5E93A

Crystal structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with neq0071
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploring Trypanosoma cruzi Dihydroorotate Dehydrogenase Active Site Plasticity for the Discovery of Potent and Selective Inhibitors with Trypanocidal Activity
rcsb
source organism Trypanosoma cruzi strain cl brener
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
total genus 110
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2015-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 5e93A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5e93A01
5K3VA 4NUWA 3A9IA 4K7YA 2OX1A 1HFBA 2JK2A 3HGOA 5KMYA 1OG0A 1UCWA 1ZAJA 1F76A 5CPMA 2NUXA 1H62A 1OFPA 1DQXA 2Z0IA 4I7VA 4NZJA 1I2QA 4JIQA 3KOFA 3PBVA 4MJMA 2YCEA 1TPC1 3VKJA 2Y6ZA 4AMAA 3M41A 1S5TA 5IM51 2QCCA 3S9YA 4UNLA 5G2HA 1SFLA 3UWVA 5AHFA 3OEXA 5CPNA 1ME9A 3P74A 3TROA 3OVQA 4IPJA 3DFPA 1VGAA 1OFBA 3BV4A 2QCNA 1W5MA 1W56A 2C19A 3CIWA 3QRHA 3U2OA 3TR2A 4D2JA 3S8HA 1FWWA 1GJPA 3ELFA 3N9SA 3BLEA 3L9CA 2TPSA 1R46A 4PFMA 1H7XA 3W1LA 2CZ5A 3KVKA 4GUIA 3SW6A 4FEZA 4M6QA 4A21A 4KKXA 4MFDA 1TSIA 5F1UA 3WJYA 2F84A 4UFHA 3UWQA 3W7GA 1G4PA 3L67A 4LTSA 3RFAA 3JR2A 1F2JA 5K2ZA 2ZZ5A 4QISA 1TYGA 1ZAIA 3S1VA 2EPHA 2ALDA 4QM1A 2GQ9A 3IGXA 4MLRA 5AYZA 1VZWA 3NVTA 4K39A 2ZQ0A 4GXMA 2ISSA 4JY9A 4NNCA 3TMQA 3FOKA 4EF8A 2D73A 2WSQA 3LGEA 4O14A 1FWNA 3B06A 1JQXA 4BR1A 2GOUA 3UXDA 3L65A 3S1WA 3TW6A 3MI2A 3MO7A 4CLMA 1EWDA 4Z0JA 3HMJG 2EF9A 3SFKA 1XBVA 1W31A 3LXCA 2J9XA 5CZJA 5DXXA 5HWMA 1GZGA 3O63A 4LWWA 3SI9A 1WOBA 4O17A 3NYZA 3DFSA 1WBHA 1DJNA 2X1RA 5LGZA 2DZUA 2VELA 4O12A 1BWKA 3C2OA 3W1TA 3GR8A 4FNSA 5HNRA 1CX9A 3TNOA 3KHJA 4LS2A 5BW6A 4YXGA 3NQMA 1H7NA 2RDTA 3M47A 3IVTA 2TSYA 3HBLA 3I7RA 2E77A 4DBEA 4DPQA 4LS0A 4HNUA 3TQVA 3GVGA 5CSSA 3UPWA 2CU0A 3B04A 4EOUA 1LBMA 5BMWA 3NGJA 4ZQNA 3EX2A 2HMCA 2BLEA 4MY1A 1ZALA 4R33A 4O4VA 2YYUA 1VCFA 3R89A 3DKJA 3UWUA 7TIMA 2FPVA 3NOEA 3N3MA 3PBUA 2QEZA 3MUXA 4GUJA 3P62A 2DORA 1VLIA 1RQEA 2NV2A 4JN6A 3L0NA 1SZEA 3W2UA 1KFLA 2CLIA 3EX3A 5I3HA 3S5ZA 2Y70A 3P84A 3LXAA 1K03A 1GVFA 3OVPA 2ZRYA 1SW3A 3QSTA 4Y8FA 1I4NA 1LLWA 2JKAA 2H90A 3K30A 3KX6A 5LNSA 2ZYFA 3P5ZA 4LVGA 2WSYA 1V7YA 1H5YA 1WQ5A 3P82A 3VCRA 1EEPA 4ADTA 4PH6A 4XKYB 1ZENA 2OJPA 4GUHA 1KM5A 3KVJA 2A7PA 1DORA 3BW3A 1Q6RA 4O8RA 2NXIA 3ZWTA 4NNAA 1N8FA 3MMTA 4N9DA 4AEOA 5MHBA 3C0JA 4JTEA 1TTJA 4XTDA 1VQTA 4UFKA 2G97A 1MXSA 3M16A 1M6JA 5H91A 4UTKA 4JYDA 4JTUA 3TJLA 4N9EA 3H55A 1IXNA 4OWGA 4WY0A 3HPXA 5AHIA 5E0KA 3HG4A 1KM0A 4DXVA 4UTTA 4M6PA 1ME8A 3ZWSA 4GUFA 1PE1A 4GNJA 5HJLA 1V5XA 3DXIA 3N2MA 2CW6A 4LRSA 5TQLA 4MLJA 3TW7A 2B4GA 1M7OA 5I3KA 4AWUA 1T99A 2AGKA 4AWSA 1XM3A 1O95A 3STEA 3FKRA 3BGJA 1EP3A 3VE7A 1U83A 1GVOA 4RZ6A 5F2MA 3EB2A 3SECA 4AB4A 3CEPA 3QMSA 3KVLA 2WSRA 5C6MA 1SO5A 3MYOA 4LS1A 2VEKA 3ANYA 5FF4A 4JTLA 3PB2A 3FJ6A 4ZQOA 1IXPA 1G67A 2FQIA 3LLFA 2YW3A 2OMAA 4IMDA 5F4XA 3I65A 4O19A 4P61A 3CEUA 2CLFA 1P4CA 4I9AA 1U5JA 3DH7A 4Z1CA 3G3MA 3G22A 2GVLA 1EA0A 4RR4A 3E12A 5LHFA 4RK8A 1A50A 5LNWA 3W7IA 1FBAA 3BGGA 3L21A 4IUOA 3W1AA 2E5CA 5K9CA 2ZZ3A 3W2JA 3M5XA 2V2CA 4ZMGA 3RU6A 3GDKA 4PC8A 5D2VA 4WUIA 1HUVA 4O1AA 2QCDA 2VFIA 3N19B 1C8VA 4LVAA 4WXYA 3C4UA 4ORIA 1OF8A 3DHFA 4S1FA 2X30A 4I7UA 1EB3A 3W7NA 3EX6A 3EWBX 5D38A 1MSSA 5CZSA 5DCEA 1XKYA 1EUNA 1FWSA 3O6DA 3BG9A 2GPTA 4FX7A 2NV1A 2ZRVA 4JX5A 3S0CA 2ZZ6A 1G7UA 3LCFA 4K38A 1VHNA 2DZTA 3E49A 4OU1A 1FXQA 1QNVA 1YYAA 2J88A 1RZMA 1NSJA 4RZ4A 3CM4A 3G24A 5D33A 2WO5A 2YR1A 4JEQA 2A5HA 3BVJA 2C16A 1K3UA 1K8YA 3OIXA 1UUMA 4XUGA 1RD5A 2OT1A 5FI8A 3TSMA 1OX4A 4IXXA 4AHPA 3MBFA 4MZYA 2G95A 3I68A 4UMCA 3A23A 1ZNNA 5DY2A 2VEIA 3UNDA 4XZ9A 2CZFA 5E1QA 1O4UA 2ZZ7A 1HL2A 3QPYA 1B3OA 3UWWA 3NPVA 2A7NA 3O15A 3YPIA 3TC7A 3MWAA 2H8XA 3A24A 5LNRA 3OHIA 3SGZA 4K37A 2A0NA 5AOUA 1L9WA 4Y6GA 1XDLA 3S5OA 5HUOA 1Z41A 4X2RA 4UFLA 5EBUA 2Y85A 2BWGA 3O8AA 3W84A 4Y9AA 3C2EA 3DFOA 4JX6A 4O0ZA 3PULA 3IIVA 4TO8A 3W2KA 2A4AA 1X1OA 3P8JA 3E96A 2VKZG 5AHNA 3RNDA 3HF3A 3L5LA 1OYCA 2ZA3A 4Z1AA 5DLCA 3TAOA 1JCLA 4IMGA 5C2XA 1KM2A 5D30A 3NL3A 4MOZA 4UTLA 2TYSA 4MIMA 4E2BA 3NQVA 2QDGA 3NZRA 1KFKA 2Y62A 5HWJA 3N34A 3QYQA 5EKYA 2YFNA 2V8ZA 1ICQA 4KFNA 3Q94A 1VJIA 4U4MA 4JDBA 1SW0A 4ZQPA 4JY8A 3D0CA 2P1FA 3BW2A 4YMZA 1VPXA 1WOAA 1QPOA 3L5AA 1VYPX 3MYPA 2DU2A 5F2GA 3W70A 4HT3A 3NQGA 2FB2A 5CZTA 4CQ9A 5D37A 1G4SA 1H61A 1LP6A 2CZDA 5T26A 1HO1A 3WFAA 1GYLA 4O13A 5D2XA 1FCQA 4K8EA 4Z0SA 3FS2A 4FHAA 3PWAA 3LI0A 2ATSA 2ABBA 5TBOA 2ISVA 1DVJA 1GPWA 3G3DA 2I1OA 3W85A 3EX4A 1QPQA 3NG3A 3T44A 1LTDA 3G1DA 1JQVA 2CLOA 3TDFA 5FF0A 3LBMA 2CLHA 4NJHA 1GTEA 1AW1A 5A5WA 2J9ZA 2DZSA 4FO4A 2A21A 5LSMA 3M0ZA 2G5WA 4HSNA 3FIGA 2FB3A 5FEPA 2X16A 3PC0A 2Y7FA 3WJSA 1X1ZA 1L6YA 4NU7A 1QPNA 4JTIA 2BXVA 3QM3A 3TJXA 3IIXA 4UFIA 4RXFA 3KRUA 3TA6A 3GDMA 1FDYA 3FLUA 3SSJA 3G8EA 1IF2A 5EPDA 3W75A 2DZXA 3I7SA 4ZQRA 3MBDA 1FWTA 3GIYA 2E6DA 4OBTA 3TMLA 1S5WA 4M5PA 2DJXA 1FDJA 5AC8A 4FX6M 4K7VA 4NQ1A 3GK0A 2VFDA 2ZZ2A 4UIOA 5FF7A 4HHPA 4ZZ9A 1EWEA 3IGSA 4ZQMA 4UTWC 5CG7A 1XBYA 3W74A 2BZNA 1YTKA 4TMCA 3W7CA 3WJWA 2X1TA 3FYPA 1B4EA 1ZHAA 2DZPA 3ABSA 3IGUA 4JTFA 1I2PA 2GUUA 4CCDA 2TRSA 1LBLA 2WNZA 3CQ0A 2R8WA 3C8FA 3BG5A 4GFSA 2CZEA 2JKPA 3KVMA 1LRTA 3WK1A 5C55A 1DHPA 4RXGA 1O60A 1QWGA 4BI6A 3TCEA 3CU2A 1GTHA 2QCFA 1TQXA 3GKAA 4N02A 3F1QA 3QF0A 3M6YA 3W23A 2WNNA 2RHGA 2QUTA 3QPZA 4WD0A 5AFDA 3MI3A 4UR7A 1W54A 4DEFA 2KZHA 2I9EA 3CT7A 3RMJA 3F4WA 4IXHA 3TH6A 4TX9A 1Q6OA 1TPEA 4HPXA 4O1CA 1KA9F 2VEPA 4LVBA 1Z48A 1MZHA 3R13A 5KZDA 3ZR4A 4ORMA 1SUXA 1TV7A 3FA5A 1LZOA 3G1HA 1W5PA 5EYWA 1CW2A 3CB8A 3GXNA 4MUZA 1PHQA 4LC6A 1XI3A 1X8FA 3G1YA 1UUOA 1KM6A 1OFAA 4JTSA 3HG2A 2P10A 2V9DA 4CCEA 3QMTA 5LZLA 4BI7A 4N4QA 3O05A 4A2RA 4UTHA 4EWND 3F03K 1BWLA 6TIMA 1RQHA 2ZBTA 3LTSA 4MY8A 3TFXA 2ZCGA 3DFNA 3TKFA 2C1HA 3FEMA 1ADOA 1GT8A 1R30A 1TPVA 1OK6A 3GXTA 1EUAA 1N7KA 5K9DA 5KZEA 2OCZA 5G2IA 2Y7DA 1TPWA 2W0UA 3W7JA 3G0SA 4S2BA 4RJEA 1QOPA 5K9XA 4K6AA 3G8RA 1WV2A 1KBJA 4CNNA 2FDSA 2NX1A 5U4NA 1YXDA 6ALDA 1C9DA 5FEZA 1W3IA 5DY3A 2VENA 1P5BA 4KFPA 4MZ8A 3P67A 4JTGA 4TMBA 2YSWA 3FFSA 1F05A 5KZMA 5EMUA 4ADSA 4O57A 1TPDA 1YXCA 4YWIA 2C0AA 2QCGA 2QDHA 5EA9A 1VLWA 1ZAHA 2ZFAA 4M7TA 2CWNA 4JTHA 2Z2UA 4I7WA 1L2UA 1YDOA 5SWUA 3G1AA 2R14A 3VI2A 3QMRA 5AHMA 1LBFA 1LOQA 3TC6A 3RK8A 4FNTA 3GKFA 3W6YA 3QJAA 1MEWA 1Q6QA 5D03A 2DJLA 1AK5A 1NVMA 3O06A 2FLIA 3TSBA 4UTUA 2E5DA 3UQNA 3R2GA 3LM7A 4YCPA 1TV8A 3A21A 1OF6A 2GVGA 2PRLA 3BK0A 3B05A 1RVGA 3LHWA 3NQ7A 5LNVA 3OA3A 2ZZ4A 3EXRA 2H8ZA 4WX2A 4Z1DA 3UZ5A 2FPTA 3KRZA 2I14A 3NL5A 2JBMA 1T96A 3CTLA 3L66A 3CC1A 3NNTA 5DN1A 3GZ3A 2E09A 4QQ3A 2BSLA 1XL9A 1OFDA 1UJPA 3UYCA 3THQA 3JS3A 1OFEA 1MEHA 1EPXA 4LT9A 3NPUA 4JTKA 3F4NA 4AXKA 4B5NA 1GYNA 2OT0A 3SY5A 1OHLA 2GJLA 1XFBA 4LVDA 3HG3A 2VEMA 1KLYA 3TQ0A 2WNQA 3LCLA 3QC3A 3N73A 1JCMP 3LRMA 4OV9A 4CCCA 3LLDA 4UMAA 1OJXA 1THFD 4KWWA 1UASA 4N9CA 1YADA 4PTNA 3W2NA 3IRDA 4ZQCA 3LI1A 4IPIA 5G2WA 5G4EA 4ADUA 4CQ8A 1YTDA 2QCEA 5DCDA 2O7SA 4YL2A 1KV8A 4O50A 1SO6A 2QF7A 4Q33A 1LDCA 3UPBA 3LTPA 4IGHA 3RLVA 1BEUA 1I2RA 5CGQA 1IGSA 4XBSA 3PAJA 1SSDA 3L0GA 5EY5A 1QCWA 3IIOA 1K7EA 2NX3A 3LTYA 4IX0A 3LCWA 2Y63A 3Q2DA 3LX9A 1Q45A 5DXYA 3G1VA 1XUUA 1AG1O 5G5IA 5LGXA 3I6RA 5LHEA 2V81A 1K02A 1KFCA 1PS9A 2HS8A 4PODA 4MYXA 2JGYA 2YX0A 2DZWA 1TO3A 4A22A 4NJIA 1OYBA 3I7QA 4U28A 5AHEA 3HJZA 4POCA 5IBXC 3NM1A 4EIVA 2BTMA 3HOJA 5I3GA 4LV4A 1P0KA 5J5DA 1YDNA 4HN4A 3W7OA 2NLIA 3N9RA 3IVUA 2ZTJA 2R91A 3LHTA 2YFOA 4WY0F 4KFOA 2B7PA 3O6YX 1UBSA 2E6YA 4K8HA 4MZ1A 1SFJA 1SW7A 4LW7A 2PRHA 3DGRA 1M7PA 2H6RA 3P81A 3GXPA 1XUZA 2C13A 1SZGA 4DO5A 2QAFA 4Z1BA 5D2YA 4GBUA 2J9YA 2NWRA 3GX9A 5I3IA 5CKSA 1H7PA 3IV3A 1B9BA 2QKFA 5D09A 1OX4B 4LC8A 1H60A 3EWXA 2PC4A 3LCIA 4MKNA 1H7RA 1J5TA 3DI1A 4LOCA 3T55A 3A5FA 1W3NA 1HO4A 3EWZA 4QNWA 1TJPA 1KFEA 4LVFA 4XBKA 1QR7A 3M44A 3A22A 4ZL1A 4FNUA 1LOLA 3NQ2A 5L6UA 3SJ3A 1DQWA 3W2MA 4IOTA 4TR9A 1YTEA 5F2LA 1FWRA 4C1KA 1JRCA 4A3UA 2X1SA 1PL9A 1GOXA 3R12A 3O6CA 5HR7A 2C18A 3PSWA 4DQWA 3W73A 1ZY9A 3KRSA 1BKSA 1GG1A 1JCYA 3B0VC 1VRDA 4HPJA 3INPA 4GC4A 4MPQA 2EHHA 3HQ1A 2V0TA 1FY6A 1O5KA 1LROA 4NVTA 1YPIA 1MO0A 3QFEA 2GVJA 5D05A 5HWNA 1KTCA 1Z44A 4S2CA 3H53A 4FNQA 3WK2A 3T4CA 4NX5A 3B0UX 2YZRA 3NQFA 3W1MA 4PCFA 3T40A 3L2IA 3MJYA 1W0MA 1D3GA 5F4SA 3NO5A 4MYAA 3CWOX 3ZS4A 3M43A 2AAMA 3B8DA 4MJZA 4UTTC 2XN0A 1X7FA 4WOQA 3U6WA 4JTJA 3NQAA 3MW7A 4RCXA 1LLZA 5AC7A 2CLEA 1F73A 2PURA 3B4UA 4NXSA 1JULA 3NQ6A 1H1ZA 1F74A 5AN7A 3C6CA 3KXQA 1OFOA 4LUJA 4K36A 1KTNA 5G1TA 4L4LA 5DBTA 2ISWA 2P0OA 1R47A 3ABQA 1DBTA 1OK4A 3C3NA 2NUYA 4WOZA 4UNKA 3KFTA 3STFA 3QQ0A 1FUYA 1VYSX 5D04C 4EVZA 4HIBA 2QCMA 2QJGA 5CPLA 1FQ0A 3R5EA 3W76A 1G7VA 3G18A 1G4EA 1ZCOA 3SGUA 5F1VA 2Y61A 1GVRA 1XCFA 3PG9A 3S5YA 3VNDA 4AAJA 1FXPA 3LERA 1WXJA 4UTMA 1KTBA 3NPXA 2Q8ZA 5KTLA 5FEWA 3UD6A 4AHQA 1X6UA 2RDWA 1EIXA 4N6FA 1XBXA 2E1DA 2ATMA 1A5SA 4XQ6A 4NJGA 2ZRUA 3U8GA 3EXTA 4OV4A 3QSRA 3E9AA 5K4ZA 1HG3A 4Q32A 4MY9A 3EWWA 3IVSA 3TXVA 4JYEA 3TAKA 4WY0B 3V75A 4OGZA 2XN2A 3HPSA 4BFAA 1HTIA 5AHLA 1D9EA 1TRIA 3L5MA 3QZEA 2Q8LA 5CSRA 3T7VA 3CPRA 3PF3A 1TPB1 3MP5A 3TK7A 1I2NA 5CPOA 1QOQA 2Z6JA 4H6KA 1BTMA 2FPYA 4A2SA 2TMDA 5D02A 1PIIA 5IBXA 3W7RA 2A6NA 1SO4A 3STCA 4AVFA 2C3ZA 2QJHA 3SR7A 1A5CA 1PCWA 1ALDA 3N14A 1RV8A 1J2WA 3DBPA 2A85A 1I2OA 3GNNA 4E0CA 4AF0B 5C54A 1YXYA 2ZZ1A 1SSGA 2WKJA 2EKCA 3PUOA 3DI0A 1XXXA 3PBYA 3SIZA 2WV8A 3N2XA 2YPIA 2E6FA 1W3TA 4O15A 1VH7A 2Y89A 3S1XA 3C2VA 2UV8G 3GYEA 3LHUA 4JX4A 3NAVA 2J24A 1F6PA 1KV5A 4LNYA 1XC4A 1LRNA 1TQJA 2RH9A 3E0IA 3EKLA 1EX5A 2ZA1A 1H7WA 3M5ZA 3ATZA 3R8RA 3TX9A 3DKLA 2RKXA 2DP3A 4X9SA 4HNTA 3H54A 1NEYA 3WJZA 5J5RA 1CI1A 1QDSA 2Z1BA 1AMKA 4DPPA 3W7PA 4YLWA 1W5OA 4O11A 2G96A 1KM4A 4M6VA 2PCQA 4IMFA 2ZA2A 3USBA 4IX2A 4IJBA 1W37A 2C14A 3EWUA 4QJ1A 3MP4A 5K7JA 3WJXA 2CLKA 2V2HA 5C5YA 5HUPA 1TPH1 1OYAA 2ABAA 4R7JA 1K8XA 3DU0A 4GWEA 4YCOA 3BARA 2YGYA 3W7EA 4FNPA 3P61A 3LRKA 3G1FA 3TIMA 4WZHA 4O10A 4L4MA 4JYFA 1R2SA 3UZJA 3HIJA 3UY8A 2X2GA 1GVSA 3MI6A 3W1QA 3TFCA 4X3ZA 2ZRXA 3W86A 1JR1A 4NXKA 1JVNA 2RDUA 1EP2A 4A29A 4QSHA 3O1NA 4OE7A 1QFEA 3SZ8A 5LKYA 4E2DA 1TREA 1QO5A 1VCVA 2A7RA 4CNOA 3PG8A 1MEIA 2GQAA 5D2TA 4H4IA 2B0MA 3RF9A 1QPRA 2NUWA 2FTPA 4UR8A 3KAOA 1RR2A 2VOMA 1C29A 3HGRA 3TU9A 4LRTA 4Q4KA 2JKEA 4RLIA 1AL8A 3TSDA 2CLMA 3BG3A 1KLZA 4ZVJA 5F4WA 3IEBA 2FFCA 3RLUA 3PSVA 2YYTA 3BLIA 1KFJA 2HTMA 3LCHA 1KM1A 5FEXA 1LOSA 2Z6IA 2F7FA 3B03A 4JIPA 3QW3A 1LRQA 5GVJA 2Y7GA 1JCJA 3M5VA 3TQKA 1VS1A 3TV8A 2CFFA 3O07A 1TPUA 5EL1A 4DELA 2CLLA 1TPFA 1EP1A 4NJKA 3DENA 2VC6A 2V2DA 3WK3A 3S5NA 1S5VA 5HR6A 1FX6A 3DFQA 3E02A 1ICSA 3IIPA 3HB9A 3M9YA 5L9FA 4BWLC 4LUIA 1O94A 4PA8A 3NM3A 4BK9A 2HSAA 3IIZA 1JCNA 4CNPA 1LYXA 4HKPA 3M5YA 5ABTA 4RX0A 2NZLA 3CWNA 4JGDA 1FCUA 1GG0A 3OVRA 3ABRA 1M5WA 3AJXA 4TU1A 5AYYA 3NL2A 1PHWA 5BRBA 4UFJA 1Q6LA 1XBZA 1AW2A 2WOQA 3GB6A 3T78A 3DHDA 2ZRWA 3W1RA 2VFGA 1NF0A 3G1XA 1DKWA 3P60A 1K7FA 1VHCA 1YDVA 3W22A 3HG5A 5FESA 2V82A 3DAQA 3BW4A 1VC4A 1F6KA 3W83A 4M19A 3GNDA 2AQWA 3LCXA 5CZ0A 3BO9A 5KITA 4BWLA 4E38A 3L68A 3NPWA 3FJLA 1KM3A 3EEGA 4FXSA 3EKZA 3W88A 1AW5A 4MVAA 1JJKA 3AO0A 2DZVA 1ONRA 4DF0A 5KSWA 5U7SA 4UTJA 3W3OA 4KWVA 2V5BA 5FF3A 4FIRA 2W6RA 3NDOA 4NT0A 3G1SA 2QCHA 4IMEA 1LM1A 5BNKA 1PVNA 3W1NA 3W72A 4O1BA 5FF2A 3PBWA 4O52A 4BF9A 1I45A 1WDWA 1SQ7A 3HPZA 4BI5A 3S6DA 4XTIA 4UFMA 3GDRA 1RPXA 2R94A 4WXZA 1W1ZA 3PR2A 1GVQA 4FF7A 2B7QA 4JTTA 3ZFHA 3W9ZA 4O18A 5DELA 1SZNA 4O1DA 3W7DA 5E93A 1I8JA 4G1KA 1TV5A 4OQVA 3W7KA 3LXBA 4IWWA 2IQTA 3QW4B 1R2RA 3NQDA 1WAUA 1YLVA 3HO8A 2QCDB 3QEZA 1L6WA 4UTIA 3W1UA 1FCBA 1NF7A 3W1PA 3UXAA 4FB7A 1K7XA 2J27A 3MHGA 4GJ1A 2NX9A 3OBKA 1R2TA 5AYXA 5A8GA 3CIXA 1VR6A 4M7SA 5G1YA 4EF9A 1IIHA 1NAL1 3NQ8A 3NEVA 4PL1A 3P80A 4XKYA 4NNBA 5HINA 5I3FA 5D32A 3G0UA 3NL6A 5TIMA 1N55A 4XWUA 2QCLA 3NQCA 1QO2A 2PRMA 1A5AA 1A53A 2XFWA 4AH7A 1JUKA 3NA8A 3W2LA 5D2WA 3S42A 3Q58A 4FIQA 3GLCA 1GWJA 1AL7A 4IMCA 1TMHA 3QQ1A 1ZJIA 2Y7EA 4JS3A 4TIMA 3ABOA 1G69A 2NWSA 4N2YA 2C15A 1E51A 5F2IA 2YDAA 3LHZA 2W79A 3LHYA 5HMSA 3W71A 3TUUA 1DOSA 4UUIA 3THAA 2E6AA 5BOOA 4LU0A 1SZFA 1QAPA 3GDTA 4GUGA 4RV8A 4X22A 3GR7A 5BMXA 1S3HA 5AC6A 2FJKA 1TJRA 4HSOA 1TTIA 4JD4A 4LV9A 3HGSA 1XDMA 1FCVA 2B7OA 3S1UA 2JGQA 1L6SA 1JUEA 1FDZA 3C61A 2A2IA 1W5QA 5DBUA 3V1PA 5DCBA 8TIMA 1DL3A 3GDLA 4AWTA 3TE9A 2H3BA 1DJQA 1LORA 5G4WA 2VFFA 5AB3A 1T0OA 1KFBA 3QH2A 2WQPA 1T8XA 3MHFA 2BX7A 2Y88A 1VCGA 1Y0EA 2B7NA 4O0KA 1ME7A 1WYIA 3UWYA 1G4TA 2X1UA 1B57A 3DZ1A 4PEKA 1ICPA 3LDVA 3Q37A 2RFGA 3OG3A 1IXOA 4UMBA 4C1LA 4JNMA 4N4PA 4JR5A 1ZFJA 3NXFA 4RKAA 1OFQA 3P8IA 3PUEA 5HULA 3HGJA 4DO4A 4NJJA 3NZ1A 2E5BA 2VFEA 4Y96A 4WQ6A 1OVDA 2E68A 4GE8A 2ZRZA 4HNVA 1KBIA 3TXZA 3LHVA 1SO3A 1NFBA 4ICNA 3L0KA 3LOTA 1SR9A 4ALDA 5HQEA 2EGZA 3EWYA 4QITA 2NXHA 3BLFA 1PV8A 4HNNA 1RQBA 4QAIA 1GEQA 2YW4A 1H1YA 5I3JA 1H50A 1H51A 4CQAA 3STGA 1Q3NA 4WJEA 4UTWA 4DBDA 3FYOA 4GRSA 5K4XA 4Y90A 1DV7A 4N6EA 4MFEA 3NR0A 5H2ZA 1TIMA 1QMLA 3W7QA 3MP3A 4ONVA 3MHUA 4FXRA 1OFRA 2Q3RA 3M7WA 2QR6A 3LCGA 3LV6A 2NXGA 3W7MA 4NX0A 2A1YA 1OABA 4OHQA 3LB0A 4QIUA 1JRBA 2QJIA 2WJZA 3W7HA 2VFHA 4R53A 2J6XA 3EXSA 2GJNA 1WX0A 4O16A 3O16A 4NZFA 4UXDA 1TB3A 3UWZA 3NQEA 2H3DA 3B0PA 1WBJA 2FIQA 2A6LA 4ML9A 1F7BA 1D3HA 4O4WA 4RZ5A 4JXCA 1TRDA 2QAPA 1H63A 3BPWA 2WPBA 1G6CA 4R34A 3W7LA 1A5BA 2ZDRA 2QUVA 3P7YA 1W8SA 3LBCA 1TTPA 1JUBA 4W9TA 2GQ8A 1PCKA 3PB0A 3VFLA 1TTQA 3G0XA 4JDYA 1WA3A 2LLEA 3EX1A 2VXNA 3GAYA 2V30A 1B4KA 1UB3A 3C52A 4PL2A 3FKKA 1SPQA 3JRKA 3CLMA 3W1XA 4UC5A 2XN1A 4JICA 4UCGA 3DFTA 1P1XA 1Z42A 2EAWA 2HS6A 3GAKA 1SU5A 3PY2A 1KW1A 2ZTKA 1OX6A 3C56A 3LRLA 4J9JA 1W5NA 4Z08A 3PUDA 3UY7A 3CHVA 1VYRA 3ATYA 3LV5A 1K8ZA 1LCOA 1F5ZA 1IXQA 3PM6A 4QNEA 2YXGA 3W87A 4H3DA 5LNUA 4AF0A 3PS7A 4N9BA 4P2VA 3W07A 3P5YA 4DF1A 4OT7A 3C2FA 1ML1A 4IQLA 1P0NA 2O7QA 3A5VA 1H7OA 3PVFA 4LY8A 4DO6A 2OZ0A 1O5XA 2Q3OA 1IIGA 1GQNA 1YPFA 2C6QA 3WK0A 3VE9A 4O54A 1J4EA 4AHOA 3C2RA 4O28A 1JCXA 1OX5A 4FX8A 4FNRA 3M1ZA 2PE4A 2QUUA 4DF2A 5KINA 4O53A 1TCDA 2V5LA
chains in the Genus database with same CATH superfamily
4GG9A 1UD6A 4AISA 2W3ZA 3A9IA 4H9YA 4MNKA 1OG0A 1WE5A 1F76A 5CPMA 1DQXA 1CIUA 1O66A 5IOBA 1VFSA 4NZJA 1I2QA 2NVAA 4JIQA 3MCNA 3BAWA 3AUOA 3PP7A 4QROA 1QWKA 1TPC1 4C60A 4AMAA 3M41A 2QCCA 7CGTA 3S9YA 5G2HA 1SFLA 3AC0A 4GABA 3OEXA 4GMEA 3TP4A 1T5AA 4Q4RA 3H2OA 4J3TA 3KWSA 3BV4A 5I0DA 3U2OA 2GDUA 3KLLA 1FWWA 4M1BA 5CC7A 6CGTA 4D9PA 3RYSA 3ZMRA 3L9CA 1R46A 2BOEX 4PFMA 1JDEA 1H7XA 3MKCA 3SUUA 3W0KA 3URNA 3S9ZA 5EGRA 4M6QA 3RG6A 4LCSA 1EFZA 5F1UA 3WJYA 2F84A 4UFHA 3WQ4A 1K9EA 3WUGA 3RFAA 3JR2A 1F2JA 4FP1A 5I77A 3WBYA 3S1VA 2EPHA 3IGXA 3B9OA 2ICSA 4LQ1A 5LA0A 3ARSA 1VZWA 1HVXA 5F7UA 3PFMA 5BU6A 2DSZA 4NNCA 2PPGA 2D73A 4WVXA 3UZXA 1XSKA 2NT1A 1JQXA 2ZOXA 2GOUA 3GG1A 3UXIA 3SADA 3S1WA 2VZOA 3TW6A 4CLMA 2YCLA 1EWDA 9XIMA 2JALA 1E3XA 1W1IE 5MF5A 3LXCA 3LPOA 5HWMA 3RJXA 4LWWA 1WOBA 4O17A 3W37A 4UZUA 1FH9A 1DJNA 2DZUA 4GYJA 3W1TA 4MB4A 1IQ8A 3WENA 3GR8A 3WLMA 1YKWA 3WLPA 3C0LA 2RDXA 3VMOA 2AQOA 3QZ6A 2WCAA 3V5OA 3NQMA 1JAKA 1W8GA 3M47A 3KTXA 4DBEA 5JIWA 3ZJ7A 1V6XA 1V3KA 3GVGA 2CBJA 1EDGA 2OYKA 3UPWA 2BNJA 3I6EA 4HB7A 4GYPC 3PPCA 4MGGA 2I16A 2BLEA 4JQ2A 3VUPA 3UWUA 1QATA 2FPVA 4XAZA 4GUJA 3OLEA 1A5OC 2DORA 2NV2A 3W2UA 4Z17A 5I3HA 1XHGA 5JVLA 1K03A 1GVFA 4G5DA 3OVPA 2ZRYA 3CB3A 3UGRA 1I4NA 1NY1A 2H90A 3E3HA 1RXOB 3K30A 3KX6A 2ZYFA 5LNSA 2CIPA 1DJWA 3VPLA 4Q8TA 2OXNA 5A6JA 5ECVA 4XO6A 1H5YA 1WQ5A 3N1AA 4XKYB 1ZENA 4UOQA 2OJPA 1F3WA 4C6CA 4ZSTA 3KVJA 2DSVA 2XDFA 4GPNA 4GQQA 4EKJA 1EGVA 4RL3A 3XISA 4N9DA 4AEOA 5MHBA 1TTJA 5HANA 1XRSA 1Y7VA 2VT0A 4XTDA 2YL9A 4UFKA 2G97A 1MXSA 1JPKA 4HMEA 3TJLA 4AD1A 4N9EA 3AXXA 3NZQA 3WQ8A 5AHIA 4B5TA 1KRMA 1KKRA 3AHZA 4UTTA 4KMQA 3JUGA 4MM1A 5LXEA 3G6MA 2I5QA 2ZVIA 1M7OA 5I3KA 1T99A 1O95A 3BGJA 3GH4A 2J74A 4RZ6A 5F2MA 1FHDA 2WC4A 4AB4A 1CB7B 1YE6A 2BASA 1SO5A 3MYOA 4LS1A 1XIDA 1E6XM 4AX6A 1V77A 5FF4A 4W8LA 1G67A 1E9YB 4QS6A 3P0WA 4O19A 1T41A 1W2PA 1EHNA 5CBIA 3CEUA 2CLFA 1P4CA 4I9AA 4Z1CA 2GVLA 4HK5A 3MC5A 4RR4A 3E12A 3UFYA 1VFMA 2WVVB 4RK8A 5LNWA 5CBBA 1AJ2A 1QBAA 5K9CA 2NLYA 4PR4A 3W2JA 3E1F1 2NQHA 4MAZA 3RU6A 3GDKA 4QRNA 1TVLA 1XISA 1W1B1 2P53A 3WNOA 3VIOA 4WXYA 4EPEC 4ORIA 3DHFA 3W7NA 2ONEA 1WO2A 2Q09A 4IJRA 3VIHA 4DN1A 3CXOA 3PNUA 3KBVA 4FX7A 3A13A 3S0CA 3EB3A 2ZZ6A 1G7UA 4QSFA 2ZUNA 5DQPA 4XSLA 4OU1A 3MV01 4NASA 1QNVA 3TWAA 3HV9A 3VIPA 2ZE3A 1EHAA 3SY8A 3VKKA 2A5HA 3OIXA 1K4HA 1UUMA 4XUGA 2OT1A 3TSMA 4IH3A 4IXXA 1Q7ZA 3A23A 4G7EA 2D20A 4JPGA 2XH2A 5E1QA 1Q6FA 2HBXA 1MW0A 1VBGA 3QPYA 1B3OA 3WF3A 3C5QA 3QTGA 2A7NA 2XISA 4JIRA 3TC7A 3MWAA 3YPIA 1ISYA 1DXEA 3IV8A 5H8UA 1UWQA 7ENLA 3N15A 2A0NA 5AOUA 1L9WA 4XSMA 2AOSA 4Y9AA 3DFOA 4O0ZA 1GOKA 3PULA 3W2KA 4K1GA 1XLJA 5T91A 4DXKA 3LK6A 1QNSA 3O9NA 4IF2A 2ZA3A 4HD5A 4Z1AA 4L6OA 1JCLA 3DIPA 4IMGA 3JU2A 3EOSA 5D30A 3THUA 1NJJA 5CJMA 4E2BA 2QDGA 4AZ6A 1DEDA 5BOEA 2Y1HA 3QYQA 1NU5A 1S2TA 1EGMA 2V8ZA 1ICQA 3BAXA 4FR1A 3Q94A 4RDWA 4FXFA 4JDBA 4H8HA 2P1FA 1EH9A 4HYRA 4S3FA 1DP0A 3LYEA 4JN8A 3CH0A 3ZT6A 3UJEA 5JBEA 1PX3A 3L5AA 1V08A 5FSDC 1VYPX 2D2GA 4J5NA 4AD5A 1J2BA 3GW0A 1MFVA 3W70A 2XWDA 4HT3A 5HPCA 1N2VA 2YKKA 5CZTA 5D37A 4CQ9A 3WQ5A 4GNKB 4O13A 3LZ5A 1B3WA 1RCXB 3UVIA 4MNMA 1FCQA 4K8EA 4Z0SA 3HQOA 2GDVA 3FS2A 3PWAA 1KXQA 2ATSA 2ABBA 4E4PA 1NDWA 4AUBA 1MUMA 4R5EA 5B7YA 3QC0A 3EX4A 3AXHA 3VOIA 3BAJA 1DJHA 3LBOA 1EDQA 2DIKA 2CLOA 5FF0A 1VJSA 3TYDA 1R0MA 3D3AA 4NJHA 1XSJA 2VC5A 4WDTA 5A5WA 1UUQA 1E0WA 1F3EA 3PBMA 4QCEA 5JIPA 2X16A 2WWCA 3WJSA 1L6YA 3WKZA 2V3EA 2BXVA 3ARTA 3IIXA 1HKVA 4UFIA 2PF8A 2D69A 3SSJA 3H2FA 4UQBA 3HURA 2DZXA 4A35A 1J01A 3MBDA 4ZOCA 3GIYA 4OBTA 2DJXA 2E4TA 5I23A 5AC8A 1UA3A 3U5UA 3GG8A 3BL3A 5FF7A 4UQCA 4DYKA 1EJUC 5CG7A 1XBYA 3W74A 4B5SA 1YTKA 2HXUA 4UOJA 3O0FA 3QZAA 4LAOA 1NFGA 1RA5A 3IGUA 4Q4SA 1I2PA 3SB0A 3H23A 2TRSA 4LPCA 3NEHA 3U0HA 2R8WA 3S9IA 3AIVA 3LY0A 4GFSA 1KBLA 2QLYA 1O60A 1ZCCA 4TX8A 4DVOA 1YW1A 3ABXA 2QCFA 4FMVA 4XX6A 3NZGA 4G9PA 4QLJA 3CO8A 2XVKA 1GQKA 5I78A 3F1QA 5DEZA 3PWGA 3MA8A 3MWCA 3QPZA 4INFA 2WSKA 3S83A 4Y9MA 5ABHA 2YBTA 2F6UA 2J13A 3CT7A 3TH6A 4TX9A 4WF7A 1Q6OA 2VEFA 3ITGA 4LVBA 1XF0A 5KZDA 3ZR4A 2VP8A 3GHTA 1U2YA 1D3CA 3KL0A 1LZOA 2IPFA 5EYWA 3PK7A 3RPTA 5ABFB 1PHQA 3IK2A 3GY1A 3SEPA 2RJHA 2DW6A 1UROA 2IPWA 3WNKA 5BXSA 4N4QA 3CQJA 4QG9A 1BWLA 3PBGA 5LIKX 1VEMA 2ZBTA 2CLPA 4DJDC 4L56A 3VC6A 2WXDM 5AECA 3GHRA 1GT8A 1TPVA 4DAIA 3VIGA 3GXTA 1N7KA 4A3QA 3WLNA 2VGIA 4XD3A 2OCZA 5G2IA 2Y7DA 4S2BA 4C6NA 3W00A 2O0TA 4V28A 5K9XA 3E2VA 2GK1A 1TZZA 2G37A 3CMFA 4CNNA 2FDSA 5U4NA 4MNJA 2QIWA 2PLMA 1KRCC 1C9DA 5FEZA 2VENA 5T9BG 4KFPA 1RD6A 3P67A 3KDNA 4TMBA 1ODZA 3WQ6A 5E5CA 3FFSA 2FGZA 3GC4A 4O57A 3RM8A 1TPDA 2RGLA 3NDZA 3O7UA 1ZAHA 5HATA 1M53A 4JQ4A 4M7TA 1ONWA 3AYVA 5AYIA 3LPPA 4MAVA 3VD9A 1L0PA 1OEPA 3OBAA 1LQ0A 3QMRA 3T4WA 1H0GA 4FNTA 1R38A 3QJAA 3E0VA 4W4QA 1Q6QA 2EPOA 3SQMA 4C7GA 5CH9A 4Q8MA 4E6MA 4NZ5A 4PMVA 4AIOA 1LQ2A 3UQNA 1M68A 5HXMA 1Q85A 3WQCA 3G6LA 1OF6A 4XVEA 2GVGA 4IIDA 4XZIA 3BK0A 3H4XA 3NQ7A 2GQ3A 4PZVA 4E2OA 2ZZ4A 2H8ZA 4WR3A 3FV9A 1I60A 3UZ5A 2JBMA 3NL5A 1J9YA 3CC1A 3CUFA 4RW3A 4DI8A 5DN1A 3N17A 1F8IA 1O5QA 4HVXA 5TNVA 4FK9A 1ONEA 4DZ5A 1JYNA 1CGVA 1BPLB 2HBVA 1P7TB 3MZNA 3NPUA 2E8ZA 3U48A 3ZSTA 3LN3A 3F4NA 3VCCA 2NVDA 3SY5A 1XR2A 1FP8A 3BAYA 3TQ0A 4LB3A 2WZIA 2XIBA 4Q3MA 2DQWA 3N73A 3V16A 3BICA 4OV9A 1V03A 2X0SA 3N6HA 1V6UA 4PTNA 4AZIA 1S1PA 3LI1A 5E6YA 5G4EA 2PC8A 3VD4A 5DCDA 1O1ZA 2XVNA 4JNYA 5ECUA 2OB3A 1H5VA 2QF7A 4Q33A 1I2RA 5I00A 4Y2WA 1VBHA 4OTKA 2FYMA 3IIOA 3TR9A 2IUZA 4YWSA 4IIHA 4KQNA 5DXYA 4E8DA 4JQ3A 1K02A 2OSXA 4F2TA 2HS8A 1NOUA 1WZAA 2BBFA 2PODA 3QHNA 4JTRA 4POCA 2XIQA 4EIVA 3RM9A 2BTMA 5I3GA 4HJFA 4LV4A 1YDNA 3W01A 2NLIA 1WB0A 3N9RA 4OUIA 7A3HA 2YFOA 4WY0F 1QI0A 2WPGA 3O6YX 3PNZA 4NHVA 5TAOA 1SW7A 4M1RA 3IJ9A 4V2XA 3UR2A 4WDWA 3UW6A 5I09A 4HHLA 4Z1BA 4GBUA 2J9YA 5I3IA 3GX9A 3MT1A 2Y8UA 1VFFA 2O9PA 1V3HA 3I3EA 3WX7A 3VDBA 2QKFA 5D09A 2XGIA 4Q8QA 3WNLA 3LCIA 1YNPA 4D8AA 4WGHA 2EJAA 1HIZA 3A5FA 3EWZA 2CBIA 2ACSA 4LVFA 2X7VA 1DIEA 2GWNA 3M44A 3MQTA 1XLLA 3ABZA 1BXBA 2WHLA 3NQ2A 1RBAA 3W2MA 2O56A 1YTEA 4FI4A 4HZMA 2XUCA 3SCQA 1JRCA 4CU7A 4D71A 4E5TA 4B3ZA 2VR5A 3WQWA 4W7WA 3W73A 1TE6A 3ANVA 5T8GA 1EBHA 4Q8OA 2ZICA 5A1AA 3SAZA 1SFSA 4FS9A 1JCYA 3OGVA 2EHHA 4PYSA 1FY6A 1O5KA 4UQAA 5HMEA 4JFWA 1JDDA 2VEGA 1DWHM 1Z44A 1BWVA 1S1RA 1Z89A 4C91A 1KNWA 4K8GA 2XZ7A 3T4CA 4NX5A 1AA1B 2YZRA 3NQFA 3B0UX 4HBKA 3MJYA 1W0MA 3DC0A 3NO5A 4KETA 4MF4A 3VU2A 1X7FA 2Y5EA 1OCBA 5AC7A 1F73A 1WUEA 3B4UA 3C8NA 4BQ2A 1X6NA 4HHHA 4W7VA 3NQ6A 5AN7A 3C6CA 3FXGA 1ZP3A 4LUJA 1E9LA 1KTNA 1WCGA 1BFNA 1FFQA 5EFDA 2P0OA 3T0TA 2ZUMA 5EMYA 4O8AA 3QHMA 4WOZA 3QQ0A 3J7HA 3E74A 4XAGA 3TYUA 5JH2A 4HIBA 2QCMA 4S38A 5CPLA 4AU0A 4Z1YA 5IFTA 1G7VA 1W3LA 1G4EA 2ZUWA 5F1VA 3GTXA 1FXPA 3LERA 1WXJA 2CC0A 3KS5A 4UTMA 4CGTA 2GGGA 3NPXA 3UZYA 1H4PA 3DCPA 5DMLA 1X6UA 2RDWA 1EIXA 5E09A 1S2CA 4GQGA 4GQBA 3FJ4A 3KRBA 2ZRUA 2HWGA 1QNRA 1HP4A 1HG3A 4MY9A 3TXVA 4OIFA 1G5AA 1JCTA 4FXJA 2KX9A 3HPSA 4BFAA 3S3GA 3UERA 4ERGA 1TRIA 3NYDA 4WSHA 4UNIA 1XLEA 1JZ7A 2HVMA 1TPB1 3MP5A 2BHUA 2Z6JA 4ZOAA 4V15A 1BTMA 2FPYA 4KWOA 2TMDA 5D02A 2W66A 3C86A 4JL1A 1OSEA 3STCA 3VZYA 2QJHA 4ZB0A 4C5ZA 9XIAA 4B5WA 1A5CA 1PCWA 2O9RA 4K1WA 3N14A 1RV8A 1UQYA 1J2WA 2A3CA 3GNNA 2WHJA 1JPDX 1CENA 1Z69A 2WKJA 2E9MA 4WDUA 3N2XA 4O15A 2PTXA 4DO7A 2YBVA 3LHUA 3NAVA 1F6PA 2ANUA 3WLOA 1TQJA 3E0IA 2F9RA 4G56A 1EDTA 3DESA 4HYVA 2ZA1A 3M5ZA 3MUIA 1BXNA 3GFYA 1SZRA 4X9SA 4PMDA 1IZJA 4HNTA 1R7OA 4DPPA 7XIMA 4YLWA 3OGSA 4EX4A 3UESA 2ZA2A 1G0CA 4PTMA 1TZ9A 3CUGA 1EYWA 2FZBA 3MP4A 2ZXQA 5K7JA 2CLKA 2WC3A 4NRRA 1X98A 3BJTA 4C6PA 3ITVA 2OQYA 4TVDA 4FNPA 3ZR5A 4CVWA 4S3EA 4O10A 1XV8A 4S3GA 1ISZA 3W1QA 4X3ZA 2Z00A 3KP0A 1KXVA 1QI4A 4QSHA 3AYRA 3ZOAA 4GXWA 3UYIA 4PULA 1ONXA 5D9NA 2BVWA 2AKZA 4PUEA 4H4IA 4GISA 3GE7A 4XD6A 4IT1A 3PFRA 2FTPA 4KW2A 4ASTA 1IT8A 1RR2A 2VOMA 4ACZA 1VEOA 3TU9A 4Q4KA 4US5D 4HPGA 3RLUA 4AQLA 4CD5A 2YYTA 1KFJA 2PDGA 4XZWA 2OEMA 3LCHA 2EXOA 4DAFA 1X6LA 5FAGA 2Y7GA 4WSKA 2INFA 3TV8A 1E1CB 3VDAA 1TPUA 2R1NA 3TONA 3OJGA 3TTSA 1TPFA 1JIBA 1EP1A 4US5A 4NJKA 4MWAA 2ZKMX 2PD5A 2OYLA 3DENA 4LJ3A 2FHFA 2NQJA 4XO7A 3WK3A 3ITOA 3R8HA 1UP2A 1S5VA 3FAXA 5RUBA 3WDIA 1SMAA 3E02A 3IIPA 3M9YA 4NF7A 3AOFA 2POZA 3WCZA 1LYXA 4IP7A 4HYWA 3WLHA 5ABTA 2I9UA 4I8DA 2VDIA 3B8IA 4QLLA 3OVRA 3SGGA 3BLLA 4TV5A 1QASA 1JFXA 1VIWA 1GOMA 1R5YA 1UH3A 1M65A 1OCJA 2WOQA 1CDGA 1PKNA 2ZRWA 5I06A 1MW2A 1A5UA 1NF0A 3G1XA 2DPEA 3P2VA 2PP0A 3P60A 2F2KA 4XAPA 3DAQA 4IIFA 3LMYA 1VC4A 1F6KA 3GNDA 3LCXA 5CZ0A 3I10A 4ZENA 3NPWA 3EEGA 3AHVA 2DZVA 4HHMA 1FWGC 5U7SA 1PYMA 4KWVA 3S2CA 2W6RA 3NDOA 4NT0A 2VGBA 3UG4A 3R10A 5BNKA 4HTBA 3BLOA 5XIAA 4O1BA 3PBWA 4O52A 4BI5A 2DQXA 4KCUA 4XUYA 3GDRA 1J6OA 3BZGA 1SVDA 4WXZA 2C79A 1Z7AA 2B7QA 3CUHA 3ZFHA 2Y24A 3W7DA 4G1KA 5FJUA 2I5IA 4QTGA 3LXBA 4EP8C 4QS5A 2D3LA 2O55A 1YLVA 4A8IA 3GG7A 4DB7A 3W1UA 1NF7A 3W1PA 3WO8A 3UXAA 1Q4WA 3FEQA 1NQ6A 1K7XA 3S6TA 5A8GA 3CIXA 1VR6A 4M7SA 4AY7A 3A3WA 3CBWA 3W4RA 4F8XA 3NEVA 4PL1A 1WZKA 2WJFA 3GTIA 4XKYA 2D0GA 3E2QA 1XH2A 5BWAA 5I3FA 1U5HA 4M6UA 3NL6A 1N55A 1MNSA 3OO2A 5DMNA 1JUKA 4Q4PA 2F6KA 3Q58A 4ZOBA 2GSJA 1TMHA 3V3WA 3QQ1A 1RBLA 4TIMA 3MMDA 3MTWA 2C15A 1VAHA 2YDAA 3EDFA 3SJNA 3LHYA 1UZ1A 4LYPA 3W71A 1DOSA 2B81A 4JKMA 2VO5A 3THAA 4FLRA 2CBVA 3WN6A 2RJGA 3L4TA 1QAPA 4RV8A 4X22A 3LZ3A 4DY1A 1S3HA 2FJKA 1TTIA 1L8PA 2JIWA 4LV9A 3HGSA 3L4YA 1B31A 1YPXA 4IQJA 1XPYA 1W5QA 5DBUA 1QK0A 3V1PA 5DCBA 3KWXA 3PANA 1DL3A 1W1VA 3A4JA 1PZ2A 1T0OA 4X9YA 3VNZA 3KBSA 3MSGA 2BX7A 3UWYA 5M5DA 1XIEA 1ICPA 5I02A 1JZ3A 1XS2A 2RFGA 4UMBA 4JNMA 4JOMA 1XFCA 3BZJA 4HOZA 1P1MA 3WQGA 2V3FA 4RKAA 4C6QA 3ZJ6A 1XINA 1CGUA 3P8IA 4NJJA 1M03A 3IUIA 3NZ1A 2VFEA 3AMGA 4GX8A 2ZRZA 5JUVA 5C7VA 3MUCA 1W9PA 2PTZA 4ALDA 1SR9A 5HQEA 1GVYA 1E4NA 4DYJA 3BLFA 2FGLA 1GEQA 2YW4A 5H8PA 2Z25A 3NSNA 1H50A 3STGA 4HU3A 4W89A 1Q3NA 4WJEA 4CNUA 4UTWA 5K4XA 3BUVA 3NR0A 3OBEA 1LL6A 3W7QA 3MP3A 4EPBC 3FX4A 4FXRA 2OTDA 4QE1A 1QI2A 5FJTA 2ISFA 2A1YA 2QXWA 4IFKB 3NO3A 4WSJA 4HK7A 2WJZA 3W7HA 2J7DA 2Z28A 5DT5A 3VOJA 3ZXWA 4R53A 2J6XA 5CC6A 2PA6A 4WGXA 1OIFA 3O16A 3I3DA 4UXDA 3WQOA 2EEXA 1ZJBA 1WBJA 4GA8A 4F40A 3IACA 1F7BA 4NZ1A 2WWDA 1U33A 4U5KA 5MKGA 3OG2A 4P8XA 1NIUA 3KBNA 1OCQA 3BPWA 4R34A 3ZLGA 2ZDRA 2QUVA 3SCWA 3LBCA 3EOOA 3GBDA 1EJSC 3PB0A 3G0XA 3M0KA 3F2CA 2V30A 3CUXA 3C52A 5EMLA 3W1XA 1R3SA 4WDXA 1OIMA 3ZR6A 3DFTA 1U22A 4IIGA 3NCOA 2HS6A 3GAKA 3TTEA 5I07A 3H26A 1OX6A 6ENLA 3LRLA 2HISA 3VILA 1W2VA 4Z08A 3GO2A 3QPEA 1BF6A 3CQHA 2EPKX 3QY8A 4JTQA 3UY7A 3VTRA 3HPAA 3NUKA 4I3GA 4JEJA 1LCOA 3T0BA 4GVIA 3NTYA 4DJED 1PZ3A 1KCXA 3C3UA 5DO8A 4R7WA 1PYFA 1I75A 1Q7MA 2F6XA 4PCNA 4P2VA 2VC7A 4DF1A 5TF0A 4OT7A 1ML1A 4IQLA 3B8SA 2DGAA 4RPQA 3EWCA 3TTOA 3B8WA 4LY8A 2OZ0A 1HQTA 2Q3OA 4IL2A 1IIGA 1PX4A 4WRHA 3VK5A 4GJIA 1Y8BA 3THCA 3M1ZA 3RILA 4TTUA 3BOLA 3THDA 5JH1A 3HM7A 1TCDA 1LT7A 2JF7A 3LA4A 4HMCA 5K3VA 3POCA 1UR0A 4K7YA 2VQUA 2OX1A 3PJTA 5C9ZA 3MSDA 1HFBA 1K9TA 2X1IA 1J5SA 1UCWA 1ZAJA 1OFPA 4I7VA 4PTVA 4MJMA 4YU1A 2WW5A 4GGHA 3VKJA 2Y6ZA 1S5TA 3VA8A 1V51A 3UWVA 4KT2A 3B0YA 4WLCA 5EBAA 5A3HA 1Q4NX 2DV0A 1W1A1 2QCNA 1W5MA 1W56A 3ZQ9A 3CIWA 1OWQA 1OCNA 3TR2A 2XG9A 2GSHA 1V4YA 3OOQA 3M7SA 1XJBA 3UR7A 2X40A 2TPSA 3W81A 4KWSA 2YZ5A 2WZTA 3W1LA 4GUIA 2D23A 2PBOA 4A21A 4KKXA 4MFDA 4F0RA 3CIVA 4BCEA 3WY1A 2R6OA 3F2DA 3KOWA 1VBJA 4WCJA 1UPPA 3H12A 4LTSA 4XV0A 4Y9NA 2DUAA 1TYGA 1ZAIA 4PMUA 5A8OA 1IWPA 4QM1A 3ZLFA 2GQ9A 5A2AA 4CNSA 4K39A 1UR9A 4S3CA 2ISSA 2EPLX 2E0PA 2V5DA 3LGEA 4FALA 1FH7A 2IW0A 1ZLPA 4O14A 1UH2A 3L65A 3REQB 1UR8A 4YTTA 1HNYA 3CAVA 3PZQA 1W31A 4EWJA 4R9OA 1PWLA 5CZJA 5DXXA 2DW7A 2VVNA 4FOUA 4GX9A 3NYZA 3REQA 1WBHA 3GU9A 1HF6A 1H1NA 3EMCA 3AXIA 5HNRA 4B9YA 1CX9A 4H8VA 1GGOA 2CEQA 3TNOA 3TCSA 3KHJA 3O6AA 5BW6A 2W63A 3GNPA 4DPQA 2E77A 2WSPA 2J6VA 3DHPA 2CYGA 5BMWA 4ZQNA 4ZSUA 3WIJA 2OVLA 3EX2A 5HNNA 3BOXA 4MY1A 4ZE5A 3NOYA 4O4VA 1WNOA 3R89A 3N3MA 3PBUA 4GIAA 2QEZA 3P62A 1SM9A 1RP9A 1EGZA 3EX3A 2VRJA 3S5ZA 2Y70A 4IPLA 2XWEA 3APYA 1SW3A 2JF6A 1FWJC 5HDRA 1IZCA 3P5ZA 4LVGA 2WSYA 2VHLA 4Z2KA 1CLKA 4AWEA 1QW7A 4PH6A 4LYQA 1KM5A 3UJ2A 4MPKA 2Y8VA 2NXIA 3ZWTA 4A8NA 3QQWA 4W5ZA 1HW6A 2HE5A 3MMTA 3C0JA 4JTEA 3WLIA 3L12A 2PBGA 3OQ8A 4JYDA 3QV8A 1RHCA 3H55A 2OEKA 3NURA 3WELA 4FLQA 3HG4A 1KM0A 2Z1VA 3TTYA 3CL7A 3CAKA 3VMPA 2IKIA 1ME8A 3ZWSA 2J4GA 4GUFA 5HJLA 3DXIA 1TR1A 4OVXA 4ZBCA 2CW6A 5TQLA 1IHIA 4AWUA 4DWSB 2WJEA 1RBOB 1XM3A 2ADAA 1BYDA 4IIBA 3VE7A 4GIEA 1GVOA 3QTPA 3M6DA 3SECA 1S5MA 2NSOA 5C6MA 1CBGA 5HNUA 2GJPA 4H9XA 3N2OA 4JTLA 2OWCA 4B3KA 4ZQOA 2PAJA 2OMAA 2YW3A 3FDKA 3I65A 5AZ1A 1IEVA 3CUJA 3WD1A 4KCVA 1EA0A 1WP6A 1GORA 2EPMX 4RZBA 1FBAA 4Z42C 4ICMA 3SN0A 2DIJA 2E5CA 2ZZ3A 4P8VA 3RHGA 3E0LA 2YXOA 3IJ8A 2OYMA 9RUBA 4IJCA 4O1AA 4ZB2A 3N19B 4Q7BA 4H41A 4S1FA 1OF8A 1UA7A 3EX6A 5C9XA 3U3HA 3EWBX 2BGSA 2FDMA 5CZSA 4DZHA 4FOKA 3O6DA 1MUCA 2NV1A 5HK4A 4CKQA 1ESWA 4GZIA 2YL8A 1XYCA 3WDQA 1IE7C 1KBKA 3SUTA 4Y7EA 2G3NA 2J88A 5A2CA 4RZ4A 4J3ZA 3L2LA 3CM4A 4JZ5A 3Q67A 3BVJA 4AC1X 3S2NA 5DF0A 1RD5A 3WYZA 1V3IA 2OR2A 2G95A 2YOCA 3L4XA 3M0VA 5DY2A 1V02A 2VEIA 4XZ9A 1K9FA 1JNDA 3CL8A 1F9CA 2FTYA 3AICA 2AL1A 1DE5A 2GK1B 5H1WA 5IRPA 1HL2A 4V1XA 1TX2A 3S6OA 2VX4A 4WK9A 1BSLA 1MWOA 3NPVA 5IXEA 3O15A 3U2CA 2H8XA 1OB0A 3A24A 3CV6A 3OHIA 2Z1KA 3GD6A 2X8RA 4Y6GA 5HUOA 2OQLA 4IPNB 4UFLA 1WZLA 2Y85A 4H9TA 3O8AA 1F3TA 3BTNA 1T7LA 3NJ3A 1VF8A 4OZOA 4TO8A 2VCBA 1X1OA 3E96A 2VKZG 3P8JA 1OZMA 3GNOA 2F61A 3TN3A 2OGJA 5D9MA 5DLCA 1XLCA 4CQBA 3NL3A 1OY0A 4B15A 1U30A 4UTLA 1TCMA 1BG4A 2TYSA 3NQVA 3NZRA 2Z24A 1V93A 1KFKA 3MUY1 1Q6EA 1CT5A 1K9DA 4TV6A 5J04A 4S3BA 1QK2A 7PTDA 2PI6A 3WLJA 1VJIA 1JPMA 4U4MA 4PUUA 1DE6A 3D0CA 2OSWA 1VPXA 3II1A 3GVQA 3PAOA 1WOAA 3V0SA 2ESCA 3AZSA 4US6A 1JYWA 4PMXA 4Q22A 5BWFA 3B9EA 4JBRA 3T05A 1E55A 2C0HA 2FB2A 1C9WA 4GVGA 4HNOA 2HPIA 4HP5A 1LP6A 2Z7KA 1GYLA 2PDHA 5GJMA 4J3UA 5D2XA 4CN6A 1PTGA 3BC9A 2E7FA 6A3HA 3W27A 7REQB 3EBVA 4GGBA 2WJDA 4FHAA 1RJQA 1C8QA 3SCUA 2G3FA 5KZ6A 3GTHA 2I1OA 1YRRA 3MY9A 3W85A 4ECLA 1QPQA 1M04A 3NG3A 3T44A 4NYUA 4HU4A 1LTDA 1JQVA 1LWIA 4S3JA 3LBMA 3BJSA 3AYSA 3N6JA 2VCAA 4E2VA 1SJBA 2J9ZA 5I79A 3EGJA 5LSMA 3M0ZA 1OC6A 1XH0A 2FB3A 4XZHA 1MMFA 3WQVA 3CPGA 1QPNA 3QM3A 4PN2A 1JL8A 3ZVIA 1FDYA 1OQFA 4Z2JA 4A05A 1E15A 2VTFA 5EPDA 4XZLX 1O7AA 4X0NA 1CXEA 3GQYA 4LALA 3I7SA 2YJQA 1S5WA 8XIMA 4K7VA 2P8CA 3GK0A 2VFDA 3W29A 4LEQA 3L4WA 3U4FA 4JKLA 4HHPA 1FTXA 4C90A 4E4FA 3IGSA 4ZFCA 4UTWC 2BZNA 2IXUA 2WM0A 3W7CA 2VWSA 5CAKA 1MDRA 1B4EA 2DZPA 2WMJA 4JTFA 4CCDA 1B1YA 4Q7IA 4DRSA 1JF5A 3TN5A 1FHUA 2OQHA 4N42A 5ABGA 2PDJA 1QI3A 2CZEA 1OGSA 3KVMA 1E56A 1LRTA 1TR9A 5C55A 4JCMA 3FNDA 4DJDD 2ODOA 1TQXA 2E3ZA 1NELA 2D2JA 4N02A 4GOAA 3B9DA 3W23A 5FJJA 3F4VA 2RHGA 1FWHC 4C7FA 1NWUA 2H9AA 2KZHA 3RMJA 4IXHA 4URIA 2ALRA 3E38A 1TPEA 1UC4A 1MZHA 3DBNA 4ORMA 4AZCA 1SUXA 1TV7A 3FA5A 2V68A 1CW2A 3K5XA 1B3VA 4MUZA 3S2JA 3G1YA 3OLDA 1UUOA 3UG8A 3MCMA 2CITA 1OFAA 4JTSA 3HG2A 2V9DA 4CCEA 1ZZMA 3QMTA 3L2MA 2GJXA 3FAWA 3O05A 3QV9A 3ID7A 1A47A 1TJ2A 4UTHA 4EWND 3F03K 2INZA 2YDRA 3RPMA 2ZXDA 3LTSA 3TFXA 1GOIA 1R30A 1EA9C 4W88A 1EUAA 4HTYA 2AGTA 5K9DA 1HJVA 1NWRA 2PS2A 2F38A 1UWUA 1TPWA 3H21A 2W0UA 4RE2A 5JQ9A 4RNHA 4RJEA 3ENLA 2FFIA 4K6AA 4F0HA 1XLBA 3G8RA 1WDPA 4DUOA 2F2HA 3PZOA 1C3FA 2NX1A 4P7NA 3JZUA 4TXEA 4CQDA 4REQA 3FW6A 5M1TA 1GVIA 1PJ9A 4JTGA 1ZS2A 5M03A 3ALGA 3ME3A 4K2SA 1F05A 5KZMA 2V69A 5EMUA 4QX4A 3V7PA 4ZTYA 4GKLA 4YN5A 2C0AA 4EE9A 3H4WA 2WMIB 2CWNA 4JTHA 2Z2UA 3VZZA 1XYLA 1MRQA 3DERA 1DXIA 1US2A 1YDOA 2W61A 2R14A 1AJZA 5GNXA 4D8ZA 2ZX7A 3ERPA 3RK8A 1HJQA 4L65A 1XH1A 4B16A 1RCOB 3O06A 1C93A 5C7HA 4UTUA 4MJ4A 1TV4A 5T9CE 3PTDA 3VABA 1WXYA 3R2GA 1MYRA 4YCPA 1E40A 3A21A 1DXFA 1GNXA 2QULA 3IWPA 4ZO7A 3RO8A 1ECQA 1GPFA 4ZXLA 1RVGA 3LHWA 2XSBA 3WSUA 3D47A 3S46A 4JL2A 1X97A 3KRZA 3OZYA 3F2BA 3GZ3A 1JFHA 1UJPA 4ZO8A 4DM2A 3E5BA 1CYGA 3EDJA 5HAOA 1Q13A 4JTKA 4AXKA 1QRQA 4B5NA 1FP9A 1GYNA 2OT0A 4D6CA 1OHLA 3HQPA 4LVDA 4GKTA 2VEMA 3ISIX 3LCLA 3BURA 4HOWA 3QC3A 2WZEA 4CCCA 3LLDA 1G94A 4UMAA 4P7OA 3W2NA 3IRDA 1MQPA 4IPIA 5HBFA 3DX5A 4ADUA 4CQ8A 1RA0A 1FRBA 4AC7C 1EO5A 2O7SA 3APTA 4YL2A 1E0VA 1KV8A 1SO6A 1LDCA 2I7GA 3UPBA 1QTWA 1IGSA 3GXFA 5EY5A 3L0GA 1QCWA 5HMDA 1C7SA 4MWAD 3G1VA 1XUUA 4V33A 3BCJA 1ENUA 2W67A 1PS9A 1Q8AA 2YX0A 1TO3A 4A22A 1OYBA 4U28A 4M0XA 3VNMA 5IBXC 3KOYA 4PEEA 3B9AA 3HOJA 4GIRA 1YEYA 5J5DA 1TIWA 4HN4A 3W7OA 4AY1A 1EZWA 1L8NA 2ZTJA 4AZ7A 2R91A 2PDPA 3LHTA 4L80A 1R87A 1UBSA 4Q7NA 2X0HA 1QW8A 4MZ1A 1SFJA 2YDQA 4LW7A 3N4FA 1M7PA 4D6DA 3GXPA 1TUXA 1XUZA 3GUWA 3ZYZA 5CKSA 1B9BA 1Q63A 1BAGA 2BY2A 1OX4B 1H60A 3FY1A 3EWXA 1JAEA 1J5TA 3GHUA 1JZ4A 4GD0A 3WUFA 3ZT7A 4B5UA 1ZPTA 1UWIA 3T55A 1POKA 1HO4A 1KFEA 1B54A 1W17A 4PMRA 4XBKA 1PXGA 3A22A 3PZNA 5A6KA 1OM0A 1S3TC 3WZ0E 2Z2AA 1JXJA 2HQAA 3K8LA 4BS0A 4TR9A 3WLKX 3UEQA 5F2LA 1FWRA 4C1KA 4TVUA 1V3JA 2HRWA 3W38A 3WDJA 3P6LA 2WQDA 1O5RA 4JTDA 1O68A 3LSCA 2E28A 1ZY9A 4V1YA 2PWGA 4GHRA 1GG1A 3ZLHA 1VRDA 4HPJA 4MPQA 3HQ1A 4J35A 4TX6A 5D05A 3SRFA 1ZQ5A 2FVMA 4C65A 5JXQA 2QUNA 2GYIA 3QY6A 4FNQA 3W28A 3MS8A 3AIWA 3VUSA 1RJPA 3PJXA 2VUNA 4Q8VA 2XN0A 1R85A 1H2JA 1A5KC 3GFXA 3CGTA 1FFRA 1BVZA 2XM2A 3HFYA 3MDUA 2CLEA 1JULA 4DZIA 1V79A 1F74A 3KXQA 1Q6DA 3V1HA 3FN9A 4K36A 2CERA 5DBTA 1XIMA 1ITXA 3VD7A 2ISWA 1R47A 2PB1A 1OK4A 2Q02A 1PB0A 3C3NA 3VIMA 4XVDA 3KFTA 3STFA 4EACA 3W82A 1GKQA 1FQ0A 3MDWA 3R5EA 4UTFA 5C9WA 1ZCOA 3SGUA 5I03A 3CAQA 3PG9A 2KAUC 1DWAM 3A4XA 4U33A 3ARZA 4AXNA 4C6BA 1UZDA 5FEWA 1AFSA 4XISA 3T2PA 2BXZA 2J62A 3URQA 1TWDA 4CVUA 2PZ0A 2E1DA 5LXXA 1A5SA 3U8GA 5HMFA 3GBEA 3QSRA 3DEQA 4I9MA 5K4ZA 1E6PA 3EWWA 3IVSA 2PDUA 4L6HA 2WVTA 2XN2A 5CGMA 3VIFA 1D9EA 3L5MA 3QZEA 2Q8LA 1K6AA 2INEA 5CSRA 3CPRA 1IT7A 1KXHA 4H6KA 3AWNA 4IMAA 3ZM8A 1NQKA 3U9IA 5IBXA 2OO6A 3UG5A 3DG3A 4CD8A 4AVFA 2GVEA 4N7QA 2HEJA 1GQJA 3B97A 3VIJA 1RJRA 1MDLA 3VKCA 4B3LA 3DBPA 2A85A 1RALA 4LUTB 3DFYA 4XAFA 3PUOA 2R1LA 1BF2A 3GVWA 3CHDA 4HCDA 2VDGA 3UZZA 2NQ9A 3ANUA 2I17A 3VM7A 3VX0A 1UWSA 5C0QA 1E0UA 4UOZA 1W3TA 1VH7A 2Y89A 3S1XA 2GGIA 2PEVA 5I7GA 4HA0A 2UV8G 4CU8A 4JX4A 2B31A 1KV5A 1GOWA 1UKTA 3KS6A 1XYFA 3EKLA 1OD8A 3VINA 1YIXA 3QXBA 1LJYA 1VFUA 4TUFA 3DKLA 2RKXA 6PTDA 4GH3A 3SDOA 3WJZA 1A5NC 3AS0A 2Z1BA 3FXYA 1J0HA 3W7PA 1DHKA 1DTNA 1OD0A 5LA2A 2PCQA 4IMFA 4IJBA 2C14A 4R7OA 1JEZA 3WJXA 1AVAA 4D6EA 1B3XA 3L4UA 3A6OA 4J3WA 1U1JA 1QT1A 3M0XA 2VYOA 1K8XA 4DBSA 3CUZA 4U5IA 4YCOA 3BARA 3CV1A 3P61A 1KBBA 2PWEA 3LRKA 3G1FA 3CPUA 3IJLA 2ZRXA 1FOBA 3HU7A 3ZT5A 1EP2A 1VFOA 3E2SA 1QFEA 5LKYA 2UBPC 1VCVA 4Q4OA 3PG8A 2B0MA 2BS9A 4S3DA 1QPRA 4QLKA 1C91A 3KAOA 5GQBA 3HGRA 4YHGA 2JKEA 4A6GA 5A2BA 4RLIA 1KLZA 4ZVJA 5F4WA 2O9OA 3IEBA 2FFCA 3PSVA 3OA5A 3HA1A 2Q71A 3BLIA 4NI3A 1Y5WA 2Z6IA 2F7FA 4JIPA 1S5NA 3QW3A 3TOYA 1X8CA 1ZGDA 1JCJA 4RDVA 5JBFA 1VS1A 1EC9A 3PN8A 4WIWA 3C0QA 2BDQA 2V2DA 3ES8A 3BGAA 1A4LA 1EEXA 1EJXC 4FR6A 3HB9A 5L9FA 4LUIA 2RAGA 1O94A 4PSPA 1EJVC 3AQUA 2FHBA 4U3AA 2R1PA 3M5YA 2NZLA 1GUVA 3VMNA 1KQZA 4TU1A 5BRBA 1A0EA 1ZBVA 4B4FA 2AQVA 1XBZA 2DVTA 3ZVHA 1US0A 3GB6A 1JPHA 4C5YA 2VFGA 3KOZA 4WKAA 3DUGA 1DKWA 3BMXA 3V0UA 1YDVA 2ZUVA 4UWMA 3BW4A 3W83A 4M19A 5KITA 2BVDA 2CWXA 2VCCA 3L68A 3FJLA 1KM3A 1E4LA 4OKDA 4MVAA 1MFUA 3AHTA 1JJKA 3AO0A 5KSWA 1NP0A 3W3OA 3U4AA 3N11A 2WZHA 4Y9PA 3R58A 1KWKA 3G1SA 2QCHA 4IMEA 1VJZA 1PVNA 4NY2A 4RE4A 5FF2A 2QNEA 1WDWA 4XG1A 3K4DA 1EF3A 4CN4A 5I5RA 1CEOA 1H09A 5DELA 1XX1A 3MKVA 1MUWA 3P93A 3W7KA 4IWWA 1L6FA 1GCYA 3QW4B 1R2RA 4O0QA 1DJIA 3HO8A 3BQ6A 2XIJA 1YBQA 3QEZA 1L6WA 4XD5A 1FCBA 4REQB 4FB7A 3FDGA 3RRXA 4GJ1A 3WDPP 5AYXA 4IG2A 5G1YA 4EF9A 3XINA 4QQUA 3NQ8A 3UR8A 2VX5A 3AHXA 4U2YA 4NNBA 3TZFA 5HINA 2PTYA 1CECA 4XWUA 2QCLA 1A5AA 4UCFA 4I5RA 3CHEA 3CV7A 2WHMA 1T40A 5D2WA 1YX1A 1X1NA 4J27A 3S42A 4FIQA 3GLCA 4IMCA 3CNYA 4L64A 3EPNA 1CB2A 2Y7EA 2OEJA 2DVXA 1G69A 2CESA 3P3BA 4FOJA 5EMJA 2HZGA 1REQB 3WBWA 3WH8A 2W79A 5AY7A 2GGEA 3KE0A 3S2LA 4DI9A 1MQQA 4UUIA 4HPHA 5BOOA 4OBSA 3R0DA 4QG6A 5ABEA 3N2TA 2DUZA 2G50A 3CK5A 5I3DA 5BMXA 3RCMA 1JDAA 4DJDA 3T0CA 5AC6A 4KIEA 2PWVA 3OPSA 1TJRA 3GNRA 4HCHA 3WNNA 3HQNA 2CHOA 4NP7A 4HZ8A 4LB4A 1XRFA 2YXXA 1IEQA 3VNLA 3K1GA 3UJFA 4GINA 3GZAA 3S1UA 2VJXA 4KRTA 2JGQA 1L6SA 1TELA 3SCVA 3ITTA 4EPDC 3V0TA 1LORA 4HCLA 4PMZA 5G4WA 5AB3A 5IHSA 1KFBA 2PDQA 3H2NA 4P7RA 1T8XA 1EJ7L 2Y88A 1Y0EA 2B7NA 1WYIA 3QGVA 2ISDA 1JNEA 1RY0A 2X1UA 1B57A 3DZ1A 3I3BA 2HNHA 1OT2A 3Q37A 4MWAC 3A9BA 3OG3A 1GW9A 3NSMA 2ZXBA 4P5UA 3F4CA 4JR5A 2G0WA 1ZFJA 3O0KA 1HKKA 1LLOA 2HV5A 2QS8A 1BSIA 3PUEA 2Y2WA 4DO4A 2YA2A 4LUSA 2E5BA 2DT2A 4WQ6A 4GE8A 2EG8A 1E4IA 4HNVA 1KBIA 3TXZA 3CH9A 3EDKA 3R94A 1SO3A 1S2WA 5IDZA 1NFBA 2IXVA 3SO7A 2WMGA 3CZEA 2NXHA 1HJXA 4HNNA 2R9RA 3ITLA 3V4BA 2E40A 6XIAA 3A12A 1TV3A 4GY7A 3TYBA 2NW0A 5I3JA 1R9ZA 1XLHA 2ON3A 3DECA 2MNRA 4H6EA 1M7JA 1PTDA 3FYOA 3NO1A 2BB0A 1DJZA 1H0IA 1TIMA 4JFUA 1JD7A 4ONVA 2QR6A 3URBA 5FJRA 3LCGA 3LV6A 1KGWA 2NXGA 1A80A 3COTA 2XJ7A 1KCKA 3HPFA 4IGSA 2QJIA 4M56A 3UPMA 3QKZA 4W8AA 1VD6A 4D72A 1WUFA 3OLIA 1TB3A 1XG4A 5E0CA 5REQA 3NQEA 4DJEC 4KIRA 3R25A 1PIFA 1A5MC 1E3ZA 2FIQA 4GY1A 1JD9A 4ML9A 1D3HA 4RZ5A 4P7LA 2UY4A 3MVTA 1H63A 3BLPX 1WKYA 2WPBA 3W7LA 1G9HA 1EBGA 2XVGA 2EG6A 1TTPA 1JUBA 4W9TA 3PTQA 1PCKA 3MV11 2OZ3A 1TTQA 1WA3A 2LLEA 3EX1A 3EMZA 4C6FA 2QHAA 3PTMA 1FWCC 3LUTA 4PL2A 3M0HA 1LWJA 4JICA 3AIBA 4UCGA 3AAMA 2E9LA 1BYCA 1OADA 1SU5A 4LAUA 1UG6A 1KW1A 2ZTKA 4NAFA 5AKQA 1AQ0A 4F4RA 3PUDA 3CHVA 4QDPA 1HKJA 2PWHA 3VGHA 3QLLA 3U7BA 3S2MA 2E9BA 4IGNA 1IXQA 2ZUUA 4QNEA 5LIUX 3AJ7A 1SR0A 3W87A 3BOFA 2QZRA 1OG6A 3PS7A 4AIUA 4HJWA 1BLIA 3W07A 2Q8XA 3D46A 4MUPA 2FH8A 1P0NA 3PZGA 2NV9A 2Z1SA 2O7QA 3A5VA 3UU0A 1H11A 2FZ8A 3WH7A 3IJ7A 4DO6A 4MSSA 2VURA 3IUDA 1Q65A 1YPFA 2YL6A 3WK0A 4IICA 4FNRA 4AYGA 3WH9A 4DF2A 3WLQA 5KINA 5M2FX 1PPIA 3BSMA 1UW9A 4J3SA 4NUWA 3QY7A 1HKWA 3M4HA 4S39A 4A3RA 2JK2A 2QDEA 2G3IA 5KMYA 3VKBA 3B3DA 2NUXA 1JZ2A 4J2MA 1SJCA 3GVVA 4LYKA 2YCEA 4JHOA 3V5CA 4ZA0A 5IM51 1D8CA 4DM1A 4UNLA 2JEQA 3RM4A 5AHFA 4X60A 5CPNA 1ME9A 2V63A 3P74A 3JVAA 4IPJA 4PMYA 3DFPA 1VGAA 1OFBA 4CD7A 1Q8JA 1JYXA 1VFLA 4W8BA 1CLXA 2C19A 1XLGA 4FLOA 3QRHA 4IG2B 4D2JA 4RE0A 2UY2A 3TYZA 2FTWA 3N9SA 3BLEA 1MRAA 1VEPA 1XYZA 5AZ0A 3M46A 2CZ5A 4C6OA 2D1ZA 4G1NA 3SW6A 1RH9A 4FEZA 1UHVA 1TSIA 3EPMA 2DVUA 3UWQA 1TA3A 4ZO6A 3L67A 4QISA 4PBGA 1LT8A 1Q2SA 2ALDA 3IJIA 4U31A 2DSUA 3LLXA 1OC5A 3NVTA 1J0ZA 3RGTA 4GXMA 3EEZA 3W25A 2DIEA 3N2CA 4JY9A 3VOGA 3VOCA 4EF8A 2WSQA 2R1MA 3QHOA 4DNMA 4F79A 4ZR8A 2Z29A 3RX4A 1ITCA 4LUTA 1F4AA 7TAAA 1MNZA 1A4MA 4WJXA 1J96A 3HJEA 2I5GA 3K8MA 3HMJG 2PDXA 2EF9A 2V6AA 8A3HA 3SFKA 4FAMA 1PKYA 4F3HA 3UZWA 1W3JA 3SIMA 3EOUA 4RUBA 1EJTC 1EJRC 2X1RA 5LGZA 3H7RA 3AROA 3FA4A 4PCSA 3H2EA 4FNSA 2VVSA 4U3CA 8CGTA 4S23A 3ONBA 4YTRA 3EKGA 1GKRA 2ACQA 4LS2A 1A5LC 4YXGA 5DT7A 1H7NA 3TQPA 2RDTA 4PB3A 2TSYA 3HBLA 3I7RA 3PZMA 2AKMA 4HNUA 3F5KA 3B04A 1UKQA 4GYFA 4EOUA 4P8UA 4LBRA 4M51A 1ZALA 2QQ6A 4L5ZA 4KEZA 1VCFA 4A3YA 3MUZ1 3MUXA 1VLIA 4JN6A 3L0NA 4DHGA 1ITQA 1SZEA 1KFLA 3N18A 3GXIA 4MB3A 4GI8A 2BY1A 3P84A 3SCOA 4LX4A 1UKOA 4Y8FA 2JKAA 3WUEA 5BYWA 3IGHX 3W6LA 1AH0A 3UBPC 3VCRA 4IFOA 1EEPA 4ADTA 3BXWA 3NVDA 4ACYA 2J75A 2DDXA 3AIEA 1DORA 3BW3A 3LSBA 2EQDA 1Q6RA 2VRKA 4O8RA 5FJOA 4NNAA 1LQAA 4ERAA 2QPSA 3DHUA 1N8FA 5FAJA 3OODA 1ZSXA 1P6WA 3R11A 4D6JA 3FCPA 3NWRA 3AXKA 1VQTA 1ZL1A 4GYKA 3M16A 1M6JA 4UTKA 4FZIA 1JI1A 1UPMB 2PF0A 3ES7A 4B5XA 4M3PA 1IXNA 4OWGA 3KL3A 3QR3A 4DLFA 1V6WA 4ML4A 3URAA 3AWOA 5E0KA 2QF8A 4H7VA 1ZB5A 1ZBKA 4YTUA 1HJWA 1V0NA 2OKOA 1PE1A 4GNJA 5AVHA 1QNPA 2DSKA 2B4GA 4R9XA 1JZ5A 4M82A 4J4KA 1P7TA 2XIOA 4PBFA 2AGKA 4D1IA 3ARWA 3FKRA 9CGTA 3ITXA 1RK5A 1XKJA 2PGWA 4HMNA 3EB2A 3F4DA 3CEPA 3QMSA 4GCAA 2WSRA 2A79A 4PB4A 3MO4A 3IRSA 1SMDA 5CEWA 4IMDA 1ISXA 5EMKA 1XYAA 3FK4A 3MANA 1S2VA 3VX1A 2ZX5A 3G3MA 4W93A 3GXMA 1V8EA 5LHFA 2VD8A 1P0BA 1XQLA 3L21A 4IUOA 5HNTA 3W1AA 1UP0A 2POTA 4YJ5A 5EMMA 1QI5A 3M5XA 2BHZA 2WMKA 4LANA 4ZMGA 1HUVA 1YBQB 2I56A 4LVAA 1V0KA 5KETA 1EB3A 3G2GA 1E1EA 5DCEA 1XKYA 1EUNA 1FWSA 3K4AA 3BG9A 2GPTA 2ZRVA 5HQLA 1ZBCA 1F07A 4K38A 2DZTA 3E49A 2HE8A 2OLAA 2IKGA 4UBPC 4L61A 1G1YA 1RZMA 1NSJA 3BH4A 4GZJA 2Y0FA 5D33A 2WO5A 2YR1A 4H9UA 4PUDA 1K3UA 1K8YA 3PZUA 1IYXA 4DYEA 3C2YA 1S39A 4AHPA 3MBFA 2IMRA 3I68A 4UMCA 1X96A 5XIMA 3GXDA 3L23A 1O4UA 4J7RA 2J25A 3NDYA 2XH7A 3N6QA 4LY4A 4I6KA 1NOFA 5CXPA 3UWWA 3CZ8A 2IPJA 1J0JA 1JI2A 3IAPA 1BYAA 2UY5A 1AH4A 1W1TA 2BXYA 1A3XA 3WMLA 1EQCA 3W26A 1W9VA 4K37A 4HNCA 1XDLA 1Z41A 4X2RA 5EBUA 2QV4A 4BEUA 3W84A 3C2EA 2PTDA 4FSAA 3SCTA 1K70A 3IIVA 2A4AA 3IANA 3FJNA 2XFFA 4LFYA 1HKMA 3PZIA 1OYCA 3PUGA 3AI0A 5CZKA 1TVNA 3TAOA 1KM2A 3QN3A 3N3TA 4MOZA 1F6YA 2X0YA 2VD9A 3VM5A 2Y62A 2OU4A 2YCLB 5HWJA 3N34A 5CPSA 5EKYA 3TC3A 2MUCA 1D8WA 1OT1A 1UWAA 5CLWA 3E2RA 4KFNA 4GVHA 4JIHA 4KRZA 1M9HA 1PBGA 1CGWA 4JIEA 4ZEPA 1JF6A 3SCRA 1SW0A 4JY8A 2GGHA 4ERIA 1NM9A 4DBWA 2FZNA 2J8FA 4KESA 5DMMA 2WVVA 2Z4GA 2C7FA 2GOKA 1KKOA 1VBRA 2PGEA 3BV7A 5F2GA 2BVTA 3KBJA 2O92A 4AYSA 3NQGA 4EAMA 5IFPA 5T26A 1HO1A 4GK8A 1XYBA 2YLAA 1HP5A 2J8GA 2YB4A 4IFKA 2A3LA 2VMFA 1UQZA 4IZGA 5TBOA 1DVJA 1GPWA 2YA1A 4YYFA 3G3DA 3BE7A 4Z2GA 2IQ0A 3O2LA 1XW8A 1E9IA 5E9XA 3RX3A 4E3TA 4ICCX 3NGFA 4HNLA 1BQGA 4H19A 3BMVA 1AW1A 2VL4A 3SY1A 5C2GA 4FO4A 3AISA 1NWTA 2G5WA 4HSNA 3FIGA 3LPGA 2VZUA 2D0FA 3GTFA 1AUSL 5LIYX 3TJXA 4GI4A 4RXFA 3KRUA 3TA6A 1JDCA 3GFZA 2BY0A 3G8EA 4JFVA 2Y5SA 3W75A 6XIMA 2W27A 4AD0A 2E6DA 1UD5A 1W1PA 1UKSA 4M81A 4YVVA 4NQ1A 2ZZ2A 2FMOA 1EWEA 4QE5A 1I9CB 1LUCA 1TUFA 5FACA 3WJWA 4BF7A 4AFYA 3FYPA 1XG3A 1ZHAA 4PSRA 3WMSA 3KBMA 2HPMA 3CHCA 2GUUA 3VGFA 1LBLA 1HX0A 2PCEA 3C8FA 3BG5A 3TLQA 2JKPA 1Z3NA 5ABFA 4RXGA 1PDZA 1CLVA 1QWGA 4CCZA 4KWUA 3QOKA 1BGGA 2PLJA 2GSEA 3I4KA 2WC7A 4H2CA 3GU1A 3QF0A 2WNNA 4DJFC 2QUTA 5H8MA 3MI3A 4UR7A 1W54A 4HPXA 1KA9F 2VEPA 4DJFA 3R13A 5HJYA 3DG7A 1K8CA 1JZ8A 2PLCA 1W5PA 1A3WA 3GXNA 4W7UA 4G6CA 1KWGA 4XD4A 1KM6A 1ODUA 2P10A 4A8RA 5CSYA 5C2CA 1GHSA 4BI7A 1UC5A 3LQLA 4AD3A 2PD9A 3CZLA 3KHDA 3ARVA 3VDGA 6TIMA 4D1JA 1RQHA 2ZCGA 1NDVA 3DFNA 3TKFA 2C1HA 3FEMA 4CD6A 1ADOA 4EXAA 4AD4A 2QPUA 4CQCA 3I4EA 4NL1A 2QJNA 3W7JA 3RUBL 3BDKA 2VM8A 3CZJA 3CYVA 1WV2A 1KBJA 1E9ZB 2PDLA 1PUDA 1JGIA 1ZUAX 2GJXB 2J7CA 2CKSA 4LCRA 4HZ7A 6ALDA 3TJ4A 1W3IA 5DY3A 5CGTA 1P5BA 5JU6A 4MZ8A 4KS0A 3D3FA 2PWFA 1WKFA 2QCGA 4CU6A 1F61A 5EA9A 4I7WA 1P43A 1L2UA 4UR9A 2NSXA 1WDDA 5SWUA 4NI8A 4DLMA 3VI2A 3RITA 3ARYA 2W91A 2JIEA 3A4WA 4YIWA 1LOQA 3GKFA 3W6YA 3A47A 5D03A 1O6IA 1VFTA 3P0XA 4YVPA 3WD2A 5BRQA 2DJLA 3B0XA 1GQIA 1NVMA 2FLIA 4GO8A 3TSBA 1CNVA 1US3A 3O3RA 3BMWA 1QU4A 2E5DA 1A0DA 2MANA 1UOZA 5CSUA 2G4FA 3MU7A 1HT6A 1H3GA 3K46A 3EMQA 3MCOA 4RNJA 3B05A 6REQB 1IR2A 4J3XA