3H2NA

Structural studies of pterin-based inhibitors of dihydropteroate synthase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
273
structure length
265
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFGSYNEVDAAVRHAKEMRDEGAHIIDIGGESTRVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies of pterin-based inhibitors of dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis str. a2012
molecule tags Transferase/transferase inhibitor
molecule keywords Dihydropteroate synthase
total genus 92
structure length 265
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3h2nA00
3MCMA 1Q8AA 4C1NB 3H2FA 2BMBA 4DJED 4S3AA 2DQWA 1TX0A 4HB7A 2Y0FA 3H2AA 5JQ9A 3H2OA 3H21A 2YCJA 4DJDD 4G9PA 4S3FA 2DZAA 4D9PA 4S23A 4DJFD 2YCLB 4S39A 4DB7A 3TZFA 4PZVA 4S3EA 2VEGA 1Q7MA 4D8AA 3H22A 4MWAE 1AJZA 3TZNA 3TYCA 4NIRA 1Q7QA 4DJFA 3H2NA 1F6YA 2Y5SA 4DJDC 4S3CA 4O0QA 2DZBA 4DAIA 3TYAA 4MWAA 3H2EA 4S38A 4S3DA 4S3BA 4DAFA 3TYDA 3NOYA 4O1EA 4DJEA 3BOLA 2YCIX 3V5OA 3H26A 3H24A 3MCOA 3TYUA 1AD1A 3TYZA 1AJ2A 4NILA 2VEFA 4NL1A 4O1FA 2Y5JA 3BOFA 4DJFC 4D8ZA 3TR9A 3H2CA 1EYEA 2YCLA 4DJEC 3TYEA 1Q7ZA 2OGYA 4MWAC 4MWAD 4C1NA 1Q8JA 4DJDA 1TWZA 2E7FA 1TWSA 2YCKX 1AJ0A 4NHVA 1TWWA 2VP8A 1Q85A 1AD4A 4MWAB 3H2MA 4CCZA 3K13A 3TYBA 2H9AA 1TX2A 2H9AB 3H23A 3MCNA
chains in the Genus database with same CATH superfamily
3RN6A 4KFOA 3E0FA 3QV6A 4HHHA 1MSSA 2FJKA 3VUSA 3H4WA 5E70A 4EK7A 5JQ9A 1KV8A 3FX4A 2R24A 3B06A 4HN4A 2UWFA 4WIWA 1UCWA 3R10A 1DHKA 1AUSL 3W74A 5FJTA 5GJNA 4EKJA 1W1VA 1XDJA 1J0HA 3VIPA 1PJ9A 4BF9A 2XVPA 3Q2DA 5FJRA 1GOXA 4PB5A 2ZRUA 3HMJG 2O7SA 1JDCA 4GH1A 4NYYA 3KBWA 1QO5A 4PEEA 3DHDA 5C7HA 3FXGA 3OQ8A 1JCLA 1W1ZA 4IISA 3PBYA 1E6ZA 3SY5A 1XXXA 2FVMA 4M6QA 5K7JA 3QV8A 1V7AA 2UZ9A 3GR4A 4FZIA 2I1OA 2G97A 5EMKA 4IH3A 3A21A 2PU0A 2TSYA 1C9WA 1V77A 3E2SA 7TIMA 2XSXA 2BY2A 3M0ZA 1UUOA 4E4PA 1CGUA 4TO8A 4M6PA 5JU6A 1X39A 2CU0A 2F9RA 2Q09A 1XRTA 3NZQA 1R3WA 5HDRA 4NZJA 5DCEA 5CGQA 4N9EA 5E0CA 3BZGA 2ZZ3A 1MQQA 1B9BA 1IZJA 3VPLA 3GH7A 3HURA 1FFRA 1RBOB 4I5RA 4FXJA 4PTDA 4CD7A 3AWOA 3QW4B 2YCJA 3VTRA 1V03A 3T4WA 1W9DM 4RZBA 2FTPA 4HU0A 3N15A 3PUGA 1VFLA 3EGJA 3H7RA 4Z0JA 3C2YA 5FOOA 3L0KA 1PDYA 1XSIA 2GGIA 1KB3A 1V08A 3NQ2A 3BCDA 4NSBA 3PZMA 4GGBA 4S3BA 5CZ0A 3KUMA 4PODA 1R6WA 1JYWA 4YIWA 4RZ5A 5JBDA 2YXGA 1ZBVA 1KM6A 1OJXA 1FCVA 1V93A 1JDFA 4ZZ9A 1XLMA 3ZXWA 7REQA 3MSRA 1TPDA 4FX7A 4QITA 4W8BA 4O1DA 4U31A 3UG4A 3EB2A 5CBIA 2Q3OA 2RHGA 2J7BA 1WDPA 1RJPA 4MUPA 4UTUA 3ZR4A 5A8PA 3URQA 3U4AA 3W86A 3T9PA 3PY2A 5TQLA 4ZB5A 2A3LA 3DG6A 1XC4A 4Z2LA 1Z9AA 2GUUA 4M29A 1WNOA 2OKOA 3IUHA 4N02A 3WK0A 1R3QA 3U2ZA 4PCFA 2CLHA 3S2MA 2WOQA 4RNIA 4ZO6A 3N6JA 1GYLA 3OIHA 4D8AA 2E6AA 3R43A 5I24A 1CLXA 5D09A 3P14A 4Y9PA 2NVCA 1QPKA 4BCEA 4D6FA 5B7YA 3VYLA 1DIKA 3AO0A 5BRQA 5ABHA 4A3QA 1VBJA 1E4LA 1QW7A 4DWSB 4A3YA 3ZWTA 4QNEA 4ZODA 1OGSA 4B5UA 2RGLA 3UZXA 2NXIA 2FFIA 3V3WA 3AJ7A 3P81A 1IXQA 2OELA 5AC4A 4P5UA 3HQ1A 1XKYA 2XN0A 1PWLA 4HHPA 3HN3A 3VX1A 3QLLA 4LV4A 3UJ2A 3BV7A 1S3TC 2HWGA 2E77A 1XHGA 4JHMA 2WHKA 2XM2A 4C6QA 2E40A 4JTLA 1AA1B 2A5HA 6XIMA 5HINA 2X8RA 3MV01 5H8PA 3GTFA 3DI1A 3UCCA 5IFTA 3LTPA 5FEXA 4JOMA 5ECVA 4LWWA 2WSPA 4UWMA 1QATA 1MEWA 3K4DA 1W6TA 3IJIA 2QEZA 3EB3A 2Z00A 4PUDA 2PLJA 2ZZ4A 5A6MA 3PPFA 1BTCA 4E8CA 1UPMB 1MRAA 1TPEA 2ZX8A 4HMNA 1NJJA 3ZR6A 3LGDA 4FMVA 4FX6M 3ZM8A 4EVZA 2V6AA 2XN1A 3TW7A 3AYSA 3G0UA 3N3TA 4EAYA 4JTKA 2XWDA 3WUEA 2VTFA 4LF2A 5IDZA 3TNBA 4OT7A 1XUUA 2KZHA 3C0JA 3AIRA 5A2AA 3PM6A 3LYEA 4GNKB 1I2NA 5FJOA 2WO5A 3AI0A 1P5BA 3B9AA 2WNZA 3ABXA 2PWFA 1G1YA 1J11A 1P0EA 1P6WA 3W88A 3FIGA 3S2CA 2WW5A 2QUMA 3NPVA 3THQA 4IUGA 3SCWA 1ZGDA 1Q7ZA 2VELA 4GH3A 2EEXA 2XSBA 2W9MA 1IV8A 3L0NA 1NH6A 3FYOA 1KLZA 4ILSA 2CW6A 3W7NA 4PMNA 3CIVA 3VGBA 3L4ZA 1MNZA 2E4TA 1UMYA 1VYPX 4C7DA 3DX5A 3SCQA 4MMWA 1JEZA 2VFDA 5I02A 1M68A 3K1GA 2J8TA 1SM9A 2FB3A 3UPBA 4A8RA 1EWDA 1GOMA 4HMEA 2V0TA 3OOQA 5L6UA 4BWLA 2FQIA 3WQPA 1DWIM 1WZLA 2CLMA 3NQAA 3G3MA 3C4UA 3NO5A 3RMJA 1V0NA 2OOFA 3F2BA 1GOQA 2ZDSA 5M3WA 1BVNP 2R14A 1GZ1A 3CIXA 3UF9A 3RO6A 2VENA 1TTPA 1HJXA 4A05A 4REQA 4KRTA 1OYCA 5HBFA 4DNMA 4KWVA 4JTGA 3CASA 4LOCA 3OGRA 3GDKA 2PDLA 4F48A 3H26A 4P7NA 3E2RA 4O19A 4JFUA 1NFPA 3Q67A 3EDKA 1HT6A 3WQ8A 2VKZG 2Y2WA 1XYAA 5DT7A 1UD2A 3WD4A 3P80A 1UOKA 4HA3A 4JYFA 1JYXA 1HTIA 5LIKX 4JKKA 4CKQA 4TV5A 3IJ6A 4UTIA 2R94A 3OA3A 4QG6A 2JGYA 5EPDA 3AZRA 1E71M 1MQRA 3AC0A 4D2JA 4HZMA 3M6DA 3ABQA 1OZQA 4CNUA 1MUCA 1HX0A 3T8LA 1SW3A 5I06A 1RCQA 4KEVA 3AXIA 9CGTA 3DHUA 4S3AA 1YXYA 2PE4A 2WJZA 2R1NA 4HB7A 4ATLA 3G22A 4QISA 1F4HA 4DYEA 4KCVA 3LEPA 2AMXA 1EJUC 4DF0A 1AQ0A 3W70A 1KFWA 3TZNA 1R7OA 3ALFA 1OEPA 1HN1A 4F0SA 3T2QA 1OK4A 1DIOA 1F74A 4IL0A 3HJZA 2HBVA 3CZKA 3PAJA 3M46A 5HWMA 4XZ9A 4AC1X 2V2DA 2IKIA 1YYAA 2Z1KA 4IICA 2QF8A 1DPMA 4NVTA 1E6RA 2GLKA 4US6A 4BEQA 3W38A 4IUOA 2O9RA 2QDGA 4FR6A 4DRSA 4CU6A 3W02A 2HTMA 3FV9A 1ADOA 2ICSA 4IP7A 4YWSA 3NR0A 1JIBA 2FZ8A 3CMFA 3OZPA 5C9UA 4CVWA 3MHUA 3EDDA 1ZNNA 1AJ0A 1JZ8A 3LSCA 2HXTA 4UOJA 4CQBA 8CGTA 3W1UA 4C6FA 2VZSA 4S3GA 1C29A 4LCSA 3RYSA 1TX2A 1UH3A 1JQVA 4HOWA 3WNNA 4AC7C 1OT1A 4PE8A 3S9YA 1FWCC 2O4MA 2PPGA 3W2MA 3CZ8A 2TRSA 4O15A 2YX0A 4Y8FA 1H0IA 4X3ZA 2VFGA 4GRSA 4XZNX 2A3BA 4CEUC 4EF9A 1O7AA 4DJFA 4I3GA 1Z41A 1E70M 3WQCA 1OHLA 3VGDA 4TTGA 4AXNA 5KZEA 4HKPA 4QXIA 5MF5A 2WZIA 4QNWA 3AISA 5LHFA 5I07A 3EXRA 4LY8A 2QR6A 3AIUA 5XINA 4LCRA 4UTWC 3SW6A 2BASA 1J6PA 3SRHA 2PDYA 2WNWA 1R3SA 2RH9A 1TR9A 4QGCA 3W53A 3SCSA 1XX1A 4GG9A 4MPQA 4XKYB 4PSPA 4IGMA 4WQ6A 3H2CA 2TPSA 3OZMA 3DFNA 4AU0A 4LALA 1XLAA 3LY0A 5AC5A 2YGYA 5T9BG 3N04A 3A22A 3MHGA 4IJBA 3UU0A 1PX8A 3W2UA 1P6BA 2NQJA 3WD1A 1ONXA 4LNYA 5U4NA 1UR9A 1RCOB 2BVTA 3U4FA 1SFSA 4KW2A 2WMFA 1DOSA 3ZZ1A 5AC6A 4E4FA 1S2CA 3EA3A 1BVZA 2VC5A 2R91A 3EEZA 3E3HA 3QBUA 2PMQA 1FFQA 2YBTA 1NAL1 2YA1A 3AJXA 5AYYA 1XF0A 4JIIX 4HJWA 3VOFA 2ZICA 3CMJA 3TOPA 3R89A 4QHRA 1QPOA 4MB1A 4QTGA 3B8DA 3FN9A 3W6LA 1E55A 1QCWA 1YX1A 4HK5A 3O1NA 1UWTA 1W8SA 1E1FA 1UZDA 5DT5A 3QV7A 1VBGA 1XIBA 4YYFA 5FAJA 4H2HA 4L6DA 3VKJA 4XIAA 4D72A 3CT2A 4K3ZA 1MFUA 3WLKX 4XZHA 4M5PA 1HL9A 5HQEA 1FCQA 4QFUA 2HNEA 4RE3A 3TDFA 4IOTA 3WQDA 5EB8A 3GYCA 5F1VA 2VI0A 3CPRA 3W24A 3IRSA 3ANYA 2E6YA 2NVDA 3SSJA 1RQBA 2AQWA 1KC7A 4DO6A 3ARXA 4NAFA 2Y61A 1BFNA 2QT3A 2WNNA 4YNGA 1Z89A 3FYPA 1GVIA 4PB4A 1B3ZA 1JF5A 1JPHA 1U83A 1YPIA 5LNVA 3OU8A 3W73A 1QBBA 5CGTA 4LUSA 2GVGA 2Y0FA 5IRPA 4O54A 2DZWA 3A5VA 1GKQA 4WKFA 3H2AA 1TTQA 3PZNA 1HJWA 4IL2A 3RF9A 3IK2A 1S46A 3MT1A 3N73A 1GYNA 1GVRA 5HAOA 3LZ5A 3SUVA 3QRHA 3GTXA 3ENLA 4CN6A 4G7EB 1OCBA 2O55A 3OA5A 4INFA 1O60A 1JUKA 3ARSA 4XAGA 1VYRA 1SW7A 2ZX6A 3MBFA 4O52A 4V1XA 4HHMA 4ZA0A 3TCEA 4DZ5A 1W32A 3VC6A 3W7JA 3B8UA 5I2UA 3OIXA 4FK9A 3GTNA 5A3HA 1XYZA 2PFHA 3STPA 4B3LA 1RSCA 2OSXA 3QHOA 2QS8A 2VCAA 3NL6A 4C6IA 3I7QA 3RPMA 1BSLA 1LJYA 3UWQA 1XGEA 4RUBA 3N4AA 1FWRA 1NDYA 4D6DA 3W71A 3CC1A 4ZFCA 1JPMA 1SO3A 4FXSA 3UQNA 3M0HA 3VZZA 5FA5A 4XVDA 1RBLA 4RNHA 4UQ9A 2ZBTA 3BAYA 2DVTA 2PZ0A 4B5SA 3CWNA 3VNMA 4R9OA 3DN5A 4KWUA 4JPGA 3NZRA 3U5UA 3EOOA 3GW3A 1VLIA 3LCFA 1QW9A 2X30A 4LEFA 1AVAA 1T99A 4LVBA 3LNMA 1J79A 1XLCA 2B81A 1ICPA 3WH9A 1UD3A 1RLCL 3MKCA 3NYDA 1P7TB 1KBBA 2FTYA 5AB3A 2ABBA 1WYIA 1QU4A 2C1IA 5LGXA 1TA3B 1I9CB 1FHVA 4MWAA 3T2OA 3F1QA 2ABAA 1FXQA 1KBKA 1LUCB 3IWPA 1Y5XA 1KXVA 4AYSA 4F0LA 4S2CA 1AQMA 3RNDA 2Z26A 1A0DA 4JY9A 3RUBL 2XG9A 4O1FA 5BU6A 3MPGA 4UFIA 4UMBA 3CWOX 4GACA 1RD5A 4MAVA 3W7CA 1KXHA 2J9YA 4GNVA 1BVWA 4PUWA 1TPFA 5D32A 4L6OA 5I77A 1EHNA 1UR1A 5JIWA 2OZTA 1KCXA 4XUGA 3DZ1A 4HSNA 1XWYA 1AQHA 1MXDA 2GVYA 5XIAA 4XSLA 4MTVA 3FJ6A 1S1RA 2VVNA 2X1IA 2Y4SA 4DWDA 2PDCA 2VQUA 4GHRA 2QHAA 2WSYA 4H01A 4OOUA 1CXHA 3EMQA 4WOQA 3QQ1A 9RUBA 1WZAA 2CLKA 3PB0A 1QASA 4WKHA 3DAQA 1EP2A 4Q7BA 4B5XA 2IQTA 4HU8A 2GSJA 2QIIA 3MMTA 4JTJA 1BYBA 2XSAA 4GYPA 1UKPA 1PIFA 4H04A 4B2DA 3GG0A 3RLUA 2RKXA 1E1EA 3JU2A 2ATSA 5E6YA 3C2VA 3F5KA 4PCTA 1M53A 3AMGA 1GJWA 3MHFA 1H51A 1I2OA 2V68A 3TN5A 1OFQA 2G41A 4DJEA 3UP8A 3VIMA 3IJ9A 3GZ3A 1P7TA 1W17A 4E2BA 1Y7VA 4AISA 1FWSA 4MNJA 2ACSA 1JZ5A 3NXFA 4AZCA 1PHWA 1AH0A 3OHIA 2WM1A 1OCQA 3HG2A 3N14A 4LCQA 2I17A 1K6AA 3OB8A 4PUNA 1JGIA 2TODA 3N4EA 1FA2A 1BXNA 1NWUA 1U5VA 1CBGA 5H1WA 1T96A 3DHFA 4KEMA 3ZMRA 4AFYA 4E3TA 2CC0A 2WPBA 3W7DA 2YCKX 1DIDA 3PPGA 4O14A 1LLZA 3DFSA 1WXJA 2UY3A 3RIKA 4ORIA 1F3EA 1SZGA 2JIEA 1J9YA 1TVPA 3IJ7A 3GLCA 4PFMA 4UMAA 3ARYA 4Q32A 1JYNA 3W3OA 2YOCA 1KFCA 3QH2A 4KKXA 4GUIA 4FOJA 2ZC8A 3LQGA 5G4WA 1UQZA 3VIOA 1JI1A 4K6AA 1LT7A 1MW1A 2WBKA 3W7QA 3JS3A 3W25A 2Z1WA 3A4JA 3FS2A 1GVSA 4IX2A 3CWHA 3N13A 3ZWSA 1Z48A 3VNDA 4FI4A 4I7WA 4MY1A 3PZTA 4NJGA 1QWGA 3LLFA 3R25A 1YW1A 3LXAA 1BTMA 3O6DA 2DZUA 1ZENA 1YPXA 3KLKA 4XVEA 2EG8A 1XLIA 3UD6A 3TWAA 2X16A 2YB1A 3IIZA 3KTXA 3GC5A 3MW7A 2H90A 2XGZA 3VKCA 4OFCA 3F7JA 1P0BA 1BYAA 3S1GA 4CNTA 3AOFA 2DT3A 3EBVA 1WAUA 1OFPA 3LPPA 3VKDA 3KOXA 1VFOA 3GXMA 4PCPA 4MDOA 5D37A 3OG2A 1ZL1A 3OZYA 3T44A 1G4SA 3MZ2A 4JDYA 3BAIA 2Z24A 1LROA 1ZUAX 2OYKA 3SN1A 3BL3A 1O94A 3WQVA 3WNPA 3BGJA 3APTA 1G01A 1UIOA 3AS3A 1RQEA 3IIXA 2G3MA 1QO2A 3WQEA 3UNTA 1F6KA 1E3XA 2ON3A 4JQ4A 1XIJA 4L80A 1SYTA 1LWHA 5A1AA 1KGUA 4H9VA 4AY8A 5HMEA 2W6RA 1RLDA 3GIQA 3T07A 4ZFMA 4MZ8A 2HRWA 4PBEA 4GVHA 1K1DA 1B0IA 3VIHA 1J6OA 3CQIA 1VF8A 5DLCA 2POZA 3TXZA 4X60A 3GE7A 3F4NA 2VZTA 2CLFA 3WLPA 2IS7A 3VMNA 1K6WA 3FHAA 3BAKA 4LC8A 1S3HA 1W2VA 3UVAA 4UCGA 4IG2B 3VGFA 3KRUA 4NY2A 1J8VA 2V9DA 2DSVA 3VM7A 3WJWA 5JMUA 3BPWA 2YCIX 3BAJA 3TSBA 3V5OA 4ZSUA 1LDCA 1W3TA 3WLOA 4UTWA 3HA1A 4UTLA 1M03A 1MXGA 1R7AA 4BKNA 5I6SA 5TD4A 3ITGA 3APGA 2E5DA 3TYEA 4GUFA 4AZBA 1JRCA 5A6SA 3TAOA 1EX5A 5JXQA 3LHTA 1QNVA 3WF3A 1XFBA 1E5NA 2J62A 3G6LA 3MUXA 1ISXA 3GNPA 1TV4A 3W7KA 2QZRA 3M5XA 4CD4A 2QAFA 5GJMA 2KAUC 4LX4A 4MADA 5HMSA 4K7VA 2ZUMA 3B9OA 3QY7A 4U2YA 4GQQA 5J8LA 3DDMA 2GWNA 1W1A1 2YIHA 3V7PA 4H41A 5CZSA 2QPSA 5RUBA 4UB9A 3M0KA 1A5OC 4S39A 3TZFA 1NFGA 3RMEA 5FJJA 2UY2A 1Z69A 4CD8A 2INZA 4JN6A 3SO7A 5CAHA 2ZZ1A 1MZRA 2C1GA 3HG3A 4PTNA 3CUZA 4J3SA 1ODUA 1TE6A 1OABA 1MNSA 1MW3A 1ZAIA 2Z29A 2ZQ0A 3LK6A 3VGGA 3MCOA 3RLHA 1K9EA 3BV4A 2X7WA 1ONRA 2Y8UA 3ME3A 2BHZA 4GVFA 4X9YA 3C2RA 3R8GA 1X6UA 1KGXA 4A8NA 1R47A 2YYTA 4TMCA 1OF8A 2C3ZA 4RCXA 2BOEX 4K8HA 3URAA 4WXYA 3N1AA 3QSRA 2CNCA 4OKDA 1EB3A 1LORA 2WZMA 4DXXA 1FDYA 3JUGA 1JFHA 4JTQA 2ZA2A 3TN4A 3B0VC 5F2IA 4CNOA 3ZSSA 3CNYA 1SO5A 1US3A 1GTHA 1Q6LA 4TVUA 4Q8TA 3M0LA 1KM1A 2W91A 5HNRA 5AHEA 1CXIA 2JEPA 1TUXA 4J3VA 3KE0A 4DJED 4Z1CA 3KWSA 1X97A 1ZCOA 4I8YA 1DQUA 1JNEA 4TMBA 5LSMA 1B57A 4AD0A 1AL8A 2DVXA 3W81A 3A4XA 1GOWA 4S3EA 3CAQA 4QP0A 2JGQA 4RDWA 3V36A 5BRPA 4JKLA 3B4UA 5KZDA 1PKLA 3LI0A 4AZCB 4M51A 5SWUA 3GO2A 3ZT6A 3FCPA 4QEHA 2QCDA 2RDXA 4TR9A 5A95A 3BQ5A 1MDRA 4O1EA 3THAA 2ZZ5A 3SUTA 4C5ZA 1O68A 4LAOA 3WK2A 4LUYA 3ZR5A 3EWCA 3QW3A 1UP3A 3UJFA 4BQ3A 1QNPA 1XINA 3GBEA 3WD3A 1TKKA 1SW0A 4QE1A 3LG3A 1L2QA 1REQA 1CLVA 3RLGA 1SGJA 1CB7B 5GQBA 3FDGA 3WQWA 1E0UA 3V16A 3GD6A 1OC5A 3TC3A 3ZJ7A 1U2YA 2I5IA 3OQEA 4OOZA 4XZWA 3P74A 4Q7NA 3T1GA 3UZYA 1E0TA 1VAHA 3NO1A 4LAUA 3M7SA 3CQJA 2YDSA 1KM3A 5ABFB 2Z2BA 3APYA 1C93A 3EDJA 2PCQA 3K8LA 3GS6A 2J47A 2QV5A 4V28A 1E6SM 4AWSA 4Q8WA 2BP1A 4C6EA 4UOQA 4HK6A 2CWXA 2FHFA 2PWDA 4Z2HA 1CI1A 1RZMA 3SCPA 2WCGA 3PNZA 4MSSA 1DJWA 1DIEA 5EA9A 1IWAA 4EPDC 2RGMA 1IEXA 4AWTA 3OPSA 4GWEA 2OJPA 1KQZA 3UJEA 4W86A 4OECA 4S3CA 4YTSA 4O0QA 4Z42C 3FW6A 4J3ZA 1IQ8A 3GVGA 3TLQA 4XX6A 3UWYA 1UHVA 3PTMA 1EHAA 1A5AA 5TNVA 1XCFA 2GDQA 5A8OA 4UTJA 5KETA 4HCHA 2ISSA 3MJMA 4MFEA 4YL2A 1TA3A 1KRBC 1FWGC 4W8AA 4XKYA 4R88A 4H9TA 1YNPA 1A4LA 1FCBA 4LANA 3MSGA 4OV9A 3WL1A 4KGJA 4Y9AA 5EBAA 4JX6A 2VR5A 1QVBA 4O4WA 2FIQA 1TWWA 1E56A 3SUUA 3LM3A 1V0MA 2ACUA 1LOLA 1YADA 3GG8A 3UCQA 2NX1A 1VJZA 2CLEA 3CL7A 3VCNA 1B30A 3WDRA 3WK1A 4C1NB 2EPNA 1GQJA 1OG6A 2OU4A 1KLYA 4MJZA 3IVUA 4PMDA 1F07A 1L0PA 3QOKA 3KCOA 2WV8A 2YW4A 1EF3A 4Z2IA 1A3WA 3O2LA 2WZTA 1EJRC 4TU1A 4PZVA 1SZEA 4G7EA 2YCEA 2DV0A 1GVYA 3WBXA 3VO0A 5G5IA 4TX9A 2OXNA 3OHMB 4HYVA 1QI2A 2XGBA 3SCUA 3QQWA 2R1PA 3BCJA 2D3NA 1S5NA 2J9XA 4AZHA 1BHGA 1G9HA 1M04A 3HGJA 3U8GA 1QUMA 3SIZA 3ZVHA 1RBAA 1P0NA 1ADSA 1QI3A 2A85A 2EPHA 1KCLA 3ITTA 3GYEA 2PZNA 1WBHA 4PR4A 1KBJA 5CXPA 3N9KA 1F3XA 1LQAA 4DUXA 5CBJA 3T0CA 2J24A 3J7HA 4D6GA 4LW7A 1Q6GA 5AHMA 4W93A 3W2NA 2J25A 1NOUA 1GYMA 1GVQA 2DSUA 2WLZA 1T6MA 2ZRZA 3ZVIA 3LQLA 4ENLA 5K9XA 3NPWA 2WCSA 4LF1A 1ZSXA 2PDQA 4UTTA 3ARUA 3RX2A 1Z42A 2QAPA 3I65A 5HQMA 3H7UA 1EYWA 1E6NA 2ZDRA 3GVQA 2PRLA 1H50A 2J9ZA 3EEGA 1JZ3A 1WDSA 5JBEA 4W7VA 3GU9A 3CV6A 2AAMA 2CZEA 3U9IA 4D71A 3CBWA 1S2UA 4DI9A 3LBMA 3AXXA 3CMGA 4B9YA 1ME9A 3BH4A 1XRFA 3UWVA 2YL8A 4IMGA 1KGWA 5A6AA 3R11A 2X1UA 3N6HA 2FMNA 5BROA 1M9HA 1UKSA 3E0IA 2NUWA 1JI2A 2PC4A 3KXQA 3R0UA 1L8NA 3DC0A 3TYDA 3PZ9A 5HK4A 5FESA 2RDTA 3GTHA 3CH9A 1KTCA 2CLLA 3AHVA 3UPMA 3UERA 3ARPA 4W5UA 1OADA 4KMQA 1DEDA 2X09A 3VD7A 3N29A 5A6BA 4YCOA 5I79A 1FXPA 3RM9A 3VDCA 4DXKA 1EXBA 1E1CB 5DO8A 4ACZB 4R7WA 3GHRA 4XG1A 2DUAA 1KA9F 2VZOA 1F61A 3F4DA 1QNQA 4A8LA 3H4GA 1V7YA 4HA4A 2YDRA 1ZRQA 5AHNA 3LPFA 3RK8A 4H6QA 2AL2A 3VFLA 3GXFA 4JIHA 2BXYA 3GAKA 3BANA 5FI8A 3W26A 5A2CA 2V5DA 3MC5A 3MUAA 1JGMA 3W1MA 2A2IA 1TX0A 3GG7A 4NNCA 3WDHA 1TRDA 3E12A 1OYAA 4LGXA 4GBDA 4QLJA 1UZHA 1VBRA 4KFPA 1K7FA 4FIQA 4S1FA 5G2IA 3TXVA 1XIDA 4AEEA 1BEUA 5J5RA 3T6CA 3NXLA 3ONCA 1TMHA 3B0PA 1FBAA 1S5WA 4X61A 3WNMA 1UD8A 1DQXA 5HUPA 2X41A 2Y5SA 1CENA 3P3BA 3B8SA 3MWAA 4X9SA 5REQB 2PA6A 1HO1A 1A53A 1YBQA 2W79A 1JCMP 1K77A 2DY3A 1UD4A 3HFTA 2ZVIA 5EGRA 4R27A 1M7XA 2EQDA 3ATZA 1EJXC 1H7WA 1AD1A 3R58A 3SRDA 1VCVA 3SJ3A 1A47A 4GYPC 6CGTA 2PDBA 4D8ZA 1J0JA 2NXGA 3E74A 6PTDA 1QTWA 2NX9A 5BMXA 2FGZA 2VFIA 3QR0A 3O8AA 1LWJA 3IACA 3JRKA 3A3XA 5FJPA 3W7PA 4IMFA 1XH0A 5E6ZA 2AQVA 3OP2A 3S0CA 2GQAA 2ZIDA 2DQXA 2ZA3A 4JTCA 3HGRA 1I2RA 1FWFC 3ZIZA 1ML1A 3N34A 4J3XA 4P8VA 4W87A 2CKRA 1X38A 3AU6A 3CGTA 3MO7A 5DBUA 3BGAA 4US5D 4BF7A 1EOKA 1QI4A 1DYSA 3NPUA 1XLLA 3QHMA 3RU6A 4S23A 1WUEA 3CPGA 4UCFA 1LOQA 4GD0A 1ZHAA 1TVLA 4GFIA 2CIPA 3IAQA 3BAWA 3LHYA 4JS3A 1PYFA 1E73M 1Q6RA 3GTIA 2CXEA 2IQDA 5CPOA 3WDJA 2Z4GA 4HJFA 3W37A 3A47A 1DJGA 1V6UA 2X0HA 1QOQA 4AX6A 2WYSA 1KXTA 3PJWA 2BFGA 3GM8A 3SCVA 1EF2A 1P0KA 4WR3A 1KCKA 2XFWA 1UR0A 2C7FA 4HMDA 3P82A 5B80A 2J88A 4ZQCA 2F7FA 2IKJA 3NZ1A 4H9YA 2XTKA 3K5XA 1J10A 3T0DA 1DKWA 1FWDC 3DC8A 4EWND 2VOMA 3ABOA 2OTDA 4S3KA 2I7GA 2WANA 1XP3A 4KBXA 1X1NA 4MAZA 3L5MA 2CHRA 1CECA 1Q4NX 4LAKA 3Q4DA 3WEOA 3HZ3A 3NCOA 1I75A 1CB2A 2V2CA 4QSHA 4DZIA 4H8HA 5AYXA 4L4MA 3NAVA 1IEWA 3CXOA 1P1MA 2QCHA 1VIZA 3EDEA 1TO3A 1DWGM 4AXKA 4UQEA 1EJTC 3S6OA 5F2LA 2VOTA 4PL1A 4RXGA 5C5YA 2ZWZA 3VD5A 1GONA 2PI6A 3E0LA 3AROA 4O12A 4KCTA 4DY1A 2OWXA 3PHAA 4LJ3A 5FKYA 2XVLA 2W5FA 3FYYA 2Z6IA 3CTLA 5EYWA 1JXKA 4GIYA 4AD2A 5D9NA 4DBEA 2NQ5A 3CL8A 2PDFA 4MB3A 3POCA 2ZZ2A 3I6RA 2XN2A 2DGAA 1EGMA 3N6QA 4PUMA 2VDIA 1WKEA 2DW6A 4D8LA 5D8ZA 4LBRA 4GKLA 4ZGYA 5FAGA 4AMAA 4S3DA 3RFAA 6TAAA 4JTSA 1X96A 3VOJA 1YNQA 4JL2A 3W7OA 4RLIA 5G4HC 2ZUSA 4DIAA 2I5QA 4WY0B 5HA7A 4GUJA 1FWWA 4S2BA 4O50A 4GQBA 3TR9A 2FB2A 3EA1A 2BWGA 1UP0A 1OIFA 2PCEA 3OBAA 4F9JA 6ALDA 2DP3A 1WOAA 1UQYA 4L65A 4G56A 4ZE4A 5I23A 1T7LA 4HPGA 1HKJA 4KWOA 4D6JA 1FWBC 2A7NA 8XIMA 1J0KA 3D47A 3UG5A 1G4TA 4C65A 4FF5A 1H2JA 1ISWA 3I3BA 3W85A 5KZ6A 2JEQA 3T05A 1GQNA 1KO0A 3UETA 3P6LA 3V0SA 4WZHA 2OYMA 2ZUNA 1JPKA 4W8LA 2GGJA 1SJCA 3WKZA 4FALA 1M01A 4LVAA 2F38A 3FEMA 2IKGA 3BLIA 2J27A 1FWNA 3W7HA 4DO5A 2CHNA 3PB2A 2XYLA 1SUXA 4JNZA 1QXLA 5EL1A 3G1SA 4D6CA 1Q7QA 1CDGA 3SY1A 2UY4A 3PJTA 1ZBKA 1H7XA 2CXGA 3WCZA 4HCDA 5DMLA 2GL5A 3VDAA 3IVSA 3GR7A 4IIHA 3W1AA 2E67A 4GJJA 3DOPA 4HPXA 3ISIX 3WNKA 5CSYA 3N2BA 1TJ1A 2V69A 4TVDA 3GXTA 4A29A 2A3AA 4HNUA 3W27A 1AH3A 2ZRXA 3A13A 1YE6A 5A6TC 4KWSA 1ELSA 3VE9A 4DELA 1L2UA 3KRSA 4Q8UA 3FK4A 1G6CA 7A3HA 4ONVA 1UWQA 3GUWA 3R1ZA 1JZ4A 3IV3A 4H7VA 3NGFA 4B92A 3EWXA 1DQWA 4IT1A 3OYZA 3U7BA 3WQ6A 4WVXA 1P0DA 2ISVA 4A35A 2WMHA 3QLDA 2VXNA 3WJZA 4Q8NA 2GVJA 3U57A 2FVLA 4M56A 3W29A 3QC0A 5LZLA 2V2HA 2V5KA 4LVDA 2GJRA 1NELA 2AL2B 1XGZA 4ALDA 3G6MA 5G1TA 5D2VA 3EPNA 1UZ4A 4Q8PA 3H4XA 4JD4A 3G3DA 1TV3A 2EGZA 2BLEA 3M44A 4WKAA 1MEHA 3BMXA 3WSUA 2QULA 5JH1A 4IIGA 4F4RA 2WK2A 1TMLA 1W1PA 2VD9A 1VC4A 3T2PA 1AJZA 4DX3A 1LBFA 1PB0A 3EOUA 3D46A 3CS2A 5H8UA 2J77A 3NDOA 4GBUA 4YTTA 3EYPA 5T91A 2CZ5A 1W5MA 1GPFA 4AZ5A 2FHCA 3VGHA 3BG5A 5TIMA 1IXPA 4JXCA 4X0NA 2CZFA 4MB5A 4DBWA 2R1MA 5C9RA 2DT0A 2OGJA 4NZFA 3H24A 5BYWA 3DG3A 3GH5A 4M0XA 1EX1A 5FACA 4XV0A 1LBMA 4KPLA 2OSWA 4UBPC 3QOMA 1POJA 1LG1A 1TPB1 3TVAA 3K1DA 1P1XA 3O06A 1K3UA 1KFBA 4LUJA 3WD2A 2PDMA 1T5AA 5HATA 1IYXA 5BXTA 1QI0A 4OE7A 1FWAC 4MKVA 1BG9A 2PDIA 3WFAA 3DFTA 5CPQA 2VNCA 2OLSA 1NQKA 3EX3A 2E9LA 5C2XA 1I2QA 5G2HA 3QKZA 3GKFA 3M64A 3HG5A 3MBDA 3DFQA 4Z1BA 4QS5A 4JTTA 1E15A 3A64A 4JIRA 5A8GA 3ZT5A 1KWGA 3ARQA 2AGKA 1QPNA 3M9YA 3MP4A 1D9EA 3AIVA 2OODA 2A0NA 1UWRA 2XIJA 3OBEA 3KBSA 1TV8A 3REQB 1HZYA 1E9YB 3H2NA 2JK2A 3GH4A 2V38A 1VEOA 4OIFA 4L4LA 1CXEA 4GX8A 1YRRA 3ARZA 3E0WA 2VDGA 1DWJM 3KZSA 4OZOA 4EACA 3UWZA 2YYUA 3TN6A 2W3ZA 3ABZA 3BG9A 2X1TA 2QJMA 1B54A 4TX6A 1E0VA 2VRKA 3DYMA 4OU1A 3R8RA 3UVIA 1E0XA 2Y5JA 1SZFA 1XJBA 4W9TA 4MF4A 2Y85A 2XDFA 2P8BA 3MMWA 1XV8A 3PZIA 5CBBA 5AOUA 2YL5A 3GWQA 1G67A 5BXRA 4MWAD 4P7RA 3CUXA 3FGCA 1W54A 1XH1A 8A3HA 3WH5A 3QTPA 4NRRA 3V1PA 1UUMA 5AVNA 2PDPA 3CLWA 4X2RA 1F73A 4M80A 4L1XA 2JIWA 1PTAA 2IXUA 1MWOA 4WJ8A 2WMIA 3BE7A 2GUYA 1OD8A 3E6EA 2H9AB 3R8HA 3E2VA 2F6KA 5KEZA 2VRQA 2ZCGA 1ZP3A 1XH2A 3BDKA 1GTEA 1KRCC 4S3FA 4I9JA 2Z25A 5HUOA 5U7SA 1FWIC 5FJIA 4YWIA 2WPGA 2O92A 4JEQA 2OWCA 5TAOA 2ZZ6A 2TYSA 3VKAA 2YDQA 2FGLA 2QCMA 4IGNA 4D6IA 4UTMA 3M47A 3O7UA 1XM3A 2DSWA 2X40A 1E0WA 2WWCA 2CBJA 3V5CA 3E96A 5CC7A 2FPTA 5LYRA 2BX7A 3ICJA 5BRBA 2DIEA 3KTCA 2YZ5A 1BWKA 4MNLA 1EP1A 4L9XA 3KL3A 1KFLA 1QI5A 3PZOA 2F2HA 2DDXA 1L9WA 4PRWA 3LLDA 4MB4A 1F76A 3W1RA 1HF6A 1VPYA 3PAOA 4O1BA 1NQ6A 4IF2A 4I90A 2PTDA 3S1VA 5HULA 3SRKA 3AMDA 1AZ2A 2BV9A 3LERA 4EPKA 5KTLA 1C8QA 2OZ8A 4JY8A 2EKCA 3AIEA 4E2DA 4NKCA 5XIMA 2EPMX 3WLJA 4H6RA 2ODOA 1QW8A 3CHEA 5T8GA 3S1XA 1HFBA 1UBPC 4WDUA 1JR1A 1B3XA 4DYKA 3CUGA 1EDGA 2BY3A 1EO5A 3F2DA 4WX2A 3HGSA 4PTWA 3H6OA 4M24A 1TV5A 3B9NA 4PBFA 3GXNA 4LXFA 4WSHA 3RX4A 5GNXA 2ZUVA 4LU0A 2OO6A 1UYQA 3UZZA 3BJSA 3EOEA 3SGZA 5I78A 2XFYA 1W3NA 1J93A 3ITVA 2Z2UA 1WX0A 4MYXA 3GSMA 1FX6A 3HJEA 1NTHA 4YHGA 3NPXA 5HMFA 4I9TA 3NQVA 1BLIA 3W87A 3NQGA 4MJMA 5EMJA 5LIXX 4JTDA 5CC5A 2ANUA 3G1YA 5HPCA 1T8XA 4OQVA 4PMJA 3QZAA 4QQ3A 1UP2A 4KCUA 1BGGA 1OT2A 3AICA 3G2GA 4MLJA 4M82A 2D20A 4N9CA 2DZXA 1B3VA 3OG3A 1P43A 3QYQA 3TAKA 2I16A 4PCNA 4J35A 2VZVA 5CEWA 4IPIA 4DEFA 1UH2A 4CU7A 2ZXBA 1BRLB 3UGVA 2G37A 1TWDA 2XIIA 3RJYA 4GX9A 1BWVA 4CCEA 2D3LA 2SFPA 2FPYA 1BQGA 5DCDA 4DO4A 2PLMA 4AHOA 3PNUA 3C2EA 7PTDA 4JTFA 1GPWA 1SZNA 1A5BA 4O18A 4GVIA 3S1UA 3S8HA 1TZ7A 3TX9A 3MVTA 3VU2A 1BKSA 2C6QA 4BQ4A 1LOSA 3O15A 2PGRA 4CQAA 4XB3A 2IKHA 3TTYA 1VFHA 4D9PA 3EA2A 3QEZA 2XFRA 4FLOA 2YBVA 3RITA 2QDHA 3MTWA 2VEGA 1VGAA 4BWLC 3LXCA 1R86A 2D0GA 1JF6A 2L5HA 5IHRA 4HPNA 2ATMA 3WJXA 3WLRA 4A8IA 1PX3A 2PAJA 2V8ZA 5EBUA 3T0TA 2YXOA 5A8NA 4W85A 1XG4A 3PWGA 1LRTA 2WSKA 3VM5A 2IW0A 1EIBA 2J4GA 4UZSA 1MXSA 4QCEA 3EWUA 1V0KA 2NUYA 5D2XA 3QJAA 4HYRA 4AD1A 3VFCA 3L23A 1KFKA 4Y96A 5DANA 1TPC1 3DKLA 3BICA 4DJFC 3L21A 3W4RA 3CV2A 3NQBA 1E5JA 3V0UA 4Q4KA 3B05A 2VC6A 4LB4A 1BKHA 3GQYA 1FWTA 2PDWA 1EA9C 4NG3A 1HJQA 1A5NC 3CM4A 5I03A 2OT1A 4H8VA 2VDHA 3UWWA 1V51A 4OUEA 4ICNA 2DT1A 4RX0A 3BG3A 4AQLA 1YTDA 2PP0A 2BHUA 3BLOA 4WEVX 3PFMA 4HBKA 2YA2A 4JFTA 5CZKA 2P0OA 4B5WA 3NQCA 1WXZA 5DN1A 3NSXA 1K8CA 2BMBA 1HVQA 1A3XA 3VNLA 3L12A 1RY8A 1AQFA 3AMCA 2GGGA 4PMZA 1H1NA 3BVJA 4XISA 4C6NA 1Z6KA 2J13A 3B8IA 1WKYA 3HPFA 4JAWA 3NL2A 3W1TA 4M7SA 2QPXA 1GKPA 3CYVA 1H7RA 1YDVA 2YPIA 4GI9A 2ZXQA 2BHYA 3L5AA 4MVAA 3B0YA 4CCDA 4BY3A 2IPGA 2W92A 4YU1A 3W72A 5HQLA 4ICMA 2G3JA 1AODA 5E09A 1EJSC 2J8FA 4H6KA 3TKFA 1S38A 3IANA 2P10A 3PBUA 2EJ1A 1KV5A 3NO3A 5D9OA 4ZOAA 4ASTA 3NWRA 3UG3A 1TYGA 1RK5A 1X6LA 3OLEA 4KIEA 2OQYA 1L6SA 4UNIA 4UR9A 4U28A 2PTWA 1XLBA 1YEYA 4K1GA 4IQJA 4ZOCA 2HJPA 1XPYA 3V5FA 4ZENA 1U1JA 4Y6GA 1FTXA 3C3UA 1MEIA 1ISVA 3QHNA 1A5SA 1RCXB 3VGEA 4WY0F 2OLAA 2P3EA 3IIOA 2C79A 4DJDA 1JCYA 3NVDA 2F84A 1UA7A 2PGFA 3PJXA 4DZAA 3OO2A 5ABEA 4Y9NA 4V15A 4BHYA 3O16A 4ZB2A 4CCZA 2BY1A 4XBKA 5FF4A 3ERPA 4PUEA 3DI0A 4LH8A 4RK8A 4DVOA 2A7PA 4HSHA 1WDQA 3DBNA 2VO5A 5MKGA 1ICQA 2V67A 4BF5A 4DNHA 1XDLA 1FWEC 1DVJA 1U1HA 1JDAA 1G69A 5FSEC 3NJ3A 3ITOA 5C7VA 3QKEA 4WLCA 4OWGA 3HPZA 1B4EA 2G3IA 4O16A 5E5CA 4JFSA 5D2WA 4JHZA 1TTJA 2ALDA 1A5UA 1H5YA 1RPKA 1A5KC 5ABGA 3T7VA 2OOGA 3NSNA 3PR2A 3ARRA 1UKQA 3SQLA 4LYRA 3MKVA 2BOFX 3UGRA 3OGSA 2FZNA 1J12A 4KWWA 1W1TA 4LUTB 2J7FA 2GJPA 1US2A 5EMUA 3WLQA 1E72M 1ZU8A 3KWXA 2QJGA 1OFDA 4B90A 1SJAA 1LRQA 3PBMA 1N55A 3O6AA 4M19A 3CHFA 4UNLA 1UMLA 1XBZA 5H2ZA 1EYEA 5A69A 1H5VA 1V3MA 2X42A 3GFXA 2GZXA 3O05A 4AH7A 5DXXA 3LHZA 3WELA 1PTDA 2OO0A 4J4KA 4Q6XA 2QCGA 2HQAA 4PFHA 4I8DA 4JFWA 3G1FA 4PSRA 2NT1A 1XIEA 5DMNA 3EWWA 1UH4A 4GMEA 4MFDA 3GNDA 1SSGA 3QC3A 3LCIA 1H60A 1IIHA 2JF7A 3FXYA 4JTAA 4CEXC 4CN1A 3WUFA 1GQIA 1XCXA 1XDMA 4YYCA 2FFCA 2PWGA 3RHGA 4H1ZA 3EWBX 3AYTA 4GJ1A 4X22A 4PEKA 1J4EA 4BJHA 1X98A 1CGYA 4E4UA 1JFXA 1HO4A 4ERGA 5GPRA 3TSMA 1I6NA 4Z17A 4UIOA 1S5TA 1PL9A 1I0BA 1UUQA 1JRBA 2JE8A 1NP2A 4K7YA 2X1SA 3UR8A 4K39A 3ITXA 1A80A 5EFDA 2PDKA 5PTDA 5LIYX 2Z7GA 5G1MA 3BSHA 2NUXA 4LS0A 4DAFA 5C0QA 3UT0A 5KZMA 1NF7A 1GNXA 2QXWA 1DBTA 1A50A 4DUOA 4LVGA 1C9DA 4G2DA 4BR1A 3W83A 4X2PA 3FOKA 3N2MA 5E0FA 2Y7DA 3C5QA 3VCCA 2HDJA 2JQXA 3NEHA 1OFAA 2QLYA 1ZJHA 2J66A 4IZGA 4UTFA 4ML4A 2CITA 3QZ6A 2DW7A 4HSOA 8XIAA 5EMMA 3VIJA 3QN3A 3CTTA 3MYPA 1FWJC 1V3IA 5CLTA 2E0PA 2EG6A 3L4WA 2OSYA 4DLMA 1HKMA 5M5DA 2VGBA 3AWNA 2DZPA 1CGTA 3ZS4A 5GNYA 3RGTA 5D4YA 1ITCA 1J18A 2J7DA 2VX5A 1TELA 3TC7A 1R3RA 4HTYA 1QPQA 3CU2A 4W7UA 3IIPA 2A7RA 1E4IA 3NYZA 1MRQA 4XZBA 4L6HA 2Y8VA 4UFHA 2H3DA 1M3UA 1QHOA 3GX9A 3LTYA 2VL4A 2VD8A 2B4GA 3FKKA 1HJVA 4LS1A 1TIMA 2Y7EA 4ES4A 3VZXA 2E1WA 4J27A 4KH2A 3CO8A 1XYBA 2A21A 3NUKA 1GCYA 1V02A 4NZ5A 5DX7A 1M7OA 1CEOA 3G77A 2C91A 4A21A 3UZ5A 1TJ2A 3R6IA 3LCGA 1GOOA 4R53A 3VI2A 3FJLA 5FEWA 4XZIA 2NZLA 1TPUA 1GQKA 2VP8A 5HJLA 4LC6A 1QJWA 1XBYA 5CGMA 2FZMA 1TQJA 4JICA 2HK0A 1WA3A 3B3DA 3THCA 1EBHA 1LL7A 2WVTA 2Y89A 4KERA 2PB1A 1J2BA 1O6IA 1UC5A 3XINA 1L6GA 3U3HA 3SGGA 1TMQA 1THFD 3UXDA 1AH4A 2Q01A 3NIYA 4B3ZA 4V33A 3B0XA 3B03A 1O5RA 2PEVA 2QUUA 1R3YA 4MNMA 4HN8A 1ZJIA 4DBDA 3AXKA 4NU7A 6REQB 3REQA 3U6WA 4C1LA 2ZX7A 5EU9A 3F03K 4CUCA 2TMDA 1XG3A 5I00A 4RKAA 3LPGA 1O5XA 1W9UA 3OEXA 2RAGA 1OX5A 3L2IA 3RCYA 4YCPA 5CPMA 4IX0A 2HROA 2RDUA 1ISYA 2H8XA 2X0SA 5ENLA 2HNHA 3KS5A 1EUNA 3CH0A 5KINA 3WNLA 1E3ZA 4FA3A 4CCCA 4IFKB 4NZ4A 1PIGA 4GQRA 1MMFA 4UMCA 4ORMA 1CNVA 5D05A 4OHQA 5I7GA 4DPPA 1R2SA 3UPWA 2WZEA 1VBUA 3LSBA 3G1AA 1U30A 3B97A 1JPIA 4LAZA 4Q6JA 1J0IA 3UY7A 2Y70A 5I3KA 5GVJA 2H3BA 2DZSA 1KXQA 1EUAA 2BBFA 2ZX9A 1RA0A 3VAVA 2AAAA 2D0FA 1XLFA 3GK0A 3EZ4A 2WC4A 4RNJA 4L4OA 2NV2A 1FDJA 2QV4A 4ZSTA 4H19A 4IMCA 1ZALA 1LM1A 1EKOA 1JULA 3N18A 4RR4A 5K9DA 3BZJA 1AW1A 3F2CA 4IWWA 1A0CA 4JEJA 3ANVA 3ES8A 3W1XA 3DCPA 4OV4A 4ATDA 8RUCA 1LZOA 1EZ2A 3S5YA 4C6MA 1D3GA 3WFLA 1LP6A 1L6FA 1H0GA 4QG9A 4PUUA 2VUNA 4JHOA 3PS7A 1RA5A 4CN4A 4IXHA 2VEFA 2JF6A 4Q7IA 4IGHA 4FEZA 1CGWA 3NQ7A 3T42A 1ZTVA 2BVYA 1A0EA 4JTEA 7REQB 1XYLA 5I5RA 2HCVA 1RQHA 4HA0A 3UJRA 2QMKA 2PRHA 5DMMA 2OX1A 4GLEA 3VINA 4O0KA 3CHVA 4Y9MA 1QNOA 3WEMA 3B8TA 3LHVA 3RM4A 4NF7A 5M2FX 3MCMA 1LBLA 1LL4A 2XWEA 4XAZA 2OQHA 3ZYZA 2C71A 5DY3A 6A3HA 5HANA 3TA6A 5BW6A 2V5BA 4C91A 3LHUA 1K4HA 3S3GA 4AYGA 3WF2A 4KRZA 1OFEA 1E9ZB 1ME7A 1U5HA 1R38A 2INEA 2J7GA 2ZOXA 4IQLA 2PTZA 3W76A 4O57A 4NZ1A 4PTMA 4GC4A 3G0XA 1UPPA 3CQKA 1YDNA 1ADDA 1QOXA 4JGDA 4Z1AA 3NM3A 3RPTA 4K8EA 5JVLA 1XD0A 3B9DA 4P8WA 2VEKA 3STCA 4MDPA 3DXIA 3HOJA 2Y7GA 3DH7A 3T0BA 1RP8A 3WO8A 4E0CA 4E5TA 3LCLA 4GUHA 3W7EA 2PURA 2HEJA 2BGNE 3L0GA 1RJQA 1G94A 4LAMA 1O12A 4QLLA 2ZX5A 1TCDA 4AX7A 4J9JA 1RR2A 1V3KA 3KBVA 4CQ8A 1Q6DA 1DXEA 2BODX 2ZRVA 2FH6A 1SR0A 3GB6A 3UY8A 4LV9A 2G4FA 1B9ZA 2VFHA 3AYRA 1Y0EA 4WRHA 3M0VA 3EXTA 2GDUA 3IRDA 4JIPA 4HZ6A 4FNRA 3P93A 3FA4A 1WDRA 5CPSA 3NM1A 3FDKA 1EO7A 5EMLA 4O8RA 3OJGA 2QDEA 4WK9A 4UFKA 1EDTA 2DSKA 3K2GA 4JBRA 7CGTA 2IUZA 2VVSA 4G1KA 2F61A 4NIRA 2NV1A 4GXPA 2WB5A 2YA0A 3CK5A 1VD6A 2KX9A 4C60A 4YVVA 4FAMA 2I9EA 3PN8A 2VEMA 4I6VA 3CAKA 1GZGA 2QCFA 3W9ZA 3NQMA 2FDSA 3DEQA 3AUJA 3H2EA 4Q22A 1Z44A 1VFMA 3U2CA 3W2JA 1V5XA 2ISWA 4EP8C 3GG1A 2Z0IA 4B4HA 3GXPA 3HQNA 4L61A 1W1IE 1EWEA 1H41A 2QGHA 1BF2A 4E8GA 2WKLA 2E28A 4J3TA 2XVKA 4GZIA 4QX4A 2UV8G 2I5GA 3VMOA 3AHXA 5BU9A 2PDJA 1SPQA 2XPKA 1PKMA 2TAAA 2VGFA 2FPVA 3UA4A 4P7QA 5A8QA 3TTOA 4X0VA 3F4CA 2FHBA 2D2HA 2PDUA 2J7CA 5REQA 1AD4A 2NSXA 3KVMA 3PSVA 3ALGA 3H23A 3POHA 3UESA 5A8MA 1MDLA 3TTSA 2Y63A 1JCXA 2ALRA 1TRIA 1H63A 3SB0A 2B7QA 2DVUA 4PBGA 4ERAA 1IF2A 3Q58A 3VE7A 4IIBA 1W9BM 5G1YA 4UTTC 3SFKA 4NJHA 3VOCA 1ITXA 4YTQA 3MI2A 5MKGB 5FEZA 1UIPA 5K4ZA 1GHRA 4RE4A 4GYJA 5HWNA 4C6LA 1GK8A 1PIIA 4GZJA 1T41A 3QYSA 2B7OA 1OC6A 3QF0A 4GGHA 3UXLA 6XIAA 1WCGA 2VT0A 1IT0A 3CHDA 2Y6ZA 2D24A 5IBXC 4LUIA 5FL0A 3R5EA 3SI9A 3RXZA 5L9FA 1OGBA 3EB4A 1TZ9A 2HS6A 5LNSA 1WE5A 3RM8A 4L9YA 5M1TA 3TROA 4J3UA 1D2KA 4ZO8A 1PO9A 1GQLA 3EPOA 4JYEA 4H7ZA 2WM0A 3HG4A 1FUYA 4QJ5B 3TU9A 4RDYA 1QBAA 5EMYA 4N7QA 1REQB 1PPIA 3SADA 4E38A 1TG7A 3MWCA 2PWHA 1NY1A 2FDMA 2OWWA 2X05A 3COTA 1M7JA 3SCRA 2X0YA 3P0XA 4DUVA 3KVJA 1LLOA 1NWTA 1SZRA 1FCUA 3URBA 5LHEA 3SURA 4N0RA 4BQ2A 1EOMA 4Q33A 3PVFA 2QF7A 3MUY1 3PULA 3QQ0A 1IZKA 2VHLA 3BLDA 3OTRA 3RCNA 3CJPA 3VVGA 3NGJA 3JVAA 3E1F1 2OG9A 3HBLA 1CGVA 4FXRA 4GIAA 5HMDA 5F2MA 3M43A 4S3JA 1N82A 4UC5A 4PMQA 4Y9OA 4BA0A 4C1KA 4FO4A 1YTKA 1SJBA 1CWYA 4PUKA 3IVTA 5H8MA 2VFFA 1Z3NA 2F6XA 4J2PA 1PX4A 5FL1A 3EWZA 4YXGA 1E40A 2ZVRA 2LLEA 1B5TA 3H54A 1U5JA 1EH9A 4J7RA 1VZWA 3L9CA 3F4VA 2E9MA 3PUOA 3FJNA 3W84A 3N17A 4NJJA 3WMBA 3WUGA 4JNMA 3OLDA 2EPLX 4P61A 5I3DA 4RDZA 1X1ZA 4XTIA 2YB4A 4LT9A 1XPGA 3SECA 5CJ5A 3OVRA 3R94A 3YPIA 1D7KA 3EKLA 2J74A 2E1DA 3VNJA 3GDMA 3PWIA 4B2DD 1JDDA 4H83A 4DXVA 4FLSA 3UR2A 4GUGA 4AHQA 3BCFA 1UWAA 4ZQNA 3N2CA 1DTNA 4H3DA 2WHLA 1T0OA 1B1YA 4Q8OA 1VEPA 3OZOA 4Q4RA 1XISA 2XZ9A 5CQ1A 1TIWA 1E6QM 4I9MA 1W3IA 4XAPA 1Y65A 1OD0A 3VABA 4AF0A 3VK5A 5EFFA 3UJSA 1K8ZA 5M17A 4PMVA 3S5SA 5IBXA 4HK7A 3UWEA 4FR1A 4XO7A 1DWHM 2W27A 4AW7A 3SEPA 3SN4A 1V3LA 4M3PA 1CLKA 1AG1O 4Y90A 4Z0SA 5G2WA 4JX4A 1W3KA 3I4KA 1U33A 4HNOA 5F4XA 2OFJA 2O9TA 4DB7A 4ZL1A 3VMPA 3QPEA 1Q7MA 1X7IA 2XH2A 4WHBA 3T55A 4L1GA 3K8KA 1TSIA 4GI6A 3VXGA 3LBCA 3KS6A 4DJDC 4KRUA 4CD5A 1WO2A 3UWUA 3S2LA 2QYGA 3BK0A 3M07A 3KZPA 5I3IA 2G96A 2GQ8A 3VKKA 3DERA 3K46A 1JJKA 3P7YA 1RXOB 1OIMA 4AB4A 4YLWA 3HV8A 4U3CA 3MYOA 1R46A 4TTUA 3TYUA 3GDLA 3GNRA 1C92A 4IHCA 3SN0A 4E6MA 3WQ4A 3T09A 1YDYA 4ACYA 2YL9A 2DUZA 3PZGA 4JQAA 1DHPA 4LPCA 2PD5A 4N9BA 2XIOA 3SM0A 4I5UA 2YFOA 4OBTA 1NEYA 4XSMA 4NX0A 4V1YA 5A5WA 1PHQA 5LXEA 5CH9A 3TP4A 1FH7A 2ZTKA 1POKA 4BQ5A 1G7VA 4N9DA 3SAZA 1VRXA 1E51A 3FKRA 1TFVA 3FA5A 1D7FA 4QAWA 3TIMA 3VX0A 1DP0A 1WV2A 5TF0A 3KW3A 4LS2A 1MW0A 4U10A 7ODCA 4F0RA 2Y1HA 4C6JA 3LI1A 4LYKA 3SGUA 1V3JA 4Q8MA 1UWSA 3LRKA 1PWMA 3CQHA 1DWFM 4MOZA 3A5FA 4HU3A 2YDAA 5AYIA 1IWBA 2BNJA 4ZB0A 5D33A 2G8ZA 1EEPA 1KD0A 1H61A 4O0ZA 2AL1A 1ENUA 2H8ZA 2XIBA 1VFUA 1TCMA 3SSZA 3W01A 2I56A 4OBRA 2I14A 2Q71A 3RO8A 3TONA 4QG8A 3H55A 1HGYA 1OFBA 4Q4PA 4P7LA 3SY8A 3STFA 1EJ7L 2WVVA 1IT7A 1OQFA 1VIWA 3EWDA 3OW1A 3KL5A 3MZNA 3HO8A 3GFZA 3Q45A 1TJPA 5LA0A 2WVUA 2DJXA 3KHDA 2BGQA 1D3HA 3TJ4A 3D3FA 4EXQA 4QEEA 5LNUA 3HB9A 5LGZA 4LSBA 1GVOA 1I1XA 4A22A 4AZIA 4PMUA 2XIMA 3SUSA 4MZ1A 3GBDA 3PTKA 2D73A 3EX2A 2OYLA 3T0AA 1V0LA 3TNOA 1W37A 3R4IA 1LYXA 2OEMA 1XC6A 2AQOA 1WQ5A 5BMWA 2PRMA 4HNLA 1ISZA 2QVNA 3OLIA 2VX4A 5C2GA 3AIQA 3EXSA 3FVDA 1JAKA 1ALDA 5A2BA 1HW6A 2B31A 3BLLA 3UXIA 2VCCA 3T08A 1S5VA 3FEQA 1AW2A 2A6NA 1G4EA 2NSOA 3N2OA 3W6MA 1B3OA 4P8UA 3EX4A 2G50A 3TCSA 3WG6A 4DJEC 4O1CA 4XD4A 1WP6A 2WWDA 4MJ2A 4XWUA 2R8WA 4O53A 4QDMA 3FA3A 3RRAA 3IJLA 1I45A 3OVQA 3WYZA 1HJUA 1JCNA 3ABSA 2ZADA 1XIFA 2O9OA 1DXIA 2C1HA 1XYFA 4DJFD 1H49A 2VEIA 1PXGA 4LBSA 1XIIA 1SVDA 2ZRYA 5A6KA 2ZUUA 1V6XA 1YPFA 3TEVA 1F3TA 2NQHA 2WVVB 1ONEA 5C70A 1IIGA 3SIMA 1SO4A 3W75A 3DGRA 3B40A 5HOSA 4CNSA 1M41A 2DZVA 5D9PA 2V5JA 1YTEA 4KEUA 3VNYA 1Q5MA 3FGCB 3MUZ1 4HPJA 3OYXA 1Z32X 3CZLA 1L6YA 2D23A 2XVGA 1PTGA 4GY0A 3AS2A 3G0SA 2VGIA 3TYAA 3GIYA 1UOZA 5CLWA 2FH8A 3ZFHA 3A24A 1OC7A 3GC4A 4KQNA 1IEVA 4IFOA 4GY1A 4O28A 3U7VA 2DUXA 4FNPA 2BSLA 2XGIA 4RL3A 2BTMA 3BOFA 2XH0A 4Q8VA 4RPQA 2HE8A 2ZKMX 4M6VA 5CG7A 3KP0A 1J5TA 1R2RA 1DE5A 3WDPP 4GXMA 3QMSA 3MSDA 2PTYA 1IGWA 3A23A 3E5PA 2DT2A 4GXWA 1FY6A 2WMKA 2QJNA 4ATWA 3H70A 1FH8A 3CV7A 3LCXA 5BCAA 3WH8A 2PS2A 4ZXOA 1GZJA 1V8EA 2ZUWA 3QY6A 2E3ZA 1QR7A 1W5PA 2A4AA 3IS4A 1A5CA 3P8IA 3GUGA 3CAWA 1Q65A 2WZHA 1DWAM 5I09A 3S2JA 1M5WA 1HKKA 1OX4B 3H2FA 5CPLA 3KOFA 3TMQA 3BW4A 2PODA 4JTIA 1TE1A 3AXHA 4DJDD 1ME8A 1G0CA 4PUJA 1K7XA 3TUUA 3T8QA 3ITYA 3LM7A 3CHCA 3Q65A 1EJWC 4HGXA 4PMOA 2P88A 4D6HA 4QJ1A 2PP1A 2H6RA 1ZJAA 3PFRA 7ENLA 4F8XA 1QFEA 3ZO9A 4IQEA 5DF0A 4R7JA 5H6HA 1R0MA 4RDVA 2G0WA 4FLRA 4G5DA 5AYBA 3AU2A 1C8XA 4O4VA 3O0KA 4QR6A 3WF1A 3NTYA 2VWSA 1MQPA 3OLGA 4EIVA 1Y8BA 2OZ0A 1M7PA 4ZE5A 1KBLA 1XFCA 3RDKA 3CAVA 5DMYA 4QCFA 2BGSA 2BB0A 4Y7EA 3NZPA 2R9RA 4JQ2A 3WD0A 1WZMA 2FKPA 4OJYA 3OVPA 1GGOA 3G5EA 3GHTA 3ZJKA 5EY5A 5E9XA 1NDZA 4P8XA 2W62A 4DO7A 3VDGA 3USZA 4NAEA 3ZOAA 3UW6A 1XSJA 4NRSA 2PUZA 3BQ6A 3UBPC 3V18A 1O5QA 1JCTA 3AYVA 4BK9A 1PCWA 4O11A 4IPLA 1KCZA 2HS8A 4O8AA 1F6PA 4GO8A 1W5OA 3LGEA 1UWIA 3SQSA 3DESA 2ZUTA 3H7VA 3LZ3A 1ZCCA 4FNSA 2GK1B 2CLIA 1ZAHA 4H7CA 2P0IA 4PULA 3EKGA 2J6XA 4IIDA 4I5XA 1H3GA 1SU5A 1O95A 3AMKA 1J96A 2C0HA 1GG0A 3GHUA 3PBGA 2XJ7A 3LOTA 2GFTA 2FVKA 3NQEA 4IFKA 4GCAA 3KBMA 1SQ7A 1K9FA 4JZ5A 4C5YA 3O0FA 1DV7A 5BOOA 3BJFA 4IQDA 2HMCA 2QCEA 2VCBA 2VYOA 4XK2A 1HKWA 2QUVA 1DORA 4LVFA 5DY2A 4HNCA 3FSTA 1JD7A 2Q02A 2EJAA 3P8JA 4AIBA 2G3FA 2XUCA 4UOZA 3TW9A 1ODZA 3IJ8A 4LFYA 1ESWA 3NVTA 1H09A 3HIJA 1TJRA 5D2TA 3EWYA 1QAPA 1F4AA 4OTKA 4DLFA 3Q94A 1R3TA 5AC7A 3AALA 3GY1A 3MANA 4GZ7A 4HD5A 4PRTA 2DH2A 1PYMA 5D02A 3G18A 1XBXA 1OYBA 4DZHA 2WCAA 8TIMA 3QSTA 3JW7A 3MCNA 3P0WA 1PKNA 3AAMA 1QK2A 4F9DA 4GIRA 2WJFA 2WXDM 3AMLA 4PL2A 2CLOA 3V35A 5IXEA 3AS1A 2J75A 3N4FA 5DEZA 4GKTA 3HV9A 3KCLA 3CPUA 1VYSX 4TUFA 3MDUA 5LIUX 3PZQA 4Q4QA 4GFSA 4WY0A 2DSZA 1KM4A 4CNPA 2DZBA 3GXIA 3QTGA 4F3HA 3QPZA 4UXDA 5FSDC 4ZOBA 1F7BA 1VP5A 3G8RA 1XLJA 5E1QA 3G1XA 5CPTA 2XISA 4GNJA 3QV9A 3BLPX 3TA9A 3NQ6A 1N2VA 3H53A 4MG4A 4AIUA 4LUSB 4RJEA 1W3HA 3KBNA 3TK7A 3WNOA 4KIRA 2GJXA 2PWVA 3DYOA 1R85A 2RUSA 4JDBA 2A3HA 2YCLA 3WLTA 3K30A 5IM51 3W7LA 4W88A 4URIA 2DPEA 2POTA 3EOLA 4L4PA 2ZE3A 4W5ZA 3WQ5A 1B4KA 4IIEA 3A3WA 1EIXA 4FPSA 3PTDA 4O13A 1G4PA 2HE5A 5I0DA 3M0IA 3ZSTA 1EDQA 5CZTA 2P53A 4AEOA 3HTWA 1B31A 5AVHA 5BNKA 3LRMA 1VJIA 2D2OA 2H9AA 1IWPA 3R7MA 1VPXA 1OX4A 2CEQA 2WHMA 3C61A 2OQLA 5HNNA 1XIHA 3I6EA 4N4PA 3INPA 2EHHA 4G9PA 2RDWA 3W1LA 2DZAA 3LCWA 5I3GA 1Q6OA 3KOZA 4E2VA 3MQTA 2V5CA 1QWKA 4GJIA 2A79A 3UXAA 2CESA 1DJXA 3DKJA 1G7UA 2Q8XA 2GGEA 4C6DA 2VR2A 3BTNA 2CFFA 1UA3A 3L4VA 5FEPA 1WDWA 4FX8A 4Q8QA 4EANA 4KEZA 2NW0A 3BOLA 3WH7A 4ZTXA 2ISFA 3WK3A 4TIMA 2BXVA 3BO9A 2EBNA 1J0ZA 1VHCA 2VMFA 4OBSA 1RVGA 4B16A 1MUMA 5A6JA 5DELA 1J2WA 3I68A 4L64A 2DFAA 3W6YA 4M1BA 5F7UA 3CO4A 4EXAA 1FOBA 1VEMA 3MI6A 4EPEC 2PWUA 3GNNA 4HNNA 3R0KA 1LCOA 5AECA 2PLCA 3C8NA 3SFWA 2EKGA 2NVAA 3S5OA 5C9ZA 4PB3A 4PMYA 5DQPA 1PBGA 1FHUA 4WSKA 5IHSA 3MDWA 3ZLHA 3HPXA 2Z6JA 5J04A 3V75A 4YHEA 1Q45A 3HMCA 1H1YA 1CXLA 1E9IA 1K8XA 1XCWA 3DFOA 4ZMGA 3VIGA 1CXFA 5AHLA 3C2OA 1BXBA 4ERIA 3RPDA 1BSIA 4U5KA 1R5YA 4JN7A 3UYIA 2GK1A 3E0VA 1ZS2A 4GYFA 1FRBA 1QPRA 1E9LA 1ZQ5A 2AOSA 2Z1XA 3N2XA 4NJKA 3QFEA 1NOWA 4GINA 1XLGA 3SJNA 4O10A 1NDWA 3LS9A 4J3WA 1TQXA 3M6YA 1A5MC 2OB3A 4X63A 2CBUA 1MFVA 4JTHA 5E93A 4M81A 3W1NA 2XINA 2CETA 3B8WA 1WAWA 1EGVA 4AG0A 4FS9A 1W9VA 1RHCA 1HP4A 3USBA 2OVLA 1TV7A 3E02A 2FTWA 4YVPA 4H2CA 2DJLA 4UZUA 4N2YA 2CLPA 3M0MA 2ZC1A 1W8GA 3IPWA 4NAEB 1KFJA 5C9XA 4GIEA 9XIMA 2E68A 5EKYA 3IAPA 4W89A 3XIMA 3W00A 4NT0A 3UA3A 2D2JA 4XAYA 2WC7A 3CZEA 4V27A 1B3YA 3WEZA 3SZ8A 1D8CA 4LRSA 2XHYA 1NWSA 1TZZA 1GT8A 2VJXA 1UB3A 5BOEA 3C2FA 2OEJA 4YTUA 2A3CA 4C7FA 1LWIA 2NT0A 4J28A 3W28A 1GEHA 1FH9A 2AKMA 3PBWA 1IXOA 1MUWA 2ADAA 3LV6A 3HU7A 1C8YA 1H7OA 4H8UA 5I3FA 2FZBA 3GW0A 2J7HA 4GVGA 1XKJA 1OX6A 4ACZA 4ZBCA 4TOQA 3RILA 1EQCA 1W1YA 3H22A 2W0UA 3KDOA 4W7WA 2WSRA 1UROA 5DRCA 3PP7A 4OUIA 1SMDA 4M7TA 4DUWA 4BEUA 2QKFA 5K9CA 4PH6A 3WQFA 5LIWX 3W23A 2A6LA 2EPKX 1F8IA 3MMDA 3STGA 2FZDA 3TJLA 3GHSA 1K02A 2PP3A 2XM1A 2Z7KA 1IE7C 4XD3A 1GW9A 5DBTA 4R5EA 3CUHA 3UEQA 3ARWA 5E9AA 3PPCA 2XIQA 1VCGA 4Q3MA 4REQB 2OMAA 5HJXA 1H4PA 5CJMA 4IPJA 1F05A 3OGVA 3WBYA 4RNFA 1CZ1A 3EX6A 1UR2A 4I7VA 4IMAA 4MIMA 2ISDA 5KMYA 4WGXA 4F0HA 2WQDA 2Z1VA 1HKIA 3AFBA 3ZQ9A 2QJIA 3HF3A 3OODA 4GQGA 3LTSA 3QMRA 1EL3A 4CLMA 1UR4A 1YBQB 2Q8ZA 1U1UA 2ZWYA 1JDEA 4U5IA 4GCXA 5DRIA 5K2ZA 4JQ1A 3ES7A 3GAYA 4F0MA 2J7EA 2D2GA 2YL6A 1IEQA 2DIKA 4N6EA 4ZO7A 2WHJA 2CZVA 3LNPA 2Y62A 2ZE0A 3IARA 3KVLA 4XZMX 3ZLGA 3K8MA 5C55A 4OVXA 2HZGA 3BUVA 2WVSA 3NFUA 3ARVA 4CD6A 2P76A 4ICCX 4TV6A 1DL3A 2YR1A 3VIIA 1V6TA 3M1ZA 1NM9A 3L68A 1R3VA 5D8WA 4C90A 4NNBA 2GJXB 4NP7A 4AEFA 4ECLA 1UR3M 2V81A 4N6FA 1QOPA 1W31A 2CCRA 2QCLA 4Z1YA 1AZ1A 3NDYA 3EMZA 1Q3NA 3BLKA 5BXPA 5CSUA 1ITUA 1VLWA 3N9RA 5CSSA 2E6DA 2D22A 4R33A 4L9ZA 4JR5A 4GK8A 1LL6A 3JZEA 1N8FA 3ONBA 1NDVA 2IQ0A 3B0UX 2C14A 3ZVHB 3CT7A 3E9AA 4H4IA 5G4EA 1N7KA 1WKDA 4R7OA 2HPIA 1JZ6A 3PUEA 4I7UA 4UR7A 3S2NA 1GORA 5E0KA 4R3UA 3SCTA 3C52A 3DU0A 1OM0A 3RLVA 1V79A 2B0MA 3BSMA 2V3FA 4MKNA 2JKPA 2OLHA 3PC0A 3P61A 4J5NA 2C0AA 1XIGA 1JUBA 3MV11 1MW2A 1V3HA 5CC3A 4WDTA 4G8TA 5IFPA 1XS2A 3FFSA 4AIEA 2GOKA 3C0LA 3L4TA 2C15A 3FNDA 4GOAA 1JCJA 2V5LA 1R9ZA 1RK6A 4LB3A 2AKZA 2OR2A 1DJNA 1YKWA 5HPOA 2E8YA 4IP4A 1FQ0A 2WJDA 2V82A 1UJPA 3GDBA 3M0YA 1V4YA 3ZLFA 3BMWA 4MHBA 2Y8KA 4K36A 4UQAA 1B3WA 3DBPA 5C2CA 2WQPA 1IXNA 1PEZA 4RE2A 1OBAA 2YSWA 4F2UA 4HYWA 2Y7FA 1CYGA 2JBMA 3CYJA 3CLMA 4QSFA 5CCZA 1BXCA 3L66A 1DJHA 3WLSA 3A9IA 4B91A 1US0A 5GNZA 2QMJA 3I4EA 1S2WA 2VUYA 2WC3A 3L5LA 1WB0A 3TW6A 1BG4A 4QM1A 1KRAC 4AVFA 2X2YA 3DFYA 1H62A 2Y88A 4B3KA 1ZB5A 1D8WA 4RXFA 2P3ZA 3O07A 1LF1A 2O56A 1E6XM 3VIFA 3BW2A 1ECEA 2VC7A 4Z2KA 3WMSA 4K1WA 1TVNA 1OF6A 3L65A 2QIWA 5F4WA 3W1QA 2EPOA 4NXKA 1W9PA 2ZRWA 4AVOA 5IOBA 2G4JA 5LKYA 4GI8A 3CUFA 1F6YA 1ZBCA 1KKRA 1VR6A 1WZKA 4AZ6A 1XGDA 4GA8A 3IGHX 5AHFA 2YW3A 3CZGA 3M7WA 5BWAA 2O9PA 2RJGA 1E6PA 2JALA 2OKTA 3SQMA 2JFEX 1MYRA 2W4XA 5BWFA 2WLYA 4MY9A 3SDOA 3PZUA 3W2LA 5JUVA 3N12A 1WPCA 4MLRA 1OCJA 1TR1A 2UBPC 3DG7A 1V6YA 1RJRA 4L1WA 3ATYA 3KL0A 2R82A 2WKJA 4W4QA 1ZFJA 4NZ3A 1EPVA 2O4QA 1ECQA 3MMUA 5DFAA 4JQ3A 1GOKA 2GJLA 3S5ZA 3TYBA 3CQ0A 1IR2A 1LLWA 1EP3A 4HNVA 4XBJA 2D1ZA 3LMYA 2WNQA 3JR2A 1YDOA 2DQWA 1R2TA 4F79A 3D6NA 3WLMA 3IGUA 1A49A 4DN1A 4D1IA 2PDHA 1X8CA 3HFYA 2VC9A 2VURA 1NF0A 2DEPA 1HVXA 1K9DA 4HP5A 1I60A 1KM5A 1ZAJA 2ONEA 2VX6A 2I57A 4UQDA 2BDQA 3GZAA 4MPKA 3E38A 2QCCA 1Q4WA 4XO6A 5C9WA 3B8VA 2GUBA 4C6OA 1CT5A 5AN7A 4EXBA 4AMCA 3UYCA 1JNDA 2PF8A 4DYJA 2WSQA 3G1HA 1XIMA 4JCLA 1OVDA 1ZP4A 1ZLPA 4AVNA 1PCKA 1XYMA 1DE6A 3LGGA 3U5YA 4NILA 4AD3A 4HA1A 3KRBA 3PF3A 4B5VA 3CUJA 2NV9A 4HZ7A 2VFEA 5AY7A 1WDDA 2OEKA 3C56A 4PTXA 2WAGA 1UKOA 6ENLA 3LPOA 3EKZA 1E4NA 1BAGA 4PTVA 3W7GA 3GFYA 1XBVA 2W67A 3LA4A 2E5BA 4Q4OA 1Q63A 1SO6A 3UFYA 3DHPA 1KR0A 3AHTA 3S4TA 1VFFA 1EJVC 3WUBA 1OGGA 4DWSC 4GQ0A 3NA8A 2VEPA 1GKRA 1XL9A 3C86A 1NIUA 3WY1A 4FP1A 5FF3A 1IGSA 3LMZA 4K68A 3H2OA 6TIMA 3W22A 2Z2AA 5H91A 1R9YA 3KCJA 7TAAA 1S2AA 2QCNA 4QJ3B 2AMGA 3QPYA 3MVIA 4TX8A 4FLQA 3S6DA 4UTKA 2P5NA 3I7SA 6REQA 3CV1A 4E8DA 1HJSA 3WBEA 3NQ8A 1C8VA 1KTNA 4RV3A 1JPDX 2D0HA 4MKSA 3C6CA 3MKKA 2WMJA 1JG9A 3T78A 2GOUA 1BYDA 4K8GA 1WUFA 4Q4MA 3KRZA 3W7RA 2VQTA 2Z1SA 3SUWA 4QRNA 3BSGA 4AIOA 1O1ZA 4N4QA 4IMDA 3WDQA 2JKEA 4HVXA 2PBOA 1PUDA 3KOYA 2OZ3A 1AW5A 4GZEA 1MI3A 1V6VA 3AIWA 3S9IA 3LLXA 1VS1A 2HISA 4L5ZA 4ZCWA 3PPHA 4ZVJA 4UUIA 1HL8A 3CUIA 1KW1A 4EE9A 3KM8A 4QDWA 4HQVA 1NFBA 5LXXA 3R13A 3ABRA 3L4XA 3R12A 1XI3A 2EG7A 3K4AA 3LDVA 4XZLX 3BMVA 1Q13A 1AL7A 3TYZA 1EC8A 2C13A 4ZTYA 1BD0A 4E3VA 1MVYA 1AMKA 3H8AA 4HMCA 1RD6A 4MUZA 1SFLA 3IK4A 3E2QA 3TFXA 3W0KA 3MB9A 1NARA 4NYUA 3PBVA 3LN3A 1OK6A 2CERA 3AIBA 3KFTA 2NLYA 3VNZA 5K3VA 4RW3A 3WJYA 2I9UA 1W0MA 1FDZA 3SR7A 4JKMA 3OBKA 4HNTA 2WMGA 1PZ0A 4CQ9A 3WF0A 1C7SA 2R1KA 4HOXA 3D0CA 1R30A 3RAOA 2E8ZA 1FWHC 4LEQA 1GVFA 4C6PA 4FB7A 2QJJA 1PDZA 2P50A 1RP9A 4NI3A 1OFRA 3DGBA 3PZVA 1AFSA 3G8EA 1SMAA 4NAFB 4NX5A 5BOFA 3W7MA 1CPUA 1PVNA 3PJUA 3VOHA 2J8GA 1V02E 1Q2RA 2ZXAA 1DJQA 2PDXA 3WBWA 2W63A 3BOXA 3II1A 4YS1A 3HM7A 3U48A 2VWTA 4NUWA 3UR7A 3CB3A 3IGSA 1BPLB 3GC2A 1J01A 1FP9A 1W5NA 4K37A 2GVLA 2CZDA 1TJ0A 5HR7A 3N11A 4BZYA 3RG6A 1W9XA 4XKMA 3IUIA 4IG2A 1FKXA 3QM3A 1HGWA 1A3HA 1TB3A 3QGKC 4JIEA 1KFEA 2ZXDA 1H7NA 1X8FA 1E43A 3NQFA 4A3RA 1S5MA 2GVEA 5LA1A 2AGTA 3MU7A 1IT8A 1XLEA 3H21A 2MUCA 4WJEA 2CBVA 4HTBA 4QIUA 5AC8A 1XQKA 3P2VA 1DTUA 1UZ1A 4DWSA 4RPPA 4UFLA 1I8JA 3RR4A 2DORA 4H8NA 3P60A 3KHJA 3LBOA 2INFA 1H7PA 4EOUA 3MP3A 4F40A 5CPNA 5AZ1A 4M1RA 1AMYA 1WBJA 2UY5A 1KM2A 1SFTA 3VNIA 1O1HA 3I6TA 1GJUA 2E09A 4JYDA 3PG9A 4MM1A 4DQWA 2A1YA 3RRXA 3BXWA 1X6NA 1LTDA 3VD9A 3KOWA 3PSWA 3W07A 1XRSA 4RV8A 1YNYA 1Q8JA 4AZGA 2JKAA 3LV5A 2HXUA 3S1WA 3P62A 1Q6FA 3KP1A 2GSHA 3R2GA 2MANA 3VUPA 4YVXA 4B5TA 2C19A 2J6VA 3ID7A 4ZEPA 1PE1A 5JBFA 1YMYA 3ELFA 3QMTA 1EBGA 1AK5A 3TSDA 3U2OA 3HQPA 1F9CA 3S9ZA 3NQDA 3WLLA 4PYSA 4DM2A 2PBGA 2EAWA 1T8QA 1PZ3A 3KTSA 4PA8A 2Z1BA 3B4YA 3Q37A 2QPUA 1SR9A 3DYPA 3TQKA 3CB8A 3FAXA 1FHDA 1SJDA 4I9AA 4KF1A 1CW2A 4G1NA 3QFWA 1FVPA 4LTSA 4KFNA 5F4SA 7XIMA 1K8YA 3TLLA 1OB0A 2R6OA 4JFVA 4I6KA 1X1OA 3DENA 3R0DA 4Z2GA 3S46A 3DFPA 2GYIA 1TV2A 1Q66A 4JIQA 5LNWA 4WCJA 4NASA 5C71A 4CGTA 4IXXA 3G1RA 3C0QA 4ROPA 1BWLA 1F2JA 2VR4A 2QDDA 1GW1A 1QDSA 1UBSA 4GC3A 2Z27A 4OGZA 5CSRA 4AD5A 3UNDA 4C6KA 2VM8A 2J78A 3DFHA 1CX9A 4J2MA 4YPJA 4XD6A 4ADUA 1EFZA 4C6CA 4MWAB 5A94A 1ZJBA 4J40A 2NWRA 5KITA 1XD1A 1BGAA 3NURA 2CWNA 1XSKA 3IJQA 3W82A 3O3RA 1KQYA 5HXMA 4AY1A 4H9ZA 1TTIA 4U4MA 2QVHA 3XISA 1TUFA 5F2GA 4PC8A 1P48A 3GKAA 2GSEA 3NL3A 3D5HA 1ITQA 1T40A 4GI4A 1IEIA 3O9NA 5LNRA 4UR8A 5JH2A 1EQPA 4PN2A 3GVWA 1I2PA 5HWJA 1R8LA 3AZTA 3THUA 3CL6A 3FAWA 4BI7A 1QNSA 2PWEA 2VX7A 5HNUA 4DBUA 3I3EA 3TJXA 1X7FA 4FSAA 3STEA 4AF0B 4BS0A 4MYAA 3W7IA 2C18A 2BY0A 4YTRA 4IM4A 3QGAC 1EA0A 4GYKA 3MI3A 3M5ZA 2QGYA 4AUBA 2ZFAA 1CXKA 3CIWA 3P5YA 3S6TA 4ML9A 9XIAA 3D3AA 3WFZA 1RUSA 4IMEA 3M5YA 3E5BA 4WXZA 1S2VA 3WIJA 3QGVA 2X7VA 3WJSA 1TREA 3VD3A 1Q6CA 1ZPTA 3DIPA 2E9BA 3TQPA 1HNYA 2VZUA 3UCDA 1LQ2A 2CPUA 1FP8A 2QQ6A 1XYCA 1OZMA 1WKFA 3G24A 4QQUA 2GGHA 1P4CA 2WMIB 1HP5A 3MJYA 1XLKA 1LUCA 4YMZA 1YQ2A 5ECUA 2BOGX 4DBSA 2ZZ7A 3BARA 1O4UA 3A3HA 3NNTA 3C0SA 1K03A 3N3MA 5HJYA 2YBUA 5D9MA 4LRTA 1QT1A 3VOGA 5KSWA 3TWBA 1N8IA 2V3DA 1WXYA 2G3NA 3LUTA 3MUIA 4FOKA 5I3JA 4GPNA 4JCMA 2IPFA 2G5WA 2BZNA 1KBIA 3GNOA 4H00A 4QBXA 2F6UA 3RR1A 3VKBA 2FYMA 5MHBA 1UJQA 3N2TA 1LRNA 5FD0A 1TWIA 3R79A 3AHYA 2HVOA 3ZJ8A 1GG1A 4ZXLA 3F4WA 4IPNB 1VCFA 3L7RA 1W3JA 2GJNA 3QZEA 1H11A 4GABA 1PSCA 3KX6A 2GDVA 3T81A 1HXJA 4RW5A 2BG5A 4JTRA 2HVMA 4WGHA 1BRLA 2FZ9A 2GPTA 4W84A 1HIZA 4A3UA 1H1ZA 4WJXA 1DXFA 4YN5A 4UTHA 3T4CA 5CKSA 1CCWB 3HQOA 1NOFA 4ZO9A 4BI6A 4WDXA 3KDNA 3RU8X 2NWSA 2FJUB 4A6GA 1VJSA 2P1FA 4QJ4B 2OPJA 1O66A 1W2PA 2BVWA 4Z08A 4XAFA 3V1HA 3EMCA 4H6EA 2J79A 3ANUA 3K4WA 1UD5A 1UASA 1D3CA 4PRRA 5B7ZA 1K4GA 3ECQA 3I10A 3NSMA 1RV8A 3MSYA 3SCOA 1KTBA 4IFRA 4MZYA 1S39A 3M0XA 4EF8A 2NQLA 3TQ0A 1TPWA 1PV8A 1G5AA 5K4XA 2YZRA 2ZA1A 3G1VA 2IPWA 1K70A 4DAIA 2RJHA 5D04C 4CNNA 5J5DA 4UQBA 3UR5A 3L67A 1UR8A 3QR1A 4M8UA 3O6CA 3WF4A 4UFJA 3GR8A 2PDGA 2XZ7A 4AAJA 2XH7A 4XBSA 4QROA 4P2VA 4UQCA 3IV8A 3CEUA 3BW3A 1VBHA 1VQTA 3GRIA 4O17A 4XUYA 5C6MA 4MWAC 3WZ0E 3S83A 2REQA 5D38A 1ZY9A 2YXXA 1J0YA 4TXEA 5DXYA 4GO9A 2DU2A 4HU4A 3L4UA 3H2MA 4MJ4A 5T26A 4P7OA 3SBFA 1YXDA 4C6BA 3C3NA 4L7ZA 2QUTA 4US5A 2NLIA 2NQ9A 4NQ1A 4NNAA 3GU1A 1KKOA 2X2GA 3I7RA 1KNWA 1F8MA 4Y8EA 3W1PA 2QNEA 5GJPA 3TQVA 1IR1A 4IJRA 1GHSA 4ROQA 3U2EA 5D2YA 5ABFA 1NWRA 2ACRA 1EXPA 3M16A 5BXSA 3PWAA 5BZAA 4RZ6A 1R87A 1XRVA 2Y24A 3OVGA 2V63A 3O63A 3S47A 4FNTA 1A5LC 3MP5A 1CGXA 1OWQA 4ZR8A 1ZBWA 3T40A 4QLKA 1QHZA 1I0DA 2ESCA 3KBJA 3WENA 4Z2JA 2PDNA 4PCSA 2GWGA 4DPQA 1Z7AA 4ZQPA 4H9UA 4K2SA 2WBGA 2E25A 4O1AA 3P67A 3EPMA 3UXKA 4WDWA 2OCZA 3M5VA 3VDBA 1OG0A 2NXHA 1VH7A 1I1WA 4GY7A 3IIVA 2V3EA 2GQ9A 3MO4A 4HZ8A 4FF7A 2BXZA 1OINA 3GVVA 1PZ2A 1W3LA 3V4BA 3P84A