3H2NA

Structural studies of pterin-based inhibitors of dihydropteroate synthase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
273
structure length
265
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFGSYNEVDAAVRHAKEMRDEGAHIIDIGGESTRVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydropteroate synthase
publication title Structural studies of pterin-based inhibitors of dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis str. a2012
molecule tags Transferase/transferase inhibitor
total genus 92
structure length 265
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3h2nA00
2Y5SA 3H2CA 3TYEA 3H21A 3H2MA 4S3DA 3K13A 4NIRA 1AD4A 5JQ9A 2VP8A 3H24A 1TX2A 4S3EA 4DB7A 4DJFA 3BOFA 4DAIA 1AJ2A 3H23A 1AJ0A 3MCNA 4DJDC 2H9AB 3TYUA 1Q7MA 1Q8AA 4S39A 4O1EA 4D8AA 3MCMA 4S3AA 4S3BA 2YCJA 3V5OA 4MWAE 4DJEC 3H22A 2OGYA 2Y0FA 4DJDA 4MWAC 3TR9A 3H26A 4D9PA 2VEFA 4O1FA 1Q7ZA 4S23A 1Q85A 1TWWA 3H2NA 4HB7A 4DJEA 1AJZA 4S38A 3TYZA 4NL1A 1Q7QA 2BMBA 4MWAA 1EYEA 4D8ZA 3H2OA 4S3FA 2DZBA 3NOYA 3TYDA 3TYCA 4CCZA 2VEGA 1F6YA 4C1NA 4PZVA 3H2FA 4S3CA 4MWAB 1TWSA 2Y5JA 3BOLA 2YCLA 1AD1A 4G9PA 3H2EA 2DQWA 2H9AA 3H2AA 4O0QA 3TZNA 4C1NB 4NHVA 3TZFA 1TX0A 2YCLB 3TYAA 4DJDD 2DZAA 1Q8JA 4NILA 3MCOA 4DJFD 4DJED 1TWZA 4DAFA 3TYBA 2YCKX 2E7FA 2YCIX 4DJFC 4MWAD
chains in the Genus database with same CATH superfamily
4BK9A 4IL0A 1A5OC 5E70A 3MHFA 4Y6GA 5HWMA 2YYUA 3GU2A 2VOTA 5T9CE 2X0SA 1AJ0A 4WJXA 5D9NA 5D02A 4DI9A 2PDKA 4C6EA 1FXQA 2FTYA 2VQTA 4PTNA 3KOFA 1UR0A 1UR4A 2D2HA 4HMNA 3N13A 1JPKA 2VVSA 3TNOA 2ZX7A 2VD8A 1KBIA 1RSCA 1TO3A 4MVAA 3S5ZA 2QDDA 2C18A 5KZMA 2EQDA 5A69A 3CM4A 4A6GA 4N4QA 2ZZ1A 3EMCA 4HD5A 2C3ZA 2Z00A 3W84A 4M7TA 3LRMA 1CWYA 3B0PA 4WXZA 1QASA 1SR0A 3G5EA 3HPFA 1F05A 3C3UA 4LF2A 1XLAA 4IFRA 5T91A 3WJSA 1C7TA 3TLLA 1F76A 7TAAA 3BLOA 4EIVA 5AECA 2CLPA 4F40A 1KBJA 3BAIA 5ECUA 1AL8A 4PCFA 1POKA 4YVPA 3FDGA 1DBTA 3VGDA 3L4UA 4AD5A 2XTKA 3HO8A 4B9YA 5DXXA 3F2BA 5EYWA 2WJFA 3UGVA 1FFQA 1DJXA 1FP8A 4FNQA 1JD9A 3UWQA 2XDFA 4GKTA 3RM8A 1XBZA 1K9DA 4P7NA 1J0YA 1C91A 1ONRA 3LN3A 3S2LA 5BRBA 3VKJA 4XBSA 1NOUA 4QJ3B 3NEVA 2GJRA 5FF4A 1XLFA 3UWZA 4MLJA 3OZMA 1B3VA 2FH6A 2Q3OA 4MNKA 5KSWA 3IAPA 3ABQA 5C7VA 1PPIA 3CMFA 5G1YA 3DI1A 1EA0A 4C60A 3MKCA 3VGEA 3TQPA 2XZ9A 2PP0A 1KC7A 1IR1A 4YL2A 1H60A 3PF3A 4AVOA 3SQLA 3BL3A 1Q4NX 4MOZA 2Z1WA 4XUYA 1GCYA 4G7EB 5XINA 1MSSA 1K8XA 1P7TA 3N18A 1PHQA 1HKIA 1TA3A 1VKFA 4AIBA 3E0FA 2V5LA 5CGQA 4AF0B 2XSBA 1T8XA 3EXTA 1EUNA 1UC5A 4YJ5A 3BURA 4R34A 3W4RA 1RD5A 5CZJA 4AAJA 1UJPA 5HMSA 3FHAA 1KCXA 3RITA 1FH9A 1HKVA 4LCQA 3W7RA 3C2FA 4EPKA 3EZ4A 3KBSA 5IBXA 1JEZA 5I5RA 1M01A 3RK8A 4EXQA 3TKFA 3W00A 3LPOA 3A23A 5TNVA 5FF7A 3P2VA 1FHDA 2GSHA 1E5JA 3QMSA 5T9BG 3MSDA 4Q4SA 2ZDRA 1E6PA 3RCYA 1QR7A 1UW9A 1V0MA 2QV4A 1RY0A 1WZAA 2Y4SA 1X8FA 1S2VA 1TJ2A 2DZPA 1L6GA 3EWXA 3IWPA 1HG3A 1EDTA 1IWPA 4Y9PA 3ZQ9A 1ZCOA 1NF0A 3HIJA 4UOZA 1VJSA 4PSPA 4NVTA 2WVVA 5K2ZA 3NWRA 4PYSA 3PBYA 5CJMA 3IIZA 2Y88A 4QDWA 2Z6IA 1CXLA 3QY7A 5IOBA 4Y9NA 2D0GA 3NTYA 9RUBA 1FXPA 1C93A 2DVUA 2NT1A 1H49A 4M24A 4BS0A 4FOJA 4AZCB 5C9RA 5AC6A 2CXGA 4K3ZA 1F8MA 1TV7A 4GQRA 1C9WA 2WSQA 3UXLA 1JRBA 3U48A 1CENA 4NT0A 3MMUA 4AVFA 3Q67A 2WC7A 3BW3A 2IXVA 1W3IA 1JZ8A 1BRLB 1SVDA 1QPOA 4C1LA 4HK5A 2I5GA 2HVOA 4S3DA 1EFZA 3IIOA 3WF0A 4B4HA 1XDLA 5F4XA 4RDZA 1ME9A 1OM0A 2YLLA 4LUYA 3TOYA 4RNJA 8RUCA 1GVEA 3GG1A 2ZX5A 4CQDA 4HOXA 2VFFA 2JF6A 3UJFA 2OWCA 2J79A 2PCQA 3WJXA 1V6WA 1W9BM 3CH0A 2QEZA 4ZQRA 1JZ2A 2JKPA 3KTCA 2HCVA 3U6WA 5FIPA 2BZNA 4D6HA 1Q7QA 3FJNA 3EB2A 2FDMA 1J5SA 4XSLA 1K9FA 4U33A 3G1XA 4V33A 2A3HA 4DN1A 3TYDA 3UWUA 4YTSA 4Q33A 3RPDA 1PDZA 2VEGA 4GJIA 1MUMA 3OVGA 1A4LA 3WQ6A 1HL8A 1B90A 4EPBC 1OEPA 2DVTA 2UWFA 2TYSA 1PZ3A 2PP1A 2CU0A 5A8GA 3MP5A 3AYSA 1KFJA 4O1CA 1W5PA 3W1AA 4LTSA 2QJNA 2ZZ5A 4X61A 1S38A 1MZHA 2FQIA 3G0SA 4LEQA 3P5ZA 2AKZA 3SUTA 1OD0A 1QW7A 3N2OA 1GVRA 5A6SA 4CVUA 2EAWA 3LG3A 5GNZA 5EU9A 2WYSA 1LOQA 3SURA 2YSWA 3E2VA 3VOIA 1M7PA 3PULA 2JEPA 3RUBL 5KZDA 5BOOA 5JIPA 4I5XA 2O4MA 3S6TA 4UOJA 1DQUA 4DAIA 4E4FA 2BY3A 3SW6A 1FHVA 2DU2A 2ZRZA 3OGSA 2CLHA 4D71A 1A5SA 4QHRA 1IQ8A 5DELA 1R86A 3PSVA 4ZSTA 4G8TA 1RQEA 1UKPA 3GR7A 2X41A 1TWWA 3DFQA 2G3NA 2XN2A 2E0PA 3NZRA 4G5DA 4DUVA 1KA9F 4Z08A 4IQJA 4QLLA 4X9YA 1D8WA 1KLYA 3TQ0A 4AWEA 5C7HA 4GIRA 3SAZA 4DZ5A 3TQVA 3F4DA 1SZNA 4RV8A 5REQA 3UR2A 5HANA 3SDOA 4I6KA 3HG5A 1FUYA 4H00A 4A8LA 5CSYA 3W25A 1US3A 3DZ1A 4IUOA 2WSYA 1UR3M 2Q8XA 1XLBA 4BF5A 3NQEA 3FA4A 1T5AA 4R9XA 4F0LA 2G8ZA 3MYPA 3BO9A 1FWWA 4MZ1A 2XGBA 1HO1A 3NXFA 3EOSA 2BODX 1Y5VA 5E1QA 1E0WA 3T0DA 3WLTA 2XGIA 1UOZA 3B06A 4GYPC 3B0YA 3KP1A 1EJXC 3EX6A 4W8AA 5IDZA 3IK4A 5TD4A 1WE5A 3V75A 2UY2A 1L9WA 2C71A 1H7NA 3TX9A 2P50A 5E9AA 3KRZA 1WDPA 4HNTA 4KFPA 5I3DA 2CHRA 3EDJA 2OZTA 2YCJA 4OV9A 4JAWA 3QQ0A 2FHFA 3ONCA 3TVAA 1V3KA 3GFZA 3RR1A 5AN7A 4G1KA 3W1TA 1CW2A 2I9EA 3PC0A 3W72A 3MHGA 3DYPA 3RRAA 4BY3A 3A22A 4D6DA 1OFRA 2D1ZA 3VD7A 3DESA 3VM5A 4IH3A 1LUCB 4CN4A 1XYFA 4M6PA 4DWDA 2PCEA 1EEXA 2NXIA 5T26A 4KCWA 4KRTA 5B7ZA 2Q09A 6TIMA 1I60A 1C8QA 3G2GA 3M0LA 1P6BA 1XIEA 2FH8A 4I8YA 1EOKA 3APGA 1FWNA 2GJXB 1YADA 1GT8A 3UPBA 2J13A 3DFOA 3W24A 1K4GA 2OLSA 1ZFJA 4JTRA 4Y7EA 4XTIA 1R2RA 3VAVA 3P93A 2QXWA 3SQSA 1S5VA 2WSRA 1V3HA 3HJEA 4L61A 3LCLA 1VFOA 2FYMA 3WDRA 2QYGA 4DPPA 5LNWA 3ISIX 5D2VA 3PUGA 3RG6A 1UR8A 6REQB 1OFDA 1AMYA 2EKCA 2V2HA 4AB4A 1V51A 2X8RA 2XH7A 1XIIA 2AQVA 5JQ9A 1THFD 1AH4A 5M3WA 4O13A 1JYNA 4DHGA 3P74A 4GQQA 1FH8A 4N9CA 3MCNA 1S2AA 4C65A 1Q7MA 3F4NA 1V3IA 2FTWA 4Z1BA 1DKWA 4UFHA 4JQ1A 1MMFA 3CIVA 3GC5A 2D69A 2X1RA 2YJQA 4P8WA 2ZXQA 3OVRA 1W5QA 3O0KA 3RLVA 5JBEA 1KM1A 1UMLA 4N02A 2ZRYA 4MNMA 1P6CA 4V1YA 1CLXA 2QLYA 1JQXA 4UWMA 1PCKA 3LERA 3M4HA 4Y8FA 1C7SA 1SFLA 2O9OA 3POHA 4UBPC 3U3HA 4JQAA 1Q5MA 5FESA 3NPVA 1VEOA 1UWQA 4DLMA 3WD3A 2D73A 1GQLA 3W9ZA 4HJWA 3PZUA 1V02E 2D20A 2NQ9A 4MNJA 2WKJA 3L21A 1VFHA 1GGOA 4KWSA 2Z29A 3CIWA 1X1OA 3AZRA 1D7FA 1NF7A 2NWSA 1BYAA 3GVWA 3H4GA 1YHTA 4UNIA 1JZ7A 2AOSA 5KZEA 1AQ0A 3B0UX 5CSSA 3W37A 1XSJA 4C6KA 4AIOA 2E6AA 4DEFA 5F2GA 2OZ0A 3OPSA 2TAAA 1FWGC 1S5TA 4H8UA 3OVPA 4UQDA 1E9IA 3IK2A 4MMWA 5BXSA 2D2GA 2YCEA 3G1FA 3FJ4A 3KLKA 1AH0A 4KBXA 1MW2A 2P8CA 3NQMA 4B5TA 1NOWA 2X40A 2WZHA 3OIHA 3VDHA 4ROQA 2VNCA 1PWMA 3LCWA 3LPPA 1LG2A 4LNYA 2PDMA 2CPUA 3UZ5A 3REQB 3K8KA 2OKOA 3L5AA 2CBJA 5L6UA 2VGFA 1OFPA 3UW6A 3AMKA 3C8NA 4HZMA 3F7JA 3LTPA 3V1HA 3PPHA 4OQVA 4F3HA 1FRBA 1VRDA 2BGSA 2PDBA 1YDNA 3TZNA 1SW3A 4H9TA 3UQNA 3OLIA 4F8XA 4AD4A 3N34A 4QS6A 1N55A 1A53A 4PBGA 2CLIA 2XG9A 3S46A 1YDVA 1UQYA 2J8FA 1EJRC 2W6RA 3WLNA 4FB7A 1W1B1 4IP4A 4MKSA 1O4UA 2QJMA 2MUCA 3UWEA 3VDCA 1WKEA 1PJ9A 4AVNA 2FGZA 1H0IA 4TR9A 2OU4A 4LC8A 4XIAA 4Z2IA 3F2DA 2FZ8A 3PTQA 1JI2A 4F2TA 1OX6A 4A2RA 5D4YA 1O66A 4AIEA 4DWSD 4MWAC 1G4SA 3H26A 1YTEA 3RMJA 4K7VA 5BRPA 1BFNA 2ZZ3A 4WD0A 1QK0A 2Q8ZA 2B7QA 4O52A 1SO3A 5I7GA 4ERIA 2GDUA 3RPMA 5JUVA 4JY9A 4ADTA 4GCXA 1C90A 1DJGA 5LGZA 3TQKA 1YIXA 4FZIA 1ZBCA 4ZCWA 4QR6A 1NSJA 1JVNA 4MB1A 2NQZA 4K8HA 4UOQA 4LPCA 2CLLA 2VO5A 2WNZA 3L67A 4XSMA 3H4XA 2VFDA 1P48A 1E15A 4JCMA 3UNDA 4PUJA 4GYFA 3WIJA 4Y96A 1XH2A 5HUPA 3SEPA 5HK4A 3LGGA 3B9NA 3ZJ6A 4U3CA 1DL3A 1YE4A 3NPWA 3WBEA 3I10A 3ITCA 4JGDA 4E2VA 4PSRA 1WYIA 2YZ5A 4DJED 3BLKA 1UIPA 2CFFA 3W85A 3SN4A 1AD4A 3TR2A 3Q37A 3TCEA 2HWGA 3WLQA 4GJJA 2E67A 5FJOA 4H9XA 4NAFB 2C0AA 3KUMA 3CV1A 3WLPA 2RFGA 3P62A 2O0TA 1KM2A 3TW7A 5DBUA 5DT7A 3LQGA 1H3GA 1EYWA 4R7JA 3R11A 3B9AA 1L2QA 4XAFA 3LZ3A 4C7GA 4CD7A 3MMDA 3Q94A 4L1WA 1P1MA 2RJHA 4HA3A 2RDTA 1TV5A 2XVGA 2QAPA 4V28A 3SI9A 3A5FA 4H3DA 4K68A 3E3HA 3M0IA 5D9OA 1UMYA 3RIKA 3PK7A 1KCKA 2E9LA 3AHTA 4M1RA 1W1TA 2VFGA 1IXOA 4XZLX 1Z48A 5HULA 1OIFA 2HXUA 3L12A 4A3HA 1ZLPA 3LUTA 3HTWA 4JKMA 1ICSA 3UR7A 1TUXA 5AYBA 4IFKB 1OG0A 5DFAA 4LQ1A 5HMEA 3VXGA 1YXCA 1V0KA 3WBAA 1XLMA 1JCTA 4RDWA 3IUDA 2ZRWA 1JYXA 3U5UA 2E7FA 5D05A 3TEVA 1F2JA 3M0HA 3C0JA 3H21A 2O92A 4QFUA 2E6FA 3SM0A 5IFTA 1Q6LA 4UQCA 3NL5A 4O0KA 3LHWA 6PTDA 4IM4A 4HT3A 2PC4A 2X0HA 1RR2A 4DQWA 3R8HA 4C7DA 1FCBA 3WYZA 4LVGA 4I8DA 2CLFA 4GBUA 2JBMA 4A3RA 4ERGA 4CEUC 3QPYA 1QNOA 3EXSA 4UTUA 3WD2A 1EO7A 2V68A 1OIMA 3GKFA 4JTEA 2OELA 5ABFB 3FOKA 4JNZA 2INFA 2DORA 2ACRA 3STGA 3V4BA 3BPWA 2ZX8A 4ZZ9A 4GGHA 1ZNNA 1Y0EA 3UZWA 4DIAA 1D3CA 3I65A 2NX9A 4AWSA 1JDCA 4DWSA 2DPEA 5G2IA 5A5WA 1SW0A 1F6KA 4L65A 3F5LA 4XKYB 1DJYA 3G1YA 5DCEA 4QG6A 1XJBA 3GIPA 1WDDA 2F7FA 2VXNA 2ONEA 3W7MA 3PPFA 2G3IA 5AVHA 4PMUA 2PU1A 4ZQCA 4NRSA 3AQUA 5JMUA 1KTNA 2WWDA 5JBDA 2NVDA 3FK4A 4EK7A 5C9XA 2IPWA 3W2JA 1AQHA 1DJQA 3CLMA 3KRSA 1ONEA 3VUPA 4RDVA 5HMDA 2A5HA 1T8QA 2FVLA 4L80A 3THUA 2PA6A 3FGCA 1P6WA 4A29A 2X2GA 3AUOA 3D46A 3LV6A 1WAUA 3W7OA 3GFXA 1JUEA 3OZOA 4WIWA 4O11A 3U2EA 2ZFAA 4S3AA 3EOOA 5LXEA 3N15A 2WAGA 2E1WA 2ZA1A 2ZE0A 1KFKA 5DLCA 3LLXA 4NZ1A 2XVNA 3LK6A 4DJEA 4H8NA 4ZXOA 2YB1A 4TUFA 4JZ5A 3WNOA 4DNMA 1L8NA 2GUUA 3GG0A 2J7GA 3CIXA 4AZGA 4H83A 3KVKA 3WKZA 3EX1A 4IHCA 3NPXA 3PN8A 4S1FA 4LU0A 1UKQA 4I7UA 2YXGA 3N1AA 3B4YA 5AOUA 1KFBA 1MXSA 4NXSA 3HZ3A 1H7WA 2OSXA 1TUFA 3IARA 3V18A 2VJXA 4ZB0A 4JHZA 3N6JA 3OBKA 3GQYA 1LROA 4QTGA 1W2VA 3R79A 4L6HA 2Q02A 4O0QA 3MC5A 1AZ2A 1LRNA 4UUIA 1F61A 4POCA 3CPUA 3AICA 1OX4A 3NL2A 3GWQA 3ARVA 2X1SA 5AHLA 3PHAA 4M80A 1K03A 1UR2A 1SYTA 3AMCA 4I9TA 4J5NA 5AZ0A 3TYBA 2GGHA 1J6PA 1GVFA 3ZT7A 1TWDA 1XP3A 4MB4A 2ZC8A 2BVYA 1JQVA 4HMDA 3EOUA 1ZZMA 3M0KA 2OYLA 1UWTA 5A8PA 3HQNA 2BY2A 3TE9A 3H8AA 5A95A 4Y9MA 4UR7A 5KINA 1P43A 4F2UA 3CHEA 2POTA 3MCMA 3K1GA 1OYBA 4S3BA 1OC6A 4K1GA 4MFEA 4PCPA 3SGUA 4H7CA 4AXNA 4LUTA 1OSEA 2DT1A 3AWOA 4XZWA 1AL7A 4LFYA 1TMQA 5LHFA 4P7OA 3BQ6A 4XAGA 3GTFA 2BOFX 3BAJA 3LI1A 3GLCA 1C8VA 1W3LA 4FNSA 3NIYA 5D8ZA 3ARYA 1T41A 3S9ZA 3K8MA 1EIXA 3UJEA 3VGHA 2WZTA 1LBFA 2PZNA 1Y65A 4RZBA 4DUXA 2QW5A 2P53A 1LL4A 3SCNA 2GOKA 3ORWA 4ACZB 1UZ1A 4PTWA 3NXLA 4PCSA 5IBXC 1KB3A 2EPMX 3FVMA 4BF9A 1AA1B 3D3FA 4A8IA 3UA3A 3LBMA 3E02A 1FCQA 5LA2A 1XLHA 4FOUA 1QFEA 4M56A 4BI7A 3VGBA 2PWVA 1UCWA 3BICA 1MXDA 1VFLA 2YLAA 4GZJA 5D38A 1NEYA 4ML9A 2BP1A 4F4RA 5F4SA 3BMVA 1XL9A 1QRQA 5B7YA 3AMGA 3GRIA 3GXFA 4H9ZA 2OGJA 3RX4A 3VK5A 5IFPA 1LWJA 4WVXA 1Q8AA 1Q6RA 4DY1A 2C79A 1BXCA 1X38A 7CGTA 3PUEA 1WAWA 3SCUA 3E2QA 3CPGA 1TV3A 3FFSA 1VBHA 3H2NA 2WMIA 4ZQOA 4XZMX 1EC9A 3PJUA 4LUSB 4FXSA 5IRPA 4DUWA 4DYEA 5I07A 1ME8A 4BJHA 4L6DA 3M64A 4JIPA 5EMMA 4HSHA 4JTKA 4FX6M 2ZTKA 1SMAA 5HNUA 3P60A 1EKOA 1M1BA 1RBLA 1PBGA 1U30A 3WMCA 1UA7A 3TWAA 3OA5A 2E28A 4MWAB 1E4NA 2GVJA 3TN4A 2XWDA 1HJQA 4YS1A 3CWOX 1G9HA 4BQ4A 4FXRA 3FJLA 4XAZA 4B5WA 4DLFA 4OUIA 4C6NA 1KM3A 1JYWA 2A6NA 1KO0A 3E12A 4C6QA 1ZBWA 4CN6A 2YCLB 1F3EA 2GOUA 3PZTA 1K6AA 4YIWA 3H7UA 1Q3NA 2H8ZA 4TVCA 3UF9A 2YCIX 1R5YA 4UTJA 5E6YA 4XD4A 3T55A 1J5TA 2PODA 3ABSA 4UQAA 4GYKA 1SSGA 4BCEA 3LX9A 4X2PA 4V27A 5E5CA 2QDHA 3O6AA 4UNLA 5CLWA 3WF3A 2WMJA 1S3TC 2Y70A 3A3WA 4O15A 2ZA2A 1OGSA 5DN1A 1XLDA 3NDYA 5LSMA 4MWAE 1EC7A 2JIWA 2PD9A 3QKZA 3VNKA 1D9EA 4QJ4B 4J3VA 4I6VA 3U4AA 1CDGA 1I4NA 1SO4A 3AFBA 1A0CA 4AG0A 2WLYA 4QROA 3LB0A 2DJLA 1Z6KA 1EYEA 4B92A 3OIXA 4IMEA 2GUBA 2NVAA 1RBAA 2WPBA 3CV6A 3V0TA 4IPJA 3UERA 3WQDA 1LCOA 2ZUNA 4HU3A 3PTDA 4ROPA 2W62A 4QITA 2J6XA 4B5UA 3RXZA 3RX3A 1WDWA 4L5ZA 1ZAJA 4B16A 2E77A 1DWGM 5I78A 4A22A 3FIGA 2G37A 5EL1A 3N9KA 5AYYA 1I2PA 3O9NA 2ZE3A 4B91A 4Z42C 3TUUA 2GZXA 3KCOA 5BZAA 3GR8A 2ZUSA 3HF3A 3P84A 3ENLA 1NDZA 3UA4A 1VCFA 1EUAA 3PZ9A 1MWOA 1OG6A 4G56A 1YPXA 1TE1A 4QGCA 3RM4A 1E9ZB 1DORA 2B31A 2DSWA 4W86A 2GYIA 1MUCA 4AWTA 2VDHA 3T6CA 3NQ7A 1Z9AA 1UD6A 4X60A 3L4YA 1M04A 1VS1A 2CZEA 3MPGA 4HSOA 1BF2A 1RZMA 3ARPA 4OV4A 1FWEC 3W26A 4QBXA 2BOGX 3SGGA 1UJQA 4Q8NA 1J18A 2H8XA 1HJUA 4E2DA 3W23A 3DEQA 3A4WA 2VENA 3WZ0E 1VLWA 2X1IA 1A5NC 1KXQA 1EQPA 3ZR4A 1UYQA 2RHGA 2B7NA 2F6KA 3R0KA 4YVXA 4B90A 2XN0A 1GTEA 3AXXA 3N9RA 1HQTA 3T78A 3OGVA 4NSBA 2E09A 1BKSA 3RYSA 4JBRA 4W5UA 4O10A 4AY1A 4E4UA 1EDQA 3QFWA 4ICCX 2DT2A 5JH1A 4XD3A 3GXPA 3ME3A 2WCAA 3BLFA 2TRSA 3MP3A 3I68A 5CLTA 4D72A 4KRUA 4DJFA 2O7SA 9XIMA 2UY3A 3LBOA 1T0OA 3PZGA 1R3SA 4IP7A 2QUVA 1MNSA 3PSWA 3V36A 1BKHA 1U33A 4U5KA 1ADDA 4LCSA 4WDWA 3K4WA 1JAKA 3WDJA 2ACQA 2EPLX 2RKXA 3CQIA 4DF2A 3WJZA 2ALDA 4MHBA 4AZBA 1HW6A 5GJNA 3UXDA 2OQLA 4WRHA 1W1ZA 1MQPA 4D1IA 3BARA 4G7FA 4IXHA 6REQA 3W7CA 3G0UA 3BV4A 2Q3RA 3VOFA 3M41A 3RPTA 3B8IA 5A6TC 3IIXA 3LCIA 2Z28A 3S1VA 2A3CA 1GKRA 3ITTA 3NR0A 1EPVA 3KVLA 2PDUA 1X6UA 4LAMA 1JFXA 4JFWA 1UH2A 4WKAA 2QUUA 3MDWA 3W6YA 3HPXA 3W1MA 1LWIA 2XIQA 4C6OA 4IGSA 2VYOA 1M3UA 1W31A 3LHVA 1VR6A 3GC4A 3MI6A 1KTCA 3HPZA 4ONVA 4HPJA 3MKVA 3LNPA 2V67A 2I56A 3W6MA 1FWFC 2P5NA 4AMAA 1LTDA 4O4VA 1R3VA 2YXXA 4FX7A 5FJUA 1SM9A 1MNZA 4MM1A 4KH2A 1EBHA 3PNZA 2OLHA 1TB3A 1DQWA 4JY8A 3M44A 1YTKA 1TIWA 2J9YA 3WUBA 1F73A 4GNJA 3WH9A 1DQXA 1UWRA 4AC1X 2C13A 1TMLA 1J0ZA 3D3AA 4W5ZA 1GOOA 4IJBA 2NX1A 1O1HA 3LBCA 2RAGA 1Q63A 4CNOA 5FJPA 1E71M 1IEVA 1BYDA 1S2CA 1TQXA 4XBJA 2IQ0A 2PEVA 3NOYA 2VKZG 4GH1A 2VWSA 4BQ5A 5C8BB 4J40A 4A21A 3N6HA 1RXOB 2R9RA 4O54A 4YN5A 4NRRA 1TYGA 3M0MA 4WR3A 4C90A 2X1UA 3N04A 2WZIA 3O1NA 3PWIA 1I45A 2WHLA 4FAMA 1P7TB 4NHVA 3T8QA 1TA3B 2TPSA 4O14A 4DM2A 3VC5A 3AHVA 3NL3A 4Q8MA 4AD3A 1WB0A 2QVHA 2WQPA 3HJZA 1Q66A 3B05A 2AGKA 2B81A 4OKDA 2DZUA 3LRLA 1QWGA 2J27A 4IIFA 4N9DA 1TX2A 2VELA 3BG5A 3REQA 1QW9A 3TC7A 1XIGA 3UEQA 1KFEA 3BGJA 1RP9A 3U2CA 4E6MA 2QKFA 1UWIA 3N14A 1AG1O 1VIWA 2HBXA 3L2LA 1XKYA 4MYAA 2E9BA 2NVCA 1PO9A 1UZ4A 1TKKA 4Q4OA 1XLKA 2VFEA 4X22A 3IV3A 4MZYA 5G4EA 2BGQA 1W9UA 3C5QA 1UD2A 2G3MA 4QRNA 1EZWA 4RE4A 1LDCA 3DGRA 5MF5A 1GJWA 5K3VA 2WVVB 5AC7A 3IRSA 1J6OA 2A6LA 1CB2A 3NQ8A 1XD1A 4P7QA 4X0NA 2FZDA 1WKDA 4PMVA 5CPTA 2ZZ2A 4DZIA 2BVWA 1HKWA 1J0KA 3CGTA 2BXZA 2GSEA 4KEUA 3WQFA 3GIQA 3USBA 5DMLA 4D6CA 4L9YA 3MHUA 8XIMA 3RGTA 4IGMA 4C6DA 2PGEA 2VRQA 3KXQA 1TWZA 1JG9A 3KLLA 1QI2A 3PUOA 1CT5A 1V5XA 5EMYA 3QYQA 5EFFA 3O16A 2CBVA 1PB0A 4FNUA 4LV9A 3UP8A 5I3JA 1RY8A 1Z41A 3QC3A 4A4AA 4L7ZA 3EDKA 2ISSA 3W82A 2PLCA 3O15A 4ACYA 1XLGA 5A6MA 1WA3A 3OO2A 5ABTA 4RE0A 3LSBA 3OJGA 4PMNA 1XV8A 2FVKA 2Y89A 3PUDA 1O68A 3PZMA 2V8ZA 1ZQ5A 2NQLA 1K8CA 2Z2UA 3O7UA 3U7BA 5C71A 4M8UA 1O95A 3EWDA 1V6XA 2VZUA 3WD4A 1KRMA 3VD3A 3UCCA 3L4ZA 3GNOA 2XUCA 1ZHAA 1Z42A 4L4PA 3OA3A 3SSZA 3L4XA 4O17A 3VZYA 1ML1A 2Z7KA 1TWSA 4NZJA 4PB3A 3WF1A 2WV8A 4XVDA 3DFSA 4NAFA 3GXDA 1QTWA 3VABA 3U8GA 2OX4A 3O0FA 4PEKA 2PGRA 1PZ2A 3VU2A 2GDVA 1Q6FA 2REQA 1CX9A 4LJ3A 3SN0A 2DGAA 1GYNA 1KFCA 1S2TA 2QCCA 2YDQA 3STEA 4Q7NA 3GUGA 3H12A 1M6JA 3LMZA 2XWEA 3AOFA 4DAFA 3CTLA 3KP0A 2PRHA 3R89A 5CSRA 2R91A 2C15A 3WN6A 4ATDA 1TIMA 1H0GA 4REQA 3M5YA 4KWOA 4GX8A 3W3OA 1Q2SA 4LX4A 1TWIA 2WMFA 4EF8A 4FLSA 4I90A 3IIVA 1B1YA 1RLDA 3HFYA 3GVGA 1P0KA 1PL9A 2D24A 3KOXA 1XR2A 4M0XA 2F2KA 3KVJA 1X7IA 4U5IA 3IACA 2VX5A 3GFYA 5A1AA 2P8BA 3FVDA 3VOCA 1TFVA 3G6LA 2V5JA 1JD7A 8A3HA 3MBDA 4DRSA 5LHEA 3MUCA 2W27A 2NQ5A 1QXLA 3KBWA 1ITCA 4FNTA 3R25A 1LLZA 2V3GA 3CAQA 3C4UA 2C1IA 1OFOA 4H9VA 4J28A 4JTAA 5REQB 2UY4A 3W38A 3GU9A 2ZXDA 4O8RA 1EP2A 3U7VA 1Y8BA 2DH2A 2OJPA 4WOQA 4J35A 5FCZA 3R6IA 1GOKA 1E6ZA 4H7ZA 2ODOA 4WOZA 1IXQA 2NV2A 5G4WA 3ELFA 3U2OA 4N42A 3MMWA 1HN1A 1G94A 2HTMA 1ZU8A 3WMLA 2IXUA 5HOSA 3BXWA 1I2NA 1X97A 1FQ0A 2QDGA 3EKLA 3M6YA 1JGIA 1SFSA 1UP2A 4F9JA 1V0NA 3TMLA 4GUIA 3H22A 4I7VA 4DYJA 2A7PA 1QHPA 3S83A 4DBEA 2INEA 4Z1CA 1KGXA 4U2ZA 1W37A 4GMEA 4AEOA 3T2PA 3P8IA 3WFAA 3HU7A 3OBEA 4BEUA 1BVNP 3OEXA 5DO8A 1TMHA 1R3WA 5I06A 1PEZA 3T42A 2GGJA 3FS2A 4DWSC 1B0IA 1NWSA 1HGWA 1EEPA 1W5OA 1TVLA 2HSAA 2BNJA 5D04C 1NVMA 1N7KA 2CKRA 4BZYA 2CETA 1AVAA 3R12A 1T99A 3IPWA 4QJ1A 3VKCA 1SW7A 1GONA 1FX6A 4JTCA 3ID7A 2CW6A 2I57A 1XYAA 1CGWA 1GHSA 5I0DA 5M03A 4PBFA 1NIUA 3DH7A 1DIOA 4ZA0A 5HQMA 4QE1A 1SU5A 2YPIA 4O18A 3S1WA 1SGJA 1KTBA 1AFSA 5ABGA 2CLKA 4HA1A 4UTIA 3GG8A 4QNEA 4HTYA 3W07A 2D0HA 1TPH1 3GH4A 3SCOA 4ADSA 4TMBA 5E93A 4P2VA 3DYMA 2H9AB 2DSKA 5MKGB 3NVDA 5DMMA 2ISWA 4S3JA 2Y8UA 1KFLA 2ZVRA 4DJEC 3FDKA 4AEEA 5EFDA 1XUZA 1SZRA 2EG8A 5C2CA 3TAOA 4YVVA 3SECA 4GHRA 4HCDA 3HQ1A 3JW7A 3ARWA 7A3HA 3WNMA 4UC5A 3EXRA 3MB9A 1LG1A 3GW0A 3CQ0A 1J0JA 3IGUA 2ZA3A 3VIIA 1R9XA 1IIGA 2G3JA 4MNLA 3GAKA 1FWHC 3T4CA 3DXIA 2CHOA 1QT1A 1GEQA 5LNUA 1W8GA 5HDRA 5B80A 1QNSA 3G18A 5HPOA 3GHSA 4W84A 2PDXA 4HHMA 1CGXA 3V35A 3EWZA 1W8SA 4HN8A 1XW8A 1RH9A 1JPIA 2Y7FA 3EWBX 2VGBA 1ISVA 2PWGA 4PUEA 4E4PA 3UPMA 3PAJA 4MPKA 1FHUA 2H90A 3KZPA 2QMKA 1MW3A 5AC4A 4GFSA 1W91A 3ARTA 3V5FA 3S6DA 1NWRA 3URNA 1XPGA 3ZT6A 4KEMA 4HQVA 3PFRA 4HCHA 4WSJA 2BG5A 3CEPA 1AW5A 3KBNA 1SQ7A 3H23A 3BSHA 4NX5A 5K4ZA 3TYUA 1UWUA 2DZTA 1QATA 4PMYA 1E9LA 1FA2A 3AISA 4LS0A 4NG3A 3L9CA 5HXMA 1U5HA 1X1ZA 3H4WA 4QQUA 3QJAA 1P1XA 1HGYA 2WMKA 4GY1A 3DAQA 2FGBA 4DO6A 4YYCA 1W1PA 3SUUA 2NLYA 4JDYA 5CPNA 1XRVA 3TLQA 4HVXA 4TTGA 4L9ZA 1SO5A 4L4OA 2Q71A 2HROA 3UYCA 1G7UA 3T2OA 3K1DA 3ATZA 1KBKA 1Z44A 3WNKA 4WSKA 4AEFA 4WHBA 2G41A 2HXTA 4LVDA 4QG9A 4YWIA 2V3FA 4HHHA 4DM1A 4DX3A 1OJXA 5BWAA 3QH2A 1CXHA 1XIFA 3CT2A 1QBAA 1OGGA 1WOAA 1QCWA 1R47A 4WDXA 2ADAA 3K4DA 3MI2A 3P3BA 2PDWA 2PWUA 2DIKA 2PWHA 3P7YA 2CBUA 2FKPA 1V3LA 3FHQA 3RRXA 1QJWA 2YDRA 3S2CA 5E0FA 4AHQA 2I16A 1G0CA 4HJFA 3B0VC 1NDYA 3KBJA 1VYPX 4ZBCA 2WNNA 2OEMA 4P5UA 2PWDA 1JDFA 3SCRA 3T9PA 4Q8UA 3MYOA 2FPVA 1S2UA 1LT7A 2EPHA 4IMGA 5LA0A 3VD4A 4H4IA 3GO2A 3NYZA 4YTTA 1EJTC 2IUZA 3QV8A 1OVDA 4F2BA 3NYDA 4OECA 1QI0A 1KRCC 3A21A 3P6LA 1QHOA 1IZKA 2D3NA 2EJAA 2YW3A 3CZ8A 1QNVA 2QPSA 2YBVA 1RK5A 1VJIA 4JPGA 4DBWA 4D6IA 3PB2A 4OBRA 5ABEA 2ZRUA 4X0VA 4GFIA 2BB0A 1IYXA 2FPTA 1E6NA 1TJ0A 1TV4A 3TA6A 3P8JA 1AK5A 4RX0A 1HJWA 2JKEA 4S3GA 3SY8A 2BHUA 1B54A 3A4XA 4EXBA 4JL1A 1ZCCA 2CESA 3DC8A 5G4HC 5A6JA 3HMCA 1VBRA 3CUJA 3C2RA 3II1A 2QQ6A 4LVBA 4B5VA 4Q4RA 3F1QA 1G7VA 1O60A 4JTLA 2I9UA 3PJTA 1F4HA 3QV7A 4HIBA 1V79A 4FF5A 3W1PA 3L4WA 3WQOA 1NQ6A 3NO5A 3VX1A 1JZ6A 3QKEA 2EKGA 3AALA 4JYFA 4EX4A 2FMOA 1PX3A 3W2MA 1TPDA 3WUEA 1S5MA 4LRSA 2XHYA 1WP6A 3UXAA 1TCMA 4HK6A 4GI6A 1NU5A 5AHNA 1S1PA 3U5YA 4QAWA 4KFOA 1IEWA 3W6LA 4N2YA 4UTKA 2EPOA 2OGYA 4Q6XA 4N7QA 3IGSA 3NSXA 4LEFA 4KETA 4AFYA 1BXNA 4IIGA 5G5IA 1ONWA 3M47A 1K4HA 1E6XM 4Q4QA 4CNUA 3HV9A 1L2UA 2POZA 5LA1A 4RUBA 3VDGA 2NQHA 2J24A 1M9HA 4FXJA 2EXOA 2Y2WA 4OWGA 3RHGA 3B8VA 1JCJA 2BASA 3BLDA 1JXKA 3UG5A 1SZFA 4OIFA 1EHNA 2E68A 4WX2A 4QP0A 4JX4A 1VPXA 3WEMA 1UBSA 5U7SA 3VOJA 3TROA 3KM8A 2EO7A 3RJXA 1VGAA 3VNYA 4AZ7A 4FR1A 1WXZA 1XISA 4UMBA 1CYGA 1JZ3A 1FFRA 4DVOA 2PDGA 1FWTA 3RO8A 2WMHA 3L0NA 1R3QA 1FCUA 3LZ5A 4KRZA 4C6FA 1C3FA 4AYGA 3KWSA 5JBFA 3BW4A 4BI6A 2JQXA 3TK7A 2ALRA 3ZWTA 1FWAC 5GQBA 1XYMA 2VVNA 1DPMA 4O0ZA 1Q6QA 2F9RA 3QY8A 3KS5A 1S5NA 4NX0A 1E3ZA 3SUVA 2WHKA 2PRMA 4HKPA 4IPPA 1OGBA 3AIWA 2QUTA 3DG7A 1QNQA 3GZ3A 3NO1A 3W75A 2ZX6A 3SSJA 3WSUA 5JH2A 3HGJA 2YDSA 4KWVA 4B5XA 3BC9A 3SB0A 3CK5A 1WOBA 3RM9A 4Z2HA 4F0KA 4WJEA 4ZOAA 1J01A 1PHWA 3T1GA 4Q6JA 1UQZA 1L6YA 2E6YA 1UD3A 1W9PA 3TNBA 3BQ5A 4W89A 3HMJG 3GNNA 5CSUA 1YRRA 2O9PA 1A3XA 1Y7VA 1TZZA 1YNQA 3SCPA 3W7LA 3BAXA 3FYYA 5HR7A 1JPMA 1VYRA 4KT2A 3AIEA 1Q6CA 1KXHA 3WNNA 3MMTA 1YEYA 5JVLA 3VIOA 1XINA 3AMLA 5D8WA 4N9EA 5I2UA 1PYMA 5CPOA 2PDJA 2WKLA 3BLPX 4AD2A 3DOPA 1OQFA 3BMXA 4GVGA 4DWSB 2YL9A 4XO6A 1BPLB 2OWWA 1P0DA 2KZHA 4DJFC 3E2SA 1QPQA 1VB9A 3NQBA 4MG4A 3BSGA 4JDBA 1LWHA 3O8AA 1UKTA 1MI3A 2ZYFA 4A05A 1H41A 3VILA 4Z0JA 3W7QA 3PS7A 2EF9A 4DUOA 1M68A 4H9UA 3OHIA 1LM1A 1T96A 2BX7A 3DECA 1Z3NA 5XIMA 3QFEA 4ZFMA 3C52A 4GOAA 1J2WA 3BANA 1FWIC 3HFTA 3LM3A 1K1DA 3JRKA 3FGCB 2WNWA 3W2UA 3B04A 3KL3A 3QPZA 4UQ9A 2QUNA 4N6EA 1AJZA 1DHKA 2HK0A 3YPIA 4W8BA 2GQ8A 5FOOA 3LCXA 1TVPA 2A7RA 2QNEA 2Y7DA 2AL2A 1YBQA 4M5PA 3AHYA 3R1ZA 2VMFA 1UASA 3QM3A 2DJXA 1FWDC 3QHOA 1Z89A 4V2XA 4DO4A 5EMLA 2HVMA 2ZUMA 2QZRA 4XAYA 3CB3A 4AW7A 1D3GA 2FB2A 2ACUA 1NP0A 7PTDA 3QC0A 1RD6A 3RILA 2CEQA 3WK1A 3VNDA 5I3IA 4N6FA 3VMOA 1TJ1A 2YA1A 4UTFA 1YXYA 4QXIA 4RL3A 4O12A 3ERPA 2QV5A 3V0SA 1AQFA 4MY8A 3W7DA 2B0MA 3C0SA 4E8CA 4AMCA 1OX4B 1SPQA 1H50A 2OO6A 4MKNA 5BCAA 4QE5A 4B3KA 5AFDA 3L2MA 5H8UA 3LHTA 3VKBA 3NQAA 5JXQA 4ASTA 3USZA 1XFCA 3BJTA 3DYOA 2YIHA 3SY1A 4X3ZA 3T8LA 3RAOA 3GDBA 2A2IA 2XFFA 5CAKA 3CHFA 2DDXA 3MDUA 4ES4A 1F5ZA 4QS5A 4TIMA 4H04A 3N3TA 3Q65A 1HZYA 4NL1A 3S3GA 1PE1A 4AY8A 3ICJA 3KRBA 5LIXX 3R7MA 5DY3A 1K3UA 1I75A 1IT0A 2D2OA 3AI0A 1XYCA 5G2WA 4K7YA 2Z27A 4LUTB 3V3WA 1CLKA 3BCDA 2V63A 1GQJA 2IKGA 2VCAA 4EVZA 1XRSA 3ANVA 4GISA 4F9DA 2INZA 3BW2A 2D2JA 4MUPA 2EEXA 5AC8A 1NH6A 1UHVA 4Z0SA 1JCYA 3B0XA 3R13A 5FD0A 3TJXA 3VIJA 1JIBA 5AYIA 3UZXA 3VDAA 1TPWA 5I09A 4JR5A 3RJYA 2GQ3A 2VCCA 3IJIA 3IVSA 2VT0A 2CZVA 4O19A 5SWUA 1ISZA 4GUFA 3WH5A 2BVDA 2W67A 3ZVHA 1POJA 2QIWA 4V15A 2VOMA 3JR2A 4XX6A 3QV9A 2ZXBA 1RPXA 3TYEA 3SFWA 3K13A 4HCLA 1ZALA 2BLEA 3CASA 3B8UA 1ZRQA 3KRUA 2EG6A 4PUNA 4WSHA 1UOKA 2HNHA 4NI3A 2CWNA 1JPHA 4Z1AA 4Q4MA 4RZ5A 1ZENA 3O3RA 1UC4A 1U1JA 3T0CA 4DYKA 3TR9A 1U22A 3MKKA 3S1XA 1LRQA 1GORA 3WBXA 3FCPA 4AIUA 2CIPA 3QYSA 4S2CA 1RJRA 1TPFA 1X8CA 1XLJA 3AJ7A 4M81A 1O6IA 3W27A 3DBNA 4EWND 2YDAA 4MJMA 1E56A 5BOEA 5LNVA 2VX7A 5I02A 3EPNA 4QISA 3KS6A 2X05A 4ZO7A 3G1DA 3R10A 2WMIB 2J7BA 4EP8C 4LY4A 4LBUA 4M51A 3SCVA 1EHAA 1B57A 3FLUA 5CGMA 4JTFA 3N25A 4A8RA 3BAYA 3CO8A 3URBA 3VD9A 2H3DA 4HZ8A 3DBPA 1G6CA 2DQWA 4PB5A 5KEZA 2J9XA 3N4FA 3U0HA 4C6BA 4PUUA 4QM1A 1RK6A 3WLIA 2I1OA 2GWGA 1NJJA 1TTIA 1R30A 4WUIA 2XM1A 2OZ3A 1CXIA 5CPLA 5F1UA 5LIYX 3O6CA 3BE7A 1R85A 1IWAA 1OF8A 3E6EA 4XKMA 2Y5SA 3G0XA 2J66A 1RPKA 2Y63A 1ISWA 5LXXA 2OSYA 4RNIA 3S1UA 1LQ0A 1ECQA 5EBAA 3W2NA 2V3DA 2IQTA 4GI9A 6XIMA 2I5QA 2XH4A 5A6BD 3EB4A 4DO7A 3WK2A 3F5JA 1T6MA 3VKAA 4D2JA 1B3ZA 1X6NA 2QHAA 2Y0FA 4ZO9A 4AZHA 3A5VA 1Q2RA 1LL6A 1LOLA 3P80A 5CJNA 4L9XA 3W1RA 1VRXA 3N2CA 4C5YA 2D23A 4E5TA 3CUIA 3FN9A 4EWJA 3UD6A 4H6EA 3CUGA 4C1NA 3FSUA 4I3GA 3S9IA 2J4GA 3CXOA 1ITUA 4JIIX 4PL2A 3ZS4A 4CKQA 2NLIA 3SR7A 1EIBA 4MGGA 3GBDA 4ZFCA 3C2YA 4DXXA 6ALDA 3E9AA 4KPLA 4PRTA 3RFAA 1UUQA 4FNPA 4XD5A 2I7GA 1E0VA 4Q32A 3THCA 2VGIA 2DIEA 1J96A 3L65A 5E0KA 2G0WA 1EWDA 5C5YA 1N2VA 1MQRA 1K7EA 3ARRA 3STFA 4D1JA 5FEPA 3AC0A 3AXKA 3H2CA 2WXDM 1E1FA 1S46A 2VP8A 4O1AA 3EYPA 2FZBA 3RLHA 1IZCA 4EXAA 3CZGA 4ZEPA 3VIMA 6CGTA 1G69A 3QR1A 1XIMA 3NZQA 4CNTA 3GH5A 5TQLA 2OODA 4TO8A 1GKPA 5D03A 3MVTA 2J78A 3W2LA 3PBVA 3FAWA 1SFJA 4CLMA 4PTMA 1LBLA 3PZQA 2QMJA 1MO0A 4NZCA 1GOIA 3ITVA 3RO6A 4OJYA 4XK2A 3BG9A 4PUMA 3VO0A 1EO5A 2BVTA 3W7EA 4AZ5A 2DW7A 2X30A 1DV7A 2E25A 3OLGA 4JNYA 1BD0A 1V6UA 1H4PA 2BBFA 3CYVA 1B9BA 1H61A 5I24A 1PXGA 5DCDA 5FJTA 3GDMA 5KITA 4EOUA 1EJ7L 4IICA 1UZHA 4IL2A 4N9BA 3PFMA 1DJIA 2ZWYA 2V2CA 1QWKA 3FKRA 3OVQA 3G1HA 2J62A 3PPCA 3QTPA 1JF5A 1QO2A 4XG1A 5K7JA 1VFUA 4XIMA 1Q6OA 2HRWA 4HYRA 4ZR8A 2ZUUA 3GD6A 4LC6A 2AAMA 4FI4A 4Q3MA 4JTIA 4FNRA 1IE7C 3WFLA 3WQVA 2YW4A 1EXPA 1QDSA 4IIHA 2AAAA 3FYPA 2P3ZA 3LLFA 5CPQA 4UFLA 4MFDA 3QW4B 5BW6A 2NZLA 3BMWA 8TIMA 1Q7ZA 2W3ZA 3KX6A 2WJDA 2FB3A 4EACA 1A49A 2FGLA 2JE8A 4GINA 1B3YA 3SJNA 2B7PA 4GVFA 3NQ2A 1A5KC 3NVTA 1DJNA 4GKLA 2A4AA 1OK4A 2QJGA 4Y9AA 1SUXA 3B9OA 2C19A 1OCBA 1S5WA 2GLKA 5H2ZA 2OT1A 5CH9A 5HQEA 4PRWA 4TV5A 3IVUA 3FY1A 3VIKA 2FDSA 5BYWA 4YCOA 1BVWA 4YWSA 3CB8A 3IJQA 5A6BA 3H7RA 1ZP3A 2J8TA 3CUXA 1H7OA 2H9AA 4HN4A 5MKGA 3GY1A 1PDYA 4NP7A 4HK7A 2GVLA 4YXGA 2VR5A 5DEZA 3TJ4A 3PZNA 3EDEA 5BROA 3QZAA 3FNDA 2NSXA 4Y90A 1V3JA 2OEKA 3ZYZA 2IKJA 1BYBA 3MP4A 3RLGA 2G4FA 1TE6A 1DIEA 1FP9A 2Y61A 3CWNA 5G2HA 1CEOA 3LENA 1V03A 1KM6A 5HWJA 1W3NA 4IQLA 1PKLA 1W3HA 1L6FA 3GX9A 4UTLA 3E74A 2JGYA 1EH9A 1TJPA 4UCFA 1DOSA 4XWUA 2DP3A 1P4CA 2GVGA 2RDXA 2PFHA 4K39A 2ESCA 4KMQA 1WDQA 4C6JA 4AUBA 3B8DA 2Y1HA 3Q2DA 1XIHA 4LCRA 4B3ZA 2NV9A 2DUAA 2J75A 1XYZA 2QT3A 3ECQA 1ISYA 1H5YA 1V6TA 3U4FA 1GZJA 2C1HA 3GHRA 1GOWA 1O5QA 3DG6A 3GVQA 1IEQA 2PDYA 1HP4A 2ANUA 4YTQA 3QOKA 5A2CA 1UWSA 1QBBA 3EEZA 3S4TA 5GNXA 1NOFA 5I00A 2QF7A 4GI8A 4KF1A 1P5BA 4X2RA 1FH7A 3G1RA 5CZTA 4IFOA 5T8GA 4Z2JA 5HR6A 3OZPA 2HDJA 3WMBA 5D2XA 5IDIA 4NU7A 2CBIA 2Z25A 5EY5A 3H53A 3VI2A 3U57A 4J3ZA 2VZTA 3LNMA 3W7HA 4EKJA 4DO5A 4M7SA 1V77A 4PA8A 2BXVA 3KVMA 4DPQA 3E1F1 3M5XA 4W7VA 1D8CA 1YX1A 4ALDA 1A5BA 5BU9A 5JIWA 4GXWA 2Z0IA 3F03K 3R5EA 3GDTA 4C6PA 1I2OA 2QVNA 3MQTA 3ANYA 1VC4A 2VC5A 3GM8A 3W29A 4A3UA 1J11A 2PD5A 3LY0A 1CBGA 4JIHA 4CGTA 1OZQA 5CC6A 5FF3A 1OX5A 3EX3A 1REQA 1MRAA 1EP3A 3NM3A 2W91A 2Y8KA 3L23A 2WBKA 2Y62A 5BMXA 4Q4PA 4NAEA 3I4EA 1E0UA 3NO3A 1UWAA 2OSWA 1ZSXA 4GNKB 2HBVA 3GDLA 5L9FA 1EA9C 2BWGA 5EMJA 3UZJA 3MUZ1 1QUMA 2FFCA 3BWWA 2V81A 1LP6A 5HJYA 4AHPA 2JFEX 3WCZA 3A9IA 4HZ6A 4LV4A 4DI8A 3N29A 4KIEA 1YKWA 5DMNA 4R7WA 4B5SA 4Q22A 1XLLA 3OODA 1GVYA 1LF1A 3UWVA 4PE8A 3W7JA 4Z17A 3F5KA 3BVJA 3RF9A 5I3KA 1W6TA 3CZLA 3CL6A 5LZLA 3DGBA 3NNTA 1PKMA 5ENLA 3S47A 2XINA 1KR1A 3GE7A 1UUMA 3B03A 4QLKA 2RUSA 4O4WA 3M5VA 3O6YX 3CJPA 1XGDA 4H9YA 4YLWA 4JXCA 1NDWA 1IF2A 3MBFA 3I6EA 1LLWA 4GD0A 4F0MA 2ZXAA 4MB3A 1KGWA 1IT8A 1V6YA 4IJRA 2AKMA 1XLCA 3CMJA 3IVTA 1DWFM 1TPEA 4GXPA 4NNCA 3HB9A 1ONXA 3KOZA 2W61A 4NJJA 2ZZ6A 1E70M 5D37A 4NXKA 2YZRA 3JU2A 4C91A 2X7VA 3I3EA 4IQEA 4ERAA 2C7FA 4MADA 4O50A 3BLLA 4UXDA 4F79A 1FWJC 2PP3A 3TTYA 5AYXA 3A64A 1T40A 2D3LA 3XIMA 1ZL1A 3FX4A 4O53A 1UR1A 4S3CA 1IHIA 2ISVA 3FXGA 1BSIA 3B8WA 3VCNA 4IXXA 1XXXA 3DKLA 4DZAA 1PKYA 4QSHA 1SO6A 3M07A 1R3RA 5IHSA 3GAYA 3VINA 2J74A 3APYA 1MDRA 5CKSA 3BZJA 3GDKA 1H7PA 2OFJA 3KDNA 4K8EA 3LEPA 2J9ZA 1UP3A 5FAGA 4QX4A 4K6AA 5E09A 4N4PA 2REQB 1S39A 1WBHA 1HL9A 4UQBA 2A3BA 4BHYA 3RN6A 4ATWA 4QCEA 3T40A 4HOWA 3NDOA 1W17A 4O16A 4RZ6A 2VEPA 1TELA 1GYLA 4JN6A 3M1ZA 3WD0A 2R8WA 4LANA 2W92A 4ICMA 3SBFA 2NQJA 1P0EA 4WDTA 3GH7A 3I7SA 3IAQA 3O2LA 4REQB 3ZFHA 4EPEC 3TH6A 4D9PA 3KWXA 2WM0A 5AZ1A 1BGAA 1ZJBA 1F8IA 3P61A 2CHNA 4MAVA 2J88A 3VCCA 1CPUA 3ZLFA 1TJRA 4XBKA 4LAZA 3AO0A 3FAXA 2RJGA 4MTVA 1CXKA 1EB3A 2ZICA 1R9YA 4S3FA 2BY0A 3B3DA 2QUMA 1HT6A 1TSIA 2PTDA 4Q7BA 3N6QA 2VFHA 1KGUA 1TV8A 1AD1A 1PTGA 3NL6A 1OINA 1XKJA 5KETA 2TSYA 1XBYA 3W1QA 5FAJA 4GXMA 5LNRA 4GWEA 3VIFA 2WB5A 1Q6GA 5I77A 1JDDA 1NWUA 3Q4DA 2R82A 4QE4A 3ZXWA 5AB3A 3B9EA 1KD0A 1GVIA 2FMNA 4EAYA 2Z6JA 4Z2LA 2TMDA 1I1XA 3STPA 1W9VA 1KV8A 2ACSA 4WGHA 3CAVA 1MUWA 1RV8A 3QY6A 4I5RA 1J4EA 4L1GA 1FWBC 1U2YA 4WXYA 3K30A 5I3HA 4R88A 4JX5A 1FKWA 4TTUA 1QI3A 4Z1DA 4TMCA 4LH8A 4LF1A 1W2PA 3BJSA 1O5KA 1WUFA 4JTGA 2WZMA 2NUXA 3CL7A 4ZTYA 1V8EA 5DMYA 3WQGA 3ES7A 3UT0A 2DZXA 2EJ1A 1GOMA 1ITXA 4AHOA 2V2DA 3N12A 1BG4A 3NZPA 3E5BA 3TYZA 1J10A 7REQB 4XZIA 1M41A 5BXTA 1SJBA 4JS3A 1V7YA 3QEZA 4OGZA 3G3MA 1UB3A 5F4WA 3OW1A 3R4IA 3AHXA 5J5DA 2BV9A 4PMQA 5EPDA 2FZNA 3POCA 4LGXA 4CUCA 3EDFA 1I0DA 1JR1A 4L56A 3UPWA 1OD8A 4JQ3A 2VZOA 4PMOA 2PTYA 2XM2A 1OK6A 4D6GA 1K9TA 1GQIA 2OB3A 1KQZA 2WO5A 1OZMA 5CEWA 4H7VA 3ZIZA 1I6NA 1R7AA 5D9MA 4IPIA 2RDUA 5BU6A 1G5AA 5TAOA 2ZUTA 4O1DA 1CGYA 3LDVA 5CPSA 3CHCA 3WQCA 5AY7A 1A3HA 1GUVA 3DFHA 3QLDA 4DF1A 4RXGA 2OR2A 1KXTA 4K36A 3AIQA 2GK1A 3VPLA 1VFFA 1AQMA 3MWCA 5I3GA 3LQLA 3W53A 3NEHA 3RMEA 3EA3A 4FX8A 3CUZA 2PTWA 5HNNA 4UMAA 3GXNA 3QZ6A 3QSRA 3ZR5A 1XRFA 2ICSA 4AYSA 1E6RA 4JTQA 2W0UA 4H8HA 2OPJA 1OC7A 1DEDA 4IGHA 4OTKA 1ZS2A 1LL7A 3TN3A 1X1NA 2QCNA 3GW3A 4CU7A 4OE7A 2F61A 1CTNA 5HNTA 1Q6EA 1JUBA 4GRSA 3DU0A 3UBPC 2HMCA 4FO4A 1EGVA 5HJXA 4MY9A 3TU9A 5H1WA 2CWXA 4HU0A 4J9JA 3I3BA 2WK2A 4H01A 5GJPA 1G01A 4UB9A 2VCBA 4ML4A 1GG0A 1FDYA 3WD1A 2VEIA 3AS0A 1TX0A 2CCRA 3CQHA 1SZEA 2V9DA 1D3HA 3MUIA 1KW1A 2XISA 3VD5A 4IF2A 4OFCA 4GZEA 4RNHA 4FIRA 6ENLA 1GNXA 4ORIA 2PBOA 4CU8A 1XRTA 3WLJA 3PG8A 4B3LA 1ZP4A 3N2XA 1U1UA 5HWNA 3R94A 1KQYA 1E4IA 3IS4A 4XAPA 4OUEA 4RV3A 2ZCGA 3WJWA 4CQBA 1T7LA 4AXKA 4R5EA 1HTIA 1XSIA 4PN2A 3M7WA 4PR4A 1J2BA 1YPIA 2DV0A 2E1DA 2OXNA 5BMWA 3T0BA 3WY1A 1MFVA 3SFKA 3T05A 1VP5A 2J25A 4NI8A 2E4TA 4GX9A 3DHUA 3CC1A 3CL8A 1KLZA 4JFVA 1E1CA 1ZAIA 4LNCA 2VC6A 5C54A 4IX0A 3W7PA 3KL5A 3PWGA 3ABRA 1P0NA 1F07A 3Q45A 3VKKA 3MY9A 2BTMA 3AXHA 4J3WA 3WLHA 1NELA 3UG8A 3NGFA 3DCPA 3AIBA 1OT1A 3UESA 2C16A 3VC6A 5LNSA 4YTRA 1VH7A 3KFTA 2XFYA 4C6LA 3IRDA 4LB4A 1ALDA 2VWTA 3W1NA 3VNJA 1SZGA 4J3XA 1BQGA 1GWJA 3TZFA 3EWWA 4NKCA 1JPDX 2E5DA 3GBEA 1DE6A 4TQTA 3NCOA 4BF7A 4H1ZA 5GNYA 3KDOA 3CAWA 2PSNA 3CHVA 1GPWA 1MRQA 2PBGA 5DT5A 5IXEA 1JCMP 1Y5WA 4E8GA 4OOUA 2ZQ0A 1CZ1A 3BGAA 1LORA 4IPNB 4HA4A 2WCSA 5A6LA 3PZIA 3LGEA 2XJ7A 2X0YA 2CERA 2ZZ7A 3S42A 4E38A 2UZ9A 3GG7A 5H91A 1RCXB 3LS9A 4MZ8A 3PBUA 5HBFA 2P3EA 5AKQA 3M6DA 5HMFA 4GC3A 3QTGA 4Q8PA 3ZSSA 5K9XA 2GWNA 1DJWA 5D09A 1JZ4A 4HMCA 1PIGA 3DI0A 4HTBA 2FJKA 3TN6A 4D8ZA 2P10A 2FPYA 2NXGA 2GJPA 4AZIA 1W0MA 4JYEA 3A4JA 4K38A 3S5OA 1PUDA 1Q4WA 3OB8A 4WDUA 4AD0A 4TXEA 4WZHA 1FWSA 2J8GA 1DWHM 2DUXA 1ENUA 2PU0A 4M82A 3W2KA 1WPCA 1B5TA 4F0RA 1QI5A 1UBPC 3K5XA 3UJ2A 2H3BA 3B9DA 1XC4A 3LMYA 4Y8EA 5DBTA 3SZ8A 1EL3A 4O28A 4CD4A 4Z1YA 3IUIA 3RX2A 2BHYA 1AZ1A 4RE2A 2Z24A 1KR0A 1H51A 3HPAA 2VDGA 3SGZA 1CGTA 1QU4A 3WQ5A 3FSTA 1RAKA 1XM3A 2CITA 3QXBA 1DP0A 5A2BA 3A13A 4GVIA 1EXBA 4W93A 4TX9A 4WCJA 3KE0A 2QCFA 1JNEA 4BI5A 1ZPTA 3MV01 2Y24A 5E9XA 1EPXA 5HAOA 1H1ZA 3C86A 2CKSA 4UIOA 1WV2A 3DFYA 3BH4A 3O6DA 3WUFA 3C0LA 3B4UA 1JAEA 2IS7A 1PYFA 4INFA 1UKOA 1FKXA 3WNPA 4MY1A 2GDQA 1VBGA 2YGYA 1OYAA 1K6WA 3THAA 3WBYA 3N17A 5CGTA 1K8YA 1XSKA 3QR3A 1H7RA 1HKMA 3H7VA 1M53A 4LYRA 3V16A 3LRKA 1CGVA 3OU8A 4NUWA 1NWTA 1VLIA 4KEVA 1TZ9A 4TU1A 5CC3A 4HMEA 1M7XA 2QAFA 4UTTA 1O94A 1EC8A 3VZZA 3WQEA 3WL1A 2DT3A 3HOJA 3BGGA 3I3DA 2OO0A 1R3TA 4FHAA 1B3OA 4KCTA 1XWYA 5AHMA 3CYJA 3WELA 4WQ6A 3M7SA 4MUZA 2J7DA 3CT7A 1WQ5A 2WHMA 2XIBA 2ZVIA 4QCFA 3FA5A 2HNEA 2E3ZA 3K8LA 5CZ0A 2GGIA 2YCKX 4PGLA 3LD5A 1H2JA 4YPJA 1PZ1A 1Q45A 1JYVA 2FFIA 1AUSL 1IXPA 4DB7A 3R8RA 3CTTA 1Y5XA 1W5MA 3UFYA 3R0UA 2V30A 3GTXA 4S39A 3S9YA 1U1HA 1W1YA 1EP1A 2BY1A 3IEBA 3V5OA 4ICNA 4JOMA 2Z1KA 2CNCA 1YYAA 4I5UA 4AX7A 3A9BA 4D8LA 1K7XA 1VQTA 3UWWA 2WPGA 3G8RA 4PB4A 3MWAA 4I9AA 2QCEA 4Q8QA 3W7GA 1Z8AA 1TRDA 1XC6A 5I79A 3OG3A 4HNLA 1DYSA 3W73A 1MEHA 1K77A 2DT0A 1E5NA 1N8IA 4J2MA 2WCGA 4RDYA 2A85A 1NP2A 3PBWA 2GGGA 1R0MA 5HPCA 4UTWA 2V0TA 4QAIA 1E4MM 6TAAA 2D0FA 4I7WA 4LBRA 1WZLA 3QVQA 4FF7A 2ZKMX 4IMDA 1PCWA 4URIA 1PX4A 5IHRA 3EOEA 2OCZA 3C61A 3LPFA 4WY0F 5J04A 1Z32X 3W70A 3L0GA 3TSBA 5FL0A 4CQ8A 1XYBA 2R1NA 4ADUA 3M0JA 3DN5A 5A94A 3GYEA 5D2WA 1AH3A 2VRKA 1KWKA 3IUHA 1HX0A 4KKXA 4BQ2A 4DBSA 3H24A 2QCDA 1Q6DA 2KX9A 2NXHA 2PUZA 4O1BA 3ZO9A 4NZ4A 4KFNA 1O12A 1BQCA 3QF0A 3ARQA 2BXYA 4P7LA 3HURA 2QIIA 3FJ6A 1TQJA 1K70A 3JS3A 1BLIA 3RR4A 1GW9A 3LGDA 4F48A 3L4VA 1PSCA 1JGMA 1NTHA 3LXAA 4ZOEA 4XUGA 5GJMA 3EPMA 1EJUC 4AY7A 2Y7GA 3M43A 3VVGA 4D6FA 4R33A 3RCNA 4W7UA 1WDSA 3UVIA 5KZ6A 3QN3A 5BNKA 3BSMA 3PANA 3S8HA 4KESA 2BGNE 2AL2B 5HA7A 1YBQB 4YTUA 4NY2A 3U9IA 3ARSA 1ZJAA 4F66A 4PBEA 1R2TA 2OEJA 1E73M 2FHCA 1VHCA 2PZ0A 2PMQA 1MDLA 3OG2A 4NJIA 5K4XA 2R1KA 2VX4A 2XVKA 1OHLA 1Q8JA 5FSEC 4DZHA 5FACA 3EEGA 3W02A 5CBIA 2WW5A 2WLZA 4PUDA 1B2YA 2P1FA 1PIFA 3GK0A 1WXJA 1QK2A 1C8XA 2FZ9A 4KWWA 4W7WA 4HA0A 1VHNA 2JIEA 1X98A 3WLLA 4IG2A 1NARA 3UVAA 1AMKA 2DY3A 2B4GA 1XG3A 3AIVA 2GJNA 4TVUA 5CC7A 3QR0A 1RLCL 4RW5A 2HPIA 3WDPP 1XF0A 5A8MA 1ZBKA 4ZB2A 3VKDA 2QS8A 4C6MA 2XYLA 2CZ5A 3GSMA 3WH6A 1J0HA 2YR1A 3CZJA 1BTCA 1LLOA 4HOZA 2WNQA 3I7RA 4XZBA 2C6QA 3KBMA 4AH7A 1NAL1 4M3PA 2DZBA 3IGHX 1UP0A 1UZDA 2PTXA 2PGWA 3CO4A 4XTDA 5LKYA 3APTA 3HM7A 4JKKA 1VCVA 2WSKA 1TTJA 5H8MA 3LHUA 1OABA 1W3KA 2OOGA 4JYDA 3EWCA 1ZGDA 4PODA 3SJ3A 2WZEA 3GZAA 2J7HA 1DIDA 3NA8A 3DFPA 4H9MA 3W86A 3P82A 4NZ5A 5FL1A 3TMQA 1TTPA 3OP2A 2XU2A 1TPC1 3BDKA 1EDGA 4FP1A 3CAKA 1V7AA 4JL2A 1XX1A 4DJDD 1E0XA 5AC5A 2VC9A 2CZDA 1E0TA 5IM51 3TA9A 5AYZA 2HPMA 3MANA 2OX1A 4O57A 1J79A 3F4CA 5CG7A 1RJPA 1H09A 1XGEA 3I7QA 4P7RA 4WKFA 2R94A 3OLEA 4YHGA 3ZVHB 3G1SA 5A6KA 4XV0A 2P88A 2PDQA 2FJUB 1PV8A 3WH8A 2A21A 3MUY1 1UPMB 3EX2A 3WFZA 4XB3A 3MW7A 2YA0A 1KM0A 2A3LA 2G96A 2X1TA 3N4EA 3DC0A 2G5WA 5A8OA 1DE5A 2XSAA 5XIAA 2VTFA 2PDLA 3VOGA 2YL6A 2FVMA 3VMNA 2I17A 3VNMA 1LOSA 3SQMA 2Z1SA 2QULA 4D6EA 4R9OA 5D2TA 1XHGA 1W32A 3GTIA 4MJ2A 5CZKA 2EBNA 3VM7A 2DUZA 1W3JA 1LBMA 2C8NA 2DSZA 4KQNA 3DIPA 2GPTA 3A3XA 2NX3A 2XIMA 4UFIA 3KHDA 2AQWA 2ON3A 2CXEA 3TAKA 3PZVA 1VBJA 4Z2KA 2OWXA 1GW1A 3G1AA 4U10A 2AMXA 3TIMA 1KCZA 2ZRXA 1QAPA 4F0HA 1QVBA 3GTHA 1VF8A 2BSLA 2A1YA 3IJ9A 7TIMA 2Z1BA 2HZGA 4KW2A 1ZAHA 3WDIA 2NV1A 4WY0A 4HYVA 3S2NA 4O8AA 4TV6A 4J3SA 4JHOA 5U4NA 4ZENA 4PEEA 3WG6A 1RVGA 3O06A 3D47A 4HPNA 3DKJA 3EMQA 4KIRA 3UCQA 5F7UA 3WQPA 1N8WA 1FWCC 3JZEA 5JU6A 1DTUA 4OZOA 3L7RA 1BTMA 1U5VA 1GPFA 3SUSA 2A79A 5J5RA 3HN3A 3VGFA 2PI6A 3VCRA 2NT0A 2QCGA 3K2GA 3O63A 1H63A 4JEJA 1DWIM 1MXGA 3W74A 1J9YA 3SADA 3E0IA 5CXPA 3BOLA 2QDEA 1GVOA 3CUFA 3SCQA 5BOFA 4PMXA 3WQWA 1GYMA 3QGAC 3HG4A 3L4TA 4MF4A 3VNLA 2Z2BA 4RR4A 3IJ6A 1ODUA 4C1NB 5D30A 3QOMA 4JCLA 4NQ1A 1CI1A 3C2EA 3CV2A 4Q8WA 4ENLA 4GH3A 2XFWA 3ZWSA 1MW0A 3M9YA 3AMDA 4NNBA 3A3HA 4PL1A 2SFPA 3S5NA 3VIPA 1SJDA 1S3HA 1V4YA 4S3EA 1RHCA 2D22A 1J8VA 4RXFA 3V5CA 3VMPA 1GG1A 2OT0A 3LTSA 4J3TA 5TF0A 2QR6A 4K2SA 1FOBA 3WQ4A 3FV9A 4E2BA 4FSAA 2V69A 2EGZA 3ITYA 4LALA 4IIEA 1BXBA 4DJDA 2Z7GA 2DVXA 4J3UA 1AODA 5K9DA 1JZ5A 1WX0A 1Z7AA 1PZ0A 1TCDA 1BEUA 4UTMA 9CGTA 1XYLA 3DDMA 5C9WA 3KCJA 1A3WA 1SFTA 3BJFA 1EJWC 3A6OA 3ABZA 5AHIA 2VL4A 4QSFA 3M0VA 1XFBA 4PTXA 3WUGA 1JL8A 1UROA 1DIKA 4R3UA 3S1GA 2PDNA 3BAKA 2YFNA 4YMZA 5LGXA 2PDIA 1X6LA 3LYEA 4YHEA 2ABAA 3S0CA 2V5CA 4MKVA 3VE9A 3SIZA 3LTYA 4IGNA 4OU1A 1K9EA 2IKHA 4L6OA 4JFUA 1H11A 2AQOA 4LUJA 3L2IA 1B3XA 2VD9A 2ZRVA 3QV6A 1XLEA 3AS1A 3SRDA 3ZJKA 1X39A 7REQA 1OCNA 4R53A 5CPMA 3SCSA 2XPKA 3WX7A 1EBGA 1DTNA 4Q8OA 4OBSA 4E3TA 4F0SA 1A0EA 3KOYA 1EX5A 3AYTA 3BZGA 1WUEA 4MSSA 4FOKA 1ESWA 3PPGA 3TW9A 4EF9A 1IGWA 5F2MA 1ISXA 1YPFA 1R6WA 4FLRA 3WLOA 1LRTA 4LOCA 3UZZA 3UZYA 2I14A 2Z1VA 3LV5A 3W76A 4IIBA 3ANUA 1UH3A 4BQ3A 1Q85A 1R3YA 5GPRA 4A2SA 4CQCA 5FEZA 1A50A 1RVKA 3PWAA 3NUKA 1ICQA 2FTPA 2UY5A 2F38A 4RLIA 4CNSA 2PWEA 4J2PA 4MJZA 1RALA 2O9TA 3H55A 1UD4A 1O7AA 2R6OA 1PKNA 1XD0A 3KL0A 4XISA 4LXFA 1ELSA 3UETA 1E55A 5BXRA 5A8NA 4IP5A 2YL8A 4QNWA 1XDMA 1GJPA 3PP7A 4NZ3A 3ITLA 1QHZA 1GEHA 5M17A 3CPRA 1G4EA 1G67A 3R2GA 2IKIA 4S3KA 4JTJA 1XPYA 3AZSA 2PPGA 2C14A 1UUOA 4JTHA 1DXEA 3WDHA 1Z69A 5FJRA 2CLOA 3TXVA 4GO8A 2V3EA 1R8LA 2VGGA 3OOQA 5A8QA 2NSOA 4WGXA 4GVHA 3VDBA 1H1NA 1RCQA 3VFLA 3WENA 1O1ZA 3COTA 3N73A 3ZJ7A 4U2YA 2Y6ZA 2PGFA 4C6CA 1B4EA 3UR8A 2G3FA 2XVLA 1N82A 3NZGA 3MO4A 3GNPA 4ZE5A 2PF0A 2GVEA 4ZO6A 3TV8A 2VEFA 3PG9A 1ZBVA 4GUJA 3OLDA 2QCHA 3HGOA 3PB0A 4C6IA 1RQHA 2EPKX 3URQA 4S38A 4G7EA 3W0KA 1H5VA 4LY8A 3H70A 4AF0A 3L5MA 2DSVA 3W01A 4TVDA 2Z2AA 3NZ1A 1JRCA 1KKRA 1V3MA 1GQNA 3ZOAA 1QOXA 2FLIA 3MU7A 4D6JA 4FXFA 5FF2A 4LT9A 3JZUA 3ZVIA 1VYSX 2Y7EA 2YOCA 2F8QA 4J1OA 4LS1A 4AZ6A 4NZFA 2E6DA 1I9CB 1H62A 3FYOA 4C1KA 1EJSC 4X63A 1DWJM 4JIRA 2WC4A 3BG3A 1XQKA 1HKKA 2R1LA 2PB1A 2Y85A 3N3MA 1XBVA 4TOQA 1HVXA 2J7EA 1KV5A 4QDPA 3UGRA 3LOTA 3TTQA 1RQBA 3TOPA 1QPRA 3KZSA 3QBUA 1D7KA 1U5JA 3E2RA 1AW2A 2ISDA 5ABHA 1XH1A 3M16A 4M29A 4OVXA 4GABA 2OKTA 4GC4A 4RW3A 3AXIA 4LVAA 4QEEA 4HNUA 5TIMA 3AYVA 5EMUA 1JULA 2XIOA 1CB7B 4U28A 9XIAA 1QO5A 3VOHA 3G3DA 4PTVA 2ISFA 2DFAA 3AROA 2QF8A 2V5KA 5C9ZA 4PMDA 1V6VA 1PVNA 1IV8A 4Q8VA 4O1EA 3OHMB 4H2CA 4XD6A 1VJZA 2ZX9A 3BK0A 4PUKA 3GDRA 1ZJHA 3CLWA 3FEQA 6XIAA 2OLAA 3PVFA 3VFCA 2XIJA 4JQ4A 4MDOA 2H6RA 3N19B 3PBMA 2Z1XA 1TRIA 3ONBA 1I2RA 3HG2A 1OCQA 2EG7A 3NAVA 2VX6A 5C2GA 4AZCA 3ITXA 1A5CA 4R7OA 7ODCA 1REQB 5D33A 3NJ3A 5EB8A 4W8LA 4CCZA 3MZNA 4LW7A 4NAEB 4ZB5A 3PNUA 1YLVA 3NSMA 1GJUA 1A5UA 1IR2A 4G9PA 2Y8VA 3DHDA 3H2AA 2VI0A 1F3TA 3LHYA 4W9TA 4HU4A 1IWBA 1QW8A 4GJ1A 1BRLA 4M6QA 4AU0A 3CNYA 1LZOA 2HS6A 5I23A 1K02A 3QRHA 4DJFD 2ZIDA 3D0CA 1QPKA 2PURA 4HNOA 1US2A 4I9MA 5GVJA 1UD5A 3HV8A 3BUVA 5DQPA 4K8GA 3VX0A 2F84A 2RDWA 3HPSA 5CQ1A 1VPQA 1MQQA 3Q58A 3GXMA 3EOLA 2YBUA 4HHLA 1NFGA 3PY2A 3VYLA 3QGKC 1DXIA 3P5YA 4IX2A 4GO9A 2YBTA 4IISA 1ECEA 3WF2A 3MA8A 3W81A 3L5LA 4LAUA 8XIAA 4NJKA 1TTQA 3NSNA 4FA3A 3IGXA 2R1MA 5F2IA 1QPNA 3LU2A 3BOXA 3G8EA 3LXBA 4H6KA 3N2TA 1JXJA 3N2MA 4LRTA 3N2BA 5CG0A 3UJSA 3SO7A 4FIQA 3ZM8A 2PS2A 5CBJA 1VENA 2RH9A 3KBVA 4Y9OA 1BHGA 1XGZA 4PMZA 3CH9A 3DHFA 3MO7A 3AWNA 2GFTA 5HNRA 2ZBTA 4DBDA 4JTSA 3THQA 1XIBA 1BWLA 5AHFA 3SCWA 2QJJA 3AIRA 4GYJA 2OOFA 1WDRA 2Y5EA 3MUAA 3W83A 4IOTA 2XIIA 3H6OA 1TZ7A 4ZMGA 4KGLA 1J12A 3LM7A 3ALFA 3S2JA 4RK8A 4IMFA 2OZ8A 3PTKA 4CQAA 3AZTA 1HUVA 3C2VA 4QG8A 2LLEA 1IEXA 3B97A 1ZUAX 5BWFA 5H6HA 3UU0A 4ATLA 1LQ2A 3MSYA 4UFJA 2QPUA 1ADSA 4UR8A 5BXPA 4J4KA 3ITGA 3HGSA 1VFSA 4FALA 1R9ZA 2DH3A 5H8PA 1HIZA 2HJPA 5HINA 3UCDA 4JHMA 1R46A 3E0LA 2WC3A 4D8AA 3NQCA 1L8PA 4PUWA 1IEIA 2C91A 1HP5A 2VFIA 1L0PA 2WVSA 1QMLA 2PDPA 2J7CA 4IWWA 2GQ9A 1L6SA 1GOQA 4RPQA 4DXVA 4DF0A 2GGEA 2WKGA 2OTDA 4ZGYA 1XLIA 3RCMA 1OF6A 3ZJ8A 3CS2A 2OYMA 4UTTC 3OQEA 4W87A 2HVNA 4NYUA 3NFUA 3AUJA 1PTDA 4A35A 5DX7A 1CXFA 3H2FA 1WNOA 2VQUA 4OOZA 1OYCA 2WOQA 4GA8A 3WLKX 1ADOA 1WBJA 3PR2A 5LIWX 1SJAA 2NUWA 5D32A 5HJLA 1HVQA 4ZO8A 4J7RA 4GIYA 4ORMA 1OY0A 3PJXA 3ZSTA 2WWCA 3GNDA 3AAMA 1OFAA 4LB3A 4L4LA 4US6A 3RU8X 3W22A 3R8GA 1DXFA 1E51A 1W9XA 4CNNA 4RJEA 3MCOA 2XZ7A 3E38A 1GQKA 4BWLA 3RDKA 4JICA 2O55A 2JF7A 3L0KA 3WF4A 2VHLA 2PDFA 3B40A 3WH7A 3R0DA 3IJDA 4NIRA 1P0BA 4CEXC 2I5IA 4K1WA 4A3YA 5FSDC 1KFWA 1XIJA 3BOFA 3GKAA 4KS0A 3J7HA 1V0LA 1OC5A 2TODA 1LUCA 3AXMA 2GVYA 3P14A 3LLDA 3NPUA 1PTAA 1VBUA 5KTLA 3T0TA 4DELA 4C7FA 3BLEA 4CD5A 4JEQA 1PIIA 1ICPA 1FDJA 5F2LA 2B7OA 2HE5A 2GJXA 3ARZA 4U3AA 4QDMA 1BYCA 3W1UA 4ILSA 2A3AA 3W71A 2QCMA 4UTWC 1F4AA 1XCXA 7ENLA 4UNKA 3G6MA 2WVUA 2Z26A 1LQAA 3N9SA 1OT2A 1TPUA 4ZVJA 3IANA 1VPYA 5A6AA 3ZT5A 4DXKA 5C55A 4NJHA 3UY8A 1I0BA 3L66A 4KEZA 1W1VA 4BFAA 4NILA 4GG9A 2G50A 4QJ5B 3EA1A 4GZIA 4N0RA 2ZUVA 3G1VA 4EPDC 3GVRA 4CCEA 2BFGA 4GBDA 4KCUA 1V02A 3IJLA 3F2CA 4HNNA 4IZGA 2YXOA 5LIKX 3KCLA 4GLEA 3ZLGA 1MZRA 1KM4A 2BOEX 1GKQA 3W1LA 2OQHA 1CGUA 4G6CA 2X2YA 1U83A 5M5DA 1PAMA 4LSBA 4QLJA 4GIEA 3ZZ1A 3WLRA 3TW6A 1EOMA 4RE3A 4IUGA 1C92A 1VIZA 1NM9A 4GQGA 4M1BA 3KEHA 4P61A 3HGRA 4HBKA 2XGZA 2XFRA 1JCNA 1HJXA 2EPNA 2GK1B 3CQJA 3EA2A 2OVLA 1C9DA 1RUSA 1NY1A 3W88A 4TX6A 3DFTA 3ITOA 4KERA 3QSTA 3ABXA 1FBAA 3TTOA 3LPGA 3T4WA 2R1PA 1EWEA 8CGTA 2VEMA 2Y5JA 1SR9A 1UPPA 2O7QA 1I1WA 1XH0A 3P67A 3H2EA 1UIOA 2ABBA 2BHZA 4XZHA 3ZMRA 5A2AA 4MDPA 4NASA 2GJLA 1YXDA 4GY7A 2V6AA 1QNRA 4CN1A 1GTHA 1BWVA 5CJ5A 3A47A 3E96A 5TBOA 4ECLA 3WK0A 3G24A 2PC8A 4HNCA 3H2MA 2J7FA 4ZQNA 4FS9A 3TC3A 2GUYA 4WF7A 4AWUA 4UR9A 3GUWA 5I03A 1HJSA 1SJCA 4Q7IA 3A4AA 3WLSA 1HF6A 1KBLA 1CCWB 2XVPA 3MUXA 2VDIA 1ZJIA 4RNFA 5FI8A 2FZMA 1UKSA 4HU8A 3T2QA 3LHZA 2VURA 3LXCA 3EAUA 4S23A 2W4XA 3INPA 3DERA 3UXKA 4WEVX 2DZSA 4G2DA 4L1XA 5PTDA 1A5LC 2GSJA 1XDJA 3GR4A 2Q8LA 2X42A 1XS2A 3CWHA 2Q01A 5G1MA 5DXYA 1A0DA 1OFEA 4UFMA 3U2ZA 4HPGA 1E1CB 3EMZA 3BLIA 2E8YA 3I4KA 1BGGA 3LA4A 3GS6A 3WMSA 1X7FA 3PAOA 3CHDA 4FR6A 4IMAA 2ZTJA 4MPQA 1EF2A 4Q4KA 4OBTA 4FMVA 5K9CA 4MB5A 2DSUA 2PLKA 3EB3A 1YDYA 3THDA 4CQ9A 4KCVA 3FXYA 5M2FX 3SN1A 4IJCA 2ATMA 4JTTA 2C0HA 1JFHA 1FHLA 1KCLA 1XIDA 3S6OA 3KHJA 1E3XA 2DZAA 1F9CA 1OADA 3NDZA 1PWLA 3PM6A 4W85A 3W7KA 3EDDA 4R27A 3AHZA 1NQKA 2OMAA 4GCAA 2VEKA 5EA9A 4LS2A 3T81A 1RP8A 1TG7A 3ZR6A 4JFSA 1DJHA 3WNLA 4B15A 3TC6A 1VZWA 1XUUA 2P0IA 1WZKA 5C2XA 4ZE4A 3TSDA 3ATYA 3G22A 2QGHA 3P0XA 4FLQA 3CMGA 1F6PA 1TPB1 4AISA 4I9JA 1E40A 3OGRA 3EWYA 1B3WA 4WJ8A 3D5HA 3M0ZA 4DNHA 2PTZA 3NQGA 1WKYA 5F1VA 4K37A 3TN5A 3UG4A 1GZ1A 2HQAA 2GQAA 3GHUA 4HHPA 5C70A 2Z4GA 2YL5A 2IPFA 2G97A 2JEQA 4CD8A 1G1YA 4CVWA 2VR2A 1W56A 3F4WA 1KKOA 1FTXA 1TREA 1YMYA 3M46A 1VAHA 5A3HA 4C5ZA 4H6RA 2BS9A 3AJXA 4BA0A 3UR5A 4EE9A 1EJVC 4UZSA 1TR9A 1MEIA 1E72M 2ZZ4A 3NQ6A 1K8ZA 2HK1A 3S2MA 2ZUWA 1QI4A 3C3NA 3P81A 4ZOBA 1EF3A 4GY0A 1ZTVA 2J6VA 5HUOA 3QQ1A 4IMCA 3HA1A 3MTWA 1YDOA 4PRRA 3WEOA 1EZ2A 3DHPA 4YCPA 4LYKA 1B30A 3FW6A 1W54A 4HP5A 5E6ZA 3HQOA 3EBVA 1QOPA 3F4VA 5DY2A 3NQFA 1JI1A 2HISA 1YNYA 1E43A 2ZWZA 3MI3A 5G1TA 2WJEA 2PRLA 2VZVA 2ATSA 4O1FA 3IV8A 1BF6A 5LYRA 3T09A 4LVFA 2ZC1A 1UH4A 3UXIA 3TWBA 4JIEA 4QQ3A 3QHMA 4ZXLA 2UV8G 3QZEA 2WVTA 5CBBA 1DHPA 2YA2A 1WO2A 2XSXA 1W9DM 3W7IA 5I6SA 3E49A 4B2DD 4L4MA 2QJIA 4HSNA 4LYPA 4IFKA 1F6YA 4NYYA 2E40A 3GC2A 2P76A 2PAJA 3W1XA 2V5BA 2VC7A 2V5DA 1EGMA 2PDCA 2DZVA 3SRKA 1YNPA 2PDHA 4NNAA 1AW1A 4E2OA 3WBWA 1R38A 2KAUC 3WEZA 4GI4A 1YTDA 4U31A 1WZMA 3GXIA 1JCLA 3MZ2A 2IQDA 2HE8A 4YNGA 3C56A 5M1TA 4XO7A 2R14A 3DX5A 4WKHA 4JN7A 4P8UA 3LCHA 1PX8A 3CZKA 3K4AA 2WSPA 3KW3A 1O5XA 1A47A 4EAMA 1M7OA 3P0WA 3GXTA 4JX6A 4RZ4A 4WLCA 2E8ZA 1UG6A 2UBPC 4GYPA 2W79A 1FCVA 1ODZA 3O05A 1R2SA 1HKJA 3MS8A 4HGXA 3AU2A 3ARUA 2X09A 4DJDC 5MHBA 1RBOB 1Q13A 2W9MA 1J93A 5AHEA 2A0NA 3NOEA 4UFKA 1EX1A 5ABFA 2XH2A 3TONA 1C8YA 4PMJA 1XCWA 1HXJA 1GK8A 2PWFA 5CZSA 1I8JA 3HG3A 2NUYA 4JD4A 4RKAA 2WBGA 1M5WA 1XQLA 4MJ4A 3B8TA 4B5NA 1QNPA 2AGTA 4BEQA 5I3FA 1E1EA 1SSDA 3RNDA 1LYXA 1D2KA 4PULA 1ZY9A 3TYCA 4XKYA 4HPHA 3MVIA 3XISA 2A3EA 4S2BA 2F6UA 1H7XA 4PZVA 1BG9A 3ALGA 3G77A 2E5BA 1G4TA 2CC0A 1GVQA 4PMRA 3PZOA 3AYRA 1QOQA