5E93A

Crystal structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with neq0071
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
313
structure length
313
Chain Sequence
b'MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Exploring Trypanosoma cruzi Dihydroorotate Dehydrogenase Active Site Plasticity for the Discovery of Potent and Selective Inhibitors with Trypanocidal Activity
rcsb
source organism Trypanosoma cruzi strain cl brener
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 110
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2015-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 5e93A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5e93A01
2NXGA 5F4SA 3GDLA 2DJXA 2XN2A 4GFSA 1TV7A 3W7HA 3KVJA 3EKLA 1MZHA 1P5BA 5FEZA 3EX2A 3NAVA 5FI8A 2YFNA 2Z6IA 3KRUA 5K4ZA 3I7SA 3LHZA 4S1FA 5IBXC 2AQWA 4JGDA 3EX3A 4ZQPA 2NWRA 1VYPX 1IIHA 3P5YA 3NQAA 2X16A 3M47A 3VFLA 3KAOA 3P81A 4U28A 4RX0A 3EKZA 3NOEA 4YMZA 4IUOA 2OT0A 1JRCA 3W7DA 1WXJA 4CLMA 1T8XA 5E0KA 1W3NA 2W79A 2J9XA 3WK2A 1Q3NA 1F76A 1GVQA 2VENA 4N9BA 4M7SA 1W37A 1AW5A 4JX4A 3WFAA 1TTPA 1XBXA 1TRIA 5I3HA 4U4MA 4DEFA 3C2FA 4O8RA 1UUOA 4FNTA 1OJXA 3P82A 3SY5A 2Z1BA 3DKLA 4P61A 1V7YA 1VGAA 1XM3A 3YPIA 3CQ0A 4JICA 1OK6A 1AL8A 1JVNA 3GDTA 4BK9A 2RDUA 1OFAA 4O1CA 3R8RA 5ABTA 4H6KA 1H7PA 1EX5A 3BV4A 3LCXA 3NXFA 1IXOA 1F05A 1YPFA 4Y90A 3M41A 2AAMA 1LBLA 1RVGA 1MSSA 3W85A 4AHOA 1YDNA 2YX0A 3NYZA 4YCPA 2VEMA 3N9SA 3PVFA 4NNBA 4Z0SA 3ZFHA 4RZ4A 4XKYA 3EWXA 3GAYA 1F5ZA 2ZZ4A 1XC4A 3L5AA 3GNNA 3LCLA 3LCFA 2JK2A 4NJKA 4PEKA 1XUZA 1ME7A 4JN6A 5HWJA 3TE9A 3SI9A 1ZNNA 4QJ1A 3FYPA 4E2DA 4KFPA 3GKAA 4MJZA 3THAA 5K2ZA 3LTYA 7TIMA 2JKPA 2WSYA 1WA3A 3NM3A 1J2WA 3IIOA 5CZ0A 4MKNA 4FX8A 2QCLA 3GZ3A 1MO0A 4X9SA 3QRHA 4JY9A 1KLZA 4DF1A 4RLIA 2CU0A 2YW3A 5CSRA 3LV5A 5DBUA 1ZAHA 4DXVA 1GVFA 3L66A 1A5CA 3E02A 3LBCA 4ORMA 3WJSA 3T44A 2RFGA 4N4PA 5LHEA 1L6WA 3ABRA 4IX2A 3BG5A 1EA0A 5CPMA 1UJPA 2E1DA 3TCEA 2C14A 5DBTA 1VJIA 4BWLA 1OX4A 5DXXA 1ALDA 1QDSA 1XDLA 3QPZA 2DP3A 4BI6A 1XL9A 4ORIA 4KWVA 4YLWA 5LSMA 3S0CA 2QUTA 3HQ1A 4BR1A 3NL5A 4LS1A 5D33A 5HR6A 3CPRA 2YPIA 3QMTA 4ADTA 5DN1A 5K4XA 2ISVA 3S1UA 3W75A 4Q4KA 2UV8G 1W5PA 2NWSA 3HPXA 1BWLA 1DKWA 4L4MA 3QEZA 1X1OA 4K6AA 3L5MA 4HPJA 4MY9A 4O0KA 3UNDA 1LLZA 3SJ3A 2J88A 4HSOA 2Y61A 1TPC1 3P62A 2WNNA 1FY6A 2J9ZA 5AHFA 4JIQA 3TK7A 1OHLA 3S5ZA 2YYUA 1TPB1 3W2NA 3VI2A 2WQPA 4LNYA 4JXCA 4UC5A 1Q6QA 2WV8A 3BG3A 5LNUA 5CG7A 4S2CA 2ABAA 4CQAA 4IPIA 4A21A 3IGXA 3L68A 1KFJA 3BW4A 4JTLA 5K9DA 4PH6A 1KV5A 1R2TA 1SZEA 2WJZA 5I3GA 4ADUA 4K7YA 4M7TA 3SSJA 4ALDA 2PURA 2C13A 4IWWA 1RQEA 1W5MA 4M6QA 1G4TA 2ZFAA 1SO3A 3S9YA 4LVBA 3N14A 1K8ZA 4ZQRA 3NQVA 3U6WA 4D2JA 5E93A 2EPHA 5CPLA 2EGZA 4Z1DA 2E5DA 5HUOA 3W1XA 4DPPA 3FJLA 1K02A 3S1XA 3G1SA 1GVOA 1I45A 3LHUA 2VFEA 4FNUA 1JCLA 1G7UA 1SO6A 3L21A 3LRKA 1PV8A 2H6RA 4OV9A 5D03A 4N02A 2I9EA 4MUZA 3W7QA 3OHIA 3GXPA 2WSQA 2X1TA 2J6XA 1XXXA 4O4WA 1WAUA 1G4PA 3LB0A 4PTNA 3T40A 3QC3A 3O16A 4EOUA 1XCFA 3ABQA 4Y8FA 4PL1A 1H63A 2E09A 1SSGA 2PRMA 3OG3A 3TC6A 3M43A 1TQJA 4LS0A 4R53A 3QSRA 1HO4A 1MEIA 3NPUA 1QMLA 2Q8LA 5U7SA 1DV7A 5D04C 4JNMA 2VFGA 3HF3A 1OF6A 3G8RA 3UQNA 4E0CA 1QCWA 3P8JA 3MI3A 4XQ6A 1KM2A 3F4WA 4UTUA 2NX9A 3HBLA 4UTWC 3I65A 4I7VA 4R33A 3E0IA 1LTDA 2FPVA 5LKYA 8TIMA 3R89A 1TYGA 1PL9A 2G95A 1B57A 1KM6A 4BI5A 1ZJIA 3S1WA 1H7NA 1LYXA 3FOKA 3O6YX 3MP3A 3GDKA 4RZ5A 4JTTA 4Z1AA 4ZQNA 5BW6A 1FX6A 4N4QA 1H50A 2YCEA 2V5LA 3A21A 4FIQA 3H54A 1EB3A 5D30A 4NU7A 3P7YA 4Y6GA 2ZZ6A 2BXVA 4LOCA 2TSYA 2ISSA 1QNVA 2X1SA 1IGSA 1Y0EA 4IGHA 2FIQA 2FJKA 5FF2A 4AH7A 2FB3A 3GVGA 1R46A 3RF9A 2QCDA 2R8WA 3TW7A 3NVTA 2O7SA 4NZJA 1IF2A 2GVGA 3NPVA 3DFSA 3N19B 3PAJA 4IMGA 4YL2A 3LCWA 3W2JA 3P84A 4FNSA 2C15A 2TRSA 3W7EA 5C6MA 4UTLA 4MYAA 1SO4A 1FCQA 2E77A 1TV5A 2AGKA 4OBTA 4LV4A 5D38A 1FBAA 2WNQA 4JYDA 3C2EA 3GYEA 5FF7A 2E6AA 1G6CA 4XWUA 4CQ9A 6ALDA 5I3IA 4RKAA 4UTTC 4KFNA 4RXFA 3TAKA 5HULA 4ZQMA 3LDVA 3S5NA 2DU2A 1SU5A 4HN4A 1W54A 4GUIA 3QM3A 1TPEA 4UXDA 4O4VA 1TPUA 1KFLA 4AHPA 4N9CA 4UFKA 5KZDA 2QKFA 5I3JA 3W1TA 3HPSA 5HQEA 3GXTA 2EAWA 4UFHA 3W1RA 3QF0A 4JDYA 3PB2A 3S8HA 1OX4B 3LBMA 5G5IA 2QAFA 2QCCA 2W6RA 2CFFA 3OVPA 3O63A 1NAL1 1KM1A 5EPDA 2BSLA 1FWRA 5G1TA 1F73A 1SQ7A 3BLFA 1PE1A 3G3DA 3HJZA 3SZ8A 1VHCA 5G2WA 2Y7FA 3C3NA 2VEPA 2WSRA 2C19A 1SW3A 1UB3A 4LVGA 1XUUA 3PG8A 3ZWSA 4NUWA 3GNDA 2V2CA 2YFOA 3I7RA 4UFJA 1D3HA 3W2MA 3EXRA 4OWGA 3W72A 1H7OA 1G67A 3FA5A 2JGYA 3NEVA 1ZHAA 4TU1A 4A2SA 3Q37A 1NF0A 3EXSA 3NQ7A 3EB2A 3KFTA 3TSMA 1VLIA 2A7NA 5K9XA 5AC7A 2C6QA 3NQDA 4EWND 5CZJA 1AW2A 1B3OA 4POCA 2OZ0A 1TJRA 2Y85A 3K30A 3DGRA 3OVQA 1T96A 4A2RA 4AHQA 1RQHA 3CT7A 4XBSA 3DH7A 3RFAA 4HSNA 4O54A 4K7VA 4IPJA 1GG1A 4Q33A 4MFEA 5D2WA 2TMDA 3TJXA 2VELA 3UD6A 1VYRA 3MJYA 3EWUA 3FFSA 4H3DA 3W22A 2FPTA 2GJNA 1JUEA 3GKFA 4UFMA 3TJLA 2X30A 3L0GA 5F2LA 2J9YA 3HGOA 3NPWA 3QMRA 5HWMA 4QITA 3RLVA 3STCA 4LT9A 1GTEA 4Y9AA 3G1YA 1QFEA 4EIVA 5IBXA 4QNEA 2ZRXA 3LOTA 2Z0IA 1JUBA 1H51A 4O12A 1A5BA 1F6KA 4XZ9A 2ATSA 1GVSA 1OFOA 3O06A 3SGZA 1GPWA 3QJAA 2JKAA 1C29A 3LTPA 1KTBA 2JGQA 4IMCA 4NNCA 2WKJA 3STGA 2NV2A 1G4EA 5LGXA 4MIMA 3RMJA 3WK3A 4JYFA 3PG9A 1OABA 2ZRVA 5FEXA 3CHVA 2V2HA 3W7JA 1JUKA 3O1NA 5LZLA 2YGYA 5CSSA 4PL2A 1EWDA 4QNWA 1Z41A 1I2NA 3EWWA 2ZZ1A 1HUVA 4HNUA 2YW4A 3VE9A 3G0XA 5D09A 4DF0A 3LXBA 3CU2A 2VOMA 4GWEA 4IQLA 4LRTA 1Q6OA 3HG4A 3EX1A 3C61A 1AMKA 2A4AA 1K8XA 1LP6A 2P1FA 3W3OA 4HPXA 5J5RA 2JBMA 3GXNA 3TSDA 1OVDA 3STFA 1LBFA 3MW7A 5CKSA 3W73A 1SUXA 1ZFJA 3UPBA 2B4GA 4O50A 5DELA 1RD5A 1FDJA 1H7RA 3DFNA 3S6DA 5G1YA 4LVFA 2H8ZA 4PC8A 1YXCA 2NV1A 3NL6A 2ZTKA 5AYYA 4FX7A 3NQ2A 4C1LA 3PC0A 5BOOA 1PHQA 3ABSA 1FCVA 2LLEA 2E5CA 3G1AA 3Q2DA 3ZR4A 2QCDB 3EWYA 1QWGA 4WXZA 3IIVA 4MZYA 1TPDA 2DZWA 1MXSA 4X3ZA 2NXHA 2X1UA 1SO5A 1KFBA 3TKFA 2V5BA 2NUYA 3DFQA 1GJPA 1RV8A 1EWEA 4PA8A 4ZQCA 2PCQA 1A50A 3ZS4A 1YDVA 1FCBA 4BFAA 3MYPA 1SPQA 2HSAA 3STEA 3M5VA 1LLWA 2X2GA 3M5ZA 4MFDA 4JD4A 2J24A 3DXIA 3B0UX 1HO1A 3OEXA 1WV2A 3INPA 4GXMA 1JULA 3TU9A 3IVTA 3GX9A 3N3MA 1PCWA 1EEPA 3B8DA 1M7PA 1FCUA 4MLRA 4EF8A 4X2RA 1L6SA 3I6RA 2B0MA 1DORA 3W2UA 1PS9A 3TIMA 1HFBA 3NL3A 2RKXA 3O8AA 1G7VA 3W1MA 2CLKA 1VS1A 2A6LA 5GVJA 5C2XA 4KFOA 5K3VA 5HINA 2B7PA 3MO7A 4Z1CA 3UYCA 2QCEA 1H7WA 3DHFA 3KXQA 4M6VA 5FEWA 3JRKA 4PODA 3UXAA 3JS3A 3CC1A 1L9WA 1PHWA 2ZQ0A 2ZA2A 2NX3A 1GQNA 5HMSA 1UCWA 3R5EA 4UTKA 2A0NA 1XFBA 1EUAA 3PS7A 3SR7A 1U5JA 3PSWA 3HGSA 3NQ8A 3G22A 3NQMA 1GWJA 1W1ZA 3LLFA 1NF7A 1TRDA 3W74A 4WY0B 1R47A 1TPH1 1ADOA 3KVKA 5AHEA 4LUIA 3W7PA 4O18A 1EUNA 1BWKA 3PUOA 1Z42A 5FF3A 3NDOA 3HO8A 5EYWA 1N8FA 4GJ1A 3E49A 3L5LA 1TTQA 4NX5A 5BMXA 5CPOA 4JY8A 5CPNA 3E96A 3SFKA 3MP4A 2CZFA 2XFWA 3F03K 4HNVA 2QUVA 5G4WA 3HOJA 2VFDA 5F2GA 4E2BA 3W07A 4EVZA 2QJIA 3TROA 3SGUA 3TH6A 1LZOA 4N9EA 1RPXA 3P74A 2ZCGA 3C56A 1A5SA 1CX9A 4MOZA 1CI1A 3FIGA 3OA3A 5DLCA 5KZEA 1M7OA 3O6DA 3T78A 1TCDA 1VZWA 2VXNA 4O1AA 1G69A 5I3FA 2YZRA 1WX0A 2OMAA 2WPBA 5J5DA 3T7VA 4X22A 2CLFA 4JYEA 4UFLA 5AHMA 4A3UA 3A5FA 3GK0A 2CLIA 1R2RA 1T99A 5TBOA 1TB3A 1O95A 4WQ6A 4JTSA 5K9CA 5DXYA 4AB4A 1IXNA 3QPYA 4W9TA 5AC8A 2A7PA 3W7RA 4O16A 3UY7A 5HNRA 4O17A 3AO0A 1P0NA 3A5VA 3HB9A 3BG9A 3NZRA 4O52A 3DFOA 3EEGA 1Z48A 2NLIA 2I14A 1T0OA 3U2OA 2Q3RA 3DENA 1GVRA 2VEKA 2G5WA 4CCEA 3EX6A 1KV8A 5MHBA 1BEUA 3W7NA 3P60A 5F2MA 4UTWA 4IMFA 3TA6A 4NVTA 2JKEA 1WBJA 2HTMA 2FFCA 2DZXA 3G0SA 4GUJA 1BTMA 3MMTA 2Y7DA 3P8IA 3NQFA 4OHQA 3PBUA 3BARA 4WUIA 1FWWA 4LC8A 3TFXA 3W23A 1LRNA 3VNDA 3C2VA 3W7LA 1QPQA 3PBYA 1DJNA 3IV3A 1I2OA 3M7WA 5SWUA 4JR5A 3DU0A 1S5TA 3TSBA 4O11A 4HIBA 4FNPA 3LGEA 1JRBA 3TQVA 2YR1A 4TMBA 3PY2A 2NZLA 4MZ8A 5EKYA 4NZFA 3S1VA 2C3ZA 4MPQA 2B7NA 3LRLA 4O0ZA 4HKPA 2A1YA 1EP2A 4DO4A 1DQWA 4DO5A 3GB6A 1OFQA 4HNNA 1K7XA 1KM5A 5AYXA 5AHLA 1QOQA 3G1HA 2F84A 3W7CA 3BVJA 4CCCA 1FWSA 4LWWA 4O19A 1KFCA 1JCNA 1ZALA 1ME8A 2E68A 4UR7A 1KA9F 3G18A 1UUMA 1SZFA 2ZRZA 4R34A 1K3UA 3LRMA 4LVDA 3TUUA 1LCOA 5T26A 1TTIA 4UTTA 4LV9A 1JCYA 1VCVA 1GEQA 3AJXA 5LNRA 1FWNA 3PM6A 1K7EA 3CIXA 4JTFA 2PE4A 2HS6A 2FLIA 3R12A 4UMCA 2RH9A 2QDHA 1OFBA 1YPIA 4UTMA 4IMEA 1TSIA 4ML9A 3L67A 5KITA 5C5YA 1TPWA 2V82A 5HJLA 3W2KA 5AC6A 4M6PA 4LY8A 4FIRA 2V2DA 3BW2A 1FXPA 3W71A 2QDGA 1QAPA 3VKJA 3LLDA 2C0AA 1GTHA 3MHUA 4TO8A 5D05A 3QW3A 1S5VA 4QIUA 1LRQA 3PUEA 1W31A 3BW3A 5KZMA 1B4KA 1OYBA 2ISWA 4FO4A 1KW1A 3DFTA 3W7KA 2A7RA 3TX9A 3BO9A 2QAPA 3CTLA 1HTIA 4ZL1A 1V5XA 1HL2A 4FNQA 3NA8A 3RU6A 2DZUA 4QSHA 4OT7A 2VFHA 2Q8ZA 2ZZ5A 1YTDA 4LTSA 4MYXA 3UZJA 1DQXA 3DKJA 1SW7A 2PC4A 4E38A 3TQKA 3MI2A 5CZTA 4UNLA 3UZ5A 4K38A 3FYOA 3W83A 3MWAA 3W9ZA 2GVLA 3TQ0A 4IOTA 4NXKA 4RCXA 5AHNA 3C52A 2FQIA 1A53A 3NR0A 4WY0A 1M5WA 5KSWA 1KM4A 2H90A 1H1ZA 4JX6A 2C18A 3IGSA 3LHTA 4MVAA 4K8HA 2GJLA 3M5YA 2ABBA 3JR2A 2Y7GA 4ZQOA 3W76A 1YADA 2Y89A 4G1KA 4I7WA 3QYQA 1P0KA 2BLEA 3HIJA 1YXDA 3G24A 1SZNA 2EF9A 3N73A 5F2IA 4FEZA 3KRZA 1XBVA 3KRSA 2CLMA 3DI1A 1SFJA 3W1LA 3HMJG 2OT1A 3DFPA 4WJEA 1OX5A 2B7OA 2E5BA 2CZEA 1KFKA 4WZHA 3BK0A 3BLIA 4KKXA 3HGRA 1LRTA 3O6CA 3LV6A 4DO6A 3T55A 4WXYA 2CZ5A 4GE8A 2FDSA 3W7OA 1C9DA 3TR2A 3MHFA 3L2IA 4HNTA 4N9DA 1OX6A 1ZAJA 2G96A 3PB0A 1S5WA 1ICSA 3LCIA 3NPXA 5H2ZA 2Q3OA 1B9BA 1LORA 3P5ZA 3WK1A 3LCGA 4XBKA 4AWUA 5HUPA 1KTNA 3FKKA 3LERA 3O05A 4OE7A 4TX9A 4B5NA 4LW7A 1ICPA 5FF0A 1I4NA 2CLLA 1FUYA 1RR2A 4LRSA 1F7BA 4DQWA 1H7XA 1QO2A 3NM1A 4NT0A 2EHHA 4I7UA 5BNKA 5D32A 3WJWA 3QQ0A 4UMAA 2Z6JA 4PFMA 4QM1A 3M9YA 1E51A 2WNZA 3HG2A 4Q32A 1M6JA 4ONVA 2CZDA 3FLUA 3NL2A 4KWWA 5DCBA 3GR7A 1FXQA 2ZBTA 4DF2A 2QCHA 5KTLA 1H61A 1X6UA 3DI0A 5AB3A 5BMWA 3QZEA 3FJ6A 3P61A 2CLOA 3ANYA 4YCOA 3N34A 3LHWA 3M0ZA 2RHGA 3IGUA 1QPRA 5AFDA 2RDTA 4IMDA 4TIMA 4N6EA 5DY3A 2NXIA 3LI1A 2G97A 3CWNA 1JQXA 3V1PA 1Q45A 1ZCOA 3UWYA 1PIIA 3UY8A 3B0VC 5IM51 2GQ9A 2QCGA 1S3HA 1N55A 2QJHA 4LS2A 1W5QA 5A8GA 3S5YA 2ZYFA 3NZ1A 4DPQA 3W1AA 2YDAA 4Z0JA 4GRSA 3BLEA 2A5HA 2Y63A 3L9CA 1ICQA 2VKZG 1UASA 3T4CA 3QSTA 1W8SA 3QMSA 4FNRA 1MEHA 2BX7A 3G1VA 1ONRA 1ZENA 4S2BA 1YTEA 1MEWA 3NNTA 3A22A 3KHJA 2PRHA 2NUXA 2QJGA 4K39A 1O4UA 4AF0B 2H3BA 1VCGA 2DZVA 2RDWA 3R2GA 4O53A 3TMLA 2ZTJA 1D9EA 3E9AA 5HR7A 3FEMA 3ABOA 3PBWA 4Z08A 1FQ0A 5EBUA 1U83A 2O7QA 4AWSA 2E6FA 5C54A 3G1FA 3I68A 1O5KA 2E6YA 1SR9A 1K7FA 4LVAA 3CEPA 3NGJA 3IIPA 4DBEA 4UTIA 4IXXA 1A5AA 2Y62A 4H4IA 4ICNA 3WJXA 5LNVA 4NJJA 1KBJA 4BF9A 3O07A 4GBUA 5D37A 3B4UA 1JCJA 2Y88A 4JS3A 3A9IA 1G4SA 1W5NA 1LM1A 4L4LA 4FXSA 1DBTA 3PBVA 3GIYA 3N2XA 3G0UA 4PCFA 1GYLA 3GDRA 3W88A 4NJIA 2I1OA 3TFCA 4WX2A 2V30A 2OJPA 2QCMA 2WOQA 4AAJA 3W7IA 4CNNA 4RV8A 4M19A 1XKYA 2ZRYA 3D0CA 4OU1A 5G4EA 3NG3A 1F74A 3LI0A 4OGZA 5C55A 3CIWA 2VC6A 3CLMA 1VLWA 1XDMA 3SW6A 1ML1A 2Z2UA 2C1HA 2XN0A 5I3KA 3G3MA 4ZZ9A 3H55A 2IQTA 4O14A 3F1QA 2OCZA 1WYIA 1ZY9A 4K37A 1N7KA 3QW4B 1VHNA 1WBHA 4BI7A 3MBFA 4JTUA 4NJGA 2KZHA 3MYOA 3PF3A 3KX6A 1OFPA 2TPSA 3W70A 1C8VA 2WO5A 1O60A 3C8FA 3FS2A 1W3TA 3P80A 1F6PA 1ME9A 2DZTA 3W84A 3LX9A 1X8FA 3CB8A 2QCNA 4AVFA 1FWTA 2A21A 1TQXA 2A85A 5KINA 4JTJA 3IEBA 3GLCA 2YYTA 2NX1A 4TMCA 3LTSA 1VYSX 4BWLC 1YTKA 3TXVA 5D2YA 1OFEA 4AEOA 1UBSA 1Z44A 1AW1A 1DHPA 1IXQA 2GVJA 1WDWA 4RXGA 1H5YA 2QEZA 3PULA 3UXDA 2TYSA 3S5OA 3NQ6A 1QPOA 2V8ZA 4UR8A 2ZDRA 3GDMA 3OVRA 4A22A 4IX0A 5FEPA 3SIZA 4DELA 5LNWA 1LROA 1LDCA 1QOPA 2QUUA 1GZGA 3TAOA 2DORA 3L0NA 4AMAA 1TV8A 1F2JA 2W0UA 3PR2A 3L0KA 1RZMA 1XBYA 5D02A 3MBDA 4UNKA 5G2IA 1O94A 1JCXA 1LOSA 3IRDA 2J27A 1VC4A 1IIGA 1KLYA 2GQAA 3CEUA 3NQEA 3U8GA 3M1ZA 1AK5A 1OK4A 2X1RA 4NNAA 2ZA1A 1D3GA 5L6UA 3R13A 1OF8A 3IIXA 4UCGA 3W1NA 1THFD 3EWBX 3B0PA 3Q94A 5HWNA 1SZGA 1NSJA 3HPZA 3QFEA 4NXSA 3GAKA 1Q6LA 3LXAA 2R14A 4K36A 4J9JA 2GQ8A 4UTHA 4NJHA 2CLEA 5BRBA 1KM3A 3CM4A 5CGQA 5LNSA 2DJLA 5D2VA 4UTJA 4JDBA 2D73A 3WJZA 1PVNA 3P67A 1GT8A 2QF7A 5AHIA 4O13A 3UWQA 4YXGA 5KMYA 3M16A 1OYCA 2HMCA 1W5OA 4FB7A 3MP5A 1RQBA 4LUJA 4WY0F 4A29A 2QR6A 3HG5A 4C1KA 3LM7A 5F4WA 2B7QA 2VFFA 4UUIA 1WOBA 1WOAA 3TV8A 3C6CA 4TR9A 3MUXA 2R94A 3G8EA 1GG0A 4ADSA 4JTGA 3G1DA 5TQLA 4UIOA 3HGJA 2R91A 1XBZA 1K8YA 3W86A 1TO3A 2GOUA 4EF9A 2EKCA 4YWIA 4O1BA 1I2QA 2VFIA 2XN1A 2DZSA 3OBKA 4LC6A 3S42A 5L9FA 4MY1A 1LBMA 2ZZ3A 3CWOX 2BWGA 4IJBA 1JCMP 1TMHA 3ELFA 1H62A 1SFLA 3H53A 4UFIA 1JQVA 1EPXA 3DHDA 1W0MA 1J5TA 4WD0A 3SECA 2BZNA 1DL3A 1EIXA 5F1UA 5U4NA 3B05A 3C4UA 2ZA3A 1TJPA 4XUGA 3GR8A 2ZRWA 5EL1A 4MJMA 4UMBA 3W6YA 1W56A 2YXGA 3BPWA 1SW0A 3N2MA 1WQ5A 2OX1A 2H8XA 1KFEA 1GYNA 3M6YA 1GOXA 3NQCA 4MY8A 3LHVA 1EP1A 1KM0A 4I9AA 1X7FA 3THQA 5D2XA 1AG1O 3Q58A 1IXPA 3TMQA 1L2UA 1X1ZA 2NUWA 1NFBA 4AF0A 4RK8A 2F7FA 1YDOA 1ZAIA 2HS8A 4WOQA 1YYAA 4R7JA 1QO5A 1HG3A 2Y7EA 4QISA 4N2YA 3B04A 3UWVA 3DZ1A 4JTHA 1OYAA 4M5PA 1NEYA 5F1VA 1EP3A 3W1QA 3TC7A 4ZMGA 1VPXA 3B03A 4O57A 4XKYB 4FF7A 1R30A 4GUFA 2VEIA 5TIMA 4JEQA 1Q6RA 3ZWTA 1AL7A 4AWTA 4HT3A 5EMUA 2P10A 2ATMA 3B06A 2FPYA 4JTIA 5CZSA 4CNOA 5H91A 2Y70A 3C0JA 6TIMA 3W87A 3UWUA 1VR6A 1I2PA 1KTCA 1FDYA 3O15A 1NVMA 1QR7A 3NO5A 3LXCA 5D2TA 1TPVA 3IIZA 2DZPA 3ATYA 3V75A 3BGJA 3MHGA 5A5WA 4GUHA 1DVJA 3W1UA 3KVLA 4CNPA 4FHAA 1PCKA 1LOQA 3MI6A 2CLHA 1YLVA 5AN7A 3TNOA 3QH2A 4Y96A 4DBDA 2ZZ2A 4WOZA 1I8JA 3RNDA 1FDZA 3EX4A 4JTEA 3C2OA 3USBA 1DJQA 2E6DA 2PRLA 1H1YA 4LU0A 1O5XA 4MLJA 2A6NA 5EY5A 4GNJA 5DY2A 5K7JA 2GPTA 5F4XA 1TREA 3RLUA 5FESA 3IVSA 5G2HA 4O10A 3IVUA 2QCFA 1VCFA 4O1DA 4RJEA 4OQVA 1OFDA 4P2VA 1P1XA 2Y6ZA 3DAQA 1OFRA 3C2RA 2GUUA 1H60A 3RK8A 1B4EA 1LOLA 2V0TA 4GC4A 3NQGA 4K8EA 4HHPA 5AYZA 5DCDA 5LHFA 3TW6A 3UWWA 4IXHA 1R2SA 3VCRA 1KBIA 2YSWA 4CQ8A 4RZ6A 4QAIA 4N6FA 3A23A 3UWZA 3L65A 3E12A 4QQ3A 3M44A 1YXYA 4XTDA 3W2LA 5FF4A 2BTMA 1CW2A 2CW6A 3TXZA 1VQTA 3FKRA 1I2RA 3A24A 3VE7A 3TDFA 1K03A 3KOFA 5AOUA 3PUDA 1TIMA 3QQ1A 1W3IA 1BKSA 2V81A 4AXKA 3PWAA 1DOSA 2ALDA 3PSVA 3N9RA 4JIPA 1P4CA 2P0OA 5E1QA 1L6YA 1TPFA 3M5XA 4Z1BA 5LGZA 4ZVJA 1VH7A 4GUGA 4JX5A 2ZRUA 2V9DA 3HG3A 1JJKA 2FTPA 2A2IA 2CWNA 2ZZ7A 4NX0A 5EA9A 4O15A 2H3DA 3KVMA 2FB2A 3LCHA 1J4EA 1XI3A 1TTJA 1SSDA 1JR1A 4FXRA 3EWZA 3W7GA 4OV4A 1QPNA 4O28A 4XTIA 1OG0A 3LHYA 3F4NA 3WK0A 3WJYA 4FX6M 4CCDA 3G1XA 3EXTA 3W1PA 3BGGA 3UPWA 3ATZA 4NQ1A 4JTKA 2C16A 4RR4A 1VRDA 4MZ1A 3OIXA 3W7MA 3I7QA 5DCEA 3DBPA
chains in the Genus database with same CATH superfamily
3FJNA 4LH8A 2DJXA 1TV7A 4E3VA 5A6LA 1R7OA 5GQBA 3BZJA 5JVLA 4H2HA 3I7SA 5IBXC 2AQWA 3H2AA 4JGDA 4MHBA 4ZQPA 1RJRA 1VYPX 3P5YA 1R9XA 3P81A 4U28A 1AQHA 1P0DA 2WHJA 3T2OA 3IUDA 4CLMA 3ANVA 3KCLA 1WDPA 2J9XA 3ARUA 1MW2A 1Q3NA 3U9IA 2VENA 1E73M 3Q4DA 4M7SA 3WFAA 4W4QA 3EGJA 5I3HA 2R24A 4DEFA 5I06A 3KEHA 4O8RA 4AD2A 4MAVA 1CNVA 3BJFA 4JPGA 4F0LA 3DKLA 2HVOA 2OWXA 4M6UA 1DE6A 1AL8A 4DNHA 2XISA 2RDUA 1UR1A 1TWSA 4LY4A 1OFAA 3VINA 2GVEA 1H7PA 1EX5A 3BV4A 4F9DA 1JPDX 3LCXA 4AEFA 3OU8A 4H6QA 2YX0A 4HA0A 2O55A 3RJXA 3ZFHA 3I3EA 4Q8NA 2NV9A 5FAJA 3MMWA 1OT2A 1BGGA 5HWJA 1CB2A 3TE9A 1TA3A 3TJ4A 4JQAA 3RRAA 4BJHA 4UQBA 4R3UA 3GKAA 2YA1A 4AD4A 2HWGA 3LTYA 4ILSA 4I5RA 1V6WA 4LB3A 2VR5A 1XLJA 1NP2A 3QRHA 4JY9A 2DH3A 4RPQA 5A6AA 1MQPA 2W61A 5A1AA 1PEZA 2E25A 1GVFA 1A5CA 3LBCA 3T44A 4NAEB 2RFGA 4Z2HA 1L6WA 2D2OA 3G77A 4IX2A 2V63A 3BG5A 3OOQA 3DERA 2E1DA 2C14A 3WO8A 1VJIA 2VQTA 3TW9A 1M1BA 3GTNA 2BY0A 2XWDA 5DXXA 3THUA 1QPKA 1W1VA 5JIWA 2BOGX 4GQRA 3QPZA 4ORIA 4LBRA 4KWVA 5LSMA 3S0CA 2QUTA 5BYWA 1Q5MA 3HQ1A 4D6GA 4DJFA 7XIMA 4ADTA 2VZOA 3S1UA 1RA0A 1W32A 3MKCA 3S3GA 4NI3A 3E5BA 1FHDA 3UCQA 4L4MA 3QEZA 3CS2A 1X1OA 3VPLA 4MY9A 3BMXA 4RV3A 3V5CA 2Y61A 1A0DA 2J9ZA 1K77A 3GWQA 3PPFA 4GXWA 2NQ5A 4LNYA 4JXCA 2ZWZA 2WV8A 4U3AA 5CG7A 3FY1A 1V8EA 2ABAA 4DY1A 5AZ1A 3L68A 4ERGA 1J9YA 5JXQA 2FZBA 5K9DA 4PH6A 4WDUA 4NAFA 3VD3A 4PUDA 4W86A 5CGMA 4L61A 2V3DA 4ADUA 4JTAA 4K7YA 5REQB 1VFTA 5BCAA 1G4TA 3SDOA 3ANUA 3AROA 4AY8A 3FDKA 3VZYA 3K1DA 1IR1A 3VIIA 5I79A 4M0XA 4DYEA 3IACA 4QJ5B 3U6WA 2F2HA 3U0HA 2EPHA 5CPLA 3WEZA 4M56A 1S2TA 9RUBA 4G6CA 2E5DA 5EB8A 3W1XA 1V0KA 3CV7A 2FZ8A 4LAUA 1W9XA 5HPOA 1HN1A 1YNQA 1GVOA 1KBLA 1FWAC 2WKGA 1F07A 2ZICA 3ARXA 1G7UA 3L21A 3NUKA 3B40A 2JIEA 3NZQA 4N02A 2I9EA 3CUXA 4MUZA 4GI4A 2WW5A 3GXPA 1XXXA 2FFIA 4ZE4A 1G4PA 4CNTA 3QC3A 3O16A 5DANA 4BQ3A 3ABQA 5CC6A 2J7EA 1SSGA 3O7UA 4KBXA 2J7BA 3REQB 4EAYA 4HYRA 1JZ2A 3DDMA 2EJ1A 3QSRA 1KKOA 3N6QA 3NPUA 2Q8LA 3PNZA 2QVHA 3H12A 3VYLA 3HF3A 1PO9A 4E0CA 2OPJA 1EH9A 1MW3A 1KM2A 3F4WA 3WDJA 1PZ0A 1ADSA 4FR6A 2VRJA 2NX9A 1UR3M 1LTDA 4D6HA 3MT1A 3DECA 8TIMA 3SRFA 3QLDA 4HVXA 5AECA 3FOKA 3O6YX 3SN1A 2GSJA 1QHPA 1K4GA 3SEPA 1MXGA 1DJYA 4GACA 2E9BA 5LYRA 3OLIA 4MB1A 3H54A 5EMMA 4NI8A 3ABXA 5CBJA 1IGSA 1Y0EA 1XSJA 3G6LA 5FF2A 3LUTA 1HL9A 4H1ZA 4N0RA 4HMNA 1LLOA 1VJZA 4NZJA 4HHLA 5CJNA 2XH2A 3ARYA 4B5WA 2QYGA 2AKZA 4NZ4A 5AC4A 3WFLA 2INEA 4UZSA 2FMNA 3ZQ9A 4D6JA 2PTZA 1FCQA 2VEFA 2PDKA 2HE8A 1RXOB 2JF6A 3E0FA 3N9KA 5D38A 4X9YA 2HZGA 3T0CA 3N1AA 4ZODA 3TWBA 3C2EA 1DJIA 2ACQA 1G6CA 2AMXA 4D6IA 1ISVA 6ENLA 4EWJA 4OECA 1DWAM 4J4KA 2D0FA 1HKVA 4QLJA 4HN4A 3UG5A 4PMZA 1VPYA 1XLEA 2XVGA 4N9CA 3WLRA 2WHMA 3W01A 2QKFA 3SY1A 3CZLA 3A4XA 4R9XA 3W1TA 5MKGB 3GXTA 3QF0A 1UH4A 3DYMA 1JEZA 2CZVA 5G5IA 3WUGA 1EPVA 1VD6A 2P50A 2CFFA 3ARQA 5HAOA 4MB4A 1KM1A 1GORA 3VKAA 1R3SA 2J8TA 4KRZA 1XD0A 4GYKA 3EPNA 1SQ7A 2ASHA 1W2VA 4V2XA 3O9NA 1BF6A 3SZ8A 1UZDA 5BRQA 4J5NA 3L7RA 2C19A 2HPIA 1SW3A 4QXIA 4WDWA 1UB3A 4XISA 3PG8A 3VDHA 2ONEA 4JIEA 4NUWA 4Q8VA 4R88A 5LIWX 2YFOA 3ES8A 4HGXA 4L4OA 1D3HA 2GQ3A 2OO0A 4WJ8A 4YVPA 1MNZA 1JZ8A 3T08A 2O0TA 3NQ7A 4IFRA 3KFTA 5CEWA 1WP6A 1BYDA 5CZJA 1AW2A 1EQCA 1VBJA 3AWOA 5GPRA 4POCA 1VFSA 1CIUA 2Y85A 3DGRA 1W1B1 4A2RA 3E2QA 1RQHA 2WZHA 4M51A 4V1YA 1AFSA 4A4AA 2ODOA 4DJDC 1UWAA 3M0JA 5REQA 4MFEA 2VELA 3PPHA 1PDZA 3SUVA 3UD6A 2FKPA 3EWUA 3EBVA 1RA5A 3LZ5A 3GIQA 1JUEA 4KT2A 3WKZA 4GZ7A 2A3CA 2QQ6A 3L4WA 2DW7A 3PN8A 3CTTA 2E28A 3BSHA 2PODA 1XWYA 2DW6A 3WBWA 2E3ZA 4EPEC 2OO6A 3N25A 3RLVA 1E9IA 4DZAA 3WEOA 2E40A 2R1MA 4Y9AA 1XIMA 4ZSTA 2Q8XA 3VCNA 3VKKA 1H51A 3AFBA 3UZXA 2Q01A 4XZ9A 5C71A 1OFOA 5I07A 5H8PA 2D2GA 2OZ3A 3BCDA 1W1TA 1ZJHA 4GX9A 5LIUX 2WKJA 4BY3A 3STGA 4ZXLA 5A69A 5LGXA 1WKDA 1J93A 3REQA 3POHA 1V79A 3PG9A 2VGBA 4GHRA 4IGSA 5LZLA 2DSWA 1S5NA 2OB3A 2YGYA 3APYA 4PBFA 1IT7A 3GU2A 3SCWA 2WC3A 4TX6A 3PNUA 3UJFA 4HU0A 4DF0A 1NU5A 3CU2A 5DQPA 1YE6A 4WK9A 3BLLA 4TUFA 4PUUA 1Q6OA 3HG4A 3C61A 1MUMA 3UEQA 4M1BA 1OC5A 2A4AA 4B3LA 4IFOA 1XYCA 2OEMA 4XZMX 4DJDD 4XKMA 1LBFA 1R3RA 5BZAA 3W73A 1ZCCA 3UPBA 3MWCA 4O50A 2PZ0A 5DELA 3CUJA 2HV5A 2R9RA 2H8ZA 4IPPA 4US5D 4KCWA 4FX7A 3PC0A 4MPKA 1LQ2A 3O2LA 2VX4A 1FCVA 4S23A 4I8DA 2LLEA 1GQLA 3CJPA 2E5CA 3R8GA 3Q2DA 2X7WA 1QWGA 4DYJA 2DZWA 3URBA 2BS9A 1RP9A 1SO5A 1QK2A 2J25A 8RUCA 2NUYA 3DFQA 2D3NA 1TIWA 1EWEA 4LBUA 4ZQCA 1HNYA 2R1PA 4F48A 3CPGA 3MYPA 1SPQA 2HSAA 3M5VA 2ZE0A 2FZ9A 1OGGA 3BCFA 3FK4A 3M5ZA 2PDYA 1L0PA 1PJ9A 4JFTA 2GYIA 4ACZA 1P6WA 2EQDA 4JD4A 1PX4A 3B0UX 1XPGA 4AMCA 4GXMA 1JULA 2P5NA 3IVTA 1EGMA 4GIEA 4Q4SA 3ISIX 1NJJA 4EF8A 4MLRA 2IQ0A 4PTMA 3I6RA 2B0MA 3W6MA 3CAKA 1A47A 1HFBA 3WSUA 3QTPA 1FKXA 4D6CA 3E74A 1H0IA 3ARSA 2PD9A 1EOMA 5MKGA 2QT3A 3S46A 1HVQA 4ZB2A 3VIFA 1TCMA 1D7FA 4UZUA 4HSHA 1YEYA 3EKGA 4M6VA 1E6SM 4OVXA 1GKRA 2BBFA 5J8LA 1NWTA 3JS3A 3CC1A 5FJJA 3UZYA 4F0SA 2J77A 2JEPA 3OLGA 3N6JA 3IGHX 1FH9A 2XJ7A 4U10A 3SR7A 5B7ZA 1M04A 3HGSA 3G22A 4IGMA 1GWJA 2IPGA 1NM9A 1TRDA 4WY0B 2NQJA 1UKTA 4LPCA 1TPH1 4LUIA 3W7PA 2PDUA 4PTWA 1EUNA 3CGTA 4ZFCA 3PUOA 4BCEA 3NDOA 1C9WA 4AIEA 1KWGA 5BMXA 1CXLA 5CPOA 5CPNA 3E96A 1EIBA 2XFWA 3F03K 1QWKA 2UWFA 3VGHA 3HOJA 2VFDA 1L6GA 5F2GA 4EVZA 4AVNA 3CT2A 2HE5A 3SGUA 2Y8UA 2J47A 1OCBA 1JIBA 4IJCA 3BURA 1AA1B 4C5YA 3P74A 3C56A 1A5SA 4QGCA 3QZ6A 1X98A 1R0MA 4ZE5A 1TCDA 1VZWA 5D9PA 3AMLA 4ACYA 1G69A 4DNMA 5B7YA 5FJOA 2OMAA 1J0IA 1YMYA 2WPBA 5J5DA 2ZADA 2XH7A 1J12A 1YE4A 2WM1A 2XIJA 1H1NA 4UFLA 5AHMA 2WBKA 4C6JA 4LBSA 2PDNA 5EU9A 1W17A 2VC9A 4ICCX 4DHGA 1O95A 1DJGA 1ZGDA 4JTSA 4O8AA 5DXYA 4AB4A 1IXNA 3UETA 4DUVA 3AHZA 4UQCA 1Z8AA 4Y9NA 2A7PA 4O17A 2AGTA 3NZRA 1ZTVA 1Z48A 1JD9A 1T0OA 1VJSA 3WMLA 2Q3RA 4I90A 1KQZA 2D2JA 2VEKA 3EX6A 1KV8A 3KLLA 3XIMA 1UWTA 3P60A 4UTWA 4IMFA 8A3HA 1WBJA 3IANA 3UVAA 2HPMA 3EDFA 3N17A 4IPLA 4ZSUA 3AIRA 4Q8UA 1DJWA 2Y7DA 2QUMA 1U30A 3NQFA 5T91A 4WUIA 4LUTB 3TFXA 4I6VA 3VO0A 2AQOA 3W7LA 2VWSA 3SCPA 1DJNA 3AYTA 1BXNA 1S5TA 5BXPA 1U5VA 2I17A 4TMBA 3PY2A 4MZ8A 4MKVA 4MM1A 2C3ZA 4IFKB 4DM1A 1V0LA 2A1YA 1EP2A 4DO4A 1W3LA 1KM5A 2ZE3A 1S3TC 5AHLA 3N2BA 3GBDA 3G1HA 3HQNA 3S2MA 5RUBA 2Z2BA 5I0DA 4S3FA 1AD1A 4DZIA 4A8LA 2CC0A 4RPPA 4UR7A 1UUMA 4M82A 1SZFA 3BGAA 2DZBA 3LRMA 4H7CA 2J7DA 1E6QM 1JPIA 3QTGA 1XGEA 1VCVA 3LMYA 1GEQA 1V0MA 1EEXA 1K7EA 2PE4A 4H83A 4UMCA 2PLMA 1YPIA 1D8CA 1CXHA 4IMEA 1DWJM 1JYWA 3C0SA 3H8AA 3B9OA 1V3KA 2BFGA 1QHZA 3K2GA 3RITA 1M01A 2V82A 5HJLA 5AC6A 2PWDA 3KZPA 5I09A 1GHRA 4FIRA 2V2DA 3BW2A 3W71A 2OG9A 4F4RA 3DOPA 3P0WA 4QRNA 4RDVA 3QW3A 1E5JA 4QIUA 4DUXA 4Y8EA 1Q85A 2E4TA 2C1GA 1VFFA 3K4AA 2QPSA 1ZLPA 4QDMA 3ARPA 2DZAA 2EPOA 2ZX5A 3FSTA 3RXZA 2XYLA 4HNLA 3BO9A 2QAPA 3TX9A 4DZHA 1HTIA 2RJGA 1V5XA 4S3DA 4Q8MA 3AHYA 1E9LA 4LSBA 3WLOA 4OT7A 1DE5A 4MYXA 3GVVA 4W7UA 2OEJA 4DXXA 3DKJA 2Z26A 2PC4A 3TA9A 5KZ6A 4C91A 2P3ZA 3W53A 3E1F1 3WQFA 1BHGA 1HQTA 1IT0A 3CUHA 1V6VA 3LM3A 3SUWA 4WR3A 2JFEX 4Q7BA 1A53A 4WY0A 3VOIA 1M5WA 4IUGA 1NARA 2PWFA 1KM4A 2X09A 4LGXA 1H1ZA 1DTUA 2GJLA 1VBGA 3M5YA 4XO7A 4J27A 2Y7GA 4ZQOA 4C6PA 3W76A 4WEVX 2R6OA 4AX7A 1R8LA 1PX3A 2HK1A 4J7RA 4U33A 3OGRA 3W00A 4KWSA 1TZ9A 1P0KA 4MGGA 5IRPA 5HBFA 3N73A 1PB0A 3KRSA 3DI1A 4CU8A 3CQKA 3O0KA 3HMJG 4JFWA 1LG1A 1W1PA 2P0IA 1RK5A 3I4KA 1OX5A 3A64A 5J04A 3PZUA 3EB3A 4WZHA 3K8LA 3W6LA 3HGRA 1UR2A 4XO6A 4DJEC 1GKQA 4GE8A 2FDSA 1V6XA 2DVXA 3TR2A 3L2IA 1EDQA 3SRHA 2Q3OA 1EJRC 1LORA 4L1WA 3P5ZA 3WK1A 4HMEA 4AWUA 3VD7A 2V69A 4TX9A 4J2PA 4B5NA 2J8FA 4F9JA 5F7UA 3I6EA 4LRSA 4DQWA 1UR4A 1H7XA 3TN3A 4KPLA 4RNIA 4UWMA 4JAWA 1QOXA 4A3HA 3QQ0A 1UD2A 2FGZA 4PMDA 3M7SA 4QM1A 4GXPA 5FSEC 4H2CA 1V3LA 3NL2A 3RPTA 3GR7A 3R43A 3LPGA 2Y0FA 1H61A 5AB3A 2J6VA 3QZEA 3QR0A 1V3JA 3LHWA 1ZB5A 3M0ZA 1QPRA 1R5YA 2RDTA 1VFLA 4IMDA 4GNVA 4TIMA 3T9PA 2WMKA 1PTGA 1JL8A 1XF0A 2G97A 4ZOAA 1FWEC 4IIHA 1XKJA 4AC1X 1ZCOA 4GX8A 4IM4A 1E6PA 2QUNA 3UWYA 4YJ5A 3WIJA 4Q8OA 3UY8A 4CNUA 1S3HA 2FGLA 4LS2A 1W5QA 3S5YA 3KBSA 3TLLA 1ZPTA 3NZ1A 2PC8A 1ZUAX 3CASA 3BLEA 4IFKA 4HCHA 3K4DA 2YJQA 4DJED 5DMLA 1ICQA 2WK2A 1S2CA 3T4CA 1XIGA 3BJSA 3ITLA 1GJUA 3G1VA 4S2BA 3KZSA 3NNTA 2PCEA 3S2NA 3KHJA 3PTDA 2ADAA 5ECUA 1CPUA 1UKSA 4V15A 4H9VA 4GZEA 4WCJA 1EXPA 5IHSA 3VK5A 2C91A 4EKJA 3IJ9A 3G1FA 3LSBA 3I68A 3S5SA 3OIHA 4H8HA 2E6YA 2VZTA 1QI4A 2W9MA 4LVAA 4AZHA 2VCAA 3NGJA 1XLAA 1YW1A 4IXXA 4ICNA 4PE8A 2WSKA 1E71M 1EBHA 3EWDA 4DUOA 3B4UA 4JS3A 3HV9A 1K4HA 1G4SA 5HNTA 4L4LA 4FXSA 3PBVA 3H6OA 4PCFA 4P7LA 5HOSA 1ZP3A 4K1WA 2GGHA 1M65A 4HN8A 3TFCA 4WX2A 2OJPA 2WOQA 4M19A 3D0CA 1XH0A 5G4EA 4UTFA 3HFYA 3RM4A 4OGZA 5C55A 3SW6A 1ML1A 2C1HA 3AIEA 3G3MA 3HMCA 3F1QA 1WYIA 1ZY9A 1XRVA 4K37A 1YHTA 3HTWA 3QW4B 1WBHA 4JTUA 3KL5A 1EJVC 2KZHA 1OFPA 1YPXA 2WO5A 1O60A 1FWFC 2DZTA 3OZMA 1A5LC 2CBVA 1F4AA 1B3ZA 4W7VA 3EMQA 3VOJA 3ONBA 2CKRA 2YYTA 4MB5A 4ZO9A 3LTSA 4JQ3A 3FXYA 5EMKA 5D2YA 1XYBA 4FOUA 4JFUA 3CIVA 3BAJA 3RCYA 1WDWA 4GFIA 1H5YA 2QEZA 3PULA 4F8XA 1UMLA 4DJFC 4CU6A 5D8WA 4UR8A 4UOJA 1AVAA 4IX0A 5FEPA 4IHCA 5LNWA 1LROA 1QOPA 4EP8C 3L0NA 1XLFA 4NZ3A 3L0KA 3GS6A 4NF7A 3TWAA 1KCKA 2YDQA 1O94A 2OODA 4Q4MA 3BXWA 2J27A 3F5JA 5BXRA 2WAGA 3TLQA 3B8UA 1AK5A 2XVLA 1T7LA 1D3GA 1QNRA 2O9TA 1F9CA 3R13A 4OOZA 3IIXA 1OC6A 4F0KA 5XIAA 3W1NA 3B0PA 5HWNA 1NSJA 1VEOA 4KRTA 3ME3A 3LXAA 2R14A 2GQ8A 4UTHA 4NJHA 2OOGA 5BRBA 3CM4A 2OOFA 1QBBA 4PTDA 4UTJA 4YTRA 1NIUA 1EL3A 1GT8A 4QP0A 4H19A 3APGA 5EMJA 3VOGA 3A13A 5KMYA 1CECA 2O92A 4PMJA 3RO6A 2EEXA 4LUJA 5GJPA 4A29A 5IFPA 1V4YA 3T05A 2B7QA 1DIKA 3AIUA 5M3WA 3TV8A 1XLHA 3C6CA 2G37A 5AZ0A 4JTGA 1WO2A 5LXXA 1V08A 4DJFD 3HGJA 4Q6XA 1XBZA 1K8YA 3BLOA 1EJXC 5GNXA 2EKCA 4GH1A 1BXCA 1I2QA 3KRBA 3DFYA 2QLYA 3ARVA 3GO2A 1OWQA 4GGHA 1SFLA 2SFPA 4CN4A 2BVYA 1JQVA 3DESA 1V02A 3E3HA 1DL3A 1WCGA 2FZNA 4GGBA 4XUGA 5EL1A 4JIHA 4MJMA 3W6YA 2YXGA 3N2MA 2H8XA 4B9ZA 3NQCA 1R3WA 4ZCWA 1XIBA 1KM0A 3PTKA 3MKVA 5CG0A 1AH0A 5FKYA 2NUWA 2Z1XA 5CLWA 4PUMA 1IWBA 1A3HA 1P1MA 3FX4A 3AIVA 3U2ZA 2BP1A 3C3UA 1QO5A 3W0KA 2C7FA 3U7VA 8XIAA 2BOFX 1RHCA 5F1VA 3V0SA 3R25A 3F7JA 4ZMGA 2OXNA 4B3ZA 4XKYB 3SN0A 3B0XA 4B16A 3QHMA 1QW9A 4M29A 1AL7A 4HT3A 2P10A 2FPYA 2QMJA 4JTIA 5CZSA 1T5AA 5H91A 2Y70A 1WZLA 3C0JA 3W87A 4GVFA 5FA5A 1RJPA 1TZ7A 1I2PA 1KTCA 1FDYA 2QJNA 4GINA 3NIYA 2PAJA 3LXCA 4A35A 2PDJA 3IIZA 1HGWA 3ATYA 2J79A 4YTQA 1R7AA 1SJDA 3BGJA 3S2JA 3BWWA 4GUHA 2F38A 3UR2A 3GU9A 4L6DA 3LS9A 3LG3A 4F0MA 1CZ1A 3LGDA 3BC9A 3KBWA 4OZOA 2QVNA 3AQUA 1OCNA 3JW7A 5FL0A 3C0LA 1SR0A 2Y1HA 1FDZA 1QXLA 4UB9A 4UQAA 1RK6A 3V18A 5DX7A 3VX0A 5F4XA 1EJ7L 4RDYA 5FESA 3IVSA 1CLVA 4JQ2A 4O10A 5CGTA 3VXGA 2HNHA 2GGGA 1VCFA 2QCFA 4O1DA 4ZXOA 1PIFA 1VP5A 1OFDA 1P1XA 2Y6ZA 1BRLA 2W67A 5A6JA 1H60A 1J01A 3RK8A 3S9ZA 1Q2SA 4TV5A 5LXEA 1XYLA 1CDGA 3P3BA 5DCDA 5LHFA 4GY7A 3TW6A 2DQXA 1R2SA 1KBIA 4ZTYA 4C7FA 2BDQA 2ZXAA 4CQ8A 1A4LA 4N6FA 4OBSA 3E12A 4QQ3A 1KB3A 3W2LA 3B0YA 5FF4A 2P76A 3TXZA 1I2RA 3VE7A 1K03A 5AOUA 4LUSA 1W3IA 1BVWA 1MMFA 2V81A 3WNKA 3SB0A 3PWAA 3W25A 3PSVA 3ZJ8A 3N9RA 4JIPA 2WHLA 3WLSA 4UR9A 1L6YA 3EWCA 5LGZA 1XIIA 1VH7A 1NQKA 2ZRUA 1Q8JA 2FTPA 4RNHA 2ZZ7A 1ZP4A 4GQQA 1AQMA 2XVKA 1J4EA 3LCHA 1TTJA 2OELA 4FXRA 4D6EA 4OV4A 3KOXA 3SM0A 2GL5A 3KUMA 1QPNA 4ROQA 4GYJA 2PP0A 1UH3A 3N18A 3WK0A 4C1NB 1ECEA 1TELA 3EXTA 4LF2A 3DCPA 3W1PA 3BGGA 4UBPC 4NQ1A 4JTKA 4MZ1A 3DBPA 3PTQA 2VM8A 5F4SA 3W7HA 3MJMA 4DBWA 4XX6A 3NAVA 2X8RA 3LHZA 1UD4A 3EX3A 3TN4A 4CN6A 4D1IA 3VTRA 1I6NA 3EZ4A 2J74A 5A6KA 2X16A 3E0LA 4HD5A 3GY1A 3VFLA 1HP4A 1WPCA 2ZOXA 1NWRA 2OT0A 3SBFA 1WXJA 3NZGA 1XGZA 4ERIA 2W79A 4B2DA 5HJYA 1N82A 4N9BA 1JPHA 1TTPA 1XBXA 3LLXA 1TRIA 3C2FA 1UUOA 6PTDA 4FNTA 1OJXA 4C6BA 2D69A 2Z1BA 1AZ2A 1VGAA 2P3EA 3ID7A 2GOKA 4Y9MA 2BB0A 4IL2A 1W6TA 1Z7AA 2OLHA 5BWFA 1HJWA 5ABTA 2HJPA 2OWWA 3KS6A 1OINA 3NXFA 3M41A 1UROA 2AAMA 1LBLA 1RVGA 3UXKA 3W85A 4AHOA 3VABA 3NYZA 4FOKA 3N9SA 3TYCA 4NNBA 2INZA 4XKYA 2ZZ4A 1XC4A 2QMKA 2FH8A 4ZB0A 1PPIA 1ME7A 3WUEA 4AD3A 1XGDA 3GW0A 3KDNA 1ZNNA 5GJMA 3IUHA 3IAQA 1AH4A 1XLIA 3D5HA 7TIMA 2JKPA 2NVCA 1J2WA 5CZ0A 1SM9A 4FX8A 2JALA 4DF1A 1KLZA 3BOFA 3GHSA 2YW3A 1V3MA 3WG6A 5CSRA 1BVZA 1X1NA 3LV5A 1UOZA 4CCZA 2FGBA 1BFNA 4DXVA 3L66A 3E02A 4G7FA 1E1FA 1M3UA 5LHEA 3ABRA 1ADDA 2BODX 5A6SA 1BYBA 3CAQA 3TCEA 5DBTA 4BWLA 3GXFA 5A3HA 4QE1A 3HU7A 3C5QA 3CUZA 1XDLA 2DP3A 3UJSA 1XL9A 2HVMA 1XG4A 1QBAA 3NL5A 1Z6KA 2EKGA 5K4XA 3W75A 5T9CE 4QJ3B 9CGTA 3MUAA 1JAEA 5A2BA 1ELSA 1W5PA 3CXOA 4YN5A 1PZ2A 3WX7A 1BWLA 5C0QA 2XIOA 1NDVA 4LF1A 3L5MA 1TMLA 2P53A 3UNDA 2J88A 5AHFA 2VDGA 1OHLA 4V1XA 2YYUA 4J3WA 3W2NA 4D8ZA 2WQPA 3K13A 4YVXA 2FTWA 1IZKA 4UOQA 3BG3A 1ZBKA 4H00A 1DEDA 4W5UA 1W3KA 1MNSA 3IGXA 2WBGA 3GXDA 2YCKX 1VRXA 3NCOA 2VDIA 5FACA 3OYZA 1KV5A 4KW2A 1R2TA 1Y65A 2PWGA 3ZXWA 1UD3A 1A3WA 2PURA 1V77A 2C13A 2UY3A 1XCWA 4M6QA 3KCOA 1L8NA 1ZZMA 3PHAA 4HU4A 2WHKA 1TG7A 2D0HA 4ZQRA 3NQVA 1RCOB 2O9OA 3A12A 5E93A 2DT3A 2EGZA 4FXJA 4Z1DA 4XZWA 2VVNA 2W62A 3FJLA 4GIYA 4MDPA 3LHUA 4FNUA 4L6HA 1PV8A 1M53A 1E4LA 3JZUA 1FWHC 4W8AA 2X1TA 3PPGA 3H2MA 5HNNA 2CHOA 2A3HA 3POCA 1XCFA 1B31A 4IP7A 4PL1A 1H63A 4NY2A 3OG3A 1B3YA 4LS0A 3WF1A 5FSDC 1MEIA 4IQEA 3DX5A 3WDIA 5U7SA 1FHLA 3L12A 4YTUA 3GHRA 1IQ8A 1J6PA 4A05A 1OF6A 3G8RA 4XQ6A 4UTWC 3V5OA 1ISWA 2Y24A 4I7VA 3OLEA 3WQOA 4BQ2A 4JTCA 4Q22A 3U4FA 3OQ8A 3PFRA 3AYSA 5E5CA 3VM5A 3WF3A 1KM6A 1OY0A 3NXLA 4BI5A 1B2YA 4Y9OA 1MI3A 2QPUA 1H7NA 1XINA 3ICJA 2WWDA 3MP3A 4LYQA 1TWWA 4L64A 4Z1AA 2UZ9A 3HPAA 1JFXA 3ECQA 1FWJC 3WENA 1OIFA 1DP0A 5I5RA 3ZLHA 4NU7A 1X7IA 1EYEA 1QNVA 5AC5A 1E3XA 2FJKA 2J4GA 1R46A 3H2CA 5C7HA 4BS0A 3RF9A 3ZLGA 4WGHA 1JGIA 2QJJA 3AXHA 1VB9A 1V3HA 1W3HA 2GVGA 1HJUA 4TOQA 5DF0A 5EMLA 3AYRA 3DFSA 3N19B 4U5KA 1TVNA 3TTQA 1XYMA 4GI6A 1J10A 3KTSA 3M0XA 5C6MA 3LQLA 4AIOA 4UTLA 3QN3A 3WFZA 1F3XA 1SO4A 3VZZA 3CL8A 4OBTA 4XAFA 4LV4A 4MNMA 2YZ5A 1FBAA 2WNQA 5FF7A 2E6AA 2QS8A 3LGGA 3A4AA 3ZM8A 4RKAA 3DGBA 4KFNA 4RXFA 3VMOA 1EC7A 1CYGA 5C8BB 3QM3A 3ZT6A 1H09A 4UXDA 2PF0A 4GJJA 3FN9A 4FR1A 3NO3A 4UFKA 1XDJA 1GKPA 3THDA 2XSBA 4JDYA 4V28A 3F5LA 1OX4B 3LBMA 5B80A 3VILA 2W6RA 3COTA 3OVPA 3CYJA 4C6KA 3KBVA 1NAL1 4MJ4A 1O1ZA 3KHDA 2BSLA 1FWRA 1TV2A 3CPUA 5BXSA 2RGLA 1VHCA 5I77A 1BD0A 1H3GA 4YS1A 2VGFA 3WLQA 3WUFA 1RCXB 3H7VA 4H8UA 4PMYA 3GNDA 3I7RA 4NG3A 4UFJA 3W2MA 1GEHA 1S2AA 4OWGA 1GJWA 1G67A 3LK6A 1BYCA 3NTYA 3EXSA 3EB2A 4MG4A 3FGCA 5K9XA 4EWND 3MTWA 1E43A 2C79A 1YKWA 3T0BA 2PP1A 1B3OA 3CUGA 2VX7A 4J2MA 3VOCA 1T96A 1GOIA 3CT7A 4NZCA 3DH7A 3BCJA 3C8NA 3RFAA 4HSNA 4CGTA 4D1JA 3RG6A 4IPJA 1KXHA 1S5MA 1IT8A 1UC4A 3UYIA 4S38A 4M80A 1XLKA 3W22A 3LY0A 4XSLA 2FPTA 2GJNA 3HQPA 2OGJA 4HYWA 4CUCA 3USZA 3L0GA 1LQAA 2J9YA 3QMRA 3NPWA 2OWCA 4QITA 4HBKA 3STCA 3AS1A 1P48A 4YWSA 1Z32X 5CAHA 3SQLA 4EIVA 1I0DA 3AS0A 5E9AA 2ZRXA 5I78A 5IHRA 1O6IA 4PUKA 1JUBA 4O12A 1TJ2A 2WMIB 1A5BA 5I6SA 3GTXA 3SUSA 1RH9A 1JYNA 3O06A 4HNCA 3QJAA 3CUFA 3LTPA 4HA3A 4BKNA 5LA1A 1J79A 1G4EA 3RMJA 3WK3A 3B9EA 2WVVB 2ZRVA 4H9TA 1RVKA 3IS4A 4CD8A 1YIXA 1JUKA 4DVOA 1AZ1A 5CSSA 4PL2A 3L2LA 4AWEA 1Z41A 3EWWA 1PXGA 4DN1A 1EBGA 1R3VA 2ZZ1A 1NOFA 3G0XA 4KESA 3QV6A 4HOWA 2VOMA 1JDAA 1EJWC 3EX1A 1AMKA 2HNEA 1LP6A 1ONEA 3SN4A 4NHVA 1VIWA 1L2QA 4IF2A 5C9WA 1SUXA 1GQIA 2OSYA 7TAAA 5G1YA 1WKYA 2PFHA 2NV1A 2ZTKA 4N42A 3RGTA 4NILA 3IJ6A 3GHTA 1PHQA 3ABSA 2J8GA 3N12A 2YB1A 4XZHA 3G1AA 2VGIA 4EX4A 2QCDB 3IIVA 3FDGA 1QNQA 5CH9A 2D0GA 4X3ZA 1UMYA 1HP5A 1RLDA 3NDYA 3TKFA 2V5BA 2NVDA 2QHAA 1EX1A 1JXJA 2PCQA 3H4XA 1A50A 3ZS4A 1YDVA 3WMBA 4MFDA 2EPNA 3VMNA 1IEWA 2CXEA 1WV2A 3TU9A 4OOUA 2DVTA 1KCLA 3GX9A 3WQCA 3N3MA 3A4WA 3CHFA 3GC2A 2YDSA 1IE7C 1YNYA 4X2RA 1L6SA 4AC7C 4BF7A 2WKLA 3QYSA 2RKXA 1SFTA 1G7VA 3GNRA 3V5FA 2A6LA 1AH3A 5C2XA 5K3VA 5HINA 2B7PA 3MO7A 4Z1CA 3DHFA 4KCUA 3ZSTA 4Q4RA 4PYSA 1S2VA 4FZIA 3GNOA 3UXAA 3U3HA 1PHWA 2ZQ0A 2ZA2A 4XZNX 2NX3A 1GQNA 2VQUA 5HMSA 1T6MA 1UCWA 3VX1A 1XFBA 3CO4A 3ITOA 4S3EA 3PS7A 3SY8A 1RY8A 3NQ8A 5CC3A 3NQMA 1W1ZA 4C7DA 3W74A 1R47A 1ADOA 3KVKA 5AHEA 2ZXBA 2WCSA 5FF3A 2Z7KA 1QU4A 3GHUA 3JU2A 3E49A 3L5LA 2HISA 3C0QA 1BG4A 3WDHA 1E0WA 5CCZA 3B9NA 3VNLA 2OYKA 2D1ZA 3WBYA 4E2BA 1R3TA 8CGTA 4H6RA 2QJIA 1GONA 4JNZA 3TH6A 2ZCGA 4MOZA 1PKMA 3FIGA 5KZEA 1M7OA 4DLFA 3T78A 2QV5A 4B4FA 3R0KA 1UWUA 4GQBA 2WWCA 3GNXA 3FHQA 1WX0A 3T7VA 2NQLA 2CLFA 4A3UA 2QIWA 1AD4A 1CXKA 5JU6A 3K4WA 4Q4QA 1QT1A 4LJ3A 5A8PA 1I75A 1ZS2A 3QV8A 2WMIA 4IIDA 4W9TA 3W7RA 3RDKA 3UY7A 3WMCA 1VBUA 1P0NA 1RUSA 3BG9A 1HF6A 2XTKA 3HB9A 4R85A 4E5TA 3ES7A 2ZUNA 2NLIA 3U2OA 3AU6A 3GDBA 4U2YA 2JEQA 5F2MA 4ZTXA 2XFYA 3H24A 3WD1A 3AWNA 2J13A 3G0SA 3UJEA 4RE4A 3KTCA 3P8IA 2PDWA 2YA2A 1UWQA 3AZSA 4J28A 1ODZA 1LRNA 2DGAA 3C2VA 1M41A 3B9DA 1HVXA 4JR5A 5AYBA 3TSBA 4AUBA 1LL7A 7ODCA 3SO7A 4FNPA 1E6RA 2CYGA 1XPYA 2YR1A 3TQVA 1WKEA 4J35A 3PUGA 1I9CB 4B5SA 3S1VA 4MPQA 3LRLA 1EJSC 1CGTA 1DQWA 3GB6A 4HNNA 5DMMA 5AYXA 5I2UA 2X0YA 2JF7A 3BVJA 4CCCA 8XIMA 2W4XA 2GGIA 4PRRA 1ZALA 1YBQA 4IISA 3B8VA 2Y5EA 1VFOA 2L5HA 4DIAA 2ZRZA 1EKOA 1E9ZB 4R34A 2VZSA 3TUUA 1CEOA 3HPFA 1TTIA 3VGDA 1YQ2A 4UTTA 2VCCA 3SCNA 3WBXA 1VKFA 3CUIA 3PTMA 3WNPA 2QGHA 3CIXA 2D23A 4JTFA 3FVDA 3RIKA 3TONA 2HS6A 3R12A 1JDEA 4UTMA 4Z17A 2YCJA 3PZ9A 4ML9A 2QXWA 3PP7A 4QBXA 5C5YA 3WQPA 1JDDA 5JIPA 4U3CA 1Q4NX 4AIBA 5ABEA 2GUYA 4TO8A 2NQZA 2O56A 3KE0A 4TQTA 1Q6CA 3PUEA 1W31A 5FCZA 3GUWA 3WF0A 3T0DA 1OYBA 1PKNA 2WZIA 4FO4A 1KW1A 3DFTA 3W7KA 4FLSA 1JDCA 1HL2A 3NA8A 2DZUA 3FAXA 4QROA 2VFHA 2GFTA 3H7RA 2ZZ5A 1GGOA 3AICA 2OGYA 2CESA 1SW7A 4E38A 1A5UA 5CZTA 2OYMA 3MDWA 4DZ5A 4K38A 1XCXA 3FYOA 2GVLA 3TQ0A 4NXKA 2DT2A 2FQIA 5CXPA 3AHTA 3B4YA 4BEQA 1XRSA 3ZLFA 4E4FA 2C18A 3AISA 3IGSA 5JBFA 3WDRA 2ABBA 5TF0A 3QQWA 2ANUA 5A8MA 1YADA 4G1NA 3QGKC 4I7WA 3QYQA 4L1XA 4L9YA 1UR0A 1UP2A 3G24A 1SZNA 2VC7A 4E2VA 3E38A 2XG9A 3WDPP 4HPHA 3DFPA 2E5BA 4GYPA 3KP0A 5HXMA 1KFKA 1XG3A 1V0NA 3SRKA 1PTAA 2PGWA 4AY1A 3UCDA 3IJDA 1HJSA 1QJWA 3AIQA 3LV6A 3T55A 4QJ4B 1MQQA 3MHFA 3TCSA 4HHHA 2CKSA 4B15A 4HNTA 1QI2A 1B9BA 2Y4SA 2X0SA 3LCGA 4AU0A 5HUPA 3U2EA 3FKKA 2X7VA 5FD0A 1HJXA 3S6TA 4EACA 1ICPA 7PTDA 1I4NA 4AD5A 1F7BA 4CN1A 1QO2A 4NT0A 5DEZA 3QLLA 3GNPA 3T0AA 2PDLA 2OEKA 2FZDA 2CETA 2WMJA 3M9YA 2IKHA 3HG2A 1CXIA 1OZMA 1M6JA 1NDWA 2CZDA 4KWWA 5DCBA 1FXQA 1TZZA 2ZBTA 3VIHA 4DF2A 1J8VA 2X1IA 5KTLA 1EZ2A 4GPNA 5BOEA 2CLOA 3M0YA 3N04A 2F8QA 2RHGA 1XICA 5TD4A 3UCCA 3TN5A 5DY3A 3SSZA 2NXIA 3LI1A 1JQXA 1CCWB 1Q7ZA 3WH7A 1NTHA 1V03A 2QV4A 1XH1A 3W02A 2Z29A 1U5HA 3B0VC 1N55A 3WF4A 5FJPA 3CL7A 3U2CA 3VKDA 2EPKX 2F9RA 4AZ5A 3VDCA 3QSTA 1W8SA 4I9TA 3R0UA 4QG8A 1US2A 3AC0A 3RCMA 1S2UA 5C7VA 4W85A 5CBIA 2PRHA 4GQGA 1WZAA 1O5RA 3OJGA 2QJGA 4LANA 1O4UA 4QSFA 2DZVA 4C6CA 3E9AA 3FEMA 1O7AA 1PSCA 3PBWA 5XINA 3FCPA 3LBOA 2E6FA 5C54A 2PU1A 2WYSA 1XD1A 3O3RA 4NKCA 1TR1A 1SR9A 5JUVA 3CEPA 4DBEA 4UTIA 1A5AA 4H4IA 1W3JA 3AHXA 4K8GA 4KCVA 4TVUA 2Y88A 4H8NA 4Q4PA 1LM1A 3IPWA 3CH9A 1GYLA 1QI5A 3O0FA 1TWIA 1P6CA 4NJIA 2V30A 1MVYA 3BLPX 4CNNA 4D6DA 3NGFA 4K68A 3LI0A 3CIWA 2BGSA 2VC6A 3CLMA 3HZ3A 3RRXA 4IPNB 1UQZA 4ZZ9A 2IQTA 1JDFA 1PTDA 4REQB 4B5XA 1BSLA 3KP1A 1H4PA 3MSDA 1VHNA 4BI7A 1REQB 4CQBA 4FOJA 1XLBA 3MYOA 3PF3A 4QQUA 2PDCA 3C8FA 1DWGM 3MSGA 5HATA 3CB8A 5BU9A 2QCNA 1UD8A 1TQXA 2CBJA 4B2DD 3QOKA 2A85A 5KINA 4JTJA 1P0EA 5E6YA 3IEBA 2DSVA 3GH4A 5CC7A 4TMCA 3BAKA 1C8XA 4ASTA 2GJXA 4BWLC 3T81A 2WB5A 2A3BA 2IQDA 1OFEA 5CSYA 4DXKA 4IG2B 1E0XA 1D3CA 1IXQA 2VZVA 1HGYA 4RL3A 4HCLA 3S5OA 1QPOA 2ZDRA 3OVRA 3CZ8A 4GCAA 2QUUA 2P88A 1UZ4A 3TAOA 4X60A 5I24A 1F2JA 3M0HA 5D02A 4UNKA 2GUBA 2GQAA 3N2OA 1LL4A 3U8GA 3GVRA 3H2OA 4DAFA 1QRQA 4L6OA 2WNWA 4B5VA 3GRIA 2CPUA 4JIRA 5L6UA 1OQFA 1GOOA 1S46A 1Z3NA 4MWAB 1SZGA 4R7OA 1IEVA 2W91A 3JZEA 1ONWA 1GZ1A 2PWVA 5CGQA 3LPOA 3PPCA 3WJZA 3WH5A 4YTSA 1UA7A 4O13A 2C0HA 3ZYZA 1JZ6A 1XIJA 3D6NA 5CZKA 4YXGA 2PB1A 2VR2A 5IXEA 3WLLA 1NWUA 1XFCA 1CGUA 4QG9A 1VEMA 3MP5A 3ARWA 4G7EB 2QR6A 5JQ9A 4GVGA 1MW1A 1N2VA 2PTDA 1OBAA 2WC4A 3MUXA 2R94A 4PRTA 2OLAA 3G1DA 3N11A 3DC0A 2R91A 3NFUA 5DT5A 2KAUC 2GOUA 4CVWA 4O1BA 1Y5XA 3R4IA 4A6GA 2G3FA 2AL1A 3OBKA 5FL1A 4FLQA 3CWOX 2VD8A 3H53A 4UFIA 2HBXA 3DHDA 1W0MA 3GH5A 4QX4A 3SECA 5TAOA 2BZNA 1US0A 5F1UA 1GCYA 2ZA3A 1TJPA 4AG0A 4MNLA 1GYNA 3M6YA 1GOXA 4MY8A 4PR4A 2DV0A 1U1UA 1JPKA 3L4VA 1L2UA 5ABGA 4RK8A 1FP9A 5A8QA 4F2TA 1ZAIA 2QPXA 2HS8A 3R6IA 4AZ6A 1IWAA 3M0KA 3OODA 3XISA 1W1IE 2Y7EA 1MYRA 4JL1A 3MKKA 3UWVA 3WQ5A 4L4PA 1D2KA 1EP3A 3TC7A 3WLHA 3ENLA 4DWSB 1RBAA 4FLRA 2OYLA 1TV4A 3M46A 2G3MA 3KWSA 1J0HA 3A4JA 1Q6RA 3ZWTA 2POTA 1JYVA 3TC3A 2ATMA 3SCUA 1MRQA 4CNOA 4CVUA 1E6XM 1WZMA 4J3ZA 1VR6A 3UWUA 2HEJA 3WH8A 3C2YA 3TR9A 3BZGA 3NO5A 2W92A 3WL1A 2WQDA 1MDRA 4ICMA 1PYFA 2DZPA 3V75A 1ZBWA 3MS8A 4CNPA 1NP0A 1C8YA 2VP8A 4FHAA 5BOFA 3RLGA 2YBUA 4MADA 2CLHA 4REQA 5AN7A 1REQA 4HTYA 4NAEA 1I8JA 1VF8A 3TTEA 3VZXA 3VCCA 1TX0A 5A6BA 1DJQA 1FHVA 1JNDA 1IEIA 3K46A 1POKA 1AJ2A 1DIEA 4XUYA 5DY2A 1E70M 2GPTA 3QFWA 4LAMA 2ZC8A 1YDYA 2Z24A 2O4QA 2OKOA 7REQB 4ZO7A 3VUPA 3GG1A 1FRBA 4ZBCA 5IOBA 3B8SA 1QI3A 4OQVA 2E0PA 2YL8A 3C2RA 4XK2A 4XZBA 2EG6A 1LOLA 2V0TA 2OU4A 4IG2A 2ZWYA 2AKMA 1F8MA 5CPQA 4J40A 1FFQA 2PBOA 2YSWA 4RZ6A 2JQXA 4QAIA 2G4JA 4W88A 3UWZA 2BTMA 2CW6A 2R1NA 3A24A 1R87A 3B8TA 3TDFA 4GI8A 4KWUA 4D72A 3RPDA 1CGYA 4GZJA 1DOSA 2ALDA 2GWNA 2GLKA 3CQIA 3UVIA 1NOUA 1TPFA 4Z1BA 4GUGA 4MWAA 4AZIA 3HG3A 5EA9A 2H3DA 4YVVA 3UZZA 1OEPA 1XI3A 1JR1A 3W7GA 6REQB 4ZB5A 2XH4A 3D3FA 4WKFA 1ZBVA 3MCMA 3F4NA 3WJYA 4FX6M 4J3UA 3ALGA 4S3JA 1F61A 1WE5A 4RE2A 5DCEA 1QTWA 1BKHA 4L9ZA 3D47A 2XN2A 4G7EA 3KVJA 4JEJA 4IIGA 5BU6A 3CHEA 5FEZA 2YFNA 5A8OA 2X2YA 5K4ZA 4NYUA 4S1FA 4W87A 3UESA 4QE5A 3S83A 3GSMA 1BG9A 4Z42C 2WXDM 3ZVIA 3WYZA 2QDEA 3KBNA 7CGTA 2XM1A 3NOEA 1CGXA 4ZFMA 3UJ2A 4IUOA 1OGSA 3B8IA 3UGVA 3TZNA 1JRCA 1T8XA 1W3NA 3WK2A 1GQJA 5HQLA 2NQHA 4AQLA 2ZX7A 4C6LA 5HMEA 3UG8A 1W9VA 3SIMA 4D8AA 3WNLA 4XIMA 3CLWA 2I5IA 3V0UA 4J1OA 1RBOB 2PSNA 3MB9A 1GK8A 3P82A 3SY5A 4P61A 1G9HA 1XM3A 3YPIA 1CENA 5A6TC 2G4FA 3GDTA 3Q65A 3HQOA 4BK9A 3W37A 5GNYA 4FPSA 3G2GA 2IXUA 4O1CA 1JFHA 3R8RA 4WKAA 4H6KA 1JZ5A 2VURA 3OO2A 1Y5WA 1F05A 2XFRA 1MSSA 2GK1B 2VEMA 4CEXC 4M8UA 4Z0SA 4RNJA 1P6BA 4DWSA 4LALA 4RZ4A 3GAYA 1F5ZA 1RSCA 1H11A 3L5AA 1DWIM 3GNNA 3LCFA 2JK2A 4PEKA 2ZXQA 1KRBC 3SJNA 1IHIA 2AMGA 4H6EA 2QULA 3T07A 4PB5A 4QJ1A 3N3TA 3FYPA 2CWXA 9XIMA 4LCRA 3THAA 4E4UA 2WPGA 2ZUVA 2XDFA 2QCLA 1MO0A 4QDPA 4X9SA 2IPFA 3RR1A 1PWMA 5G1MA 1XX1A 4ORMA 3WJSA 4XAPA 3TJIA 1IGWA 1UJPA 3UT0A 3A3XA 1J0KA 1ALDA 3NOYA 3PJWA 3ZT7A 7REQA 4K3ZA 4BI6A 3WQVA 3LN3A 1W9UA 2Q09A 3VIJA 4BR1A 4GY1A 4LS1A 5D33A 3CPRA 2YPIA 4Q8TA 5DN1A 2INFA 3A9BA 4AVOA 4XVDA 2PMQA 2UV8G 2YLLA 3HPXA 3R94A 1DKWA 3QR3A 4O0KA 1U1HA 1LLZA 4IH3A 1QNSA 1TPC1 3PJXA 3P62A 2WNNA 3TK7A 2DDXA 1SJAA 1TPB1 4H9UA 4WF7A 3AU2A 4GNKB 3VI2A 4UC5A 3LNPA 1F3WA 5LNUA 2NLYA 1E56A 3R10A 4IPIA 3F4VA 4PSRA 1HL8A 5DMYA 1KFJA 5HPCA 1DXEA 2CERA 4JTLA 1SZEA 2BVWA 2WJZA 1UUQA 3BTNA 3SSJA 1PWLA 4TTGA 4IWWA 1W5MA 2E1WA 1IV8A 1EYWA 1A3XA 2BVDA 3S9YA 4MJ2A 3IJQA 2A3LA 4WJXA 6REQA 4ZOEA 3A6OA 4D2JA 3CMFA 1UWSA 3U57A 2VYOA 4DPPA 4PBGA 3S1XA 2HRWA 1I45A 3I4EA 3LRKA 2H6RA 5D03A 2PDIA 4WRHA 3OHIA 2WSQA 3KL0A 3UG4A 4O4WA 1WAUA 1X97A 3PZNA 4PTNA 4K2SA 4FAMA 4EOUA 4BQ4A 3A3WA 4GD0A 4EXBA 2E09A 2PRMA 1O5QA 2BGNE 3W38A 1HO4A 4XBJA 3MZNA 1DV7A 2WANA 1R86A 1BPLB 3PWIA 2XIMA 4IL0A 1GOWA 4NP7A 3MSYA 3GTHA 2NT0A 4QLLA 1QCWA 3P8JA 3DG3A 2PUZA 4UTUA 3HBLA 1TE1A 4WSKA 4R33A 5A2CA 3OB8A 3WEMA 3FSUA 5LKYA 4J3TA 1TYGA 1PL9A 2X42A 2G95A 1GOKA 3QC0A 4C6MA 2FJUB 1ZJIA 1E1CB 1LYXA 4OKDA 4W93A 2ZC1A 3GDKA 4RZ5A 3DYPA 4E6MA 2XPKA 1BWVA 4JTTA 3VOHA 3VKCA 4ZQNA 4N4QA 2DSKA 1H50A 2V5LA 1GHSA 4FIQA 3RX4A 1AUSL 2IKGA 4V33A 4ZO6A 3VC5A 4Y6GA 1RJQA 2BXVA 2YBTA 3OW1A 4LOCA 2ISSA 2X1SA 1K6AA 2FIQA 1A5KC 4KEMA 1C7TA 1JI1A 2GK1A 2DSUA 3T8QA 3R7MA 1DQUA 2PDQA 3TW7A 1XSIA 1R38A 3NPVA 4XB3A 4IMGA 4YL2A 1PUDA 3P84A 4FNSA 2C15A 1ONXA 1M9HA 3WDQA 2E77A 1TV5A 1TA3B 1MZRA 4V27A 1UBPC 4HTBA 3QGAC 4CQ9A 5I3IA 4UTTC 2Y5SA 4MAZA 1DXIA 1EGZA 2E8YA 3LDVA 4P8UA 1MWOA 2J78A 4R5EA 3BOLA 1SU5A 4C5ZA 4GUIA 4HB7A 3N29A 2TODA 1AODA 1TPEA 3CO8A 1Z69A 4O4VA 2ZUUA 2G3NA 1FTXA 1KFLA 1MXDA 2WVTA 1H0GA 3NO1A 3AYVA 4MB3A 4Y9PA 5I02A 2WC7A 5M2FX 3W1RA 2ZKMX 3S8HA 2EPMX 2QCCA 1KO0A 3SQMA 3O63A 2Q71A 2XM2A 3EPMA 3LSCA 3BDKA 4QCEA 2A79A 4MKSA 1F73A 2PGEA 1PE1A 1Q6FA 3G3DA 4YIWA 5G2WA 3GIPA 1WZKA 4S3KA 2VEPA 4HJFA 4LVGA 1US3A 2V2CA 1IZCA 1V6TA 3WQDA 1RBLA 2PA6A 3W72A 2GSHA 3V35A 5EFFA 3NEVA 4TU1A 2Z28A 4A2SA 1XR2A 5C2GA 1VLIA 5AC7A 1WDDA 2C6QA 2OZ0A 3K30A 3OZPA 3OVQA 4KS0A 4XBSA 4JBRA 4O54A 2YDRA 1GNXA 2Y8VA 1GG1A 4Q33A 1V51A 1VYRA 1UIOA 3FFSA 6TAAA 3SQSA 4MWAE 4CD5A 1VBHA 4XZLX 1CGVA 2J7CA 4IICA 3TJLA 2DSZA 3WZ0E 5F2LA 1LQ0A 2WZTA 3HGOA 5HWMA 3M6DA 4GYPC 2BY3A 4PCSA 3H70A 2XGZA 1EO7A 2ISFA 1AMYA 1QFEA 3LU2A 4QNEA 1ISXA 3LOTA 2Z0IA 1XIFA 3SCOA 5ABHA 1G5AA 3SGZA 2F2KA 5AKQA 1JYXA 1K9FA 1KTBA 1XH2A 2DT1A 4HU3A 4DI9A 3NEHA 2NV2A 4IZGA 2WCGA 4GG9A 4JYFA 4LCQA 3MMUA 4PBEA 3RU8X 2V2HA 1BXBA 4Q7NA 3O1NA 2X41A 3R79A 1EWDA 4QNWA 4GOAA 1I2NA 3P0XA 4HNUA 3UU0A 2VVSA 2J7GA 4RW5A 3LXBA 1BQCA 1U1JA 1SMAA 4LUTA 4JL2A 3UR5A 3W4RA 1CGWA 4GWEA 4LRTA 3AZRA 1UJQA 1K8XA 4DB7A 3W3OA 2Z1KA 1XQLA 4RW3A 2JBMA 3TSDA 1S2WA 1E1CA 3ZR6A 3ITGA 2VOTA 3LMZA 3V7PA 1ZFJA 3TYAA 4IP4A 2B4GA 2AOSA 1FDJA 2XZ9A 1Q6GA 5LA2A 4PC8A 5E09A 3NQ2A 4C1LA 2VZUA 3QY8A 3MSRA 2P8BA 3ZR4A 3BOXA 4WXZA 1UKOA 1XW8A 4MZYA 4XD4A 3FEQA 3MCNA 3URAA 1MXSA 2NXHA 2X1UA 1FH7A 3ZJ7A 3NJ3A 1GJPA 2Z1WA 5XIMA 5E9XA 4BFAA 3TNBA 1LLWA 2X2GA 5I03A 2VGGA 2IW0A 3BANA 3GE7A 1NY1A 4LB4A 3K5XA 3DXIA 1HO1A 1VFHA 3INPA 4GMEA 4OJYA 3B8DA 1M7PA 1DJZA 3QXBA 2D3LA 1EF2A 4D71A 4YTTA 2XGBA 1DWFM 4RUBA 2VX5A 1DORA 3W2UA 3TIMA 1W91A 4P8XA 2WMHA 2CLKA 4AFYA 5GVJA 1JAKA 3NZPA 5AYIA 5JH1A 3WELA 4ZOBA 4QEHA 2DUAA 3UYCA 1H7WA 3EOOA 4JCLA 4E4PA 5FEWA 2O4MA 1UR8A 3SCRA 5C70A 5EBAA 3R5EA 2B31A 1GOMA 4JIIX 1NELA 4UTKA 3VD9A 3WD4A 5H6HA 5DMNA 1UR9A 3EPOA 1B30A 1U5JA 3PSWA 4HK7A 2NSXA 3RLHA 4LAOA 1M7XA 1PKLA 1OC7A 1SMDA 1FKWA 5CBBA 1Y5VA 3VIPA 3THCA 3WD3A 1FWCC 3VC6A 3VD5A 1RP8A 5A6MA 4Z2IA 3HO8A 5CJMA 1XRTA 2F61A 2XIBA 4GJ1A 1U22A 1TTQA 4NX5A 1KC7A 4JY8A 3UGRA 1C7SA 2ZVRA 3MP4A 2CZFA 2ACRA 3AI0A 4HNVA 5G4WA 1UKQA 4E8GA 1HJQA 3ITXA 4DO7A 4F79A 4I5UA 1I0BA 3W07A 5E0CA 3TROA 2V68A 1LZOA 3W26A 2DEPA 4N9EA 2GWGA 4YPJA 1DIOA 1RPXA 1HKJA 4HMDA 5M17A 1CX9A 1VFMA 4NIRA 3OA3A 3O6DA 2Q02A 3WLMA 1XP3A 5T9BG 3EMCA 2VXNA 5D8ZA 5I3FA 2YZRA 1X8CA 2G3JA 4X22A 3MC5A 4O1EA 3KOYA 3A5FA 2UBPC 4PEEA 1PDYA 4IMAA 5TBOA 3B8WA 2IS7A 3R58A 4KEVA 3S6OA 2PDHA 3CQJA 1X6NA 3VIGA 1OIMA 2WVUA 4NSBA 4O16A 5HNRA 3AO0A 1VBRA 2XU2A 3A5VA 4O52A 3DFOA 4KETA 4HU8A 4UNIA 3QV9A 3EEGA 4XD5A 1CT5A 2ACSA 2WMFA 3OYXA 4C6IA 2I14A 4JN7A 4CEUC 5E6ZA 3O6AA 2Z25A 3DENA 3T6CA 2W27A 3AIBA