3CUIA

Cellulomonas fimi xylanase/cellulase cex (cf xyn10a) in complex with sulfur substituted beta-1,4 xylotetraose
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
314
structure length
314
Chain Sequence
b'ATTLKEAADGAGRDFGFALDPNRLSEAQYKAIADSEFNLVVAENAMKWDATEPSQNSFSFGAGDRVASYAADTGKELYGHTLVWHSQLPDWAKNLNGSAFESAMVNHVTKVADHFEGKVASWDVVNEAFADGGGRRQDSAFQQKLGNGYIETAFRAARAADPTAKLCINDYNVEGINAKSNSLYDLVKDFKARGVPLDCVGFQSHLIVGQVPGDFRQNLQRFADLGVDVRITELDIRMRTPSDATKLATQAADYKKVVQACMQVTRCQGVTVWGITDKYSWVPDVFPGEGAALVWDASYAKKPAYAAVMEAFGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exo-beta-1,4-glucanase
publication title Probing the binding sites of Family 10 and 11 Xylanases with extended Oligosaccharides
rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
total genus 133
structure length 314
sequence length 314
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2008-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3cuiA00
2JF6A 4BQ2A 4J3TA 3TP4A 1EIBA 2O9RA 2V5DA 1BGGA 4Q22A 3AIVA 1XSJA 1PJ9A 1QOXA 1CYGA 1HJSA 1CXEA 2ZUUA 3CZ8A 3WQVA 3GNOA 3UG5A 1JNEA 1VFFA 4NRRA 1H41A 3ZJKA 3BMVA 2VRKA 1E6SM 3OBAA 3L4YA 3SCQA 3WEOA 1K6AA 3SURA 2XSAA 4CU7A 3G6LA 5E0FA 1JZ5A 5HPCA 2WKGA 2YL8A 4UR9A 5ABFB 2GK1A 3VIHA 3AZRA 1HIZA 1CXHA 5E6YA 2C7FA 3PN8A 1TUXA 1J0KA 1W32A 4CCEA 7CGTA 3RCNA 2XVPA 5A6BD 1NH6A 4UFJA 3BXWA 1B1YA 5CPSA 4J3SA 5BXTA 1MQRA 1O7AA 1V6XA 2QF8A 1X6NA 3W24A 4BCEA 2A3CA 2DT2A 3WD2A 2WMGA 1VEMA 2Z1SA 4WKAA 1KXVA 3T08A 1E4NA 2WBGA 4P7RA 1WB0A 2CBJA 4DWSB 2DIJA 4M80A 3WY1A 2DH2A 1ITXA 4PMQA 2C8NA 1HKIA 1GOWA 2YJQA 1PAMA 2J4GA 1QNOA 4CU8A 4H04A 1UOKA 1A3HA 1JF5A 2PBOA 1KBKA 4AW7A 2J47A 2DSWA 4TX8A 2ZUNA 3DC0A 3UETA 4MAZA 1HVXA 4F79A 3AZTA 1QNRA 4TTUA 3VINA 3IJ7A 4F66A 1MW3A 3PTMA 1OB0A 4XZBA 5EB8A 5CSUA 4D6HA 4V27A 3ZR6A 3A3HA 1BAGA 1JZ8A 1JYXA 3VIMA 1E56A 4V28A 3RPMA 4IM4A 1E5NA 3BAKA 3TA9A 1KR0A 1QHOA 2JALA 2VRJA 4AZ6A 3A4WA 3K8KA 1GQIA 3L2LA 4UNIA 3SCNA 3BAIA 1V3JA 1DEDA 1KXHA 1GHRA 4HA1A 1DHKA 4CCDA 3ZM8A 2DSKA 1XSKA 2D0HA 1ZS2A 4PMRA 5AC4A 1TZ7A 4JFSA 3PZUA 2GDUA 4L4PA 1QBBA 1B3YA 3WMCA 2EPLX 2UWFA 1QVBA 1UA3A 1QW9A 3PZOA 2XFYA 4P7LA 1OIFA 2X8RA 3BSGA 5JIWA 2BHYA 2UY2A 1G94A 2WHKA 4AIOA 2OSYA 4GZEA 3OGRA 3VNYA 5IHRA 5DO8A 2BXZA 2DSVA 1UD3A 5M5DA 3NSXA 2YIHA 2QPSA 3WENA 4PTVA 2YBUA 3PZQA 5BRPA 4Z2KA 2WVUA 3WNNA 3ARQA 5E70A 4AD0A 8CGTA 4OZOA 2F2HA 1HJQA 1ZBVA 1KQYA 5IFPA 2W66A 5A8MA 2DT3A 5FCZA 4DUVA 1E43A 4FLRA 2VMFA 2CBIA 1B9ZA 1XCXA 3GH5A 2W67A 1E6RA 4M1RA 1V3MA 1XD1A 2V5CA 1XH0A 1GOQA 7A3HA 3CHCA 3RJYA 2YA0A 5LYRA 1US2A 3QR3A 3MU7A 3AS3A 2XJ7A 1U30A 4MB4A 4XB3A 1ITCA 5A6LA 3SCPA 4HOXA 1J0JA 1PIFA 3RM8A 1TR1A 2GUYA 4CD4A 1ZJBA 3AS1A 1WZKA 4AZBA 1WKYA 1H2JA 1VEPA 1W1TA 5JBDA 4PMVA 3WD0A 4RE2A 1OSEA 2XTKA 3HMCA 2FHCA 4EANA 1EOMA 5D8WA 4D6JA 3FXYA 3EMZA 5HPOA 1JL8A 3WMSA 1E0VA 2VC9A 1JAKA 3K8MA 2X0HA 3MKKA 2VO5A 2BY2A 3TTQA 2WCAA 5CQ1A 4AIEA 4UQDA 3SCUA 4KGLA 4HA4A 4D6FA 1LQ0A 1X6LA 1QHZA 5A2CA 4PSPA 1OWQA 1LWJA 1MWOA 3WQ8A 2EJ1A 1E0XA 1R7OA 1PZ3A 2YA1A 3UG3A 3WFZA 4HZ8A 2V3GA 2FDMA 5DT7A 1CPUA 3PZNA 1S46A 2Y2WA 1JIBA 1JD9A 1PZ2A 1J0IA 1KWKA 1JG9A 4JL2A 3VGDA 1W9XA 3TOPA 2BHZA 4HTYA 4EE9A 3IANA 4PTWA 3NSNA 1H0GA 3GM8A 1GHSA 3ARRA 1H0IA 3ZT5A 5HXMA 5FD0A 1LWHA 2PB1A 4PRWA 1ODZA 2WMJA 3N17A 1U2YA 3VGFA 1OGBA 3OLGA 2XFFA 4JCLA 1BGAA 1FOBA 2ZX6A 2O9OA 1NWTA 1JD7A 2WPGA 4XUYA 3GH7A 3N12A 3QGVA 1NWSA 1C7TA 3RM4A 9CGTA 4D72A 3L4WA 4LYQA 4OJYA 2XSBA 3S2CA 3WUBA 4C7GA 1EO5A 2JIWA 4CU6A 4TTGA 1MXGA 4RE3A 3GBEA 4XV0A 4UQAA 1Q6DA 1BYDA 1HN1A 3WD4A 2VT0A 2WSPA 3HN3A 4M81A 3GXFA 4UQ9A 1CIUA 3GNPA 4GQQA 5A6AA 2DDXA 2J7GA 1VFOA 2ZIDA 4FLSA 3OG2A 1CWYA 1B3XA 1E6PA 1SYTA 4CVUA 1QPKA 3F5KA 4PMUA 1KGUA 4MAVA 4MADA 2VX4A 1GZJA 1ESWA 1W3HA 3TTSA 1UD4A 4WIWA 2WMKA 4OUEA 4FLOA 3ZQ9A 1HL8A 1DWGM 1R85A 1CGVA 1CEOA 3APGA 3BH4A 2WHJA 3W81A 1E72M 1UR8A 2YL5A 2WCSA 3SUWA 2BXYA 2GVYA 1UKSA 3F5LA 1E4MM 3VU2A 1PX3A 3PZVA 1FFRA 2WAGA 3NIYA 2OYMA 1FH9A 1US3A 4QP0A 2X09A 1C90A 1K9DA 1QI5A 5LA0A 1GPFA 2VX7A 3B9AA 1EA9C 2AAAA 3ZO9A 3W29A 2WWCA 2TAAA 4U3AA 2ZUMA 1XGZA 1AQ0A 3PHAA 3VGBA 2DQXA 3MUY1 5GNXA 1V0KA 2G3NA 3DHPA 3WELA 1BTCA 1WAWA 1V6YA 3RMEA 3FN9A 4UQBA 4P7NA 2X2YA 3T0AA 4P7QA 2DT1A 2NW0A 1L8NA 2HISA 3UCQA 1MW2A 1GVIA 3AIUA 4DWSC 2OWCA 3VX0A 4KWUA 2VZSA 4W89A 1MXDA 3BGAA 1UR0A 2VNCA 3WNLA 3OZOA 1NP0A 4PYSA 1JXKA 4PMZA 3EMCA 4W5ZA 4QLJA 4D6CA 1CTNA 1B90A 2WYSA 1DWIM 2V38A 1E6ZA 1VF8A 1XV8A 1DP0A 1W1PA 1EHAA 4D1JA 4KRTA 4P8UA 1DTUA 3UG4A 3I3EA 2PWEA 1B3ZA 2BY3A 1KWGA 3K4AA 3L4XA 3ARUA 4QCEA 1HNYA 3W28A 1KGWA 1W2PA 2WLYA 2WC4A 4HPGA 1HJXA 1UA7A 2WC3A 2XVNA 2WM0A 4U5IA 3OZPA 4YPJA 4CN4A 4D1IA 1AQHA 3UR7A 4M24A 2PWGA 4IPNB 3QHNA 2VX6A 1Y7VA 1GOKA 1TCMA 2QPUA 1ZB5A 2W91A 1KB3A 3CHEA 4FLQA 1X1NA 1UD5A 1MW1A 5A6MA 5A2BA 2EEXA 2GJRA 4LGXA 2OLHA 5KZ6A 4D6IA 1WDPA 4TVUA 1XH2A 1UUQA 3CLWA 5I78A 1E3ZA 3BCDA 2ZWZA 1AMYA 3EDKA 3EDJA 1XC6A 1F4HA 2VOTA 3U5YA 4FK9A 1TE1A 4M8UA 4AD5A 3FAWA 4J3UA 3VIIA 1GONA 3IAQA 3GTNA 1BVNP 3CHDA 4QDMA 5FOOA 4HOZA 5IHSA 3WQ5A 3AMLA 3CZKA 3WDPP 1LLOA 3AI0A 4TVCA 5F7UA 2WVTA 1WP6A 2XM1A 2CERA 1WE5A 2XPKA 5I0DA 5JUVA 1W3KA 3WQ4A 2YKKA 1L0PA 1H11A 1AQMA 3VD3A 1ZBWA 4H8VA 1PX4A 1RP8A 3WUEA 1JYVA 2MANA 4UQCA 1Q6EA 3GZAA 3VD9A 3N13A 1CGTA 5I23A 1ZL1A 3AISA 3SCTA 3WF4A 3VMPA 1HKKA 1SFSA 3AIQA 2XHYA 4U31A 5E0CA 4GPNA 3OLIA 5ABGA 4ZENA 1BFNA 3AHVA 1E4LA 3FHQA 2XIBA 3AIEA 3WDJA 1EXPA 3GNRA 3M07A 3AHYA 5A6JA 1KR1A 1OCQA 3CUHA 5LA1A 3ZJ6A 3L4VA 1HP4A 4BZYA 3ARSA 4MDPA 5LA2A 1EDTA 1UD6A 1WZMA 5EFDA 3PZGA 5JBFA 3O6AA 4S3JA 4CN1A 1MFVA 3NSMA 3CUFA 1UH2A 5M17A 1CZ1A 3ARZA 2PC8A 4RE4A 1Q6CA 3VDBA 1RH9A 1WPCA 2WB5A 1I1WA 4MPKA 2XIIA 3ZSTA 2VZUA 4MB5A 3VGGA 3TTYA 2JE8A 5C70A 1ISXA 2X05A 2W4XA 5AYBA 6A3HA 3IK2A 1UKPA 1WCGA 1J10A 1UR1A 4M56A 2DPEA 1WDQA 3T2PA 2CKSA 4F9DA 4PUDA 2XG9A 1PIGA 4NRSA 2FGLA 3RM9A 2XGBA 4LQ1A 1E40A 2GK1B 5FL1A 1UKOA 1W9VA 2X0YA 3GXMA 2CHNA 3NYDA 4AD1A 1DWJM 2DIEA 2G8ZA 4F8XA 3VOCA 3T2OA 2BVDA 3M7SA 3SUUA 1TFVA 3PZIA 1MQQA 3AJ7A 3SUVA 4H7VA 4Z2IA 1OD8A 2BY1A 1KGXA 1D7FA 4Y7EA 3T0DA 4Z2LA 4ACZA 1FH8A 2BFGA 2CITA 2YOCA 4MTVA 1JGIA 4DM1A 1LL4A 2ZE0A 3ZT7A 1JI1A 4C7FA 1W9UA 1C3FA 3WNOA 1UWUA 2WBKA 1JZ3A 3WEMA 2J25A 5A6BA 1W9BM 3PZ9A 2IXUA 1B2YA 2XFRA 3T09A 5CJ5A 3PZTA 3VPLA 4A3YA 1C8XA 4PUEA 1WDSA 4QCFA 3MV11 1OBAA 1E0WA 1GQLA 4J3WA 3AYSA 5DT5A 1J0HA 2CIPA 3VD7A 1CXFA 2ZX9A 4TUFA 3RDKA 4PSRA 3HU7A 2ZX8A 4PTXA 2ZUVA 3EDEA 1W91A 5A8OA 3EYPA 3GYCA 4U2YA 2E9BA 3ARTA 1BLIA 4PBGA 2XWDA 1JFXA 3LMYA 2WZEA 3N18A 4AXNA 3WNPA 4J3XA 1FHLA 4B9ZA 5CG0A 1JYNA 4B9YA 1CECA 1M04A 2VZTA 3J7HA 1V3HA 3CMGA 5FKYA 1JZ6A 4LXFA 2PI6A 3CIVA 5CPTA 1C8QA 1R8LA 3FHAA 2DH3A 1JFHA 4E2OA 1NQ6A 3CHFA 5DMYA 4Z2JA 4CVWA 4MNKA 2J7EA 2WSKA 4TVDA 1C93A 1JDAA 1NARA 1H3GA 2YBTA 2EXOA 5DFAA 2GFTA 1ECEA 3AXHA 2J77A 3WH5A 4JAWA 1CNVA 1B3VA 3L2MA 1W9DM 4YN5A 5BYWA 3W4RA 4AEEA 1E1FA 4MNMA 4AD2A 1J18A 2DSZA 3VM5A 1OIMA 3U7VA 3WIJA 1CGUA 1Z32X 2VI0A 2YDRA 4JZ5A 3KWXA 3WH6A 1HP5A 2D1ZA 4MJ4A 1FFQA 2DEPA 1D2KA 3THCA 3MS8A 4LX4A 3MSGA 4CD6A 1CGWA 5AYIA 1LF1A 3GBDA 4HMCA 3AIBA 3BAWA 2FHBA 1EQPA 3RJXA 1UD2A 3M6DA 4J3VA 3TONA 1V3KA 2XGIA 3PZMA 4XX6A 3QHOA 3VIGA 2J75A 1QNQA 4BA0A 3DYOA 2IXVA 2WCGA 3VIKA 1GJWA 4UZSA 2D3LA 3KE0A 4UCFA 5I6SA 4S3KA 1XH1A 1YHTA 1IZJA 2HVMA 2O9TA 2PF0A 2WVVA 4ZXLA 1VEOA 2WMIA 3MV01 3PTQA 1GNXA 2BY0A 2YL6A 4QLKA 2A3HA 3WF0A 1HF6A 5KEZA 3VGEA 1UWTA 3WSUA 1V0NA 1ISWA 4PMDA 3GXIA 1CXIA 3MMDA 4JHZA 5EMYA 2ZX7A 3CUJA 2D22A 2F8QA 4AYSA 1UR2A 4MB1A 4HP5A 3VMOA 3D5HA 2EO7A 1GOIA 2D2OA 2Y5EA 2CNCA 1B0IA 1NOUA 2ESCA 1E1EA 3WDIA 1TA3A 5DEZA 1ISZA 1HJUA 1V6VA 3N11A 1MW0A 1VFMA 2RGLA 2CHOA 1BG9A 1GORA 1LG1A 3VTRA 1JZ2A 4UOJA 4UFLA 5I3DA 1RPKA 2J79A 1J11A 2Z1KA 3GXDA 1G01A 2VCBA 1CLXA 3CZEA 1HKMA 3TTOA 1SMAA 1WNOA 1JNDA 3T2QA 4NI3A 3VVGA 3D3AA 4GZIA 3WQWA 1G0CA 4DWSD 1MVYA 3VD4A 3CZJA 1H09A 1H1NA 3W26A 1E55A 2VR5A 1QI2A 1XYFA 1E6NA 5IXEA 2WWDA 2WVVB 5ABHA 2VX5A 2V3EA 2WMIB 2E8ZA 4WSKA 3MUZ1 4GO8A 3VDHA 4PN2A 1UH4A 4NF7A 2QHAA 1PEZA 3AIWA 4AISA 3WL1A 1TG7A 2W92A 1XSIA 4PCTA 2CBUA 1M01A 1QNPA 1QI4A 2GJPA 4LYRA 4RL3A 3AS0A 1OT2A 2BVYA 3ZIZA 1VJSA 2Y8VA 1I75A 2EPKX 2PWDA 4OBRA 7TAAA 1QHPA 3BAJA 1HJWA 2YDSA 4ZXOA 1V6WA 1BF2A 3WH7A 1G1YA 1K9TA 3AMCA 1GQKA 5BXRA 4CN6A 2WHLA 3DHUA 3CMJA 5CPQA 4WJXA 2WMHA 4E8DA 2EBNA 3SEPA 4WKHA 4AY1A 1EGZA 1W3JA 3OGSA 3S6TA 5BCAA 4W86A 5I24A 1CGYA 3SCWA 3OA5A 3NUKA 1VB9A 1TVNA 1GUVA 3ARVA 1W3LA 4W8LA 1C8YA 4K68A 5CLWA 3ECQA 3N15A 4XZWA 3WDRA 2WK2A 1SR0A 4UFKA 1LL7A 3A6OA 3W0KA 4C7DA 4D71A 3WNKA 4BQ3A 3MUIA 2GJXA 5DF0A 2Y4SA 5A69A 3L4TA 3CZGA 1HXJA 2ZXBA 3WDQA 6CGTA 1EQCA 1R86A 1UQZA 5ABEA 4W84A 1HL9A 3G6MA 4GI6A 1RP9A 1B30A 2G41A 5BROA 3ZJ8A 5IDIA 1KXTA 2XYLA 2PWHA 4B3KA 4B16A 4D6EA 3KZSA 2VCAA 4IISA 4GI8A 3ZT6A 3POHA 2EPOA 3WBAA 5A1AA 1O6IA 1QW8A 4P8VA 4W5UA 4OBSA 4EK7A 5IFTA 1EOKA 2VRQA 4AZ5A 2E9MA 3VUPA 3KL3A 3QOMA 1V0LA 1C92A 1LG2A 1CDGA 1NP2A 4WK9A 5I79A 3W25A 4J28A 1UQYA 3MUAA 4TXEA 2ZICA 2G3JA 2WHMA 1E3XA 2PBGA 2ZUSA 5D8ZA 1CGXA 2E40A 4TOQA 2WW5A 2JEPA 3W38A 2W61A 5CGMA 2ZWYA 2J74A 5M03A 3JUGA 4M82A 2OYLA 1WZLA 1GOOA 1NOFA 3A4AA 2J78A 3AXIA 1M7XA 3RO8A 3F4VA 5BXPA 2JF7A 3W6LA 1PX8A 3I3DA 3ZR5A 1BYCA 2J7HA 1BHGA 2NT0A 2WC7A 3WF3A 1K9FA 3BLKA 2DT0A 3CH9A 1BYBA 6TAAA 4ZFMA 3NDZA 3O9NA 1TVPA 1MQPA 4WSJA 2NSXA 2D24A 4PTMA 5HDRA 2CCRA 2GJXB 1UHVA 1NOWA 3VILA 5E09A 4X0NA 4Z2HA 2UY3A 3ZOAA 2QV4A 3FW6A 3WQ6A 4HMDA 4H8UA 2CKRA 2V3DA 2ZUTA 3OLDA 4CCCA 1Q6FA 1QI0A 4QLLA 3THDA 3WL0A 1UYQA 4EAMA 1ISYA 2Y8KA 4CGTA 3W53A 3AICA 1E73M 1WO2A 4GQRA 5E9AA 1GCYA 2JIEA 3RILA 2A3BA 4ML4A 2V3FA 2J8FA 4OOZA 2AMGA 4J7RA 4IUGA 2E8YA 4HPHA 3ALGA 4DUWA 3ZMRA 5E6ZA 1XD0A 5D9MA 5A6KA 2WVSA 1UR4A 1XCWA 4UTFA 3CBWA 3AYRA 3GH4A 1M03A 3AOFA 1E5JA 3II1A 2D23A 3KEHA 4AZHA 4ATLA 3LPOA 1DWFM 2WLZA 5A8QA 2CYGA 2FGZA 1CENA 1B3WA 3NCOA 1I1XA 3K46A 2VVNA 1VRXA 1NM9A 5D4YA 2BS9A 2DGAA 3SUTA 2WXDM 4KH2A 5JIPA 3WF2A 1UWSA 1V02A 3GDBA 1W1VA 3AROA 1VENA 2UY4A 2C0HA 2DSUA 2VURA 4M29A 4PMOA 4AZ7A 3A47A 1J01A 3A4XA 3WD1A 3PTKA 4MNLA 4MDOA 4BS0A 2CETA 3W6MA 5I77A 3VDAA 4W7WA 5A3HA 1FHDA 4URIA 4PMNA 1V3LA 4LPCA 2VZOA 4UOZA 4Q7NA 4QAWA 4GINA 2CEQA 2D0FA 5A94A 3CPUA 1JZ7A 3CUIA 2QLYA 1OGSA 1CBGA 3VIFA 4N0RA 2VTFA 4JKMA 1EDGA 1W2VA 2WANA 2VUYA 2D0GA 3I3BA 5CLTA 1QI3A 4B3LA 1E4IA 3ARPA 4W87A 3EBVA 4E4PA 4CD8A 1CXLA 1BVZA 3ZJ7A 1C7SA 2CPUA 1JF6A 3WUGA 4NZCA 1LL6A 3VD5A 3L4UA 1OT1A 4PMXA 1WDRA 5D9PA 3OLEA 2VR4A 2F61A 1V3IA 4F9JA 1EO7A 3BLPX 2VZVA 2UY5A 4L4OA 3WEZA 4X9YA 1V0MA 3OGVA 3BC9A 1MYRA 1B31A 1KBBA 3MANA 1HX0A 2YLLA 5BWFA 2VVSA 5A2AA 3VDCA 1VJZA 1JDCA 3LPFA 1BG4A 1W9PA 4JHOA 4W85A 4JL1A 3OB8A 1G9HA 3UR8A 5HBFA 4CUCA 1K9EA 5A8NA 2VQTA 4WLCA 1A47A 3CUGA 3VKKA 3MSDA 3O2LA 3SIMA 1JXJA 2J7BA 4LYPA 3B9DA 2D3NA 2EPMX 4GI9A 4GXPA 4JKKA 4H8HA 3QOKA 1UH3A 4HA3A 3BAYA 4A3HA 4JFTA 4U5KA 1Q6GA 3L4ZA 1VFUA 1CLVA 3B9EA 4KMQA 2NT1A 3U7BA 4D6DA 3K4DA 1DWAM 1MFUA 3WUFA 4ACZB 4X0VA 1PPIA 4B15A 2J7FA 3AHZA 3WFLA 4YHEA 3ALFA 2JEQA 3WBEA 3LPGA 1VBRA 3RIKA 5D9OA 2O9PA 5CXPA 2GDVA 1FP9A 2G4FA 2J7DA 2J7CA 2VL4A 1JAEA 1KCLA 1PBGA 1UWQA 2ZXDA 4N42A 2CBVA 1GW1A 1EH9A 4UFMA 1IT0A 2G3MA 3ZSSA 1FA2A 2ZX5A 1BPLB 2XM2A 1HKJA 1UWRA 2BNJA 4AZGA 4W88A 2A3AA 1G5AA 5CGTA 4AD3A 1H49A 1UWIA 1U33A 3AXXA 3W37A 3WKZA 5GNYA 3SCVA 4MB3A 1E6XM 5JBEA 1ZBKA 2WZIA 1KCKA 3N1AA 4W8BA 4AZCA 2J8GA 3WF1A 4KGJA 3AS2A 1N82A 3ARYA 1TMQA 4AC1X 2WZHA 4OKDA 1OD0A 4J27A 4ATDA 3W82A 4JCMA 1KXQA 1C91A 5GNZA 3SCSA 4P8XA 3DYMA 4AWEA 1J0YA 4U2ZA 1OGGA 1Q4NX 5FL0A 2FH6A 1VIWA 2VQUA 2BHUA 3FY1A 1IV8A 1NWRA 2ZUWA 3VNZA 4HU0A 4CD7A 3W27A 2PWFA 3WH9A 1EDQA 2A3EA 3ARWA 3VO0A 3F5JA 2OWXA 5C8BB 1V08A 4ZE4A 2XVLA 4E8CA 2Q8XA 4Z2GA 1UZ4A 3DECA 3AMDA 5EFFA 1UD8A 2OWWA 4ZEPA 2RGMA 3VGHA 5ECUA 4BF7A 1LJYA 3AZSA 4UFIA 2B31A 4FF5A 1HVQA 2WKLA 1NWUA 1V03A 1R87A 3POCA 5FIPA 3KL5A 3AIRA 3U57A 1UR9A 5A95A 4V2XA 3T0BA 4A4AA 3VM7A 1CXKA 4W7UA 3WMBA 1JZ4A 2XWEA 1BYAA 1HJVA 3PBGA 3CTTA 4UOQA 4AD4A 1UKQA 1GQJA 2QMJA 3N04A 1XYZA 5EBAA 4HZ7A 4JKLA 4AMCA 3FAXA 2JFEX 2J62A 3EMQA 1P6WA 3SCOA 5AY7A 1WZAA 3MO4A 1J12A 4AZCB 3N9KA 4KRUA 1KQZA 1JDDA 2ZXQA 4OOUA 3VMNA 3AQUA 4HOWA 4UQEA 4AIUA 1XHGA 3EDDA 3CZLA 1XRVA 1W1YA 5D9NA 1D3CA 3SCRA 4YHGA 4HZ6A 3UESA 3BAXA 4HU8A 5AC5A 2ZOXA 4U3CA 1EHNA 4BQ5A 2X1IA 4W8AA 1OINA 4HMEA 1QNSA 3IJ9A 4GIAA 2YDQA 4W93A 1R7AA 4AEFA 3AFBA 2D20A 1J9YA 4MNJA 1UG6A 2WNWA 3WH8A 3M46A 3QHMA 2OYKA 2VCCA 3FNDA 1ZJAA 3VX1A 3E1F1 4JFUA 3WDHA 3AHTA 1BSIA 3HJEA 2FH8A 3MMWA 5GPRA 5TD4A 2O92A 2OSWA 3K1DA 1V02E 1GOMA 2WMFA 4R5EA 4GO9A 4H41A 8A3HA 4WKFA 2EPNA 5C71A 3VIOA 1YQ2A 2FHFA 5HNNA 2E3ZA 4MJ2A 3WNMA 3AMGA 2YA2A 1OM0A 4PCSA 1FP8A 1E70M 1GJUA 2OSXA 1F4AA 4AZIA 4CKQA 4UZUA 1M53A 1H5VA 3IJ8A 4ACYA 4ZE5A 1DWHM 2AOSA 1H4PA 5CSYA 1ZBCA 5HOSA 1E9LA 1TA3B 4EKJA 2E9LA 2EQDA 3VIJA 1JYWA 1QBAA 4PMYA 5M3WA 1UZ1A 1RD6A 3WD3A 1E15A 2W5FA 4DM2A 1HT6A 2YL9A 1V6UA 1VBUA 4UFHA 5I2UA 5CZKA 4JFVA 2ZXAA 1IZKA 1GVYA 2E0PA 3CGTA 4FMVA 3BCFA 4R27A 4D6GA 4CD5A 3SUSA 2QMKA 4BQ4A 3NDYA 4GZJA 4TX6A 4WF7A 4P8WA 5A6SA 2CESA 1AVAA 3MMUA 3NJ3A 4JFWA 3OIHA 4W7VA 4DUXA 5ABFA 2CXGA 3UEQA 3U5UA 2VJXA 2XUCA 3B8SA 4ATWA 2GSJA 3DYPA 2XVGA 2W62A 1BQCA 4U33A 5GQBA 2BVTA 4OIFA 2Y24A 4NSBA 4PEEA 5BXSA 2XVKA 1VAHA 3AHXA 3KL0A 5A8PA 3BMWA 1E71M 3EDFA 2BV9A 1J0ZA 3UERA 4JIEA 3VIPA 1KFWA 4H2CA 3K8LA 3CO4A 4P7OA 1ISVA 3IAPA 2G3IA 1ODUA 3LPPA 1SMDA 4DWSA 2IUZA 1JI2A 1ZU8A 4QFUA 4GKLA 3BSHA 1FH7A 5I5RA 1UKTA 2W63A 3WN6A 3ARXA 1E6QM 2YLAA 2E4TA 3AMKA 4IPLA 5BRQA
chains in the Genus database with same CATH superfamily
3V5CA 2BMBA 4BQ2A 3EOSA 1UMLA 4QBXA 3F2CA 1PSCA 2AGTA 3AUJA 1XSJA 1DORA 3RR4A 1MUMA 3RHGA 1QOXA 1CYGA 1HJSA 2QV5A 2VWTA 1CXEA 3D46A 1YNQA 4IT1A 3UG5A 1K4HA 2R9RA 4JNZA 3LCLA 4C1KA 1XINA 3MQTA 2VRKA 1EC7A 1YTKA 2DUZA 3OBAA 3S4TA 1A80A 3UPMA 2QS8A 1KLZA 4BY3A 2Y61A 5HPCA 2WKGA 4UR9A 2GK1A 3VIHA 1FWNA 1HIZA 5K7JA 4C91A 1CXHA 3PN8A 3OVRA 1W32A 1OFOA 2NQ9A 3PNUA 1X98A 4EACA 4C1NB 2XVPA 3LU2A 3BO9A 1MQRA 5JQ9A 4FPSA 2CLHA 4DELA 4FAMA 1KC7A 4DRSA 1VEMA 1OYAA 2F6KA 2Z1SA 2V2HA 4WKAA 1E4NA 4XTIA 4NJKA 1VRDA 2H9AA 1ZPTA 4M80A 2OELA 1LBFA 3NAVA 2C8NA 1HKIA 3VZYA 3MDUA 3TMLA 1A3HA 3DG6A 2E6AA 2DSWA 4L4LA 1QNRA 3E74A 3IJ7A 4F66A 1V79A 2PRLA 3WO8A 2ZZ3A 1M41A 5EB8A 2Y7EA 5CSUA 4YXGA 4D6HA 3ZR6A 1Z89A 3W2JA 1VHNA 3S5ZA 4JIHA 2DY3A 1F3TA 1E5NA 2JALA 1L8PA 2VRJA 1R5YA 4AZ6A 1A4LA 3WYZA 5CPNA 3OBKA 1O12A 3NG3A 4IG2B 3BAIA 4Q8WA 1V3JA 1JCLA 1AZ2A 1IWPA 1KXHA 1GHRA 4HA1A 4X63A 4UTUA 1GPWA 3STFA 4CCDA 1TZ7A 4IIHA 3GG7A 2GDUA 4Y96A 3M5VA 2GVEA 1SZGA 2V2CA 2UWFA 2PU1A 3CIXA 3VNIA 1HW6A 1UA3A 1UROA 3PZOA 4P7LA 1OIFA 2X8RA 2DZVA 3NR0A 2WHKA 4R7WA 4PL2A 3T44A 2QDEA 1M68A 4JBRA 1PUDA 4GZEA 1EZWA 4I9TA 3GDRA 5DO8A 2BXZA 3EX3A 2PCEA 1OCJA 1XLLA 3NSXA 3UP8A 3MHUA 1OY0A 1J93A 3QY8A 3S6OA 1MRAA 2YBUA 3IUDA 3PZQA 4QJ3B 4Z2KA 1GYNA 1TJPA 3ARQA 5E70A 4GQ0A 8CGTA 1GEHA 4OZOA 3NGFA 2F2HA 4GVFA 5A8MA 4DUVA 2HK1A 4JGDA 2OEJA 1GKPA 1D8CA 1RD5A 4LBRA 3MZNA 3TLLA 4LT9A 1WV2A 3IIXA 1XH0A 4JHMA 1CW2A 1ONEA 5CZTA 2TYSA 3AS3A 2XJ7A 4FNPA 2CZFA 2W0UA 4R53A 5FAGA 3TJIA 4AY7A 1QW7A 3SCPA 1J0JA 3RM8A 3F4WA 1M7OA 1ME9A 2V82A 4AZBA 1RV8A 4LH8A 1R2SA 1H2JA 2BASA 3OQEA 1OSEA 2W79A 2FHCA 3EMZA 1OCNA 1EGVA 1JL8A 4K3ZA 6XIMA 4IQJA 1LDCA 2DV0A 1KM0A 1RPXA 3K8MA 3MKKA 4GFSA 4PBFA 3TTQA 4LNCA 4ZGYA 3E3HA 3SCUA 4KGLA 3SFKA 4HA4A 3DBNA 3N29A 2HBVA 5AZ0A 2WZMA 3EKLA 4LV4A 1ZLPA 5A2CA 4PSPA 2EKCA 4KEVA 3KOZA 2VKZG 4KS0A 2ZZ2A 2R24A 1IEIA 4DBEA 4WDXA 3C8FA 3F2DA 4XISA 3UG3A 4HZ8A 1ONXA 3Q4DA 4Q4SA 2NV2A 1JGMA 2OZTA 1S46A 1XIDA 2Y2WA 3NQ7A 3A5FA 4TU1A 4O4VA 1JG9A 3VGDA 1W9XA 2ZA2A 2BHZA 3TC3A 3WJZA 1T5AA 4L1GA 3VFCA 4PTWA 3PJTA 1H0IA 5FD0A 2QNEA 3EKZA 1OZQA 1LWHA 1VZWA 2GLKA 2PB1A 4LWWA 4DAFA 1U2YA 2JKPA 1JRCA 3H53A 2ZX6A 1NWTA 4IQEA 4XUYA 1XPYA 1YBQB 3RITA 2HE8A 3PC0A 2H90A 4D72A 5D2XA 3UZYA 5G2WA 4ZCWA 3FKKA 4IJBA 1P7TA 4TTGA 3GBEA 1EJXC 2ABBA 3JVAA 1B3OA 1K4GA 3WD4A 1B5TA 4NX0A 1PB0A 3HOJA 3GNPA 3SY8A 5K9CA 3W07A 3KOYA 3L0KA 5D03A 3P5YA 1ZAIA 5JU6A 5FJUA 4ICNA 4CVUA 5D32A 3HIJA 3F5KA 3UGRA 2VX4A 1ESWA 4HNNA 4XO7A 1SZFA 3TTSA 1UD4A 2NZLA 1HL8A 1PVNA 2IQDA 1DWGM 4HD5A 1DTNA 1CEOA 3BH4A 3DOPA 5FEZA 3ZZ1A 4OWGA 5DRIA 4RJEA 3CL8A 1VIZA 4ONVA 3W7KA 1R9XA 2GVYA 1TIMA 4IP7A 1KKOA 3GUGA 5DX7A 1K02A 1FFRA 2FTWA 1YDVA 3HA1A 2WAGA 1YNYA 4KWSA 1EEPA 3NIYA 3MWCA 4ZZ9A 1FH9A 4QP0A 4IJCA 3LSCA 2VX7A 4JN8A 4YNGA 1CT5A 2TAAA 4UTTA 4E6MA 2BOFX 5KTLA 2Q3RA 1LBMA 3KCOA 1XGDA 2OKOA 5GNXA 3QV7A 2PMQA 4LC6A 1V0KA 3S8HA 1OK6A 4ZB2A 3WELA 1BTCA 4R9XA 1UZHA 1V6YA 5LIUX 2AQVA 4UQBA 2F9RA 4P7NA 2X2YA 4Y9MA 3T0AA 3QKEA 4HNUA 1L8NA 4GOAA 2BSLA 3UCQA 2DIKA 4CNTA 3HV9A 5KETA 3VXGA 3A5VA 1P0NA 2WJZA 4W89A 3QM3A 5F2MA 2ASHA 1M9HA 2PTYA 1JQVA 3P60A 4N9CA 2RJGA 4GJ1A 1CTNA 1K7EA 4K8EA 2V38A 3LCWA 4FNQA 5CGQA 1RQHA 1XV8A 1DP0A 3E5PA 3WK3A 4FO4A 4JQ1A 3G3DA 4D1JA 4PULA 1SR9A 2CLOA 3EA2A 3DG3A 4K8HA 3UG4A 1DTUA 3TW6A 3I3EA 4N6FA 4KIRA 1KWGA 5AKQA 2DZUA 3CNYA 3L4XA 1VYRA 3FS2A 3TX9A 3KWSA 4L4MA 1UA7A 3JZEA 2XVNA 4IH3A 4YPJA 1PZ1A 1S2CA 4M24A 4NAFB 3KRUA 3UWWA 3R7MA 2QPUA 4MFDA 3RN6A 5LIWX 4CQCA 1R6WA 2QT3A 3CHEA 1X1NA 1VC4A 3TYAA 2EEXA 4MHBA 1ZCOA 4MJZA 1D8WA 1FQ0A 5BU6A 1E3ZA 3BCDA 3NQEA 3NGJA 2GGGA 3EB3A 2VOTA 2Z1BA 4AD5A 3FAWA 3MUCA 1KM6A 3IAQA 2J9YA 4NKCA 3IGHX 1D3GA 3CB8A 1A5NC 4EXQA 3OVGA 3CZKA 3G1HA 1JPIA 3LY0A 2WVTA 2XM1A 1ZSXA 3B0VC 1G4PA 3WQ4A 1L0PA 1MUCA 3FXGA 3VD3A 1ZBWA 4H8VA 3DDMA 1PX4A 7ENLA 1JYVA 2O55A 4YL2A 2MANA 4UQCA 1U1HA 3ABXA 1TJ1A 1Q6EA 5HNUA 1TPC1 3N13A 3H26A 3LLFA 3U9IA 3MJMA 3W7EA 3AISA 1IEVA 3T4WA 1YMYA 1BFNA 1M3UA 2HZGA 3AIEA 4GVGA 3M07A 1DQWA 3IJDA 1G7UA 2YCLA 1Y5VA 2W3ZA 3BLLA 4PBEA 5LA1A 4OTKA 5AVHA 3L4VA 4GCXA 1HP4A 1AA1B 4KETA 1ZTVA 3NVTA 5D2YA 3W1QA 2QW5A 4PCPA 4A22A 3CUFA 5M17A 3P8IA 1NDWA 3M4HA 5F1VA 4RE4A 1Q6CA 1Z41A 4C6KA 3VDBA 3LGGA 1RH9A 2GQAA 1FCQA 2C19A 2WB5A 2DVUA 4S1FA 2VELA 1EX1A 2XIIA 3L0NA 2CXEA 2CWXA 4CNPA 1ISXA 1IXNA 4NILA 3PJWA 1UBSA 4IGNA 2HVNA 5EBUA 3A13A 3S6DA 3WK0A 4F9DA 4XD4A 4H9ZA 1PIGA 4NRSA 2YXOA 4PUMA 1AH0A 3QMTA 4IL0A 2RAGA 4DI8A 2GK1B 1OF8A 4E5TA 2B7NA 3I4KA 1AJZA 4XD5A 4UTWC 5EMJA 1DWJM 1GOXA 2DIEA 4FZIA 3QPYA 1YDNA 3M7SA 3WBYA 1MQQA 2FQIA 2YZ5A 3AJ7A 4Z2IA 1D7FA 3RMJA 2C1IA 2FVLA 2QUUA 4Z2LA 4UB9A 1IZCA 4MTVA 3W86A 1UBPC 3W7LA 1DXIA 1QFEA 1LL4A 4GH3A 3B04A 5LNVA 1SQ7A 3WQOA 3SW6A 4HHMA 4H83A 2HROA 1NSJA 1UUMA 2XSXA 1UWUA 3PPCA 1RA5A 2KX9A 3W7MA 2IXUA 1B2YA 3PZTA 1E9ZB 1EC9A 4UTWA 4J40A 3W3OA 1YDYA 1SZEA 2HS6A 4RZ6A 1CXFA 4DJFD 5F2LA 1Q85A 4GGBA 1Q6OA 3M0ZA 3OVQA 3W2NA 5F4XA 1NDYA 3FSUA 3ZXWA 3EYPA 3GYCA 4LCRA 3WLIA 3ARTA 3DI1A 4B9ZA 3SI9A 5CG0A 1CECA 4ORMA 3NQ6A 3H4GA 1YKWA 5FKYA 5AOUA 2KAUC 1JZ6A 3H21A 4JYEA 2UV8G 1R8LA 2REQA 3QFEA 4N2YA 4INFA 2VDGA 4WDTA 1R3YA 2E28A 1QJWA 3CHFA 3DFSA 3RYSA 4MNKA 1KFEA 4HHHA 1EF2A 1HO1A 3W2MA 4O57A 1ECEA 3AXHA 3MMTA 4PZVA 1C9DA 3RLVA 4JAWA 3L2MA 1W9DM 3MYPA 5FF4A 2BZNA 4IL2A 4AD2A 3VM5A 2DSZA 1OIMA 2QDGA 1CGUA 3M0LA 4JZ5A 2VFIA 2ZZ5A 4J1OA 4HJWA 2R6OA 2D1ZA 2VEFA 2DEPA 3THCA 4LX4A 3MSGA 3UD6A 3W9ZA 4M0XA 5AYIA 2IKGA 5C9XA 1NVMA 1RXOB 5EMMA 2FHBA 2F38A 2BOGX 1ICPA 4LVAA 2XGIA 1H62A 4RNHA 3UW6A 4IIEA 3R0KA 3LHWA 4LW7A 2IXVA 1VYSX 2WCGA 2Q02A 3CL7A 3RX4A 3VIKA 1GJWA 1SSDA 2RFGA 4S3KA 3FGCB 2PPGA 2WVVA 4O4WA 2WMIA 3MV01 3OP2A 4WJEA 2YYUA 4B2DA 3BARA 2CZ5A 5D09A 3URBA 1TPDA 3DX5A 3GR8A 3ONBA 2J13A 4F3HA 3GHSA 1CXIA 3GXIA 3ITTA 5CC5A 2ZX7A 2H6RA 3E2SA 2FJUB 2D22A 3E0IA 1EJSC 1K3UA 1UR2A 5AYZA 3QY7A 4J4KA 1G4SA 4EOUA 3IRDA 3GXNA 1FWCC 4I7WA 1QR7A 1DQXA 5CC7A 2YCJA 1VFMA 2RGLA 1GZ1A 1K03A 2X1SA 3W1LA 4MGGA 1J11A 4TO8A 1G01A 1Z6KA 1XYAA 2VCBA 1TJ2A 3CZEA 2FZ8A 3WLNA 3RUBL 1WNOA 1JNDA 4NI3A 1QPQA 2DVXA 2A79A 1R3VA 1MVYA 3VD4A 1XPGA 3BICA 1O95A 1H1NA 5IXEA 4AHPA 2ABAA 3KOWA 4FNRA 1EUNA 3CT7A 4WSKA 4XAPA 3MUZ1 3NQAA 2J6VA 3W75A 2CLLA 4NF7A 3AU6A 2QHAA 3AIWA 1ADOA 4AISA 3WL1A 1VH7A 4KCWA 1YXDA 1QNPA 1BXBA 1RVKA 3NQDA 1ALDA 4OV4A 4LYRA 2BVYA 2ZC8A 3GO2A 1QHPA 3BAJA 4ZL1A 2OOGA 1V6WA 4HBKA 3TN3A 3AMCA 2CLEA 3DKJA 3DHUA 1K1DA 2J27A 3UZXA 4M6VA 4GUGA 4E8DA 2EBNA 4AHOA 1PKYA 4WKHA 4AVFA 3UZJA 3S6TA 3DC8A 2PD9A 5I24A 3G18A 2C15A 2PP0A 1VB9A 4EPBC 3IUHA 5AC8A 2VD9A 3LERA 3I65A 4Y8EA 4DF0A 2QULA 1XYCA 1PO9A 3M64A 1LL7A 2AL1A 4C7DA 5K3VA 1I45A 1KM3A 4L6DA 4QJ5B 5DF0A 1HXJA 2JGQA 5H8UA 4QSFA 1FY6A 3NPVA 3GTHA 2QJGA 2G41A 3ZJ8A 3BW3A 4JTRA 2Z25A 2XYLA 4B3KA 2QJJA 2YX0A 3STEA 4ZQPA 2BGQA 3SN1A 5A1AA 1QW8A 4W5UA 1B4KA 1XLMA 3W84A 3H22A 2E9MA 3NO3A 5H8PA 1S39A 4CEXC 4ERGA 5E0KA 1PWMA 1DHPA 1XLEA 1UQYA 3MUAA 5G4HC 5F1UA 3E38A 2OO6A 1CGXA 2E40A 2WW5A 3V1HA 2ZWYA 2Y1HA 5M03A 4M82A 5T9BG 1XC4A 2OYLA 1WZLA 1NOFA 1B9BA 3A4AA 2J78A 2R1MA 2C91A 3OHMB 4MFEA 1XM3A 4JTUA 2OZ3A 1TPB1 1BYCA 2J7HA 2GGJA 3SY1A 2AGKA 2DJLA 2V2DA 1IIGA 4C6PA 3VKDA 6TAAA 4JTFA 4LALA 5TNVA 3GDKA 4I5RA 3PK7A 2P3EA 3NNTA 5SWUA 4JXCA 2NSXA 4LVBA 1J8VA 2GJXB 3W1MA 1NOWA 3VILA 4EAYA 3NQMA 3B3DA 1SVDA 5KSWA 1TREA 4EPDC 4H8UA 1KBIA 1GK8A 5H91A 1Q6FA 1FDYA 3THDA 3TTEA 5HQLA 3GG8A 2ALRA 4B5NA 3LD5A 1JCMP 4CGTA 3GYEA 1X39A 1Q3NA 3PUOA 3QEZA 5H1WA 4NASA 2R1PA 4J7RA 1I2RA 2G4JA 3P80A 3ZMRA 1XD0A 5G4EA 5D9MA 5A6KA 2C6QA 1M03A 3II1A 1LBLA 1OFQA 1IR2A 1DJQA 4IPIA 3VK5A 1XG4A 3O15A 1EB3A 4JTHA 1CENA 3EXRA 3PWAA 2Q8LA 1LP6A 4DJDD 4KH2A 1UWSA 3TA6A 1OX4A 1V02A 3GDBA 3W1UA 1W1VA 3AROA 2DSUA 4KWVA 4FOJA 2INEA 3C8NA 2OMAA 4IXXA 1JULA 1Z69A 3OEXA 3PTKA 4MNLA 4BS0A 4C6JA 3RPTA 4IIDA 4Q8UA 5A3HA 2PD5A 3M0IA 1OC6A 3COTA 1Y5XA 2VZOA 3T0TA 5A94A 1JZ7A 4CNSA 3VIFA 5AYXA 1W2VA 3APTA 1X8CA 3BLOA 3KS6A 1QI3A 4B3LA 1E4IA 3DZ1A 4W87A 3VI2A 4WDUA 2HSAA 4N4QA 3DKLA 1FWHC 1BVZA 2VFHA 4B5TA 1KNWA 3BK0A 2CPUA 2VOMA 3V35A 4YVPA 3RK8A 4NZCA 3BURA 3L5AA 3BJFA 2R91A 1S2TA 4L4OA 4X9YA 3EWDA 3BC9A 1VCGA 1B31A 3A9IA 1Z8AA 2QDDA 3O1NA 4EXBA 4QITA 2VVSA 1VJZA 1W9PA 4W85A 1OYCA 4JL1A 5HBFA 4CUCA 2RHGA 3JZUA 4LCQA 5DBUA 3TYUA 1HL2A 3QJAA 5C9WA 3MSDA 1I4NA 1N2VA 2E7FA 1LWIA 4LYPA 4H9TA 2G3FA 2YB1A 5HNRA 3LBCA 4M3PA 3LHUA 4H8HA 2IQTA 3L7RA 3V0UA 5BMXA 4HT3A 3G0UA 1ME8A 3L4ZA 4XZLX 3V16A 3B9EA 2PDLA 3U7BA 4D6DA 1MNZA 4LVDA 1UPMB 1MFUA 2ZRVA 2HVOA 4IFKB 3TW7A 5I3HA 3WFLA 1X97A 1FUYA 3KHJA 3WBEA 1VBRA 2O9PA 3AAMA 4IMDA 1E1CA 3NO1A 2HCVA 3UWYA 4O1DA 2J7DA 2J7CA 3QZEA 4DY1A 1CX9A 4GBUA 2G3MA 4LUTA 3ZSSA 3A9BA 1GVEA 2ZX5A 1D3HA 2XM2A 1UWRA 3TR2A 4AZGA 4W88A 1S5VA 1TZ9A 3T07A 1A5SA 2A0NA 7ODCA 4O1FA 1UWIA 5DMNA 1SJCA 3HURA 4MB3A 4M6UA 2V69A 1KCKA 3EKGA 3FFSA 4NZ5A 4DZIA 1N82A 1TMQA 1ADDA 3BJTA 1I0BA 4LUSB 4W9TA 4HNOA 4ATDA 3FYOA 1C91A 5GNZA 1F07A 3SCSA 4IQDA 3VAVA 1JUKA 4BKNA 1J0YA 4U2ZA 5EYWA 2FZ9A 1UJQA 2GQ3A 1FHVA 4R85A 3VNZA 4HU0A 3W27A 1AD1A 3ZLHA 1XYMA 3WH9A 3KCJA 3UR5A 4ZA0A 3EPNA 1HUVA 4H01A 3R12A 2OWXA 5C8BB 1AL7A 1UZ4A 1NF0A 3KP0A 4LOCA 1KV5A 2PDJA 5EFFA 2BDQA 1UD8A 1VFTA 4ZEPA 2RGMA 4BF7A 5ECUA 1S3TC 4JICA 2PWUA 2YSWA 4FF5A 1RHCA 5K9DA 1Q8JA 4LVGA 3VKJA 1N8WA 3MUXA 2GSEA 4XO6A 4WDWA 5A95A 2FPTA 5HMEA 1N8FA 4V2XA 3VM7A 1CXKA 2XISA 2G37A 3LDVA 2GGIA 4JTTA 3LCFA 3PBGA 2I57A 5BRBA 5E9XA 2R8WA 4MYXA 1XYZA 4L64A 4LF2A 2CLFA 4NJIA 1KD0A 3BLDA 1TYGA 2C71A 1J12A 4CQBA 4MOZA 4KRUA 1KQZA 1XIIA 3KXQA 5HMFA 4UQEA 1XHGA 1PKNA 4WSHA 1XRVA 2JBMA 1D3CA 4NJGA 4YHGA 2V9DA 4HU8A 5AC5A 2OGJA 4AF0B 1EHNA 1SPQA 4YWSA 5A6TC 1Z48A 4HMEA 1QNSA 2A6NA 5LNRA 2C0AA 2Z4GA 2E68A 3LXBA 4ZTYA 4AEFA 1KLYA 3ZVHA 1J9YA 3G1SA 4ZBCA 1W37A 3FSTA 3U48A 4AB4A 1HKWA 1KRBC 3QSRA 2VCCA 1XL9A 3FNDA 4RDVA 1A3WA 2ZA3A 4QSHA 4F4RA 3HJEA 2EPHA 2FH8A 3ERPA 4C6LA 3UZZA 4RNFA 3LHZA 4RV8A 8A3HA 3LSBA 3VIOA 1OCBA 2FHFA 4JQ4A 4MJ2A 1WDWA 4FP1A 3UFYA 1F4AA 4AZIA 3LI0A 1DYSA 2BX7A 4RW5A 3WQFA 4EX4A 1SJAA 4GBDA 5ABTA 1DJZA 3PM6A 3DG7A 5DLCA 3UXKA 5HOSA 1ZBCA 3C2VA 4R7JA 3W2KA 2E9LA 2EQDA 4EKJA 4XKYB 2CZEA 4PMYA 1XBYA 2W5FA 1HT6A 2YL9A 5BOOA 4ZOEA 3XISA 3O16A 3GTXA 4TIMA 3TYCA 4UUIA 1A5KC 4CD5A 1ZGDA 3B9NA 2F7FA 1M5WA 5AC6A 2YDAA 1NFGA 3KCLA 4JFWA 2PZ0A 3OIHA 5ABFA 3WLPA 1J4EA 2Z7GA 4EF9A 1EEXA 3BQ5A 4JD4A 3GUWA 2E67A 3ABRA 4U33A 1BQCA 1VGAA 4ZQMA 4AFYA 1RA0A 4F0HA 3EB4A 4GWEA 2NLIA 2PRMA 1VAHA 3AHXA 5A8PA 1E71M 2BV9A 1WXJA 1OABA 2V68A 3VIPA 3NURA 1XGEA 3DHDA 4H2CA 3H2AA 3CV7A 4HPNA 2PUZA 4P7OA 1ISVA 4IMAA 4DNHA 4DWSA 2IUZA 3BLFA 3WQEA 4ERIA 3SY5A 1FH7A 5I5RA 3RRXA 3AMKA 4FB7A 4IPLA 4EK7A 2JF6A 4FX8A 3QQ0A 2PRHA 4Q4MA 4J3TA 5LKYA 1BGGA 1PIIA 4IICA 5HA7A 1J5TA 4E0CA 4NRRA 1VHCA 3TJ4A 1RAKA 1H41A 1KM5A 3BMVA 4J35A 1XLKA 3UY7A 3L4YA 3I7RA 1H51A 3SCQA 2QGHA 3WEOA 3SURA 3OTRA 2XSAA 3TXVA 3DUGA 2TODA 3G6LA 1CI1A 5E0FA 2NWSA 1A0EA 2Z2BA 4F0SA 1UIPA 3P6LA 4A8RA 1J0KA 6XIAA 1Q5MA 7CGTA 2QF7A 2MUCA 3H7RA 1YRRA 1Z44A 1K7FA 2CW6A 2PGFA 4IP5A 2DUXA 5IOBA 1X6NA 3CJPA 5FSDC 5C2GA 2ZRUA 2A3CA 2NQHA 4Q8NA 3W1XA 2Y8UA 3WD2A 4GACA 2Z2AA 3DGBA 2PS2A 4D8ZA 2CBJA 2DIJA 3WY1A 1H5YA 2Y62A 4PMQA 2BWGA 1VFLA 4PFHA 3LLDA 1PAMA 4CU8A 1UOKA 1G4TA 4QM1A 3UVIA 4B90A 3EEZA 1SW3A 4TX8A 2ZUNA 2DU2A 3Q2DA 1HVXA 3EOUA 3KBNA 3AZTA 4TTUA 1ELSA 1G7VA 1MW3A 3T05A 1F73A 4XZBA 3BWWA 4ADSA 3A3HA 1JZ8A 1B4EA 2DJXA 4PUNA 3PUEA 2PGRA 2YB4A 1Q63A 3A3XA 3BAKA 3TA9A 1T8QA 3VCCA 1J6PA 3HTWA 4D2JA 2GZXA 3E2RA 1WBHA 2WKJA 4LF1A 5T91A 3UF9A 1KTNA 3P5ZA 3P84A 1R38A 2KZHA 2CHRA 4Q4PA 3H2CA 4GISA 1O4UA 5TAOA 2XFYA 5HR6A 1AH4A 1ZJHA 4AIOA 1TB3A 3T42A 2VDHA 1ZAHA 2ACSA 1YTDA 1ZENA 3BSMA 3TJLA 4NL1A 2FTYA 5IHRA 5A8GA 1TWZA 4YCOA 2QPSA 3WENA 3RLGA 4BFAA 4DLMA 1MXSA 4MYAA 5BRPA 2WVUA 5G1MA 1BRLA 4M6PA 2P8BA 1HJQA 3GFZA 1OX4B 4LS2A 2O56A 2VMFA 4BI7A 2EG7A 1OK4A 2YYTA 2W67A 4E2BA 1H50A 1OFDA 1V3MA 1GOQA 3TV8A 5HR7A 7REQA 4JNYA 1UOZA 2GUUA 3CB3A 4M19A 3SGUA 2GQ9A 1U30A 4MB4A 2OX4A 4EF8A 1FWJC 3B0UX 2C3ZA 4H6KA 2GUYA 2XIOA 3SADA 3GIYA 3NPXA 3CAQA 3K4WA 2DORA 1UC5A 4RE2A 1TMLA 1XKYA 2XTKA 2WO5A 4DJFC 1EOMA 5D8WA 5HPOA 3CWOX 1QO5A 2PLKA 1E0VA 1RR2A 4XZNX 4ICMA 2BY2A 1JUBA 4JTGA 5CQ1A 3GHUA 4Q8MA 1KFKA 2AAMA 2X1RA 2BTMA 2OCZA 3W00A 1LQ0A 2P0OA 3V75A 4OECA 1X6LA 1QHZA 3G22A 4XWUA 1LWJA 5CBBA 5CC6A 2QUNA 1R7OA 3S9IA 4GKTA 1VBJA 2Z1WA 3T40A 1CPUA 2V30A 5FEPA 2V8ZA 3EX1A 3PZNA 4F48A 2PTWA 4HNVA 4P61A 3W01A 2ZTKA 1XYLA 3OYXA 4QE1A 1W1ZA 4KCVA 2WOQA 3IANA 1H0GA 1YW1A 3HJZA 3GM8A 1LRTA 3EPMA 5HXMA 2WQPA 5C9UA 3V18A 4PRWA 2A7PA 1ODZA 1XLFA 2WMJA 3N17A 2NXIA 3AYTA 4CNNA 4RXGA 1R9YA 5EL1A 1QTWA 1YDOA 3EPOA 3OLGA 1IXPA 4Y8FA 1H7OA 1J2BA 2FFCA 3OU8A 3LCIA 4GMEA 4FXFA 3N12A 2QCEA 1NWSA 1C7TA 9CGTA 4OJYA 4S3DA 4DVOA 3LCXA 4JTJA 4CU6A 1MXGA 2CU0A 1OFRA 1HN1A 1JCTA 2WSPA 3HN3A 4M81A 3MP3A 3W7NA 1GVFA 2NV1A 3GXFA 2TMDA 1O94A 1MEHA 4QNEA 1F3WA 1S2VA 1H7PA 3VKCA 1TMHA 2PURA 1VFOA 2ZIDA 3KDNA 5G1TA 2ZDRA 1B3XA 3P8JA 3RNDA 2GJNA 4POCA 5AECA 4JIPA 4DF1A 1GZJA 2X42A 3UYCA 1DJYA 4ZOAA 4FLOA 3ZQ9A 3QTPA 3TWBA 3ABOA 3CQ0A 4RR4A 3W76A 4EP8C 3FVMA 4I6VA 2HBXA 1KTCA 1HFBA 3S46A 1UKSA 2I9UA 4JPGA 4DPPA 4FX6M 5C55A 1PX3A 2YR1A 2ISDA 5I09A 2OYMA 3MKVA 5HINA 1US3A 2A4AA 2X09A 1C90A 4YYCA 2VC6A 5BOEA 2AAAA 2OJPA 4MWAE 1XI3A 3PHAA 2POZA 3W7QA 3LXAA 2G3NA 3LBMA 2PDXA 4FX7A 1EP2A 4LAMA 1R2RA 2P8CA 3FN9A 5XIMA 1KKRA 3CL6A 2NQ5A 4XAYA 4JR5A 1GZGA 1MI3A 3AIUA 2DW6A 3VX0A 1NAL1 2OEMA 2ATSA 1DJIA 1SU5A 2CC0A 1MRQA 1UR0A 2QXWA 3S1VA 4JQ2A 1NP0A 2I56A 4MY9A 1S2WA 4QLJA 4D6CA 1B90A 3R58A 3OJGA 2PDNA 1DJNA 1W3NA 1H7NA 4EWJA 1VF8A 1V7YA 1TX0A 1W1PA 4B4HA 3M41A 3LHVA 3KP1A 4PUJA 3GC4A 4P8UA 3ONCA 3N4EA 5KZMA 4B3ZA 5D38A 1TO3A 4LY8A 4HU4A 3W28A 5F2GA 2YW3A 2WC4A 3KVMA 2WM0A 2IPJA 3OZPA 4CN4A 2Y7DA 4D1IA 4J5NA 5HMDA 2PWGA 4L56A 2VX6A 2YW4A 5LNUA 3FV9A 1JEZA 1GTHA 1ZB5A 2W91A 4C65A 1MDLA 1UD5A 1RBLA 3SDOA 4XK2A 5KZ6A 4D6IA 1WDPA 1SFTA 1XH2A 3C2FA 4L7ZA 1OFPA 2POTA 4AYGA 1P0DA 4G5DA 1RJRA 4XZMX 1J96A 1VPQA 3ANUA 4FK9A 4NG3A 2IPFA 3VIIA 2O4MA 4AWSA 2L5HA 5FOOA 2OTDA 3MT1A 3WQ5A 3WDPP 1PHQA 4TVCA 1R47A 2ODOA 4GQGA 1WE5A 1MEWA 2V81A 3EX6A 3UNDA 3V5FA 1W3KA 2YKKA 1H11A 1ML1A 5FSEC 4S2CA 3U4AA 5CZ0A 2XGZA 5D2WA 1TJ0A 1RP8A 4QISA 3BG3A 4Z0JA 3HO8A 1M6JA 3ENLA 5HWNA 4Y9AA 2YCKX 4MM1A 4HIBA 3SCTA 1F76A 4G1NA 3VMPA 3VCNA 5LSMA 3AIQA 3R8RA 3OLIA 4ZENA 3FHQA 1ZALA 2VWSA 3WDJA 3MBDA 4GA8A 4NAEA 2DP3A 5A6JA 1IR1A 3NEVA 1ZNNA 1P0KA 3LRLA 1WZMA 5EFDA 2OB3A 1MFVA 4IP4A 1WKDA 2ISFA 3NOEA 1ZZMA 3CV6A 3QLDA 4Q7IA 2F6XA 3BUVA 3SRDA 3TN4A 5AHEA 1I1WA 1KCXA 3ZSTA 3H2NA 4JN6A 1F7BA 2JE8A 3T1GA 3QGAC 1YADA 4MPQA 4IMEA 2X05A 2VGGA 5HAOA 2O7QA 3IK2A 4ZO9A 4E8GA 1SFJA 3O0FA 3REQA 1UR1A 1QOQA 4OQVA 4IMFA 4MWAA 4Z42C 2JKEA 1WAUA 3AALA 5BOFA 3BZGA 4C6IA 4O28A 3RM9A 2FLIA 2QCMA 4LQ1A 2XGBA 1BXCA 2FVMA 4GZ7A 3GD6A 5FL1A 2WSRA 5K4ZA 3GXMA 2CHNA 1RQBA 3ES7A 4DBSA 5H2ZA 3N2CA 4YIWA 4F8XA 2X7WA 3TYDA 1MSSA 2NLYA 1XCFA 2HJPA 3QC3A 4IIFA 4H7VA 3PP7A 1FCVA 4LRSA 4I8YA 3B0YA 3GDLA 3UWZA 3GR7A 4ACZA 4QJ1A 2YOCA 3B4UA 4DM1A 1OFAA 1W5PA 3BJSA 4DJDC 3AC0A 2HMCA 4WD0A 3JW7A 4MVAA 2H3BA 1SO4A 1XLAA 1F6KA 1AZ1A 2OQYA 5A6BA 1SUXA 1WUFA 3HG2A 2VHLA 5CJ5A 1B54A 1H7RA 3CAWA 3KOXA 5M1TA 2B4GA 2NQZA 6REQB 4GIRA 1AW5A 1Q66A 5DT5A 5JVLA 2WJFA 1G6CA 2ZX9A 2ZX8A 3GFXA 4A8IA 2GJLA 1F6PA 1QOPA 2INFA 1BTMA 1LZOA 3MTWA 1A49A 2QCGA 3LI1A 3U6WA 1MEIA 2OT1A 3WNPA 4J3XA 1JYNA 1OFEA 1R3QA 1LRQA 4E3TA 1IHIA 1M04A 2VZTA 1V3HA 3CMGA 3S9YA 5JH2A 3CIVA 4RCXA 3GSMA 3FHAA 3RAOA 3N34A 3K13A 3FVDA 5C54A 2DZAA 1B57A 4Z2JA 4CVWA 1NU5A 1QATA 5AFDA 1C93A 5K9XA 2YBTA 4QQ3A 3Q65A 5DFAA 3R43A 4O0KA 2EHHA 2J77A 3WH5A 4Q4QA 4YCPA 3HZ3A 4GC4A 1XDLA 3W4RA 1HKVA 1XQLA 1E1FA 3QMSA 1QK2A 3L0GA 3U7VA 1Z32X 5C2CA 1XLJA 4O13A 3HPSA 3WH6A 4FHAA 2BGNE 1D2KA 1PTDA 3VOIA 4C6MA 5LGZA 2AL2B 3S2NA 3R0DA 3M0JA 4JEQA 4JS3A 3GBDA 4REQA 4HMCA 1UB3A 8TIMA 3AWNA 4GCAA 1UD2A 4AIBA 3ZR4A 3UYIA 4J3VA 3TONA 1V3KA 3PZMA 1H1ZA 4XX6A 3QHOA 1O5KA 3VIGA 1WOBA 3FDKA 4C90A 4BA0A 4I9JA 3W7CA 1LQAA 1S38A 4O53A 1YHTA 1IZJA 4RUBA 4ZXLA 2E5CA 1EIXA 3OPSA 3PTQA 4IX2A 4WZHA 1G69A 1GNXA 2BY0A 5FJOA 3M16A 3G1YA 3ME3A 1ENUA 3PTDA 4Q4RA 4B5WA 3WF0A 1HF6A 3VGEA 1UWTA 3WSUA 1IEWA 1ZRQA 2J8TA 4DXXA 3CLMA 1D9EA 2INZA 2HV5A 4DI9A 4O16A 4MB1A 2PWVA 3BOXA 3VMOA 1JPHA 4Q8TA 3OO2A 2NSOA 2GYIA 2VFFA 4XBJA 2XDFA 1SSGA 2J24A 1NOUA 3EOEA 5AVNA 2VD8A 1E1EA 1TA3A 1ISZA 3GK0A 4FNUA 2CHOA 1BG9A 4I6KA 4UFLA 4DJED 1IXQA 5I3DA 3UU0A 4MUZA 3IWPA 4G7EA 2Z1KA 4LUYA 3GXDA 2V5BA 1ZAJA 3NL6A 3H24A 1DJWA 4HK5A 4KFPA 1HKMA 4Q33A 3TTOA 3T2QA 3L23A 4US5A 3PS7A 3W1RA 1UCWA 4XKMA 1G0CA 5I02A 2VR5A 1DL3A 2DUAA 5AHIA 2WV8A 2IW0A 3CS2A 1I6NA 4GO8A 2OT0A 3VDHA 1UH4A 1IE7C 2ISVA 3HQNA 4A2RA 4MKSA 2W92A 1DE5A 1W3IA 1XSIA 3PF3A 3FDGA 1M01A 2GJPA 4G1KA 1SJBA 2OQHA 4ZO6A 1VJSA 2Y8VA 3GVWA 4PGLA 2PWDA 1P6CA 1HJWA 4EPKA 2P50A 5MKGA 1WX0A 1BF2A 2PZNA 3H7VA 4JTAA 4QROA 4KCUA 4CN6A 3L5MA 4BF5A 3BW4A 2VC7A 4W86A 3FA4A 1BKSA 2AKMA 3CC1A 4U28A 3SCWA 4DO4A 1XLGA 1KA9F 4KFOA 2PP1A 2VGBA 3KRZA 4IPJA 3S42A 4O12A 1C8YA 4NIRA 1ZHAA 3ECQA 4XZWA 5AZ1A 5CLWA 4X22A 5AN7A 4Q4OA 3ANVA 3W0KA 3LV6A 1FTXA 3C52A 5A69A 1A5LC 2QCDB 2ZXBA 1I2OA 4UTHA 1L6FA 4W84A 5EMLA 1HL9A 3G6MA 2V5KA 6ALDA 1RP9A 1B30A 4HTBA 4PTNA 3KBWA 4O8AA 4BR1A 3NQBA 2YCEA 4FIRA 4D6EA 4LCSA 3ZT6A 2EPOA 3SN0A 1O6IA 4Y9PA 2V67A 3KBJA 3S47A 5IFTA 1R2TA 2BP1A 1TTPA 3D0CA 5G2IA 2QUVA 3KL3A 3VUPA 3I7QA 1FDZA 3M44A 1L6GA 1LG2A 1CDGA 1NP2A 4QS5A 4WK9A 5PTDA 4J28A 3W2LA 3TU9A 1TV4A 1E3XA 1SW7A 4TOQA 1JR1A 2JEPA 2W61A 3DEQA 4OVXA 5CGMA 4DF2A 4ZFCA 3JUGA 1ONRA 3WBXA 4MJMA 1V4YA 1A0DA 1GOOA 3S3GA 1RCQA 3ZWTA 3AXIA 4Z1YA 1M7XA 3SBFA 5BXPA 3GE7A 2JF7A 3TN6A 1VS1A 3I3DA 4L61A 4JQ3A 3KW3A 4ZMGA 1I60A 2NT0A 2OKTA 3EXTA 4R3UA 3A3WA 4N02A 4WY0B 4HMNA 3E0LA 1F8IA 1XKJA 3QW4B 3BLKA 4H9YA 1BYBA 4ZFMA 1S2UA 3OBEA 3O9NA 3I6EA 4GIEA 3PUDA 4NUWA 1I2NA 4WSJA 3A22A 3WLOA 4MY8A 4PTMA 5HDRA 4XZIA 1QCWA 1UHVA 3N6JA 5E09A 1FHUA 2UY3A 3FW6A 3G1RA 3WQ6A 2CKRA 3M7WA 3M43A 1OC5A 4CCCA 3B9OA 4EAMA 1ISYA 2Y8KA 4JEJA 3AICA 6ENLA 5IDZA 1E73M 1WO2A 2JIEA 3RILA 4ML4A 4AHQA 3N73A 2J8FA 4JTSA 4N9BA 3MW7A 2E8YA 1JPDX 4HPHA 2NUXA 3W7GA 3IVTA 4IIBA 4FA3A 3ZLGA 5M2FX 2WVSA 3EEGA 1X6UA 2QCHA 1UR4A 3IV8A 4UTFA 3CBWA 3GW3A 1WA3A 2GDQA 3KEHA 2F2KA 2GVJA 3LHTA 1IWAA 4F0LA 3ATZA 2WLZA 3QH2A 2CYGA 4PC8A 2FGZA 3PBMA 3K46A 2BS9A 3WF2A 5HMSA 5KINA 5DN1A 1RUSA 1YNPA 4O52A 2UY4A 3Q67A 4M29A 2XIMA 3TNOA 3NYZA 4WQ6A 3A47A 1J01A 4O18A 3M5YA 3TK7A 4FNSA 5I77A 4NXKA 4ZSTA 5CAHA 3C2OA 3QXBA 1L2UA 4WCJA 4QE4A 4UOZA 2CEQA 2D0FA 1V51A 5I3FA 3CPUA 4C1LA 2PDGA 2QLYA 1DJHA 3PB2A 2VTFA 4JKMA 3WQPA 4JYFA 4KPLA 1BWLA 1EBGA 3P81A 4C6NA 1POJA 1UPPA 3EBVA 4E4PA 1RBOB 4LBUA 4ZO8A 4WVXA 3VUSA 5C5YA 4MG4A 4GUFA 5CJMA 3C0JA 4IXHA 2QIWA 1C7SA 4WGXA 2QVNA 1QNVA 3C2EA 2WPBA 2ZCGA 2XIJA 3W7HA 4PMXA 1P43A 4UR7A 1TKKA 5D9PA 3OLEA 3H6OA 4LNYA 2UY5A 1RK5A 2ACUA 4RDYA 5T8GA 4AQLA 6TIMA 3L5LA 4NX5A 1V0MA 3K2GA 3OGVA 2OVLA 1Z9AA 1W8SA 2YLLA 5BWFA 2P10A 5A2AA 1LYXA 3VDCA 3LPFA 1KW1A 1GVOA 1JQXA 4JHOA 2QJHA 3N2BA 3UR8A 5A5WA 3DFQA 2XN0A 4O1CA 1LROA 4PB4A 5HK4A 1CLKA 3MJYA 3LHYA 4IFOA 3SIMA 1W6TA 3FJ6A 3TLQA 2J7BA 2ISSA 2D3NA 2PSNA 4GXPA 1XQKA 4CEUC 1RCOB 4Y2WA 3TQKA 2YXXA 1M7PA 1VFUA 3MHFA 1CLVA 2NT1A 2V5JA 2X16A 3WUFA 4KKXA 2Z27A 4ACZB 4B15A 2J7FA 1WKEA 3AHZA 4H7CA 1O5QA 4UBPC 4GUHA 5LIKX 3LPGA 2BXVA 4NZ1A 1PDYA 2GDVA 2VL4A 1KCLA 1QPNA 3DN5A 4O11A 2ZXDA 4N42A 2CBVA 1GW1A 2A21A 3IJ6A 1HKJA 2BNJA 1W8GA 1O68A 3QN3A 2A3AA 4AD3A 1H49A 8RUCA 1TELA 3MA8A 3TOYA 3PWIA 1VKFA 3MP4A 3V0TA 1TQXA 2ANUA 3BCJA 4KGJA 3AS2A 4AC1X 2WZHA 1NFPA 3VE7A 1VJIA 5DCDA 4J27A 1NEYA 2NXHA 4H4IA 4D9PA 4JCMA 1KXQA 1KCZA 3W74A 2PEVA 1U83A 4P8XA 4FEZA 3DYMA 4RZ5A 1A5BA 1Q4NX 5REQA 2VQUA 1IV8A 3G24A 1XDMA 3EWWA 2A3EA 4EWND 3VO0A 1OHLA 1O66A 3UZWA 2Q09A 4Z2GA 1AUSL 3ELFA 3LXCA 1O5RA 1KTBA 4ALDA 3AMDA 1OVDA 2OWWA 3FA3A 3KL5A 2GWNA 3GNNA 4G7FA 4P5UA 1UR9A 3T0BA 4A4AA 3LRMA 3H12A 5DMLA 1JZ4A 1HJVA 3GFYA 4UOQA 1FWWA 2QMJA 3MO7A 5EBAA 3MKCA 1TV3A 4JKLA 5C2XA 1TPWA 3MVTA 3FAXA 2JFEX 2J62A 5B7ZA 2C14A 3EMQA 3SCOA 2DW7A 3MO4A 5F4WA 4AZCB 3N9KA 1WUEA 1WKFA 4OOUA 3AQUA 3VMNA 4Z1AA 3EDDA 1H61A 4G56A 3SCRA 4HZ6A 4U3CA 3CQJA 1OINA 3H2EA 4PTDA 3PPFA 2FZNA 2YDQA 2ATMA 3P2VA 4MNJA 5DXXA 1UG6A 5DANA 1MZRA 4YYFA 4E38A 3P62A 4O50A 3LUTA 1WYIA 5LHEA 4NJHA 4TMBA 1PCKA 1RBAA 4HN4A 1BXNA 1V5XA 2OSWA 1S5TA 3P14A 4R5EA 4H41A 1TPH1 4LU0A 2A7RA 4HN8A 4K38A 5HNNA 2E3ZA 3WNMA 4PCSA 1OC7A 2BODX 4MY1A 3HPXA 2OODA 1J79A 3IGXA 1DPMA 1TJRA 1KBJA 2BBFA 4L9XA 2RUSA 1TWDA 4FSAA 1H4PA 4GNJA 4A3RA 4DYEA 1TA3B 3VIJA 1VLWA 1X7FA 5M3WA 3PY2A 3C61A 4DM2A 1UW9A 3SRKA 3D6NA 1LOLA 1GVYA 3CGTA 3G1DA 4FMVA 1XRTA 3G1AA 1A5AA 3UBPC 4D6GA 2C18A 2E5BA 3UJSA 3PNZA 3NQFA 2Z24A 3NDYA 4GZJA 4TX6A 1TWSA 4WF7A 1AVAA 3MMUA 2HE5A 4K7YA 3UEQA 1I2PA 3U5UA 1F8MA 3UPBA 3G5EA 2XUCA 1YE6A 3B8SA 4ATWA 4C1NA 2GSJA 3U2EA 3DYPA 3I10A 1FWFC 2W62A 1FCBA 2BVTA 4OU1A 4OIFA 2Y24A 5BXSA 3O6CA 3NO5A 2V6AA 2E1WA 1U1JA 4HKPA 3P7YA 4JIEA 4GABA 1PDZA 3PAOA 3M9YA 5I06A 1ODUA 4O1EA 3SQLA 1DIKA 1JI2A 1FWRA 3DGRA 3W22A 1RY0A 1QASA 2E4TA 3DFTA 3VABA 4WGHA 1XW8A 1P0EA 2V5DA 2WNNA 3AIVA 1PJ9A 1TV8A 4F40A 5DY3A 3CZ8A 3WQVA 3GNOA 3VA8A 4QG9A 4PE8A 3UQNA 1QMLA 3MP5A 2IKHA 3QF0A 1E6SM 3GVVA 1QXLA 1QK0A 5GJMA 4XVDA 4BWLC 1K6AA 4CU7A 1TSIA 4IG2A 1HG3A 3R8HA 1JZ5A 4DYJA 1S3HA 3AZRA 4AEOA 2ICSA 2DZBA 4R88A 1AQFA 1TUXA 1REQB 4KEUA 3OYZA 1XISA 4GRSA 1JDFA 3RCNA 3UT0A 5IBXC 4UFJA 5J8LA 3R5EA 2FGBA 1BWKA 3GU9A 3RG6A 5BXTA 5C7VA 3CHVA 2VEKA 2QUTA 2XH0A 3LLXA 2ZRZA 2WMGA 1LUCB 1KXVA 3XIMA 2RDUA 3CASA 1KRCC 1WB0A 4BEQA 2BG5A 1F6YA 1F5ZA 1GOWA 4ZVJA 1QNOA 4H04A 4D8AA 4NNCA 1JF5A 1OZMA 1R30A 4AW7A 3CYJA 3LGDA 4MAZA 2PDBA 4F79A 3VINA 5I3GA 1OB0A 3ISIX 5BU9A 4IGHA 4V27A 4BHYA 1JYXA 3VIMA 3RPMA 3HB9A 2RDWA 1KR0A 1QHOA 4DUOA 1DQUA 1XXXA 4H9VA 1L9WA 3K8KA 4UC5A 1GQIA 1XICA 3L2LA 4XAGA 4UNIA 3UJRA 3UWEA 2VEGA 3LYEA 3UG8A 3BGGA 1DHKA 3ZM8A 3H2FA 2D0HA 3E0WA 1ZS2A 4PMRA 3K30A 4JFSA 4H6QA 3PZUA 2EF9A 2DFAA 1B3YA 4XAFA 1DOSA 1YPIA 3G0XA 2I1OA 1QVBA 3VOGA 2QAFA 1QW9A 4Z1DA 1FX6A 3AUOA 1DIOA 3KFTA 1EYEA 4E2DA 4ASTA 5FI8A 4PH6A 3E0FA 1HTIA 2H9AB 3IARA 5DRCA 4HPXA 3M5ZA 5DELA 1UD3A 3R79A 5M5DA 3O6DA 2EG6A 1EKOA 5H6HA 3GC2A 2FMNA 4N6EA 5XINA 1SW0A 1PV8A 4JN7A 3R89A 3TZFA 4AD0A 1KV8A 3GWQA 1ZBVA 1KQYA 4QGCA 1X8FA 4RK8A 2W66A 9RUBA 2DT3A 5FCZA 4K6AA 1E43A 4B2DD 4FLRA 1X38A 2CBIA 1EF3A 2NX3A 1B9ZA 3LQLA 2VFDA 3GH5A 4JDYA 1E6RA 2NWRA 3LK6A 4RZ4A 3RJYA 2YA0A 5LYRA 5GJNA 1US2A 3ITVA 1VCVA 1BVWA 3GXPA 1FDJA 3GTIA 3JS3A 4XB3A 3E9AA 4CQAA 5A6LA 4LB3A 4HOXA 3W83A 3UA3A 1K70A 5CPOA 3GX9A 1ZJBA 3UXDA 4GD0A 3H55A 4GYPC 1VEPA 5JBDA 4PMVA 2Z1XA 3WD0A 5CBJA 1YBQA 3HMCA 1LTDA 5D33A 4D6JA 3FXYA 3LB0A 3R1ZA 4GI4A 1JUEA 4KFNA 3WMSA 3C0LA 1JAKA 4LAZA 2XN1A 1AH3A 2VO5A 3W1AA 2WCAA 4UQDA 3B0PA 3M0KA 3F7JA 3EOOA 2G0WA 2OR2A 1TCDA 1OWQA 4F0RA 3ANYA 1OYBA 4HPJA 3WQ8A 3G8EA 2EJ1A 1E0XA 5T9CE 1RLCL 1YYAA 3Q45A 3WFZA 3C3UA 2V3GA 1FWSA 1IXOA 2ZDSA 3ES8A 1JIBA 2OQLA 3PSVA 5CSSA 1PZ2A 2C1GA 1KWKA 3MSRA 4JL2A 5EA9A 4JTEA 2PODA 3TOPA 4HTYA 3M6YA 3NSNA 1GHSA 2CLIA 3ARRA 4F0KA 3MY9A 2A7NA 2BVWA 2O4QA 1Q8AA 1OGBA 3GVGA 2XFFA 2QJMA 1TZZA 1FOBA 4S39A 2Z1VA 2JKAA 4JIRA 1JD7A 3OVPA 4XZ9A 2WPGA 1T41A 3GH7A 2JGYA 4GVIA 3WLQA 4K1WA 3WUBA 1VR6A 3S1UA 4UTLA 2YCIX 4HJFA 1KFBA 4RE3A 4GXWA 5DQPA 4HNLA 4XV0A 3DFOA 4UQAA 3G0SA 1Q6DA 4L65A 1BYDA 1Z3NA 3FEMA 3BQ6A 4O1AA 4G6CA 3EWYA 3P74A 4UQ9A 3U2CA 3OG3A 1J5SA 3FKRA 4GQQA 2DDXA 2J7GA 3L9CA 4FLSA 1Q2SA 2A5HA 3FJ4A 3OG2A 1CWYA 3UXIA 1E6PA 1GG0A 1SYTA 4MKNA 3BV4A 1TVLA 2YXGA 4Z1CA 4RV3A 4QNWA 1KGUA 3EWBX 1UASA 4B5SA 3O06A 4MADA 1EYWA 1XLHA 4ENLA 4WIWA 2PDKA 2WMKA 4OUEA 4C6FA 3CPGA 5JXQA 5G5IA 3SIZA 1CGVA 3GC5A 5DMMA 2WHJA 1EGMA 3W71A 3W81A 3N3MA 4ML9A 1E72M 1UR8A 3TXZA 3USZA 2WCSA 3ATYA 2R14A 3SUWA 5HUPA 3F5LA 3NM1A 3KVJA 3VU2A 4BI6A 2P76A 3PZVA 1FCUA 3BLEA 3G1FA 4ECLA 2ADAA 3LENA 5FAJA 4L9ZA 3LNPA 1K9DA 1QI5A 4L1WA 9XIMA 4NAFA 1EA9C 3B8WA 4DJEC 3W29A 2WWCA 4HZMA 4U3AA 2ZUMA 1XGZA 3DESA 1AQ0A 3VGBA 4FI4A 1FKXA 4J9JA 3BDKA 3MUY1 3GDTA 1N8IA 3DHPA 1P7TB 2R1LA 1WAWA 1JPMA 3RMEA 4QG8A 3EX2A 3Q58A 3GY1A 4C6QA 4P7QA 5CPLA 2DT1A 3BG5A 3VZZA 4O0ZA 2NW0A 1MW2A 3LN3A 3WQDA 4KWUA 1AG1O 1OG6A 3THQA 2VZSA 3NQVA 1SO3A 1MXDA 3E2QA 3WNLA 2Y88A 2ZTJA 4PYSA 1JXKA 4PMZA 4V1XA 3UGVA 4RDZA 3NL5A 5B80A 3EMCA 4W5ZA 5AC7A 1F3EA 1QT1A 5ECVA 4JTIA 4NXSA 3TFXA 3W7RA 1DWIM 2P0IA 1A3XA 1L6YA 3GZ3A 1E6ZA 3WJSA 1XBZA 1EHAA 3RPDA 1CB2A 4FR1A 4LRTA 1DJGA 2PWEA 2CFFA 2ALDA 4DBDA 1PS9A 3ARUA 3B8VA 4XBKA 4QCEA 1HNYA 1W2PA 3PSWA 1POKA 3W02A 4O14A 2YGYA 1SFLA 2Y5JA 3NXLA 2WC3A 1O5XA 4Q8PA 5E93A 3JRKA 1JCYA 1AQHA 2XFWA 1AJ0A 3QHNA 4IFRA 3T8LA 4NU7A 1YTEA 1Y7VA 4F2BA 3B40A 3PJUA 1MW1A 5A6MA 1UJPA 2J88A 3L68A 4MUPA 4LGXA 3WQGA 4TVUA 4WR3A 1EJUC 3OZYA 3CLWA 2ZWZA 1AMYA 1IEXA 3ABSA 3SRFA 3EDJA 1XC6A 5I07A 1F4HA 4UNKA 3U5YA 3H8AA 4H9UA 3HFYA 4M8UA 3GHRA 1GONA 3CT2A 3LM7A 4KQNA 4QDMA 3NTYA 4HHLA 1GW9A 3AI0A 4FR6A 4XZHA 5F7UA 2XPKA 4LEQA 4H6EA 4PEKA 4Y9OA 1AQMA 2VYOA 2VEIA 3IGSA 4RZBA 5E1QA 5J5RA 1R3SA 1EP3A 4YMZA 1U5HA 3MDWA 3GZAA 2OZ0A 4FNTA 3KUMA 4JQAA 5I23A 1SO5A 1EC8A 3WF4A 1S1RA 3AXKA 1SFSA 5E0CA 2XHYA 3F2BA 3QV6A 5ABGA 2GVGA 3AHVA 3UNTA 2XIBA 3LRKA 5TQLA 4GGHA 3QLLA 3RU6A 3ARSA 2F6UA 5LA2A 4JTDA 1GG1A 3PZGA 5JBFA 3WLRA 2ZE3A 4CN1A 2QUMA 1S2AA 4GY0A 3OODA 2NUYA 1UH2A 1CZ1A 3ARZA 4QJ4B 2PC8A 3QQ1A 5HNTA 3OOQA 4MPKA 1TRDA 2BOEX 3LA4A 4HCHA 4WY0F 3VGGA 3TTYA 5C9RA 4CQ9A 1GVRA 3SFWA 1UKPA 1RY8A 3G1XA 4LS0A 4M56A 5AHNA 2DPEA 1WDQA 1TTQA 2ZVIA 4PUKA 3KLLA 4PUDA 2XG9A 2FGLA 4OHQA 2WJDA 1T99A 3R11A 5U4NA 3E5BA 4KEZA 3TCEA 5FJRA 2X0YA 4FOKA 3QY6A 3NYDA 4AD1A 2WM1A 1FWAC 2BVDA 4V33A 4BJHA 3SUUA 2HXTA 2CLPA 1PKMA 4NNBA 3TNBA 3SUVA 4L9YA 4RLIA 2AQWA 1JCNA 1OD8A 1KGXA 1LOQA 4DNMA 3ITXA 4Y7EA 2WNZA 2BFGA 4BF9A 1XLBA 1JGIA 2IPWA 3FOKA 1QPOA 3HM7A 3W7IA 3L2IA 2YCLB 2HEJA 4NZ3A 2ZE0A 3ZT7A 1JI1A 4C7FA 1W9UA 5TF0A 4Q32A 5T26A 2VC5A 3URQA 1C3FA 3WNOA 4GXMA 3IGUA 1PKLA 1JZ3A 3WEMA 1JCXA 3CH0A 1W9BM 5F2IA 2GVLA 2DQWA 3PZ9A 4A3YA 3VPLA 4PUEA 5C0QA 3VNMA 1WDSA 4QCFA 3WMLA 3MV11 1OBAA 1E0WA 3HG3A 4J3WA 1TX2A 3AYSA 4IZGA 1EL3A 2CIPA 4PODA 1BSLA 4TV6A 5BMWA 3RDKA 2FTPA 4PSRA 3HU7A 1U5VA 2ZUVA 4N9EA 4MMWA 1PYFA 3PPHA 2E9BA 1BLIA 4PBGA 3UCCA 4CQDA 3I4EA 2E77A 2WZEA 4DO5A 4DBUA 3N18A 3C56A 4AXNA 1FHLA 3FGCA 2ZZ1A 1RALA 2HPMA 4LVFA 3HGSA 3QZAA 3ZWSA 5D37A 1DXEA 5CPTA 1C8QA 6PTDA 2DZWA 2DH3A 1JFHA 2PGWA 3EZ4A 4UTIA 4YVVA 4GJJA 2E5DA 3S5YA 3W72A 5K4XA 4ZOBA 3VDGA 1VQTA 3IJLA 3QW3A 3PBWA 4YU1A 1AW2A 1CNVA 3TUUA 4YN5A 2HTMA 4H9XA 2VEPA 3GIQA 4ZQOA 1A4MA 3VYLA 4MNMA 3U2ZA 2PDQA 1DE6A 2VI0A 4AY8A 2YDRA 5IRPA 3N6QA 1HP5A 4MJ4A 1FFQA 4H2HA 1S1PA 1YIXA 3GTFA 2Y0FA 3MS8A 3T4CA 4CD6A 4S38A 3BG9A 1CGWA 3WLKX 1KFLA 5CAKA 5CC3A 1FWEC 2GOKA 4JX5A 4HGXA 3STCA 3BAWA 3G8RA 2FZDA 4Q6XA 1EJ7L 3M6DA 3URNA 2J75A 1QNQA 7XIMA 1QRQA 3DYOA 4M7SA 4UCGA 1TV7A 4HHPA 4UZSA 1Q13A 4UCFA 1XH1A 1SM9A 2HVMA 4PUWA 2PDHA 2A3HA 2REQB 3L65A 1V0NA 1ISWA 4PMDA 4J2PA 4HVXA 1MZHA 4KERA 1FXQA 4LEFA 5HJLA 5EMYA 3E0VA 3CUJA 4XSMA 1J2WA 4XSLA 1GEQA 3UJ2A 2EO7A 3IRSA 3RU8X 1GOIA 3TQVA 3M0VA 4IHCA 4Q8QA 3SGZA 1PTGA 2Y5EA 1H7WA 1U1UA 1X96A 1B0IA 4KWWA 2ESCA 3R0UA 3CUZA 4UTTC 5DEZA 1HJUA 1V6VA 3N11A 1S5MA 1GORA 1LG1A 1JZ2A 3TC6A 3IIZA 1T40A 2H8ZA 1DIEA 1RPKA 4H3DA 3S2LA 1CLXA 1P6BA 4H6RA 1OQFA 4WUIA 5LXEA 4DXVA 3PBYA 1AODA 5KZDA 3SJ3A 3PFMA 4DWSD 5CEWA 1DXFA 4IJRA 3BANA 3CZJA 3TN5A 1H09A 3B8IA 3W26A 3FK4A 1E55A 4XG1A 4GX9A 1XYFA 1E6NA 3UWUA 2WWDA 1Y65A 1EJWC 1CCWB