 3W82A 4AD3A 4AEEA 2VP8A 2WXDM 3VOJA 3C2FA 4MNMA 3EWWA 4JYFA 3LHUA 2YPIA 1AMKA 3QGKC 3RHGA 2J8FA 3DFQA 3TYUA 4ERAA 1RBAA 2VURA 4ICMA 1HFBA 4GUGA 2J62A 1SJDA 2ISDA 4DF2A 4QROA 3UR5A 2NW0A 3U7BA 3CIVA 3HGJA 2A3EA 3G1VA 5EBAA 2DT0A 2FZ8A 3ITYA 5JH2A 5CBIA 2IUZA 4DWSA 5DANA 1G7UA 3SB0A 1V7YA 1EZWA 2G3MA 4AH7A 2X42A 2J7GA 4KCTA 1OX5A 4JL1A 3IUHA 4XZ9A 1YIXA 1QAPA 3S47A 1M53A 2FVMA 3AICA 4C90A 4IP4A 3VM5A 1XW8A 4IPPA 2YYUA 3FNDA 3SW6A 1KR1A 2W61A 2JGQA 3WJWA 1L0PA 4CD8A 5A6TC 3TW7A 3WQEA 4C65A 1E4LA 1U1JA 2QJNA 3CQHA 3IS4A 1E0UA 2FVKA 3T8QA 3VKDA 3B0XA 3EXRA 4ZQNA 1UG6A 4DB7A 3FS2A 4QISA 2OLSA 1P7TB 3CO8A 4OBTA 1ONWA 1PHQA 1BEUA 3PUEA 3BV4A 5D04C 4G7FA 1SGJA 3PB0A 4W93A 1UC4A 3ONBA 5LNVA 2PF8A 1FCQA 4JNMA 3BXWA 4DO5A 3PK7A 3JU2A 4G7EB 3VD4A 4LEFA 4B16A 3MP5A 1FX6A 1RZMA 3QR0A 1CXFA 2DJXA 2DT3A 3IK2A 1E0VA 1ME7A 1GQLA 1HVQA 1W3LA 3WG6A 1X7IA 1FWIC 4E2VA 2GGIA 5I3HA 4MVAA 3E0VA 1UD6A 4FB7A 3W7IA 2CERA 5DFAA 1F76A 2V38A 5HA7A 1GKRA 2YR1A 3VIMA 3NQDA 1BWLA 2P5NA 3OVRA 3WF2A 3W6LA 5JIPA 1PKYA 4ZENA 4ONVA 3I6RA 1G4SA 3MWAA 3UXKA 3COTA 1F3WA 1UIPA 2FMNA 4MWAB 1A5MC 4C6LA 3QQ1A 3VUSA 3W25A 4JTLA 1GQKA 5K9DA 4GUHA 5LSMA 4NIRA 3SQSA 2PBOA 1PBGA 5JVLA 3TMQA 2GK1B 2HEJA 2C13A 3KOWA 1QVBA 5CPSA 1KLYA 1XDMA 3W02A 2FH6A 3M7WA 1EP2A 2IMRA 5KETA 4NXKA 1DP0A 3ITXA 5KTLA 3R25A 3GG8A 3AC0A 2OODA 1B1YA 2E7FA 3EB2A 4KWSA 4RR4A 3HFTA 4AXKA 1QPKA 3ZVIA 1E1CA 5AVNA 1GQIA 1WO2A 4NKCA 2XIQA 3PJTA 5FJTA 1GQJA 2C14A 4FNQA 2FFCA 3BH4A 3BCFA 2A0NA 3AS1A 1E15A 3DG6A 3GU1A 4PC8A 3H2AA 4M19A 4HK7A 2BNJA 1XFBA 1DV7A 2D1ZA 1QK2A 2DZAA 1J9YA 1W2VA 4B2DA 5MF5A 1UJPA 1WX0A 3M64A 2R8WA 3AMLA 3KRUA 4L6OA 4JIIX 1KR0A 1J4EA 1KFBA 4PL2A 3H8AA 3KCOA 4YTRA 2BOEX 1UP2A 2OEMA 2YYTA 4JTEA 3IAQA 3WNKA 3I3DA 4H2CA 2NQZA 5CSYA 3B9NA 1OINA 5HWJA 5IRPA 2WYSA 2Z1SA 3IIPA 4QLKA 1KGXA 3NQVA 4L1GA 4JFTA 1GW9A 2V5LA 2X1IA 5FEWA 1RQHA 3EWXA 5C70A 5U4NA 1GOQA 2V30A 2NLIA 1NOFA 2PC4A 5A8NA 3ALFA 3VKKA 1IXPA 3OYZA 5LGZA 3F4VA 2OWCA 4DI8A 4J5NA 4MGGA 1KW1A 3NZQA 3V1PA 1NF0A 5C71A 4O1AA 1S3TC 3S83A 2XINA 1T7LA 1EUAA 2QAFA 1LTDA 1X1OA 3BANA 3NL3A 2RJHA 3H7VA 3N13A 3GC5A 5BZAA 2CBJA 4LY4A 5J5RA 5AOUA 1BLIA 3BQ6A 1JZ5A 3T05A 4FNUA 3LV5A 2QDHA 3NXFA 3WCZA 1XJBA 4RCXA 5AHIA 1JDFA 1NWUA 4DUOA 4IJRA 5CZKA 2JIWA 3QR3A 2ZZ7A 4C7DA 2I5IA 3NCOA 3ORWA 3NDYA 1DJXA 4ZB0A 4DBDA 1K70A 2J9ZA 4Z2JA 3V18A 1OCQA 2ACRA 4GH3A 3SJNA 3EXTA 4TVUA 1X7FA 4GACA 3NYDA 4G6CA 3U2ZA 4E38A 1UD4A 3ZR5A 4S1FA 4HMDA 4FI4A 1KRMA 2A85A 3MPGA 3G22A 2IXUA 2PDQA 4TTGA 1WB0A 3T0DA 1BGAA 3EDFA 3LXAA 5JQ9A 2QDEA 2I5GA 1RBLA 5GVJA 5REQA 3RJXA 4M51A 5E70A 1RQBA 2V3FA 4WF7A 1K8ZA 1DJGA 5FJUA 1HKVA 4M1RA 3EA3A 3QM3A 3VZZA 1YE4A 1RHCA 4B2DD 1NY1A 2ACQA 1JZ4A 4F0HA 1V3LA 5DT7A 3MSGA 2Y4SA 3DHPA 3AUJA 4QJ1A 5CC3A 3DBNA 2NQJA 1E4NA 2POZA 1G9HA 1I2PA 1ZLPA 4JFWA 2E6FA 4TXEA 4LEQA 2HCVA 3E0FA 1J93A 1PTDA 1DQUA 3R2GA 3LTSA 1A53A 4YVVA 4K37A 4LUTB 4HA3A 1BXBA 3E2VA 2BLEA 3GNXA 2CZEA 3KZSA 1W6TA 1TWWA 2YA0A 3MV11 3ABXA 3WQDA 2WJDA 4N6FA 4GYKA 5FF3A 5CBBA 4RNJA 3R6IA 3P6LA 1EJXC 2QJGA 2ZX9A 4B3LA 5XIMA 4BI6A 4IMDA 2W63A 1XLBA 3QQWA 1BVNP 2C6QA 5K7JA 2B4GA 4HJWA 4S3KA 3OLGA 1R2SA 3W7CA 1FBAA 5LIXX 2V67A 4A2SA 1UZHA 2QXWA 2I5QA 2WMJA 5F4SA 3SQMA 1LUCA 2V69A 1ONRA 2TMDA 1FCVA 3HQOA 1YBQA 1EYWA 1ZAJA 3I6EA 2ZRYA 3AWOA 1XIMA 4PMJA 5AECA 2D3NA 3QMSA 1EHAA 4AHOA 1JPIA 4LUSA 2VUNA 1UC5A 4KFPA 1HL9A 1PCKA 3OVGA 4LAZA 1VEPA 1Q45A 4ZQRA 1YXYA 3T42A 3HBLA 1KFLA 4WD0A 4X2PA 1NP0A 2JALA 1RPXA 2CLLA 4GFSA 1I0BA 1V3MA 1GHSA 5I3KA 1TMLA 1YXCA 4CQCA 2V5JA 3V7PA 5DT5A 4HNOA 4OIFA 4YS1A 4GIYA 1TV3A 2IQTA 1T8QA 1F07A 3OLIA 1AK5A 5DO8A 4CUCA 5PTDA 1F61A 1WUFA 4W89A 1WP6A 2VEFA 3LTYA 2H9AB 4DLFA 2NX1A 5BRBA 4X2RA 3MSYA 4IXXA 4CNUA 4N9DA 4A8LA 4FXFA 4OGZA 5E6ZA 3ZLHA 4NRRA 4GBUA 3UG8A 4PBGA 2OG9A 2VX4A 1RD6A 4CGTA 1JDAA 4JIQA 3K4DA 5DN1A 5EBUA 1B31A 3W6MA 1K8CA 1ZENA 4LYRA 4ZGYA 4D1JA 2NWRA 1VYRA 4PULA 2V2CA 4NQ1A 3HTWA 3H4XA 3U2OA 4MWAC 2JE8A 2Z1KA 2J27A 1KM4A 1VKFA 5LA0A 2CKRA 3BSGA 2UY3A 2AGTA 3VABA 1WDRA 2VM8A 7TIMA 5BU9A 1W9BM 4MWAA 4NX5A 5HR6A 4GCAA 4C6BA 2AQVA 4OTKA 1XBYA 3LZ5A 1F8MA 5I79A 5HQLA 4YIWA 4CEUC 3IJIA 2EQDA 3WEOA 4C1LA 4I5XA 4CNOA 3AFBA 4DWSD 2ICSA 1W9VA 3CZJA 3NVTA 3TQVA 1CYGA 1TTJA 2EXOA 1LOQA 2PCQA 4ZO7A 2BVTA 4LAMA 1GNXA 2UY5A 3A3XA 3DESA 3R0KA 1H7WA 4WY0F 3ZJ7A 3M0HA 5B7ZA 1GJWA 1OM0A 1FKWA 3K13A 2J79A 1EC7A 4G5DA 3D5HA 3VYLA 3MI6A 5K4ZA 5LKYA 3FOKA 2GSJA 3LOTA 3ZJ6A 2BVDA 3CV2A 1YW1A 1QPQA 3TROA 1S2WA 3GVQA 4F2UA 4MZ8A 5HJXA 1XYZA 3H4GA 3KX6A 3T4CA 1EYEA 4YTUA 3TTYA 3R8GA 2RGMA 4HOWA 3PNZA 4GY1A 3TQKA 4U2ZA 4LVGA 4YXGA 1Q6GA 3TQ0A 1MEWA 4AD2A 1MRQA 4UBPC 2BS9A 1PB0A 3R0UA 1P6WA 5FI8A 1UP0A 1EXPA 4HU8A 3UZWA 3APTA 3U8GA 3VE9A 4MSSA 5LZLA 4KMQA 3P61A 2EEXA 1R9ZA 4EKJA 4EX4A 5H2ZA 2QCNA 1B9ZA 5D33A 2DORA 1XRVA 5AYZA 2IKGA 4L64A 2X1UA 4NJKA 2ZUUA 1X6LA 1UR2A 3KLKA 1Q65A 1X1ZA 4FF5A 4IWWA 1OC5A 1Y5XA 4HOXA 4BKNA 2ZE3A 1PIFA 1ITUA 2ANUA 5HUPA 1FDJA 4L9YA 3GRIA 1EL3A 4ZOAA 8RUCA 1JD7A 1WCGA 1B5TA 1CXHA 1K3UA 3CPUA 1QR7A 1SM9A 3G1HA 2J9YA 3I7RA 1J0JA 1NFGA 1W8GA 3WL0A 2X41A 2R94A 2QVHA 1JXKA 3THUA 3GDRA 4Y8FA 4AHPA 4O8RA 4IG2B 3WMCA 1EX5A 2B7PA 3PAJA 3DZ1A 3KVLA 1M68A 1TIWA 5U7SA 1KV8A 1XIIA 1R9XA 3FSUA 3RX3A 5G5IA 2PGEA 1UIOA 3BW4A 3SI9A 2G50A 1Q6CA 1WDWA 4ZA0A 3A24A 4GMEA 3UW6A 1EEPA 3G1XA 1R46A 1W5OA 1P6BA 3H54A 1I2QA 4DJEA 3WUGA 4R5EA 4X9SA 4HA0A 3TUUA 2DIEA 2ZXBA 2HXTA 1XC6A 1EKOA 1TWIA 4PSRA 1HVXA 4H00A 4KETA 3P67A 1Z89A 2VC6A 1A50A 1SU5A 4BA0A 1AD4A 3WNOA 4YCPA 3TTEA 3QC3A 4S38A 2WMIB 1TE6A 1YDYA 4N2YA 1CGWA 3A6OA 2PFHA 4YN5A 5H1WA 3GNDA 2OO0A 7XIMA 2XN1A 3W73A 3T7VA 1CENA 2E25A 1V6UA 4PE8A 1OFOA 4DAIA 4HPNA 5ABHA 1TV2A 2WZMA 4LNCA 4QG6A 2VC7A 1IEXA 5JBEA 1T0OA 2W79A 4HVXA 1B4KA 1I0DA 3ABOA 3U6WA 2YB1A 1KTCA 1EEXA 1JPMA 5D8ZA 3DKJA 2Q02A 2JF7A 1QU4A 4US5A 1Q66A 1J0IA 1MSSA 3ZT6A 2ZDRA 1MXSA 1YBQB 2YW3A 5E0CA 2WSPA 3B0UX 3CQJA 1RLCL 4HPXA 5HULA 1UR0A 2EKCA 1WOAA 3TSDA 3KVKA 1XX1A 2QLYA 2XFFA 1PTAA 3RMEA 1ISWA 1ME9A 2IKIA 3KP1A 2QNEA 5ABTA 4IIEA 3BZGA 1JUKA 2W67A 4JTFA 3W75A 5FL0A 2GOUA 5I07A 1JRBA 3WQPA 4JIRA 3GNNA 4OOUA 3W85A 4JTTA 1REQA 3M9YA 2WMIA 1VYPX 1QW8A 1NQ6A 4ZODA 5HNRA 1YXDA 1OYAA 1YDVA 1TB3A 3QTPA 3E0IA 3PPFA 4MUZA 5DCDA 5HPOA 3FVMA 4BF7A 1FWCC 2W6RA 3BGAA 4UNIA 2WC7A 3KVMA 3NQBA 2VZVA 4UMBA 3W74A 2GVJA 1BG4A 3EYPA 4HZ7A 3GTXA 1U5JA 2DY3A 2V2HA 3V0UA 1S39A 2CYGA 4Y6GA 3FK4A 2QIIA 1UWTA 1UR9A 1IT0A 1EC9A 3S5YA 3LCFA 2QEZA 3U5UA 1H63A 5IBXC 1A49A 4GINA 1W3IA 2E68A 1EF2A 2FB3A 1U5HA 1UZ4A 5D4YA 3DN5A 1UWIA 4O8AA 4LRTA 3GWQA 3AMGA 4B92A 1F6PA 1LBFA 4H9UA 3M6DA 1KCLA 5HDRA 3WLOA 1TV4A 1FHVA 5CC6A 2TODA 4RW3A 5D09A 3Q45A 1X6UA 1GVEA 4PMRA 4U10A 4AZHA 1YNPA 1XRSA 3W7LA 3O0KA 2G3JA 4H9YA 3UVIA 1TCDA 1V5XA 1UD2A 3BLLA 3BAYA 2OCZA 2YZ5A 3T6CA 2O9PA 1V0NA 1LOLA 3AIVA 5FJRA 2BWGA 2P8BA 4HT3A 3MMTA 1F74A 5FESA 2V3DA 4BS0A 1W9XA 4DZHA 3UBPC 1TPWA 2RDTA 4AYGA 3CL8A 4O1CA 2CU0A 2QQ6A 3CJPA 2WNWA 2FZBA 1XIBA 4NAFB 1ZY9A 3TFXA 3UJFA 1PTGA 5BOOA 3T09A 1XLHA 5H8MA 4D6GA 1ZUAX 3RO6A 5J04A 2VI0A 5EGRA 2EGZA 1F73A 3AHZA 5D2VA 2QT3A 3FJLA 3PZIA 4LVBA 3U57A 1VCGA 2O9TA 3WK3A 2YBVA 9XIMA 1TX0A 1J18A 2X1SA 4E5TA 2ZA2A 4K3ZA 5A1AA 3WBAA 3SCRA 2DUAA 1EJRC 5G4WA 5CG7A 3VTRA 3OW1A 3QEZA 2V63A 3D3AA 1S2UA 3NO1A 7ENLA 1TWDA 3WEMA 4AWUA 3H55A 4Z2LA 1C8YA 3W7KA 4W5ZA 3IIZA 1FWHC 5D2YA 3VK5A 4Q4MA 3IV3A 1L2QA 4E0CA 3W86A 1CNVA 2V8ZA 3TP4A 1EJTC 1BD0A 4DVOA 3QJAA 1DBTA 4F8XA 4NZ3A 1M04A 1E70M 3PN8A 1O6IA 4BR1A 3O7UA 3KHDA 1DJHA 1YTDA 1H7RA 2AOSA 3BG9A 4DZAA 1GZ1A 4GYJA 2PLKA 3CQKA 2UBPC 4IL2A 2YA2A 1PUDA 4PZVA 5BXTA 1C7SA 3HG5A 1BF6A 4D6FA 4TOQA 1SJCA 1UMLA 1O5QA 4D8AA 2A6LA 3N2CA 4UOJA 3EAUA 4NF7A 3DI1A 2VVSA 1KLZA 1FWGC 5C9RA 1WZKA 1KFCA 1F3XA 4H83A 3KOZA 2XGZA 2E3ZA 3P84A 5BMWA 3GC2A 4GFIA 4BI5A 4HMEA 2G0WA 4FLSA 1S2AA 3Q4DA 3REQB 1OG6A 4FMVA 4UOZA 1EDQA 4MLRA 4Z1YA 5H8UA 3VMNA 1OY0A 2R14A 3THCA 2GUUA 3DERA 4LAUA 3EBVA 4RX0A 5I0DA 3HGSA 1MW0A 4LGXA 3NEHA 1OX6A 3FA5A 4UR8A 4XZBA 3LU2A 3M41A 3BGGA 3UWWA 3MVIA 1QNQA 3HOJA 2VXNA 3GNOA 1W5MA 2VUYA 4JR5A 2WV8A 1OGSA 2G37A 4PBFA 4O1BA 4BFAA 2ZRXA 3TSBA 4KWUA 1OQFA 1IT8A 4PUWA 3PWGA 4HQVA 3NM1A 2OJPA 2OLHA 2WO5A 2HE5A 3ABZA 3UWZA 1RD5A 1RY0A 3FFSA 3QV6A 3W29A 3MV01 4GHRA 2XVLA 3G1AA 2B7OA 5I06A 4ZQMA 1PYMA 1CZ1A 4GC3A 5FJJA 1MUMA 3L5LA 4K38A 1K7EA 4UFLA 1HJVA 4JNYA 2ZZ5A 4K7YA 1R30A 5G2HA 3ITLA 1QXLA 2VEGA 4A29A 3CUFA 3QY8A 5D2XA 3B9EA 1PZ3A 1Q6OA 3SCTA 4XVDA 4JPGA 4TX9A 4F0LA 3W00A 4JY9A 1KBIA 1NFBA 3RITA 3ITOA 3UVAA 3R8RA 3TKFA 5KZ6A 3TV8A 2QCLA 1QOXA 3MUXA 5T9CE 4CD4A 3S1WA 4Z1CA 4IQDA 1PDZA 1Q8AA 3UWEA 4HJFA 5C7HA 3N9SA 3QBUA 4I3GA 4L9ZA 3MKCA 1KFJA 2X7WA 2WSQA 1WKEA 2WHJA 3QFEA 4X3ZA 4A8RA 5H91A 2H3DA 3UG3A 3PF3A 4IMFA 3TAOA 5I24A 1BXNA 2E0PA 4XD4A 4Q32A 1YPXA 3A3WA 2VX5A 3SCPA 8TIMA 3N25A 3DGRA 4HPHA 2GSEA 2A2IA 4Q6JA 3VO0A 4MG4A 1GK8A 1UH3A 1I45A 5M2FX 2QJIA 2WK2A 1FQ0A 1V3HA 2E1DA 3KXQA 1XISA 3CZGA 5C9ZA 4DNMA 4ALDA 5BROA 2ZUSA 4RUBA 4KH2A 1O66A 1KC7A 4RKAA 1QCWA 3T40A 3B8UA 3HU7A 3N2XA 1LG1A 5HATA 4I90A 3POCA 3QLLA 1VP5A 1LRNA 3DFHA 2I9EA 2R1LA 4HGXA 2BV9A 3I7QA 4PTWA 4PCPA 3G5EA 4NT0A 4A35A 2W62A 6TAAA 4I6KA 2Z2UA 2RH9A 2VZOA 4IIHA 3N19B 1JQVA 3IGUA 3PZQA 5A6MA 2C79A 4WZHA 3IUIA 2AL1A 1W54A 4I9AA 3KFTA 5F2MA 4XAPA 3BG5A 2AAMA 4P8VA 4JYDA 2VZTA 4UXDA 3T55A 5C2XA 2HVNA 4F0MA 1QDSA 3NDZA 2C3ZA 4A3HA 5I09A 1XLKA 2FPTA 4HOZA 4QTGA 4XAZA 2BHUA 2PLJA 2D24A 4ATDA 4XV0A 1R6WA 3QXBA 1BYAA 2Z29A 4JN8A 4GZ7A 1TKKA 3VIHA 1K02A 2OT1A 4ZSUA 4ML9A 1TJ0A 2VKZG 2GQ8A 2FDMA 2BGNE 2P3EA 3MZ2A 4JTKA 1F5ZA 2YDQA 3AZTA 3BAIA 3POHA 4C6NA 1E9ZB