5E93A

Crystal structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with neq0071
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploring Trypanosoma cruzi Dihydroorotate Dehydrogenase Active Site Plasticity for the Discovery of Potent and Selective Inhibitors with Trypanocidal Activity
rcsb
source organism Trypanosoma cruzi strain cl brener
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
total genus 110
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2015-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 5e93A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5e93A01
3FA5A 4Y90A 5FF2A 1TV8A 1MSSA 1FCUA 1QMLA 4UNKA 2WKJA 4I7WA 4TMCA 5D2TA 3NQMA 3S9YA 1GG0A 3W7LA 2ISWA 4Q33A 4O10A 1FWWA 4X9SA 5E0KA 2G96A 3O8AA 4N9BA 1LRQA 1YADA 4RLIA 2E09A 3QQ1A 1YDVA 1XDMA 3SR7A 4O0ZA 4H6KA 3TCEA 5I3GA 1KV8A 2DU2A 2V82A 4EWND 2YPIA 1UB3A 2GVJA 3NR0A 4GC4A 2FB2A 3T55A 5C5YA 5FEXA 3U6WA 3JR2A 4ZL1A 4TIMA 2NX1A 4LUIA 3C2FA 4AEOA 1FDZA 1Z41A 2ZRZA 1GZGA 4WJEA 3BGJA 1GVFA 3GNDA 2NX9A 3QMSA 3HG5A 4U4MA 4UTKA 3CIXA 4N4QA 3MO7A 4DEFA 1ZALA 3KOFA 1TTPA 2DJXA 3TKFA 4JY9A 1ME9A 1W1ZA 3G1AA 3PAJA 3VE7A 1FBAA 1KW1A 3DAQA 1NFBA 2JKPA 4NJHA 1OFDA 3NG3A 1KFJA 1NF0A 4YLWA 1B3OA 1IXNA 3N9SA 1H7RA 1WBHA 4HNVA 5K4ZA 1CI1A 1QPNA 1UJPA 3A22A 4XQ6A 3PC0A 1B57A 2QCNA 3RF9A 3TJLA 2E6YA 4UFMA 3MYPA 4JX6A 3NPUA 1GJPA 3S5OA 3W1XA 1HUVA 3HGSA 1IIHA 3W1LA 1EEPA 4O1CA 4S2CA 2VELA 1LOLA 4XTIA 4GUGA 5KZMA 1GTHA 4JXCA 2H8XA 2CZFA 1L6YA 3NXFA 3UPBA 1FCQA 4JY8A 1OFRA 4UTUA 4O8RA 1H7XA 2W79A 3QW4B 3E96A 3RU6A 3NQDA 3G1XA 4Y8FA 2NXHA 3LXCA 1XM3A 3BVJA 5BOOA 1KBIA 3NQ2A 1RZMA 3HPZA 2OJPA 3R2GA 1Q6LA 1VCVA 4MUZA 1P1XA 1K8ZA 3PBYA 3UY7A 1LRNA 2OT0A 4GWEA 1EIXA 1J4EA 1ZCOA 3DFOA 4CQ8A 3L9CA 2WJZA 1G6CA 4MZYA 2ZYFA 3MI2A 2VENA 4IMGA 4LNYA 3OG3A 3S1WA 5D37A 1K02A 1XBVA 4U28A 3LHTA 2NUXA 1K8YA 4BFAA 1WOBA 3P61A 3LI0A 1RD5A 3DU0A 1ONRA 3A23A 1F05A 1B4KA 4GXMA 2GQ8A 1LBMA 3P62A 3M6YA 2PCQA 3W7MA 4IXHA 5EPDA 4UTLA 1G7UA 3PG9A 5F4XA 3KAOA 3MP3A 3WJYA 3SECA 3PBVA 3QQ0A 2RDUA 1WV2A 3GDLA 1O5KA 4MYXA 3N2XA 3MJYA 3W7JA 3HG4A 1TJRA 1BWKA 1M5WA 1VLIA 3LHYA 5DBUA 2BWGA 1RV8A 3M43A 4KFNA 3O6DA 1JCXA 1KV5A 5KTLA 4O4WA 3O15A 3NQGA 1H7NA 1TREA 2YFNA 1A53A 3MBFA 1YXYA 1WAUA 3GDMA 3Q58A 4JYFA 4WXZA 3S5YA 3HQ1A 4IMDA 3C3NA 1K7FA 4ORIA 4EF8A 4DXVA 3LRMA 3L5AA 1L2UA 2A85A 4CCEA 3FEMA 1SU5A 5EBUA 4RXGA 4UCGA 2CW6A 3B05A 1OX5A 1FQ0A 1ZAHA 5AHEA 3MBDA 3DKLA 3QPZA 1T8XA 3W22A 3ZWSA 3AJXA 1F6PA 2C13A 1H1YA 4RK8A 3A24A 3IGUA 2P1FA 5CPOA 2YW4A 1EWDA 2FB3A 2YZRA 3VE9A 3IIXA 5DELA 3TMLA 3W6YA 3GNNA 1ICSA 3QSTA 1LP6A 5SWUA 3HO8A 3W76A 4I7UA 1TV5A 4AWSA 1JQVA 3GDKA 4HKPA 3EX6A 1UCWA 3E49A 4HNNA 5FF4A 2QF7A 1KM0A 3QRHA 3M9YA 3BLEA 1JCNA 1K3UA 1E51A 1YDOA 3AO0A 4QQ3A 1ICPA 3LCLA 1P0KA 4CCDA 1W3IA 4XUGA 3L0GA 2ZQ0A 2ISSA 4JX5A 4OV9A 5IM51 4MY8A 1XCFA 4AVFA 3CIWA 3R12A 1MZHA 4BI5A 4M7SA 5K9XA 1RR2A 4Z08A 5LHEA 1YPIA 2YW3A 3UNDA 1VRDA 2A4AA 5AYYA 2CFFA 1GT8A 4UR7A 4FB7A 2ABBA 2WSYA 2BZNA 3HOJA 3DI0A 1TTJA 2FQIA 5F1VA 3W3OA 3MHFA 4O57A 2Q8ZA 2V2HA 4OQVA 4PCFA 4M7TA 1RQBA 1VH7A 1F76A 1XUZA 4NU7A 3UZJA 4OE7A 2CLEA 2Y7FA 3L5LA 1XKYA 5E93A 3C2OA 4Z1BA 4C1KA 1G69A 4UTWC 2QAPA 5HR6A 2Z6IA 2C18A 3TQ0A 3W73A 4FEZA 4W9TA 4Y96A 4AAJA 3GZ3A 3TW6A 3NL3A 3LBCA 2QCMA 3N14A 5BMWA 3ABSA 4O19A 5KSWA 4CNPA 5AHIA 1KFCA 5EL1A 3G22A 1BWLA 3HGOA 3WFAA 2E68A 3I65A 3IV3A 1LZOA 4MY9A 2E5DA 2W6RA 2GJNA 1THFD 3UY8A 2D73A 3BK0A 3NM3A 3H53A 3NNTA 3TH6A 3G0SA 1NSJA 4WX2A 3NA8A 2ABAA 4JTJA 1VYPX 3VNDA 2XN1A 4UMAA 2YYTA 3FJLA 2EGZA 1JUBA 3TSDA 3EWZA 5AN7A 3IRDA 1O95A 3IEBA 4UTTC 4GBUA 5F2LA 4AMAA 1SW0A 4PFMA 2PC4A 3HIJA 4QITA 4XTDA 2B7QA 2DZUA 2V30A 3SSJA 1UBSA 3GXNA 4GRSA 3INPA 2ZTJA 1IGSA 2FPTA 3W74A 1ME7A 5FF0A 2GQ9A 4GNJA 1EWEA 4JD4A 1Z48A 2J9XA 1FCVA 3P74A 1ADOA 3W2LA 3IVUA 1R2TA 4JTIA 3P5YA 3NYZA 3W07A 1JUEA 4CCCA 3BO9A 5DXYA 1R30A 3L2IA 4JTSA 3RLVA 2CLFA 1H63A 3TMQA 4FX7A 5D30A 2E6FA 4Z0SA 2NZLA 2A1YA 3NPXA 4FNTA 4ZQOA 1H50A 1LOQA 2QCFA 3N19B 1QWGA 5TBOA 2EHHA 3NQAA 5TIMA 3OA3A 1PIIA 1SR9A 3O06A 4GE8A 1HL2A 5HUOA 3TSMA 3N34A 1TPVA 3TXVA 2VFFA 2FDSA 4LT9A 4MLRA 3W7OA 5KMYA 2RFGA 1DHPA 1T96A 5CGQA 2B7NA 4LS2A 1FXQA 3FYPA 3KVKA 4ZQMA 4P2VA 2DZSA 3O6CA 3LCHA 2V2DA 2X1UA 3HPXA 3TJXA 3C2RA 2F7FA 3L65A 3HGJA 4Z0JA 3G1VA 3ABRA 5LNSA 4UFHA 1TQXA 3C56A 3QF0A 4IOTA 1WA3A 5DCBA 4JTEA 4TX9A 4N2YA 4RKAA 1H7PA 2PRMA 3LRLA 4IMCA 4NZJA 2JGQA 3GVGA 5CPMA 3W7KA 4BWLC 1RPXA 1PHWA 1V5XA 1XBZA 3S6DA 3Q94A 4MFDA 2TSYA 5DN1A 4P61A 2VFGA 3FLUA 4Z1AA 2JBMA 4WD0A 4EVZA 5H2ZA 3PUDA 1I2NA 3NGJA 4H4IA 1SW3A 2ATMA 2VEKA 3GLCA 3I68A 1GYNA 6ALDA 3KRUA 4R7JA 2C14A 2FPVA 3IIPA 3S8HA 4AHQA 3SI9A 1X6UA 3B8DA 4O18A 3W2UA 5D2YA 4ZQCA 3OEXA 5H91A 1SO3A 1YXDA 3R13A 4YWIA 5FF3A 4GUFA 1DORA 1GQNA 1BEUA 3T78A 3STGA 3ZFHA 5BW6A 4OBTA 1G4PA 3UPWA 1QNVA 1EB3A 4UTHA 2QCDB 4O16A 4A2RA 3TQVA 3WJWA 1GVRA 3ANYA 4DQWA 1A5BA 3HB9A 1ZNNA 4O54A 2VEMA 4PL1A 3WJSA 4ZZ9A 1MO0A 2Y85A 3W84A 3BV4A 1SQ7A 4E0CA 3P8JA 3JS3A 3BG9A 3PWAA 1UUMA 5BNKA 1L6WA 3UWYA 3P5ZA 4PODA 3CEPA 3WK2A 3LLDA 4MFEA 3BW3A 2O7SA 3GAKA 1FCBA 3CWNA 5DBTA 1W0MA 4XBSA 4PC8A 1TO3A 3W7EA 3UWWA 5CZJA 3GR8A 3GXPA 3B0UX 2R8WA 2R14A 2ZZ2A 1YTEA 4FHAA 3RLUA 3SIZA 1C9DA 1SW7A 5K9DA 1SUXA 3B04A 5BRBA 2QR6A 5EY5A 2B4GA 1P0NA 3QZEA 3UWQA 1H60A 1H61A 3BW4A 2E5CA 3SFKA 4WZHA 3M7WA 2QDGA 4RX0A 5HWMA 1LROA 3MHGA 4X22A 4MYAA 4A29A 2E6AA 4WUIA 1T99A 2Q8LA 1DL3A 2DP3A 2QDHA 2VEPA 4M6QA 4WOQA 4NJKA 4GUHA 1Y0EA 4IUOA 3PULA 4A2SA 5D05A 1NEYA 1AL7A 1PVNA 1CW2A 1MEIA 4M5PA 5J5RA 1PL9A 4UR8A 2R91A 1F7BA 2NXIA 3GR7A 2ZZ3A 4BK9A 1VJIA 2A6LA 5I3FA 3EKZA 2QUUA 4Q4KA 3NOEA 4O17A 3DFNA 4DF1A 2P0OA 2ZZ5A 3S1UA 1KLZA 3W87A 3NL5A 5F2IA 4DPPA 4K7VA 3UWZA 1YYAA 2OT1A 1IXPA 1W56A 1Q45A 4JIPA 4JICA 2O7QA 3TK7A 2DZPA 4FX6M 1JJKA 3M41A 3EX3A 5C54A 1PV8A 1TTIA 2Z1BA 2NV2A 3LXBA 3PSVA 3G1SA 2Y6ZA 1XBYA 2YYUA 1LBLA 3GDRA 2NXGA 5AOUA 3KHJA 1OF6A 3G3DA 2OCZA 3P81A 3P84A 4XWUA 1EUAA 4R53A 1VCGA 4M6PA 5LNWA 4N9CA 2V5LA 3LCFA 4S1FA 3UQNA 1YTKA 2Y63A 2X30A 1B9BA 3BLFA 3SY5A 3M1ZA 3GKFA 3L68A 3W75A 4JN6A 3I7SA 4KWVA 4UIOA 4NT0A 3UZ5A 3DXIA 1OHLA 4IPJA 2X1SA 2RH9A 2YSWA 1M6JA 3CB8A 5G4WA 1B4EA 4NX5A 2H90A 4GJ1A 2ZRXA 3OIXA 2WO5A 3NL6A 3S1VA 3SZ8A 5LKYA 2ZRVA 4FNRA 3NO5A 5L6UA 1SZEA 1KLYA 2A7RA 4HPJA 5G2HA 3E9AA 1WBJA 3DGRA 1TV7A 4QNWA 3ZWTA 4MZ8A 4NJJA 4JTGA 4LRTA 1TMHA 4RR4A 3A5VA 3QH2A 3QPYA 1IIGA 5DXXA 1JCLA 3EB2A 4GUJA 5LSMA 3HPSA 3CU2A 8TIMA 4UFKA 1QOQA 2J6XA 3M0ZA 2QKFA 1X1ZA 1JULA 1RQEA 2Y70A 4HSOA 4HNTA 2WPBA 1K7XA 4EOUA 1Q6RA 1GVQA 2VEIA 3MI6A 3W1QA 2UV8G 4PL2A 3PY2A 2H8ZA 3LM7A 2CU0A 3EWYA 1OG0A 3CT7A 3TAKA 3NQ6A 1I2OA 4IXXA 5DY2A 3W2JA 5HUPA 2QCLA 3DENA 4C1LA 2ZCGA 3NL2A 5J5DA 1OYCA 4D2JA 5AHFA 1TYGA 2G97A 1GEQA 4OGZA 4MJMA 5G2IA 3W7QA 4OT7A 4JYEA 4Y9AA 1SSDA 3B0PA 5FEWA 3TC6A 2ATSA 1KM3A 1VC4A 3G24A 2BX7A 1XC4A 3RMJA 3T7VA 4FNSA 3NZ1A 1AW1A 3SJ3A 4FXRA 2JK2A 3GAYA 3WK0A 4YL2A 1TCDA 1KM2A 4N4PA 3GB6A 2V5BA 4Z1DA 1V7YA 1W37A 3DFSA 4JYDA 4N9DA 4AF0B 2JKAA 1SFLA 3VCRA 3OVPA 3OVRA 5KINA 4LS0A 1W5QA 2NLIA 3ABOA 4UUIA 4RJEA 2ZBTA 4O1AA 3W71A 2YX0A 1P4CA 4JDBA 3KX6A 1ME8A 5CSRA 3HBLA 3S1XA 2C1HA 3TU9A 4AXKA 5I3KA 1TRIA 1TJPA 3QEZA 3EX2A 1TTQA 4XBKA 1OFOA 1W31A 6TIMA 3R8RA 4ONVA 1MXSA 1QCWA 3VI2A 3LGEA 2F84A 2B0MA 3LHVA 3CM4A 5HULA 5DY3A 2A21A 4FNQA 2ZZ1A 3TQKA 5U4NA 4QNEA 4RV8A 1EP3A 4AB4A 3TUUA 1WDWA 1C29A 1N7KA 1TRDA 1GOXA 5AHMA 3W7CA 5D32A 4JGDA 4Z1CA 3NVTA 4ZMGA 1TPFA 3WJZA 2DZVA 1NF7A 4FNUA 4FXSA 3U8GA 3DBPA 3W7HA 1SZNA 4QJ1A 5AC6A 2J9YA 4NUWA 1ZY9A 1QPRA 3WK1A 3FKKA 1FWRA 1DV7A 2J88A 1M7OA 1H51A 3A5FA 3UWUA 2PURA 1W3NA 5K4XA 2EKCA 4O1DA 1KFKA 3W1RA 3MMTA 3PUOA 1QPQA 3N3MA 5HNRA 1Q6OA 2OMAA 1P5BA 3BW2A 4JIQA 3W86A 2BSLA 3LI1A 4IGHA 3Q2DA 3M5YA 4NNAA 4XKYB 5CKSA 4LC8A 3K30A 2QCCA 4MVAA 1XFBA 2DORA 4O15A 3F03K 1OYBA 4TMBA 5HWNA 2CZEA 3GIYA 3W2KA 1LYXA 1QDSA 5D2WA 4WY0A 3LHUA 2YGYA 3STEA 2DZTA 2R94A 4A22A 4K8HA 1BTMA 1PCKA 2XN2A 3HG2A 2AAMA 1F74A 2VC6A 3ZR4A 4CNNA 3MUXA 1VPXA 4E38A 3I7RA 4LVBA 1D3GA 4M6VA 4A21A 1F5ZA 4O53A 3KXQA 2I1OA 3L21A 4PA8A 3P7YA 3CHVA 5AFDA 4LVDA 5C55A 1ZENA 4NJIA 4K36A 4FNPA 4JTUA 3EXTA 2Q3OA 2J9ZA 5HMSA 5CZTA 5GVJA 3CPRA 3C2EA 4IMEA 4IQLA 1VCFA 3LCGA 2Y7EA 4JDYA 1FWSA 1TPH1 3E0IA 4KWWA 1G4TA 4ORMA 1JCYA 4XZ9A 3MI3A 2RHGA 3PB2A 3C61A 1FWNA 2ZDRA 4N6FA 2CZ5A 2A7PA 2C15A 3W1MA 2Z6JA 3OBKA 3UXAA 4QIUA 1F73A 3G1YA 2ZZ6A 1OJXA 4MIMA 5AYXA 4UTWA 4KFPA 4GUIA 2RDWA 3M5ZA 2FPYA 2YFOA 1SZGA 3KFTA 2P10A 1CX9A 1QFEA 1JVNA 3E02A 3NQ7A 5AHNA 4AH7A 1KFBA 1FY6A 4O4VA 2WSQA 3HG3A 4OV4A 1IXOA 2V81A 5F2MA 1XL9A 1OFPA 5LNRA 3W1NA 2WSRA 2VFDA 4JX4A 4AF0A 5HR7A 3UD6A 2YXGA 1KFEA 3HMJG 1TPDA 4N9EA 3W1PA 3EXRA 1OFQA 3CTLA 2ZRWA 4O0KA 4AHOA 4PEKA 5D2XA 4S2BA 2RDTA 3EKLA 1SZFA 2GPTA 2BTMA 1TSIA 3FJ6A 5K2ZA 1S5VA 1H7WA 3B4UA 1VHNA 2Z2UA 4TU1A 5FESA 3NQ8A 5AC8A 3I6RA 1Z42A 2TRSA 2WOQA 5CSSA 2H6RA 2B7PA 2QUVA 3F4WA 1NAL1 3O63A 4ICNA 4YMZA 4HIBA 4RZ4A 3VFLA 4BR1A 1SSGA 4K39A 2NWRA 1W3TA 5G1YA 3CC1A 1G7VA 3FS2A 3G1FA 3G1DA 2HMCA 5EMUA 3SW6A 2WNZA 5KZEA 3W7PA 4BI7A 2FFCA 1DBTA 4G1KA 2ZRYA 4I9AA 3TX9A 1D3HA 3LTYA 2NUYA 3PM6A 1AK5A 3IIVA 2V2CA 1DQXA 2Q3RA 5F4SA 3QC3A 1QOPA 4QSHA 1MEWA 1OX4B 5MHBA 3C2VA 2YR1A 5TQLA 4RZ5A 4LRSA 2Y62A 2OZ0A 4DF2A 1O60A 1VLWA 3O05A 1W5OA 3MP4A 4X2RA 4DBEA 1IF2A 4QAIA 2OX1A 3A21A 2Y7GA 2H3DA 4ADSA 5T26A 3W2NA 3EX1A 2QCDA 4BI6A 1LORA 4JTTA 2X1RA 4OWGA 3BPWA 1N55A 3WK3A 1OFAA 5F1UA 5LHFA 3RFAA 1AMKA 3QMTA 2X2GA 1L9WA 4IPIA 5D2VA 1OFBA 3W2MA 4MY1A 2W0UA 3LV6A 3NQVA 1EPXA 3W9ZA 3B0VC 3G0UA 5DCEA 1HG3A 1R2SA 1I8JA 2HTMA 3OVQA 1M7PA 2CLOA 3FYOA 3NPVA 1A50A 4MLJA 3E12A 2Z0IA 5CPLA 3NM1A 4JR5A 2I14A 3L0NA 2KZHA 3ABQA 4MOZA 4O14A 3C6CA 4LV9A 4NQ1A 5F4WA 4LY8A 3FIGA 4PH6A 2QCGA 5D33A 2A5HA 3CEUA 2GOUA 2C3ZA 1IXQA 4OHQA 4E2DA 4NNCA 1ALDA 4BWLA 3QFEA 1WXJA 5D38A 3LV5A 2BXVA 4TR9A 2DJLA 3W7GA 4CQAA 1GYLA 3TFXA 4NNBA 1G67A 1W5NA 5A8GA 1QPOA 3STFA 3P60A 3PUEA 4LVFA 1HTIA 4NXKA 4K37A 1LRTA 1JR1A 2QCHA 3LBMA 4BF9A 1KTCA 3TDFA 3KVMA 2NUWA 2E5BA 2FLIA 1EP1A 3LTPA 3LXAA 4MKNA 3ZS4A 3TA6A 1S5TA 4O1BA 3TXZA 4HSNA 1W5MA 1TPB1 2QAFA 4CLMA 4UTMA 2ZA2A 3NQFA 3MWAA 2FIQA 2TYSA 4WY0B 2YCEA 5K3VA 3MW7A 3BG3A 3LB0A 3PBWA 3DFQA 3RNDA 3RK8A 2ZA3A 3H55A 3T44A 1VYRA 3NZRA 3GKAA 3P82A 2ZA1A 3G1HA 4NZFA 4YXGA 3HF3A 2TMDA 3NDOA 3TNOA 3TIMA 3KVLA 3VKJA 3NQEA 5IBXC 1SO4A 5ABTA 3TR2A 4DO6A 5G4EA 2JKEA 1LTDA 4I7VA 4ZQPA 4CNOA 1LBFA 2QJIA 1SO5A 3NAVA 3QM3A 3LCWA 4O52A 1PHQA 2Y88A 3JRKA 1AW5A 4MPQA 1PS9A 1X7FA 1I4NA 5K7JA 1YDNA 4HNUA 4AWUA 2EPHA 4AHPA 5L9FA 1OFEA 3W1UA 1KA9F 4ZQRA 1ICQA 3C8FA 1A5CA 4NXSA 3G8EA 3P80A 1FUYA 2E1DA 4FO4A 4QISA 4UNLA 4JS3A 4ADUA 2GVLA 4DBDA 4WY0F 3KRZA 1TQJA 1JCMP 4LTSA 1JRCA 1LDCA 3W7IA 4RCXA 5DLCA 3TFCA 1GPWA 2A2IA 3B06A 3DI1A 1TPWA 2V0TA 1R46A 3M47A 3O07A 3TV8A 2NV1A 5I3HA 1GWJA 1C8VA 1RQHA 2Y7DA 1FDJA 3V75A 1WX0A 5AC7A 3M5VA 1ZJIA 2Y89A 4FIQA 1G4EA 3GK0A 2GJLA 1OK4A 2QEZA 2A0NA 4ALDA 1SFJA 3BGGA 1J2WA 4O11A 3T40A 5LNVA 3W85A 2QJHA 1YXCA 3PG8A 1VGAA 3DFTA 3LX9A 5KITA 2GUUA 3L0KA 3IVTA 2E77A 1EX5A 2HS6A 1U5JA 3W83A 4LS1A 1JCJA 4ZQNA 4K38A 5I3IA 3KVJA 4B5NA 1VZWA 1ZAIA 4LW7A 4KFOA 4O50A 4N02A 3L5MA 4YCPA 1UUOA 2CLHA 2CWNA 2C16A 4RXFA 5G5IA 3R5EA 5FEPA 4WXYA 3PBUA 2PRHA 3USBA 3IGXA 2A6NA 3DZ1A 4JTHA 4LVAA 1WOAA 4LWWA 2A7NA 5KZDA 1EUNA 3H54A 4J9JA 5HJLA 3WJXA 3L66A 4FIRA 3W23A 1JUKA 1XBXA 3QSRA 1W8SA 2AGKA 3PB0A 5DCDA 1KBJA 1OYAA 3ATZA 2J27A 2QUTA 1DKWA 1N8FA 3TROA 3C4UA 1I45A 4O13A 2CLKA 4LV4A 5FF7A 3S42A 4FX8A 1X1OA 1QO2A 5A5WA 1W54A 4JTLA 3G18A 1I2PA 1LLWA 2HS8A 3IVSA 4E2BA 5E1QA 4IWWA 3LLFA 4LUJA 3HJZA 3STCA 2ISVA 3B03A 1FXPA 2ZZ4A 2QCEA 3S5ZA 2V8ZA 5AB3A 1J5TA 2EAWA 3LHWA 4HPXA 1KTNA 2CLIA 3PF3A 1ZAJA 1FDYA 4ADTA 3NPWA 1VYSX 5CZSA 2VKZG 5EKYA 4DO4A 4X3ZA 3BG5A 3LHZA 5EYWA 4DPQA 5IBXA 4K6AA 4O28A 4TO8A 5CZ0A 3LCXA 3V1PA 2H3BA 4L4LA 5G1TA 4PTNA 4POCA 1S3HA 2GVGA 3QMRA 5AHLA 2WNQA 3G0XA 4JTFA 4UXDA 1OX4A 4UFIA 2EF9A 2GQAA 2PRLA 4MZ1A 3EXSA 3P67A 2TPSA 3DHFA 3DFPA 1HO1A 4OU1A 3S0CA 3DH7A 3M44A 1XUUA 3G3MA 1X8FA 4LC6A 5AYZA 1RVGA 4K8EA 4Y6GA 3DHDA 1FWTA 1I2QA 1W5PA 3EWWA 4HHPA 3N2MA 4R34A 1TB3A 3TW7A 3CLMA 4FF7A 3R89A 1DJNA 3O16A 2CLLA 2RKXA 1VQTA 4IMFA 2XN0A 3UXDA 1UASA 4AWTA 3EX4A 4DF0A 1TPEA 4ML9A 5FEZA 1H7OA 2Y61A 3CWOX 3FKRA 1L6SA 3LCIA 1FX6A 1VR6A 2G95A 2I9EA 2X1TA 4IX0A 5HWJA 5D09A 1EA0A 1SPQA 4UFLA 5LZLA 3LRKA 1Q3NA 5C2XA 1ZFJA 4UTTA 1GG1A 3GDTA 3EEGA 1TPC1 1ZHAA 4R33A 4UTJA 2NX3A 3CQ0A 1DQWA 3C52A 1A5SA 3W7RA 4K7YA 2E6DA 5BMXA 4EF9A 1NVMA 1QR7A 2ZFAA 1AW2A 1LM1A 1TIMA 5CG7A 3TC7A 1I2RA 4H3DA 1MEHA 3N73A 4UC5A 1OVDA 4IX2A 1AL8A 3UWVA 4DO5A 1JRBA 1WYIA 4WQ6A 1AG1O 1D9EA 5LGXA 3O1NA 2DZWA 3GYEA 2ZZ7A 3PSWA 3BARA 2CZDA 2C6QA 3PR2A 2AQWA 2V9DA 4L4MA 3OHIA 3QYQA 2X16A 4M19A 3LDVA 1T0OA 4N6EA 2VFIA 2NWSA 5D04C 7TIMA 4GFSA 5CPNA 1JQXA 2PE4A 1K7EA 4HN4A 1KM4A 1OABA 3LTSA 2VXNA 1PCWA 4YCOA 1QAPA 4JTKA 3I7QA 3TSBA 4IJBA 1PE1A 4Q32A 1XDLA 5HINA 4LOCA 1HFBA 3W7NA 1GVSA 2B7OA 1KM6A 1O5XA 4MJZA 3ATYA 2WNNA 2ZRUA 1GTEA 1OX6A 4A3UA 3A9IA 4LU0A 3PVFA 3EWUA 2WV8A 3DKJA 1F2JA 4NX0A 1SO6A 3GXTA 1DJQA 3O6YX 1KFLA 1QO5A 4UTIA 3SGUA 2CLMA 3G8RA 5F2GA 5K9CA 3TE9A 4CQ9A 5EA9A 3W72A 1OK6A 4XKYA 3IGSA 3M16A 3LERA 1KM1A 3SGZA 2IQTA 2J24A 4DELA 1O4UA 3NEVA 2WQPA 2BLEA 3IIOA 1H1ZA 3KRSA 3N9RA 5I3JA 3MP5A 2ALDA 3MHUA 1A5AA 1GVOA 5HQEA 4JEQA 3GX9A 1H62A 1Z44A 1R2RA 3YPIA 3PS7A 4UMBA 1VHCA 2HSAA 1Q6QA 1LLZA 1XI3A 3W1AA 5D03A 4QM1A 5C6MA 4ZVJA 1S5WA 1KTBA 4LVGA 3W1TA 3QW3A 3THAA 3NQCA 2VOMA 3L67A 3HGRA 4JNMA 4UFJA 3Q37A 2VFHA 4EIVA 1H5YA 4KKXA 3S5NA 2FJKA 1LOSA 3T4CA 2ZTKA 3D0CA 1OF8A 1K8XA 2LLEA 3UYCA 1WQ5A 3EWBX 5LNUA 1DOSA 3P8IA 3BLIA 3QJAA 5U7SA 3U2OA 4UMCA 3F4NA 3C0JA 3W70A 1R47A 2YDAA 3F1QA 4NJGA 1O94A 2DZXA 3LOTA 2JGYA 2C19A 5G2WA 3W88A 2VFEA 2C0AA 3MYOA 2XFWA 3M5XA 3FFSA 3EWXA 1XXXA 1K03A 3TAOA 1YTDA 4NVTA 3W7DA 1BKSA 2G5WA 3IIZA 5D02A 1LCOA 4O12A 3FOKA 1ML1A 1U83A 1DVJA 2QJGA 1TPUA 1YPFA 1EP2A 2FTPA 1F6KA 4RZ6A 4HT3A 1KM5A 3ELFA 1G4SA 5LGZA 5FI8A 4WOZA 1HO4A 1VS1A 3THQA 1YLVA
chains in the Genus database with same CATH superfamily
3FA5A 4Y90A 4KCVA 1TV8A 1FWDC 1EJ7L 2ACRA 2PDQA 3MS8A 1FCUA 4UNKA 3QV9A 1VKFA 4MG4A 3URNA 4I7WA 4TMCA 5D2TA 3NQMA 2RAGA 2PDJA 1GG0A 1VEMA 2BVDA 4GYPA 4PUWA 2ISWA 3BLOA 4DXKA 1GJUA 4O10A 3O8AA 4N9BA 1XGDA 1HL9A 2QLYA 4ERIA 2NQLA 1YDVA 1XDMA 4TTGA 4GVHA 2NLYA 5I3GA 3VMOA 1U5VA 2J77A 3SCVA 3AJ7A 4XZMX 3GBDA 4EWND 4S3GA 1QVBA 2ZUVA 2GVJA 1NTHA 2FB2A 4REQA 1DIDA 3JR2A 4ZL1A 3C2FA 1FDZA 3T0AA 1Z41A 3DFHA 3SIMA 2DQXA 4PUDA 2FZ8A 3M0HA 4U4MA 1E9ZB 1OZMA 1R3WA 1US2A 4GQQA 1DJXA 1TTPA 2DJXA 1EJVC 4D71A 1W1ZA 4OECA 3G1AA 3RN6A 4F2BA 2V68A 3TN3A 4XZWA 2P50A 4FPSA 1UWQA 3GVWA 2G3JA 3NG3A 4ZEPA 5IDZA 3QVQA 2DIJA 4IPPA 3N9SA 2D20A 4K2SA 1Y65A 5A69A 2V3EA 1ELSA 1D3CA 1UJPA 1GGOA 1UWRA 5PTDA 2QCNA 3RF9A 3TJLA 3EPNA 4UFMA 3CT2A 5KETA 5BROA 4DRSA 1GJPA 2XGBA 3S5OA 1E5JA 3T0DA 4JCMA 3R6IA 3U4FA 1LF1A 1UA7A 1J96A 2VELA 2PWUA 2VEFA 1LOLA 4XTIA 5A6BA 4GUGA 3WCZA 4URIA 5E0CA 3UPBA 3LLXA 3PPCA 1N2VA 2WWDA 4O8RA 3WEMA 3RO8A 3RU6A 3UJRA 3W29A 3OBEA 4Y8FA 2EPMX 3LXCA 4WJXA 2A3HA 1Q6FA 4H7ZA 1WUEA 3BVJA 5A8NA 6A3HA 1RZMA 2DDXA 2HDJA 1G9HA 2VGFA 2OJPA 3TJIA 3MUAA 1VCVA 3PBYA 3KDNA 1AH4A 1XIEA 2C8NA 4J1OA 4CQ8A 1EGMA 3ARZA 4QX4A 4F4RA 4DJDC 3MI2A 2VENA 4AVNA 4IMGA 3S1WA 3ONBA 1VP5A 4NYYA 4M81A 4C6PA 3BCFA 1MNZA 1FRBA 1UD4A 3WNMA 1WOBA 3P61A 1ONRA 1E1FA 4F0RA 4JTRA 3S5SA 4O0QA 1LBMA 2IXVA 1QRQA 3WLSA 4UTLA 3PG9A 3ZT7A 1OWQA 3AIRA 1WV2A 4GC3A 4FA3A 2YJQA 4LH8A 1XG3A 3W7JA 1TJRA 4U3AA 1VLIA 4S3FA 1XP3A 2BWGA 2Y24A 1JCXA 3BZJA 1K8CA 1IEIA 1H7NA 3NZQA 1TREA 3GDMA 4WXZA 4YHGA 4GVGA 2CEQA 2VL4A 4E3TA 3L5AA 1FVPA 2A85A 3BSHA 3FEMA 3WLHA 3R58A 4RXGA 4UCGA 2CW6A 5AHEA 1ZAHA 2HPIA 4JZ5A 3MBDA 3SQSA 3QPZA 1OSEA 1XF0A 3ZWSA 1H1YA 3HN3A 2BOGX 3VIJA 2P1FA 2QZRA 2YZRA 1LL6A 5DELA 3M7SA 3GNNA 1ICSA 3QSTA 1LP6A 4U5IA 3W76A 3W25A 2F2HA 1UCWA 4BS0A 4HNNA 3QR1A 3U2ZA 3MZNA 3QRHA 3M9YA 1JCNA 3ABXA 1BSLA 3AO0A 4QQ3A 1P0KA 4DWDA 4XUGA 3VGDA 4GX9A 1VD6A 3L0GA 2ISSA 3CL7A 2QPUA 3GBEA 5IM51 1XCFA 4AVFA 3CIWA 3R12A 1CB7B 1V8EA 4M7SA 2GK1A 3AAMA 1RR2A 1V02E 3I4EA 1WO2A 1HF6A 3UNDA 1UD6A 4LAKA 2VDIA 1MFUA 2I5QA 3HOJA 1E0UA 3CZJA 3IRSA 1QASA 3W3OA 2BNJA 3IV8A 4O57A 2VX7A 1KXQA 3L5LA 1XKYA 4J3VA 4DIAA 1W3JA 2JIEA 4PUJA 1G69A 4PMOA 4JL2A 1Z69A 3TQ0A 2CZVA 5XINA 4H2HA 3LBCA 2IXUA 2QCMA 1E1CA 1ZU8A 4CQCA 3ABSA 1XSIA 3EMCA 2W67A 1W3KA 5EL1A 3AUJA 4K1WA 4M24A 3N4AA 2BV9A 1PIFA 3P3BA 3H4WA 1JD7A 3CZLA 4AEEA 4HTBA 4YWSA 2G50A 3I65A 1LZOA 3K4AA 4GYFA 1A49A 4GI9A 4JNZA 4L65A 3GIQA 4XD3A 3WDQA 3H53A 4PB5A 3TH6A 1Q2SA 5GNYA 3NA8A 1OCNA 1WNOA 5T8GA 1VYPX 2P76A 2YYTA 3F5LA 2X0HA 3TSDA 3P93A 4UTTC 3ANVA 5F2LA 4AMAA 2Z24A 3UCDA 4M29A 4PMYA 1RCOB 1TMQA 1XH0A 4IT1A 4KEVA 4GRSA 2ZTJA 1BXBA 1ME7A 5FF0A 2GQ9A 3C86A 5C0QA 1PZ1A 1RCXB 4QDWA 4JD4A 2J9XA 2DSUA 1FCVA 3P74A 1ADOA 4ZOEA 1R2TA 4XZNX 4IF2A 3NYZA 1FWFC 3W07A 2V38A 4DY1A 1ESWA 4XZBA 2OLSA 3VINA 4BCEA 4XAYA 2CLFA 2XGZA 4UQCA 5KEZA 3TMQA 2WCAA 1F8MA 1P6BA 4GIEA 3LK6A 4Z0SA 2A1YA 3NPXA 4ZQOA 3RYSA 1H50A 2QCFA 3N19B 5TBOA 7A3HA 3MZ2A 3NQAA 5TIMA 4H6EA 1GOIA 3T81A 4GE8A 1HL2A 3VPLA 1TPVA 3TXVA 2WJFA 3GU1A 4GABA 2L5HA 3N6JA 5KMYA 1T96A 2VGGA 2B7NA 3QFWA 2UY5A 1HQTA 4YTUA 3CPGA 3O6CA 3LCHA 3GXIA 3C2RA 2F7FA 3HGJA 4Z0JA 3G1VA 5LNSA 3DGBA 3QF0A 1ADDA 2YZ5A 4JTEA 1SFSA 4ILSA 2PRMA 4ZB2A 2INZA 5CZKA 5CPMA 4RPPA 3W7KA 4YPJA 3SCTA 2HK0A 1HKVA 2CESA 4EXAA 3S83A 4LXFA 3W01A 3Q94A 3M0IA 4UZSA 4DJDA 2ZE3A 2VFGA 3GNPA 1YNYA 4WD0A 2F6UA 1TKKA 3NGJA 4CD7A 4LX4A 2O4QA 2FH8A 2ATMA 4P5UA 3GLCA 6ALDA 5A1AA 3IIPA 1XS2A 1XKJA 3SI9A 5D2YA 3DG6A 3FGCA 1YXDA 1S5MA 3R13A 2NQ5A 1XLEA 1FKXA 4PCNA 1NOWA 1TJ2A 3PFRA 2P5NA 2PGEA 5BW6A 2QGHA 1Q65A 1W1A1 1EB3A 3RXZA 1SJDA 4UTHA 3TYDA 3TQVA 1EC9A 1GVRA 4DQWA 1W3LA 5M5DA 2VEMA 3WJSA 4J2PA 1DTNA 2OPJA 3JS3A 3PWAA 5BNKA 2VC7A 1I75A 1AODA 4W4QA 1Z9AA 3BW3A 3V18A 4WR3A 1ONEA 1W0MA 1W17A 3UWWA 2GUBA 1HKMA 2GWGA 4V27A 4HCLA 2R8WA 1DP0A 1ODZA 2R14A 4DJEC 5LIXX 5HPOA 1UMLA 1SW7A 5K9DA 3S46A 9XIAA 2HZGA 1SUXA 3BLDA 1M53A 3C0LA 4PB3A 5EY5A 1DWGM 3LNMA 3BCJA 5BU6A 1XLBA 1SYTA 2QDGA 3S9IA 4X22A 3GC5A 4WUIA 1DL3A 1FHDA 2IMRA 7CGTA 3URBA 3B9NA 7XIMA 1Y0EA 1DWHM 4IUOA 3ITTA 4BZYA 1MEIA 1EYEA 3VZZA 5I6SA 3SUUA 2R91A 3VD3A 2NXIA 3GR7A 5A6BD 1VJIA 3SCRA 4Q8QA 3DFNA 3U7BA 1CXFA 2PBGA 2P0OA 2ZZ5A 1ISZA 3S1UA 3B8VA 2PDGA 2BVTA 5FSEC 3NL5A 4WDUA 3AS2A 3MT1A 3UWZA 4LNCA 3S2JA 3H2CA 1W56A 5D9PA 4JICA 2DZPA 4FX6M 4LF2A 4WDWA 1JJKA 1F3XA 1P0EA 5C54A 5DEZA 2NV2A 4KCWA 2XHYA 4L4OA 2Y6ZA 1XBYA 3THUA 1YEYA 5AOUA 1OF6A 4JQ1A 2IPFA 1UWTA 3G3DA 4RE3A 1V79A 2OCZA 4ZCWA 2POTA 1VCGA 3UQNA 2Y63A 5HANA 3JW7A 1GONA 4QHRA 4K8GA 3I7SA 3WF1A 3CS2A 4H9ZA 2INFA 5C2GA 4Y8EA 4Z1YA 1M6JA 4CD4A 5G4WA 3NO1A 4Y2WA 4NX5A 2H90A 5I5RA 5LKYA 2PP0A 5A8MA 5L6UA 3HV8A 2D0HA 1UMYA 1OD0A 4IIBA 4PUKA 1RBOB 4HPJA 1V93A 5LIKX 4NJJA 4JTGA 1GCYA 4W8LA 1PZ0A 3FXGA 4GMEA 1JCLA 3EB2A 3MUCA 1CXHA 7PTDA 5LSMA 2WVTA 1VFSA 4UFKA 4MPKA 4M0XA 1HIZA 1QOQA 2J6XA 2QKFA 1Y8BA 1JULA 3UA3A 3QHNA 1K7XA 4EOUA 1XIIA 2JE8A 3MI6A 3W1QA 2UV8G 1GW9A 1J6PA 3R4IA 1P48A 3CT7A 1OY0A 1I2OA 5HUPA 3UERA 5JBFA 4C1LA 1MW0A 1UP3A 1OYCA 5AHFA 4OGZA 5LYRA 4C7GA 4ZSTA 3LD5A 5BXPA 4WIWA 1UD8A 5FEWA 2ATSA 1DEDA 1DJZA 3J7HA 4JQAA 4RV3A 1VC4A 4JTAA 3WMBA 3G24A 3CV1A 3WFLA 4Q7IA 5A6AA 2R1NA 2HVOA 1US0A 2YXOA 1SVDA 4LUTA 3WK0A 4U2YA 4QG6A 4W89A 1V7YA 5E6YA 3LG3A 4N9DA 3LENA 1UC5A 2EPKX 2JKAA 2XVKA 3ITGA 1A0DA 4PBEA 1E9LA 4QGCA 3URQA 2HPMA 3CHCA 4O1AA 3FJ4A 1S2CA 2BDQA 3THCA 4PRTA 3S1XA 4FI4A 3TU9A 3CL8A 4AXKA 2W3ZA 1RXOB 4LYRA 3QEZA 4LY4A 3VDGA 1TTQA 5I7GA 1OFOA 1W31A 6TIMA 4Q4PA 1MRQA 3BOFA 1VB9A 4H6QA 2F84A 2B0MA 5HULA 9RUBA 4BHYA 2HCVA 2VR5A 2J4GA 2DUXA 4RV8A 1EP3A 2GSJA 3TOPA 1GKPA 2ZX6A 3CZKA 1N7KA 1TRDA 2FZBA 4JQ2A 2W5FA 4P7OA 2Z7GA 4QEHA 3F2DA 4EPBC 1Q7QA 3WJZA 1EQCA 4QBXA 2QGYA 3BZGA 3WDRA 5F7UA 3DBPA 2XFRA 1JAEA 1AVAA 3AXXA 3VNYA 3G5EA 5D9OA 3FKKA 1FWRA 5H6HA 1M7OA 1VBJA 3UWUA 1W3NA 3BJFA 2EKCA 4O1DA 2XWDA 4IQJA 4NG3A 1XIDA 3PUOA 1OC7A 3N3MA 4XB3A 3VDCA 3Q2DA 4EX4A 3K4DA 4XKYB 3K30A 2QCCA 4MVAA 4L56A 1QDSA 3CYJA 1Y5XA 3CTTA 3STEA 2DZTA 2NSXA 4A22A 3NSNA 3E38A 1F74A 4CNNA 3UZYA 1WZMA 1XLKA 1VPXA 2WCSA 4M6VA 1LQ2A 3HJEA 3E0LA 1S2AA 1B3VA 1V3KA 1X38A 3QGAC 2YA1A 3CHVA 1CCWB 1ZENA 3EXTA 2J9ZA 3WUEA 3SADA 1EDQA 5CZTA 3TTQA 1E6PA 3QY8A 1OINA 3FK4A 1JYXA 2BY0A 1TPH1 3W4RA 2J78A 5CC5A 3C61A 2CZ5A 4PCTA 3W1MA 1E15A 1J10A 4ZOAA 3G1YA 1NDZA 2ZZ6A 5AYXA 4UTWA 4BQ4A 2FPYA 3H2NA 2VT0A 3DOPA 3KFTA 2C1GA 2WHLA 1V3MA 2VUNA 1QFEA 4HMNA 5AHNA 2I56A 4O4VA 1E3ZA 2CKSA 2WSQA 3HG3A 1IXOA 1D2KA 2PZNA 5M17A 5GNZA 2VFDA 1JZ2A 4QRNA 1O6IA 4J35A 3QXBA 3CTLA 4O0KA 1LWHA 2ZKMX 5D2XA 4S2BA 3EKLA 1CZ1A 1DJYA 3WQCA 4I9MA 2V5CA 3FJ6A 2I17A 2VRQA 3NQ8A 2PDNA 3WH5A 5AC8A 1Z42A 2OU4A 2BASA 2QPXA 3F4WA 2AQVA 4BQ5A 4YMZA 1SSGA 4K39A 3REQA 3SQMA 3G1FA 1UPPA 1E72M 3W7PA 1FHUA 1X97A 2F9RA 1ZCCA 3BGAA 4C6OA 3A13A 4UOZA 1QHZA 3MV01 1AK5A 2E9BA 2H9AA 5C71A 4D1JA 2Q3RA 4JTDA 5F4SA 1QOPA 4HGXA 1MEWA 5E0FA 3MSGA 3KLKA 1JFHA 2YR1A 5M03A 4RZ5A 4LRSA 4BEUA 2Y62A 1ZQ5A 1VLWA 4DBEA 1XLLA 1BAGA 4ZO9A 2EEXA 1AH3A 2DSKA 3ZT5A 4JTTA 3VMNA 4OWGA 1J93A 1N55A 4MB4A 4X2PA 4FSAA 2Z1XA 5F1UA 3RPMA 1YNPA 3RFAA 1AMKA 4IGNA 2C71A 1NQKA 4GNVA 2W0UA 1JNEA 4QE5A 4JIEA 4UB9A 3MVIA 2XPKA 1I8JA 2HTMA 4IIEA 3PPGA 1B1YA 4DZ5A 3HPAA 3FYOA 3H2EA 3EPMA 2X40A 1A50A 1XPGA 2EJ1A 4FLRA 4MOZA 3WMCA 1FTXA 4LY8A 5ABHA 2XIMA 5IXEA 5DMYA 4HJWA 1WKEA 1GQJA 4E2DA 3QFEA 2FTWA 3W7GA 1GYLA 4ZODA 3TFXA 2W9MA 1TV4A 1EYWA 5A8GA 3CQJA 2JF7A 4K37A 1JR1A 1W1IE 3LBMA 4AXNA 4NAEB 4AUBA 4ML4A 4E8CA 2E8YA 3N2TA 1TV3A 3PJUA 3WQVA 1TMLA 1ADSA 3KHDA 3LXAA 4H8VA 4WK9A 1JDAA 4WLCA 3H23A 1XGEA 3QR3A 3MWAA 2FIQA 1XPYA 3TWAA 3CIVA 5EMMA 4ZTYA 1V0NA 2XU2A 3LB0A 2ZX7A 1UKSA 5D8ZA 3TN6A 2F6XA 3RK8A 4WSHA 3H55A 3NZRA 2BY1A 3P82A 3L4XA 4CNUA 4YXGA 1ONWA 1A47A 2REQB 4EAYA 2PDYA 2GWNA 3L4YA 3Q45A 5AC4A 2WMFA 5ABTA 2AGTA 4DO6A 4P7NA 3PZNA 5G4EA 4I7VA 3H70A 4CNOA 3I6EA 3GSMA 1Q4NX 2Y88A 4PRRA 2XVPA 3U4AA 3WLPA 1YDNA 4DJFA 1B2YA 4AWUA 2EPHA 4AHPA 3ZSTA 5L9FA 3URAA 1OFEA 2DW6A 1PEZA 1ICQA 3WD2A 3C8FA 5HNTA 4NXSA 3G8EA 3KE0A 4C6BA 4E6MA 1ISXA 4UNLA 3UW6A 3D46A 2PF8A 1UKOA 4R85A 3LU2A 4J3TA 2A2IA 3B06A 3D3AA 3B4YA 4H04A 1R46A 2W92A 1CYGA 3TV8A 2Z1SA 4LSBA 1WX0A 4LCRA 3H12A 3TW9A 2Y89A 4ROPA 2GDVA 2WC3A 1NWRA 2GJLA 2PUZA 2PWVA 3DYOA 2QEZA 3WQFA 1LT8A 4RL3A 3TC3A 1UJQA 3AIEA 1SFJA 2WM0A 2UWFA 3IAQA 5A6SA 3BGGA 1J2WA 4RNIA 4O11A 4PSRA 3W85A 1G01A 2QJHA 3PG8A 1LWIA 3DFTA 1XIMA 3LX9A 1QPKA 4NAFB 3IVTA 1RAKA 3MUZ1 2ZICA 2G37A 3LY0A 5E5CA 3OOQA 4LS1A 4ZQNA 2DSWA 5I3IA 4RE2A 2VR2A 2E3ZA 4N02A 2VGIA 3A3XA 3R5EA 2WSPA 5FEPA 3BMXA 3L12A 1I1WA 4JN7A 5CPTA 3USBA 5LA1A 1WOAA 5KZDA 3KOZA 4NAEA 4QAWA 3WJXA 4FIRA 1E43A 1KKOA 4JHOA 4HCHA 1XBXA 4O1FA 4ZGYA 4R88A 2AGKA 2QIIA 1OYAA 2J27A 3TROA 1XFCA 4UQEA 1I45A 3TYBA 4Z2GA 4LV4A 5A5WA 1FOBA 4C91A 1UR2A 1LQ0A 4HK5A 5E1QA 1PWLA 3HJZA 3B03A 5I00A 1UHVA 3VU2A 2AAAA 3AZRA 2C1IA 2NVAA 3R1ZA 1YHTA 3LHWA 4HPXA 4ADTA 1H0IA 4DO4A 4LCQA 1AJ0A 1BYBA 4X3ZA 3LHZA 5EYWA 4DPQA 5IBXA 3EZ4A 4GH1A 4K6AA 4IIGA 5C9UA 4TO8A 2Q6ZA 3N13A 3OU8A 4POCA 4A8IA 1M9HA 4D8AA 3QLLA 4JTFA 4UXDA 6XIAA 1O7AA 3LSCA 3P67A 3DHFA 1XIJA 4JEJA 4OU1A 3S0CA 1FHLA 3U5UA 3DH7A 3M44A 5FIPA 1XUUA 2OLHA 4GY0A 2WKGA 1I2QA 1W5PA 2X0YA 3PZTA 1XDJA 4I9TA 4GD0A 2E25A 2ZXAA 1BG9A 4GZEA 1Q6EA 3TW7A 5CG0A 3CH0A 1KGXA 1IWAA 1DJNA 1HXJA 5D9MA 2OOFA 5H8UA 2RKXA 1J5SA 2DEPA 1UASA 3QBUA 4JCLA 1TPEA 1VJSA 3N12A 1FX6A 2I9EA 1FKWA 5D09A 4UFLA 5LZLA 3LRKA 1GG1A 5T9BG 2CLPA 1ISVA 2HISA 2DVXA 1W6TA 3OG2A 1HJXA 1WXZA 3C52A 3W7RA 4K7YA 4INFA 1V02A 3E2SA 2E6DA 4W86A 1V08A 4A3YA 5B7ZA 2ZFAA 1QR7A 4F9DA 1QTWA 3UJSA 4F0KA 3N6QA 4XO7A 3ZLGA 1S2TA 1MVYA 4H9XA 4XVEA 3BOXA 3V4BA 2HEJA 4WQ6A 4W5UA 4Q7BA 2HRWA 4IH3A 3O1NA 2OYLA 4H1ZA 4US6A 4H9TA 1MXGA 3PSWA 3T09A 1FWIC 2PDWA 3PWIA 2C6QA 3MA8A 4CKQA 1IEXA 2PE4A 1UR9A 4HN4A 1KM4A 3HFYA 1OABA 3A4WA 1V3HA 4JTKA 5D9NA 3WNPA 4IJBA 4CU6A 3R0KA 1PE1A 8RUCA 1HKKA 1HFBA 2ASHA 1KM6A 3VCNA 4MJZA 3ATYA 2YBTA 3WLQA 4AW7A 3F4CA 3OBAA 4A3UA 2ZWZA 4HYVA 3V1HA 2DSZA 3GXDA 3N4FA 3GC4A 1OQFA 1DJQA 2OWXA 4DM1A 4DWSA 3VUPA 3HZ3A 5F2GA 3WLOA 3TE9A 3POHA 1AQFA 4NF7A 1ISWA 1IHIA 3W72A 1KM1A 3SGZA 1O4UA 4PTXA 1ECQA 5AVNA 2BLEA 4GY7A 3KRSA 1CENA 5I3JA 2ALDA 4NKCA 1M1BA 2PODA 4Y7EA 1A5AA 2ACQA 2G4FA 2ZX9A 4UMBA 1A3XA 2HSAA 3QHMA 3W1AA 1IT0A 1XINA 4EXBA 3ITXA 2ZUTA 4JL1A 1I9CB 5C6MA 1S5WA 5BOEA 2D2OA 3MCMA 4LVGA 5BXTA 2MNRA 1V4YA 4Z42C 4HPGA 1WXYA 3KEHA 3VIFA 2IQDA 3L4UA 1NWSA 2VFHA 3L7RA 1H5YA 3CAKA 3EDJA 4J28A 2FJKA 1LOSA 2PLCA 4XZLX 4DZHA 4D6JA 5C7HA 3D0CA 1OF8A 4X63A 1MUWA 3CAQA 3BLIA 3QJAA 5U7SA 1IYXA 4U10A 4UMCA 5CEWA 1UR3M 3GTFA 5DMMA 3BAWA 4NJGA 1O94A 1EJWC 3BWWA 3A12A 4RE4A 2C19A 2WZIA 1PKYA 5GJNA 2JQXA 1V6XA 3FFSA 3TAOA 2PP3A 4NVTA 4B9YA 2G5WA 2YL9A 2OTDA 2YIHA 1DVJA 1Q6DA 3QZ6A 1DJIA 1ZS2A 1IEVA 1F6KA 3KL0A 5HOSA 1Q85A 3MUY1 1EZ2A 5FF2A 3ECQA 5BXSA 4H9MA 4CU8A 1KXTA 1X1NA 5DRCA 3R11A 3VGGA 4DI8A 4H7CA 3Q67A 2NQZA 3UCQA 4Q33A 3XIMA 1BQGA 1FWWA 2G96A 5HK4A 5A6MA 3II1A 5A8QA 6ENLA 2IKHA 3QQ1A 5HDRA 3SR7A 4A3QA 4CN4A 3TCEA 2W66A 3PZVA 2DU2A 3IUDA 2QV4A 4YNGA 1BF2A 1EH9A 4RW3A 3L4ZA 3T55A 1OM0A 5FEXA 3U6WA 4TIMA 2I57A 3WIJA 3BGJA 4W8BA 2DUZA 2NX9A 2DGAA 3CIXA 4DEFA 1FWCC 1ZALA 3GU2A 3UYIA 3QR0A 3ZT6A 4F0LA 3T8QA 1W2VA 1NFBA 2CBJA 4NJHA 1OCJA 1OFDA 3DEQA 1C7TA 4FALA 3TTYA 1NF0A 1ZPTA 5JU6A 1E56A 5HNNA 1UD2A 1H7RA 2D69A 4KH2A 4HNVA 2WB5A 5K4ZA 3WG6A 2V5KA 3VIGA 1QPNA 4PEEA 5HAOA 4HP5A 3A22A 2E6YA 3PJTA 1UQYA 1PTDA 4FOKA 1HUVA 3PJWA 3F2BA 3M6DA 3W1LA 3CB3A 1EEPA 2E28A 4O1CA 4YVVA 1MUMA 1Y7VA 2WKLA 3KOXA 2OELA 4B3LA 1E0TA 4JXCA 2CZFA 2BG5A 4WRHA 1A3HA 4IPNB 3RLHA 2R1KA 2QVNA 4DBSA 4UTUA 3NQDA 2WQDA 3QY6A 4WKAA 5H8PA 1GVEA 2WJEA 1XM3A 4AD4A 4GQRA 5BOOA 1TWIA 3FN9A 3GVVA 1KBIA 3R2GA 5FJTA 1QI2A 3PPHA 1K8ZA 1J4EA 3DFOA 1AH0A 2WJZA 4JIIX 4MZYA 3ZO9A 2ZYFA 4DJEA 1XQLA 3DHUA 1K6AA 4PTVA 3OG3A 3WD4A 1NY1A 3S2NA 3W0KA 4ZO7A 1XBVA 4U28A 4MAZA 4X9YA 1K8YA 2P8CA 3POCA 4ICCX 3LI0A 3A23A 3M6YA 4AEFA 1KC7A 5F4XA 4L9ZA 2GQ3A 3MP3A 2FZ9A 1VIZA 3SECA 3QQ0A 4HOWA 3VAVA 1B54A 1MWOA 4Z2LA 3N2XA 5H8MA 3A4XA 4S3EA 4YVXA 3GG0A 4GYJA 5DBUA 3M43A 1JPHA 3NQBA 3M0JA 5DFAA 2FVMA 3EAUA 4RPQA 2YFNA 1A53A 4JYFA 3NCOA 2X7WA 3HQ1A 4EF8A 4GKLA 3LRMA 1W9BM 1L2UA 3KRBA 4PMRA 2BXYA 1SU5A 5EBUA 4AZBA 1B0IA 3HFTA 3DKLA 5A2AA 2OEKA 3FVMA 1RJPA 1F6PA 4RK8A 2YDSA 3A24A 2W91A 3SY8A 2YW4A 2OQYA 3EOLA 3VE9A 3IIXA 1K77A 2GJPA 3FEQA 4W88A 4AWSA 1JQVA 1A5MC 1U30A 2GVEA 3V7PA 3CXOA 2CBUA 1Q6CA 2INEA 1KM0A 2QF7A 2EPLX 2CCRA 4ZB0A 1YDOA 1UR0A 3WSUA 3UGRA 4PUMA 4U2ZA 1H0GA 3GNXA 4IIDA 1QJWA 3AXKA 2ZQ0A 1VFOA 4OV9A 3GNRA 4MY8A 1UZ4A 1MZHA 1X6LA 5K9XA 4FS9A 3NZGA 2PDLA 4Z08A 5LHEA 1YPIA 4A35A 5AYYA 4UR7A 4GXPA 4FB7A 4GZIA 3ZM8A 4CN6A 2BZNA 4C60A 5EB8A 4QTGA 2DVTA 3DI0A 2HVNA 5F1VA 4X61A 3MHFA 4Q3MA 2Q8ZA 4HNLA 3TWBA 4OQVA 2VWSA 1RQBA 1VH7A 1F76A 4RDZA 2Y7FA 3K5XA 5E93A 4Z1BA 4C1KA 2BP1A 1ITUA 3RX3A 3VDHA 4DAIA 2C18A 4B90A 2AL2A 1YIXA 4FEZA 2D3LA 1BRLB 3TW6A 1XCXA 1P6WA 1A5OC 3RDKA 2F61A 2PGWA 4O19A 1E40A 2EG7A 3O0FA 4YTTA 4R27A 5T9CE 1CBGA 4GO9A 2I5GA 4S38A 3VD7A 2OKTA 3LEPA 3IV3A 1ZBVA 4L9YA 1RJQA 2E5DA 2W6RA 3R8GA 5IFTA 1GOOA 3ARUA 4WJ8A 1XISA 4AYSA 1XV8A 3MSYA 1MI3A 1RUSA 1VBRA 2VZTA 3O3RA 1L6GA 4HPHA 3NNTA 2D0GA 4JFTA 1DJHA 3T1GA 1UR8A 4GIAA 2ABAA 4JTJA 3VNDA 3FJLA 2XIBA 2EGZA 3EWZA 3D5HA 3IEBA 2AOSA 1CLXA 5EFDA 2PC4A 4XTDA 3AYVA 4ATLA 1DWIM 1CGUA 1F6YA 1E4LA 3GXNA 1CIUA 2FPTA 3C3UA 5DT5A 2X8RA 1EWEA 1Z48A 2WSKA 4XG1A 2OO0A 3H7UA 1CNVA 3BMWA 3DHPA 3WKZA 3BO9A 4JTSA 1OC5A 3RLVA 2VRKA 4QDPA 4WSJA 4Z2IA 5I2UA 1XLIA 4FX7A 3WQDA 4AD3A 3FSTA 2J8GA 1HVQA 4PFHA 3IUIA 1PSCA 3ITCA 3BSGA 2EHHA 3B8UA 5FCZA 3OA3A 1PIIA 3O06A 4M3PA 3TSMA 3N34A 5A95A 1MW3A 1EJUC 3G77A 4Q8UA 2RFGA 1DHPA 4HZMA 1FXQA 3BICA 1MQRA 3KVKA 2YDRA 4ZQMA 3RCYA 2Q71A 3BMVA 2GGEA 2X1UA 4B2DA 1R87A 1REQA 3L65A 1YNQA 1RP9A 1JL8A 1WA3A 4LEFA 4TX9A 2CKRA 3K8LA 5CLTA 5EMJA 4IMCA 2JGQA 4BWLC 1U22A 3IK2A 1PHWA 1VFMA 3RX2A 1V5XA 3S6DA 4MFDA 1R7OA 3FX4A 4P61A 3MMUA 2XFYA 3FLUA 2JBMA 2XSBA 3IJLA 1UKTA 4EVZA 1DIKA 1E6SM 1OIFA 3GNOA 4NZCA 3I68A 3ARYA 3KRUA 4M8UA 4ZE5A 1X6UA 3S2CA 3W2UA 4V1XA 4NILA 3IJDA 4WKFA 3VYLA 3S2MA 2R24A 4YWIA 3SCQA 4GUFA 4Y9OA 4NIRA 2GLKA 3V5CA 4B91A 1QXLA 4OBTA 3UPWA 3UXKA 1PTGA 3AMGA 3UP8A 4O16A 4A2RA 2ZX5A 1MNSA 3PFMA 2QHAA 2FKPA 4GVFA 2PTYA 4FAMA 4IGMA 4O54A 4RDWA 3BH4A 1JAKA 3T2PA 1UZHA 1MO0A 2Y85A 3N2BA 2OSXA 3VGFA 3BG9A 1UUMA 1BF6A 1L6WA 1MQPA 3BSMA 3RG6A 1BG4A 3MPGA 3FV9A 3N4EA 4XBSA 3WUFA 1TO3A 4PMZA 2DH3A 4BQ2A 5CZJA 1M04A 5REQB 1BD0A 2G3IA 4FR6A 1YTEA 5C9XA 1MFVA 2ZUNA 3B04A 1JDDA 2QR6A 4CVWA 2WVUA 1NP0A 3EKGA 1HKWA 4EPKA 3MHGA 4IP7A 4A29A 2QDHA 4NHVA 4A2SA 5CJMA 1TWZA 1NEYA 3BCDA 3UG8A 4GH3A 4F66A 4HN8A 1F7BA 2WLYA 3E2VA 3K8KA 4W8AA 4Q4KA 3NOEA 2PLKA 4O17A 2Y0FA 2OB3A 2ZADA 3ONCA 4FF5A 2IW0A 3F4DA 3CQHA 4K7VA 4DWSC 4JIPA 2FFIA 1A5LC 2PDXA 3OJGA 5A3HA 3NSMA 1PV8A 2EBNA 4HYWA 3AMCA 3PSVA 1GQIA 1CGTA 1IT8A 3KHJA 1LUCA 2JF6A 1L8NA 3EA2A 1JPKA 3P81A 3P84A 2XM1A 2G3FA 2QQ6A 4M6PA 4ZFMA 4J2MA 4M1BA 4N9CA 3LCFA 3EPOA 5CAHA 1YTKA 1PDZA 3CNYA 3G6MA 1B9BA 3LBOA 4E8DA 3M1ZA 3GKFA 3BL3A 3W75A 4JN6A 3GHTA 4KWVA 3UZ5A 1OHLA 3ALGA 2YSWA 2XH0A 1KBBA 1XRFA 2AQOA 3C0SA 4LUSA 4GJ1A 4FNRA 1SZEA 3CWHA 4PGLA 4E3VA 1H1NA 5I77A 4F40A 3VZYA 3MV11 5FJJA 1TV7A 4QNWA 4Q8NA 1XD1A 3WL1A 4P8VA 4M6UA 3B0YA 2IPGA 1TMHA 4RR4A 3A5VA 2CHNA 3VOHA 3DG7A 2PU1A 1IIGA 1R9XA 5DXXA 3RPTA 3NYDA 8TIMA 2BXZA 4I8YA 2IPWA 3LPGA 4HSOA 2HXUA 3R25A 7TAAA 1GVQA 3E0FA 1ENUA 4PL2A 2WVVA 4AC7C 5FL1A 3LM7A 4MWAC 1OG0A 3NQ6A 5DY2A 3QOMA 3W2JA 1MW2A 1JGMA 2VWTA 4KEUA 3NL2A 2DH2A 5J5DA 1RLDA 3BLKA 4PUUA 1IQ8A 4GNKB 3CUXA 3RRXA 3VK5A 1P1MA 2FYMA 3VIIA 4KGJA 1UOZA 2PDMA 4JYEA 3SURA 4GLEA 5CPSA 3VX1A 3WQ8A 3OB8A 3DYPA 4KWSA 4XSLA 2PWHA 2BX7A 4XV0A 1XC4A 3EDDA 3T7VA 4HYRA 4E4UA 4JQ4A 4A8NA 2E8ZA 3U48A 1AW1A 1NU5A 2Y8UA 4CD5A 4YL2A 1KM2A 3AISA 2A3BA 1UKPA 2V5BA 4ECLA 2ZC1A 2D22A 1RD6A 4JFSA 1J11A 2R1LA 3HA1A 1JDCA 3GZAA 1JXJA 4DYEA 3OVPA 3VCCA 2RJHA 5KINA 4Q4QA 2QJJA 3KL5A 4C5YA 2YX0A 1P4CA 1ME8A 4F79A 2C1HA 1CWYA 1TJPA 1C3FA 1IWPA 3EX2A 3BOLA 3CYVA 8XIMA 3N17A 1B9ZA 4HA4A 4YN5A 3IACA 4UZUA 1VFTA 1ZJAA 5HPCA 3TQKA 4QNEA 1XH2A 3NSXA 3TUUA 1WDWA 2JEPA 3RPDA 1GOXA 4WHBA 1Q8AA 3W7CA 2IKJA 5D32A 4Z1CA 3VDAA 5CBJA 3UR2A 4ZMGA 3GW0A 3TONA 5E09A 4FNUA 3U8GA 4OJYA 3RR1A 1SZNA 4QJ1A 5AC6A 2J9YA 1ZY9A 4PMUA 2OQLA 3QY7A 4ZBCA 2J88A 1ZBWA 1JG9A 3A5FA 4LALA 3WDHA 3L4TA 1KFKA 1BXCA 3VABA 2OMAA 3W86A 4IMAA 2BSLA 1U2YA 3LI1A 4IGHA 1SFTA 5HQLA 4NNAA 4AIOA 4MM1A 3NOYA 1JCTA 1XFBA 4O15A 1JPDX 1IT7A 1CLKA 1LYXA 5CBBA 1EKOA 3CZGA 3QTGA 3S3GA 3A3WA 3RM9A 1XYAA 3HG2A 4NAFA 2AAMA 3ZR4A 1PIGA 3MUXA 3I7RA 1D3GA 1ZP3A 3L21A 3HU7A 3A4JA 5HJYA 4KCTA 4ERGA 5AFDA 5C55A 2X09A 4FNPA 5HMSA 2VI0A 3CPRA 3C2EA 1VCFA 3LCGA 1QW8A 4JDYA 1FWSA 1M41A 1DE5A 3CAWA 4C6KA 4HHMA 4QR6A 2ZDRA 2BHUA 3PPFA 1R8LA 2A7PA 3ES8A 3UXLA 4HA0A 5I09A 3UXAA 4QIUA 1BKHA 4M1RA 4AZ7A 1OJXA 4KFPA 3OLDA 2YBVA 3M5ZA 1QT1A 1CX9A 1XR2A 3OP2A 3TQPA 2NQHA 3NQ7A 5DRIA 2GUYA 1WP6A 1FY6A 4OOZA 1Q66A 2Y2WA 2P8BA 4OV4A 2V81A 5F2MA 1OADA 3W1NA 2V69A 2WSRA 2D2GA 1R3YA 4AF0A 5HR7A 3HMJG 3EEZA 3OTRA 1OFQA 2P88A 4C6MA 4GCAA 4L5ZA 4PEKA 1SJBA 2PDFA 4B5SA 1WB0A 1SZFA 3BAIA 4OUIA 3IJ9A 1C9WA 1QW9A 3UR7A 5GPRA 3FDKA 4UWMA 5EMYA 2W62A 3I6RA 4GPNA 1ZB5A 3KM8A 4HHHA 1GUVA 1T5AA 2ANUA 3O63A 2X05A 4EP8C 3VFLA 3T9PA 1VBGA 1NM9A 2NWRA 3G1DA 3DESA 4RDVA 4UCFA 3MB9A 2BMBA 3T05A 3N2CA 5IOBA 4W7UA 4XD5A 2FFCA 3F2CA 1DBTA 3AIUA 3TX9A 3LTYA 3S4TA 3VIHA 3WBWA 4ASTA 1DXFA 3H2AA 3H6OA 2CBIA 3AZSA 9XIMA 1F61A 1TJ0A 1PYMA 3ORWA 4P7LA 1AA1B 2I9UA 5MHBA 2CIPA 4DF2A 1O1HA 4X2RA 4FOJA 2OX1A 3A21A 2Y7GA 2H3DA 2GVYA 4GJJA 4ADSA 4IFKB 4S3CA 3EX1A 2QCDA 3WQEA 5HQMA 2GFTA 2C79A 2OGYA 5HMEA 4HNOA 3RU8X 5LHFA 3MMDA 4H8UA 2Z2BA 5D2VA 1CGYA 2PGFA 2OR2A 1EPXA 4HK6A 4PMVA 3B0VC 3G0UA 1SGJA 1A0EA 5DCEA 1QI0A 1NH6A 3O9NA 1J18A 4GZ7A 3NM1A 1TJ1A 2I14A 3L0NA 1E71M 3SCSA 4O14A 5A6JA 5AY7A 3AOFA 4NQ1A 1DTUA 4HK7A 2A5HA 1E1EA 2E9MA 2C3ZA 3MQTA 1IXQA 4OHQA 5BU9A 2BXVA 2OYMA 4TR9A 4NNBA 4CQBA 2ESCA 3TTSA 1JF5A 5I23A 2VCBA 4N7QA 1EJRC 1OIMA 1HP5A 3TDFA 2FGLA 4GKTA 2E5BA 4ZXLA 3LTPA 3B9AA 3ZS4A 3TA6A 3E2QA 1S5TA 4EXQA 4O1BA 3V0SA 4HSNA 2X2YA 4CLMA 4UTMA 3GG1A 3ARPA 1TWSA 1AZ2A 4KEZA 1PPIA 2HK1A 4FLQA 3RX4A 1AQMA 1E70M 3RNDA 1HJUA 2XINA 3T44A 1Z8AA 1EDGA 3HF3A 3NDOA 4NI3A 3TIMA 3BTNA 3KVLA 3RITA 4IL0A 5IBXC 4HU0A 2P53A 3UCCA 1CEOA 2JKEA 1ZP4A 1TCMA 4ZQPA 5DMNA 1TR1A 2FZNA 1SO5A 1BSIA 2HE5A 2QMKA 4AD1A 4DVOA 5A94A 4MPQA 1KD0A 5CPQA 1PS9A 3GWQA 3QGVA 3UU0A 4B5UA 4HNUA 4Q4RA 3E6EA 2BB0A 4ZQRA 2VVNA 1ZJHA 1A5CA 1EGZA 1HNYA 3CUHA 1M65A 1BHGA 5LXEA 4JS3A 4ADUA 3WBYA 3WQOA 4CNTA 3KRZA 1JCMP 4LTSA 1LDCA 3UR5A 3FJNA 1TG7A 4IJRA 5TF0A 3ARSA 1TPWA 3E0VA 1TUFA 3O07A 2NV1A 5EMKA 4HA1A 5AC7A 3QHOA 4ZO8A 4G56A 3AFBA 4FXFA 3GK0A 2POZA 4EANA 1UWSA 1UP0A 2FGBA 2KX9A 3H2MA 1N8WA 2DUAA 1GYMA 3UF9A 3LN3A 5HMFA 3RCNA 3OYZA 3T08A 4E8GA 1YXCA 1YE4A 5KITA 2GUUA 5I02A 2HS6A 1JCJA 1O1ZA 1XRTA 1S1RA 2J74A 1VZWA 1R85A 4I9JA 1ZAIA 4GZJA 4KQNA 3L5MA 4WSKA 2OXNA 2CWNA 2C16A 1VF8A 2QW5A 5G5IA 3GO2A 2PRHA 3DZ1A 2X7VA 3CUFA 4G2DA 2A7NA 4D6FA 1Z7AA 3ARQA 4J9JA 3OZPA 1OBAA 3W23A 4D6DA 1JUKA 3PB0A 5DO8A 4F2UA 3WF0A 2PS2A 1H11A 1J0ZA 4W7WA 2VM8A 4FX8A 2CPUA 1QO2A 5FJIA 1W54A 4J3WA 1W32A 4JTLA 1C90A 4HZ6A 1LLWA 3EB4A 1RLCL 4A8LA 4LUJA 2BS9A 3HMCA 2RGLA 3DUGA 4D72A 4F0MA 5A8OA 1UIPA 3FA4A 2QCEA 6REQA 2HNEA 2V8ZA 1VEPA 1J5TA 3ES7A 2CLIA 3UESA 3NPWA 2RGMA 1FHVA 1VENA 3VUSA 4UTFA 4H41A 3IJ8A 3BG5A 2QYGA 1RSCA 2NQ9A 2GSEA 5GJMA 4LUYA 2GL5A 3LCXA 2NVDA 1H3GA 3V1PA 2H3BA 1S38A 4PTNA 1S3HA 2GVGA 2VVSA 4LJ3A 2ALRA 1JFXA 4QLJA 2OGJA 4MZ1A 2TPSA 4KT2A 1HL8A 4PBFA 1Q4WA 3FGCB 3G3MA 4DX3A 1JZ5A 5AYZA 1R86A 2GYIA 1UROA 5CGTA 1FWTA 4AYGA 4JOMA 2J7BA 1HJQA 5HNUA 2XZ9A 2FHBA 4HHPA 1V0LA 4Q22A 2VQUA 3VOGA 4MWAD 2BFGA 3MY9A 2OSWA 1J01A 3SUVA 2HWGA 5JMUA 4ACZB 2XH7A 2XIIA 4AWTA 4DF0A 4ML9A 5FEZA 4MGGA 4GI4A 3LCIA 3EOSA 3GH5A 2X1TA 4ZSUA 1LLOA 1EA0A 3RM8A 1CTNA 3MUIA 1VBUA 3GR4A 3AMLA 1JXKA 4NRRA 1V0MA 4DYJA 3M46A 1MRAA 2UY3A 1BYAA 1NVMA 1HN1A 4JBRA 2WM1A 1B3WA 1I2RA 3AMDA 4KIRA 1A3WA 4JIHA 4Q4OA 1MEHA 1ZSXA 4RUBA 5CQ1A 2VNCA 3N73A 2NQJA 1AG1O 5TD4A 2GJRA 2DZWA 3MU7A 4S3KA 2OSYA 5AYIA 1U1UA 2ZZ7A 4P8UA 2CZDA 5ENLA 2PLJA 1RA0A 3OHIA 1X96A 1IR1A 4N6EA 3A9BA 3ZJ7A 1PDYA 1AJ2A 5AC5A 1IV8A 2PC8A 1RA5A 4CEXC 1HJVA 5DMLA 4AZIA 3OGRA 4Q32A 2DY3A 5E6ZA 5HINA 2GGHA 4LOCA 3W7NA 1K6WA 3UA4A 4UNIA 1O5XA 2BOEX 3RILA 3WDIA 1KKRA 3TZNA 2ZRUA 1GTEA 1OX6A 3VOJA 3A9IA 3UZZA 1LL4A 1BYCA 1CB2A 4US5A 3SCWA 3EWUA 3VC6A 3QC0A 3ARRA 1YRRA 4PULA 4PMDA 3CHFA 1KFLA 3IAPA 1D8CA 1NFPA 4UTIA 3R0DA 4G9PA 3IPWA 4GOAA 1R9YA 2CLMA 3OZYA 3ZR6A 4I8DA 4GINA 5IDIA 5D4YA 5MF5A 4I90A 4Q8TA 4Z17A 2E1WA 5CXPA 1OK6A 3UJ2A 1H2JA 2IQTA 2J24A 4F8XA 2DSVA 2WQPA 2ZUWA 3IIOA 4JFVA 4A3RA 4IL2A 4YYCA 1DWAM 3T2OA 3GTHA 4C5ZA 3WYZA 4ERAA 1YE6A 1GVOA 1ZGDA 2FJUB 3UG3A 1S2WA 1F3WA 3RCMA 1OGGA 4C1NA 4JNYA 6PTDA 5BOFA 4QM1A 1QUMA 3BJTA 4ZVJA 5I06A 4ZOBA 1TA3B 1Q13A 3QW3A 1B3XA 2VOMA 3L67A 2GGJA 4UFJA 3Q37A 4EIVA 3S5NA 4FP1A 3T4CA 2ZTKA 3AS1A 3WLMA 1K8XA 3EWBX 5BCAA 3N2OA 2XG9A 3F4NA 3W70A 2YDAA 3F1QA 2CHRA 4AIUA 1FP8A 5G2WA 4C6CA 3TNBA 3MYOA 3M5XA 4C6QA 3AQUA 2BHZA 3EWXA 3QLDA 3NFUA 2OLAA 3TCSA 5D02A 1LCOA 1LG2A 4O12A 1C8YA 3FOKA 1U83A 5HJXA 4ZA0A 3CJPA 1TPUA 1XLMA 3TP4A 5EFFA 3GU9A 1M01A 1X7IA 4M80A 4RZ6A 4REQB 5C9ZA 3TOYA 1W9PA 1UH3A 1SMAA 3VIMA 4LAZA 3THQA 3AWOA 3USZA 3UG4A 2BGNE 2WKJA 2W4XA 4I6VA 3U5YA 4G7EB 1NARA 5E0KA 1MQQA 4PE8A 1YADA 1CGVA 4RLIA 2PWGA 4GFIA 2EJAA 1T7LA 3E5PA 1D8WA 4JFWA 1KV8A 3WNOA 3AHVA 2DIEA 1GKQA 2V82A 3GFXA 1XJBA 4QE4A 2PDHA 1UB3A 2I5IA 1DE6A 1H41A 2BGQA 4TQTA 4TX8A 4C6JA 1R3RA 4LUIA 1FWEC 2YCLB 1LL7A 1J9YA 4AZ6A 2AL2B 4AFYA 1GVFA 2D2JA 4CD6A 3HG5A 2PFHA 3BAKA 4UTKA 3MO7A 3PZUA 3LUTA 3UPMA 3KOFA 1I1XA 1V6UA 1TE1A 3STPA 1QNOA 3SY1A 3TKFA 4JY9A 2CXGA 3GDBA 1ME9A 3D6NA 4D6CA 1XLHA 4DLMA 4XX6A 3VE7A 1SR0A 1FBAA 2DT0A 4EACA 3S1GA 1KW1A 2VCAA 3DAQA 1B3YA 2PAJA 4MADA 1KFJA 1JZ6A 2VC5A 4Q8WA 1LWJA 2VMFA 4YLWA 1B3OA 1IXNA 4LB3A 3AZTA 4GO8A 3P6LA 2ZE0A 1ZBKA 1RALA 3SN4A 3N25A 5C70A 4XQ6A 1B57A 4JN8A 3LMZA 3A4AA 3UG5A 3MYPA 4YTSA 4JX6A 4C6NA 3NPUA 2YL5A 3JZEA 3HGSA 4DAFA 4Y9MA 2B81A 1HT6A 4S2CA 1WDQA 4XAGA 5KZMA 3VGHA 2H8XA 4CU7A 3VM7A 2QT3A 4GQBA 2J6VA 1FCQA 1N8IA 2W79A 3ITOA 3QW4B 3VNJA 8CGTA 1DJWA 3VOCA 2GDUA 2NXHA 3QYSA 1XICA 3MTWA 4AZ5A 3BLLA 2DT3A 3NQ2A 2Z1VA 2Z4GA 2B31A 5FJOA 3EB3A 3UY7A 1V77A 4GWEA 1ZCOA 3L9CA 4PSPA 3A3HA 1KO0A 1IZJA 1EOMA 4XO6A 1X8CA 3O0KA 3AHTA 4BF7A 4CD8A 1XC6A 3TTEA 4LNYA 1XLDA 3IJ6A 3WLTA 1RY0A 2NUXA 2J75A 1BGAA 3REQB 3V5OA 5JH2A 3THDA 1MZRA 4MNKA 1RD5A 4XK2A 1F05A 1B4KA 4GXMA 2GQ8A 1XYZA 2PEVA 3P62A 3PZGA 4HCDA 2PU0A 2PCQA 3H4GA 4IXHA 3OHMB 5EPDA 3WH9A 1G7UA 2RUSA 1QHPA 3WJYA 4LUTB 4UOJA 1X6NA 3H26A 3PBVA 1XH1A 2RDUA 3GDLA 1O5KA 4MYXA 4NZ5A 3FCPA 1NDVA 5CJ5A 2W27A 3MJYA 6XIMA 3HG4A 3A64A 4G6CA 4ZE4A 1BWKA 1B30A 2HBXA 3LHYA 3WD3A 1TV2A 5KTLA 4O4WA 4CN1A 4AMCA 3MKCA 2X0SA 3TYCA 5G1MA 2OWCA 3MBFA 1WAUA 3Q58A 3W38A 3S5YA 3TYZA 4IMDA 3C3NA 1K7FA 4ORIA 4DXVA 2EO7A 4CNSA 3NZPA 1V3LA 2O9TA 2J13A 4V33A 5HATA 2HE8A 1CXIA 2Z26A 2C91A 1T41A 1XSJA 3A47A 1T8XA 3W22A 3AJXA 4CGTA 3S9ZA 1NWUA 2C13A 4J3XA 1OC6A 4HZ8A 2OEJA 5CPOA 2FB3A 3CLWA 3GY1A 4A05A 3TMLA 3AUOA 3W6YA 1KWGA 1QBAA 4I7UA 3T0BA 1TV5A 2WHJA 1A5UA 3EX6A 3W53A 3AHZA 3G1RA 1K3UA 3CQKA 4ENLA 1ICPA 2F6KA 3LCLA 3ID7A 4J40A 1W3IA 5FAJA 1GKRA 3H7RA 4JX5A 1VEOA 1GNXA 4LYKA 1ZLPA 4HTYA 1GHRA 2WZEA 1M7XA 4KERA 1VRDA 4AY8A 2CFFA 1GT8A 2ABBA 2WSYA 2R6OA 3OQ8A 1QK0A 2XFFA 1TTJA 3I3EA 1W1TA 3C8NA 1GOWA 4GK8A 2V2HA 3U9IA 3KBWA 3KTCA 4M7TA 3UZWA 3GE7A 1XUZA 4NU7A 2CLEA 4NP7A 1J8VA 1AD4A 3H22A 3C2OA 3B9OA 1TA3A 1UP2A 2QAPA 5HR6A 1A5KC 2ZUMA 3W73A 4W9TA 4CEUC 1EJTC 1X39A 3NL3A 5BMWA 1WDPA 2IKIA 1ZL1A 3DC0A 5KSWA 1W1B1 4CNPA 2QS8A 4DHGA 1BWLA 4X0NA 3MC5A 1CPUA 3SCNA 3COTA 3SO7A 1P7TB 1JEZA 1HKIA 4XSMA 1R9ZA 3FNDA 3ZJKA 4CVUA 3N11A 3OGSA 1S1PA 1EJSC 2GJNA 2PF0A 4RZBA 1THFD 3UY8A 3BK0A 4Q6JA 4NL1A 1B5TA 4WX2A 2OZ3A 4UMAA 2ISDA 1CXLA 3IRDA 3WQWA 1SW0A 4LCSA 3HIJA 3SSJA 3E0WA 4QJ5B 5HXMA 3TLLA 3W74A 3CUGA 3VA8A 4KWUA 2VD9A 2QDDA 1KCKA 3IVUA 2O92A 4KF1A 2DT1A 3P5YA 2QV5A 3IWPA 4M56A 3AS0A 3QKZA 3C2YA 1JUEA 1HVXA 4CCCA 1A4LA 1R30A 3L2IA 6REQB 1TVPA 4P8WA 2C0HA 1UWUA 5D30A 1FH8A 2YL6A 1R5YA 1GJWA 3AYSA 3SJNA 2NZLA 3CZ8A 1PBGA 3FAWA 5AECA 4DI9A 1SR9A 3K8MA 1U1JA 3PZOA 4MLRA 3W7OA 3WNNA 5CGQA 3FYPA 4Q6XA 4P8XA 3CPUA 2V2DA 3OA5A 4PMJA 2HV5A 3HPXA 3TJXA 1UR4A 3WY1A 3RAOA 1OD8A 3NIYA 3ABRA 4UFHA 4IOTA 5DCBA 4S23A 3K4WA 2OYKA 1QBBA 4RKAA 3LRLA 1QHOA 3ZYZA 3AHXA 2TSYA 2DFAA 2JIWA 3IGHX 4Z1AA 4HU8A 1V6VA 2P3EA 1UR1A 1AQHA 4ATDA 4KRZA 3M0LA 4H4IA 1SW3A 1GYNA 3R7MA 3ZZ1A 2YCIX 4AHQA 1WZKA 2X41A 3B8DA 4O18A 3SRFA 3OEXA 2PWDA 2V3DA 1C7SA 2OFJA 2Z7KA 4U5KA 5FF3A 3F4VA 4XD4A 1DORA 3KL3A 4PRWA 4D6EA 4QLKA 4MWAB 3T78A 4LANA 1W2PA 3VKCA 1D7KA 4QCEA 1QWKA 4F48A 2WNWA 3IJQA 1K9TA 1W9VA 3WJWA 3ANYA 2PWFA 3H2OA 1VIWA 3ZVIA 4I5RA 4V1YA 4XUYA 2VX6A 1YBQA 3W84A 1AFSA 1SQ7A 5DANA 1POKA 2E0PA 4HNCA 3TN5A 1Z6KA 3P5ZA 1WZAA 3LLDA 2J7CA 2PDKA 4MFEA 2O7SA 3GAKA 1P43A 1FCBA 3CWNA 2Y5SA 4RNFA 1F3TA 4D6HA 1KBLA 3KZSA 1TFVA 4JKLA 3GR8A 3GXPA 3PTDA 3SGGA 3ZSSA 2PPGA 4FHAA 2O4MA 3SIZA 1C9DA 1IR2A 1C8XA 4YU1A 3LGGA 4YTRA 1UD5A 3UWQA 1P0NA 3RGTA 1H60A 1RPKA 3BW4A 3IJIA 4WZHA 1KFWA 4RX0A 2XIQA 4DUWA 4MYAA 1GQKA 1JDFA 3AU2A 2E6AA 2DP3A 3ZMRA 1MYRA 2VEPA 4WOQA 4M6QA 2ZUUA 4F2TA 2D0FA 3BAJA 4TVDA 1E6XM 5D05A 1PVNA 1K1DA 1CW2A 4IG2B 3N29A 4M5PA 5CAKA 5J5RA 1IWBA 4UR8A 2PBOA 2ZZ3A 2A6LA 5I3DA 4TTUA 4J5NA 1JYVA 3KS5A 3ITLA 3E1F1 1KLZA 3H24A 3W87A 1SMDA 1VFUA 1J0KA 3PZIA 5IHRA 5F2IA 3FHQA 1U33A 4DPPA 2A3CA 1YYAA 2OT1A 2XIJA 4JQ3A 1KGWA 1Q45A 4KETA 2PTWA 3GVQA 3TK7A 5T91A 3SQLA 1E5NA 4IIHA 3EX3A 2D1ZA 1TTIA 2Z1BA 3LXBA 2YYUA 1LBLA 3CMFA 3GDRA 1NDWA 1GQLA 1Q7MA 4XWUA 5LNWA 2V5LA 4QLLA 3DN5A 4S1FA 2X30A 2D24A 2OOGA 3SY5A 1JGIA 5DT7A 3L68A 4C6FA 4UIOA 4NT0A 4H2CA 3DXIA 4IPJA 2RH9A 3W82A 3CHEA 3OIXA 3EOEA 2GZXA 1RCQA 3NO5A 5A8PA 1KLYA 4HPNA 2VD8A 2A7RA 1FWAC 1Z32X 3BQ6A 3DGRA 3ZWTA 4LRTA 3DBNA 4AWEA 2PZ0A 4HMEA 5CSYA 3T07A 4KMQA 1WE5A 1MW1A 1SZRA 3QH2A 4Y9PA 2WAGA 3QPYA 2OX4A 3VTRA 3LM3A 4GUJA 4MB1A 3HPSA 4WDTA 3CU2A 3ITYA 3IANA 4C6IA 3M0ZA 5LXXA 1XYFA 2VGBA 2Y70A 2WPBA 1W9DM 4B5WA 1XLAA 3PY2A 4E2VA 1F9CA 1J0JA 4MUPA 3TAKA 4IXXA 3GQYA 4OFCA 4E2OA 2ZCGA 2BGSA 3V0TA 1M68A 2G97A 3KBJA 1J0YA 2Z1WA 4ZOCA 4QROA 2AKZA 1SSDA 3B0PA 3U7VA 3ZXWA 1BPLB 1ONXA 4X0VA 1LT7A 2J7EA 3IJ7A 1EO5A 3RMJA 1XIHA 2V3GA 4FNSA 1Q63A 3SJ3A 5CSUA 3GAYA 3ME3A 1TCDA 3UJEA 4KPLA 1O66A