3WK1A

Wild-type orotidine 5'-monophosphate decarboxylase from m. thermoautotrophicus complexed with orotidine 5'-monophosphate ethyl ester
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
215
structure length
215
Chain Sequence
VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Substrate distortion contributes to the catalysis of orotidine 5'-monophosphate decarboxylase.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
total genus 88
structure length 215
sequence length 215
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3wk1A00
5D32A 2H90A 5AHFA 1B4EA 3L68A 3SIZA 3O16A 3W75A 4XWUA 3G18A 3G1DA 4O18A 4TO8A 2FB2A 3PB0A 4LU0A 4TR9A 1OJXA 2D73A 2CLKA 3GAKA 4IMDA 2E5DA 2G95A 3N2MA 1QNVA 3WK2A 3TX9A 1RVGA 1HO4A 3W1UA 1W3IA 2Q3OA 1QO5A 4LTSA 4XZ9A 1H61A 3DHDA 1F76A 2WV8A 5BMXA 3THQA 1LLWA 4JYEA 1GQNA 1PVNA 3MYPA 3S5OA 4MYXA 3CPRA 4FNTA 2YFNA 1I2QA 3W07A 5J5DA 1O5KA 2B0MA 3LI1A 2FFCA 3M44A 1OYCA 3LLDA 3UWYA 3A23A 3IIOA 1KFKA 1O4UA 4E2BA 3IIZA 1DVJA 2YSWA 4DF0A 3MHUA 1AL7A 2QCDA 4WQ6A 3C4UA 4XTIA 2FB3A 2J24A 3UWZA 3AO0A 4AHPA 4GJ1A 3EX2A 2ABBA 3VKJA 3LCLA 3VI2A 1Q6LA 2WO5A 3I7QA 3LCWA 5HWMA 4GXMA 3EWBX 4JDBA 2C0AA 3HGSA 3W7HA 5F4WA 3VE7A 3A9IA 4O1DA 2BZNA 3R12A 3S6DA 3NQEA 4HPXA 5HUPA 3BLEA 3NL6A 3TCEA 3IV3A 1VRDA 4I7WA 1GVOA 5E1QA 4JYDA 5CPLA 3UQNA 1FWTA 4AB4A 1H7XA 1FQ0A 4KFNA 1XCFA 4WOQA 1OFBA 1ICPA 3CHVA 4LRTA 5AYXA 1VCVA 3UPBA 3TU9A 5DCBA 3W7KA 3LCIA 2TRSA 5AYYA 2CLLA 2XN0A 4MOZA 1GTHA 2R14A 1VCGA 4UUIA 1IXQA 4NJHA 4BF9A 3P74A 1ADOA 4XKYA 1PHQA 2ATSA 3UXAA 1PCWA 3A5FA 3PWAA 4FNSA 1XBZA 3KRZA 4XTDA 7TIMA 4QSHA 3TNOA 3CB8A 4K39A 3TQVA 3F4WA 3I68A 3C3NA 4MIMA 4O4VA 3TQKA 3L0GA 4K7YA 3I6RA 1VQTA 3QQ1A 3HG5A 2NZLA 5FESA 3NPWA 4P61A 2YYUA 3TJLA 1AL8A 3GDKA 3TV8A 3S5NA 3OVRA 5CPNA 3WK3A 2VENA 4AEOA 3RK8A 2Y7GA 5AOUA 4CQ9A 1FCQA 2OCZA 4MY1A 1T96A 4HIBA 1OABA 3P81A 3B4UA 4OBTA 3MBDA 2A21A 1SQ7A 2Y63A 2QJGA 3PULA 3BW2A 1WX0A 3BLIA 5G1YA 3LXBA 1D9EA 1SO3A 2B7NA 2AAMA 4MY8A 5DXYA 4BI5A 1SUXA 3A21A 1ZHAA 1UB3A 1RQEA 5AN7A 3W1PA 3W7OA 5CGQA 3SSJA 1XC4A 2VELA 3P82A 2NUXA 1TTQA 3LV5A 3GDTA 2ZA1A 3NQGA 3G8RA 2C14A 3WJWA 5EBUA 3QPYA 1IGSA 1ME7A 2ZCGA 4Z08A 1YYAA 2ABAA 4HT3A 3SI9A 4AMAA 4DQWA 1VZWA 4BK9A 5F2LA 3W1MA 3LHVA 3LHWA 4Q4KA 3LB0A 2ZZ2A 4M7SA 3W83A 4GUFA 2VFIA 5F2GA 2FPTA 4N4QA 3TFCA 5AC7A 2WKJA 1VCFA 4WUIA 4KKXA 2B4GA 3TC7A 3ZR4A 2QJIA 5FEZA 3H55A 4WXZA 3SY5A 4UTUA 4K37A 2A7NA 1NSJA 2GPTA 4RR4A 2E09A 1LOSA 4RCXA 3F1QA 2C19A 1YLVA 3W1AA 4UCGA 3IVTA 3KVLA 1ALDA 5I3GA 1Z48A 2Z6JA 3W88A 1XDMA 4GUHA 4JTHA 3LHYA 2YXGA 1DORA 1BWKA 1YXYA 2YYTA 3QF0A 1I2OA 3LLFA 4O1AA 4O16A 2WNZA 3LHTA 3FLUA 2FQIA 4AWTA 1JVNA 1P0NA 3LGEA 3N34A 1L6SA 4IPIA 3TMQA 2Z1BA 3GZ3A 3LXAA 4H6KA 2DORA 2PRLA 4I7VA 1OHLA 3I7RA 2HMCA 1W5PA 4O1BA 5C2XA 1RR2A 4Y96A 3CEPA 4XUGA 2E5BA 3N14A 4JY9A 4JNMA 2A7RA 4O50A 3QYQA 1LRTA 4CCCA 3E02A 4UFJA 2ZDRA 1SSGA 4QISA 4IX2A 3EWZA 3MMTA 5KTLA 3B0UX 4YLWA 1TYGA 3WJYA 2FIQA 3MO7A 3W7MA 5EMUA 3O06A 3TROA 1K7XA 3EX4A 4EF8A 3EXSA 3FJLA 4UTMA 4LS2A 2PC4A 1S5WA 2QF7A 5L6UA 4CNPA 3CT7A 5K9CA 4N9CA 5U7SA 4QM1A 4DPPA 3ZFHA 4PH6A 4MKNA 2ALDA 5FEWA 1SW0A 2CZFA 3W1RA 2YR1A 3R89A 2Z2UA 1K8YA 2BX7A 1IF2A 1ONRA 2VFEA 4A29A 3ZS4A 2DZVA 3JR2A 4KWWA 4DF2A 4UMAA 1V7YA 4IMFA 3EXTA 1WXJA 3CEUA 2E6DA 1C9DA 4ZL1A 5HJLA 3W7IA 1NAL1 1THFD 3G1FA 3P61A 1F2JA 3FJ6A 3U8GA 5AHMA 1PCKA 3W1LA 3HGRA 3M41A 3GR8A 2V5BA 1F74A 2CZEA 2QAPA 2Q8ZA 1QPQA 4ZQCA 2ZBTA 3NM1A 3TXVA 4LV4A 1LM1A 1KTBA 3L0KA 4K38A 3TQ0A 3TXZA 1FY6A 1YPIA 3BG3A 1TTPA 4LRSA 3O8AA 1H62A 1TV5A 5BRBA 3TAOA 4IMCA 1Q3NA 2GQAA 1JCLA 3P62A 3CM4A 1X1OA 3N3MA 3W7LA 3GVGA 4UFHA 2Q8LA 2BXVA 3L2IA 4AWSA 3S9YA 1YXDA 2ZRZA 3M9YA 1TSIA 5F1UA 1GYNA 2R91A 3PG9A 3JRKA 4RK8A 4K36A 3MHGA 3OHIA 3NQ8A 2VFGA 3NZ1A 4O15A 4O17A 1HL2A 1H63A 1B3OA 4HKPA 4TX9A 3W2LA 4RXGA 5LNSA 4WXYA 5F2IA 1W1ZA 2R94A 5A5WA 3EX6A 2O7SA 2AQWA 1C29A 1ZCOA 1TPFA 1LDCA 2R8WA 3STCA 4JX5A 3ABQA 3P84A 4RKAA 4P2VA 5DCEA 3PM6A 3M43A 2A2IA 4QITA 1JQXA 1QOPA 2VXNA 2O7QA 4ZVJA 4HHPA 2E1DA 1BKSA 3DFSA 2ZTJA 1TO3A 3QW3A 4NUWA 3O6DA 3UWQA 4K8EA 3TR2A 4NZFA 3W2MA 3SZ8A 5FF4A 3LRMA 3G24A 1HG3A 2TMDA 1SZNA 1Q6QA 3BVJA 1RQBA 2W0UA 3B8DA 4KFOA 3IGSA 1VJIA 2GUUA 4QNEA 3V1PA 4DBEA 4EWND 3R13A 4QJ1A 2GVLA 1NEYA 3H53A 1GG1A 4HNVA 5AHNA 5TBOA 4B5NA 1W5NA 3G1VA 1H50A 4LVBA 2Z6IA 4N9DA 1W5OA 3BV4A 4NT0A 4LC8A 2DZPA 2VEIA 4X22A 1L2UA 4C1KA 3BG9A 2J6XA 4FF7A 3MI2A 4JTFA 4A2SA 4WY0A 4EVZA 1O60A 4LWWA 4IXHA 1NVMA 3I65A 3FFSA 2I14A 4Y6GA 3VCRA 2ZZ5A 1R2RA 4OWGA 3K30A 3NVTA 3QC3A 4Q33A 4WJEA 3M47A 3KOFA 1DBTA 5G2WA 4N9EA 4HPJA 2Y7DA 2Y6ZA 3W1NA 4UTLA 1JULA 5DCDA 3PBVA 1S5TA 4MPQA 5H2ZA 3S8HA 1I4NA 3ZWTA 4JX6A 4ADUA 4CLMA 5G4EA 2QCCA 1UJPA 1W5QA 3EEGA 1X6UA 4S2BA 4ONVA 3A22A 4RLIA 1LCOA 1TPEA 2P10A 3KVMA 2KZHA 2ZRWA 1GVSA 3GK0A 3DU0A 3PR2A 5FEXA 1TPVA 4JTGA 4M5PA 3RU6A 2HSAA 1TTIA 4S1FA 1WOBA 4O1CA 4R7JA 3NEVA 4IX0A 2QCHA 2CLEA 5IBXA 2A85A 1QPNA 4PEKA 5LZLA 1LZOA 5F4XA 5LKYA 3SGUA 2F7FA 4AF0B 2E5CA 2ISSA 1RPXA 3W84A 3P60A 3LI0A 2BSLA 1G67A 3GLCA 4DXVA 3STFA 5EY5A 2ZZ6A 1R30A 4GFSA 4FXRA 2EKCA 1XDLA 5LNWA 1EP1A 1WBHA 3T40A 4I9AA 5FF7A 5F2MA 1WAUA 5CZ0A 2WQPA 1Q6OA 1SZFA 2RFGA 1KA9F 1SSDA 1FCBA 2DP3A 1TRDA 2X1SA 1TPC1 3ABSA 4ML9A 4LOCA 2QCDB 2V5LA 4FNQA 4N2YA 3TE9A 1TREA 3S5ZA 3ELFA 5C54A 3CWOX 4O13A 2NUWA 1SO5A 4HN4A 4UFIA 1Z41A 4Z0JA 3T4CA 2XN2A 4OQVA 2CLIA 1Q6RA 1R46A 1FWSA 1AW5A 2V8ZA 4OV4A 1GG0A 1LRQA 2X16A 1OFQA 3O05A 1JQVA 4GE8A 1XFBA 4N9BA 1OK6A 3MJYA 3U2OA 1PS9A 3GDMA 5CZJA 1R2SA 3MYOA 5DY3A 3P8JA 4ADTA 3BPWA 1KFJA 6TIMA 4FX6M 3QRHA 4WY0F 4X2RA 3E9AA 1TQJA 4NU7A 2JK2A 1TPH1 2EAWA 3PBYA 1G4SA 1EUAA 5TQLA 1SW3A 5HMSA 1KFEA 3FKRA 1JRCA 2EPHA 3HGJA 3W85A 1EP2A 3HOJA 5AC6A 1SFLA 1TPB1 2A4AA 2ZRVA 1W5MA 1A50A 4XKYB 2PE4A 4Y8FA 3W2JA 1YDOA 5KZMA 3LBCA 2CZDA 3DFNA 2OT1A 4GUIA 1H7PA 3PUDA 1UBSA 5C6MA 1X1ZA 2NWRA 1SPQA 3QJAA 5FF3A 1ICSA 3HIJA 1ZFJA 2V0TA 3IEBA 2RDUA 4RJEA 1TPWA 3LCXA 5CZSA 3PY2A 2A6LA 2NWSA 3DFTA 4MZYA 3OIXA 1LBMA 3P67A 3PAJA 4UTHA 3MI3A 1DQWA 2VFDA 1W3NA 2A0NA 3OA3A 3OG3A 4MLRA 1EA0A 1LOLA 3WK1A 1ZALA 2QAFA 1KM1A 5DY2A 4X3ZA 1OVDA 3D0CA 4RZ5A 2H3BA 4UR8A 2H6RA 4FIQA 4EOUA 3G1XA 3C2RA 4R34A 3LCHA 5AHIA 3L9CA 1H1YA 3NPVA 4Z1BA 3TDFA 4RV8A 2V30A 1MXSA 3TW7A 4E38A 3IIPA 3W71A 4UFMA 4YL2A 1MEWA 1GYLA 3W1QA 5C55A 3C2EA 3S1UA 4A3UA 4K7VA 1NFBA 2FDSA 3GKAA 1ZAJA 1XBXA 3WJSA 3LERA 4OHQA 3E0IA 4LVAA 3MUXA 3S0CA 3GKFA 1JCMP 2E6FA 5D2XA 2A7PA 1ML1A 2EGZA 4IMGA 5IBXC 1KV5A 2PURA 1XUZA 1TJPA 3S1WA 2C6QA 1LROA 1KTCA 2FLIA 3W2UA 2QUUA 4MUZA 2NXHA 3VFLA 4CNOA 2YW4A 4JTKA 2I9EA 1ZY9A 2YGYA 4OE7A 2RDTA 1UUMA 3A24A 4IGHA 5ABTA 2NX9A 2A5HA 3HJZA 4JN6A 2J88A 2ZRXA 1X7FA 3L65A 4O28A 2VFHA 2B7QA 1W8SA 2WSQA 1XI3A 3EB2A 1JCJA 3NAVA 3VNDA 4UTWA 1XL9A 1G4EA 4FX8A 1K7FA 1JJKA 5C5YA 3NL5A 3H54A 2ISWA 3G0SA 3QSTA 3DAQA 3CU2A 3L67A 3W72A 2VEKA 2CU0A 3LDVA 4FNPA 4XQ6A 1A5AA 2X1UA 5HQEA 5K4XA 2NLIA 1LYXA 4LS0A 3WJXA 5K3VA 2Y88A 3MP5A 3KAOA 5LGXA 5D09A 2YPIA 1M5WA 1IIHA 2NX3A 2QCLA 4IMEA 5DBUA 1YDNA 3WK0A 1FDZA 1U83A 2Q3RA 1UASA 1EIXA 2DU2A 1WDWA 3UZJA 3W7RA 4O57A 4NJIA 2ZZ7A 2RKXA 4Z1AA 4OT7A 3IVSA 3OVPA 1FDYA 1FCVA 3BG5A 2OZ0A 4IJBA 3DI1A 2ZFAA 1GT8A 2JKPA 3PSWA 4YCOA 3GXTA 3QH2A 1YTKA 5KZEA 3SR7A 1QCWA 1JCNA 1BTMA 5I3JA 3L0NA 1FWNA 4Z1CA 3T78A 5CSSA 3TFXA 4L4LA 3W7DA 1OX6A 2QCMA 3N2XA 1IIGA 1OFAA 3PS7A 3Q37A 1U5JA 2JBMA 4A21A 4G1KA 5H91A 2H8XA 3NDOA 1MEIA 1R2TA 4KFPA 4O53A 3O07A 2Y70A 5D2VA 4D2JA 3C52A 3G1AA 4NZJA 2G5WA 5DELA 2YZRA 5I3KA 3NXFA 1AW1A 4O10A 3QQ0A 5G1TA 1OFEA 5LSMA 3NQFA 5D33A 1OFOA 3LHZA 1KLZA 2JGQA 2ZTKA 5AHEA 4MFEA 2DZSA 4ZQRA 5CKSA 3PSVA 5EPDA 3UD6A 4EIVA 2WSYA 1KV8A 2CFFA 3RLUA 1FWRA 2VEPA 3M6YA 4MYAA 3E49A 3IIVA 1GEQA 2V2HA 3TSDA 4M19A 3KXQA 4JX4A 3SW6A 5KSWA 3E12A 1OFPA 3R8RA 1IXPA 1PV8A 2RH9A 3KVJA 2FPYA 3BLFA 3UY8A 5MHBA 3CQ0A 2ZA3A 1XUUA 1LORA 5K7JA 1K8ZA 5FF2A 4HSNA 3LRLA 4NNBA 4TMBA 3W23A 3M7WA 4JTJA 5LHFA 3NQ7A 5LNUA 1H7OA 4IWWA 3RFAA 2I1OA 4JYFA 3FS2A 1B4KA 3IRDA 1LP6A 1UCWA 4XBSA 3P5ZA 2QEZA 1EB3A 3NQDA 1G6CA 3CIXA 3PUOA 1WQ5A 2A6NA 1VYSX 3GXPA 4JTUA 4DBDA 4NX5A 1GWJA 3OEXA 2V9DA 1CX9A 4X9SA 2QJHA 5I3HA 2CZ5A 3WFAA 5BNKA 2DZUA 3P7YA 5SWUA 2QUTA 4NXSA 1NF0A 3NM3A 5IM51 2X30A 3B05A 3B06A 4PL2A 4PCFA 1KM5A 4R33A 5I3FA 1B9BA 1RD5A 3TAKA 4LS1A 5DXXA 4ZQPA 3PBUA 3GXNA 3OVQA 2GJNA 1C8VA 2G96A 1G69A 3QFEA 3FIGA 1TV8A 4CNNA 1P0KA 4UTWC 4AHQA 3KX6A 2ZZ1A 3LX9A 2HTMA 2C3ZA 3Q58A 5HINA 3B0PA 6ALDA 3HGOA 3O6CA 3CC1A 1W56A 4J9JA 4AXKA 2QCEA 3LRKA 5AB3A 3NQAA 1LBFA 3PBWA 3LOTA 3W7EA 1KFLA 3TH6A 4M7TA 1E51A 2BWGA 3EWWA 1MSSA 2QCFA 3BO9A 5F4SA 1QPRA 1WA3A 2Y85A 3B0VC 4K6AA 1KFBA 1TQXA 2WNNA 3MI6A 4LNYA 3DZ1A 4MY9A 3W7QA 4JTLA 1FXPA 1WYIA 4YMZA 3HO8A 4Y90A 2V2CA 4PA8A 4IQLA 1VLIA 3EWUA 4Y9AA 3DENA 3CIWA 3NQVA 1YPFA 4ZMGA 3SECA 1GZGA 3L5LA 1W0MA 2WJZA 1K3UA 1JCXA 3BW4A 2DJLA 1GVQA 4A22A 3IVUA 1P5BA 4WY0B 1XBVA 2B7PA 1GOXA 1OX4A 3LCFA 1FWWA 3NL3A 1KM4A 3ABOA 1V5XA 2JKAA 3P8IA 1TRIA 2PRMA 4O12A 5K2ZA 3NQCA 3DXIA 5D37A 5E0KA 1H5YA 1KW1A 3WJZA 1FBAA 5KMYA 4UTJA 4DO5A 5L9FA 2UV8G 3C2FA 3TKFA 5LGZA 1HFBA 2DZTA 3W74A 1G4PA 4GUJA 5CPOA 3M0ZA 4H4IA 2YCEA 1H60A 1K03A 2E6YA 3NA8A 2VKZG 1YDVA 4O0ZA 2Z0IA 3DFQA 1A5CA 4M6QA 1EEPA 1ME9A 3PC0A 3T7VA 1RZMA 5DBTA 3QZEA 2J9YA 3NZRA 1OFRA 4GUGA 4MZ1A 3NYZA 2ZRYA 1T8XA 1DL3A 1H51A 2ZA2A 1SW7A 4UTTA 4BFAA 1CI1A 4POCA 5J5RA 3W2NA 1OK4A 4MFDA 4TU1A 1YADA 3O63A 3MP4A 1F6PA 1JUEA 3IIXA 1VGAA 3O1NA 1O94A 3KRSA 4O11A 1OF8A 2QDGA 1OYBA 5LNVA 3DKLA 1ZENA 3NQMA 1LLZA 3LBMA 3LTPA 3L66A 2PCQA 3EX1A 3QM3A 2OX1A 2PRHA 2WNQA 2ZYFA 4LUJA 1F73A 3RMJA 5DLCA 4W9TA 1F6KA 3W3OA 5KINA 3HB9A 2FJKA 4N02A 3P5YA 2BLEA 5I3IA 5D38A 1WBJA 1GTEA 5AFDA 4MJMA 2GQ8A 2P0OA 1T0OA 4AF0A 1TIMA 1IXOA 2Y7EA 3E96A 4N6FA 2VFFA 4CQ8A 3HQ1A 3YPIA 4ALDA 1LTDA 3KVKA 5K4ZA 3STGA 4ADSA 4NVTA 2V82A 3GIYA 3UY7A 3N73A 1QMLA 2P1FA 1J5TA 4JTSA 1OG0A 1X8FA 1M7PA 5G5IA 1KFCA 1RV8A 4AWUA 1A5BA 1XXXA 5F1VA 1I2PA 3NQ2A 3W73A 4FX7A 3B03A 3DHFA 3GYEA 3GDLA 2E77A 1LRNA 4FXSA 5AHLA 2YFOA 4MLJA 2YX0A 2W79A 4WZHA 1KM3A 1TV7A 1ME8A 4HSOA 4U4MA 4LVDA 4WX2A 4JS3A 4PL1A 3JS3A 1SO6A 4FNUA 3S42A 3QW4B 3EX3A 4I7UA 4FB7A 1Y0EA 2W6RA 5BOOA 2H8ZA 1OFDA 2QR6A 3G1SA 1SFJA 5TIMA 3DFPA 2TSYA 3G0UA 2H3DA 5EL1A 3G8EA 4O14A 2Y7FA 3UWUA 3FEMA 1S3HA 3MW7A 3TK7A 3SGZA 2BTMA 5U4NA 1QFEA 1XKYA 4ZQOA 3UPWA 3CLMA 5D30A 2GVJA 1QWGA 3G1YA 4IPJA 1XM3A 4YCPA 4O8RA 2ZRUA 1I2RA 2J9XA 1YXCA 1GPWA 1WOAA 3T55A 4CQAA 1DQXA 1EWEA 4ZZ9A 4AHOA 4NQ1A 3F03K 3UXDA 5EA9A 2J9ZA 5D2WA 3W86A 2ZZ4A 1RQHA 3M16A 4DO4A 4RX0A 1A53A 4GWEA 3HPXA 2J27A 4ORMA 3G1HA 4UIOA 1DV7A 4JXCA 1O5XA 5CPMA 4JTIA 4M6PA 3SFKA 4N6EA 3EWYA 1MEHA 4JR5A 5GVJA 4JY8A 4JIQA 1BEUA 3M5YA 3EXRA 2GQ9A 5K9DA 3MWAA 1VYPX 4O54A 2CLMA 3W70A 4LC6A 1W31A 4DPQA 1N55A 4UTKA 1I8JA 1P4CA 4JIPA 2WOQA 4ZQMA 2X1RA 1DOSA 1FUYA 1VR6A 3HPZA 3IGXA 3GR7A 2V81A 4TIMA 1Z44A 1EX5A 4NJKA 4RZ6A 3GNNA 4OU1A 1GVFA 4UTTC 1SU5A 1MZHA 1TTJA 2DJXA 4YWIA 2QUVA 4LT9A 4LY8A 2C16A 1HO1A 2DZWA 5CZTA 3TSMA 1P1XA 2ZQ0A 1G7VA 3V75A 3W7GA 1ZAIA 3HPSA 5E93A 4LUIA 3HG4A 3LTSA 2NV1A 3GDRA 4QIUA 2DZXA 3TIMA 1EP3A 1TJRA 2NXGA 4N4PA 3B04A 1TCDA 3NO5A 4WOZA 3RF9A 4AAJA 5D04C 3DI0A 3M5XA 4E0CA 1J2WA 3F4NA 2OJPA 1K7EA 1OF6A 2CLFA 2QKFA 5EYWA 3W2KA 3OBKA 3C8FA 2QDHA 4Z0SA 4U28A 3UWWA 3BGJA 4FEZA 1B57A 3TSBA 3BW3A 4GRSA 4E2DA 4C1LA 3GB6A 2HS6A 3FYOA 1KM2A 4QNWA 4GC4A 4O0KA 1TPUA 3W76A 3FYPA 5A8GA 1GJPA 3THAA 2XFWA 3EKZA 4YXGA 1PL9A 1QO2A 3TJXA 5LNRA 2X1TA 3R2GA 2AGKA 5G2IA 1HTIA 5D05A 1FX6A 3O15A 3M5VA 1DJQA 3ABRA 1TMHA 5G4WA 3C6CA 2CW6A 3INPA 4IOTA 3TMLA 3PG8A 4K8HA 3LCGA 3M1ZA 3HMJG 2C1HA 3VE9A 4DEFA 3BGGA 2TYSA 3LM7A 3S1XA 2B7OA 3PUEA 2QCGA 3ATZA 4UMCA 3HG3A 3DH7A 5D2TA 2C15A 1KBJA 4LVFA 1WV2A 4LW7A 4UFLA 4GBUA 2Y89A 3NR0A 1H7RA 3W1TA 2RDWA 1JR1A 1XBYA 1H1ZA 5EKYA 1AW2A 1SZGA 4BWLA 5D03A 5KZDA 2FTPA 3HBLA 4WD0A 1DHPA 1W54A 2A1YA 3L5MA 3KHJA 4JICA 4TMCA 3M5ZA 3NOEA 3LHUA 3NPUA 4JD4A 4ORIA 3W22A 5DN1A 4FNRA 2LLEA 1CW2A 4AVFA 3HG2A 4FO4A 2F84A 1VS1A 1M6JA 1H7WA 2X2GA 1QDSA 1T99A 2YDAA 4DF1A 1ZAHA 3C56A 4NJJA 4QQ3A 3MHFA 4CCEA 3DKJA 4HNTA 1I45A 2VOMA 3W6YA 2GVGA 3GAYA 1LOQA 2VC6A 1KBIA 1UUOA 1W3TA 2Y61A 4UXDA 3UZ5A 5KITA 3C0JA 3Q2DA 1VLWA 2NXIA 5CG7A 1ZJIA 1AK5A 2GJLA 1JUBA 3GNDA 5HULA 1G4TA 5HUOA 4BI6A 2YW3A 4RXFA 4DO6A 3NGJA 1BWLA 3TC6A 1AG1O 4Q32A 3W7PA 4MZ8A 1KM0A 3QMTA 4MJZA 3S1VA 1I2NA 4R53A 1EWDA 2G97A 1QAPA 1NF7A 4JTEA 2ISVA 3T44A 4DELA 1AMKA 3NNTA 1OX5A 3QMRA 4PC8A 3ZWSA 3ANYA 4BR1A 2NV2A 3UNDA 1EPXA 1O95A 3N9SA 1W37A 1J4EA 2ATMA 4EF9A 1KLYA 3ATYA 5D02A 2Y62A 4AH7A 4NX0A 1D3GA 4RZ4A 3R5EA 3PF3A 2NX1A 3C2OA 2JGYA 3QPZA 4NNCA 4UTIA 1D3HA 5FI8A 1TPDA 3QSRA 3L21A 1L6YA 1VYRA 1VC4A 2NUYA 1VHCA 3TA6A 4UNLA 4S2CA 1G7UA 3LXCA 3C2VA 3L5AA 3W1XA 4IUOA 3CWNA 4ICNA 5G2HA 2XN1A 4UNKA 2V2DA 1Q45A 1S5VA 3C61A 4L4MA 1YTEA 4UMBA 1JCYA 3AJXA 3G0XA 4NXKA 1SO4A 4JGDA 4BI7A 3LTYA 5FEPA 1HUVA 4UR7A 1YTDA 4MVAA 1SZEA 3RNDA 3STEA 1F7BA 3BARA 2CLHA 2C18A 1R47A 3NQ6A 1Z42A 3NL2A 1L9WA 3O6YX 1JRBA 3DFOA 1OYAA 5K9XA 3KRUA 3UWVA 5LHEA 5BMWA 4QAIA 1A5SA 2CLOA 2EHHA 4UC5A 4Z1DA 2E6AA 1FDJA 3N19B 1KM6A 8TIMA 3W7CA 1KTNA 3CTLA 4O52A 5HR6A 1PIIA 1PE1A 1F5ZA 4LV9A 1L6WA 4O19A 3FOKA 4FIRA 3I7SA 3LV6A 3SJ3A 3W7NA 1LBLA 1N7KA 3KFTA 1N8FA 1OX4B 3W87A 4PODA 2EF9A 4NNAA 4CCDA 2QCNA 4XBKA 1SR9A 4BWLC 5HWJA 5T26A 2VEMA 2JKEA 4JTTA 3A5VA 3DGRA 3PVFA 4A2RA 1DJNA 1MO0A 1VHNA 4IXXA 1QR7A 3FKKA 1M7OA 3FA5A 5FF0A 3TUUA 3P80A 4UFKA 2HS8A 1VH7A 4GNJA 5HWNA 4OGZA 4PTNA 4HNUA 3QEZA 4JEQA 1VPXA 3RLVA 3USBA 5HNRA 1EUNA 1QOQA 3S5YA 2IQTA 3EKLA 4FHAA 4LVGA 4HNNA 1GVRA 3DBPA 5AC8A 2WPBA 3IGUA 1H7NA 3PB2A 3QMSA 5CSRA 3HF3A 1QPOA 2TPSA 4KWVA 3W7JA 3G3DA 1K8XA 4ZQNA 5AYZA 2OT0A 2E68A 2RHGA 3G3MA 1ICQA 4H3DA 3GX9A 3MBFA 4O4WA 2WSRA 2C13A 1K02A 3Q94A 1PHWA 1JUKA 3UYCA 1FXQA 1F05A 3TW6A 5BW6A 5HR7A 3U6WA 3G22A 4OV9A 1IXNA 1FCUA 3N9RA 3EWXA 2OMAA 3NG3A 3NPXA 3BK0A 2FPVA 4PFMA 1DKWA 4M6VA 1TB3A 2CWNA 4NJGA 5D2YA 4JDYA 1ZNNA 3W9ZA 2GOUA 3MP3A 2ZZ3A
chains in the Genus database with same CATH superfamily
4J4KA 3L68A 3W75A 3G1DA 4O18A 2BASA 4L9XA 1S2VA 1OJXA 1EC7A 3N2CA 3C5QA 2G95A 3WK2A 3TYEA 3W1UA 4ZFMA 2Q3OA 4UB9A 1XX1A 1H61A 1YPXA 3H7VA 3WKZA 1SM9A 4QG6A 3CUZA 5C2CA 1Q7MA 3E1F1 2HDJA 4JYEA 1ISVA 1V8EA 1UR9A 4FR6A 2KAUC 4GVIA 2W66A 1CGWA 1HJSA 1I2QA 6CGTA 3G5EA 2V5CA 3CO8A 5A8NA 2P8BA 4FXFA 1OYCA 3LLDA 3UWYA 1KNWA 4MB5A 3AUOA 1DIDA 1AZ2A 3SIMA 2WMIA 3L4ZA 4E2BA 3BE7A 4S39A 4Z2IA 1UD6A 1J8VA 5H6HA 7REQA 4P8UA 4X0VA 1UPMB 4EXAA 4P7LA 2HZGA 2J24A 3UWZA 2R1MA 4AHPA 4GJ1A 1M68A 2PDKA 2PDYA 3VKJA 3THCA 2OVLA 3CUXA 5FJPA 5J8LA 3VI2A 4OFCA 4HK5A 1Q6LA 2WO5A 4WIWA 3I7QA 4FOJA 4PCTA 4WF7A 3SQMA 2BY0A 1V3IA 2GUBA 1RCXB 4C90A 2I9UA 4F79A 1QNOA 2C0AA 3G6LA 2FZNA 3A9IA 3QFWA 2YBTA 3S6DA 4HPXA 3SJNA 3BLEA 3MJMA 1VRDA 3THDA 5E1QA 1CENA 4MKVA 2RJGA 5CPLA 4A35A 1F3EA 4H7VA 4KFNA 1ICPA 1VCVA 1CTNA 2PDHA 1DJXA 1ZBWA 2XN0A 4J3VA 1GTHA 4IGMA 5FOOA 4NJHA 3P74A 5HJYA 3RM8A 4XKYA 1PHQA 3E2SA 4EACA 1E6XM 3AICA 7TIMA 2FHFA 4Y9PA 1FWDC 3TTSA 3F4WA 3PWGA 1F61A 3C3NA 4UWMA 4GIEA 2XH7A 4K7YA 1XV8A 3KOYA 1MUCA 3A64A 4IIHA 1UR4A 3HG5A 3IJQA 5FESA 3NPWA 2GYIA 3H4WA 1RXOB 1AL8A 2G50A 4C6JA 3S5NA 1WAWA 1N82A 3QY7A 2Y7GA 3BGAA 4CQ9A 2KX9A 2OCZA 1EEXA 3PTKA 1YNYA 3P81A 2PP0A 4GKTA 4QXIA 4YS1A 2VOTA 3EMZA 3BLIA 5G1YA 3M0IA 3KOWA 5LIXX 1UB3A 5JIWA 4ZODA 4F2BA 1RQEA 4IJCA 5CGQA 3VU2A 4IFOA 3AU2A 2VELA 4FP1A 3R8HA 3WNMA 1E0VA 3NQGA 3G8RA 2D0GA 4J40A 4Z08A 2ABAA 4DQWA 1XYMA 1VZWA 4BK9A 3W1MA 4M3PA 3WELA 4B5VA 3LB0A 3ZO9A 4C6LA 2WKLA 4GUFA 5F2GA 5AC7A 2WKJA 1VCFA 3JZEA 4GK8A 3ZLFA 2B4GA 1BLIA 5FEZA 2XIBA 1N2VA 3ENLA 2A7NA 1NSJA 2E09A 4W8LA 4F2UA 4QHRA 1WUEA 3IVTA 5I3GA 4F66A 3W88A 3CL7A 4QLKA 4GUHA 3KE0A 4JTHA 4DLMA 3LHYA 2VR4A 1Z89A 2YYTA 4KBXA 4XVEA 3R10A 4O1AA 4O16A 4IPPA 3FLUA 2WANA 1DXEA 2Y8KA 4XD4A 1NQKA 1SFTA 3WEOA 1E6QM 1W9UA 4H6KA 2DORA 2PRLA 4CD4A 4JZ5A 1JZ5A 1W5PA 5C2XA 4Y96A 2PDQA 3V0TA 1HJXA 1WDRA 3AIQA 4DI9A 1ONXA 1XS2A 3T09A 3O6AA 3EWZA 3LYEA 4XIMA 3B0UX 1TYGA 1IWBA 5E09A 1O66A 3MO7A 3W7MA 4DJFD 4LJ3A 4V2XA 8RUCA 3GY1A 2X05A 3EX4A 3FJLA 4UTMA 2PC4A 3CH9A 1ZCCA 2ZC1A 3GXDA 3WD3A 1OCBA 3FXYA 4WJ8A 3ZFHA 2BXZA 2Z2BA 1IYXA 1SW0A 3TYDA 3R89A 1K8YA 2C91A 4LFYA 1IF2A 3SUUA 1ONRA 4IUGA 1OC5A 1HX0A 3M0LA 4KWWA 3H2FA 4H9MA 3CEUA 2E6DA 4IHCA 3H21A 5HJLA 1ODUA 4QDPA 3W7IA 2QVHA 3F7JA 1TX0A 3TZFA 4Y8EA 3CAVA 1O68A 3W1LA 3HGRA 2IPFA 3GR8A 4XB3A 2CZEA 4X9YA 5D9MA 5CBIA 4KRTA 1LM1A 4L1GA 1PZ3A 3TQ0A 2Q01A 1W2VA 3VC5A 1FY6A 3IAPA 4IIFA 1ITUA 2NSOA 4LRSA 1ADDA 1TV5A 4ZR8A 2PPGA 1HKJA 3LPPA 2GQAA 1JCLA 3P62A 4OUEA 3CM4A 4QGCA 3ABZA 2VC9A 1MW3A 3AXIA 1MW1A 5F1UA 1OG6A 4I3GA 2R91A 3PG9A 4GQGA 4RK8A 2TAAA 4K36A 2QT3A 3ZJKA 4HKPA 1CGVA 3L4WA 1FWFC 4W7VA 3W2LA 2O9OA 4Q4SA 1KCZA 3N25A 4Q4OA 4AZ5A 4H01A 1E0TA 3PWIA 1XH0A 2DW7A 3EX6A 3GVRA 3GG8A 4EWJA 1UYQA 2FMOA 2R8WA 3O0KA 1C9WA 3P84A 5DCEA 4QITA 1QOPA 5C71A 2O7QA 3TJ4A 1ISXA 1BKSA 4E8CA 4KIRA 1TO3A 3SCNA 1BQGA 1XYAA 3KOXA 3UU0A 3TR9A 1LL7A 1S39A 4PR4A 1SZNA 2J8TA 5EMKA 1OCQA 5T8GA 2BVYA 4PTWA 1RQBA 3ITVA 2W0UA 4NI3A 3OB8A 2GJXB 4UBPC 5BCAA 4B5NA 3G1VA 5BRPA 4XX6A 4LVBA 2G37A 4AIBA 3QGAC 2VX4A 3K5XA 2VEFA 3QV6A 4NT0A 2D3LA 2YL5A 1FWIC 5MKGB 2J78A 4E8GA 1YKWA 3MI2A 2WJEA 2WVVB 4A2SA 3SY8A 4LWWA 3NFUA 1ZJBA 2Q71A 1NVMA 3FFSA 5FSDC 2ZZ5A 1R2RA 3NDZA 3NVTA 4Q33A 4S3KA 1DBTA 5G2WA 3K46A 4Y2WA 4B4FA 2Y0FA 1JULA 4GIRA 3PBVA 1IZKA 3CQJA 2V5DA 3NGFA 1TVLA 5E70A 3GR4A 1EYWA 3UBPC 3S8HA 3ZWTA 1GNXA 2AKMA 2GVYA 2OWWA 5G4EA 4LAMA 1W5QA 5FJOA 2P88A 3OODA 3WBAA 4UQAA 1Q5MA 4S2BA 3M6DA 4ONVA 3A22A 4RLIA 2KZHA 3GUGA 4D9PA 4TV5A 4DI8A 2BP1A 4QG8A 1ZL1A 4JTGA 4M5PA 3WSUA 4AWEA 4AU0A 3UZYA 3GG1A 1WKFA 4IX0A 3BJFA 3WQ6A 2CLEA 1V77A 3OU8A 3KHDA 1QPNA 4AF0B 4NIRA 2BFGA 2VYOA 5FJRA 4HOXA 4AIOA 3KBMA 3P60A 2BSLA 3OO2A 3GLCA 3EOSA 5EY5A 2ZZ6A 1TUFA 4GFSA 1CEOA 3DG6A 4FI4A 1A80A 3ONBA 4P8XA 2EKCA 5LNWA 4GI4A 3T40A 5F2MA 3ITGA 1WAUA 4D6FA 4DJDD 3QHOA 4HPGA 2E9MA 3UPMA 4YIWA 2W92A 3QV8A 4ML9A 2V5LA 4FNQA 4AZ6A 1EPVA 4IIEA 5M03A 4KETA 4GZJA 3EPMA 3CWOX 4O13A 2A3LA 3VTRA 5BXSA 1E4NA 1JD7A 4ML4A 3MU7A 2FZBA 4AY7A 5JVLA 4W85A 5A94A 4PTDA 4OV4A 1LRQA 1ZJAA 1PS9A 3MYOA 1WZKA 2CKRA 3P8JA 4ADTA 1JYXA 4Q6XA 1VEOA 2RJHA 2J25A 4FALA 3AS0A 1NWUA 1CGYA 2HVMA 3WLOA 1S2TA 3AC0A 1JRCA 1Q7ZA 5HK4A 2YCLB 1E9IA 3HOJA 2VTFA 1SFLA 1TPB1 4UR9A 1TCMA 1A50A 3T42A 1VFLA 4AD1A 4GYFA 4MWAA 2CZDA 1TKKA 2OT1A 4JOMA 3EZ4A 4XD3A 3HIJA 3D5HA 2GFTA 1JNEA 2V0TA 2E1WA 2RDUA 3LCXA 3HZ3A 1LBMA 4UTHA 3MI3A 3FSUA 3ERPA 5EMLA 2VFDA 3OA3A 3D3AA 5H1WA 2Z27A 1OBAA 2OEKA 3KS5A 2GQ3A 2PUZA 5DY2A 1SGJA 4HMEA 4X3ZA 1GEHA 3D0CA 4DIAA 4NHVA 2WMKA 1FH8A 3G1XA 2R24A 3RUBL 1NOWA 1H1YA 3TDFA 4PB4A 4RV8A 2V30A 1MXSA 4MHBA 4AD5A 4QDMA 3LEPA 4UFMA 4YL2A 1FFQA 1UKOA 2VGIA 1GYLA 3VNJA 3W1QA 3S1UA 1NFBA 1ZAJA 4H41A 3EYPA 3WJSA 1EIBA 4CU7A 3V18A 6TAAA 2E6FA 3LPFA 5D2XA 3LLXA 4PMYA 4E8DA 1TJPA 2OZTA 2C6QA 5IDZA 1IEQA 4GXPA 2VRQA 2NXHA 4JTKA 4L56A 3T0BA 4QE1A 4X2PA 3TYAA 1B90A 3WNOA 2RDTA 4LX4A 3H24A 3SCWA 2NX9A 3HJZA 3RYSA 2J88A 1JDFA 4PUMA 1E0UA 2PDPA 2WSQA 1XI3A 1OCNA 2IXUA 1LL6A 3EB2A 1XL9A 4TUFA 1ONWA 2YBUA 3G0SA 1GVIA 2QQ6A 3RCNA 4FK9A 3CU2A 3WUBA 4JL1A 3KUMA 4HGXA 5HQEA 5CC6A 4F0HA 1LT8A 4E2OA 1HXJA 3MP5A 1IR1A 5LGXA 3UZZA 2PLMA 4PTXA 1IIHA 4I90A 1WNOA 3VMPA 1UASA 2CESA 3UZJA 1FTXA 3PNZA 4Z1AA 1M04A 3OVPA 2OZ0A 3HA1A 4YHGA 2GGIA 3NWRA 1JXJA 2JKPA 4AX6A 1OT2A 3KBNA 2GDVA 3WH7A 5KZEA 3VIGA 1ZS2A 4OOZA 1JCNA 1FWNA 4BY3A 5CSSA 3TFXA 3W7DA 1FWEC 1OX6A 4DAFA 2QJMA 1IIGA 1XYZA 1OFAA 3B40A 3KTXA 3MVTA 5ABFB 1J0YA 4G1KA 3WQ5A 3NDOA 3S3GA 4NG3A 2HJPA 4LUTA 1QWKA 3TN5A 3CH0A 4D2JA 4V27A 3C52A 1QI0A 1MYRA 2AAAA 2BHZA 2BY2A 1AW1A 1AODA 2I57A 2C7FA 5M17A 5A8OA 5LSMA 4B92A 2I5QA 3OLEA 5AHEA 2IPWA 4ZQRA 3PSVA 1R8LA 4R7OA 3VDCA 1V6XA 4PZVA 1JFHA 3WBWA 3LBOA 1WXZA 2V2HA 2Y5EA 4HD5A 3TSDA 4M19A 4JX4A 5KSWA 1U5VA 2RH9A 4NZ1A 3ZQ9A 4HMCA 1K8CA 1X6NA 4Q8OA 1LORA 3CHDA 3LRLA 4NNBA 3VIHA 4XD5A 3IAQA 4MF4A 4C6PA 3RFAA 3VNYA 2V38A 4JYFA 3IRDA 1LP6A 1UCWA 1U22A 1EB3A 4C65A 2VX6A 3CIXA 2A6NA 3UXLA 5BOFA 4B3LA 3GXPA 4GNKB 2ZWZA 1GWJA 2V9DA 3L4TA 1CX9A 2XGBA 1V93A 5BNKA 3WFAA 2DZUA 4D6EA 3P7YA 1MVYA 2VVNA 2QUTA 4MG4A 4KWSA 2X30A 3VIFA 4PCNA 4QCFA 1AH3A 4ZENA 3HQPA 4EK7A 1B9BA 2EJAA 4E3VA 3TAKA 3M0XA 4CU6A 3UG4A 5DXXA 3O2LA 2ZOXA 4GIAA 2G96A 3K4DA 4AVOA 1CYGA 4TQTA 1V02E 1BYDA 3LX9A 2HTMA 4YVPA 5HINA 1XF0A 4PE8A 3H22A 3CGTA 2Z1XA 3NQAA 1LBFA 3LOTA 1KFLA 3TZNA 2WHMA 2QCFA 4BEUA 3HU7A 1QPRA 3B0VC 2Y85A 1TQXA 2WNNA 3RRXA 2GGEA 2P50A 1WYIA 5E5CA 2VWTA 1CXFA 4I8DA 4PA8A 2XGIA 1VLIA 2V63A 1VFUA 3SECA 3L5LA 1W0MA 1OADA 1AQFA 1K3UA 2VR5A 4O0QA 3T2QA 3IVUA 4GBDA 4HP5A 1DJYA 2B7PA 3QN3A 1GOXA 4Q8UA 1JZ7A 2D2OA 2I7GA 3LCFA 4MDOA 1TUXA 3ABOA 1V5XA 2JKAA 6ENLA 1TRIA 2PRMA 1JF6A 4O12A 4DJFC 3NQCA 5K2ZA 1CXKA 3U7BA 1XIIA 1CDGA 4REQA 1KW1A 2QW5A 2GJXA 3WJZA 1CZ1A 1FBAA 2P3EA 4UTJA 2PWDA 2VX5A 2X7WA 3GHSA 3WH9A 3TKFA 3VGGA 1HFBA 2DZTA 1FKWA 4LCRA 3S4TA 4JIIX 4H4IA 2R1KA 2OWXA 4GA8A 4KWOA 3S2JA 4I6KA 3DFQA 1OWQA 1I0BA 4C7GA 1GORA 1DE6A 4JIRA 2QS8A 4M6QA 1ME9A 3PC0A 3QZEA 3NZRA 3NYZA 1IWPA 1DL3A 3SN1A 4BFAA 1CI1A 3AZTA 3W24A 2OB3A 1XLJA 3W2NA 2BGSA 2REQB 2QPXA 1CGXA 3VIPA 3UJSA 3A4XA 3IIXA 3PJWA 1BXCA 1VGAA 1O94A 3VNLA 2HNEA 4KF1A 3NQMA 3IACA 1LLZA 3LBMA 4CN1A 2DUZA 3LK6A 2PCQA 3EX1A 3T0TA 1K6WA 3WDRA 5CLWA 2PRHA 3UA4A 1GONA 2WMGA 1WXYA 4ZO8A 2ZYFA 4G1NA 1HN1A 2PWVA 2A3EA 3T0AA 3FDGA 4N02A 1P48A 1WBJA 1GTEA 3MSRA 5AFDA 2GQ8A 5CJNA 1LWHA 1YE6A 5CPTA 1YRRA 4AF0A 1ZRQA 1TV2A 4H9XA 4YTQA 5HPCA 3YPIA 1Q6DA 1W1TA 1AJ2A 4NVTA 5D8WA 4JTSA 1OG0A 2VI0A 4AUBA 4Y9OA 1RV8A 3U3HA 3AZRA 1GGOA 3QYSA 5HOSA 5IHSA 4LB3A 3GYEA 3UZWA 3WNLA 5E6YA 1BTCA 3RO6A 2GGGA 1QASA 5AHLA 2AL2A 4M6UA 1VAHA 1TV7A 4HSOA 3Q4DA 4U4MA 3JS3A 4QP0A 1UA3A 4J3SA 1XRTA 3VOCA 3RPTA 1OFDA 2QR6A 4EPBC 4XIAA 1UIOA 2FYMA 3G0UA 3K4AA 2Y7FA 4XO7A 3UWUA 3B8SA 4G5DA 1I9CB 3IJ9A 2BTMA 4HZ8A 5U4NA 3SQLA 3R25A 3WLRA 4B2DD 2G3MA 3UPWA 5C9UA 2XH4A 3V16A 2DH3A 2XH0A 1XM3A 4O8RA 1TZ7A 3MKCA 1I2RA 2IKHA 1GPWA 1WOAA 3CUHA 3T55A 4CQAA 2V67A 5AC5A 2WW5A 2FZDA 2J9ZA 4LF2A 1PWLA 5I79A 2HPMA 4RX0A 4GWEA 2J27A 3G1HA 5BZAA 4JXCA 4JQ1A 4JTIA 3TWAA 3EWYA 4OVXA 1MEHA 2WSPA 4K2SA 5GVJA 3OW1A 1BEUA 2CEQA 2O9TA 3M5YA 3XISA 1QRQA 2VGGA 2CERA 3T0DA 1NU5A 1UWTA 4DXXA 1P4CA 4WGHA 2DSVA 4UTFA 4A8LA 2V81A 3OG2A 4HTYA 4TIMA 4NJKA 3GNNA 4H1ZA 4DY1A 1MZHA 3QGVA 2H9AB 9XIMA 3II1A 5IFTA 2W4XA 1HO1A 5CZTA 3TSMA 1JIBA 1G7VA 4CGTA 4ASTA 2JFEX 4EXQA 3HPSA 1CXLA 2HPIA 2NV1A 4ZEPA 4K3ZA 3QLLA 4WVXA 3TIMA 1UZHA 5XINA 1JYNA 3MUZ1 1UH2A 1UR2A 3T8QA 4ZTYA 4E0CA 2IQDA 3MY9A 2QKFA 3UZXA 3OBKA 1GOWA 4ERAA 1VBRA 4Z0SA 4U28A 4JTQA 4DJDC 1B57A 3ITCA 3NSMA 3GB6A 3FYOA 3AYRA 1KM2A 2J7BA 1ECEA 3W76A 1M7JA 2PEVA 4PRWA 4LXFA 1VEPA 2AGKA 5G2IA 4Q8MA 2PGEA 1FX6A 4J3WA 2HCVA 3C6CA 4GX8A 3NJ3A 3COTA 4AY8A 1Q7QA 3OP2A 2C0HA 3HG3A 3DH7A 5LA1A 1M3UA 4CVWA 2YKKA 1EC9A 4ACZB 4D6CA 1KBJA 2WBGA 1J0JA 2OOGA 5HA7A 1GHRA 3BAKA 1YBQB 3S47A 4RDWA 3W6LA 4GLEA 2UWFA 2I56A 2FTPA 3HBLA 4B5XA 2A1YA 3R0KA 4JICA 4TMCA 3GC2A 1E5NA 5D9PA 2D0FA 3WQPA 3OA5A 2J8FA 3V1HA 4TTUA 2DT3A 1X96A 4FNRA 3KL5A 3W25A 4FO4A 3DFYA 1H7WA 4DNHA 3S5SA 1NY1A 2YDAA 4PUUA 3MHFA 4CCEA 3PZ9A 1I45A 4C5ZA 4EPDC 2VC6A 1PZ2A 4UCFA 5KEZA 5KITA 1VLWA 1MRQA 3UJFA 1QVBA 1FRBA 3AHVA 1NWSA 1YDYA 3PZUA 3GNDA 5JMUA 4P8VA 2CHOA 2J62A 4PMUA 4NKCA 1POJA 3SUWA 5AZ1A 3NSNA 4IQDA 5DF0A 2YDQA 3VIKA 2OQHA 3WENA 3FK4A 1FWAC 1MQQA 5IHRA 1KM0A 3S1VA 3OIHA 3OTRA 5HAOA 3MVIA 1ECQA 1XIFA 2ISVA 3T44A 2OPJA 3B8IA 3NNTA 1BVNP 4JQ4A 3HMCA 3DESA 2OXNA 3AIWA 1EPXA 1AFSA 1W37A 2ATMA 3AALA 1D3GA 1XRSA 3R5EA 4RZ4A 3PF3A 3AU6A 3C2OA 2JGYA 1LWIA 4GD0A 4NNCA 2ZIDA 4UTIA 5FI8A 3QSRA 3L21A 1KKRA 1W91A 3U48A 2PI6A 4DBSA 2DSUA 2ACRA 2VJXA 9RUBA 2VC7A 3KL0A 3GW0A 4S2CA 4L6HA 3TYZA 3L5AA 4IUOA 3HURA 5HXMA 4H8UA 4ICNA 3N2OA 5G2HA 1F8IA 1P0EA 1S5VA 4L4MA 1YTEA 2XPKA 3SB0A 4RNIA 2DW6A 3FJ4A 1HVQA 5FEPA 2ZKMX 1XSKA 3UP8A 3JUGA 4JTCA 1NH6A 1YTDA 2D2HA 3WH8A 2VHLA 3ZT6A 3RNDA 4B5WA 2XU2A 3BARA 3GZAA 2CLHA 1R47A 3A4AA 3NL2A 1NOUA 2ZUWA 4F0MA 1OYAA 2E67A 1DP0A 4H6QA 3KRUA 1F6YA 4S23A 5BMWA 3FHQA 2VEGA 2EHHA 4Z1DA 1FDJA 4WDWA 5EFDA 1CXEA 4A8IA 2VQTA 3N19B 1KM6A 2XYLA 2PDWA 2XINA 3AUJA 1JDEA 3CTLA 4XAFA 2Q02A 1SR0A 5HR6A 5CQ1A 1PIIA 4BEQA 2OSXA 1RPKA 3AIBA 1F5ZA 4LV9A 1YIXA 3FOKA 4K8GA 3W7NA 1A3WA 1LBLA 4PMZA 1XHGA 1EOKA 1QK0A 3W87A 1V3LA 3H4GA 2QCNA 1UKPA 4DN1A 4LCSA 5T26A 3E74A 1QXLA 4A2RA 1ZBVA 1QR7A 3HFYA 1QI3A 4H83A 3TUUA 2HS8A 1VH7A 4GGBA 4OGZA 3AI0A 2VD9A 2NQJA 4PTNA 3JU2A 4GH1A 2NSXA 1ZBCA 3QEZA 3ARZA 2OOFA 5DFAA 1O5QA 4WJXA 4LVGA 3M0KA 4HNNA 1GVRA 3DBPA 2HISA 4Q8QA 4LALA 4TV6A 2WPBA 8XIMA 3IGUA 3P93A 3PB2A 1I60A 2QIIA 1Q65A 1QPOA 3HF3A 3W7JA 1QT1A 1K8XA 4KEVA 1U1JA 3WL0A 3G3MA 4XZMX 3MBFA 4US5D 4S3GA 5DMMA 4AZ7A 3Q94A 1PHWA 4IICA 3UYCA 1OEPA 3ARUA 1FXQA 4ATWA 4HA1A 3E38A 4OV9A 3RX2A 2OLAA 3UCDA 3EWXA 1Y5WA 1MXGA 3WLSA 2FPVA 4ZB5A 1DKWA 3KZSA 1J79A 3AIRA 4EXBA 3CIVA 3VX1A 4N42A 2GOUA 1NDVA 1GJWA 1TFVA 5D32A 1Z69A 1QU4A 5HNTA 2ASHA 1XKJA 4AZHA 3R0DA 3CV6A 4GYPC 2PGWA 3PB0A 4GCAA 2D23A 3R4IA 4IMDA 1DJIA 4FPSA 3SGGA 3GHUA 2PODA 4ERGA 1QO5A 1RBAA 2WJFA 4XZ9A 2GGHA 1A5LC 5BMXA 3THQA 1LLWA 1SJBA 1YEYA 2GGJA 1GQNA 1MFVA 4GKLA 1PVNA 2TODA 2POZA 1XPYA 1VP5A 3EWDA 3MV11 5J5DA 1LG2A 3M44A 3ECQA 3ZVHB 2ACUA 4OKDA 4WKFA 1O4UA 4W88A 4C6NA 3AISA 3MHUA 2QCDA 3C4UA 2OKTA 1E1FA 4WDTA 4BQ4A 5DANA 4CQBA 4PRTA 5DT7A 3QR0A 5HWMA 1GUVA 3BUVA 4JDBA 3HGSA 5F4WA 3H26A 2IUZA 4ZTXA 4O1DA 5HUPA 3NL6A 1S5NA 3IV3A 1Q2SA 3BZGA 4JYDA 4YTRA 3UQNA 2J8GA 1ZP4A 2Z26A 1H7XA 1FQ0A 1XCFA 1UZ4A 4PRRA 3CHVA 4LRTA 5AYXA 1WKYA 4HQVA 1A49A 4FOKA 1ADOA 1MWOA 5JBFA 1CECA 5A1AA 5I2UA 3KRZA 3C86A 3TNOA 1RY8A 3TQVA 4TX8A 2XDFA 2J47A 1A3HA 3TQKA 1W2PA 5BU9A 3U2CA 1UA7A 3I6RA 4BZYA 1EHAA 3BZJA 3QQ1A 4J2MA 4RNFA 1W3JA 2YYUA 2CNCA 1LUCA 3POHA 2OFJA 1O12A 3WK3A 5CPNA 1XH2A 1AQMA 2VENA 4AEOA 5LXXA 3RK8A 1LQ0A 3IJIA 4MY1A 4HIBA 3B4UA 4HK7A 3RCMA 2A21A 3R58A 5GNXA 2QJGA 2WHLA 3PULA 1WX0A 1D9EA 2B7NA 2AAMA 1K4HA 2F6UA 4MY8A 5DXYA 4BI5A 1SUXA 1X38A 5DX7A 3EEZA 3H7UA 4H9ZA 1TR9A 1XC4A 4GY0A 3T08A 4G9PA 3WY1A 3K2GA 3LV5A 3KDNA 4F0SA 1POKA 4AD4A 5AZ0A 3SQSA 1ME7A 2D1ZA 3H2AA 4QAWA 1WCGA 3NYDA 4C1NB 2VNCA 1RJPA 4HT3A 4AMAA 1GQKA 1SJCA 1EC8A 4Q4KA 4AYGA 1M9HA 4XZWA 3W83A 1VBHA 3H8AA 3ZJ6A 2ZUSA 3B8VA 1U5HA 4KKXA 3RO8A 3ZR4A 7A3HA 4WXZA 1JPIA 3SY5A 4K37A 4PB3A 3GNRA 4NY2A 2XIJA 2NQ9A 1IEWA 3KBVA 1LOSA 3MUIA 1C93A 3GXMA 3F1QA 1YLVA 3W1AA 2XTKA 4UCGA 5CSUA 5IFPA 1Z48A 2NQLA 2ZDSA 3F5LA 4J3XA 1YXYA 3E2RA 3AMKA 3QF0A 3W27A 1QATA 3LHTA 3MB9A 4E4FA 2FQIA 2POTA 3SN4A 4QJ5B 3TTYA 4CD7A 1L6SA 3PZMA 1OHLA 4XSMA 4ACZA 2MUCA 4XBJA 2YCKX 5RUBA 1M03A 2AOSA 3WLTA 3N14A 4YTTA 4JNMA 4O50A 1E9YB 1SSGA 4QISA 5I07A 4KCWA 1SZRA 1XLFA 1S2AA 3MMTA 4RNJA 5DMLA 1XYCA 3BLPX 3W02A 1MRAA 4EF8A 4MJ2A 1S5WA 1AH4A 5L6UA 4H9VA 4TX6A 4HZ7A 3EMCA 2YLLA 3XIMA 1BF2A 5MF5A 4N9CA 1LJYA 1WKDA 4PH6A 1B3YA 4MKNA 2PDNA 1QI2A 4AZGA 1QUMA 1O5RA 3WQDA 4XAYA 1KCXA 2VFEA 4A29A 2C8NA 3WF2A 4C6FA 4M80A 1BF6A 2YOCA 5FAJA 4DF2A 2OWCA 1V7YA 1S1PA 1C9DA 1Y5XA 3AQUA 3P61A 3FJ6A 1QNSA 3WD0A 3U5UA 4ZXLA 3M41A 1TWZA 7ENLA 4GYJA 3A3WA 1W1IE 4LAOA 2WCSA 3TXVA 3VAVA 3GBEA 5AYBA 1BFNA 3BG3A 1TTPA 2ONEA 1SFSA 1H62A 5BRBA 2BG5A 2EKGA 1Q3NA 1FHUA 1W1YA 1XCXA 3GVGA 2OTDA 3H2CA 2BXVA 3L2IA 3S9YA 1H0IA 3M9YA 4YN5A 2HV5A 1E71M 1VBJA 1BXBA 1XCWA 3JRKA 4IP4A 3MHGA 3NQ8A 4O17A 1HL2A 4LCQA 3DOPA 4UNIA 5LNSA 3PJUA 4WXYA 4H6EA 3O9NA 2ZE3A 1JYVA 2QPSA 3RLGA 1C29A 1TPFA 4P2VA 2WJDA 4PN2A 3PM6A 5A3HA 3OPSA 1W6TA 1XIGA 4JFUA 3VZXA 3DEQA 1GCYA 3ARVA 3KM8A 5DRCA 3CB3A 2Y8UA 2ZTJA 4L9YA 5BOEA 3QW3A 5I24A 3CQIA 4NZFA 4HOZA 4PULA 5FF4A 3SZ8A 3DHPA 1HG3A 4WHBA 4EAYA 2TMDA 1IT7A 3BVJA 3F5JA 3ISIX 3B8DA 3R94A 2YIHA 3IGSA 3DC8A 5BYWA 4NAFB 3CUJA 3QHMA 4EWND 3R13A 1IT8A 2GVLA 1NEYA 1X8CA 1GG1A 5I03A 5TBOA 1MNZA 1KFWA 2Z6IA 3CZEA 3FW6A 4LC8A 2XG9A 3DECA 3H7RA 3WF0A 1H11A 4C1KA 4CD6A 4FF7A 3TN3A 1S3TC 1T8QA 2CBJA 4HVXA 1O60A 3EOUA 4S3BA 3VGDA 4IXHA 5CPQA 1UMYA 2DT2A 1Z3NA 4L1WA 4EANA 3M47A 4AFYA 1JPDX 3KOFA 4N9EA 2Y6ZA 1I6NA 3OQEA 4A05A 4A3HA 3IPWA 2AMXA 4HOWA 4MPQA 3IGHX 4XKMA 4Q8PA 1I4NA 3SFWA 2QCCA 3AWNA 1X6UA 3WLPA 1LCOA 3UCCA 2P10A 2ZRWA 3WO8A 1GVSA 3PR2A 1TPVA 4YTUA 4BKNA 1A3XA 2F6XA 3H2EA 2HSAA 4TVUA 4HPNA 2IKIA 4O1CA 5JQ9A 2QCHA 5IBXA 1E6NA 5F4XA 4ATLA 2HEJA 1MQRA 2NVAA 3A4JA 1BVZA 3DCPA 3KCOA 2PF0A 1XLEA 4GXWA 1Z6KA 3DG3A 2QV4A 2WVTA 1XDLA 1S1RA 1UWUA 4ICCX 4M24A 2XZ7A 2WMIB 1FCBA 1TPC1 3FN9A 3VGFA 3DN5A 3ABSA 1JD9A 3L23A 4HBKA 1I75A 1TREA 7REQB 4JTDA 4K1WA 2WVSA 3ZZ1A 5D4YA 2NUWA 5EMMA 3RCYA 3T4CA 4Z0JA 4B9YA 4HU8A 2CLIA 4RL3A 4WK9A 2BOEX 2CBIA 4XZLX 1FWSA 2BDQA 3HV9A 4C7DA 4GE8A 1XFBA 4N9BA 1OK6A 5JIPA 1H1NA 5CZJA 4DUVA 8CGTA 4DO7A 3R8GA 1VJZA 1UKSA 4G56A 4H19A 4NU7A 1G4SA 5TQLA 3FKRA 3VOGA 5LIWX 3HGJA 4MJ4A 3W85A 1JG9A 1XLBA 1VFMA 3LGDA 1KBLA 4XKYB 2PE4A 3LBCA 4QCEA 3DFNA 1UC4A 5C6MA 1EZWA 1X1ZA 2NWRA 3RJYA 5A8MA 3QJAA 1MXDA 3VCCA 3PP7A 1TPWA 1FWBC 4GQ0A 3DFTA 4MZYA 4HHHA 1NP2A 1FA2A 2D20A 1HP5A 1KRCC 3IJDA 4IM4A 4S3AA 5JH1A 1Q4WA 3KTSA 5FJUA 3T0CA 4RDZA 3P2VA 2QAFA 2J7FA 5IRPA 4B3KA 4U5KA 5CGTA 1XQKA 3P14A 2WVUA 2PDLA 4QEEA 2Z2AA 1UD2A 5LIYX 5AHIA 5HANA 2YDSA 3TW7A 1QTWA 3OZYA 3CHFA 3TN4A 1MEWA 2BB0A 1WDPA 3GKAA 4IL0A 2R82A 3PTMA 1EJVC 3PUGA 3E0IA 4LSBA 4UOZA 3MUXA 3NO3A 2EEXA 1ML1A 4IMGA 1NWRA 4CD8A 1XUZA 1I1XA 1XRFA 3S1WA 2FHBA 3OLDA 3TEVA 2ACQA 3AIEA 2Y5JA 1YNPA 3F5KA 2I9EA 1E55A 1KRAC 2YGYA 4KESA 5FA5A 1NP0A 2ZRXA 3B9EA 1X7FA 4MUPA 2OKOA 1OT1A 1JCJA 4UTWA 3PHAA 4FX8A 2RAGA 1E6ZA 6REQA 2X2YA 1K7FA 4JQAA 4F0RA 5C5YA 3FXGA 3H54A 3DAQA 4LUYA 1WO2A 3WQGA 2VEKA 3V7PA 1A5AA 2NT0A 1V3KA 5D9NA 2QDEA 4LS0A 1RCQA 3KAOA 3ZJ8A 1M5WA 2J7EA 2QJJA 2QCLA 3H70A 3WK0A 3QY8A 2Q3RA 3KOZA 1EIXA 1R3WA 4H8NA 2WXDM 3FEQA 4KEUA 3IVSA 3NIYA 1Y65A 3RPDA 1EHNA 3DI1A 3KL3A 1GT8A 5GQBA 3PSWA 3L12A 5TAOA 1UZDA 2VGFA 4BCEA 3H6OA 5KETA 1NQ6A 2NV9A 1QCWA 5I3JA 3L0NA 4Z1CA 4DWSB 1EF2A 3S46A 5ECUA 4L61A 3SURA 2PDUA 3CYJA 1TWSA 3PS7A 1GZJA 3PZNA 1XIDA 3HV8A 2G3FA 4M56A 1BQCA 4O53A 3PN8A 2VGBA 3O07A 4NZJA 3SUSA 5I3KA 4AMCA 4O10A 5G1TA 3QQ0A 1NARA 1DQUA 3PANA 4ZO6A 4JCMA 3NQFA 1DXIA 5CZKA 3LHZA 1KLZA 2DZSA 5CKSA 3UD6A 1AUSL 4EIVA 4GH3A 2X8RA 1RALA 3RM9A 3IIVA 1R6WA 2CHRA 1HL8A 3KXQA 3R8RA 1PV8A 3PZTA 3WBXA 1KR0A 2FPYA 5BWAA 1XUUA 3VA8A 1R3QA 3ZOAA 4HSNA 2BHYA 4U2YA 3RM4A 3M7WA 4PFHA 3BAJA 4JTJA 3L4XA 4RPQA 5LHFA 4A3QA 4IWWA 1UPPA 2DH2A 1EGMA 1G6CA 1W9PA 1WQ5A 2L5HA 4DBDA 1R3YA 3VD3A 4X9SA 1QI4A 2QJHA 2WC3A 2CZ5A 3ARPA 4V15A 3VUSA 3B05A 1WKEA 1RP8A 3B06A 1UBPC 4P7OA 4PCFA 2G41A 4R33A 5HMDA 1M41A 4DX3A 4M0XA 3PBUA 2A3AA 5CEWA 3OLIA 2GJNA 1G69A 3LSCA 3QFEA 4FLSA 1D7KA 1LQAA 3WMSA 1E4LA 1E15A 4AHQA 3GIQA 1TV3A 3Q58A 2GUYA 3B0PA 2ICSA 4QSFA 1U1HA 3LNMA 4AXKA 2EJ1A 3WUFA 3LRKA 4S3DA 2E8YA 4ZSUA 3TH6A 3T07A 1E51A 2BWGA 2GLKA 3EWWA 4AZIA 1CIUA 4MGGA 2ZVIA 3BO9A 3EPOA 1XW8A 3DZ1A 5CJMA 1GJUA 3SUTA 3NEHA 1FXPA 4Y90A 1VIZA 3EWUA 3M46A 3H12A 1OC7A 3CIWA 1YPFA 5E9AA 1GZGA 2HROA 3N1AA 1B54A 2IPGA 4UOQA 2WJZA 2R1NA 1J18A 2Z1VA 4HNOA 3UA3A 1A47A 3EPNA 1OX4A 3VGEA 1XLMA 4FAMA 1KM4A 3BOFA 3P8IA 3DXIA 1E4IA 1NTHA 5D37A 2BV9A 5E0KA 2BY3A 3NZQA 4L6OA 5LGZA 3IJLA 2EO7A 4PUJA 1TG7A 1G4PA 2JIWA 4RW3A 1EXBA 4KWUA 4GUJA 3LU2A 1SJDA 2PLCA 3T1GA 1K03A 5AKQA 4O0ZA 1V6VA 3RU8X 2VZVA 1JFXA 4JIHA 1JPMA 1Z9AA 4PSPA 3T7VA 1A4MA 4Q4MA 4GUGA 4MZ1A 2ZRYA 2ZA2A 1J6OA 1SW7A 3CJPA 4UTTA 3OVGA 4A8NA 5J5RA 1BYAA 1E1CB 4MFDA 3VDBA 1GPFA 3MP4A 4PMJA 1F6PA 2XVLA 1ESWA 2ZX9A 5C9XA 3EMQA 3QTPA 3TP4A 5HNUA 3OGSA 3QOKA 2QDDA 3WG6A 1ZENA 1OZQA 2E8ZA 1UWQA 4X0NA 3L66A 4HA4A 1H41A 2OX1A 3VC6A 3SO7A 4LUJA 2FVLA 3PZQA 3V5CA 3W3OA 3HB9A 2J4GA 3P5YA 4UQEA 3VINA 1XLLA 5I3IA 1L2QA 6A3HA 5BXPA 1E9LA 2P0OA 4QTGA 3ZSTA 1IT0A 1P6WA 1C8YA 2XSXA 1PKLA 1KFCA 2XGZA 5F1VA 4PMQA 4M51A 3W73A 1KCLA 4FX7A 3KWSA 4U31A 4F9DA 3J7HA 5GJMA 3GDLA 3Q65A 3UXIA 4FXSA 5FJJA 3GVWA 2YFOA 4GI8A 2W79A 4WZHA 4C6DA 4LAKA 1SO6A 4FNUA 2CXEA 3QW4B 3EX3A 4LF1A 4C6KA 5BOOA 2OYLA 3G1SA 4F40A 2QGHA 2QPUA 1IQ8A 3K8MA 3GC4A 4DZ5A 1JXKA 2AQOA 3FEMA 4MWAB 3TK7A 1BGAA 1IHIA 4WSJA 3URBA 2G3NA 1XKYA 3SUVA 1OY0A 4IPJA 4CNSA 2ZRUA 1MFUA 4Q8WA 2PDCA 1DQXA 2DQXA 3A4WA 1EWEA 4PMXA 3CASA 3BAYA 4AHOA 4NQ1A 3F03K 3UXDA 1A5MC 5D2WA 3W86A 1XICA 2ZZ4A 1A53A 1V0MA 2VUYA 3FAXA 4UIOA 1R87A 4M6PA 1HP4A 3SFKA 4JFVA 2J77A 1DJWA 3M0HA 3EXRA 2GQ9A 3MWAA 1KQYA 1RA5A 3W70A 5LIUX 4B3ZA 1W31A 4JFSA 1W3HA 4UTKA 1N55A 1IEXA 1I8JA 4ZSTA 1UG6A 3E5BA 1CT5A 4ZQMA 2X1RA 1DOSA 1BVWA 3QKZA 4E4PA 4DAIA 2O4MA 4CQDA 2HVNA 1Z44A 2WMJA 1EX5A 2VRJA 2RUSA 1SU5A 1TTJA 2DJXA 3D6NA 2DZBA 4LY8A 4TVCA 2C16A 2PTDA 3WF4A 1C3FA 3W7GA 3BLDA 3ZSSA 2VP8A 4R88A 5F7UA 2DZXA 4LEQA 1EP3A 1TJRA 4N4PA 4H9TA 1TCDA 1K9FA 4DBUA 1S46A 3HN3A 4WOZA 3RF9A 3GBDA 3SCUA 3UWEA 5HMFA 3DI0A 3GC5A 3AYVA 4B9ZA 3KLKA 1OF6A 2CLFA 5EBAA 3W2KA 2XFFA 4BHYA 1EGZA 1UR1A 3UR8A 5DRIA 3UWWA 3M0MA 3TSBA 2VX7A 3QC0A 4QDWA 3KTCA 1KBBA 2HS6A 4MTVA 4GC4A 1TPUA 3TN6A 4DJEA 1Q2RA 3GYCA 1PL9A 2HE5A 1QO2A 3MKKA 3RILA 5XIAA 1HKIA 4PMDA 2X1TA 5BU6A 4J3ZA 1HTIA 5C2GA 5D05A 1PIFA 3M5VA 4DHGA 4M8UA 1KRMA 1FHVA 3R11A 4IOTA 3PG8A 4K8HA 3VE9A 3BGGA 2TYSA 2B7OA 1I0DA 2CWXA 4UMCA 1EFZA 5HBFA 2F2KA 4IFKA 4LW7A 4UFLA 3RRAA 2Z00A 4GBUA 1K9EA 1G94A 2ZXAA 3NR0A 3WN6A 4YYCA 3K8KA 5A6BA 4Z1YA 4EAMA 4L65A 3W29A 4AVNA 1NFGA 3H2MA 4WD0A 1DHPA 4ROPA 1W54A 3C0QA 3L5MA 3KHJA 4HCLA 3VD4A 2WLZA 4Q8TA 4QBXA 1MDRA 3NPUA 2QF8A 1V79A 4JD4A 3RHGA 4XAPA 3G6MA 4LUTB 1GHSA 2OQYA 1CW2A 3K1GA 2OU4A 2FZ9A 1OINA 1M6JA 1HW6A 1T99A 3KZPA 4LAUA 4DF1A 3C56A 4QQ3A 3DKJA 1HJWA 1XD1A 2VOMA 2GVGA 4MM1A 4DWSA 2Y61A 1EBHA 1R85A 4G8TA 2D0HA 2NXIA 4GO8A 2DVXA 1RVKA 3VIJA 2GJLA 2OSWA 2JEPA 5HUOA 4BI6A 2YW3A 3C2YA 4RXFA 1TVNA 3OBEA 4DO6A 3CZLA 1J01A 3TC6A 1AG1O 1P43A 4MZ8A 1WP6A 3QMTA 2QZRA 1I2NA 4RE0A 4NYUA 3SY1A 4JTEA 1Q8AA 4XZHA 2I16A 2IKJA 4DELA 1AMKA 3T05A 3ZWSA 4R9XA 2NV2A 3UNDA 1O95A 3BANA 4EF9A 1IZCA 1H2JA 5C70A 2NX1A 4HHLA 4NSBA 3QPZA 4RW5A 1TPDA 1L6YA 5CJ5A 1K9TA 4Z2KA 1VYRA 3UEQA 3GTXA 3VKCA 2QULA 3Q67A 2DGAA 2GK1A 1D8CA 4DLFA 3JZUA 1NIUA 5C0QA 3AHXA 3N4AA 4L6DA 3C2VA 3WMLA 2F38A 1W9BM 1V6TA 4K1GA 2XN1A 4UNKA 4AW7A 1Q45A 4D71A 1QW8A 3AJXA 4NXKA 1SO4A 3LTYA 4MNMA 3VGHA 3B9OA 4W5ZA 1EDQA 4MVAA 4ZCWA 5EU9A 3DIPA 1F7BA 2C18A 1OC6A 4GABA 3WDQA 3CQKA 4FSAA 1BG9A 1PX3A 3BJSA 1BYBA 3DFOA 4I9TA 2PBOA 5CH9A 5K9XA 4C91A 5LHEA 4QAIA 2DDXA 2E6AA 4MWAE 1B0IA 1BG4A 3W4RA 1F9CA 5C7VA 3RN6A 3T9PA 3CXOA 1RCOB 5BROA 3EDDA 3I7SA 3SJ3A 3MS8A 2VDIA 1XDJA 3KFTA 1G01A 3CV1A 1HZYA 3IUHA 3CBWA 2EF9A 3WX7A 4BWLC 5FAGA 2YB1A 3A5VA 3DGRA 2BGNE 4REQB 5BRQA 1CWYA 1NDWA 3FKKA 1EJSC 1UMLA 2ZX7A 1ZGDA 4HNUA 2ZUTA 4RNHA 3RLVA 3USBA 5HNRA 3CNYA 1FKXA 4L7ZA 4FHAA 1VEMA 5LYRA 2D24A 1H7NA 3IUDA 4Z2GA 3FYYA 5CSRA 4MB4A 2B31A 4ZQNA 4HSHA 2OT0A 4UOJA 2E68A 4HJWA 1ICQA 2C13A 1K02A 4RV3A 4PUKA 1W1PA 4RE4A 7CGTA 3TW6A 4X63A 3U6WA 3WDPP 3WYZA 1FCUA 3O0FA 4JN8A 3VM7A 3A9BA 2Z24A 4XAZA 3IK4A 4MMWA 4W8AA 4M6VA 2EG7A 3AJ7A 1TB3A 5A8QA 1H3GA 4NJGA 4JDYA 1ZNNA 4EP8C 2G4JA 4KRZA 3REQA 3WDJA 3OJGA 5AHFA 4Q7BA 1B4EA 3O16A 2VR2A 1KC7A 4PMOA 1V51A 3WLQA 1NFPA 1E1CA 1PTDA 4TO8A 2FB2A 4TR9A 2D73A 2XM1A 2CLKA 3GAKA 4KEMA 2VCCA 1QHPA 3UETA 1QNVA 2EQDA 3TX9A 1N8IA 3ZVIA 5AC4A 3NSXA 4LTSA 1QBBA 3N3TA 3DHDA 3E3HA 2Y8VA 4GQQA 5C9WA 2RDXA 4LGXA 1M65A 1PSCA 3MYPA 5LA0A 1Z8AA 1OD8A 5T9BG 4UQ9A 3CPRA 4B5UA 3WNPA 4FNTA 2YFNA 1TMLA 4XUYA 3W07A 1JDAA 3GWQA 4KRUA 4PBEA 1LL4A 1O5KA 1EJTC 2B0MA 2FFCA 2AL2B 3KBWA 3A23A 3F4CA 3IIZA 1QK2A 4DXKA 4WQ6A 3U2EA 1UQYA 1DWJM 2FB3A 1CGUA 3AO0A 3EX2A 3U4FA 1VENA 2ABBA 2IQ0A 1RK6A 3LCLA 4KQNA 3BAXA 1WUFA 4YHEA 4H7CA 4L9ZA 3AWOA 1DJZA 3LCWA 2XZ9A 1UD4A 1DYSA 2WNWA 4GXMA 2AQVA 4R9OA 3EWBX 4Z2HA 3GQYA 4JTAA 3VD7A 2BZNA 3V5OA 3FNDA 4LQ1A 1NWTA 3TCEA 4HHMA 2DUAA 3E5PA 4GISA 1WDDA 2VO5A 3QR1A 4AB4A 1E70M 3EDEA 4WOQA 1T7LA 2YXXA 3GTIA 3UPBA 3TU9A 2O55A 3W7KA 3LCIA 2TRSA 3HM7A 2CLLA 2ON3A 2FKPA 1O6IA 4L4PA 4MOZA 1BHGA 2R14A 1ZJHA 3LMYA 3GDBA 4UUIA 1IXQA 4BF9A 3N13A 3ZMRA 1RJRA 5AVHA 3T6CA 4M81A 4MWAD 4AZBA 3UXAA 1JAEA 1PCWA 3PWAA 4FNSA 1XBZA 4QX4A 4PB5A 2XUCA 5FKYA 4QSHA 4FA3A 4HZMA 2VM8A 3I68A 3PZVA 4O4VA 4GI9A 4DUXA 3L0GA 3URAA 3UJ2A 4AZCA 4L5ZA 1VQTA 3DYMA 3ZJ7A 1SYTA 3ITLA 1E9ZB 3TJLA 3CV2A 3BLKA 4I6VA 3OVRA 4A4AA 4ECLA 1VFOA 3LZ5A 1QI5A 2OEJA 3F2BA 5AOUA 1FCQA 2WYSA 4F8XA 2YA1A 4TTGA 3AS2A 1OABA 1US0A 3N9KA 5DMYA 3MBDA 2Y63A 3GXFA 4F4RA 3BW2A 1JCTA 2WM0A 4A3RA 4XAGA 1SO3A 3FAWA 4KPLA 4NILA 3PFRA 1I1WA 2ODOA 1JNDA 4MNJA 1JGMA 1KKOA 3T4WA 4DYJA 1EBGA 1U30A 4QFUA 4L64A 3P82A 5BWFA 2NUXA 1TTQA 3GDTA 4AIUA 2ZA1A 4U2ZA 2C14A 3WJWA 4F9JA 5EBUA 1DE5A 3QPYA 1IGSA 5I06A 3AZSA 1MI3A 2WSKA 4IGSA 3LHVA 1IZJA 3LHWA 2ZZ2A 3SM0A 1ENUA 2VFIA 3PZOA 4N4QA 2BVTA 4J2PA 3TFCA 4V1YA 4GVGA 4WUIA 4D6IA 3TC7A 2QJIA 3H55A 4UTUA 1R7OA 3LS9A 2VCAA 4MB3A 4FLQA 4OIFA 2G8ZA 4RR4A 5GNZA 3CZ8A 3DDMA 2YBVA 2QIWA 1C8XA 2C19A 3AXKA 2HVOA 3KVLA 1KBKA 4I8YA 1LWJA 4KGLA 1XDMA 1QPKA 4ROQA 2YZ5A 1BWKA 1TWWA 2PD5A 1JYWA 1I2OA 3LLFA 4MAZA 1ITQA 2WNZA 4G7EB 3D46A 3P6LA 2B81A 1Q6EA 1P0NA 3U2ZA 2ZUMA 3T8LA 4LYRA 3GZ3A 3UG8A 4I7VA 4YPJA 2HMCA 1J12A 4J3UA 3WQ8A 1RR2A 3E0WA 1FWCC 4XUGA 1QJWA 2J66A 1H49A 2A7RA 4CCCA 3E02A 4ZB2A 2ZDRA 4IX2A 1XLAA 2JF7A 2OQLA 2WMHA 2FIQA 4CUCA 3PBGA 3WD4A 5EMUA 2HK0A 2NVCA 1ISZA 2PDBA 2V3DA 3TROA 5C9RA 1K7XA 3P0XA 4LS2A 4DNMA 3MUCA 2QF7A 3ORWA 4CNPA 1PUDA 2PGFA 1YMYA 3ZR6A 5CPSA 4DPPA 5FIPA 2ALDA 2CZFA 2UY5A 2YR1A 4OBRA 3HQNA 4GPNA 3W28A 1B1YA 5HNNA 1E56A 1TJ0A 2DZVA 3JR2A 3V0SA 2X0SA 4IMFA 1WXJA 2QV5A 5GNYA 4ZL1A 4U10A 3G1FA 1W1B1 1F2JA 5CBBA 3U8GA 1V08A 5AHMA 1PCKA 2I5IA 2IS7A 3TVAA 3CMJA 2XIIA 2Q8ZA 4CN6A 1E3ZA 4Q6JA 3TLQA 4E2VA 1KTBA 4JHMA 3L0KA 4WRHA 1C8QA 1V0NA 4ZXOA 4UZUA 4J28A 2JIEA 3MWCA 4CEUC 3LENA 1L6FA 1TR1A 4IMCA 3N6HA 3I3BA 1ODZA 2HK1A 2GWNA 4B91A 4J35A 4UFHA 4AWSA 1MNSA 2NVDA 2BY1A 3PPHA 1IE7C 1YXDA 3H23A 5I02A 1TSIA 1FWJC 1F3TA 3U4AA 3OHIA 2VFGA 3NZ1A 4O15A 1V3MA 3WZ0E 4TX9A 4RXGA 1UP3A 4HTBA 4ATDA 2R94A 2QNEA 3APGA 4NF7A 3IJ6A 2VDGA 2O7SA 2AQWA 2OX4A 4RE3A 1R5YA 1ZCOA 3ARRA 4JX5A 3ABQA 4RKAA 3WNKA 4IPNB 2EPOA 2UY2A 4D1JA 3S6OA 1E0XA 1JQXA 1XFCA 4XZNX 2CC0A 1TZZA 4ZVJA 3AHYA 1R9XA 4HHPA 2E1DA 1UWIA 3PPCA 2F61A 3DFSA 4NUWA 3O6DA 1PTAA 3UWQA 1WZMA 4K8EA 3LRMA 3QZAA 3IS4A 4I5XA 5I3DA 3MMUA 1VJIA 2GUUA 2GWGA 3SCQA 3WD2A 4QNEA 4DRSA 3UESA 3V1PA 3UVAA 4DBEA 3V36A 4QJ1A 3DYPA 3CMFA 3BOLA 1ZBKA 2WM1A 3H53A 2R9RA 3UG5A 4LB4A 4U33A 4DUWA 3BURA 3BV4A 3SRKA 1R3TA 2QMKA 1EX1A 2DZPA 2ZADA 4G2DA 4X22A 1L2UA 3BG9A 4PTVA 2J6XA 2XVPA 4WY0A 4EVZA 4D6GA 3I65A 3WLNA 2I14A 4AISA 4MADA 3VCRA 4GJIA 3UGRA 4OWGA 1B9ZA 1RH9A 3QC3A 3QV7A 4X61A 4H9UA 2V69A 4WJEA 2XHYA 4WDXA 3TA9A 4HPJA 2Q09A 5B7ZA 1H0GA 4UTLA 4H7ZA 2PDJA 3V3WA 5BXRA 2XJ7A 4U5IA 3K4WA 3VABA 4ADUA 1PAMA 4HJFA 1UP0A 3E6EA 3EEGA 4YNGA 4AG0A 4GC3A 4DM2A 1TPEA 2EPMX 3KVMA 4FOUA 1XYLA 3GK0A 4ZOBA 3DU0A 3OQ8A 4JQ2A 4PUDA 3RU6A 3VKDA 2J6VA 4LYQA 4R7JA 3B9DA 3NEVA 2PMQA 2PDMA 1OD0A 4PEKA 5LZLA 3W6MA 2INZA 4ZOEA 5LKYA 4LY4A 3TQPA 1J11A 3ANUA 1RPXA 3NQBA 1BSIA 3HTWA 3W84A 3LI0A 2DIJA 1A4LA 1OZMA 2E40A 4KIEA 1R30A 3MUY1 4CN4A 4H04A 4QE5A 1EP1A 1WBHA 3LD5A 2BGQA 5T91A 3CUIA 3I10A 4I9AA 2RFGA 1SZFA 1SSDA 4ERIA 2DP3A 1TRDA 1PX8A 2X1SA 3SCSA 5KZ6A 4PCPA 4LOCA 2QCDB 4N2YA 3TE9A 3VDHA 1Q66A 1FP9A 1HGYA 3ELFA 3I6TA 1B3VA 1SO5A 3MO4A 1Z41A 3AOFA 5JUVA 4OQVA 5A6JA 1XLIA 3VNMA 1ZQ5A 3WQWA 1GG0A 2X16A 1OFQA 1JQVA 3KDOA 1A5OC 3S1GA 4NL1A 2DIKA 3T81A 1AQ0A 1O7AA 3BPWA 1ITXA 4FX6M 3QRHA 3QHNA 2EPKX 5HMEA 3E9AA 3BMWA 1GW9A 1TPH1 2EAWA 3PBYA 3ME3A 1EJRC 1EUAA 3URQA 1LQ2A 4DZAA 5HMSA 1KFEA 3B4YA 3S2MA 5A6MA 2PSNA 1EP2A 3CAWA 3OGRA 2A4AA 3VKAA 1W5MA 3VD5A 1HKKA 1QW7A 3W2JA 3EWCA 3MKVA 2EPLX 4GUIA 2HNHA 2XSAA 1SPQA 5FF3A 1ZFJA 3VYLA 4RJEA 3WDIA 3PY2A 2A6LA 2NWSA 1DWGM 1B30A 1PKYA 4N7QA 1ZPTA 3F2CA 4CNTA 1UR3M 1XR2A 3PFMA 1LUCB 4B5TA 4MLRA 2D22A 1EA0A 3VFCA 3WK1A 3KBSA 1EDTA 2BS9A 1XD0A 4RZ5A 1TVPA 2H3BA 3DERA 4UR8A 3LZ3A 3N4EA 1A5KC 4FIQA 4EOUA 3C2RA 4MB1A 4R34A 3LCHA 3QV9A 3NPVA 4Z1BA 5A2AA 2BNJA 2CCRA 2PTZA 3QQWA 3CO4A 4E38A 3IIPA 1UOKA 2DSWA 3W71A 1RP9A 3R43A 4BJHA 3MCNA 3WQOA 1XBXA 1UH3A 3LERA 4LVAA 1K9DA 5DQPA 2A3HA 3S0CA 1P7TA 1XYFA 1TMQA 1JCMP 3GKFA 3RR4A 4Q22A 4QS5A 2A7PA 4CKQA 2GJRA 1KV5A 4IT1A 3SCTA 4H6RA 2XVKA 4J1OA 2ZWYA 2JEQA 3CHCA 1MDLA 3QZ6A 4W86A 1LROA 4XZBA 1PKMA 2FLIA 4JFWA 1A0CA 2QUUA 4MUZA 2CXGA 3VFLA 1H4PA 3CS2A 1PDYA 2X0HA 3TONA 1ZY9A 2WZEA 1T6MA 3PJXA 1J10A 3A24A 1UUMA 1X97A 4IGHA 1GK8A 5GJNA 5ABTA 3MSYA 1JAKA 4JN6A 3L65A 2A3BA 4TXEA 3VNDA 2FGBA 3LQGA 1JPHA 1JJKA 5M3WA 3NL5A 5REQA 2Q8XA 2ISWA 3L67A 1HQTA 1R86A 3LDVA 1LLOA 4FNPA 1YX1A 2X1UA 4C6EA 1RBOB 1XQLA 5HJXA 5K4XA 1LYXA 3WJXA 4QR6A 4D72A 3VZZA 5D09A 2GDQA