5E93A

Crystal structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with neq0071
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Exploring Trypanosoma cruzi Dihydroorotate Dehydrogenase Active Site Plasticity for the Discovery of Potent and Selective Inhibitors with Trypanocidal Activity
rcsb
source organism Trypanosoma cruzi strain cl brener
total genus 110
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2015-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 5e93A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5e93A01
3HGOA 2O7SA 1QDSA 4WD0A 1SZEA 3VE9A 2WSYA 4E2BA 3IGSA 4WX2A 5EL1A 3G1SA 3NA8A 3ATZA 2ABAA 2ZRXA 5D2VA 3GKAA 1Z44A 3W86A 2J88A 2X1TA 3M5VA 3W2JA 3UXAA 3LHWA 3QQ0A 4K38A 1M5WA 3IIPA 3MI2A 3M5XA 4Y90A 1SW0A 4Z1AA 4QIUA 1MO0A 3GDRA 2Y89A 3NG3A 4A2SA 3GIYA 1H7NA 4NZFA 3G1HA 3EXSA 1P4CA 4NT0A 1MZHA 3B0PA 3P8JA 4N9DA 1GVFA 3MYPA 1FCVA 1AMKA 3GAYA 2WSRA 4JXCA 1B4EA 3RLVA 1QPRA 4CQ9A 3EKZA 1EEPA 4DPQA 5H2ZA 4MOZA 1Q6LA 3NNTA 1OK6A 3PAJA 3DXIA 2R14A 3NL5A 1KLYA 3GDMA 1W56A 1OYCA 1H62A 4GUHA 2CZDA 3W88A 2Z0IA 1IXOA 3W7LA 2Y88A 4FNTA 1ME7A 3PWAA 5HNRA 5F2LA 1J4EA 4ZL1A 1RZMA 3LM7A 3G1AA 5MHBA 3G24A 3GDLA 3KOFA 1W5QA 3I65A 2Y61A 1ZAHA 4DELA 4MYXA 3UQNA 3EWWA 1DV7A 3P62A 3E96A 4S2BA 3SR7A 4AAJA 3EX3A 4N4PA 1YDNA 3M44A 1GYNA 3C2FA 1JVNA 4O11A 3IRDA 3W7PA 3NQAA 2ZTKA 3HQ1A 3GZ3A 1AW5A 1M7OA 1XBZA 4WQ6A 4DF1A 4PCFA 3CIWA 3JR2A 5L6UA 3LBMA 3UY8A 3V1PA 3WK1A 3D0CA 5EA9A 5D2TA 1O95A 3P80A 4UMCA 2ZZ1A 1XC4A 1YXDA 5HWJA 2QAPA 2ZRVA 1KM6A 1JUEA 4LVAA 5FEPA 3P67A 4HT3A 1DQXA 3IV3A 5DCBA 4ADSA 4O52A 3HPSA 5A8GA 4WZHA 2GQ8A 1H7XA 2JGQA 2X2GA 3W7EA 3VE7A 1JRBA 1B3OA 1QAPA 3QQ1A 1LRNA 3DFSA 1RQBA 5TIMA 1RQHA 3T44A 1FXPA 1WDWA 2QKFA 3LCHA 3EWYA 3FYOA 4CQ8A 1RV8A 3M5ZA 4Y96A 2OX1A 4LUIA 5IBXA 3P84A 2ZZ4A 5T26A 3SJ3A 3P60A 5KMYA 3B0VC 4JTFA 1R2SA 4BI5A 3I7SA 2H3DA 1D3GA 1PHWA 3DFTA 5D37A 1JQVA 4XTIA 3S5ZA 3W1XA 5AYYA 1OFBA 3LB0A 3TSBA 2QCHA 1KFCA 5F2MA 4RCXA 3L0GA 4UCGA 4RLIA 3LCWA 1VYSX 4UTTC 5KZDA 2CLKA 3E49A 3G1XA 4O4WA 2JKAA 4N2YA 3F03K 3NOEA 4JYFA 4OT7A 3NGJA 3JRKA 5DXXA 3RK8A 2ZZ5A 3UWUA 1OYBA 1LORA 3ELFA 5AHIA 4U4MA 3W7MA 4GXMA 3QPZA 3O07A 1UCWA 3LBCA 3LV5A 2C3ZA 4XKYB 3WJWA 1W5MA 2W0UA 3W2LA 3TU9A 2Z6IA 3CT7A 4KFPA 2I9EA 2WKJA 2VEMA 3KRZA 1FQ0A 3MHFA 1XBVA 3HPXA 3W2UA 3W72A 1F2JA 5D2XA 2F7FA 1L9WA 5CPMA 5DCDA 5TQLA 4IWWA 4JYDA 5CZ0A 5G4EA 1VHCA 3W7QA 2Y6ZA 4JX5A 1TCDA 1EWEA 4O14A 3MP5A 5LHFA 1KBIA 1SO3A 3B8DA 5D30A 3C52A 3QPYA 5K7JA 3C56A 2NV2A 3LI0A 5I3IA 1QOPA 3QW4B 2C19A 4GNJA 4DEFA 1W8SA 2NXGA 3ABQA 3EEGA 1Q6OA 5AOUA 3NPXA 2J9ZA 1K7EA 3THQA 3G8EA 4Z1BA 5G2HA 2Q3OA 3A22A 3NVTA 1SZFA 4NX5A 4X2RA 5LKYA 3INPA 2VEIA 1JCYA 3PG8A 1K03A 4A3UA 2IQTA 1GWJA 3PBVA 1G4PA 3MMTA 3PUOA 5E0KA 4O18A 4IXXA 1XBYA 4IPIA 1O94A 4ZQMA 2BXVA 4H4IA 5HR6A 4AF0A 1J2WA 2DU2A 1X6UA 1TPC1 3PUDA 3PSWA 2D73A 1EUAA 5HINA 1FDJA 3CIXA 4EVZA 1W54A 4OBTA 3CWNA 2QJHA 4O0KA 3TK7A 5LNWA 3W73A 3W1TA 2AQWA 4OQVA 1ICQA 1X8FA 3EWBX 5BMWA 4AHOA 4ML9A 1Z42A 5K4XA 2CW6A 4I7UA 2RDUA 3UPBA 1VYRA 2H8XA 4NJGA 4O1AA 3M41A 4CCEA 1FXQA 1M6JA 1C9DA 4IX0A 3BGJA 2P10A 3O05A 5DBUA 4LS1A 1ICPA 3MYOA 1DQWA 2OJPA 1W3TA 1DHPA 4HNUA 1THFD 3W76A 2VFIA 3GLCA 4O15A 1TQXA 3TXVA 5CZTA 4LY8A 4FNQA 4KKXA 3NZ1A 5K2ZA 3WJSA 1N55A 4S2CA 5KINA 2DZTA 2DJLA 4IMEA 1G69A 1TPEA 4D2JA 5CSSA 1YXYA 2TMDA 3W1AA 4YLWA 2BX7A 2ZA3A 3TE9A 3W83A 3M16A 1DJQA 3FLUA 3QSTA 3TR2A 1Z48A 3R8RA 3TUUA 4LS0A 4HPXA 5AC8A 4TU1A 3S0CA 2B4GA 3S5OA 3L68A 4HIBA 1F6KA 4BI6A 3FS2A 1NVMA 4CCCA 4FXSA 1N8FA 5E1QA 4A29A 1EX5A 3O6YX 3L5LA 2NX3A 3R5EA 2VFFA 3NL3A 2XN0A 4QITA 3BW2A 3GB6A 3HGJA 3MP3A 4E38A 2ALDA 3L5MA 1PE1A 3L2IA 4EOUA 5FEXA 2VFGA 3NQ6A 2G95A 2Y62A 5DN1A 5K3VA 4ALDA 1OX4A 3W71A 2VEPA 3LERA 2PE4A 1AW1A 4O17A 2PRHA 1XBXA 4JN6A 2RKXA 1PL9A 4UTLA 4ZMGA 1G7VA 4TIMA 4TMBA 3IGUA 3W84A 2O7QA 2Q3RA 2PURA 1E51A 3DHDA 2YYUA 3CLMA 4W9TA 2NWSA 1R30A 3C2EA 2C14A 1UB3A 4CLMA 2VFHA 1ZAJA 2R8WA 1A5BA 5K9CA 4AVFA 2NXHA 3DHFA 3LHUA 6ALDA 3JS3A 3LHTA 2RDTA 4MZ1A 2GVGA 1P1XA 3B04A 3HJZA 4UUIA 3SGUA 5KITA 3NL6A 3TJLA 3W3OA 4IPJA 2WOQA 1MEIA 4M6VA 2P0OA 3GNNA 5BNKA 3IIZA 3NDOA 4QAIA 5F1UA 4BWLA 4P61A 4POCA 4UTKA 5HJLA 1O5XA 2Q8LA 4UIOA 1T96A 4YCPA 2Z1BA 1JCMP 4K8EA 1TJPA 4MJZA 1PVNA 4PODA 5AC6A 3QH2A 3UWZA 4XZ9A 2NX1A 1S5TA 4O4VA 5DCEA 1I8JA 4EWND 2YGYA 3VI2A 2OT0A 3AO0A 2GVJA 2DORA 3GR7A 1OFRA 1R47A 3KVLA 1GTEA 3LTYA 3NQCA 4R53A 3DFOA 1RD5A 1I2OA 1DKWA 5FF0A 3UPWA 2TPSA 3NXFA 1I45A 4JY8A 3DENA 4FIQA 2WO5A 3E9AA 1KV5A 4DF0A 3KXQA 2V5LA 3HO8A 5L9FA 1KFKA 3FOKA 3LCGA 2EF9A 5F2GA 2CLOA 3KVJA 5D2WA 1EP3A 3HG2A 4JD4A 3MO7A 4Q33A 2FPVA 4AH7A 5LNRA 3TC6A 5LHEA 3TW6A 1GJPA 4O1BA 2ZZ2A 3F4NA 1LOLA 3N73A 3FJLA 1OF8A 3QW3A 1K7FA 4AHQA 1LLZA 1LRQA 1DOSA 3O16A 1KW1A 2V0TA 1WX0A 2A4AA 3U6WA 5EKYA 5KZMA 1V5XA 4WOQA 1KM4A 1H1YA 3MHGA 2PRLA 4BFAA 3TCEA 1WA3A 2CLHA 3T4CA 3W87A 1V7YA 1LOQA 3MI3A 4K7YA 5HMSA 1TPVA 3UYCA 4LT9A 4UMAA 3WFAA 4AWTA 3W1RA 3O06A 1ALDA 4QJ1A 4ZZ9A 2X1UA 1A5AA 2YR1A 4O8RA 3H54A 3GXNA 3NM1A 4Y8FA 4MYAA 3BW3A 4NU7A 1K02A 1MXSA 1ZJIA 4FEZA 3PULA 4JTHA 4OV9A 3W22A 3S5YA 5FI8A 1TTQA 1W5NA 1FY6A 4MFDA 5F4SA 3BG5A 1F6PA 4I7VA 4H6KA 5LNVA 1SUXA 1VGAA 3PSVA 1SR9A 2QCFA 2VOMA 3R13A 3W70A 1M7PA 3QMTA 1OJXA 4AF0B 2FQIA 1G4SA 4LNYA 1P5BA 2CZEA 2ZFAA 5FEWA 3DH7A 1ADOA 1L2UA 1LLWA 3STFA 4HKPA 4WY0A 3R89A 3ZWTA 3EWUA 2V2CA 2XN2A 3W1PA 1EB3A 2QCCA 3TQVA 5CPLA 4K6AA 3OEXA 4CNNA 3P82A 2Y70A 3LCFA 3IIXA 1TPFA 2QDGA 2C18A 2WNZA 4UTMA 1FCQA 1IIHA 2G96A 5D02A 1XFBA 4NX0A 4DF2A 3DKLA 4JIPA 1CI1A 2CLMA 3PVFA 1LBLA 1HO1A 3NQVA 1VLIA 1H61A 3PB2A 4N4QA 2NLIA 2WNNA 4X3ZA 2AAMA 1W5OA 3E02A 1F5ZA 3O8AA 3M5YA 4XTDA 5DY2A 1S5WA 3KX6A 2Z6JA 1PHQA 3TV8A 1TPUA 3TNOA 3UWYA 2YFOA 1OF6A 3HGRA 2WQPA 5LNSA 1CW2A 2H90A 3NQ2A 3HG5A 4RV8A 3LRKA 3G0SA 1W5PA 4XUGA 1SQ7A 1SO6A 3CB8A 3SY5A 3N9RA 1Q45A 4QSHA 1QPQA 1QNVA 1TJRA 7TIMA 3C2RA 4UFKA 3CHVA 1DORA 5AHLA 2C1HA 3P7YA 3UWQA 2CFFA 2YDAA 1G67A 3W7JA 3W07A 4UNLA 3Q58A 3IVTA 2HS6A 3SGZA 1ME9A 3HMJG 3G1DA 1MEWA 1SFLA 3DI0A 3EX6A 3W6YA 1KFEA 3O1NA 1N7KA 4AB4A 4UC5A 5CG7A 4O53A 2GJLA 5C5YA 3LHVA 2ZRWA 1ZALA 1I2PA 3GXPA 4JX6A 3G0UA 1DL3A 3QFEA 1O60A 3N3MA 4ZQCA 5G1YA 1IGSA 3IIOA 5CZJA 3W1LA 1G4TA 1W0MA 3LHZA 2ZZ3A 4O28A 5CZSA 1TYGA 5D32A 2E1DA 5G2WA 3A5FA 1OX4B 3FYPA 1VC4A 4AXKA 3GYEA 2ZRZA 1GQNA 5U4NA 1NFBA 3A23A 5HWNA 4UTUA 3ZR4A 4GC4A 5HQEA 2A2IA 3T78A 1IXNA 4PTNA 4HNTA 1NEYA 1BWLA 3HGSA 4NJIA 2ATMA 3GVGA 4R33A 4JY9A 2TRSA 3G1FA 1TO3A 3NQ7A 3P81A 3GKFA 4M6QA 5AYXA 4CCDA 2YSWA 5KSWA 4NJKA 2Y85A 2QJIA 1MEHA 1RR2A 2TYSA 4UFJA 3RMJA 1VCFA 3A9IA 2DZWA 1K7XA 5HULA 1SU5A 2BWGA 2BTMA 5K9DA 2QUVA 3L9CA 3NQFA 3S6DA 4AWUA 3L66A 1JJKA 1GEQA 1R2RA 1W3NA 1W3IA 1FWNA 4RK8A 1YDVA 4PC8A 3VCRA 2NWRA 2Y7GA 1KM0A 2W79A 2X30A 3NZRA 1XCFA 1RVGA 2A85A 5FESA 4YL2A 1LBFA 1VQTA 3LLFA 1WBHA 3PB0A 3QZEA 1SFJA 4DQWA 3CM4A 4DBDA 2YZRA 3B4UA 3O15A 3R2GA 4PEKA 1FDYA 3VFLA 2ZA2A 2ZZ6A 4MLJA 4N02A 3BG3A 1EPXA 2Y63A 1GG1A 3QMRA 3B03A 2PCQA 3C8FA 4E0CA 1U83A 3NEVA 3MP4A 3W7OA 4IUOA 3MWAA 4UNKA 1BWKA 4LVFA 3ZFHA 3U2OA 1DBTA 4N6EA 1SZNA 3G8RA 4FXRA 5J5DA 4M7TA 2DP3A 3LRLA 3WK3A 4UR8A 4ZVJA 3TSDA 4NXSA 3W7HA 1TPB1 3NAVA 2EPHA 1ZFJA 5SWUA 4UTTA 1I4NA 3UD6A 2QUTA 3L21A 3ZWSA 4TMCA 1XUZA 3KFTA 2F84A 1SZGA 3Q94A 3W74A 1EP2A 1OFPA 4MKNA 4NZJA 1KTCA 2ZA1A 3KRSA 1TRIA 4GUIA 4IX2A 3U8GA 1TPDA 4PL1A 2FPTA 4JDYA 3WJXA 3PC0A 3TDFA 1OFQA 3LXAA 2E5CA 1Z41A 1VCVA 2WV8A 1I2NA 3PBYA 3RFAA 1LBMA 4XQ6A 4M6PA 1T99A 2QCMA 2V2HA 3I7RA 4KWWA 4AHPA 1QOQA 1TSIA 4OGZA 3STEA 3LX9A 2Y7DA 4UMBA 2J27A 1KM1A 3F1QA 3NPWA 1AL7A 2GQAA 1VCGA 1KLZA 3CTLA 1F76A 4M7SA 5D38A 4RKAA 4MY1A 1KV8A 2V30A 3DI1A 4O16A 1T0OA 2ZDRA 5DXYA 4QNWA 4NUWA 2OZ0A 4KFNA 1P0KA 5I3FA 1JULA 3TA6A 4E2DA 1JCJA 1W37A 2OT1A 4R34A 4FNUA 2ZRUA 5AC7A 1LYXA 3LOTA 5C6MA 4MLRA 2JKPA 4LTSA 3GX9A 1O4UA 2QCLA 4RXFA 5K9XA 5FEZA 4N9BA 4TR9A 2NUWA 2ABBA 2E77A 1KFBA 5D05A 4NNBA 4WY0B 1YDOA 5EYWA 3FKKA 4MIMA 2G97A 1YPFA 3N34A 4JEQA 3FA5A 2A0NA 1GVRA 1I2QA 3Q37A 2FLIA 1YLVA 1HUVA 3BLEA 3TXZA 3GK0A 4Y6GA 1WOBA 4TX9A 4O1DA 1XDLA 1AW2A 5BMXA 1L6SA 4JX4A 8TIMA 4NJHA 3N2XA 1XKYA 1A53A 5FF2A 3DAQA 2B0MA 3EB2A 3NPVA 4YMZA 3VKJA 3E12A 4PA8A 3LDVA 2WSQA 4K36A 2A6NA 4LOCA 1FDZA 1SSGA 2H3BA 3TAOA 3BVJA 4C1KA 2E09A 2HS8A 5C2XA 2ATSA 3C3NA 1WAUA 3ZS4A 1LTDA 1HFBA 3LRMA 4OHQA 1AL8A 4K37A 5A5WA 2FPYA 4JGDA 1H7OA 4HHPA 2JKEA 4OE7A 2GVLA 1EP1A 4EF9A 1YTEA 1LROA 2DZPA 1HG3A 3OVPA 4FX7A 2A6LA 3VNDA 4WXYA 3E0IA 1GT8A 3W1NA 1SW7A 5FF3A 2KZHA 4ORIA 4FIRA 3UWVA 4KWVA 4O10A 3GDKA 2JK2A 5TBOA 3RLUA 2Y7FA 2VEKA 3M7WA 3QMSA 4PH6A 4ADTA 1D3HA 5BRBA 1NF7A 3QYQA 1LM1A 2NUXA 4N9EA 3IVUA 4IMGA 4LVDA 2QCDB 4I7WA 1VJIA 2CLIA 3H55A 3NQDA 1KBJA 1PCWA 5DY3A 3O6DA 1VLWA 4QM1A 3CEPA 4MZ8A 5DELA 3USBA 2E6YA 3TFXA 3CWOX 3W7DA 3A24A 4MY9A 4LU0A 1FWSA 5AHNA 3IVSA 1DJNA 1U5JA 4O0ZA 3W7IA 4ICNA 3QSRA 3LTPA 1WBJA 3B05A 3CU2A 1NF0A 1H50A 2NXIA 5CKSA 4HPJA 3W7CA 3UNDA 2E6AA 5D33A 3M0ZA 4GWEA 2NZLA 2A5HA 1QPOA 3S1XA 1TPH1 4DXVA 2E5BA 1K3UA 3QC3A 2QF7A 4WY0F 4UTJA 2ISVA 2TSYA 1GPWA 3WJZA 1UUMA 3UXDA 1Q6RA 5AHMA 4A22A 4YWIA 2QEZA 1A5SA 1LDCA 3I68A 3NQGA 3G1YA 2J6XA 4LV4A 1GOXA 5LGXA 1QO2A 3NM3A 4ONVA 3W7RA 3MW7A 4YXGA 3BG9A 4Y9AA 3W75A 3C61A 4AEOA 2JGYA 3N9SA 4UTHA 5D2YA 2YFNA 1KM5A 4MVAA 4FB7A 4EF8A 2CLFA 1H7PA 1WQ5A 2J24A 4LWWA 3G0XA 4RZ4A 4DO4A 3QM3A 2FTPA 3FKRA 3GR8A 3R12A 4RR4A 1UJPA 1QPNA 3I7QA 5HUOA 3TW7A 3LI1A 1UBSA 3PBUA 1L6YA 1YADA 1GZGA 1ICSA 2ZTJA 3NQ8A 3LV6A 3M6YA 3PY2A 5CPNA 1OG0A 4WUIA 4XBSA 4U28A 4UFIA 3O63A 2R91A 2RH9A 5I3GA 1OFAA 2FJKA 1TMHA 2EKCA 3W1UA 1VPXA 3DZ1A 3M47A 2NV1A 3TFCA 1F05A 1S3HA 3OVQA 1KFLA 1KTBA 3SZ8A 4OU1A 1TIMA 2Y7EA 1TTIA 3EX2A 4ZQPA 5BW6A 5G2IA 5EPDA 3THAA 4MJMA 3PM6A 1LCOA 3G1VA 2DJXA 2BSLA 3ABOA 4O1CA 1G4EA 4LW7A 3W1QA 1JCLA 1YYAA 1GVOA 1GVQA 1VHNA 4MPQA 4GRSA 3W2NA 3TQKA 3S1VA 3P61A 4L4LA 1CX9A 2C6QA 5LNUA 5IBXC 3TC7A 4S1FA 1K8ZA 4AWSA 2W6RA 4FX8A 5J5RA 1TRDA 2A1YA 5HR7A 1TV5A 2C13A 3LCXA 5EY5A 3L5AA 2YPIA 3KVMA 3PUEA 2XN1A 2HMCA 4UR7A 4Z0SA 1F74A 1LZOA 5F1VA 1TTJA 4LRSA 1PS9A 3P8IA 2QDHA 2CU0A 2GJNA 1SPQA 4LV9A 3S1WA 3G18A 3MBFA 1UASA 3EWXA 4UFLA 4LVGA 3T40A 5DLCA 1FX6A 1P0NA 1YTKA 1OFOA 2YXGA 4RXGA 4BF9A 1F7BA 1OABA 3HPZA 4FNPA 3LCIA 4O57A 4JIQA 4JTKA 1LOSA 2A21A 2C16A 2B7OA 3STCA 1SO4A 2QCNA 2GQ9A 3DFPA 4C1LA 4JTGA 4UXDA 4JTIA 3C2OA 4WXZA 4N6FA 3AJXA 5K4ZA 4JR5A 3MHUA 1EWDA 2YW3A 5AFDA 3W7GA 4GUJA 4CNPA 1ZNNA 4UTWC 2LLEA 1L6WA 2V5BA 3W85A 4TO8A 3GNDA 3B06A 4DO6A 5LSMA 1W1ZA 1VZWA 4IMDA 1K8XA 3NR0A 3GDTA 1ZHAA 1EA0A 3MJYA 3FJ6A 1XL9A 1ZENA 3M43A 4ZQRA 5HUPA 3BGGA 3MUXA 1OHLA 2QJGA 1TPWA 4FF7A 2QCDA 3FFSA 4Q32A 2P1FA 2DZXA 1ME8A 1NAL1 1OFDA 2YX0A 1JCXA 2V9DA 2Q8ZA 4I9AA 1VYPX 2UV8G 1GG0A 1QCWA 1B57A 4LC6A 1FCUA 4GJ1A 5I3KA 4X22A 2ISSA 1H7WA 2E68A 2ZZ7A 3GAKA 3HBLA 4NXKA 4UTIA 3BLIA 1W31A 1H60A 3QRHA 3HG3A 2B7NA 2J9YA 1SW3A 3C6CA 2HTMA 1QR7A 4LRTA 3FEMA 2PRMA 2QAFA 3DU0A 1MSSA 4UFMA 3W7NA 3P5YA 4MUZA 1RPXA 1XDMA 1RQEA 2FB2A 5FF7A 3WJYA 1O5KA 2VC6A 2E5DA 2BZNA 4R7JA 3RU6A 5D04C 1FBAA 4PL2A 4G1KA 3KAOA 1C29A 3DKJA 2A7PA 3H53A 3KRUA 4FHAA 2XFWA 4K7VA 2B7PA 3CQ0A 3P5ZA 4DBEA 3N19B 3IIVA 2AGKA 6TIMA 4YCOA 2RHGA 4JNMA 3G22A 3QEZA 4LUJA 3W1MA 3SIZA 3ABSA 3YPIA 4OWGA 4IGHA 1J5TA 3W9ZA 2EGZA 3OVRA 4O54A 1OFEA 2E6DA 2X16A 3BW4A 3C2VA 4FX6M 4UTWA 3NQEA 4LS2A 1TQJA 3TX9A 1XXXA 5C55A 2WNQA 3KHJA 1WV2A 1X7FA 2A7RA 2GOUA 1DVJA 1H5YA 3IGXA 2YCEA 4MFEA 3RF9A 5G4WA 1OYAA 3KVKA 5I3HA 1G6CA 3OIXA 1FCBA 4LC8A 3BO9A 3NPUA 4JTSA 1FWWA 2OMAA 3ATYA 4RZ6A 1FWRA 5F4XA 1C8VA 2ZCGA 3S42A 2DZVA 3LTSA 1VR6A 4AMAA 3EX1A 2WPBA 3W23A 3C4UA 2X1RA 4FO4A 5KZEA 5LGZA 3SSJA 2B7QA 3ABRA 1PV8A 1A5CA 3TROA 1TV7A 3DBPA 2QR6A 2G5WA 3I6RA 4JTEA 4KFOA 2R94A 1Y0EA 4NVTA 3OBKA 3PG9A 3LGEA 1KFJA 3C0JA 1OX6A 3L67A 4RX0A 1XI3A 5HWMA 1TB3A 3S9YA 4A2RA 1F73A 2NUYA 3IEBA 2H8ZA 4JTTA 4K8HA 2E6FA 4M19A 3DFQA 1QWGA 5CPOA 4GBUA 3S8HA 1ZY9A 5FF4A 1KA9F 1JUBA 3W2KA 3L65A 3FIGA 3SW6A 3TMQA 1B9BA 4IJBA 2RDWA 4ORMA 4XWUA 5AYZA 3DFNA 1OX5A 2VELA 3N14A 3WK0A 4N9CA 2VXNA 4IMFA 4X9SA 2C0AA 3ANYA 3EWZA 2X1SA 5EBUA 4J9JA 1IXPA 3HIJA 5CGQA 4RJEA 3NQMA 3CC1A 1ONRA 3A21A 3NL2A 4JYEA 1BTMA 2Z2UA 3A5VA 3M1ZA 2VENA 4HNNA 1T8XA 2VFEA 4IOTA 1K8YA 4HN4A 2EHHA 5C54A 4QNEA 1NSJA 1GTHA 3HG4A 1OK4A 1QO5A 4LVBA 3S1UA 1SO5A 1QMLA 4A21A 3BPWA 2HSAA 2QCEA 1AG1O 3UY7A 3PR2A 4GE8A 4GUFA 4DPPA 2VFDA 2JBMA 3N2MA 3PBWA 1WXJA 2V81A 3OHIA 2V82A 4BWLC 3G3DA 4HSOA 4K39A 1XUUA 3HOJA 4FNRA 2RFGA 4UFHA 4M5PA 4CQAA 4HNVA 2ZQ0A 3O6CA 3OA3A 1JR1A 1HO4A 4CNOA 2GUUA 1H7RA 5DBTA 3TMLA 5EMUA 2C15A 5IM51 2I14A 4P2VA 2PC4A 4Z1CA 1EUNA 5LZLA 1VRDA 1WOAA 5E93A 3DGRA 3HF3A 2I1OA 1TREA 1JCNA 2ZBTA 5D09A 1JRCA 1YTDA 1ZAIA 4JTLA 1G7UA 1TV8A 1S5VA 4Z08A 1D9EA 3L0KA 4GFSA 2CLEA 4IMCA 4QISA 5AN7A 5G5IA 1H63A 3UZ5A 4FNSA 5F2IA 3EXTA 5U7SA 1H1ZA 5CSRA 4NQ1A 3TH6A 3V75A 3GXTA 3W7KA 3NYZA 4BR1A 1Q3NA 2FB3A 2YW4A 3LXBA 4MY8A 3EX4A 3TQ0A 3P74A 1YXCA 4BK9A 3UZJA 4JICA 4GUGA 2ISWA 2J9XA 3BK0A 2FIQA 3TAKA 4ZQNA 2CLLA 3UWWA 1PIIA 1VH7A 4IQLA 4JDBA 4H3DA 3EKLA 1GYLA 4Z1DA 1SSDA 3BLFA 1UUOA 3LXCA 3LHYA 1XM3A 3K30A 3TJXA 1R2TA 4NNCA 5F4WA 4XBKA 1A50A 1BKSA 1PCKA 3MBDA 2QUUA 1B4KA 1ZCOA 1OVDA 1X1ZA 1KTNA 1BEUA 3HB9A 2GPTA 2EAWA 1YPIA 2ZYFA 4WOZA 3L0NA 2FDSA 4XKYA 3S5NA 4MZYA 1AK5A 1HL2A 2H6RA 2FFCA 3CEUA 3LCLA 3M9YA 1KM2A 3G3MA 2BLEA 1IXQA 4BI7A 3T7VA 4WJEA 3BARA 4EIVA 2VKZG 4O50A 4QQ3A 3BV4A 1I2RA 4RZ5A 1IF2A 1LP6A 1H51A 5BOOA 4NJJA 4HSNA 5D03A 3F4WA 4JTJA 1FUYA 2CZFA 4B5NA 1HTIA 4JTUA 3TSMA 3QJAA 1FWTA 5ABTA 1ML1A 2V8ZA 5AHEA 1KM3A 3TKFA 2ZRYA 3B0UX 3LLDA 5KTLA 4O19A 5GVJA 3RNDA 3TIMA 1VS1A 4DO5A 1EIXA 1JQXA 2CWNA 2V2DA 2YYTA 3QF0A 1IIGA 2DZSA 4L4MA 3SFKA 5AB3A 4PFMA 3CPRA 3OG3A 4ADUA 3PS7A 4JS3A 3STGA 1TTPA 1R46A 3MI6A 3SECA 3T55A 1JUKA 3SI9A 2WJZA 4Q4KA 5AHFA 2CZ5A 5I3JA 1LRTA 2NX9A 4NNAA 3WK2A 4IXHA 5G1TA 2OCZA 1Q6QA 2A7NA 2DZUA 1GVSA 3PF3A 3Q2DA 5H91A 4ZQOA 1QFEA 1X1OA 4O13A 4Z0JA 3NO5A 3EXRA 3W2MA 4OV4A 1WYIA 2QCGA 4O12A
chains in the Genus database with same CATH superfamily
1AJ2A 1H2JA 3VE9A 1CXEA 2WSYA 4WX2A 4CU7A 4WKAA 5EL1A 3OLIA 3V0TA 3NO3A 5D2VA 2XM1A 3BCJA 5F7UA 2NQ5A 2JALA 3CPUA 5HK4A 3FDKA 3MI2A 2O9OA 4JFVA 3R10A 1JZ2A 4CD7A 2NT0A 4ZE5A 4H6QA 4LF1A 1MW0A 1PZ1A 3CK5A 1GVFA 4IFRA 1GZ1A 1ZBKA 1AMKA 3U57A 1PWMA 1B4EA 3RLVA 4CQ9A 1EEPA 4DPQA 2EO7A 2EEXA 1Q6LA 2R24A 1PBGA 3NL5A 4P7NA 3GDMA 1E1FA 3OYZA 3QYSA 4Q3MA 1H62A 3W82A 1B90A 4EWJA 2VHLA 2XIBA 1XC6A 1OIFA 3W7LA 1XQLA 2ZX9A 4RZBA 1MRAA 5HNRA 2WJDA 1J4EA 2JF6A 3LM7A 3DYMA 5MHBA 2JIEA 1RVKA 1HL9A 4GVHA 4AD0A 4HYWA 3SR7A 3EX3A 4D6EA 1JVNA 3IRDA 2Z27A 3NQAA 4GVIA 3HQ1A 3GZ3A 2PDKA 4DF1A 3K1DA 3CIWA 5L6UA 3LBMA 4KBXA 5EA9A 3P80A 3LMZA 3PTMA 3B8VA 1YXDA 4P7RA 4MMWA 2UY4A 2OWCA 1KM6A 4AYSA 4NZCA 1E3XA 2J74A 3BJTA 2Z00A 1BYDA 3HPSA 3URNA 4L4PA 2JGQA 1OINA 2X2GA 3VE7A 3UW6A 1V51A 3NSMA 3ITXA 3ARRA 1GONA 2O56A 1QVBA 3CLWA 3UP8A 1LG1A 3QQ1A 2ZUNA 2X41A 3W25A 1H11A 1RQHA 2BOEX 1AJ0A 3AIWA 1XPYA 3VOIA 1BGGA 5DMLA 1X39A 4U31A 3EWYA 1US0A 4Y96A 3P84A 5T26A 5HMDA 5KMYA 4JTFA 1R2SA 1D3GA 1XH2A 2WBGA 1EFZA 4XTIA 2WPGA 1ITCA 3KCOA 4XD3A 5AYYA 3LB0A 1KFCA 2YBTA 5F2MA 4RCXA 3R58A 5CQ1A 1C8QA 4XVDA 3I10A 1VYSX 2H9AB 2DVXA 2W67A 3JRKA 1OC7A 3B97A 4DUOA 3U48A 3ELFA 2PDCA 4PMNA 2Z1VA 1GHRA 4AD1A 1MW3A 1AMYA 4U4MA 3TOPA 3AICA 3DCPA 2C3ZA 2WVSA 3WJWA 1W5MA 4J28A 2Z6IA 4KFPA 2I9EA 4WIWA 7PTDA 3MHFA 3HPXA 1VFFA 3W72A 3N29A 5D2XA 3W6MA 4HHLA 1BVNP 5G4EA 1VHCA 3O7UA 3KW3A 5AVNA 1BXNA 4S3FA 3W28A 5C2CA 5ABGA 1CIUA 5LHFA 2DVTA 1KBIA 1SO3A 3N2TA 5D8ZA 5ABFB 3QPYA 3PFMA 3C56A 4CD6A 2WMIA 3C8NA 4GNJA 3RO6A 3N04A 1V3IA 4JIEA 1OB0A 1X96A 3G8EA 3S83A 4AZ5A 1SZFA 2RUSA 1GKPA 4HA4A 2GSHA 1K03A 1TIWA 1GWJA 3RM8A 4I9TA 4Z2KA 3H4XA 4HPGA 4PTDA 3MMTA 3P0WA 3PPCA 1EYEA 2DIKA 1ZTVA 4IPIA 4ZQMA 1DP0A 4MWAC 3EB3A 3R7MA 5EU9A 1W1A1 4QAWA 4GGBA 3UGRA 3WLRA 2D73A 3UG8A 1Y7VA 2DSUA 4OBTA 4H9XA 4REQA 3PJXA 1UIOA 4O0KA 3REQB 3TK7A 3W73A 3AU2A 4V28A 4W86A 5BMWA 3TYDA 1CLVA 1B3WA 2QGYA 5K4XA 4IIHA 4YIWA 4I7UA 1QU4A 2PDUA 3M41A 3E3HA 1C9DA 4HYVA 3BGJA 5IFPA 3O0KA 2HVMA 4FF5A 1W1PA 3UR7A 4ILSA 2IUZA 1VBGA 4DWSC 1UW9A 3GLCA 1TQXA 1UKPA 5CZTA 4L80A 4LBSA 4DX3A 4IMEA 3N4EA 1XLIA 2ZX6A 4D2JA 5HBFA 1WZMA 3W83A 4OKDA 3M16A 1DJQA 3FLUA 3QSTA 1XYFA 1Z48A 2J66A 4LS0A 4WF7A 1PKYA 1FOBA 3L2LA 1NOFA 2RDXA 4Q8TA 1VBHA 4HPXA 3BSHA 4PUKA 3GTIA 3TW9A 4TU1A 2XZ9A 4FSAA 2GFTA 3L68A 1XIMA 3VOJA 7ENLA 4GY1A 2J79A 3KOWA 4CCCA 4H01A 1N8FA 2DSKA 1Z7AA 5E1QA 3NL3A 2XN0A 2O9RA 3GB6A 3S3GA 3AALA 2HJPA 4EOUA 5FEXA 2W92A 2VFGA 3NQ6A 5DN1A 5CJNA 1AZ1A 2Y8VA 5A8MA 3OTRA 4ASTA 3UBPC 3G5EA 4CD5A 1EF2A 2PRHA 4ZMGA 3W84A 2O7QA 1BLIA 1MFVA 2Q3RA 3CYJA 3LYEA 4ZO7A 4Q7IA 3ZT5A 3IACA 3C2EA 1UB3A 2OEKA 2QV5A 4CLMA 1UG6A 2WC4A 2KAUC 1XP3A 1ZAJA 3AIBA 1A5BA 4ERIA 1V0MA 1BSIA 4XD6A 3WQ5A 3HJZA 1ISXA 4GQBA 5KITA 3NL6A 1PTDA 2WMKA 3P6LA 1NY1A 3ZR5A 4M6VA 4TTGA 3IIZA 4UNIA 2XGZA 4UTKA 1O5XA 1XLMA 1RPKA 2VO5A 1XSIA 2X09A 2Z1BA 1TJPA 4MJZA 4XAFA 2VGIA 1FVPA 2GK1A 4AYGA 1Z9AA 2NX1A 3QKZA 1I8JA 2G3NA 2YGYA 5BROA 2OT0A 2GVJA 3H70A 2DORA 4Q22A 4GI8A 4FALA 4XG1A 2HPIA 3NQCA 3F2DA 3DFOA 4PUNA 5FSEC 3QFWA 2XU2A 5I03A 3UPWA 4H83A 1XLKA 2QPUA 1I45A 1PPIA 4ICMA 2PDXA 4D6FA 1V6YA 2XGBA 3CQIA 4TX6A 1Q4WA 3E9AA 3EDFA 1SFSA 4ZCWA 1M7XA 3KXQA 3ARWA 3HO8A 5F2GA 1PEZA 2CLOA 3KVJA 3GG1A 5E5CA 3HG2A 4JD4A 2XFFA 1E56A 1H4PA 4QLKA 2R1KA 1QBBA 2O4QA 1GJPA 4HZMA 4KETA 2HK0A 3CQHA 4Y9OA 5C9XA 3FJLA 1OF8A 3SN4A 1XLEA 3M0MA 1KW1A 4JQ2A 4V33A 1NWUA 1WX0A 3M64A 1X6NA 2BB0A 2DUXA 4B3KA 1KM4A 1H1YA 3MHGA 4HMNA 3ZIZA 2Z24A 2PRLA 2CBJA 1E15A 4GISA 1C3FA 4F0RA 1F8IA 1W6TA 3VGBA 4US5A 4U10A 2ACQA 3S2LA 1E9LA 1RHCA 3AC0A 4DIAA 2X1UA 3H54A 3GXNA 3R79A 3OZMA 4KEMA 4Y8FA 1KR1A 3BW3A 3R4IA 3ID7A 3CZLA 1ZJIA 5CC6A 4FEZA 5M03A 3F2CA 2PBGA 3W22A 3LU2A 1S2UA 1GZJA 4IZGA 3U4FA 1RD6A 2CHOA 1W5NA 2D2OA 2JQXA 3VK5A 4B5SA 1UOKA 1SUXA 1VGAA 4HQVA 1OT1A 3W70A 4GKTA 4BA0A 4J7RA 3GNPA 5GJMA 1QXLA 3ITTA 3NURA 3ZJ7A 2J4GA 2WKLA 4S23A 4AF0B 1G4SA 2QQ6A 3ZJKA 1P5BA 4V15A 1NJJA 2ZFAA 3DH7A 3VCNA 1ADOA 4NAEB 4LAMA 1R6WA 2PB1A 5IDIA 4DBSA 1EZ2A 4DJDA 1HVQA 4K6AA 2HDJA 3QTGA 3LCFA 1F4AA 2X2YA 3UA3A 5IRPA 1WKFA 1EJWC 4UTMA 1IIHA 3EDEA 5D02A 1Z3NA 3DKLA 4WRHA 2PWUA 2PDMA 3NQVA 1VLIA 2G4JA 1H61A 4H6RA 4Y9MA 4W4QA 3U7BA 2G3MA 3TN4A 4GO8A 3AIEA 1RCXB 4IUGA 4XTDA 1XLHA 2E40A 2BVWA 3LSCA 2WHKA 3RILA 1OF6A 3VIOA 3HGRA 4KF1A 2WQPA 1PDYA 2H90A 3HG5A 4RV8A 3G0SA 1SO6A 3UPMA 3N9RA 4DUWA 4RW5A 3O3RA 4D1JA 4H7CA 1DIKA 4UFKA 3B8UA 3CHVA 3NDYA 5AHLA 2PWEA 2C1HA 5M2FX 3CBWA 2OKTA 2CFFA 5FIPA 4A35A 3W7JA 4LF2A 1HX0A 2ZC8A 3G1DA 1RP8A 1ZU8A 3WMBA 1YPXA 1KFEA 4HP5A 4R9OA 4AB4A 5CPSA 4UC5A 1MQRA 5LA0A 3BAKA 3MMUA 1IE7C 3GXPA 4JX6A 1DL3A 3CGTA 1EEXA 2FYMA 4LH8A 2VL4A 1W0MA 4L9XA 3LHZA 1QHOA 4IPNB 3FYPA 5JXQA 2DQXA 1VC4A 3KBVA 5J8LA 3GXFA 2OYMA 2ZXBA 4J3ZA 3G2GA 4D9PA 4QDMA 2ON3A 3WSUA 3CWHA 4WJXA 5HQEA 1IXNA 2YCLB 3JU2A 3WQCA 1NEYA 4NJIA 4N0RA 2ATMA 1FP9A 5XIMA 4JY9A 3G1FA 1PX4A 3ZO9A 3NQ7A 3P81A 3TZFA 1JFXA 5AYXA 2YSWA 5KSWA 3FJ4A 2Y85A 4HCDA 1RR2A 3U5YA 3U5UA 1CXHA 2BWGA 2IQDA 4AC7C 3S6DA 4AWUA 3SCNA 3M0JA 1G9HA 1JCTA 3GVWA 4W5UA 1B31A 1YDVA 4PC8A 1OIMA 2WC7A 4C6IA 3GBEA 2Y7GA 3SFWA 4IIFA 1KM0A 2X30A 3NZRA 3LNMA 2A85A 3GM8A 4KIEA 3H21A 4IL0A 1VQTA 3MB9A 3PB0A 1SFJA 7REQB 3UFYA 3AIRA 3B8TA 1EOKA 4H8UA 4RE3A 4KCVA 4MLJA 4M82A 1J93A 3BG3A 1EPXA 3QMRA 3CAVA 3DFHA 3P0XA 3GC2A 2CPUA 4E0CA 4WR3A 2F61A 3MP4A 3W7OA 3SQMA 3UG3A 4ACZA 3U2OA 3WK3A 4ENLA 1GJUA 3ITLA 4ZVJA 5JUVA 5CC7A 3ARQA 2OTDA 1B2YA 1ZFJA 3PJUA 4UTTA 1I4NA 3ZWSA 1SZGA 3Q94A 1Y65A 4IH3A 3H6OA 4NZJA 1H1NA 1GPFA 1KTCA 4RUBA 1TPDA 1EC7A 1OFQA 2E5CA 3BLPX 1X8CA 3PBYA 3SY8A 3IJQA 4RDZA 3I7RA 3NZPA 2VVSA 1SJBA 3HMCA 1QOQA 3WD0A 2IKGA 4OGZA 2XH7A 5M1TA 2G0WA 1KLZA 1EHNA 4NF7A 4AZHA 4M7SA 3OOQA 4H9ZA 4Q4QA 3T6CA 3I3EA 2V30A 1XRSA 3UWEA 3KWSA 2PODA 5GNXA 1WXYA 2ZDRA 5IXEA 3EOOA 4QNWA 2P8BA 4S3BA 1S5NA 1XV8A 4LYKA 2BY2A 3RHGA 4XV0A 2QYGA 4MF4A 2NT1A 1W37A 3EMZA 5AC7A 1LYXA 1IEWA 4MLRA 2JKPA 3DYPA 4RXFA 5FEZA 8XIMA 2NUWA 1OT2A 5D05A 4C5YA 1O5RA 3FKKA 1X1NA 4YVVA 2VGBA 1CNVA 4B5WA 4JEQA 1WUFA 2A0NA 3N18A 2J78A 1PZ3A 3Q37A 2BY3A 6XIAA 4A8NA 3GH7A 4NY2A 1EBHA 4O1DA 4FP1A 3RCYA 4QE1A 4D8LA 3HPAA 3D46A 3N2XA 1XYZA 3BLKA 3EBVA 4PMVA 3FCPA 5BXRA 3DAQA 3VX0A 2B0MA 2OWWA 4C91A 3EB2A 5CLWA 3W37A 4LX4A 9XIMA 3URQA 3VKJA 4MKSA 1JYNA 2E09A 1WAUA 3ARSA 5E0FA 1HFBA 1V03A 4OHQA 1XLFA 3SUVA 2FJUB 4CEUC 3VFCA 4GQGA 4PBEA 2W3ZA 2VWTA 1F3WA 1EP1A 3R0DA 3P3BA 5DEZA 1Q65A 1F3TA 1TV2A 3W1NA 1SW7A 4AVNA 1B0IA 1LL4A 4ORIA 3UWVA 2E7FA 4KWVA 3GDKA 2JK2A 2WQDA 5TBOA 2Y7FA 2FMOA 2VDGA 1D3HA 1CCWB 1NF7A 3QYQA 5BRBA 1ONXA 4J2MA 4RL3A 4IMGA 3GU9A 4I7WA 2CLIA 3NQDA 1VLWA 2WZMA 3CEPA 3PJTA 3FAWA 2E6YA 5FD0A 3W7DA 4A6GA 3BQ5A 4G7FA 4LU0A 1Q63A 1FRBA 5JMUA 3W27A 2XIJA 2VCBA 3GG8A 2G3FA 5BXPA 1WBJA 3CU2A 4OUIA 1NDWA 4HPJA 4MUPA 4DJFD 5A1AA 4L6DA 3MUCA 2NZLA 1LL7A 1QPOA 2G3IA 1TPH1 4GPNA 3B0YA 2YKKA 4GFIA 1VIZA 2QF7A 4IGSA 4EX4A 3BUVA 4IM4A 3BXWA 4WLCA 2XG9A 3H8AA 3UU0A 3S9ZA 4MNLA 1U33A 2QEZA 3NQGA 3G1YA 5LGXA 3MW7A 1V6TA 3HJEA 3BG9A 3R6IA 3GTXA 4M1RA 4Y9AA 3AHZA 1E6QM 2JGYA 3N9SA 4PEEA 3MA8A 4DZIA 5MKGB 4WDTA 4EPDC 4EF8A 1OWQA 1WQ5A 4W87A 3B9OA 4DYJA 1DJWA 4DO4A 1K9DA 3QM3A 2FTPA 3FKRA 3VD4A 2VT0A 3QPEA 1UBSA 4Q8UA 1L6YA 1GQLA 1SMDA 3NQ8A 3S2CA 1OG0A 4U28A 3GHSA 2R91A 2VCCA 2Z29A 1H0GA 1CEOA 2O9PA 5I79A 4JKMA 3VKBA 2BS9A 3WMCA 4GMEA 4F9DA 3M47A 3TFCA 4LGXA 1VFTA 1S3HA 3OVQA 1KFLA 1PYFA 2ANUA 1KTBA 1TX2A 5DANA 1AVAA 3QR3A 5DRCA 1TIMA 4TX8A 2QUMA 3RM9A 2PDGA 3S4TA 4JOMA 2D20A 5EPDA 1QNQA 3PM6A 1LCOA 3R94A 2DJXA 4LXFA 5BZAA 1W3JA 1G4EA 1Q8AA 1NP2A 3GTHA 1S1PA 4HU8A 4CNSA 3WLIA 3S1VA 3P61A 1KCLA 1MZRA 3ZQ9A 4S1FA 3IJ8A 1WNOA 4AIEA 2C13A 3EA1A 5EY5A 3L5AA 1MQQA 1XJBA 5AC5A 4W8LA 4LEQA 1XG3A 1PX3A 2XN1A 3ZMRA 4Z0SA 4LRSA 3P8IA 3SCTA 2GJNA 4KRTA 4LV9A 1IR2A 3G18A 3MBFA 2HRWA 3QLLA 3B9AA 4LVGA 1FWFC 1Z89A 1JD7A 1KB3A 2ISDA 2YXGA 1F7BA 3U0HA 1KR0A 4FNPA 4MJ4A 2G50A 4JTKA 1LOSA 2A21A 3B40A 4NRSA 3GU1A 5K4ZA 1G0CA 4J4KA 1O1ZA 4GVFA 3ITGA 4GUJA 1DTNA 1RP9A 2OZ8A 2X7WA 4JN8A 1XRFA 5CC5A 1VZWA 4IMDA 3SN1A 1EA0A 1NOWA 1UJQA 2BXZA 3FJ6A 1XL9A 3BGGA 3MUXA 3N6JA 4IFKA 2QJGA 1TPWA 3O6AA 5D4YA 3FFSA 4PULA 1NAL1 1OFDA 3CH9A 3RLHA 1C9WA 4FOUA 2D23A 2A3AA 1ISWA 2UV8G 1GG0A 4XZBA 3AXHA 2VGFA 2X7VA 4BJHA 3GAKA 4NXKA 1TWWA 3WDJA 1IEVA 1SW3A 5M3WA 5BOFA 3H2MA 1GW1A 5C0QA 3DU0A 4IJCA 3ERPA 1RPXA 4NAFA 2FTYA 4RW3A 4AEFA 3AS3A 2VC6A 1GK8A 5FKYA 3AMLA 3ARZA 1XIHA 1FBAA 1C29A 3WNNA 1YRRA 4PE8A 4URIA 4K7VA 1CXIA 3J7HA 3P5ZA 1KNWA 3RPMA 2VUNA 4HOZA 4JNMA 3DG7A 3ES7A 1TWDA 4IGHA 2E6DA 6REQB 4XO6A 3TX9A 3DN5A 2WNQA 3KHJA 2A7RA 3DDMA 2GOUA 1DVJA 3BOLA 2VRKA 4MFEA 3RF9A 3WDHA 3KVKA 2HBXA 1OY0A 4PUEA 1FCBA 3NPUA 2UY3A 5FCZA 3ATYA 1EX1A 4OZOA 1LQ2A 3L4YA 3VUPA 4L56A 1C8VA 3QLDA 1JIBA 4D6CA 4AMAA 2WPBA 4OOUA 5KZEA 5LGZA 3SSJA 5A2BA 4IQJA 1J9YA 1K9EA 1EBGA 2W66A 3ABRA 3U9IA 2CWXA 1TV7A 1L6FA 2G5WA 1JZ3A 1GOOA 2R94A 3T0TA 3SO7A 1BSLA 1OX6A 1S46A 3L67A 1OCNA 3S9YA 1F73A 5G1MA 2WJFA 3HFTA 1QWGA 5CPOA 1KA9F 3L65A 5H6HA 4IJBA 2RDWA 1QNOA 2VELA 3N14A 4N9CA 2VXNA 1YW1A 1AD4A 2QDDA 2PA6A 5EBUA 3HIJA 5CGQA 2ZC1A 3VNKA 3CC1A 4OBSA 1DE6A 4OOZA 1CT5A 1E40A 3NL2A 4PUUA 4E4PA 3A5VA 4XZHA 2VENA 4HNNA 2VFEA 3LPFA 1QW7A 2ZDSA 4HN4A 3MT1A 5C54A 2FGLA 3G1RA 4GGHA 2I5IA 1OK4A 3S1UA 3VD7A 3VYLA 3F5KA 4DXKA 2HSAA 2QCEA 4DPPA 2VFDA 3HA1A 1WXJA 2V81A 4P5UA 1ONWA 1JDDA 4HSOA 1TJ0A 2J7FA 1UD3A 5CEWA 1H3GA 2RFGA 4AZ6A 4M5PA 1BRLB 1F3EA 2XFRA 2ZQ0A 3OA3A 3A12A 4CNOA 1EJXC 2GUUA 1H7RA 3LA4A 3MQTA 1JI2A 1TUFA 1PZ0A 2PC4A 2QS8A 3OU8A 3KS6A 3PZUA 3WUBA 2OB3A 5KETA 1WOAA 3MTWA 1BG4A 2FVMA 5E93A 2AOSA 1PIGA 4F2UA 4DJFA 4DYEA 1IQ8A 2P76A 1UQZA 1Z32X 1YTDA 1SZRA 1TV8A 3R11A 4PCNA 2W9MA 3L0KA 4GFSA 2Y24A 1MMFA 3HU7A 3THUA 4FNSA 2L5HA 3BLLA 1H1ZA 1R8LA 1OD8A 4B2DD 1S2CA 4B9YA 2WYSA 3TN3A 5FJRA 1GNXA 1A5LC 3EX4A 3M0YA 3N17A 4U5IA 4BK9A 2CCRA 3WQGA 4GUGA 4EPEC 3M4HA 3BK0A 4ZQNA 3PNZA 2CLLA 3UWWA 4UQBA 4H3DA 4YU1A 2D22A 1EDTA 1SSDA 3LXCA 3LHYA 1VD6A 4C1NA 4OBRA 3PZNA 5F4WA 4NNCA 1R3SA 4XBKA 2Y0FA 1A50A 2PUZA 3RG6A 3KZSA 3MUAA 1QI2A 1E43A 1HJUA 1BEUA 1DPMA 1LL6A 3SCRA 1YPIA 3QGKC 1E5JA 4JTDA 1JNDA 4C6EA 1DJXA 4GX9A 4MZYA 4GZEA 1Y5XA 1MDRA 3CEUA 3LCLA 3WLPA 1D7KA 3N1AA 4EIVA 3W02A 1S3TC 1HXJA 3BAIA 3KTXA 4MWAD 3HURA 4B5TA 1UWIA 3D3FA 4HNOA 3WZ0E 3BICA 4B5NA 2YJQA 4FA3A 3IPWA 3TSMA 1ML1A 1TA3B 4BS0A 2ZWZA 4DI8A 1KBKA 3ZZ1A 2ZOXA 1JI1A 4DO5A 3TTSA 3QZAA 2CWNA 1IIGA 1UH2A 2DZSA 3SFKA 1OADA 1CLKA 3PS7A 3WQDA 1IEQA 4DJDC 3MI6A 3T55A 3SI9A 2WJZA 3BMXA 2CZ5A 4JL1A 4XX6A 2CXEA 4NNAA 4F2BA 2INEA 3WK2A 4PMDA 2FZDA 2DZUA 1GVSA 1R9YA 3PF3A 5BWFA 2WZIA 4ZQOA 4J40A 3N3TA 3NO5A 8CGTA 2OGJA 3H2EA 4O12A 3HGOA 4UOJA 3AZRA 2O7SA 4WD0A 3IGSA 1JEZA 1UD8A 2ZUWA 4W85A 2WWCA 4QE4A 5IDZA 1XW8A 5AVHA 2J88A 5D8WA 3D47A 5JIPA 3UXAA 1JPHA 3IIPA 3CMFA 4XO7A 3M5XA 1SW0A 4NASA 4DNHA 3DHUA 3NG3A 4W8AA 1H7NA 1UR0A 1UUQA 1GOIA 3G1HA 3WNOA 3CHEA 4R7OA 2QVHA 2WVTA 3WH5A 4NT0A 1MZHA 3P8JA 1QOXA 4GZJA 3KBNA 3BANA 3WD4A 3GAYA 4UTFA 8RUCA 2WSRA 1XIDA 2V3GA 4KRZA 4LYRA 3VIMA 4GLEA 3AS1A 5DMNA 3EKZA 4KEZA 3H7RA 3BC9A 1PIFA 4ZB0A 5LYRA 4CGTA 3SRFA 4JKLA 5HMFA 2O0TA 4HTYA 4UZSA 1KLYA 1FTXA 3LPOA 4GQRA 2QZRA 2YDQA 2PPGA 3FY1A 3W88A 4F0LA 1XSJA 3PBMA 1IXOA 2WHLA 3CZKA 4FNTA 3PUGA 4Q6JA 2QMKA 3II1A 3WF1A 3KTCA 3GDLA 3KOFA 4LSBA 3I65A 2Y61A 4A8LA 3PZTA 4MYXA 4Q8WA 1EYWA 3H22A 3QZ6A 4B90A 2JE8A 4AAJA 3C2FA 2FZBA 2ZTKA 5A8OA 4C5ZA 1MXGA 2ZUVA 3VDHA 3WX7A 4PCFA 4PRTA 2XDFA 1OD0A 4OECA 4CNUA 3FXGA 3V1PA 4HMDA 4C60A 2PLKA 3TONA 2ZZ1A 1YE4A 5HWJA 1VBUA 1WDSA 4GD0A 2IKHA 1US3A 2DGAA 4WZHA 1H7XA 3E0VA 5C9ZA 2C1IA 4GABA 3M07A 4XK2A 4B3LA 2WK2A 1QAPA 4U3CA 3UZWA 1EJ7L 2GDQA 3DFSA 1RQBA 3KUMA 3IGHX 1DQUA 4B5UA 2QKFA 5TF0A 2FZ9A 3TOYA 5HNNA 1FWJC 1RV8A 1Q6GA 3BMVA 3KDOA 5BU9A 5IBXA 3P60A 3OLDA 2OLSA 1RBLA 2YB4A 4PCTA 3DFTA 3EPOA 3QV6A 3UJSA 4KGLA 3S5ZA 1R3VA 4X61A 1EGMA 4P8WA 5I7GA 3LSBA 1FFQA 1TJ2A 3CL8A 4JTRA 3L0GA 4UCGA 3RDKA 4UTTC 3KOXA 3T0CA 2QVNA 4F0SA 4N2YA 4JYFA 4OT7A 3NGJA 1YIXA 4PTVA 1CGUA 3UWUA 4LYPA 1OYBA 1DJHA 3SQLA 1J0KA 1GVIA 4YVXA 4TV5A 3IRSA 1I9CB 3V7PA 4GXMA 3KLLA 3WFLA 1UCWA 1FHLA 4XKYB 3ZSSA 5FL0A 3TU9A 3ISIX 3CT7A 1B3XA 2WKJA 4C6FA 2VEMA 1FQ0A 1VENA 1XBVA 4TVDA 4BQ5A 3K4WA 2F7FA 3PN8A 2DSVA 1NDVA 2VC9A 2XVPA 3MCMA 3MJMA 3WH8A 2XWDA 2PGWA 2DEPA 5HNUA 4E3VA 2Q71A 1PB0A 2PWHA 3B8DA 4HCLA 2BOFX 2EXOA 3C52A 3L4UA 1YNPA 5K7JA 5REQA 2A3LA 2C19A 4DEFA 1J6PA 3EGJA 3W29A 4HU0A 3URAA 3ABQA 1V0KA 2HQAA 2G37A 1DIEA 5JBFA 2CBVA 2Q3OA 3NVTA 2MUCA 3KCJA 4IGNA 2PAJA 2VNCA 3PG8A 3PTDA 2O9TA 2IQTA 2DQWA 4W7WA 4PUMA 4O18A 4NKCA 3CZEA 2PDLA 4H4IA 5HR6A 3WDIA 3GWQA 1J2WA 1X6UA 3V0UA 1QK0A 3PSWA 1EUAA 3WDQA 5I0DA 4QJ4B 3CIXA 3CWNA 2QJHA 5TD4A 4RDVA 3SB0A 3MKKA 1BXCA 1HP4A 1QNSA 2XIMA 4GYFA 2GJPA 2AQWA 4OQVA 3KM8A 1X8FA 1G1YA 4J3UA 2OSYA 4Q8VA 1OBAA 1TWSA 3CV2A 3UPBA 4NJGA 4O1AA 1TELA 4CCEA 4LBRA 3WLSA 2P10A 1UP0A 5FJPA 4XISA 4LS1A 1DQWA 2OJPA 4AQLA 1W3TA 4H04A 4CKQA 3K8LA 1RA0A 3W76A 2AMGA 1UWUA 1NFPA 2E25A 3M6DA 4LY8A 3BSGA 3VIKA 4D72A 4E5TA 3NZ1A 1KQZA 3CO4A 3WJSA 3H2CA 4F0HA 5AYIA 1UMLA 2WHMA 1TPEA 1JYWA 2FH6A 1YXYA 3VGHA 2TMDA 4PMOA 4AIBA 1HKMA 1OCQA 3TR2A 5FAGA 5LIWX 3R8RA 1S2VA 3BAWA 4GI6A 3AROA 3S0CA 1QTWA 2CC0A 2B4GA 4XZIA 3VOCA 3T0DA 5A6MA 1NVMA 1RLDA 4FXSA 4L6OA 4A29A 2DV0A 2UY2A 1EX5A 3S47A 2X42A 4YNGA 2VFFA 3IJLA 4MWAA 4B16A 3EB4A 1D3CA 3HGJA 4NILA 2ALDA 2G95A 1EPVA 2VEPA 1UC5A 3LERA 1AW1A 1PL9A 3C0QA 2PGEA 4UTLA 1G7VA 3NDZA 3NGFA 4LY4A 1RY0A 1XCWA 2V67A 4W9TA 3VNIA 1D8WA 2NWSA 3F4VA 2H9AA 1HQTA 5A8QA 3C5QA 5E9XA 4AVFA 3LHUA 1ZL1A 3VCCA 3RCNA 4GIRA 3SAZA 1P1XA 3B04A 4LYQA 4UUIA 1T41A 2YZ5A 3MDWA 3IWPA 3SCVA 4LUTA 4DWSA 1R86A 2O92A 2Z7KA 3EPMA 5BNKA 3KCLA 2D0GA 3NDOA 4QAIA 5E6YA 4AD2A 1JAEA 4POCA 2YCIX 5HJLA 4DUVA 1NOUA 1QATA 1ITUA 3F5JA 4UIOA 4AZ7A 2Z1XA 1TV3A 3CO8A 3I6EA 4NSBA 4U2YA 4K8EA 4PODA 1N8WA 4YTQA 4XZ9A 1S5TA 4O4VA 1ITQA 3CAQA 2GYIA 5CBJA 1UH4A 4IIBA 4M81A 3KVLA 1GTEA 4GBDA 5DO8A 3V0SA 1I2OA 3SRKA 4B3ZA 3C0SA 3AOFA 2HE5A 3TYAA 3DENA 4J2PA 4FS9A 2PLCA 2J8GA 4NZ4A 5LIYX 1XLCA 5L9FA 3LCGA 2EF9A 2J7HA 3VC6A 2BV9A 5T9BG 4KWOA 2P50A 4AH7A 4EXBA 5LHEA 1PKLA 4FOJA 1XLGA 5A6SA 2ZZ2A 4CN1A 1LOLA 2Z4GA 3QY7A 3WMSA 3QW3A 1K7FA 1LLZA 3K8KA 2XZ7A 3OB8A 3O16A 2A4AA 3U6WA 3MSGA 1TVLA 1UBPC 4PTXA 5EMKA 1XIIA 1VB9A 3E0WA 5BRPA 2X1IA 2QJMA 1W9VA 2VRQA 1LOQA 3FGCB 5HMSA 3VO0A 4XUYA 1LWHA 3G6MA 4LT9A 4UMAA 4AWTA 1X97A 3W1RA 2ZIDA 4A4AA 7ODCA 4QJ1A 4F4RA 2WMIB 2YR1A 4KERA 3VOHA 1Q13A 2PZ0A 4NU7A 1M1BA 3DX5A 1MXSA 2D69A 4KMQA 2PGFA 4OV9A 4HU4A 2YL8A 4NL1A 3CZ8A 3GVQA 4MFDA 3BG5A 1F6PA 3T08A 5GQBA 3F4CA 1JGIA 1VFLA 3PSVA 1XIGA 3AYVA 2Z1SA 1QRQA 1J11A 2CZEA 3QGVA 1O6IA 1RK6A 3GG7A 2XIQA 2FZ8A 4HKPA 3R89A 3VX1A 1DIOA 3EWUA 3IJ6A 2XN2A 2FHBA 4AY1A 1EB3A 1DEDA 2OOGA 3EMCA 3TQVA 4RE4A 4REQB 5CPLA 2HPMA 3CL7A 4CNNA 3IUIA 2Q02A 3APGA 2XVKA 2PWVA 1FCQA 2G96A 1QUMA 4YTTA 4NX0A 1N8IA 4P7QA 1XDJA 2CLMA 3GHUA 2QJNA 3BLDA 1MFUA 4EXQA 2AAMA 1Z69A 3RITA 4IP7A 1F5ZA 2WAGA 1S5WA 3KX6A 2Z6JA 3NSNA 1AQMA 3VGFA 2PDWA 1XYCA 5LNSA 3NQ2A 2XWEA 3M7SA 3CB8A 3SY5A 2NQ9A 2NV9A 4QSHA 1QPQA 1HJQA 1QNVA 1EJUC 1TJRA 3GH4A 4WSHA 3IAQA 1UR8A 4MGGA 3QOKA 2XYLA 4QP0A 2VZSA 2XVLA 1XIEA 3ONCA 2YDAA 1G67A 1LUCA 3W07A 4UNLA 3Q58A 4ZOAA 3HMJG 4YYFA 3CUFA 1VPYA 1MEWA 3V3WA 3L4ZA 3O1NA 1HT6A 4HK6A 5CG7A 3FDGA 4J3TA 1ZALA 4H9YA 1J8VA 1I2PA 1TR9A 4E4UA 3E2SA 3EDDA 4KEVA 1UD2A 1V02A 4QGCA 4C6CA 1HKJA 5LIXX 1O60A 5G1YA 3IIOA 5FJJA 3QY6A 5E0CA 4C6QA 1G4TA 4GCXA 4GCAA 4O28A 1TYGA 5D32A 3EDJA 3A5FA 4TTUA 5G2WA 3NTYA 3SCSA 1W9DM 4AXKA 3GYEA 3PPFA 3FX4A 1W9BM 2A3HA 1NFBA 3WBEA 4M51A 1JZ5A 2Y4SA 1V6VA 4UTUA 4GC4A 4ZODA 2A2IA 4ROQA 4PTNA 4PMJA 3FSUA 5A94A 6TAAA 1BWLA 3HGSA 4MWAE 3GVGA 4BCEA 1OEPA 3GKFA 5IHRA 2PF8A 3WBYA 4CCDA 4S39A 5HQLA 4NJKA 3L2MA 1PKMA 1MEHA 5DMYA 3ZJ8A 4LAKA 1NWSA 3A9IA 3KE0A 2XINA 1K7XA 4RDYA 4RPPA 3LZ5A 5K9DA 3L9CA 3NQFA 2ZX8A 1JJKA 1R2RA 3R43A 3SCOA 1R85A 1FWNA 1RAKA 4RK8A 3ALGA 1JG9A 1QJWA 4WKHA 1MI3A 3LN3A 1O1HA 1B3VA 5JBEA 2GK1B 3TTOA 1EA9C 2IPGA 1NU5A 3QZEA 3MANA 1QW9A 3LQGA 4DBDA 4HD5A 1YHTA 3O15A 3R2GA 1FDYA 4OFCA 1WDPA 2ZA2A 2ZZ6A 3CIVA 1TVNA 3PTKA 3MS8A 2DT2A 1XINA 2XSAA 2YB1A 3E5PA 1U83A 3PZQA 3NEVA 3WF4A 3MWAA 4UNKA 4LVFA 4H41A 1YNYA 1SZNA 4FXRA 3UEQA 4W84A 3CL6A 2DP3A 4JQ4A 3TP4A 4NXSA 3W7HA 3E74A 1TPB1 3KL0A 3H4GA 4QG8A 4WJ8A 1Q7QA 4ZEPA 4TMCA 3L21A 1JPIA 1LT7A 1XUZA 1PYMA 2J7DA 3GDBA 1EP2A 1JZ7A 4MKNA 4X63A 3U8GA 1UHVA 4JDYA 1N82A 3WJXA 3A3XA 3PC0A 4DJEA 3MV01 2DSZA 4UBPC 2GL5A 2PDPA 1Z41A 4HYRA 3ITCA 2WV8A 1LBMA 4XQ6A 4M6PA 2XH4A 2FTWA 3KP0A 4D8AA 3NPWA 1AL7A 2GQAA 4P8VA 1VCGA 5C8BB 1F76A 3CUZA 5D38A 3M0KA 4DAIA 2XJ7A 3N25A 1T0OA 2E28A 3H2NA 1HL8A 4KFNA 3PAOA 3CQKA 1X7IA 1AJZA 1JULA 3KBSA 4E2DA 4BHYA 1R9XA 5ABEA 3IS4A 4GYJA 1CXFA 4LEFA 5C6MA 3L4VA 3LZ3A 2HNEA 3GX9A 1IEIA 4A3HA 5K9XA 4R27A 2VVNA 4GZ7A 2KX9A 2E77A 4R5EA 4KIRA 4RNJA 5ENLA 4P7LA 1YPFA 2BG5A 1SMAA 3FA5A 3L12A 2J25A 1GVRA 1I2QA 1UWAA 1YLVA 4Y6GA 2AGTA 1WOBA 1HKIA 4TX9A 4GJIA 3MCNA 1AW2A 1L6SA 1FP8A 3H26A 1A53A 3A47A 2GGHA 3PANA 3NPVA 2CKRA 1S2AA 4YMZA 5FJIA 3W01A 4I5RA 4K36A 4LOCA 1FDZA 1XKJA 5C71A 2ASHA 2QMJA 1LTDA 3LRMA 5TAOA 3HQNA 3VNMA 4LNCA 1AL8A 3ABZA 1E71M 2INFA 5A5WA 2FPYA 1H7OA 2YCLA 2JKEA 5HMEA 2GVLA 4EF9A 4M1BA 4KRUA 1YTEA 3WBWA 1TMQA 4FPSA 3OVPA 1Z6KA 3AHXA 4TVUA 2A6LA 2WKGA 4Y2WA 1KC7A 4J3WA 2WHJA 4IQDA 4WXYA 3TN5A 3KZPA 4RPQA 4E8CA 3GRIA 3CASA 3WF3A 4FIRA 4Q8MA 3WL1A 3LPPA 2VEKA 1VRXA 5CSUA 1JDCA 1LM1A 4N9EA 3IVUA 4QCFA 2DT3A 2QCDB 1VJIA 3SCQA 2J7EA 4MZ8A 3A24A 1RLCL 5HJYA 3FA4A 1DJNA 1U5JA 2F2HA 4ZOBA 7REQA 3UJRA 1NF0A 3WELA 3IAPA 3W7CA 3UNDA 2E6AA 3M0ZA 4GWEA 2VCAA 2DUAA 3S1XA 2OR2A 3N2OA 3MU7A 4IP5A 3ARVA 2QT3A 3QC3A 1M41A 1XIFA 2ZKMX 4UTJA 1KWKA 1IZKA 2TSYA 5DT5A 1NWTA 3L4WA 4FK9A 1Q6RA 4A22A 1GORA 1G94A 3N4FA 2WBKA 4XSMA 4YWIA 1KRMA 1LDCA 1SVDA 4Q6XA 3WL0A 1QO2A 4H00A 3NM3A 4ONVA 4QSFA 3C61A 4AEOA 5D2YA 4JFSA 1VBJA 2J8TA 2XISA 1KM5A 2VC5A 1GKRA 1H7PA 4F0KA 2E4TA 2XVGA 4GACA 1YEYA 2VI0A 2VZVA 3PK7A 4L1WA 4RR4A 1V6UA 4KCUA 2BGSA 3I7QA 5HUOA 3TW7A 2ACSA 3LI1A 3PBUA 1YADA 1GZGA 2ZTJA 1A49A 5JQ9A 3M6YA 4WUIA 4UFIA 4JHMA 2XUCA 4HVXA 4CVWA 2HE8A 5I3GA 1OFAA 1TMHA 2CESA 4RNIA 2AMXA 2E0PA 1UR3M 3K8MA 4ACZB 2NV1A 1JPKA 2AKMA 4FLQA 2X0YA 1EQPA 1WE5A 5DT7A 3UA4A 3TEVA 1M9HA 3AQUA 1T5AA 3T0AA 5BW6A 5G2IA 5H8UA 3N12A 4AFYA 3CMGA 2Y5SA 2CYGA 2BSLA 2IKIA 2WNWA 3WD3A 1UKQA 1PZ2A 1FWIC 1V6WA 1YYAA 1GVQA 2V5DA 4NRRA 4MPQA 1YE6A 2DFAA 4L4LA 1CX9A 1KGXA 5LNUA 1US2A 5IBXC 4AWSA 3LLXA 1JZ8A 2PWFA 1KRBC 4EAYA 1ENUA 1UD4A 1TV5A 5EFFA 3RUBL 1IWPA 3UERA 1FKXA 3LCXA 1DIDA 2YPIA 3KVMA 5E70A 1K8CA 3AZTA 3PUEA 4R85A 5F1VA 1PS9A 3B3DA 2CU0A 3WNLA 2XH2A 1MNSA 3G77A 4Q4SA 5AC4A 3UG5A 3S1WA 3WLMA 2REQB 3DEQA 1UASA 3T40A 4AX6A 3UXIA 4F0MA 3TJIA 3I4KA 3ITOA 5HOSA 4US5D 4GG9A 1HJSA 4BF9A 4KQNA 1OABA 1J0JA 2PTDA 3B8SA 3HPZA 4D6JA 8A3HA 2BASA 3WLOA 3LCIA 4O57A 2C16A 1SO4A 3DFPA 5C9WA 4JTGA 4UXDA 3C2OA 3ZT6A 3EOLA 1VAHA 3MHUA 1TE1A 3GNRA 2YW3A 3AU6A 4CNPA 1ZNNA 3WFZA 2BHUA 3W85A 2QXWA 3WLLA 2GVEA 3GNDA 3VDAA 1W1TA 1W1ZA 3WLJA 1F8MA 1ZHAA 4ZQRA 3M43A 4MNKA 2ONEA 2GGGA 1V79A 1IWBA 4AD5A 4C7DA 3THCA 4UZUA 2P1FA 2VP8A 2YX0A 2Q8ZA 1IV8A 4G2DA 4ZO9A 1GVYA 1ZQ5A 1B57A 4BY3A 4LC6A 1FCUA 2IQ0A 4DJDD 1TG7A 4AU0A 4X22A 5I78A 2ZWYA 2ZZ7A 4UTIA 4CQBA 1H60A 3S2NA 3HG3A 3VDBA 1R3YA 3VAVA 5CSYA 3JVAA 3UCCA 1GQJA 2HISA 2PRMA 1E9IA 4IISA 2HVNA 2POZA 4HJWA 3W7NA 3P5YA 4MUZA 1WUEA 1W9XA 2FB2A 2YL6A 1IZCA 2EPMX 5FF7A 1O5KA 1ZJAA 4LUSB 5D04C 1D7FA 5E9AA 4GXPA 1EJSC 4L64A 1P43A 4DBEA 3N19B 2E3ZA 2AGKA 6TIMA 4YCOA 1XLDA 2RHGA 1UZHA 3QEZA 4HMCA 3SIZA 4OWGA 2VMFA 4O54A 1NDZA 2I17A 4GYPA 1VFMA 4I90A 4QFUA 3T07A 1TQJA 1XXXA 3ARPA 3BGAA 1TE6A 5A69A 1WV2A 1X7FA 4NZ5A 4TXEA 1H09A 4O1EA 1H5YA 2YCEA 1B9ZA 4A3QA 3TCSA 5G4WA 3WNKA 1OYAA 3BZJA 1G6CA 3OIXA 2OMAA 3VINA 1KXVA 4PB5A 1FWRA 5F4XA 2I56A 2ZCGA 2DZVA 3CV1A 1VR6A 2NSXA 1EXBA 3C4UA 4FO4A 3ZJ6A 2CKSA 3UGVA 3E0FA 2ZXQA 3ORWA 1A5CA 5DRIA 4GINA 3ANVA 3I6RA 4JTEA 5HATA 1Y0EA 4NVTA 3PG9A 1Z8AA 3LQLA 3OZYA 1KFJA 2YLLA 2GJXA 5C7HA 1XI3A 5HWMA 3THDA 2C7FA 1K70A 1WP6A 2DDXA 2E6FA 3RX2A 2Z1WA 4XAGA 2B31A 3DFQA 1JXJA 2J13A 1JUBA 3FIGA 1NFGA 1B9BA 4W7VA 4ORMA 4XWUA 5AYZA 3ANYA 4GY0A 3FSTA 1WZAA 4GX8A 4RJEA 1W3KA 1ONRA 4UR9A 4C6JA 1O12A 1V08A 1CWYA 2XPKA 1ZJHA 3AJ7A 2Z2UA 2YXOA 1S1RA 3BOFA 2XTKA 2EHHA 2OEMA 2ZVIA 2F9RA 1CYGA 2A3EA 3JZEA 1RCOB 4LVBA 3NWRA 3GVVA 1ZLPA 4YJ5A 4H9UA 1SO5A 3H4WA 3TNBA 3PR2A 3VD9A 2I9UA 4GE8A 1QNPA 3UT0A 2V82A 2WWDA 3G3DA 2DZBA 4D6HA 3AIQA 4K39A 3O6CA 4AZGA 1J96A 1HO4A 4YTUA 4JCLA 3TMLA 3QR1A 3S6OA 2C15A 5IM51 3VMPA 6CGTA 2CIPA 2WSPA 4P2VA 3MO4A 4I8YA 3P93A 4Z1CA 1ODZA 5D9NA 3CHFA 3DGRA 2I1OA 1JCNA 5D09A 3PZOA 4JTLA 1P7TA 4Z08A 4S38A 2CLEA 2GOKA 1SJAA 5G5IA 4ATDA 5U7SA 5CSRA 3TH6A 4JEJA 3F7JA 5EGRA 4IG2A 1LWIA 1Q3NA 2FB3A 2YW4A 3K4DA 2V3FA 2XVNA 4QROA 3UZJA 2VR2A 3EEZA 3VXGA 1PIIA 1VH7A 1YBQA 2R82A 3EKLA 3WLKX 2ZXAA 3V1HA 2X0HA 1IEXA 1UUOA 2YDRA 3WENA 1CECA 1XM3A 3K30A 4Z42C 1R2TA 3GHRA 1BKSA 4IFKB 4B5XA 2PI6A 2WVVA 5PTDA 1E1CB 3LS9A 1I6NA 2BVYA 4H1ZA 1OVDA 1DTUA 1KTNA 4L7ZA 2J47A 1J0YA 5CPQA 4WOZA 3R0KA 5GPRA 1EGVA 1AK5A 1AH0A 2H6RA 4G7EB 3M9YA 3FNDA 1IXQA 3E38A 2WLYA 2VKZG 3WQ8A 1W1IE 3BV4A 1I2RA 1RBAA 4AIOA 1H51A 4CEXC 4CQDA 4NAFB 1Q2SA 2VD8A 4NYYA 1E6PA 5DMMA 1FWBC 4WDXA 4LALA 3NZGA 4MAVA 5ABHA 4L65A 1NELA 5LA2A 4K2SA 5LIKX 2YYTA 2V2DA 4L4MA 5AB3A 4I3GA 4ML4A 4ADUA 4JS3A 3PPHA 1JUKA 4H8VA 2Z7GA 4D71A 2NX9A 2V5JA 3TJ4A 5CJ5A 5G1TA 1Q6QA 1RJQA 3WQFA 2A7NA 5H91A 1TWIA 1QFEA 3ZR6A 4Z0JA 3EXRA 4OV4A 1WYIA 2DVUA 4GZIA 1KCXA 2GQ3A 1NARA 2XIIA 3G1SA 3OPSA 3NA8A 1W3LA 1HGWA 6XIMA 2ZRXA 3GKAA 1Z44A 2Q8XA 3M5VA 2P3EA 3QQ0A 3VNLA 1T8QA 1M5WA 3UYIA 2VOTA 4P8UA 1V3HA 4QIUA 1JD9A 2ISFA 4BKNA 1MO0A 3GDRA 2Y89A 2PDNA 1CENA 4NZFA 1P4CA 4QS6A 3D6NA 3B0PA 3MYPA 3SEPA 5A8PA 1FHDA 3HQOA 2PSNA 3KHDA 4JXCA 1MUMA 1VEMA 4MOZA 3NNTA 1RALA 2XIOA 4V2XA 2YA2A 3DXIA 3V5FA 1BRLA 1W56A 3ZLGA 3ZLFA 3GD6A 4MTVA 2CZDA 4PYSA 4GI4A 2Z0IA 2Y88A 1ME7A 4MJ2A 3KRBA 3M0VA 1UPPA 2WCGA 3G24A 1W5QA 1ZAHA 4DELA 5I77A 3UQNA 3EWWA 4BEUA 5M17A 4PMZA 2EG7A 3E96A 4S2BA 3BDKA 1YDNA 3WBAA 3E0LA 5ECUA 3GFYA 5JIWA 3W7PA 2P8CA 3OZPA 3RO8A 3SDOA 2OXNA 3QV8A 1AW5A 1M7OA 1XBZA 3MZNA 5A8NA 4GOAA 1QHPA 4Z1YA 3UY8A 5C7VA 3D0CA 5D2TA 4PSPA 3R25A 3GXMA 1XC4A 3VVGA 2WJEA 2ZRVA 3WQEA 1WDRA 5FEPA 1DQXA 2DH3A 4HK5A 4L4OA 4ZFMA 4QJ5B 3HTWA 3DHPA 4EPKA 3QQWA 4PB4A 6PTDA 5EMYA 2PD5A 2TAAA 2GZXA 1JF5A 4U3AA 1FXPA 1UR2A 1WDWA 3AHYA 4G9PA 3FYOA 4CQ8A 3RXZA 4WHBA 2JF7A 3SJ3A 1ZP3A 1PUDA 3I7SA 2OOFA 4JQ1A 4CD4A 2BODX 3KDNA 1PHWA 5D37A 3PWIA 5M5DA 5BU6A 1EO5A 3TSBA 2PGRA 2QCHA 4HTBA 1J5SA 1WKDA 3NIYA 4RLIA 4H8NA 3E49A 4Q4OA 3G1XA 3F03K 3NOEA 1EF3A 2OWXA 3GIPA 3N13A 2ZZ5A 1LORA 4DJEC 3ZSTA 4QLJA 1JPDX 2P5NA 4PMYA 7A3HA 3W7MA 2FHFA 4Z2IA 2R6OA 3QY8A 3LBCA 2VQTA 3LV5A 5CH9A 3KLKA 3ALFA 4PRWA 1KXQA 3W2LA 1PKNA 1IT0A 3S2JA 1JGMA 1U2YA 3AIVA 3W2UA 4YHGA 3UNTA 3OODA 3TWBA 1F2JA 3Q65A 3TTYA 4XZMX 5DCDA 5TQLA 4F79A 4IWWA 4JYDA 3KBWA 1MXDA 1Q7ZA 2EPNA 3NO1A 1CPUA 2Y6ZA 1KBLA 4JTAA 3NFUA 5BWAA 3CHDA 3QN3A 2VZUA 3QV7A 1JDAA 4G8TA 2D1ZA 1HW6A 4HSHA 1ISVA 4QCEA 5BXTA 4EXAA 3HV9A 3SRHA 4LCRA 3QW4B 4JTCA 1O66A 1W8SA 2NXGA 3EEGA 5XIAA 2OVLA 1Q6OA 1VJZA 5AOUA 3UR2A 3ABXA 5HANA 2J9ZA 3A64A 2HK1A 2V6AA 2PDHA 5G2HA 3I4EA 4O0QA 3A22A 1EZWA 3INPA 2VEIA 1JCYA 4A3UA 1AUSL 3GYCA 3PBVA 1G4PA 2BHZA 1K1DA 3AI0A 3PUOA 3PTQA 1XBYA 2BXVA 3UVAA 3PHAA 3WYZA 3T1GA 1XD1A 1TPC1 4YN5A 4IIDA 4MSSA 2OQLA 3JW7A 1XH1A 4MB3A 3T2OA 1W54A 4MAZA 1WDQA 1GVEA 3UXKA 3W1TA 1ICQA 3DG3A 3WEOA 3L7RA 4ML9A 2CW6A 2RDUA 1VYRA 3H2OA 4L6HA 3AS2A 4PZVA 1ELSA 1ICPA 5I09A 1DHPA 3C86A 1Q85A 4GXWA 1THFD 4W93A 4O15A 3TXVA 4EKJA 2PWDA 1R38A 3GE7A 5K2ZA 4S2CA 5KINA 2DJLA 4M80A 1G69A 5FJTA 3W1AA 2BVTA 4NIRA 4YLWA 2BX7A 2ZA3A 3TE9A 1PTAA 1E55A 1KKRA 3VOFA 2G41A 1RUSA 5AC8A 2NW0A 1LQAA 2PDFA 4JCMA 3VIHA 3S5OA 1J0HA 1W9UA 4BI6A 3FS2A 2ESCA 3VOGA 4C6DA 3O6YX 3L5LA 4DAFA 3BWWA 1NTHA 3R5EA 1TUXA 2FVLA 4S3EA 4C65A 3MP3A 4E38A 9RUBA 3TTQA 3L5MA 1PE1A 3L2IA 2Y62A 2NVCA 1OX4A 3W71A 1GGOA 2RKXA 4TMBA 3AMDA 3QV9A 3AISA 2PURA 3RRXA 3BQ6A 1R30A 2C14A 4R3UA 2Z2BA 3DFYA 3URBA 4EP8C 3UETA 1ISZA 2VFHA 5B80A 5K9CA 3HN3A 4B91A 2NXHA 2RAGA 3JS3A 3LHTA 1GQIA 4L5ZA 2ADAA 2BFGA 2RDTA 4MZ1A 1G5AA 1QK2A 4PTMA 2OG9A 3W3OA 2WOQA 2QUNA 2P0OA 1XYLA 3AYTA 3FVDA 2I5QA 4JNZA 4U33A 1QBAA 3I3BA 3B8WA 1PXGA 1T96A 3OW1A 4YCPA 5GNYA 2EBNA 1YX1A 5AC6A 3QHNA 3OGRA 5LA1A 1BTCA 3VI2A 3AO0A 1A47A 4B4FA 1PAMA 3A4JA 3B4YA 1IT8A 3BAXA 4QE5A 4B5VA 1OSEA 4R53A 1RD5A 3TN6A 3L23A 3VA8A 2CETA 1DKWA 1RBOB 4RNHA 2TPSA 2OKOA 1R87A 2IXUA 3FVMA 5MF5A 1BYAA 1J10A 2DSWA 3SCPA 5HQMA 2WO5A 3UXLA 1KV5A 4F48A 4Q33A 4GIEA 1FWDC 4PGLA 5LNRA 7XIMA 2MANA 4O1BA 2CXGA 1C8YA 1S39A 3SIMA 4AHQA 3GW3A 1DOSA 2OFJA 3IUDA 2IKJA 1J6OA 5KZMA 1BD0A 4WOQA 3V35A 3UJ2A 3DERA 3GS6A 3MSDA 1W32A 1QNRA 3T4CA 3W87A 1V7YA 3CUHA 4L61A 1EO7A 2ZE0A 3UYCA 3WQWA 4PN2A 3WFAA 3OHMB 4TQTA 3O06A 5REQB 1ALDA 4PMUA 4AD3A 4J3XA 4O8RA 1OCJA 4MYAA 1K9FA 1UWQA 4X2PA 2XM2A 2PP3A 5CPTA 1P6WA 1WZLA 4KH2A 1JDEA 3MMDA 3S5YA 4ZE4A 1TTQA 2HV5A 1E6ZA 1FY6A 5F4SA 1VFUA 4H6KA 5LNVA 4AMCA 3MPGA 2QF8A 3CS2A 3R13A 5RUBA 2RGLA 3WH9A 4HOXA 1M7PA 1XLAA 3CV6A 3GY1A 1OJXA 1OM0A 3CZGA 4G1NA 4LNYA 1T7LA 5CGMA 5FAJA 5FEWA 1R3QA 1L2UA 1SFTA 3STFA 3IV8A 4WY0A 3EAUA 3QC0A 3W1PA 2QCCA 3CUIA 3K46A 1QI5A 4C90A 2Y70A 1LT8A 2DW6A 3IIXA 3GZAA 2OSXA 1VKFA 1ZBVA 4E8DA 2E8ZA 2OZTA 3BE7A 3OVGA 1XFBA 3VIIA 5I23A 3P14A 1PDZA 3KS5A 1VPQA 3QGAC 3PB2A 4N4QA 2J7GA 2NLIA 2VM8A 3AHTA 2WNNA 4X3ZA 5C9RA 3OA5A 3M5YA 3EPNA 3TV8A 3TNOA 1KFWA 2QIWA 3UWYA 1KBBA 1CW2A 1WKYA 4WEVX 1HKWA 3HPFA 2VX4A 5B7ZA 4UQEA 7TIMA 3C2RA 4PBFA 2I7GA 2OO6A 1DORA 4ERAA 4QRNA 2YOCA 3P7YA 3MMWA 4YVPA 2YIHA 3UWQA 2C0HA 4GYPC 1TZ7A 3IVTA 2HS6A 3SGZA 1ME9A 3CPGA 1SFLA 3DI0A 3EX6A 3W6YA 3IJ7A 1P6CA 1QI3A 3WLNA 4H9TA 4O53A 3U3HA 3WLTA 2W61A 3G0UA 3MKCA 3QFEA 4MWAB 2CBUA 1XF0A 1IGSA 3M0LA 3MUZ1 4US6A 1B5TA 5CZJA 3N6HA 3W1LA 5AKQA 3AMGA 4XB3A 4QG9A 1GOMA 4XAZA 2E1DA 3TWAA 1E4IA 4JBRA 3GC4A 4LANA 2ZRZA 4DZHA 1GQNA 5HWNA 3A23A 1CXLA 4FLSA 1PWLA 1JXKA 2WM0A 3KTSA 3C3UA 2Y5JA 2P3ZA 3FAXA 4R33A 2C79A 2TRSA 4AZBA 3BJFA 1TO3A 2IPJA 3Q4DA 2QJIA 4DUXA 1S2WA 1VCFA 1OGSA 2GSJA 3OJGA 4IHCA 5T8GA 4LUTB 5HULA 5A2CA 4DWSB 3VIPA 1VIWA 3D3AA 1P6BA 3WKZA 1GEQA 1HF6A 4EAMA 1W3IA 1NM9A 3Q45A 2NWRA 2D3NA 4G5DA 2J7CA 4DHGA 2W79A 3BZGA 4BZYA 4YYCA 4NG3A 2CHRA 5FESA 4JHZA 3MWCA 1LBFA 1SJDA 3AXXA 1EHAA 3LLFA 1WBHA 3OQ8A 4YL2A 3R8GA 2NQHA 2FGBA 1XQKA 4DQWA 1UZ1A 4J3VA 3CM4A 4WSKA 2YZRA 3B4UA 3VFLA 5JH1A 3FGCA 5HA7A 1TZ9A 4N02A 4TVCA 4N7QA 4FXJA 1DXFA