5E93A

Crystal structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with neq0071
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Exploring Trypanosoma cruzi Dihydroorotate Dehydrogenase Active Site Plasticity for the Discovery of Potent and Selective Inhibitors with Trypanocidal Activity
rcsb
source organism Trypanosoma cruzi strain cl brener
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 110
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2015-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 5e93A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5e93A01
3QJAA 3HG4A 4JTLA 5I3GA 1OABA 1W5QA 1H7WA 1HG3A 3LTYA 1H1YA 1U5JA 5FF4A 1W8SA 3I6RA 4IUOA 3USBA 1MSSA 3EWBX 3NEVA 4LTSA 1PV8A 4RR4A 4MLRA 1FY6A 1QDSA 3CC1A 4UTKA 3HB9A 1DV7A 1FXPA 3M47A 3IIZA 4FIRA 2Y6ZA 4O1CA 3MI2A 3R13A 1GQNA 3LCGA 3TXZA 1QR7A 5L9FA 2C6QA 3GR8A 4E2DA 3NQGA 5DY3A 3C2OA 3IIXA 3M9YA 2ZDRA 4HSNA 4GJ1A 3BG5A 1BWLA 4UTWA 2V0TA 1RZMA 1GPWA 4EF8A 2C3ZA 3LTSA 4ML9A 1OX4A 1QO5A 3FJLA 5G1YA 4FX6M 4ORIA 1YTEA 3OVPA 2J6XA 4S2BA 5AC8A 1OX6A 1OFEA 1VYPX 1TV7A 2XN2A 3P67A 4HSOA 1LORA 4PODA 4QJ1A 3A22A 5E1QA 3OBKA 4Y96A 3NO5A 3RNDA 1LOQA 4JY9A 3QSRA 4TX9A 3W7MA 3DFOA 1KV8A 3EX3A 2QCNA 4KKXA 1XI3A 4M7SA 3GDKA 5BMWA 4MOZA 2FQIA 5KITA 1H62A 2EHHA 3W7CA 3ZFHA 5SWUA 1YDOA 5EPDA 1TRDA 5LHFA 5CKSA 3Q94A 1LZOA 3U8GA 5AC6A 4DBDA 4PFMA 3G8RA 5HWMA 1UB3A 2H6RA 2NWRA 4M6QA 1VH7A 4J9JA 3DFTA 1W37A 4N02A 1VCGA 4OE7A 2A7RA 4ZQOA 1U83A 1YXCA 4OBTA 3S42A 1I2OA 3IIVA 1I2NA 4S1FA 3W7RA 3GIYA 3W83A 3S5ZA 3GAKA 3G0UA 5F2GA 1HO4A 1KM2A 3PWAA 1RQEA 4JYEA 2I9EA 4O13A 3TUUA 1K3UA 5DCBA 2V5BA 1SO4A 1PHWA 5D2YA 4GXMA 3O07A 1K7EA 1JRCA 2GPTA 4GE8A 4I7VA 3C2EA 2Y63A 1I2RA 1E51A 2AAMA 3QYQA 3W9ZA 1F76A 3KRZA 4N4QA 2FTPA 1W5OA 2ZA3A 3W07A 4BK9A 4JNMA 4UMAA 1MO0A 3E02A 3KFTA 1ZCOA 2NV1A 3LB0A 1K02A 5D2XA 4QNWA 4CQ8A 4DQWA 1I2PA 1N55A 4PC8A 2JKEA 4GRSA 4UTIA 4K6AA 1W0MA 1WA3A 2PRLA 1EUAA 3PAJA 3W74A 1BTMA 3PC0A 1R46A 4FEZA 3VI2A 3P8IA 2QCMA 3QRHA 3M5YA 3DKJA 4A22A 1NSJA 3KX6A 4AH7A 4ADTA 4IWWA 1CI1A 4FNTA 2DZSA 4IPJA 5CZSA 3OIXA 3P8JA 3ZWTA 5AHMA 4BF9A 1JQVA 4LC6A 5F2IA 4X22A 5KINA 3THAA 1G4EA 3UNDA 3E0IA 3EWWA 3MWAA 3EKZA 4JIPA 3W73A 1H7RA 3NGJA 4CQ9A 2TRSA 4JR5A 4AHOA 4TIMA 4NZJA 3CPRA 3TX9A 2ZRVA 4A2SA 1TSIA 1EIXA 3W23A 2ZTJA 1EEPA 1T0OA 2ATSA 4Z0JA 1O4UA 1OYCA 4A29A 4N4PA 4JX4A 5AYYA 3TQVA 2C14A 1F7BA 1K8ZA 2VEKA 5HINA 5DN1A 2YPIA 3QPZA 3P80A 2ZZ6A 1XUZA 3K30A 4Y9AA 4LOCA 2J9ZA 3BW2A 3MP5A 3MHGA 2E6FA 1TMHA 4RV8A 5CGQA 4HNNA 3DAQA 4NUWA 1H7NA 2Y85A 3ABSA 1HUVA 3O63A 1GVFA 2Z2UA 3BPWA 2ZTKA 1S3HA 5HQEA 3T44A 3QFEA 1C8VA 1OJXA 1X7FA 3DHFA 1YYAA 4JICA 2HMCA 1G4SA 3WK3A 2NUYA 1TREA 2OZ0A 2Z0IA 2DZPA 3IGUA 2RDWA 1A5AA 4LS2A 1MEWA 2ZRXA 4O1BA 4UR7A 4O8RA 3W2KA 4IMCA 2EAWA 4ZQNA 3HGSA 1TPVA 4IPIA 2ZZ7A 3E9AA 5G2HA 4HHPA 2HSAA 1D9EA 2QCHA 1SZNA 3C3NA 1JULA 4HT3A 4OGZA 4GNJA 3M1ZA 1ZFJA 3TA6A 4HPXA 4JY8A 1TPC1 1HFBA 3FYPA 3M5ZA 3UD6A 2R91A 3O8AA 3BO9A 4RXGA 1G67A 1TV8A 1WXJA 3S5YA 1NEYA 3Q2DA 3T78A 1PCWA 4JS3A 1YDNA 3LI1A 3S8HA 3PULA 1JQXA 3UZJA 1DBTA 1ICSA 4E0CA 1A5BA 1AW2A 3L67A 2JKAA 3B0UX 3GXPA 1M6JA 1W56A 3SZ8A 2GJNA 3W75A 1SW0A 3W88A 1G7UA 3S1UA 3UPBA 4JN6A 2YYTA 3LHYA 4GUGA 4O16A 2CZ5A 3HOJA 1ME8A 5D2VA 4PEKA 4M7TA 4LVDA 5BMXA 5FEWA 1GVQA 1BWKA 2JGQA 2A6NA 4XBKA 2E77A 3DU0A 5ABTA 4FNRA 5DY2A 2DZUA 4IX0A 1I2QA 4JYDA 4AHPA 5J5DA 1H51A 2Z6IA 4UR8A 1TPWA 1QFEA 3BW4A 3LXCA 3QQ0A 3BARA 3NQMA 3TJLA 3ABOA 3MBFA 5I3JA 2J9XA 1Z42A 4OHQA 3GDMA 1G7VA 1L6WA 5G1TA 3A24A 4NJKA 3EWUA 3NL6A 2A4AA 2Z6JA 4N9DA 2ZZ4A 3MI6A 5I3HA 3KOFA 1OYBA 3WJZA 5F2LA 3SECA 4AB4A 1IXPA 3U2OA 1TQJA 1VHCA 2FDSA 3N34A 3KVJA 4O18A 2DZWA 2WPBA 3FLUA 1SW3A 2FPYA 3D0CA 4FNQA 5LKYA 1IIHA 2V2DA 2EKCA 3BLIA 2G96A 3RU6A 3LHTA 1K7XA 3O06A 2BZNA 3ABQA 1KFEA 4K37A 3E96A 3EB2A 3PBYA 3W84A 4XQ6A 4FB7A 1R2SA 1LTDA 3IIOA 4B5NA 3W7HA 2X1RA 3PR2A 3PVFA 4LVAA 4AWTA 1FBAA 2QCEA 3IEBA 3STFA 3BGJA 1G4PA 3DFPA 2QJGA 4EF9A 4N9BA 3TC7A 1EUNA 1KM1A 2A0NA 2OT0A 2C16A 1ME9A 1LOLA 3WJXA 2CLMA 1ICPA 3LRLA 2H3BA 2YCEA 1YPFA 3KVKA 1VCFA 1G6CA 2PC4A 5HULA 2WSRA 2OJPA 4KFNA 3WFAA 3MP3A 3L68A 2PE4A 1TTPA 4O1DA 1XBZA 4NJIA 3PB2A 3M43A 1LROA 4U28A 5EA9A 3NNTA 2C13A 2PRMA 3W1UA 3S0CA 2QCDB 4S2CA 3BLFA 3TMQA 2PURA 4LUIA 1W3IA 2Y7GA 2E68A 2P0OA 3TSBA 5IBXC 1RD5A 4MFEA 3M41A 5AHFA 3VE9A 5D02A 5T26A 3NQEA 2QF7A 1ZAHA 4O50A 1OFAA 3GNNA 3TXVA 3CWNA 3LCLA 4U4MA 2J24A 4GUFA 2X1TA 1QMLA 1Y0EA 1KFLA 4MYAA 3NL2A 4UTMA 3WJWA 1GT8A 3MYOA 4XKYB 4LWWA 1JUEA 2BSLA 2VENA 1VR6A 1M5WA 1FDJA 1IXQA 5DXXA 5HJLA 4ONVA 4JTGA 5AFDA 5BRBA 5TQLA 5KSWA 2JBMA 4X2RA 3NL3A 2VEIA 1ICQA 2EF9A 4HNTA 4FO4A 3O6CA 3HGRA 3KAOA 4YLWA 3M7WA 3CTLA 3FYOA 3U6WA 4NX0A 2BTMA 4Z1DA 2WV8A 1TB3A 1AW1A 3FFSA 4QQ3A 1XDLA 1ZAIA 3QH2A 4YMZA 1UJPA 2YXGA 1SQ7A 3GLCA 3T55A 3QMRA 4UMCA 4I9AA 4BWLA 5FF3A 1S5TA 3DENA 2Y62A 1XUUA 5I3IA 1M7OA 1TPDA 2ISVA 3DI0A 4IOTA 4NVTA 4WY0B 4LU0A 4RLIA 1SW7A 1BEUA 2E6AA 3C61A 1KBJA 3FS2A 4WUIA 4HKPA 3HG2A 4UMBA 5AOUA 3B0PA 3EXTA 3HO8A 2GVJA 3OG3A 1WQ5A 3VKJA 2DP3A 1DVJA 4L4LA 4UFLA 1V7YA 3NQFA 4GBUA 1QPOA 3W1TA 1AG1O 3G8EA 2F84A 3C56A 4O10A 1O60A 3BG3A 3OHIA 1K7FA 4I7WA 3M0ZA 3EX6A 3P84A 1W3TA 2WNZA 1P0NA 3OEXA 1ZAJA 3KXQA 4R7JA 1KM0A 2CW6A 4QISA 2CWNA 5G4WA 3N19B 2W0UA 4UNLA 3SW6A 1WOAA 4Q33A 3SSJA 5D37A 5D32A 3T4CA 3LHWA 4JTIA 2C19A 1WAUA 1C9DA 2H90A 1XC4A 3MHFA 3N73A 1XXXA 2V2HA 3KVMA 2NZLA 2QEZA 5F4SA 3TW7A 4O17A 2NX9A 5G2IA 2X2GA 3LCFA 3P60A 5KZDA 1DORA 5AC7A 3UYCA 3GK0A 3LX9A 2Y7FA 3SGUA 3VFLA 2DZTA 4LRSA 4UTTC 2Y88A 3S1VA 5CSSA 4ZZ9A 4JIQA 3L0GA 4AMAA 3UXAA 1H7OA 2FIQA 3EX2A 5EKYA 4GWEA 4NNBA 1A53A 2NXGA 4O4VA 3G1SA 1YADA 2RDUA 4K39A 3N3MA 2PCQA 3A9IA 1SUXA 2NXHA 3LHUA 1GYNA 2QCLA 4BI7A 3W7QA 3DFQA 2CLLA 1JCJA 2Y89A 1WV2A 4E2BA 1H50A 2AGKA 5U7SA 1H60A 3GYEA 4AF0A 3PBWA 1LRTA 3LERA 4UFKA 2V81A 2FPTA 4TO8A 1X1OA 3OVRA 3NPUA 2CLOA 4DO6A 2GQ8A 2QJIA 1D3GA 1KLZA 1IXOA 2V2CA 3TC6A 4MZ1A 5EBUA 1YTDA 1TTJA 4LV4A 4C1LA 4N6EA 3HJZA 1XBYA 3W1QA 5HWJA 1UUMA 2VEMA 3KHJA 3STGA 3CIWA 1F2JA 2KZHA 2YSWA 1JVNA 4ZMGA 1NAL1 5AHNA 3I65A 3ANYA 2Q3RA 5F4XA 4WJEA 3H53A 3I7QA 1KV5A 2DZXA 3MUXA 3W71A 3P5ZA 2R8WA 1SZEA 4LVBA 4PCFA 2LLEA 5G2WA 1F05A 2EPHA 1OG0A 1XBVA 1PL9A 3S5OA 2QUTA 5KZMA 1X1ZA 1KFBA 3PM6A 5AYZA 1UASA 1T99A 1QOPA 1TQXA 4DPQA 1O94A 2X1UA 4M6PA 4WOZA 4CQAA 4JEQA 1J4EA 3ELFA 3W2LA 1PS9A 4H6KA 1LYXA 5MHBA 4MJMA 2TMDA 4MY8A 1O5KA 4D2JA 5K7JA 1C29A 1SO6A 2B7OA 5D2WA 1XCFA 3ATZA 5CPLA 1OK4A 1TPEA 3RLVA 3O6DA 1EX5A 4JX5A 4N9CA 1QCWA 5TIMA 1F6PA 3G1FA 4XZ9A 4L4MA 5HR7A 4JXCA 1F6KA 3UY7A 4ORMA 1OYAA 2QCFA 1JCXA 1VYSX 3HGJA 4OQVA 4DF0A 3P62A 1FWRA 3HG3A 1SO3A 1NFBA 4JTEA 2V30A 1SSGA 4FIQA 3PUOA 2C0AA 3G0SA 1DJQA 3CEPA 1THFD 1KM3A 3UXDA 2UV8G 2V9DA 4ZQRA 3HPZA 3UY8A 4DEFA 3CQ0A 3PF3A 1KBIA 1KTBA 1SFLA 2B7QA 1XM3A 4JX6A 3F4NA 4BFAA 3MYPA 3NM1A 3NAVA 5L6UA 1TPFA 1GZGA 3S1WA 3B06A 3L5LA 3TIMA 3TDFA 3C52A 3UQNA 3ZWSA 1OFOA 1WX0A 1W3NA 1LCOA 1WDWA 4PH6A 4X3ZA 2B0MA 4FNUA 1H5YA 3HPSA 3M5VA 1YXYA 1TTIA 5E93A 1Q6OA 4NNCA 3NQCA 3T40A 1VCVA 3BGGA 1AMKA 4XTIA 2P10A 2ZA2A 1KFKA 3NPXA 3GNDA 2YGYA 1ZENA 1QPRA 3PUDA 3WK0A 4PL2A 1JUBA 3N2XA 4BR1A 3HBLA 3M6YA 3EKLA 4RXFA 3B0VC 4DO5A 1SSDA 2WSQA 3GKAA 5A5WA 5CZJA 4WXZA 3B8DA 1B3OA 3KRUA 1L2UA 3G1DA 3PBVA 2ZRYA 4IGHA 4TMBA 3W85A 3EXSA 3VCRA 5BW6A 3I7RA 4KFPA 3CWOX 1P0KA 1DOSA 3S6DA 3AJXA 3Q58A 5K4ZA 4O53A 4O11A 1VZWA 1KFJA 2V82A 4FXSA 3IV3A 4H3DA 3C8FA 1GVOA 2YR1A 4AVFA 1WOBA 4M6VA 1TJRA 4K7YA 4ADSA 1LBMA 4NJJA 1B4KA 4RJEA 5EL1A 1EB3A 3KRSA 1P1XA 5A8GA 2G97A 1SR9A 1GVSA 3LRMA 4WY0F 5GVJA 4K36A 1PVNA 1FQ0A 2ZCGA 3QEZA 5G5IA 5K2ZA 2Y61A 1K8YA 2A5HA 1K03A 1H63A 1RQBA 1ONRA 3VNDA 2OCZA 3PS7A 4OU1A 3G0XA 2OT1A 1MEHA 1OVDA 1KLYA 2RH9A 3DH7A 2WQPA 4BWLC 4MIMA 5HWNA 1V5XA 3CHVA 1LLZA 2IQTA 4JDYA 4FX8A 4ZQCA 3FKRA 2B4GA 4O0ZA 3F4WA 3MJYA 1QPQA 4YL2A 3STCA 1GWJA 4JTFA 2VXNA 3PB0A 3LDVA 1F73A 1L6YA 3GVGA 4O15A 4JYFA 5C54A 2Y7EA 2ZBTA 1FWWA 4CNPA 4DELA 3G3MA 3QZEA 4NX5A 1DJNA 3TNOA 4JTUA 3SGZA 3JR2A 1JCMP 4X9SA 3LCXA 2NUWA 5CG7A 1JCYA 1QWGA 1OX4B 1L9WA 5AN7A 4M19A 4YCOA 4R34A 2CU0A 4IX2A 4N9EA 4IMFA 2I1OA 1VQTA 2QDGA 2X1SA 5AHIA 3ABRA 3N14A 3UWYA 2ZZ2A 5D38A 5LNRA 1KM5A 2WNQA 2NXIA 2A85A 2H8ZA 1ADOA 1EWDA 3MI3A 4NXSA 4O0KA 3L65A 1TPB1 4ICNA 5H2ZA 3MBDA 1TJPA 3IVUA 2GUUA 3LV5A 1VS1A 3TU9A 3LCHA 3FKKA 2A1YA 1OFQA 3BG9A 2GQAA 1Z44A 3M16A 2QCGA 1TRIA 1I4NA 3LLFA 4MKNA 5F2MA 1VJIA 4UTWC 2GVLA 1HO1A 1DKWA 4Z1AA 2E6DA 4IQLA 1RQHA 2ABAA 2NUXA 3GXNA 3P81A 1SFJA 1JCLA 3GAYA 4I7UA 3IVTA 4AEOA 5LGXA 3QMSA 3W1AA 5FF0A 4EOUA 3ZR4A 2D73A 1LRQA 4UTHA 1YLVA 4NU7A 2E5BA 2DZVA 5CZ0A 3L0KA 2WOQA 2YFNA 5I3FA 1FXQA 4ALDA 4MVAA 1YTKA 4LY8A 4TU1A 3S9YA 3JS3A 3W86A 3NQ2A 3W7KA 5LSMA 2GOUA 3CM4A 3DBPA 3LHVA 4G1KA 1GTEA 3FJ6A 4FHAA 3O05A 5DLCA 3NPWA 3HG5A 4UXDA 1S5VA 4GFSA 4NT0A 2GVGA 1W5PA 2YW4A 4MY9A 1LBLA 4JD4A 4UTLA 1SZFA 2TPSA 2X30A 3TQ0A 3W2JA 2YYUA 1GG1A 4O19A 4MLJA 2QAFA 2CLHA 2XFWA 3DKLA 1ZY9A 5F1UA 3W6YA 4EVZA 3LXAA 3C0JA 5CPOA 4A21A 3CB8A 2RHGA 2J88A 4K8HA 3W1LA 4UTUA 3P82A 4KFOA 4KWWA 1QO2A 4JTHA 3L5MA 3LI0A 2V8ZA 4JTSA 1RPXA 1TYGA 5HNRA 4MY1A 1LDCA 1G69A 4JDBA 1VRDA 4UFIA 4MJZA 3W22A 2ZRZA 2W79A 1O5XA 3KVLA 2ZRWA 5G4EA 2J27A 1KTCA 1VLWA 3EX4A 3TMLA 3GB6A 1ML1A 2FLIA 2FPVA 2QKFA 3W2MA 1W1ZA 2BXVA 3C2RA 1TPUA 1QOQA 5LGZA 3LHZA 5HUOA 1VYRA 3EWZA 1EPXA 1NF7A 3M44A 2Q8ZA 2W6RA 3NR0A 4AWSA 4LRTA 2FB2A 2WSYA 3CEUA 3B04A 2FB3A 4IXHA 5H91A 4CCDA 1S5WA 4UUIA 3PG8A 3P7YA 3I7SA 1Z41A 5C6MA 3FIGA 5KTLA 5EY5A 1PHQA 1G4TA 3RLUA 4LVFA 3UWVA 3WK2A 3C6CA 2XN1A 1JRBA 1XBXA 1CX9A 4A2RA 3O16A 4IMEA 3FOKA 3I68A 4DBEA 2ISWA 1UBSA 5DBTA 2VOMA 1WBJA 4O28A 4ADUA 1TCDA 1M7PA 3W7IA 1ZHAA 1H7PA 1GEQA 1SPQA 3IRDA 1VPXA 3P74A 3W1RA 4RKAA 2CLIA 2TSYA 2YX0A 5D30A 3NQDA 3BV4A 4YXGA 1ALDA 3BW3A 4JTKA 4QNEA 4YWIA 3DZ1A 2VKZG 3RMJA 1R2RA 1B4EA 3NZ1A 4UTJA 1JJKA 2XN0A 1XDMA 1DQWA 3UWQA 4Y6GA 4FNPA 4Z0SA 4GUHA 3UWZA 1SO5A 4K8EA 4ZQMA 3EWYA 6ALDA 3M5XA 4RCXA 4R53A 4UIOA 1FCUA 5F1VA 4OWGA 4OV4A 4HNUA 3QF0A 1QNVA 3O6YX 3W7NA 1OFPA 2Y70A 1FWTA 1J2WA 1LRNA 2NX3A 1OFBA 4WX2A 3L66A 4OT7A 1J5TA 4CNNA 3PY2A 4ZVJA 1MZHA 2X16A 3DFNA 1KFCA 1FCBA 3FEMA 4XUGA 5DCDA 4JTJA 2C1HA 2NV2A 1A5CA 2VFHA 1JCNA 2Q3OA 3G1YA 3TFCA 2DU2A 2CLFA 2QAPA 3ZS4A 5LHEA 2G5WA 1F5ZA 2VFGA 3Q37A 1WBHA 1T96A 1LP6A 2OX1A 3TSDA 4UFMA 1GG0A 3PBUA 3PG9A 4MZYA 4POCA 3TE9A 4DF1A 3HF3A 4O1AA 3LOTA 5IBXA 2VFEA 3L9CA 4FXRA 5EMUA 3G1AA 1KTNA 4WQ6A 1SU5A 4IXXA 3R2GA 3O1NA 3A21A 1TO3A 5LNSA 2GJLA 4R33A 1OF8A 3V75A 1TV5A 1LLWA 5AB3A 5BOOA 1JUKA 1B57A 3A5VA 5K9DA 1Q45A 4RK8A 1R2TA 2V5LA 4HN4A 3W87A 1P5BA 3LRKA 2CLKA 2C15A 3NQ8A 1I8JA 2QCDA 2EGZA 1KM6A 3LCIA 1TPH1 4O54A 1JR1A 4CNOA 3W1PA 3HPXA 4EIVA 1N7KA 1P4CA 4O12A 2VFIA 3DHDA 4O14A 4W9TA 5K3VA 2B7NA 3AO0A 4NJHA 5EYWA 6TIMA 4H4IA 3NQ6A 4GUIA 1KW1A 2AQWA 5D03A 1TTQA 3G22A 1UUOA 4UNKA 5FF7A 3UPWA 3NVTA 2QR6A 4XKYA 4XTDA 3H54A 1MEIA 4WOQA 4LUJA 4DXVA 3WJYA 1VHNA 1AL7A 4RZ4A 5D33A 5FEXA 1BKSA 2QCCA 4IMDA 1FCVA 3NM3A 1A50A 1CW2A 2BLEA 4LNYA 2E1DA 3TK7A 1K8XA 3EEGA 1NVMA 3S5NA 3W7OA 4AHQA 5FI8A 2GQ9A 4MYXA 1H1ZA 1EP2A 1N8FA 3SIZA 3QM3A 5K9XA 4QITA 3O15A 3TSMA 3HQ1A 2RFGA 3PUEA 4MZ8A 1D3HA 4Y8FA 3B03A 3EX1A 3HIJA 4GC4A 4O57A 1F74A 5FF2A 4UFJA 2E5DA 4NQ1A 4NJGA 5IM51 3TV8A 2A21A 3FA5A 1DHPA 2A7PA 1Q6QA 4WY0A 2VC6A 4RX0A 4WD0A 3WK1A 4QM1A 3INPA 1LM1A 3W2NA 3H55A 2HS8A 1ZNNA 3NDOA 3SJ3A 3G3DA 1AW5A 1FX6A 4WZHA 1I45A 1R47A 2JK2A 4MFDA 3N9RA 3YPIA 2E5CA 3W7PA 5F4WA 3LV6A 3RF9A 5J5RA 4UTTA 2RDTA 3PSVA 3GX9A 2JKPA 7TIMA 1AK5A 2ZRUA 1NF0A 4PTNA 3W7DA 3JRKA 4RZ5A 1OFDA 2DJXA 4LV9A 1XKYA 3NOEA 3L21A 3NQ7A 3G24A 3B05A 3G18A 3W1MA 3PSWA 2CFFA 2CZEA 2PRHA 4NNAA 1GTHA 4K38A 3N9SA 3NYZA 2ZYFA 3DFSA 1EP3A 3QPYA 3C2VA 4AAJA 2ATMA 4QIUA 1RR2A 4QSHA 5D09A 4C1KA 1DL3A 5C5YA 4K7VA 3UWUA 2CZFA 1X8FA 1AL8A 3TAKA 5CPMA 1SZGA 5LNVA 1W54A 3CT7A 4BI6A 3G1XA 1ME7A 5AYXA 1RV8A 4Q4KA 4CCCA 2C18A 4TR9A 5E0KA 2QJHA 4AXKA 2Z1BA 2NWSA 3T7VA 3CU2A 4LVGA 3NXFA 3MMTA 3IIPA 3W70A 4EWND 2F7FA 3W7GA 1LBFA 2H8XA 4P2VA 3TKFA 3DXIA 2E09A 3SI9A 2O7QA 2R14A 2ABBA 3LCWA 3QC3A 4A3UA 3MP4A 4LS1A 3B4UA 2VFFA 5D04C 2VFDA 4O52A 2NX1A 2G95A 3F03K 3GXTA 1HL2A 4ZQPA 3STEA 3GR7A 4LT9A 4AWUA 3QMTA 1YXDA 3W7EA 1MXSA 4UC5A 2A6LA 1GOXA 5FESA 5AHEA 2I14A 5HMSA 3GZ3A 3GKFA 4HPJA 4KWVA 4Z1CA 4MUZA 2H3DA 3TCEA 4FF7A 4CCEA 3LGEA 1L6SA 2ZZ5A 1FDYA 2B7PA 2R94A 5DELA 1KM4A 2ZZ1A 3R12A 2YFOA 3RK8A 2E6YA 3NG3A 2CLEA 3QW4B 4LW7A 4JTTA 4UCGA 2TYSA 3VE7A 4TMCA 1H7XA 3G1HA 4ZL1A 5CZTA 4YCPA 3C2FA 2DJLA 3NZRA 4DPPA 2JGYA 3W7JA 1VLIA 2OMAA 4AF0B 2FJKA 5CPNA 2BX7A 2WKJA 1PIIA 4FX7A 5KZEA 3L0NA 3E12A 3LLDA 3P5YA 4P61A 4JGDA 5U4NA 2O7SA 2BWGA 3DGRA 3LBMA 1W31A 1HTIA 1PE1A 4QAIA 1FWSA 4Q32A 4E38A 3QQ1A 1Z48A 4M5PA 2ISSA 4DO4A 1FCQA 1Q6RA 2A2IA 3BK0A 3BVJA 3MW7A 3C4UA 3LM7A 4OV9A 2WNNA 1W5NA 3TAOA 1PCKA 2ZFAA 3LXBA 4CLMA 3ATYA 3RFAA 3TQKA 3A23A 5LNUA 3QSTA 3W76A 2WJZA 8TIMA 3UWWA 5HUPA 3IGXA 1OF6A 3THQA 1FUYA 2DORA 3LTPA 2YW3A 1X6UA 1IIGA 3OVQA 2RKXA 2ZA1A 2J9YA 3R89A 3NQVA 1VC4A 1W5MA 3GDTA 4RZ6A 1OHLA 1FDZA 4XWUA 3BLEA 3TROA 1YPIA 1VGAA 4O4WA 5CSRA 3W1NA 1A5SA 4HNVA 1GJPA 4XBSA 2YDAA 3N2MA 1EWEA 1OX5A 5AHLA 3NA8A 3W3OA 1R30A 1OFRA 3QW3A 5DCEA 1FWNA 3NQAA 3W7LA 1LOSA 4UFHA 1QPNA 3S1XA 3TJXA 3L2IA 5KMYA 3TH6A 4NZFA 4WXYA 4Z1BA 3HGOA 1OK6A 2QUUA 1H61A 2ZZ3A 2ALDA 3TR2A 5DXYA 4DF2A 4HIBA 4NXKA 1KA9F 3LBCA 1UCWA 3WJSA 4IJBA 3W1XA 5LZLA 1IGSA 5I3KA 5FEPA 5LNWA 4N6FA 3NPVA 5C55A 2Q8LA 3GDRA 1Q6LA 1GVRA 5K4XA 3G1VA 4IMGA 5DBUA 1GYLA 2P1FA 5HR6A 4PA8A 4Y90A 2VELA 1T8XA 2Y7DA 2VEPA 3IVSA 3TFXA 3P61A 3TW6A 4Z08A 1QAPA 2ZQ0A 1Q3NA 3CLMA 4BI5A 2NLIA 3A5FA 2CZDA 3UZ5A 3GDLA 3W2UA 4GUJA 5K9CA 3HMJG 2FFCA 4N2YA 1EA0A 1YDVA 2WO5A 3MO7A 1RVGA 5BNKA 1IXNA 3L5AA 3SFKA 2QUVA 3V1PA 1EP1A 1XFBA 2HS6A 3CIXA 3F1QA 3R8RA 1O95A 3SR7A 1TIMA 3E49A 5TBOA 1DQXA 4MPQA 4FNSA 3NL5A 5C2XA 3MHUA 1WYIA 2QDHA 3IGSA 5D2TA 3EXRA 1B9BA 2A7NA 2HTMA 1IF2A 3W72A 3R5EA 4LC8A 4LS0A 3SY5A 1XL9A 1ZJIA 3EWXA 3OA3A 4PL1A 5D05A 1ZALA 5FEZA 2YZRA 3DI1A
chains in the Genus database with same CATH superfamily
4US6A 1OABA 1W5QA 1H7WA 1HG3A 4FMVA 3SRDA 3LTYA 1JPMA 2EJ1A 3WMSA 1EC7A 1PV8A 3OGVA 2GGJA 1FY6A 1QDSA 3A3WA 2YA2A 2Y6ZA 5ECUA 4E2DA 3NQGA 3F5KA 1E0VA 3C2OA 3M9YA 5C70A 4UTWA 3T0DA 2QV5A 4ML9A 2E40A 5I00A 3FJLA 2O9TA 3TQPA 3WY1A 1P6WA 1LORA 8XIMA 4JY9A 3QSRA 5CH9A 1KV8A 2FH6A 1FWBC 2XIOA 2QCNA 1WZKA 2WK2A 4MWAD 4AD5A 3KBMA 1W1YA 5CKSA 6REQA 3GHUA 1TWZA 1I0BA 1A0EA 3GWQA 1US3A 3TLLA 4J9JA 4MDPA 4N02A 4ASTA 3EOEA 2E4TA 1OGSA 2Q6ZA 4ZQOA 1U83A 1V6UA 4GIRA 3W83A 4HA0A 2ISFA 1TUFA 1FA2A 3QTPA 2XYLA 3PANA 1RQEA 3B9EA 3PJUA 4JYEA 2V68A 1CYGA 4MAZA 3TUUA 4NY2A 1UMYA 5D2YA 1JRCA 3CUHA 4BQ5A 4AUBA 1FWAC 1ZCCA 1UD6A 4GE8A 5DT5A 1I2RA 1XLKA 3ZO9A 3IUHA 3B0YA 1W5OA 3MPGA 4AZCB 1XIGA 4JNMA 1WUFA 1XLEA 4PSPA 2NV1A 4CQ8A 4S39A 1FHUA 2CKSA 1N55A 2YCKX 4E8CA 2JKEA 4ENLA 4UTIA 3F5JA 2QV4A 3PAJA 1AJ0A 1S2UA 1R46A 3T0AA 3P8IA 2Y5EA 3BWWA 3DEQA 3QRHA 3EMZA 3HURA 4A22A 3CZ8A 3U4AA 4ADTA 2VC9A 2FHFA 4DX3A 4IWWA 3CMGA 4FNTA 5ABGA 2IKJA 2WMFA 3P8JA 1JAKA 2X09A 4LC6A 1RBAA 2HISA 3SM0A 4LY4A 2FZBA 5JH1A 1JYXA 4IP4A 3KTXA 1J01A 3ARSA 2JEQA 3E0IA 1W9PA 1TR1A 2DT0A 3EKZA 1ZRQA 3W73A 2I17A 2BMBA 2TRSA 4AHOA 3TR9A 4ZE4A 1TV4A 4TIMA 4NZJA 3CPRA 2WANA 2PDXA 3C2YA 4S38A 2ZTJA 3MCOA 3WMCA 1EEPA 3QZAA 1K9DA 2ZVIA 4C6KA 1O4UA 2XIMA 1OYCA 4YTSA 1PJ9A 4A29A 1CXHA 4B5WA 1F7BA 5DN1A 4N7QA 1DJZA 1RSCA 3P80A 1LG1A 1XUZA 5I5RA 2YCLB 4Y9AA 1QNQA 3MHGA 5CGQA 3AXMA 3DAQA 1H7NA 2PTDA 4KRTA 5HQEA 4AU0A 2WPGA 1OJXA 4Q4PA 4JICA 2R1NA 1PEZA 1A5AA 1MEWA 3H21A 2ZRXA 3CXOA 4A8LA 3W2KA 4IMCA 2EAWA 4ZQNA 2ZX8A 4DBSA 4JFTA 4H19A 3E9AA 5G2HA 2HSAA 1KCKA 3AS1A 4BJHA 4GQQA 4XK2A 4ZO7A 3C3NA 1Q4NX 4GNJA 3QYSA 3M1ZA 3FHQA 1HFBA 4NZ5A 3PBMA 1LWIA 1BQGA 3BO9A 3QN3A 1WXJA 4DWSD 1NEYA 1SGJA 1B54A 1CENA 4GYJA 4GGHA 1X8CA 2X41A 2PMQA 3T78A 2J66A 3PULA 4IFKB 3GXDA 3UZJA 4E0CA 1XPYA 3DECA 3GC2A 1ZJAA 4QCEA 1XR2A 3GXPA 3CAVA 3W75A 1G7UA 4JN6A 3LHYA 4KS0A 1CECA 2CZ5A 4D6DA 1XLFA 3B40A 4PMJA 5BYWA 4LVDA 2PCEA 1TG7A 3GYCA 3E0FA 3EZ4A 3N2CA 4XBKA 4RNIA 3DU0A 4FNRA 2BGNE 5A1AA 4IX0A 4CNTA 4JYDA 3SCUA 1TPWA 1QFEA 1LQ2A 3BW4A 3L2LA 5HBFA 3ABOA 2J9XA 2OXNA 3PZUA 3BAKA 4OHQA 1G7VA 1L6WA 3A24A 3NL6A 4A3HA 2DW6A 1KXQA 4B92A 2Z6JA 2OGYA 2ZZ4A 3MI6A 3VIGA 2D2JA 4Q7IA 1MVYA 1IXPA 1VJSA 3U2OA 1VHCA 3T1GA 2FDSA 1W3LA 3NDYA 4J40A 2HNEA 2DZWA 3W0KA 4FNQA 3S83A 1QXLA 2V2DA 1UWAA 1W1A1 2G96A 2W27A 1K7XA 3O06A 1E6ZA 3ITTA 3E96A 3EMCA 3W84A 2DEPA 1R2SA 2X40A 4B5NA 4W86A 4G7EB 2D24A 3CZLA 2QCEA 1WDSA 3AHVA 3W38A 4N9BA 2A0NA 4AY1A 2C16A 1YIXA 4WSJA 1LOLA 3SRKA 3WJXA 1JF5A 2QUNA 5TNVA 2WJEA 2H3BA 3WMBA 1V3IA 1D2KA 2ZUUA 4DUVA 5BWFA 3P93A 2O9PA 4XZWA 1YPFA 4HCDA 3CQHA 2YXXA 1EC9A 1Q7MA 2PC4A 2WSRA 1P7TA 1AH4A 4K68A 1FFQA 2P8BA 1TTPA 5MKGB 2CC0A 2FJUB 1XBZA 4NJIA 4UQCA 3P6LA 5EA9A 3NNTA 3WLKX 2P50A 3LLXA 1XW8A 5B7ZA 4S2CA 3TMQA 1ISVA 1J96A 4V2XA 3TSBA 4HCLA 1Q63A 3VE9A 3QOMA 2ACQA 3NQEA 2QF7A 2DDXA 2EO7A 5D9MA 2J24A 1CXKA 2X1TA 3OB8A 4MYAA 3DFHA 3CV1A 1GT8A 2CBUA 4HHLA 4XKYB 4E2VA 1W3HA 4IJRA 4J3WA 1M5WA 1DTUA 3A12A 3AZSA 2P53A 4QBXA 1TWWA 3LMZA 1W3KA 2EF9A 4LAMA 5DX7A 1UD2A 2BG5A 3DCPA 1WB0A 3O6CA 2MANA 5LA0A 1V6YA 3CTLA 3FYOA 2OLSA 4Z1DA 1RJQA 1W6TA 2DSUA 2HK0A 3EDKA 3K5XA 3MVTA 1XH2A 3FFSA 4G1NA 3CWHA 4PMQA 4UMCA 1KBLA 5HNUA 4WDTA 4JTRA 1ZBVA 3DYPA 1TPDA 3MZNA 2VT0A 4NVTA 1K6WA 1SJCA 3L12A 2E6AA 1KBJA 4WUIA 4H04A 1RALA 3B0PA 3EXTA 5A8PA 1NH6A 2OODA 4HP5A 3VKJA 1DVJA 4XV0A 3NQFA 1NM9A 4GBUA 1AG1O 3I3DA 1X97A 3BG3A 3VOCA 5C7HA 2ADAA 2GSEA 4YYFA 3KXQA 4YS1A 1CDGA 1KGWA 2BASA 3G6LA 3WDQA 2HZGA 5G4WA 3BH4A 3N19B 1W17A 2O9RA 3AHYA 4UB9A 1GVEA 5EMLA 4ZTYA 3SSJA 3FJNA 2KAUC 3LENA 5IRPA 1MUCA 5GNXA 1W1TA 1WAUA 2H90A 1XC4A 3MHFA 1XXXA 2PLCA 1C3FA 1FKWA 5EFFA 3GK0A 3VFLA 3M0KA 2GWNA 2DZTA 4L9XA 1F3XA 4ZZ9A 2D2HA 4JIQA 3L0GA 3UXAA 3G1SA 1YADA 2RDUA 3WELA 4UQEA 1HIZA 4MUPA 4HHMA 4HCHA 2QCLA 4DWSB 7A3HA 4CD7A 3ZSSA 1XJBA 2CLLA 2Y89A 3GVVA 3POHA 2AGKA 1HGWA 4B4HA 4KGLA 3GYEA 2OTDA 3GG1A 4AF0A 4IISA 4H9YA 4L4OA 4AY8A 4KQNA 3B8TA 1PYFA 4TO8A 3IK4A 3PUGA 1LUCB 3WLPA 2V2CA 3PFMA 1PTGA 3WD0A 1TTJA 4C1LA 4Z2IA 3HJZA 1ISXA 3W1QA 4MKVA 1O5QA 3AS3A 4Z2HA 3SSZA 3ANYA 4DJFA 1LG2A 2Q3RA 1Z32X 5F4XA 2VGGA 4WJEA 5GJMA 3Q4DA 2DZXA 1ZPTA 4K1GA 1S46A 2R8WA 5DFAA 9CGTA 3VTRA 4RDWA 1F05A 1OG0A 1KFBA 1DHKA 4E2OA 1YBQB 4GX9A 4LYRA 3MSYA 1Y8BA 3RO8A 1N8WA 2G8ZA 3VAVA 1UASA 3S6OA 1QOPA 3K46A 4I6VA 2QQ6A 5FJUA 5HPOA 3GIQA 1F9CA 4ATLA 1VFFA 4H6KA 4XX6A 3WF3A 2VQTA 2D1ZA 5K7JA 4DZ5A 1SO6A 2B7OA 2DIJA 5CPLA 1TPEA 3RLVA 4QLLA 4N9CA 1V3LA 3GTHA 3U9IA 1F6PA 4XZ9A 4L4MA 5HR7A 4JXCA 1F6KA 5HOSA 1OYAA 4R9XA 1ZZMA 4KWUA 2HVOA 4OQVA 2ALRA 4AD1A 3UESA 2Z25A 3S9ZA 1NFBA 5CBBA 3SN0A 4FIQA 4XG1A 3G0SA 3CGTA 4PRRA 4DVOA 3UY8A 1B1YA 4ERGA 3PF3A 3T08A 4JHZA 4JCLA 1XM3A 3M0HA 3MYPA 3CUGA 1M03A 3IWPA 5IFPA 1L6GA 1KR0A 3NAVA 3WBYA 3S4TA 4DUWA 2YIHA 3WQGA 3C52A 4HK7A 2E9MA 1K4GA 1OFOA 1WX0A 1QNOA 3ZLFA 3WN6A 1YXYA 5E93A 3CPGA 3T40A 1R9ZA 2P88A 2YDRA 4XTIA 5EMKA 3WF0A 4TUFA 1S5MA 1KFKA 1VENA 1U5HA 3T8LA 1QI5A 3PUDA 1JUBA 5CSYA 3TYCA 3HBLA 4WCJA 3CO8A 1SSDA 1M65A 3VNZA 5CZJA 4WXZA 2WC3A 5CLTA 4U31A 2DZBA 2ZRYA 2OO0A 3W85A 2RUSA 3EXSA 3ZLHA 3AAMA 3BICA 1AA1B 5TD4A 1DOSA 1VPQA 3D47A 4F66A 3AJXA 4L56A 1S39A 3IJQA 2V82A 4FXSA 4X61A 5BRQA 2QVHA 4JBRA 3XISA 1B4KA 1GVYA 4GX8A 3KRSA 3SRFA 4CEXC 4ZA0A 3IGHX 1HP5A 5A8OA 4H8HA 3LRMA 4Q7NA 1TKKA 4ZB5A 5GVJA 1Z9AA 2ZCGA 3QQWA 4H9ZA 4YU1A 1QNSA 2XWDA 1CXIA 4JEJA 5CCZA 2GZXA 1ONRA 4IIGA 4BF7A 3TYEA 3PTKA 1E40A 2OCZA 1H41A 3UR7A 1ISWA 3WZ0E 2OT1A 5CC5A 4BWLC 5HAOA 1UWQA 1EA9C 3B0XA 4JDYA 1UWIA 4ZQCA 3B9AA 1V79A 1EZWA 4YL2A 1GWJA 3MMDA 4RE4A 4JOMA 3GVGA 4O15A 3O6AA 3MO4A 1QK2A 2Y7EA 4AX6A 3NSNA 4NX5A 3IARA 4ZXOA 3SUTA 3ZLGA 4JTUA 3SGZA 1FOBA 2GWGA 1E6XM 1UD5A 2NUWA 4UQBA 3MU7A 1QWGA 2PWHA 1V7AA 2Z2AA 3LMYA 3LYEA 4YCOA 1Q4WA 4Z17A 3N6HA 4IX2A 2CHRA 5HNTA 4C6JA 2I1OA 3W25A 1SMDA 3UWYA 5I07A 1UKQA 3KEHA 3F4CA 5LNRA 2NXIA 1V3KA 1ADOA 3MI3A 2WB5A 3L65A 3V36A 1TPB1 3MANA 1TJPA 2ZX9A 4QG6A 1UMLA 3LCHA 1OFQA 2Z7KA 2G3MA 4XKMA 4P8XA 5JBDA 3M16A 4KF1A 4MKNA 3OO2A 1H4PA 3VKKA 2X42A 4LCQA 2GVLA 6REQB 4OVXA 4Z1AA 4U33A 5CBJA 4S3DA 2VR2A 3CL6A 3WH5A 1XC6A 3QMSA 3W1AA 2VCAA 3ITYA 4J2MA 3ITCA 4UTHA 2C0HA 4DJDA 3L0KA 4U2ZA 1R86A 3LQGA 4B5TA 3VC6A 1UR1A 3S9YA 3GFYA 2PDPA 1EZ2A 3W86A 1TMQA 1XISA 5LSMA 1CNVA 2GOUA 3CM4A 3VU2A 4NG3A 3M0YA 1XIDA 4GFSA 4WGXA 4Y2WA 1YE4A 2GVGA 1W5PA 1LBLA 4JD4A 2DUZA 2YYUA 1CGTA 3VNJA 2XFWA 1TVLA 1JNEA 4PR4A 1WPCA 2PDHA 1RPKA 3UG5A 2YL5A 3W1LA 3IV8A 3NEHA 5DQPA 4KWWA 1XG3A 1FHVA 3L5MA 4G7FA 5JIWA 3OBAA 1M53A 1KC7A 3B8VA 4MY1A 3T2QA 1G69A 4KIEA 4DRSA 4V27A 1J0YA 2VZVA 1O5XA 3KVLA 2ZRWA 2OFJA 2Z24A 4PBEA 1VLWA 3GB6A 4BHYA 3BSMA 1KKRA 2QKFA 3W2MA 1W1ZA 1IR2A 1M41A 1QOQA 4HA3A 1WZLA 3GFXA 1UR0A 2IW0A 3UFYA 2CITA 1IZCA 4KEVA 2Z2BA 4MWAE 2MUCA 2J7CA 3PNUA 3CEUA 1GZJA 3HU7A 4GO9A 4HK5A 5H91A 4CCDA 3VD7A 1DJHA 2V63A 1FTXA 2GUBA 3FIGA 2FVMA 3PJTA 1PHQA 1G4TA 2XN1A 1XBXA 5C9UA 3AMCA 4A2RA 3O16A 3UVAA 3QY8A 2YCIX 3RU8X 3AXKA 4ADUA 2X7WA 4KW2A 1SR0A 1E9IA 2BY1A 3T0TA 2OSYA 1VPXA 3P74A 5I79A 1TVPA 2GFTA 4WDWA 2HV5A 2YX0A 9XIMA 3WDIA 4JTKA 1TE6A 3UYIA 4RUBA 1C8YA 4DUXA 3COTA 3NZ1A 1JJKA 4UTJA 1DQWA 3UWQA 4UQAA 1UD3A 4Z0SA 4GUHA 1R9XA 1WDPA 3QR0A 5A6MA 4RCXA 3VGGA 1LT7A 2YA0A 1RY8A 4Q4RA 1NDYA 3O6YX 1PWMA 3W7NA 4CD4A 2RDXA 3M0LA 1J2WA 3TYBA 4JPGA 4OT7A 3GH5A 4QS5A 2FZ9A 4CNNA 3PY2A 1MZHA 3DFNA 2VX6A 2QHAA 1FCBA 1PX8A 4ACZA 3K13A 3RYSA 4CD6A 2DFAA 1A5CA 4BS0A 1E0XA 2Q3OA 4I5XA 3R79A 2CLFA 2G5WA 3KBSA 1F5ZA 3E2QA 1T5AA 1J12A 2OX1A 1JFXA 3PBUA 1EC8A 3FK4A 4POCA 1E70M 1OG6A 3M6DA 4DF1A 4O1AA 3LOTA 3CL7A 1W2PA 1SU5A 3U5UA 1P0BA 1NP2A 4D9PA 1OF8A 1DE5A 1TV5A 4OZOA 1BYBA 4QG8A 2HEJA 4EXAA 4Q22A 3LA4A 5I23A 1Q66A 3LRKA 4M1RA 4R7WA 4XD5A 3SN1A 1E71M 2EGZA 1CGVA 1KM6A 3LCIA 2CETA 4DI9A 1JR1A 3DG6A 4YYCA 3HPXA 4EIVA 5E0CA 3B9DA 2X2YA 3RRXA 1XYAA 4W9TA 1J9YA 2PGRA 1EDTA 3AO0A 1RBOB 1Z89A 6TIMA 1JDAA 2AQWA 3GH7A 2BXYA 5D03A 3THCA 2VOTA 1KWKA 3UPWA 3DFYA 1GVIA 4XTDA 4X60A 1BWVA 3M64A 4QAWA 4ML4A 1DJYA 5D33A 4JL2A 5FEXA 1BKSA 1ZUAX 2ANUA 1FCVA 3NM3A 2WLZA 5H6HA 1P7TB 1MRAA 3M0VA 2E1DA 3NZPA 2VURA 2P3EA 3BLOA 2WLYA 1NVMA 3VUSA 2GQ9A 1O66A 4MYXA 5K9XA 3U0HA 2WVSA 4LYPA 3TSMA 1TA3A 3MQTA 3C3UA 1WKFA 2EPMX 1F74A 3O0KA 1UH4A 3W27A 4L9YA 5EB8A 5JMUA 3TV8A 2DSKA 2XSBA 4Z2LA 4RE2A 2A7PA 1A80A 1RXOB 2GJRA 1GQIA 1VFOA 4WD0A 1FKXA 4UTFA 3RCMA 1LM1A 2GQ3A 2HS8A 1D8WA 3NDOA 1AW5A 1FX6A 1UR3M 2CIPA 1A3XA 2XGZA 3A47A 1JD9A 3ERPA 2RDTA 3VM5A 2ZX7A 4PTNA 2FGLA 1VFTA 3AROA 1JZ7A 3WFLA 2EPLX 4C6IA 3VIHA 3NQ7A 1TWIA 3PSWA 2CFFA 2CZEA 3AWNA 4M80A 1CZ1A 5B80A 2G3IA 1E0WA 3BQ5A 2ZYFA 3DFSA 3PPFA 3QPYA 3IJDA 3V0SA 2OLHA 1PWLA 2ATMA 2PODA 4MNLA 2E9LA 4A4AA 1XLIA 1US2A 1WZAA 2NSXA 1AL8A 1QBBA 1UR4A 2OELA 1VIZA 1H11A 4NRRA 4L1XA 3SCVA 4L61A 1V6XA 5AYXA 2HBVA 2W5FA 4GABA 5E0KA 3L4VA 2NWSA 4LVGA 2J8FA 4UOQA 3MMTA 6CGTA 1CXLA 4DBUA 3TKFA 1VJZA 1F4AA 1AUSL 1HNYA 2BVTA 4AX7A 3C0QA 1Q6CA 3MP4A 5D04C 2VFDA 4O52A 3TYZA 2G95A 3WQPA 1EH9A 1HL2A 4ZQPA 2PWDA 7REQA 4AWUA 4GK8A 1MXSA 4UC5A 1Q7QA 5JVLA 1HKWA 2A6LA 5FESA 5HMSA 1GZ1A 4TVUA 3EEZA 3RCNA 4CCEA 4J28A 3TA9A 1CTNA 1KM4A 3A4JA 3R12A 2EG8A 4JQ2A 3S9IA 1NDVA 2CLEA 1V6VA 1XLAA 2OVLA 4J2PA 4YTUA 4GLEA 2BHYA 4AD2A 1NQKA 3C2FA 3NZRA 2D23A 2JGYA 2XVKA 3W7JA 1U2YA 3T9PA 1Q2RA 4H2CA 1D7FA 1ONWA 2OMAA 4AF0B 3GW0A 4C6QA 2BX7A 2D20A 1JXKA 3FVDA 3L0NA 2ZUNA 1Q6FA 4GMEA 3P5YA 1BHGA 5U4NA 4F0RA 3R7MA 4F9JA 1N2VA 3L2MA 3QV9A 1KGXA 3H2NA 1OZMA 2OSXA 4B5VA 2I5IA 3EPOA 4ZOEA 4PCPA 3C0LA 2XU2A 2A2IA 5BXTA 3BVJA 3C4UA 3MWCA 4OV9A 2WNNA 3R8GA 4DJDD 4CLMA 1L2QA 5TAOA 4C6NA 4F48A 3FAXA 1E72M 4FXJA 4H7CA 4Y9OA 3O2LA 2DORA 3LTPA 1W1PA 3BCJA 1PIFA 4PUNA 1KB3A 2J9YA 4HPNA 2WWDA 4H6EA 3VIJA 1OHLA 1FDZA 4MDOA 3CZEA 2VO5A 2W63A 4IFRA 2HK1A 4XWUA 3UP8A 3TROA 1M68A 4MWAC 2IXUA 2HNHA 4IICA 3S2JA 4H01A 4W7UA 1G1YA 5A6JA 3R1ZA 2CLPA 3M0MA 3BDKA 3GDBA 3NA8A 3W3OA 1R30A 4MNMA 1RJPA 4PBGA 4Q8OA 3TJXA 5KMYA 4NZFA 4WXYA 4Z1BA 5E6ZA 1VFSA 3QR3A 4L1WA 5H8PA 3IUDA 3CYJA 4H8VA 3WJSA 3IPWA 1IGSA 5I3KA 3RM8A 5M03A 3HJEA 4HD5A 2Q8LA 2ZUVA 4QEHA 2IPFA 3G1VA 2AMGA 3FYYA 4IMGA 3LUTA 4P8WA 4I5UA 2P1FA 4PA8A 3AXHA 1T8XA 3IVSA 1CIUA 2YL8A 3TFXA 3SQMA 3U3HA 4LB4A 2OQLA 4Z08A 1Q3NA 3KBWA 2CZDA 3NSXA 2FGZA 1V6WA 5K9CA 3HMJG 2FFCA 4E8DA 3BANA 4TVDA 2OYLA 1UR9A 4H8UA 1DTNA 3SDOA 1YNQA 4PSRA 3PJXA 2QUVA 3TVAA 3V1PA 3N15A 1R0MA 4CCZA 4C90A 1OT2A 2HS6A 1KFWA 3SR7A 3ARVA 4HQVA 2PUZA 1GW9A 1XH0A 3Q45A 1EJXC 2A7NA 2W61A 4LS0A 1KNWA 3SY5A 4FALA 5ECVA 1XL9A 4WDXA 2HROA 4PL1A 4KCUA 2YZRA 4HU0A 1K8CA 4IL2A 3HG4A 4JTLA 5CPSA 2HDJA 5BRPA 1H0IA 3RXZA 1UHVA 3GUWA 4EANA 3I6RA 2PTXA 3TWAA 4QDWA 1D8CA 3GG0A 4UTKA 2Y1HA 3NQBA 3HB9A 3M47A 4J35A 1HJVA 4GKLA 4LQ1A 1A49A 3MI2A 3R13A 1JNDA 1H09A 1XD0A 1ISZA 2ZDRA 1BSIA 2FZ8A 2V0TA 1IQ8A 4DZAA 3E5BA 4LX4A 3CHCA 5G1YA 1JZ6A 1MUWA 4FX6M 4E6MA 2BGSA 4ORIA 3HV8A 5AC8A 4IGNA 4Z2GA 3MUIA 2XN2A 4HSOA 4PODA 2BVYA 3N13A 1QW7A 3A22A 5E1QA 4Y96A 4NI3A 3RNDA 1AQFA 4BCEA 3ZZ1A 3DFOA 4AZ5A 2OGJA 1DIDA 3EX3A 4HB7A 4V28A 5AVHA 4KKXA 4M7SA 4XZHA 1OCJA 1H62A 3W7CA 3ZFHA 1WNOA 5SWUA 1FWFC 2JE8A 1UWSA 2IS7A 3Q94A 3IJ9A 3KTSA 4PFMA 2HXTA 3S2CA 1VH7A 3DFTA 1S2VA 1W37A 2EPKX 2OG9A 3WO8A 3TTQA 4OBTA 4J3SA 3UZWA 4DWSC 3S42A 3IIVA 1EF2A 2A79A 3W7RA 1LJYA 3GAKA 1MW2A 1KM2A 3RITA 4O13A 2DSVA 1NOFA 3VINA 4J27A 3QR1A 3UR8A 1E3ZA 6A3HA 1R85A 2WYSA 4PUJA 4OBRA 3W9ZA 2REQA 3WLMA 3N12A 2ZC8A 3MJMA 1ENUA 3SCPA 3W07A 4BK9A 3AS0A 4M1BA 3R58A 2YKKA 1QI4A 3KFTA 3DC8A 1ZCOA 3LB0A 3AWOA 5D2XA 1TUXA 3FA3A 2VHLA 4K6AA 3V16A 4KIRA 4HU3A 2R24A 2DW7A 4S3JA 2QCMA 1EDQA 3DKJA 3FXGA 1NSJA 3KX6A 4AH7A 1GEHA 4JTAA 1CI1A 4QXIA 2DZSA 1A5LC 5CZSA 3NURA 4GH1A 4BF9A 2C79A 1IEXA 4DLMA 5REQA 4LFYA 4X22A 2WQDA 4CGTA 3VIOA 2FMNA 2A3AA 4KGJA 4ICCX 4V15A 1OT1A 1H7RA 3N2OA 1E73M 3BGAA 3VC5A 1DJGA 3MB9A 4UCFA 3TX9A 2ZRVA 1TSIA 2YA1A 4H7VA 1T0OA 2VWSA 2QJMA 1XCXA 2XINA 2Z4GA 4JX4A 5AYYA 2XM2A 3GHSA 2RJGA 3AYVA 3KDNA 4KCTA 3ITLA 3RHGA 4ZFCA 2ZZ6A 1F3TA 3T05A 1BF2A 2NQJA 3A4XA 3PP7A 3OZMA 4LALA 3ABSA 1M9HA 3TOPA 3AFBA 3H4GA 2W62A 3WH6A 5FACA 3QFEA 3DHFA 2W9MA 4NYYA 3UBPC 2PZ0A 3WK3A 2NUYA 1KQZA 1QBAA 4AEEA 3IGUA 2DT2A 3WQDA 2INFA 2BOGX 4LBRA 4D1IA 4ERIA 4HYRA 1JD7A 2NSOA 1C9WA 3O9NA 2WZMA 3KE0A 3AUOA 1LT8A 1LWHA 2ZZ7A 4HHPA 4M6UA 1D9EA 2PTZA 5IHSA 2QCHA 3GTIA 4HT3A 3WQWA 2EKGA 3TA6A 4YTRA 2J62A 1OZQA 2VM8A 3UD6A 2BFGA 4GKTA 5H8UA 3NCOA 5DMNA 4RXGA 3BC9A 2VUYA 3FDKA 1QASA 1IGWA 2DH3A 1F8IA 3IAPA 3KDOA 2PDCA 2JKAA 3CUXA 3WQVA 3SZ8A 2GJNA 1SW0A 3W88A 4PYSA 3ZT5A 5I78A 2YYTA 1M01A 4WGHA 2VL4A 4LCSA 2V3EA 1JFHA 5BMXA 4DHGA 1BF6A 2QIWA 2CKRA 2JGQA 2W92A 2A6NA 3CK5A 2PZNA 1OCQA 5J5DA 1D7KA 4I8DA 1XPGA 3CQKA 2FGBA 1O1ZA 3BARA 4G9PA 4Y9PA 1UR8A 4C6FA 3SCNA 1XIBA 4NJKA 3CMJA 1LQ0A 3MKKA 3WSUA 4QJ5B 2C71A 3WJZA 1XYCA 4MB4A 2VRKA 2PLKA 1XLGA 3FLUA 1SW3A 2FPYA 5LKYA 1IIHA 1B9ZA 2QPUA 2IKHA 3RU6A 1ZL1A 2DUXA 1KRMA 1IT7A 3GRIA 3DDMA 3TNBA 3FSUA 5AC5A 1XYLA 4K37A 3U4FA 1ODUA 1BVNP 2GDQA 3DYMA 3IIOA 3KCJA 3W7HA 2X1RA 3PR2A 1TZ9A 4LVAA 3TZNA 3STFA 2QJGA 2OZ3A 5EBAA 4EF9A 1UOZA 1KM1A 3TN5A 4O8AA 3BE7A 1R3TA 1ICPA 4Z2JA 3FA4A 2YCEA 1MXGA 2PDNA 1G6CA 2TODA 1BYAA 2BY0A 4M3PA 1AH3A 4V1YA 4KFNA 2PE4A 3EOSA 3SO7A 1P43A 2VZTA 3AXXA 2VX5A 4KESA 4U28A 1X38A 2HPMA 4A3QA 3W1UA 2YL6A 1M7XA 7PTDA 3BLFA 2PURA 2VR4A 2Y7GA 3KZPA 3UNTA 2AGTA 1RD5A 4M81A 4IF2A 1KWGA 3AHZA 5DF0A 3LG3A 1ZBCA 4Q7BA 4O50A 3FJ4A 3TXVA 1MFUA 3CWNA 3VD5A 1PDYA 4GUFA 5CJNA 1Y0EA 1KFLA 1QU4A 3HQPA 3WJWA 3E5PA 4US5A 1IT0A 2BSLA 1I0DA 1W9XA 5DXXA 3UJSA 1CXFA 2YCLA 3L23A 1QW9A 4JTGA 4O1FA 5GPRA 5BRBA 3F2DA 5EFDA 4X2RA 2VEIA 3WF2A 3VNIA 4HNTA 1JGIA 3V4BA 4W5ZA 2IMRA 5A8NA 3FVMA 2KX9A 2OEKA 4NIRA 3PZTA 3U6WA 2J75A 3CJPA 3K4WA 5BROA 1FH8A 2AOSA 1XDLA 3WUBA 4YMZA 2YXGA 2OSWA 1TA3B 1SQ7A 3GLCA 2GOKA 3QGVA 4GYKA 4I9AA 1J5SA 5FF3A 1S5TA 1B2YA 1XUUA 2IQDA 2Y62A 3G2GA 4IPNB 4AG0A 1CBGA 4TXEA 1SW7A 2ZOXA 3C61A 1T8QA 4UMBA 2VZSA 3AICA 3HO8A 2GVJA 1KCZA 1F8MA 3WQOA 1RK6A 3W1TA 4I8YA 1O60A 1XH1A 5A94A 1LL6A 2WHMA 4MB1A 5AZ0A 4ZSUA 1UG6A 4I7WA 2XFRA 2WNZA 3EKGA 3AYTA 3OEXA 2IKIA 4YJ5A 1TR9A 4Z42C 3LBOA 4F0HA 2CW6A 2CWNA 4QDPA 4PB4A 3SRHA 3AZTA 3GTFA 4TOQA 5D32A 3T4CA 3ES8A 2C19A 1E4IA 3WKZA 2XIBA 4QLKA 1JZ5A 4HYWA 4OFCA 1TWSA 5G2IA 5A6AA 1W3JA 5AC7A 1UR2A 5AYIA 4DM1A 1TJ0A 3WQ6A 2Y88A 2MNRA 2W91A 2FIQA 3EX2A 3U2ZA 2AAAA 5HDRA 3DUGA 3LZ3A 1A53A 2NT1A 4GY1A 3UF9A 1A4MA 1WUEA 1QT1A 3VIIA 1X6LA 4XSLA 3LHUA 1GYNA 3VNLA 4PMNA 3DFQA 1JCJA 1O6IA 3V35A 1V0KA 1H60A 3VOHA 1LRTA 2FPTA 4NAEA 1AMYA 3OVRA 3NPUA 2CLOA 4DO6A 1IXOA 5FCZA 1XFCA 3A9BA 3RPMA 2V5DA 3ZJ8A 7REQB 1ONXA 4L9ZA 1BTCA 3CV6A 4MWAA 3RAOA 3HV9A 1XBYA 2YBTA 1QWKA 3EDEA 3CIWA 1F2JA 2YSWA 2OWWA 1JVNA 1QUMA 4ZMGA 3U2CA 1AD1A 4PTMA 1I60A 3I7QA 1KV5A 3MUXA 3N2BA 4BEUA 5PTDA 1RH9A 2EPHA 1XBVA 1FP8A 5GQBA 5KZMA 2QT3A 3DN5A 1X1ZA 1TMLA 2Z1XA 4F40A 2I9UA 3LSCA 4DLFA 4DYJA 1EHNA 1UP3A 2ZE3A 3GBDA 1HKKA 3H7UA 1O94A 2R9RA 4M6PA 4CQAA 1J4EA 4FP1A 1PS9A 1A3WA 2TMDA 4MY8A 1C29A 1F6YA 1B3XA 3ATZA 1OK4A 4M24A 3VOIA 1RAKA 4LNCA 3O6DA 1EX5A 4JX5A 4N42A 2XVLA 1C8QA 3VNMA 4PMDA 1MW0A 1QCWA 3MDWA 4NRSA 4GCAA 3UY7A 2CHOA 2QCFA 3HGJA 3GHTA 3HG3A 2XH2A 2ZADA 3VGFA 3HN3A 3PUOA 1K77A 5XIAA 2VR5A 2Z1KA 2C0AA 3PWIA 1DJQA 1IWBA 1EJSC 1THFD 4INFA 1A47A 4J4KA 1P0DA 4S3KA 2UV8G 1TV2A 5FAJA 2J77A 1FWHC 4DEFA 3CQ0A 3TTEA 3GQYA 5A8QA 2PS2A 1KTBA 1SFLA 2B7QA 3USZA 4JX6A 3F4NA 3K8LA 4JHMA 2Y5SA 4IGSA 1TPFA 3WLLA 3S1WA 4HZ6A 3TDFA 1U5VA 1LCOA 4W4QA 3RG6A 4X3ZA 1XIFA 4FNUA 5HMDA 1H5YA 1KRBC 4HU4A 3M5VA 1Q6OA 4NNCA 1XICA 4PTXA 4PTWA 2X7VA 4ZEPA 4AIBA 2P10A 2I56A 2ZA2A 5IFTA 2YGYA 4DZIA 1ZENA 3RIKA 1AQMA 4U3CA 1SYTA 4PL2A 4R9OA 5LYRA 7TAAA 3N2XA 3M6YA 3EKLA 1CB7B 4F4RA 1ADSA 4DO5A 3BCDA 5FOOA 4LYQA 3SN4A 1JPIA 3WQ4A 1AQ0A 5E9AA 5HPCA 4EE9A 1L2UA 3G1DA 1ZJHA 3AIVA 3E74A 3PBVA 2EPOA 3STPA 5C2GA 3G77A 4XD4A 3VCRA 1RP9A 4V33A 3CWOX 3WNMA 2P0IA 1P0KA 3E3HA 3Q58A 4B16A 3EB4A 1KFJA 1GORA 1RCQA 1PDZA 1NJJA 5CPTA 2IXVA 3K2GA 1LBMA 4RJEA 5EL1A 1EB3A 2GL5A 5A8GA 2G97A 4UQ9A 3CUJA 4WR3A 3LPPA 5G5IA 5I6SA 2A5HA 1E0TA 4W88A 4GYFA 4H9UA 1K03A 2YLAA 4ILSA 1OCBA 5DMLA 3RJXA 3VNDA 1W1IE 2AKMA 2ODOA 3OQEA 2OZTA 2WZTA 1MEHA 2XZ7A 1OVDA 1KLYA 2RH9A 2XSAA 3WFZA 2CBVA 4MIMA 3FW6A 1J10A 1KBKA 1GCYA 1VF8A 4ZO9A 1VFMA 3FKRA 2XISA 1AVAA 3PZQA 2BVWA 1HXJA 3PB0A 3E0LA 3LDVA 3PPHA 3H8AA 3UXIA 1FWWA 4CNPA 3QZEA 1DJNA 4GZJA 1KCLA 3TNOA 4IZGA 3JR2A 5LXXA 3KP0A 3BJTA 3AYRA 1MDLA 4Y7EA 3UG3A 4M19A 2DIEA 2JF6A 4R34A 1OGBA 3F7JA 1MZRA 3TN3A 4IMFA 2QMKA 3CAWA 2X1SA 2QDGA 4AQLA 2NVAA 3N14A 2ZZ2A 4YWSA 5D38A 1ZTVA 3MSDA 3N17A 3RO6A 2H8ZA 4CQBA 1Y65A 1VBUA 1Z6KA 2RAGA 3RILA 4GZEA 3LV5A 3FKKA 2A1YA 2WZEA 1J79A 4FZIA 3OTRA 3WBEA 2Z7GA 1T40A 4I5RA 1I4NA 1RA5A 2NT0A 3SCRA 1VJIA 4XAZA 4IP7A 1OINA 5I06A 1DKWA 3T07A 2E6DA 1MQPA 4H2HA 3TCSA 1RQHA 3VCNA 2ABAA 2GK1A 2NUXA 3EDJA 3GXNA 3P81A 3VIMA 3IVTA 4AEOA 5FF0A 4L6HA 1LRQA 1UH3A 2F61A 2E5BA 3M0JA 1N8IA 5CZ0A 2V6AA 4Q8UA 4HJWA 2WOQA 2YFNA 3QOKA 4MVAA 1SFTA 1XP3A 1ZB5A 3IAQA 4W8BA 4E4UA 1V8EA 3L4WA 3DBPA 4HPGA 1HVQA 1QJWA 1Q8AA 2W66A 1GTEA 1AODA 2ISDA 2OX4A 3NPWA 3ABXA 4XD3A 4NT0A 4M82A 5FA5A 2YW4A 4UTLA 3AIEA 2VEFA 4WSHA 2REQB 3PTMA 2NQHA 4O19A 4MLJA 3DKLA 4DN1A 3LXAA 1X1NA 5CPOA 3KLLA 4F0SA 1M7JA 1V3MA 2ZXBA 3AIRA 3EOUA 4US5D 4JTHA 3BQ6A 1FWJC 1NP0A 5HNRA 4JTDA 2IPWA 1ZBWA 3AIWA 3ZVHA 4JDBA 4GVGA 4Y8EA 1VPYA 3VOGA 2W79A 4MMWA 4J3ZA 3GXIA 5H8MA 1V51A 4JKKA 5G4EA 2J27A 1KTCA 4GISA 2FLIA 5T8GA 1UA7A 5REQB 2BXVA 1TPUA 3SIMA 5LGZA 3LHZA 1VYRA 1G94A 1UH2A 3UZYA 3NZQA 4PMXA 1R9YA 2WSYA 2XTKA 3LM3A 1HJUA 1QI3A 4S3CA 1FHDA 2ZXDA 1WO2A 1S5WA 3PG8A 3I7SA 5KTLA 1EDGA 3RLUA 3PZ9A 3WLSA 3G6MA 1CGYA 3FN9A 1EEXA 4FSAA 5T9CE 4DBEA 5DBTA 1WBJA 4X2PA 4Q6XA 4GD0A 1TCDA 1GQLA 1W9BM 4UBPC 3H2MA 2IQ0A 1XYZA 4XZBA 3EA3A 1MFVA 1XIMA 2R1LA 3IRDA 4PFHA 5DMMA 3ICJA 5D30A 4G8TA 1ALDA 2FVKA 4QNEA 4YWIA 1T7LA 4OJYA 2VKZG 4XZIA 1R2RA 1B4EA 3T6CA 4F2TA 4E8GA 3WNNA 5C8BB 3SFWA 4RZBA 1XDMA 2C1IA 4E3VA 1MUMA 1SO5A 3IJLA 5LIYX 2P3ZA 3GSMA 3EWYA 3M5XA 2OEMA 2WXDM 5JXQA 2WCAA 2OO6A 1UPMB 2VRQA 4UIOA 2Z29A 4W7VA 4OWGA 4OV4A 3MUCA 4HNUA 3VNYA 3CL8A 3QF0A 2JIWA 4M51A 3A64A 2H9AA 1OFPA 3FGCA 2Y70A 2E25A 1FWTA 4QP0A 4NL1A 1OFBA 2XVNA 5BCAA 1YHTA 4L5ZA 5D9NA 1J5TA 1Y5VA 4P7OA 1U33A 1XS2A 2X16A 3HFTA 4FXFA 4JQAA 3FEMA 4XUGA 4JTJA 3CH9A 3UVIA 3S2NA 2YDSA 2J6VA 2NV2A 4X63A 4D6GA 1FWGC 3G1YA 1BPLB 1KCXA 1C8XA 2QAPA 1KO0A 3ZS4A 3RR4A 5I77A 1W9VA 3JZUA 3CB3A 4QCFA 1EYWA 1T96A 1LP6A 3PG9A 2GDUA 2RGLA 4GCXA 1XIIA 3U2EA 2R1MA 3HF3A 3CYVA 2VFEA 1U1HA 5E09A 2WVTA 2W4XA 1E9ZB 4IXXA 1K1DA 1R3QA 2J7FA 2YOCA 4AWEA 2J7BA 3RMEA 4REQA 4DNHA 1TO3A 3CHFA 5LNSA 4GI8A 2BY3A 2GJLA 1BG9A 3ZYZA 4GIYA 1LLWA 5HK4A 3WEZA 1XCWA 2EQDA 1R2TA 2VJXA 5LIUX 4AD4A 4ZR8A 2QDEA 1I8JA 2QCDA 3SY8A 4E5TA 2EG6A 2GDVA 3F2CA 4O54A 4CNOA 4OUEA 3W1PA 4W84A 3GH4A 2F8QA 2DVUA 1CT5A 1P4CA 3M4HA 1EQCA 4O14A 5K3VA 2B7NA 1RCXB 3EAUA 3KS5A 3ITOA 3PZOA 1EX1A 3G22A 1Y5XA 4UNKA 5FF7A 3NVTA 5CJMA 1LQAA 2J25A 4WOQA 1HL9A 1P6CA 2PDBA 3WJYA 5CSUA 1VHNA 2PEVA 2WMIA 4IMDA 2GJPA 1A4LA 4PRTA 1CW2A 1Q8JA 1ZBKA 3T09A 3CQIA 4LNYA 4V1XA 3BLDA 4LUSA 1K8XA 3EEGA 3S5NA 3W7OA 3KS6A 3LNMA 2PI6A 1N8FA 2J7GA 3QM3A 1V03A 1O5RA 4QJ3B 2WNWA 2XIIA 3O15A 1GOOA 3B03A 4WJXA 1C7TA 4O57A 4IIHA 2E5DA 1EL3A 4NJGA 4IFOA 2A21A 1EPVA 1Q6QA 4WY0A 3W2NA 3NFUA 3H55A 3G3DA 2XZ9A 3E0VA 4H7ZA 4DJDC 3GD6A 4N0RA 1R47A 2JK2A 1H0GA 4H41A 4LF2A 7CGTA 1UD8A 2PBOA 4FK9A 1KXVA 1VFUA 2CXGA 5F4WA 3L4XA 1PTAA 5J5RA 1PKYA 3GX9A 3QKEA 2JKPA 4GVFA 3TEVA 4GJIA 1CWYA 2DJXA 3WD4A 4LV9A 4H9MA 2VQUA 4RV3A 1IEIA 1LF1A 3UA3A 3B05A 3LQLA 1FWDC 2OWXA 2QVNA 4K38A 2EEXA 4MJ4A 1MNZA 4ZOCA 4YHEA 3MUZ1 1F07A 4AAJA 4EAMA 1CB2A 3C8NA 3N4AA 5A8MA 4D6CA 2CZFA 3TAKA 5CPMA 2FH8A 5LNVA 3VOJA 1CGUA 4BI6A 3ZMRA 2F2KA 4CCCA 3N11A 3TN6A 4TR9A 3BAXA 3NXFA 3IIPA 3W7GA 1LBFA 2WJFA 5BWAA 2UY4A 5G1MA 2WMKA 3WLNA 2O7QA 2R14A 3WH9A 4LS1A 3B4UA 2VFFA 1F61A 4ZSTA 2QPSA 2NX1A 3F03K 3LU2A 3RX4A 2HPIA 1YXDA 4GZ7A 1JI2A 2YB4A 1GOXA 1NQ6A 3SQSA 3UXKA 3GKFA 4KWVA 1GKPA 3LSBA 1OGGA 4MUZA 3TCEA 4FF7A 4UNIA 1UBPC 5HMEA 4IUGA 1FDYA 5DELA 1MWOA 3KHDA 1NDZA 3QW4B 4U10A 3ZVIA 1HZYA 4JTTA 5JUVA 2TYSA 3U57A 1UIOA 2YL9A 3POCA 1H7XA 3G1HA 2QZRA 4ZOBA 2ZIDA 3VM7A 4C7GA 4XZMX 3NVDA 1VLIA 3WNKA 1JYVA 2JALA 3E2VA 1OC7A 1PAMA 4NAEB 1UUQA 4ATDA 3LBMA 2WSPA 3UPMA 4Q32A 4M5PA 3BAWA 4U5IA 5G4HC 4MWAB 1Q6RA 6ENLA 2OYMA 3BK0A 3UZZA 1UPPA 1W5NA 4F2UA 3VIFA 3ATYA 3RFAA 3A23A 1QTWA 2PB1A 2WJZA 1SVDA 3EWDA 8TIMA 1JDCA 5HUPA 3NO3A 3AYSA 3P0WA 3THQA 4LAUA 3KLKA 2ZA1A 1V3JA 3R89A 2X0HA 3GDTA 4RZ6A 2XDFA 4M8UA 3BLEA 5I0DA 3URQA 4O4WA 3IACA 4HNVA 4PCSA 3GG7A 1GJPA 4XBSA 7ODCA 2YDAA 2X05A 4LF1A 4S3AA 2GSHA 1OX5A 2CHNA 5DCEA 3W7LA 3WNOA 1LOSA 2BS9A 3S1XA 3L2IA 3ARRA 2QGHA 3HGOA 3GW3A 2ZZ3A 2WVUA 2YB1A 3ARTA 5DXYA 1ZLPA 5KETA 3W1XA 5LZLA 4EACA 1GOKA 5CAKA 1WZMA 4TV6A 1GVRA 2G0WA 3CZGA 1S3TC 5CC3A 1GYLA 3KCOA 3ZIZA 5BOFA 2VEPA 4FLOA 1S38A 4ROPA 3BAYA 4OECA 1GKRA 3P61A 1QAPA 3ME3A 4FLQA 3WH8A 4GUJA 1YE6A 4PUUA 1YDVA 2VTFA 3DIPA 2WO5A 3HM7A 1R5YA 1IXNA 4GXWA 9XIAA 1JF6A 1EP1A 1BD0A 3F1QA 3CIXA 1O95A 1LLOA 4KT2A 1ODZA 3WQCA 1DXIA 3OPSA 5TBOA 1DQXA 3HPAA 4FNSA 3NZGA 5C2XA 1WYIA 1E0UA 1DJXA 2PGFA 2QDHA 4JN7A 5D2TA 3NO1A 1IF2A 2ZE0A 1B31A 4MKSA 1ZJIA 3OP2A 5D05A 1A5KC 1V0NA 2PWEA 3B97A 4CD8A 1BGGA 2XFFA 1VP5A 3QV7A 1UWUA 3QFWA 3BSGA 3WG6A 4EAYA 5BXSA 4H00A 2AQVA 5KZ6A 1H49A 3WDRA 2ESCA 2R6OA 3F4DA 1H1YA 1W8SA 4IUOA 1MSSA 4JIIX 3WDJA 4MLRA 4EPBC 1PYMA 1DV7A 3I4EA 3IIZA 4FIRA 3WEOA 5A2CA 3GU9A 1GQNA 4UOJA 5L9FA 2PWGA 1HP4A 2DSWA 4OBSA 2C6QA 3GR8A 3TYAA 4S3BA 1V02E 1GQKA 5DY3A 3UCDA 3VMPA 3IIXA 3LPGA 4Q6JA 2E1WA 3QVQA 4GOAA 1M3UA 1BWLA 4HMDA 1RZMA 3H2FA 4EF8A 4ZODA 2C3ZA 3LTSA 4YHGA 3VX0A 2FZMA 1QO5A 3CV2A 4I9TA 1XINA 4GYPC 1BG4A 4WJ8A 3B3DA 3R4IA 1E5NA 2FFIA 3RM9A 3CAQA 1OX6A 1OFEA 1VYPX 1TV7A 1BAGA 3V1HA 2V3FA 1LOQA 2WSKA 1V0MA 1UQYA 3UXLA 4J3TA 3FX4A 4L7ZA 4YVVA 1XI3A 5A6KA 3W37A 1DWJM 1MMFA 4E3TA 1YDOA 1E6QM 1TRDA 4U5KA 5LHFA 4ROQA 4QG9A 2ZWYA 3U8GA 4DBDA 2J8TA 4EPEC 2OWCA 3AALA 2PDYA 1IEWA 4GIAA 4EPKA 3QHOA 3RGTA 3FHAA 4D1JA 3EA2A 2HVNA 1VCGA 1W8GA 2A7RA 4QDMA 4YVXA 4ZB2A 1JL8A 1YXCA 3SCOA 4IIDA 1I2OA 1OM0A 1I2NA 4S1FA 2RGMA 4B91A 3S5ZA 2HWGA 3G0UA 1QHZA 5F2GA 3WNLA 2VYOA 1F3WA 2JEPA 3NUKA 4DIAA 4F79A 5DCBA 4Q4OA 4WDUA 1SO4A 1PHWA 3ARYA 4GXMA 3O07A 1K7EA 4I7VA 2Y63A 1Z8AA 3GM8A 1GOQA 4RDYA 1XGZA 1NWTA 3ABZA 3KRZA 1W2VA 1IEQA 4UMAA 4WKFA 4IM4A 1MO0A 3U5YA 4PUEA 1K02A 3CHDA 3KUMA 2GK1B 2J7HA 1X96A 2ONEA 2PRLA 3OJGA 3KP1A 3W74A 1BTMA 1Y5WA 3AXIA 5D9OA 4FEZA 5CG0A 4AZGA 3M5YA 4GH3A 5CPQA 1G0CA 4IPJA 1XRSA 3N1AA 1V08A 1I75A 1R3RA 5AHMA 1R8LA 2VGIA 1JQVA 3WYZA 2PDLA 4HZMA 4AEFA 3THAA 5D8ZA 1G4EA 3UNDA 1U1JA 3EWWA 1QW8A 3MWAA 3TJIA 4JIPA 1UIPA 3NGJA 4CQ9A 4JR5A 2EPNA 1Y7VA 1WDDA 4RPPA 4CQCA 2Y8VA 4MAVA 3VDHA 5M1TA 4Z0JA 1HW6A 1GOIA 3TQVA 2J4GA 2C14A 1Q6DA 1OCNA 1H2JA 3K30A 4XO7A 3OIHA 4LOCA 1KBBA 2J9ZA 3BW2A 3MP5A 2EG7A 3ZVHB 4IP5A 4RV8A 4HNNA 2Y85A 1HUVA 3O63A 1GVFA 2Z2UA 3OOQA 3E38A 1S3HA 3T44A 4QE4A 1C8VA 1X7FA 2JQXA 2HMCA 1G4SA 2OZ0A 1TREA 2Z0IA 3FY1A 3AI0A 4O1BA 1OQFA 4UR7A 2GGHA 2PP0A 1C90A 4XZNX 4RE3A 3S46A 5E5CA 3QY7A 1TPVA 4IPIA 1DWAM 1EHAA 2J7DA 1TE1A 4LBUA 4JNYA 1JULA 4GI4A 1BXBA 1ZFJA 4HPXA 4JY8A 1YX1A 3NJ3A 3ITVA 1R3WA 1GYMA 4FPSA 7ENLA 2R91A 3OODA 3W24A 4JAWA 1E56A 1G67A 1TV8A 4IIBA 4C6BA 3S5YA 2F6UA 1S2AA 3ECQA 3DHUA 3NSMA 4HGXA 1NU5A 2F2HA 1PCWA 4JS3A 1YDNA 3LI1A 3S8HA 4C5YA 2UZ9A 1JQXA 3OHMB 1DBTA 1ICSA 4CU6A 1DIKA 4RE0A 1AW2A 3R0KA 2Z28A 2BDQA 1W56A 1R87A 3UPBA 4GUGA 4O16A 2O4MA 2BHUA 1PXGA 4GNVA 2ACRA 5C7VA 1L8NA 5D2VA 2VDHA 1VB9A 2VP8A 4GO8A 1BWKA 5KEZA 2ZVRA 5ABTA 2IUZA 1I2QA 1MW3A 3CO4A 1H51A 3CBWA 2B81A 2Z6IA 3LXCA 3QQ0A 1DIOA 2PF0A 3NQMA 3TJLA 2PDIA 5I3JA 1JIBA 1Z42A 2BV9A 2DQWA 3GDMA 3WEMA 2H9AB 2VGBA 2A4AA 3FGCB 4D6IA 3M0IA 4KRUA 4N9DA 4XVDA 1UWRA 5I3HA 3KOFA 3FV9A 4MTVA 3SECA 4AB4A 3N34A 3L4UA 5HANA 3VX1A 1JZ8A 3KVJA 4O18A 2WPBA 2Y4SA 2D3NA 4K2SA 4J3VA 3BLIA 3LHTA 3ABQA 1KFEA 2F6XA 1XX1A 3KCLA 4I6KA 4CN4A 1BVWA 4XQ6A 4C6LA 4FB7A 4MJ2A 1LTDA 3KL0A 3R0UA 5I02A 3WF1A 3PVFA 5BU6A 2PD9A 2QLYA 4XO6A 4AWTA 1FBAA 3IEBA 3BGJA 1EUNA 1BYDA 3MV01 2XGIA 2CLMA 2PPGA 4HA4A 2DVXA 4NSBA 4OKDA 1A5OC 3CMFA 3KVKA 4REQB 1VCFA 4PB5A 4PTVA 4AW7A 1P6BA 4GACA 2PLMA 2OJPA 3MVIA 3KM8A 4WK9A 4XAPA 4O1DA 4P7NA 2A3HA 3JUGA 4CVWA 1IZKA 3TC3A 1DIEA 4PUWA 2C13A 2PRMA 5AVNA 3HA1A 3S0CA 1GJUA 1JDDA 1POJA 2QCDB 3I3BA 3SEPA 4ATWA 2PU1A 1W3IA 4IT1A 1W91A 2E68A 1Z3NA 5E9XA 5IBXC 5FJTA 3QGKC 4MFEA 4CN1A 3M41A 5AHFA 2Y2WA 3P14A 1ZAHA 4P8VA 3LCLA 4U4MA 1QMLA 1M1BA 3MYOA 3ITGA 1NIUA 1JUEA 4LWWA 1TCMA 3LGDA 4TV5A 2DY3A 1FDJA 1IXQA 4I9JA 2A3CA 4ONVA 3PPGA 2JBMA 2WMIB 4OIFA 1CPUA 3NL3A 1ICQA 4JFUA 3VGEA 4D6JA 5DRIA 3AIUA 5CBIA 5CGTA 4FO4A 3P3BA 3MKVA 1EJUC 2DT3A 3KAOA 2ICSA 3IK2A 4LUSB 4YLWA 3DG7A 1JPDX 4NX0A 1W32A 1EJ7L 4QHRA 1TB3A 1AW1A 4A3YA 3QH2A 4GFIA 4BQ3A 3T55A 3QMRA 1TZ7A 1FFRA 2QULA 1RBLA 2I7GA 1M7OA 3L4YA 4AD0A 3DI0A 4IOTA 4DAIA 1GHRA 1X98A 3S5SA 4WY0B 4LU0A 1XRTA 4RLIA 2O56A 4B5XA 3EWCA 3JW7A 1X39A 1BGAA 2Y8KA 1CEOA 4HKPA 5AOUA 4W85A 3OG3A 3RCYA 3RUBL 3SCQA 4UFLA 3ALFA 4LYKA 3S47A 3NTYA 3ZSTA 3M7SA 3OHIA 2D22A 1B3YA 3M0ZA 4AZBA 3EX6A 1W3TA 1P0NA 3UA4A 1W1VA 1ZAJA 4ZBCA 4OUIA 2VZUA 2W0UA 2YXOA 3SW6A 1WOAA 2WKLA 4Q33A 1W9DM 5D37A 3SCTA 3LHWA 5CQ1A 3QHNA 2OKOA 3IJ6A 2PDUA 3KVMA 2NZLA 1CXEA 4YTTA 2ZC1A 5F4SA 5HMFA 3URBA 3LCFA 4NZCA 5KZDA 5LA2A 1DORA 3UYCA 2Z1VA 2QJNA 2Y7FA 1ONEA 2TAAA 5IHRA 2WM0A 3KL3A 3MSRA 3KW3A 4AMAA 1CCWB 1H7OA 4AC1X 4JCMA 2QIIA 1PKNA 4GWEA 4NNBA 2NXGA 4O4VA 1HJXA 4B2DA 3VGBA 1YRRA 4KRZA 2AQOA 3A9IA 4IQEA 3KRBA 3MMUA 3K4DA 3W7QA 4X0VA 2XJ7A 2BBFA 1WV2A 2B31A 1H50A 3BMWA 3PHAA 5U7SA 5A6TC 3A6OA 4LH8A 4IL0A 2WKGA 3PBWA 2V81A 2I5GA 3WL1A 1ZJBA 3WLIA 4ZCWA 4HPHA 5JIPA 1X1OA 4YTQA 2QDDA 1PKMA 3TC6A 1FRBA 1J18A 5CLWA 4LV4A 4IIEA 3MUY1 3KBNA 5HWJA 2BY2A 2VEMA 1EXPA 2FKPA 3STGA 3E1F1 1K9TA 3CUZA 4HTBA 3SCWA 1NAL1 1JYNA 1CLVA 3VIPA 3H53A 4D6FA 3W71A 3P5ZA 1SZEA 4LVBA 4PCFA 1VFLA 4IMAA 4B9ZA 2QUTA 3AQUA 3NWRA 1EO7A 2A3LA 5AYZA 3WLHA 1T99A 4X9YA 1TQXA 4DPQA 5ABEA 2X1UA 4L64A 2AKZA 2E3ZA 3PZIA 4WOZA 4JEQA 1RUSA 3ELFA 3W2LA 1SJBA 3IJ7A 1LYXA 1OBAA 4MJMA 1O5KA 4F0MA 2XWEA 1EGVA 2OKTA 1H3GA 1XCFA 2J78A 1O7AA 3CPUA 4X0NA 4BQ2A 5TIMA 3G1FA 4XBJA 3GVRA 1A5NC 2CESA 1QHPA 1GW1A 1FWRA 4C60A 1SO3A 4JTEA 4DJEC 2V30A 2E9BA 2Y8UA 2CXEA 4LJ3A 4WKHA 4R5EA 3UGVA 1DXFA 3BXWA 3H7RA 4BY3A 2V9DA 4ZQRA 3B9NA 3HPZA 1UOKA 4EX4A 5ENLA 4DNMA 3Q65A 4BFAA 3NM1A 4KEZA 1XDJA 1J8VA 3CUIA 1GZGA 3B06A 3S3GA 3L5LA 3PZVA 4HNOA 1LWJA 5J04A 2YZ5A 3HFYA 4PH6A 1WDWA 1Z69A 3MUAA 2B0MA 1EJRC 4W7WA 3NQCA 4LUY