3CUIA

Cellulomonas fimi xylanase/cellulase cex (cf xyn10a) in complex with sulfur substituted beta-1,4 xylotetraose
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
314
structure length
314
Chain Sequence
ATTLKEAADGAGRDFGFALDPNRLSEAQYKAIADSEFNLVVAENAMKWDATEPSQNSFSFGAGDRVASYAADTGKELYGHTLVWHSQLPDWAKNLNGSAFESAMVNHVTKVADHFEGKVASWDVVNEAFADGGGRRQDSAFQQKLGNGYIETAFRAARAADPTAKLCINDYNVEGINAKSNSLYDLVKDFKARGVPLDCVGFQSHLIVGQVPGDFRQNLQRFADLGVDVRITELDIRMRTPSDATKLATQAADYKKVVQACMQVTRCQGVTVWGITDKYSWVPDVFPGEGAALVWDASYAKKPAYAAVMEAFGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exo-beta-1,4-glucanase
publication title Probing the binding sites of Family 10 and 11 Xylanases with extended Oligosaccharides
rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
total genus 133
structure length 314
sequence length 314
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2008-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3cuiA00
4DWSC 1VFMA 3W38A 5LYRA 4XZWA 4Z2IA 4PYSA 4W8AA 4AIEA 1JFHA 3VGEA 4WKAA 3K8MA 1CBGA 4MADA 2J25A 4UNIA 4UQAA 4RL3A 1US3A 4JKMA 2UY5A 4MB4A 3WD2A 3FAXA 3EDEA 1US2A 3T09A 4WKFA 1HIZA 3DHPA 5ABGA 1H09A 4PMOA 5A2AA 1LL4A 5AC4A 3GBEA 2EPMX 3DYMA 3HN3A 3L4TA 1EOMA 2VCBA 3U7BA 4DUXA 2J62A 1ZBCA 4M1RA 4N42A 3NJ3A 4UQBA 1CYGA 4AZCB 4BQ3A 4ML4A 1DWIM 3BCDA 1ZBWA 2J7CA 3SCPA 3CMGA 3SCVA 3VIPA 3JUGA 3POCA 1JL8A 1KGUA 3FXYA 4JAWA 1W91A 4H04A 1HX0A 1UWUA 3RMEA 2EPLX 4R5EA 4PSRA 4CD5A 1DWGM 1GUVA 4MNLA 3WD0A 3OLDA 1HKIA 3WD4A 4D72A 5I24A 4LPCA 1J18A 4J7RA 3GH4A 2YA1A 4GZEA 4ACZB 4QFUA 1V6UA 4XUYA 2WMKA 1CXKA 3ZJKA 3UR8A 2CKRA 2WYSA 2DIEA 2Y8KA 3WL0A 4EE9A 4W8LA 4GZIA 3WDRA 4DUVA 4MJ2A 3WEZA 4MAVA 1C93A 3ZIZA 1OB0A 1HJSA 1Q4NX 4JFWA 1UR8A 1U2YA 3W37A 2D3NA 1TA3B 3CHEA 3S6TA 1NQ6A 3ARTA 3M7SA 1W1PA 1MYRA 1HVXA 1FH7A 3WMSA 2PC8A 1JXJA 3A3HA 4CUCA 1KWKA 1CXLA 1CGXA 1GVYA 4E4PA 1UR0A 4HA1A 2VURA 4WJXA 1N82A 3CUJA 1C91A 1PX4A 2X0HA 1CLVA 3SCUA 3L4UA 4ATWA 1GJUA 3OGRA 5A6JA 3VDCA 1PX8A 1JD9A 4J3WA 2OSXA 2XVLA 3VM5A 1MW0A 1NOWA 4IUGA 1KXTA 2BFGA 5M17A 1TR1A 2J7HA 3FN9A 2BNJA 3VGHA 3OGVA 1KCLA 3KZSA 1UZ4A 3WDIA 1SR0A 5JBDA 3UESA 1BGGA 4B3KA 2ZUTA 2ZWYA 5ECUA 1E4LA 3ZT7A 1H49A 2PWHA 2VR5A 3W6MA 3D3AA 2VC9A 3SCRA 3DECA 4AIOA 1KWGA 4AZ6A 4Q22A 3AZTA 5A8MA 2EPNA 2ZUUA 1UR9A 3DC0A 2FDMA 3EDJA 1KR0A 2BY3A 1CGTA 3SUTA 3OZPA 1CXFA 2O9TA 4NI3A 4ZXLA 3VD9A 1BG9A 3N04A 2XSAA 3ZR5A 4UCFA 2ZIDA 2O9RA 4MJ4A 3LPOA 3BLPX 4B9YA 1LL6A 3IAPA 1J0IA 4WF7A 2V3EA 3AICA 1MQRA 5F7UA 2XUCA 3VIKA 4MPKA 1PAMA 5CJ5A 2VVNA 3UR7A 4AIUA 1W2VA 4BZYA 5BRQA 2VRJA 3RPMA 1HF6A 1ZJAA 3AXHA 2CPUA 4LQ1A 1SMAA 4URIA 4W7VA 5EMYA 3MUAA 2YL9A 1CPUA 3L4ZA 1F4AA 3THCA 3RIKA 2JEPA 1XSJA 3MUY1 3PZUA 2IXUA 1KR1A 4D6CA 1QHPA 1JF5A 4F79A 1QI5A 1J0YA 1PIFA 3U5YA 4HOWA 6TAAA 2J7FA 2ZOXA 1OINA 2NSXA 1UHVA 4PMZA 4TOQA 1VRXA 4AYSA 4P8VA 5IHRA 2XYLA 2WMGA 4J27A 2VMFA 4FLOA 3AIQA 2VX6A 2YBUA 5I6SA 1HN1A 3U7VA 5CZKA 3VD3A 1TVNA 5LA2A 4DWSD 4AZIA 1UR2A 2WXDM 1XCWA 2DT1A 2AMGA 4MB1A 2GSJA 2ZX9A 3KWXA 1PPIA 3EMZA 2BHUA 3THDA 2WZIA 2YDQA 1BF2A 3MO4A 1U33A 2DSKA 1QBAA 2WSPA 4EAMA 1OBAA 1QNSA 2QMJA 1K9DA 1Q6DA 5DEZA 4GI6A 1BLIA 3VGGA 2X05A 1HL8A 1XD0A 1DHKA 2PWFA 5CPTA 1EQCA 3UG4A 2WCSA 2WZHA 4YHGA 4DM2A 4BCEA 5BYWA 5KEZA 2EQDA 1E4NA 3EDKA 3L4VA 4P8WA 1WB0A 1UYQA 3WF1A 2CBJA 1P6WA 3AJ7A 4H2CA 5HOSA 1LG1A 1J0JA 2WVTA 5DF0A 1V3JA 2W5FA 1MXGA 1NWSA 2WVVB 2G3IA 1M03A 2V5CA 3W26A 2O9OA 4D1IA 4M56A 1AMYA 1D3CA 2XIIA 2WHJA 5EFDA 1B3ZA 1JAEA 4PMUA 2WSKA 3WNMA 4EKJA 1EO7A 4TX8A 1E1FA 1EDTA 3VD4A 1VEMA 1VF8A 1WPCA 2G3JA 2PB1A 3M46A 2YA0A 1BTCA 1NM9A 1HNYA 1QVBA 5M3WA 3L4XA 2JF7A 5CXPA 4P8UA 1GQKA 5A6BD 3AQUA 2VO5A 4UFKA 2QHAA 2J79A 1BYCA 1H4PA 5FOOA 4OIFA 3K46A 5FL1A 3OLGA 3AS1A 2XGIA 1XCXA 4H41A 7CGTA 3LPGA 1EGZA 3TTQA 2PBGA 4P7RA 4N0RA 1Z32X 1JNDA 1Q6CA 1RPKA 2CHNA 1WDRA 5A6LA 2JIEA 2WC3A 4GO8A 1ITXA 4YN5A 1OIFA 1CGUA 1HJXA 5GNZA 7A3HA 3AZRA 1ODZA 1CENA 3E1F1 1R7AA 4Y7EA 2DH2A 1ISXA 3AIUA 1C8QA 2WC4A 2YIHA 3CBWA 4CD4A 2GJPA 2CXGA 2DQXA 1HJUA 3IANA 5ABFB 1B31A 1KCKA 2XTKA 1E6XM 1LJYA 2BS9A 1E5NA 4UFJA 3BCFA 4GINA 3G6LA 4W88A 5A6SA 2XPKA 1JNEA 1E70M 3EDFA 3UG5A 1UUQA 4UFLA 4D6GA 2J74A 1CTNA 4TVDA 2A3BA 3N1AA 4AWEA 1KGXA 4PTVA 4C7DA 2E0PA 1GZJA 4HPGA 3HU7A 4Z2GA 1UWTA 5HNNA 1LG2A 2WBGA 3WQ6A 2OSYA 1WZAA 2Y5EA 3BAXA 4AZGA 3LMYA 1BAGA 5TD4A 3NSNA 1HXJA 2VZSA 3U57A 4AZ5A 1E9LA 5D9OA 4UQDA 5C8BB 1CXIA 1R8LA 2VRKA 4ZXOA 4JHZA 1HL9A 1B2YA 2DSUA 1UD8A 4PMRA 2XG9A 2DGAA 1CEOA 3CZ8A 3WD3A 2DSVA 3VKKA 4JL2A 5JIWA 2D20A 2WHKA 4JFUA 1EXPA 4OOUA 4AEEA 3T2PA 4CN4A 1HP4A 2OWWA 3VIJA 3SUSA 1E0XA 4FF5A 2QF8A 3PZOA 2G41A 1NWTA 3RM8A 2BXZA 2CETA 4LYQA 1XYZA 2QMKA 4PMNA 4DWSB 3PTMA 4JZ5A 3VIHA 1W1VA 3APGA 4W84A 4TTUA 5A3HA 5EBAA 2JEQA 2XVPA 3LPFA 3AHXA 4AMCA 1DWAM 1H41A 5AY7A 2CHOA 1J10A 4QDMA 1EHAA 1E6QM 1LWJA 5AYIA 1M7XA 1GORA 3NUKA 1VJZA 1KBKA 4KH2A 4MDOA 4U2ZA 1UR1A 1E73M 5A8NA 4GXPA 1GJWA 4E2OA 3AIRA 2ESCA 1CWYA 3PBGA 2QPSA 3EBVA 1GCYA 3CUHA 1E3ZA 4XZBA 5HBFA 1K9EA 1RD6A 3WNOA 2VCCA 5LA1A 4OJYA 1UA7A 3VNZA 4AD4A 2VCAA 4WLCA 4X0NA 1FP9A 1HJQA 3WQ4A 2V5DA 3WKZA 2NT0A 2DSZA 1OGBA 2D24A 4B9ZA 4QLJA 2CESA 2VX5A 1XD1A 3WMCA 1KBBA 4LXFA 4MB3A 5M5DA 3CZKA 5D9MA 3VDHA 1BFNA 5GPRA 3WDPP 3I3DA 1PX3A 2NW0A 4RE4A 3AS3A 3SCNA 4HU0A 1C92A 1E71M 3CHDA 2WHMA 2WHLA 3ARRA 2UWFA 3WF3A 3BSGA 2YKKA 1H1NA 2UY3A 2OLHA 2UY2A 1RH9A 4ZE5A 1GVIA 1EA9C 1B30A 1S46A 2ZX8A 1J0ZA 4HOXA 3OIHA 2BVYA 1QNPA 3AMKA 2XWEA 1G01A 1F4HA 3PN8A 5C71A 7TAAA 4TVUA 1VBUA 2BVDA 1JI1A 1JDCA 2J77A 1HT6A 1LLOA 1MXDA 2DT3A 3A47A 4UFIA 3QR3A 4BQ2A 4U2YA 1MQQA 3HMCA 5DMYA 2WVUA 3PZTA 2EJ1A 1DWJM 5E0FA 5I0DA 3TONA 1MW3A 1W9DM 2F61A 4TX6A 2W66A 2JFEX 2EO7A 3K4DA 1NWRA 2ZE0A 1OD0A 1SFSA 1BHGA 3QHNA 1A3HA 3VTRA 4A3HA 2G8ZA 1J9YA 2GK1B 4HZ6A 4UZSA 1W1TA 1B0IA 1GOIA 3N17A 1GOWA 1EH9A 1VEPA 1NP2A 1JZ8A 4BQ4A 1UWSA 3EMQA 4OBRA 1BYDA 2WM0A 1UH4A 2VI0A 4KGJA 2Y2WA 1J11A 3T0BA 4AZHA 2GJXA 2WVVA 4D6JA 4U3CA 4UQ9A 1OM0A 3PTQA 2WB5A 4JKKA 3O9NA 2X0YA 1B3YA 1B3VA 3OLEA 2PI6A 3IJ7A 1H3GA 5EB8A 1TZ7A 2YLAA 3WF2A 5BXSA 1WP6A 3KE0A 2V3DA 4IISA 4W7WA 1CXEA 2W92A 3WSUA 4W93A 4CU8A 3AS0A 1IV8A 4KGLA 3FAWA 4M29A 2WNWA 3OG2A 4OKDA 4ZEPA 3W29A 1MWOA 4CVUA 1QNOA 4CGTA 4HU8A 2VJXA 4PMXA 2WZEA 3GXFA 2CERA 3VVGA 2ZUMA 9CGTA 2VTFA 3VU2A 3BAKA 2HISA 3VIOA 2NT1A 4BS0A 5E0CA 1BVZA 2D23A 1UZ1A 1WNOA 4JCLA 3WH8A 4NF7A 4KRUA 1LWHA 3AROA 2J4GA 1JF6A 2ZX6A 3F5JA 1C8XA 3W4RA 1DWFM 1UD4A 4CCDA 1HVQA 2WKGA 3A6OA 3AS2A 1D2KA 4P7OA 3VM7A 2HVMA 3MANA 4AZBA 4PMDA 3GBDA 2YDSA 2WWCA 1JZ2A 3BXWA 5I23A 3GH7A 3WELA 3VINA 1BSIA 3WEOA 3EMCA 3BGAA 4U33A 2G3NA 1X6NA 2X8RA 1V08A 1V6WA 2F8QA 1I75A 1UD6A 4GKLA 5CQ1A 1E15A 3I3EA 5ABHA 3AIVA 1G94A 4HA3A 1UWIA 1W9XA 1HKMA 3TTSA 4AW7A 5A8QA 2ZXBA 5D9NA 1GOOA 4H8HA 3VNYA 2WMIA 5A1AA 1C90A 1UQZA 4LX4A 3VD7A 2XHYA 1E4IA 5CSYA 4GI9A 3WUBA 3ARWA 2DSWA 3CO4A 1VFUA 4F8XA 2A3AA 1AVAA 3W82A 3PZMA 3T2OA 5JIPA 3WQ5A 3AMGA 5CGMA 1V3HA 1V0NA 1OT1A 4JFSA 3GNRA 3VGBA 4W86A 1WCGA 1IT0A 1YQ2A 1E1EA 2ZWZA 5HDRA 3N11A 3T0AA 5I78A 4J3SA 1R7OA 2RGLA 4DUWA 3WH7A 2BY1A 5BCAA 1GOKA 2BXYA 2F2HA 1M01A 1E6PA 8CGTA 1FH9A 1CNVA 3PZQA 1KB3A 2YL5A 3WQ8A 1JIBA 4UOZA 1C3FA 1JYVA 5CGTA 3WUGA 3F5LA 1XGZA 1XC6A 5AYBA 4ATLA 3WMBA 3FNDA 1FP8A 4PSPA 1WKYA 2BHZA 1GQIA 2YDRA 5I2UA 2CEQA 1ECEA 1G9HA 1WDQA 2E9BA 1ISWA 2E40A 1GOQA 3AMLA 4KWUA 5IFTA 1K6AA 2A3EA 1KXHA 4PTXA 1CDGA 1UH3A 5ABEA 5E9AA 1W2PA 3QHOA 2ZX7A 1J01A 4HZ7A 2CBUA 4HP5A 4AD5A 2WC7A 4CVWA 4H7VA 4AY1A 1FFQA 1UWQA 4E8DA 4U5KA 2XWDA 3QGVA 4NSBA 1E43A 3T0DA 2MANA 1UKOA 2RGMA 1YHTA 1VBRA 2EEXA 2G4FA 2BHYA 4H8UA 4GQQA 4GI8A 3MU7A 2UY4A 1UH2A 3L2LA 3VILA 3VMPA 1GONA 5D4YA 3PZNA 3WDHA 2O9PA 3WNKA 1V6VA 2WMJA 1W32A 3AIBA 3CZEA 5I3DA 2YJQA 2WWDA 3N12A 4PBGA 1H11A 5A8PA 5IFPA 4IM4A 1JZ3A 4H8VA 4WSJA 2J75A 4M8UA 2D1ZA 3ARSA 4W85A 4AZCA 4Z2JA 4PUEA 3BSHA 3GYCA 4TTGA 1QOXA 3MUZ1 5A6MA 3W0KA 1TCMA 2ZXAA 3AI0A 4B16A 3VO0A 4LYRA 2Q8XA 3AFBA 2V38A 3A4WA 2WKLA 2GJRA 1G5AA 1JGIA 3SEPA 5JBFA 1EDQA 3GM8A 1QHOA 4KRTA 5DO8A 4DM1A 1VB9A 1K9TA 4NZCA 3ZMRA 2CNCA 2AAAA 2O92A 3TA9A 1RP9A 1E40A 3MV01 4AZ7A 1V3LA 3WD1A 4EK7A 4MB5A 1XH1A 1PZ3A 1JD7A 1QW8A 3WDJA 4J28A 4A4AA 4D6EA 2VQTA 3PHAA 3AHYA 2W91A 3CUIA 1L0PA 4ACZA 1C8YA 4MNKA 1W3LA 3RO8A 4HMDA 1UG6A 1OGSA 2OSWA 2BVTA 3RM9A 5IDIA 3W6LA 2DT0A 3PZ9A 1X6LA 2VOTA 3BAYA 2XFYA 2EBNA 3OA5A 5BXRA 2WAGA 4ZFMA 2A3HA 2CBIA 2AOSA 1E55A 1TA3A 1KXVA 1SYTA 4C7GA 1HKKA 2D0GA 1UD2A 3TOPA 3WUEA 2J7DA 4UFHA 4CCEA 3SUVA 1W3HA 3PZGA 5FKYA 1WZMA 2VVSA 1NOUA 4LGXA 3ALFA 2XIBA 4P7LA 4J3XA 1XH2A 3VMOA 2EXOA 4ACYA 1JZ6A 3BH4A 1OGGA 4Z2HA 4D6IA 1QI3A 1TFVA 1CGYA 1UR4A 1ISVA 2GFTA 3WH5A 3M07A 5CG0A 1DP0A 2WCAA 3WH9A 1EQPA 1VFFA 1JYXA 3VUPA 1V02E 1FA2A 1ZU8A 1VJSA 1DTUA 2Y24A 3LPPA 2E9LA 1QNRA 2QPUA 5DT5A 3AMDA 2WW5A 3AZSA 2GDVA 2WLZA 3AIWA 3QHMA 1TE1A 4MNMA 3MS8A 3NIYA 1UA3A 2E8YA 4QP0A 3VGDA 3GNOA 1FFRA 4IPNB 5CLWA 4JL1A 1GHSA 4W87A 4LYPA 5KZ6A 4JCMA 1UQYA 4K68A 3VOCA 2D3LA 2W67A 3OLIA 3CMJA 2VZVA 2C0HA 4BQ5A 3NDZA 5E09A 5A6AA 4GIAA 1MFVA 3TTOA 4AISA 1PEZA 2XM1A 1WE5A 4FLRA 1W9PA 3K8KA 4ZENA 3QOKA 3WFLA 1Q6FA 2W61A 4CKQA 1BQCA 2J7EA 1ISZA 1VAHA 1W9VA 2TAAA 5BRPA 5C70A 2WMHA 3ARPA 5A2BA 3GTNA 1KFWA 4B3LA 1CZ1A 2DEPA 4B15A 1R87A 3SCOA 1ZBVA 1JI2A 1QI0A 1OD8A 3WFZA 5FCZA 1WAWA 4HMEA 3DYOA 3VDAA 1UOKA 1QPKA 2JALA 1UKPA 3ARZA 1QW9A 3WNPA 2FGLA 2J7BA 2WANA 1ZBKA 4V28A 3AXXA 1FOBA 4WK9A 1BPLB 3SURA 3CLWA 4HOZA 3VGFA 1R86A 4ZE4A 3N15A 2PWDA 3KL0A 3RDKA 3OB8A 3J7HA 4PMQA 3GXIA 5A2CA 5BWFA 1UWRA 1XH0A 2J7GA 4GZJA 1GQLA 2VR4A 3K4AA 1QBBA 4XB3A 2PBOA 3VPLA 4MNJA 1BYBA 3WUFA 3ECQA 3UERA 2CIPA 5DFAA 1O7AA 8A3HA 2OWXA 2QLYA 3VD5A 3ZQ9A 2E8ZA 3G6MA 4WSKA 2FHCA 2Z1SA 4BA0A 3AISA 3AIEA 3UEQA 4PTWA 2ZXDA 1GOMA 3ARXA 3CGTA 1E5JA 3VIMA 1Q6EA 1AQHA 1W3JA 5E70A 5D8ZA 1J12A 1HKJA 3K8LA 1JDDA 1UKSA 5GQBA 3WIJA 4AC1X 4PTMA 3ARUA 3ARYA 1AQMA 1GHRA 1FHLA 1VIWA 3WY1A 4XV0A 4GO9A 1V03A 2FH8A 1LL7A 4S3JA 5FIPA 5M03A 3CTTA 3WNNA 6A3HA 3TP4A 2ZUWA 5A94A 1AQ0A 1JZ7A 1J0HA 1M04A 4S3KA 4Q7NA 3FHQA 1ISYA 2CYGA 1CGVA 2OYKA 2ZUNA 5FL0A 5I5RA 5A8OA 2WBKA 2E3ZA 6CGTA 3RJXA 1E6RA 3GZAA 1V6YA 4HMCA 2OYLA 2XM2A 3ZOAA 3ARQA 4CD7A 4NRSA 2XSBA 3VX0A 3WH6A 1HP5A 3CPUA 4F66A 3BLKA 1HJWA 2VX7A 4W89A 2OWCA 2Y4SA 1SMDA 5JBEA 2DH3A 3AXIA 1MW2A 2C7FA 3MMUA 1FH8A 3WF4A 3KL3A 1V0KA 4UZUA 3RILA 4M24A 3U5UA 2WLYA 4CD8A 1ZS2A 3W24A 1L8NA 3NSMA 3KEHA 3D5HA 2CBVA 3ZJ6A 1X1NA 3NSXA 2X1IA 3O2LA 4IPLA 3ZJ7A 1TVPA 1TG7A 3UCQA 4HTYA 3B9EA 4M82A 4YPJA 4ATDA 1OSEA 4UTFA 2W62A 1JAKA 4J3VA 1PBGA 2J8FA 1V0MA 3IK2A 3MV11 4W5UA 2ZX5A 3F4VA 4P7QA 3AYSA 3VIIA 2BV9A 2GDUA 4GPNA 5ABFA 1QI2A 3I3BA 4CU6A 3W27A 1NWUA 3BMVA 3MMWA 3VX1A 1G0CA 1XRVA 2XFFA 4U31A 2DIJA 3QOMA 4L4PA 1E3XA 4PEEA 5AC5A 4J3TA 4UR9A 2FH6A 1MVYA 3N18A 3L4WA 2JIWA 1NARA 4F9JA 4OBSA 3OBAA 1UD5A 1H0IA 3WL1A 1QHZA 5E6ZA 1O6IA 4NRRA 4PMYA 4YHEA 4PCSA 2JE8A 4V2XA 1BYAA 1TUXA 1BVNP 2D0FA 2BY2A 3GXMA 3GH5A 3UETA 2ZXQA 3F5KA 3AHTA 1MFUA 2VZUA 4FK9A 3CUFA 5D9PA 3WQVA 4JFVA 5DT7A 5HXMA 1C7SA 1R85A 4JIEA 1CGWA 1CIUA 4AD3A 4JKLA 1VENA 4E8CA 4QCFA 4BF7A 2GUYA 1JG9A 1PZ2A 4FMVA 1EOKA 3IJ9A 2C8NA 2DT2A 4CU7A 3B9DA 4C7FA 1E72M 1B90A 3OZOA 1JYWA 4UFMA 1V3KA 1WDSA 2PF0A 1NOFA 2BY0A 4DWSA 1C7TA 1VFOA 3NYDA 4FLQA 3L4YA 2J78A 4D1JA 1OIMA 3VIGA 4TXEA 2VL4A 3VIFA 3AMCA 4P7NA 4Z2KA 4W5ZA 5BXPA 2XVGA 1KQZA 3RM4A 1U30A 5FD0A 4OOZA 3M6DA 3AYRA 3PTKA 3L2MA 4PCTA 2YA2A 1LF1A 2CKSA 1MW1A 4QCEA 4RE3A 3MMDA 3NDYA 1QNQA 2WCGA 2XJ7A 5GNYA 1K9FA 3CHFA 4AD2A 4Z2LA 1I1XA 1W3KA 4L4OA 5E6YA 2PWGA 4TUFA 3WQWA 4F9DA 3WDQA 4AD1A 2D22A 3FY1A 3FW6A 3ZO9A 1GQJA 3ARVA 3O6AA 2WMFA 1ZL1A 2ZUSA 5EFFA 3CH9A 2YBTA 1D7FA 2WK2A 4JFTA 3VMNA 3MUIA 3T2QA 3N13A 4FLSA 3BAIA 4R27A 4UOJA 1DEDA 4D6FA 3KL5A 2DDXA 3ZR6A 2B31A 2W63A 2X09A 3GXDA 3W53A 4CD6A 1V3IA 3DYPA 2J47A 3POHA 4UQCA 4AD0A 1XSIA 1IZKA 1B9ZA 1EDGA 3CHCA 3ZSTA 1XHGA 4JHOA 3CZLA 3W25A 2E9MA 4UOQA 1MQPA 1E6NA 2CCRA 2W4XA 1WZLA 3MKKA 3DHUA 2D2OA 2VX4A 2VNCA 2GJXB 3FHAA 4CN1A 5HPOA 3A4AA 4M81A 5A6BA 2VRQA 2XVNA 2ZUVA 3W81A 3ZT5A 1CXHA 3SUUA 1JZ5A 1VEOA 1B1YA 2VZOA 3OGSA 3SUWA 3II1A 4OZOA 2VUYA 1B3WA 3S2CA 2FHBA 4XX6A 3ZM8A 5BXTA 1H2JA 1QI4A 2X2YA 1W9UA 2CITA 1E0VA 1CLXA 1XSKA 1OT2A 3WEMA 4HPHA 3GDBA 1A47A 1JFXA 4TVCA 1FHDA 1W1YA 5CSUA 1DWHM 3CZGA 1E6ZA 1E6SM 1PJ9A 5GNXA 4WKHA 2PWEA 4QLKA 1V02A 3EYPA 3PZIA 4P8XA 3WN6A 3SCWA 4PN2A 3IAQA 3VDBA 3GNPA 4X9YA 5IHSA 2IXVA 4KMQA 3ALGA 2Z1KA 1CECA 3B9AA 3MSDA 1GNXA 5I77A 3CUGA 1Y7VA 2VZTA 5CPQA 4HA4A 3B8SA 2WPGA 4X0VA 2ZICA 1ESWA 1WZKA 2GK1A 2YOCA 4QLLA 2IUZA 1E56A 4MAZA 1HJVA 4PMVA 1M53A 1G1YA 1NP0A 1E0WA 1OCQA 4WIWA 3BAWA 3BAJA 3AHVA 4MDPA 2YLLA 3K1DA 3SCTA 2A3CA 4CN6A 2E4TA 1WDPA 1LQ0A 2VQUA 2VT0A 4AEFA 4V27A 4U5IA 2EPKX 2OYMA 1XYFA 4AXNA 2WMIB 5IXEA 4A3YA 3T08A 3WNLA 2JF6A 4D71A 2WVSA 2EPOA 1ZB5A 1E4MM 1EIBA 3CZJA 4PRWA 5JUVA 3SCQA 4J3UA 5BROA 5LA0A 1KGWA 4W7UA 4W8BA 4UQEA 4EANA 5CLTA 1W9BM 3CIVA 1IZJA 4GQRA 1KQYA 4D6DA 2XVKA 1NH6A 5D8WA 3AHZA 3TTYA 1ITCA 1EO5A 1ZJBA 2Y8VA 3WF0A 2YL8A 2DPEA 2D0HA 2YL6A 3PZVA 3RJYA 4PUDA 3NCOA 4RE2A 1H0GA 1J0KA 3MSGA 5HPCA 1GW1A 3A4XA 3SCSA 1TMQA 4QAWA 3RCNA 5A6KA 1XV8A 2V3FA 2J8GA 4OUEA 3HJEA 2FHFA 3W28A 1OWQA 5I79A 4HZ8A 3WBEA 5CPSA 1JDAA 1V0LA 1JZ4A 1Q6GA 3EDDA 4D6HA 3WBAA 4M80A 3IJ8A 2G3MA 1KXQA 4CCCA 3BMWA 3AOFA 3SIMA 1I1WA 2GVYA 3WENA 1WO2A 1UD3A 1EHNA 4MTVA 1V6XA 1JXKA 2XGBA 1H5VA 1ODUA 1BGAA 3ZJ8A 2QV4A 3ZT6A 4U3AA 3ZSSA 2FGZA 1V3MA 1RP8A 3UG3A 1JYNA 5A69A 1BG4A 2V3GA 3BC9A 1UKTA 1B3XA 3N9KA 1UKQA 5A95A 2XFRA 1GPFA 1PIGA
chains in the Genus database with same CATH superfamily
3DERA 1VFMA 3W02A 5LYRA 4ONVA 4XZWA 4W8AA 4AIEA 1JFHA 3VGEA 1CBGA 4MADA 4UNIA 3SY8A 5CBBA 1H1ZA 4JKMA 3KTXA 3VOGA 4FNPA 3V3WA 1RCQA 2YYUA 1H09A 4ZO8A 3LHTA 4ZGYA 1JR1A 5AC4A 3UXIA 2EPMX 3DYMA 3HN3A 3HURA 3L4TA 3LYEA 3S1XA 1EOMA 4JDBA 4QHRA 2J62A 1ZCOA 3G1DA 4FEZA 4N42A 1ZP4A 3NJ3A 3UJ2A 4UQBA 2ZCGA 2QCLA 3B0YA 1XIEA 4GVHA 3VKDA 1DWIM 1XKJA 2QVNA 3M0KA 5HJXA 1XIFA 3R0KA 1XUZA 3SCVA 3VIPA 3JUGA 3NQ6A 3EB4A 3FXYA 1DHPA 4R85A 3GU9A 1HX0A 4LCQA 3RMEA 4CD5A 4PSRA 4DBEA 3EX2A 3ABXA 1XDMA 3NZPA 3P6LA 2CXEA 4MFEA 4GGHA 3CAKA 3QC3A 4I8DA 4LPCA 1LBMA 3GH4A 3GXPA 4C6CA 3I4EA 1EJSC 3WK3A 4ICMA 4QFUA 4GC3A 2C1HA 3HPFA 2PDMA 5CPLA 3N4EA 1EFZA 3ZJKA 4U10A 5AHFA 4EE9A 1M7PA 3WL0A 5F2MA 4XBKA 3DGBA 3HQOA 4MAVA 2BWGA 1YPXA 4KPLA 5CPNA 1UR8A 3FLUA 1U2YA 4GJ1A 4A2RA 3ATYA 1TA3B 3S6TA 1NQ6A 3BZGA 3ARTA 3RX4A 3S2LA 3GNDA 1XLEA 3N3TA 1LDCA 1FH7A 4IX2A 4XAFA 2QGHA 4IFOA 1ZP3A 5BOOA 3P61A 3CL7A 1P0NA 4QISA 3B0PA 4L6HA 4RW3A 1P7TA 4CUCA 1GVYA 1NFPA 3TV8A 2FZ8A 4HA1A 2DZUA 1R2RA 3VA8A 2HXTA 4XSLA 1CLVA 2FQIA 4JQAA 3SCUA 3QGAC 3VDCA 1JD9A 1PWMA 1VIZA 4OWGA 3NL5A 2OXNA 3JVAA 3FN9A 3QMSA 3VE9A 3E38A 4RR4A 2BOFX 2VYOA 1UZ4A 3WDIA 1SR0A 4ZQPA 2ZWYA 5KITA 3W6MA 2DZAA 2VC9A 4Z1BA 3IUIA 1KWGA 3AZTA 5A8MA 1HO1A 2EPNA 4QS6A 1R30A 2FDMA 1KR0A 3SUTA 6REQA 1PSCA 2HJPA 1VHNA 2J9ZA 2O9TA 3UWQA 2IQDA 5D2TA 1BG9A 2E77A 2QUNA 3BW3A 3ZR5A 1R3VA 1T5AA 2O9RA 4O0QA 3VKCA 5FJJA 2OJPA 3EGJA 2TYSA 3GB6A 1XIGA 4ZCWA 4IMFA 3L68A 5DBUA 4GYPC 1AJ0A 4TU1A 4ICNA 1H7RA 4I9TA 1R2TA 1MQRA 2TODA 1REQA 4MPKA 2H3DA 4XISA 5CJ5A 1YE6A 1QOPA 4S3EA 2VWSA 3FDGA 1HF6A 3SFKA 1FWGC 4KRZA 5DXYA 2A0NA 4G2DA 4W7VA 4FXJA 5EMYA 3VNLA 4DO4A 3MJMA 4WY0B 3L4ZA 3ERPA 4JNMA 4YWSA 3MUY1 2ACUA 4MY9A 4F0SA 1IWAA 1PIFA 2PEVA 3U5YA 3QPEA 1OINA 3B9OA 1OG6A 1VRXA 3AWNA 3RX3A 3ZLHA 2J13A 4FI4A 2XYLA 3GC2A 4AEOA 4FLOA 2VX6A 4WGHA 1YBQB 3NAVA 3MW7A 1Q8AA 1KM3A 1RAKA 1NDWA 2E6DA 4MB1A 9XIAA 2ZX9A 4LAMA 3EMZA 2RDWA 4C90A 2IW0A 3THDA 5IOBA 5L9FA 7TIMA 1QBAA 2FVKA 3F2CA 3W3OA 4CNNA 1K9DA 5DEZA 3ZWTA 3KOXA 2MNRA 1W1ZA 1DHKA 4XZNX 1EQCA 5CJMA 2VEPA 1UP3A 5E0KA 5HOSA 1Q6RA 1MUWA 1LG1A 1J0JA 2FFIA 2PDUA 5DF0A 2W5FA 1RLDA 1NWSA 3GIPA 3H21A 2V5CA 3AUJA 2O9OA 4O14A 4D1IA 1AMYA 1D3CA 4DF2A 2DP3A 4Z1CA 3TR9A 1B3ZA 4PMUA 3H12A 2GSHA 4TX8A 3BV7A 2Y70A 2VHLA 4AY8A 3BJFA 2OOGA 1VF8A 1RCOB 3BQ5A 2YA0A 3O7UA 2AQWA 4NJIA 1HNYA 3W7NA 5IRPA 2X42A 1DQWA 4BI5A 4DJEC 5CC6A 1QPRA 1GQKA 3I68A 1LRTA 5U4NA 3GG0A 3H4GA 2VO5A 3OTRA 4J35A 5H8PA 1H4PA 3TYDA 5FOOA 1UWAA 5FL1A 4LNYA 2F84A 3RFAA 4IH3A 1RALA 3TTQA 4P7RA 2PP3A 4ENLA 2QUTA 4GIYA 1RPKA 2CHNA 2JIEA 3IIVA 1S2CA 5I03A 1PS9A 3H55A 1ITXA 7A3HA 2DJXA 1ZRQA 4L9YA 5BZAA 4PBEA 3V36A 1DORA 1ISXA 3CNYA 3UJSA 3AIUA 1C8QA 4BJHA 2NVAA 3LHYA 4QJ4B 3C2RA 5ABFB 1LJYA 4I90A 4QE1A 3DFQA 3BCFA 3BG3A 2GOUA 3M0ZA 4O1DA 3DC8A 4PH6A 3FYPA 1E70M 3EDFA 4D6GA 4PFHA 4TVDA 4IJBA 3N1AA 1GKRA 1KC7A 1KGXA 3BOFA 4PTVA 1GZJA 3SY1A 6PTDA 3B06A 1GEHA 3WQFA 1IQ8A 3HU7A 2DU2A 2WBGA 1XLKA 1VFTA 3LMYA 1LUCA 5DXXA 1HXJA 1RVKA 5C8BB 4FOJA 1B2YA 4NI8A 1Q7ZA 2HE5A 5LNSA 1PE1A 4NL1A 3LHUA 3WD3A 2ZRWA 4JTFA 4DBSA 2YGYA 2D20A 2HK1A 1HFBA 1EXPA 3PANA 2P76A 1XYBA 2OWWA 3SUSA 1QMLA 3O63A 3ELFA 4RDZA 3K13A 4PCNA 2G41A 3RM8A 3CQHA 2BXZA 1XYZA 2B0MA 3VIHA 2I16A 3TX9A 4B90A 2NVCA 3TN4A 3EPMA 2ZBTA 3AHXA 3TN5A 3DHDA 1X1OA 4QDMA 1EHAA 2FB3A 1LWJA 2NUYA 1M7XA 3EWUA 1KBKA 4M51A 4MDOA 4U2ZA 5A8NA 4GXPA 3GLCA 4HN8A 3RLGA 1YIXA 3VKAA 2GGEA 3CUHA 2P88A 2VCCA 5LA1A 1UA7A 3VNZA 4LTSA 3ITVA 2FMNA 3E0LA 4IJCA 3WQ4A 2V5DA 4KFNA 4E0CA 4DY1A 2DSZA 1OGBA 1I2OA 1DYSA 2D24A 1FBAA 2VX5A 1KBBA 4MB3A 5D9MA 3LCWA 3VDHA 1DV7A 3O6DA 1EPXA 4LF2A 3Q58A 2QCDA 1N2VA 3E0IA 3OU8A 3GR7A 2UWFA 2OLSA 2C0AA 2QIWA 3LHWA 4GKTA 2XINA 4RUBA 1XLAA 3RNDA 1PZ1A 4IOTA 1Q3NA 4I7WA 4LBSA 3SW6A 4IIFA 4LNCA 4UC5A 3HPSA 4UNLA 3L9CA 3B0UX 2FGBA 3PN8A 1F4HA 4UTTC 5C71A 4FIQA 1VBUA 3H2AA 2B7NA 3H2FA 3PNZA 3UT0A 1TZZA 1LLOA 3H22A 3G1YA 4DJDD 3QF0A 3CAVA 2DT3A 4EWJA 3MP3A 4IP4A 1MQQA 5DMYA 2WVUA 2EJ1A 3KVMA 3CEUA 3LM3A 4QTGA 4A05A 2E68A 3PWGA 4NJKA 4LUIA 1MW3A 1XRFA 2W9MA 3SDOA 1OD0A 3DCPA 1SFSA 3C0SA 3CH0A 1Z3NA 4ZQMA 4Z1DA 3KHJA 2Y7EA 4HZ6A 1GOIA 4K37A 1UBPC 1XLHA 2WOQA 1TRDA 2Z24A 2JKAA 4JTIA 1JZ8A 3UF9A 3BV4A 1TSIA 2VI0A 3P7YA 4YIWA 3STGA 3W6YA 4XO7A 2WVVA 4U3CA 3N25A 4UQ9A 3PSWA 3PTQA 4NVTA 3CIXA 2PWVA 2Q3RA 1JUEA 3UPMA 4MY8A 3O9NA 4EXAA 2PI6A 1H3GA 1IIGA 1J6PA 4C1NA 3KTCA 3H2CA 3WF2A 3C0JA 3KE0A 4GI4A 1CXEA 3WLTA 4K1GA 1IEIA 2QCGA 1UCWA 4W93A 4CU8A 3NPXA 4KGLA 4OKDA 4RZ5A 4QBXA 4DF1A 2PCEA 2W0UA 4CVUA 3LBCA 2WZEA 3ANUA 2CERA 3R79A 3BVJA 3TMLA 2DUXA 2HISA 5D32A 2NT1A 2ONEA 5E0CA 2D23A 5ECVA 5AB3A 1GG1A 4JCLA 3ZZ1A 4R53A 1VD6A 1IEQA 4C6KA 3L7RA 2ZX6A 2GGJA 2INZA 5C2XA 3TYCA 1DWFM 2PGRA 1UD4A 1E1CB 4DO7A 1D2KA 4P7OA 1ENUA 2HVMA 4XK2A 3MANA 4MKSA 4AZBA 2YDSA 2Z7KA 4GFSA 1WBJA 3RHGA 4PULA 5KTLA 1QOQA 1VC4A 3BGAA 4Q6XA 4U33A 3PUEA 4MJMA 1V08A 2F8QA 1I75A 1PYMA 3MUCA 3AXKA 1S5TA 4YTTA 5G4EA 1EC8A 1Q13A 4HA3A 4NZ4A 3S2JA 4E2VA 1HKMA 4AW7A 4MHBA 1V8EA 1GOOA 3VNYA 4FNTA 3SAZA 2P53A 1C90A 1UQZA 1GK8A 3VD7A 1TPWA 5CSYA 4DBUA 1SJBA 4ZOBA 4GD0A 2W27A 3UXKA 1DE6A 4DQWA 2A3AA 1F07A 1AVAA 4HBKA 4HNUA 2H9AA 3PZMA 3T2OA 1MZHA 1M6JA 4HPJA 2CC0A 3QYQA 5FEXA 3ZVHB 2Q09A 3PWIA 1XIIA 1WCGA 1IT0A 2ACSA 4L61A 5HDRA 5I78A 1R7OA 2RGLA 4JR5A 2X1UA 3R0DA 4IIBA 4J2MA 3WH7A 2BY1A 4DJFA 4DHGA 3RLVA 1XLJA 1DTNA 1M01A 1DL3A 1E6PA 1FH9A 1OZMA 1LTDA 3WQ8A 4UOZA 3S42A 5J8LA 2RAGA 3VNKA 1JYVA 5CGTA 3OHMB 3W7QA 3F5LA 4Y96A 1XGZA 1XFBA 3E0VA 1GGOA 1X98A 3PG9A 2BHZA 1GQIA 3LHZA 1FWBC 3EEZA 4MMWA 3DU0A 1K1DA 3TSBA 4O13A 4B5UA 4NZFA 4JTTA 4Z42C 2A3EA 2PS2A 1KXHA 1EYWA 7XIMA 4PTXA 5ABEA 1LYXA 4N9BA 3OZYA 2V8ZA 2X2GA 3C4UA 2IQ0A 2CBUA 1E51A 2QS8A 3QV9A 1O5XA 4AY1A 4X3ZA 4U5KA 2TPSA 1ALDA 5B7ZA 3T0DA 3R1ZA 1E9IA 1YHTA 5JQ9A 1TTIA 1QNVA 4XQ6A 3ITGA 4GQQA 1IWBA 4FR6A 3MU7A 3FEQA 2I5QA 2VELA 3GG1A 1KRCC 3CHVA 3VILA 3VMPA 1GONA 4YCOA 3VDGA 5K4ZA 4PUWA 1A5OC 4WJEA 5C5YA 3W7OA 4JEJA 3AIBA 5I3DA 1G69A 3LGGA 4PBGA 1F9CA 2EF9A 4N4PA 5A8PA 3KWSA 5AYXA 3EOEA 2GDQA 4BF9A 3NXLA 1DJYA 1RBOB 4X61A 4H19A 1RBAA 3M0YA 3N4AA 4HZMA 3W70A 3TTEA 3TMQA 2HROA 5HQEA 4W85A 2F6KA 4E2DA 4TTGA 3PJUA 1TJPA 3NGFA 2ZXAA 3IEBA 5C9WA 2WKLA 3CAQA 3SEPA 2YCJA 1EDQA 4DM1A 3WLHA 3ZMRA 4PB3A 1RP9A 5HMEA 3UNTA 4HHHA 1EBHA 1J2WA 1V3LA 1QW8A 4A4AA 1C9DA 4D6EA 3GNNA 4JN7A 4JQ2A 5REQB 3QY6A 4ACZA 1C8YA 4KCTA 3RO8A 4YXGA 2IMRA 4L4MA 1UG6A 3U2ZA 2BVTA 4FPSA 2DT0A 2GUBA 1X6LA 1D7KA 3OO2A 4LSBA 2P3ZA 1B9BA 1NELA 1PZ0A 1V7AA 1QO2A 4K7VA 5DY3A 1H7OA 4NAFB 1E55A 3H4XA 4HTBA 4AB4A 2KAUC 4C7GA 3TOPA 1P6BA 3OBEA 1CB7B 4CCEA 3CIWA 1KM0A 1W3HA 4GJIA 5FKYA 3ZS4A 4GY1A 3E2VA 3ALFA 3VZZA 2ISVA 2XIBA 4WX2A 4P7LA 4MZ8A 1S5WA 4H7ZA 5ABTA 1Z69A 3LQLA 4L56A 1W1A1 2ZZ7A 2GFTA 3VOJA 3WBWA 3WH5A 3M07A 1XX1A 5CG0A 2G37A 2GWGA 1XXXA 3LK6A 1ZU8A 1N8FA 4RLIA 1NQKA 4WDWA 3RRXA 4PCFA 2Y24A 3LPPA 1M65A 1QNRA 2Y5SA 5DT5A 3ONBA 2XH4A 3AMDA 3AZSA 2WLZA 3AIWA 1TE1A 5DCBA 2H8ZA 1NF0A 2QDDA 4ZB0A 2H6RA 4YYCA 2E8YA 3FVMA 4QP0A 3MQTA 3B8VA 4LVAA 3VGDA 5CLWA 4IPNB 4UIOA 4W87A 3I6RA 4LYPA 1T8XA 4CQCA 2W67A 4HNVA 4KWVA 2C0HA 3V75A 2Y6ZA 5C2GA 2PRHA 4XTIA 5A6AA 1GW9A 1MFVA 4GIAA 1OF6A 3LQGA 1YTKA 3W88A 3GG7A 1W9PA 2PZNA 4ZENA 1Q6FA 4C6EA 3UXDA 3ITLA 3LENA 2Z0IA 1TPH1 2J7EA 4QG9A 3QQ1A 4WJ8A 3LG3A 3ITXA 3GTNA 1Q4WA 1QWGA 3QZ6A 1KFWA 4B3LA 2Y5JA 4GISA 1JI2A 3F4CA 4QG8A 1IXQA 1OD8A 3GW0A 1WAWA 1W5OA 3FDKA 4EIVA 4HMEA 3DYOA 1UOKA 3BANA 1O95A 3UJFA 4L1GA 3NVTA 1AZ2A 1SPQA 2J7BA 4LBUA 3UY7A 1ZBKA 3AXXA 1X1ZA 4NJGA 4Q8PA 1TPFA 2OZ8A 5BOEA 4ZE4A 1K4HA 2PWDA 5G1TA 4UTMA 4A8NA 4O15A 5BWFA 3V18A 1R3SA 1NEYA 4GZJA 3GTIA 3IGUA 1GKPA 2XH2A 1ME7A 2PBOA 1K8CA 2TMDA 3GK0A 3UERA 2CIPA 2V81A 5DFAA 3PUOA 5C9UA 3ZQ9A 3HGRA 5FAJA 3G6MA 2Y85A 1KD0A 2E1WA 2OZ3A 3GU2A 1EJRC 4NXSA 4GGBA 3HG4A 3CL6A 3Q45A 5E70A 1TJ0A 3WBXA 1HKJA 3EA3A 4YU1A 1JDDA 3MA8A 3WIJA 4ZFCA 4R7WA 4PTMA 3ARUA 1FHLA 3GHSA 3T07A 2A85A 1R46A 1IIHA 2FH8A 3SB0A 5M03A 1H61A 2PTYA 3KDNA 6A3HA 3IARA 4HNOA 1FQ0A 3T81A 1D9EA 1KBJA 1ISYA 1NFGA 4CQ8A 1XINA 1DE5A 3FGCA 2ZUNA 5FL0A 1W17A 1E6RA 2PU1A 4PUUA 3CWHA 2OYLA 1SU5A 3H7VA 4D8LA 1BF6A 1LOQA 1NIUA 4LB3A 1LCOA 4NUWA 1OCJA 2XZ9A 1J4EA 4NRSA 1KFJA 4F66A 1HP5A 2OR2A 2YCKX 3IV8A 3T1GA 3EWBX 2HQAA 1SZRA 1SMDA 4WY0F 5JBEA 3U4FA 3AXIA 1BXBA 2C7FA 4IXHA 1MEWA 1KTCA 4HNTA 1X6UA 3U5UA 4US5D 3IK4A 4ZZ9A 2WLYA 3MSYA 2GQ3A 3LBMA 5CCZA 3URNA 3EA1A 3ZXWA 3D5HA 3I10A 1F05A 3PBUA 3ZJ6A 2VEIA 1X1NA 1TVPA 1TG7A 3RLHA 1UP0A 4PRRA 3E02A 4YPJA 4H9YA 3DEQA 4QDWA 4MKNA 1KV5A 3NOYA 5IBXC 1FWCC 2J8FA 1LLZA 2CLIA 1Z44A 4YVXA 1XP3A 4F0MA 5H6HA 1EL3A 4NIRA 2X1SA 4GPNA 4C6NA 4CU6A 1S5VA 4EVZA 3W27A 3TFCA 1DXEA 3VX1A 1XKYA 4UTLA 1YDVA 3FA5A 1SZNA 1RQBA 1XRVA 3LX9A 3W2JA 1K7EA 1JPDX 3IVTA 3TK7A 1MVYA 3N18A 3S1UA 3GRIA 3TDFA 4DI9A 4BEQA 1UD5A 3WL1A 4QR6A 3D3FA 3WLRA 4UMBA 1O6IA 2QT3A 4PMYA 1BVNP 2YCIX 4N02A 5MHBA 3GSMA 3GXMA 3C2EA 3GH5A 4FXSA 2ZXQA 3F5KA 1IYXA 1MFUA 2PSNA 3CUFA 4FSAA 1GVOA 5DT7A 5HXMA 1YLVA 2C1IA 2Q3OA 3E96A 4FR1A 1CGWA 1D8CA 3SM0A 4PFMA 4JKLA 1JDFA 3QMTA 4QCFA 3TJ4A 1RCXB 2WQPA 1PZ2A 3GXTA 4XVEA 3MWCA 2C79A 3HG5A 4V1XA 2WKJA 3KW3A 4C7FA 2Z1WA 4RK8A 1V3KA 2QULA 2PF0A 1NOFA 2BY0A 1SZGA 4DVOA 2J78A 3HV9A 1UUMA 3QR1A 3S1VA 4IXXA 1GVSA 1OIMA 2C19A 4TXEA 1J96A 3EXTA 3W76A 4F2TA 2OO6A 3EZ4A 4JNYA 3FXGA 2QJGA 3G1VA 4XKYA 3PTKA 3UQNA 1MW1A 4QCEA 3NDYA 4BHYA 4NNBA 5CAHA 4JNZA 5D30A 1WUFA 3C0LA 3A64A 4LC6A 2D22A 2GPTA 3FY1A 5HJLA 5HATA 3Q2DA 3CQIA 4NZ5A 1OX6A 2WMFA 1J2BA 3WQDA 1S3HA 2FPTA 4N9EA 2QCHA 3E0FA 4GZ7A 3MUIA 1H62A 1XL9A 1Z6KA 4UOJA 3QQWA 2DDXA 3ZR6A 2B31A 2W63A 1DJXA 1XM3A 4GOAA 1WDWA 1PCKA 1V3IA 2BMBA 3DYPA 4LAKA 3P84A 1ZQ5A 1EDGA 1C29A 3KOZA 1YXYA 3ZSTA 4QROA 2OGYA 3QLDA 1MQPA 1E6NA 2CCRA 4WDTA 3DHUA 2D2OA 1W0MA 1P48A 1O5KA 4DI8A 5A6BA 2VRQA 3PPFA 3ZT5A 3DFPA 4HN4A 3SUUA 5HUOA 1P7TB 5CZTA 5HWJA 1WXJA 1QJWA 3ZM8A 4AAJA 3LTYA 1KFCA 1H2JA 2CITA 4YS1A 1OT2A 3GDBA 1A47A 1IHIA 1E6ZA 3NQ7A 3CV1A 1TIWA 1PJ9A 4WKHA 1UROA 3GYEA 3GS6A 2QUUA 3ABZA 3W7PA 5H8MA 2NX3A 1WX0A 4JN8A 3GNPA 4KMQA 3ALGA 3B9AA 3QKZA 3T8QA 1XBXA 4PL2A 1F6PA 3S9IA 2VR2A 3ABOA 1K8YA 4NASA 4HA4A 4LUTB 3V4BA 1ZHAA 7ODCA 1MDRA 3FVDA 4C1KA 3HJZA 2YOCA 4XIAA 3LS9A 3QW4B 2PDKA 4QIUA 1KFEA 3PPGA 4PMVA 1G1YA 3SRFA 2QW5A 4JTRA 3B8DA 2HZGA 3PUDA 3BAWA 3BAJA 2YZRA 4MDPA 4ZSUA 2B7OA 3RO6A 4ICCX 5FJRA 5I7GA 3NEVA 5CG7A 1J8VA 1LQ0A 1REQB 3R43A 4V27A 2JF6A 3LNMA 1V5XA 1YDNA 3CU2A 3GVQA 1E4MM 1EIBA 3SCQA 1VZWA 3CV6A 3G77A 4L6OA 5LA0A 4ZL1A 4W8BA 4HU3A 5HUPA 4EANA 5CLTA 4GUFA 2YFNA 3CIVA 5CKSA 1EUAA 4D6DA 2PP1A 1EO5A 5AVHA 1ZJBA 2C18A 3TJLA 3VFCA 4L1WA 4C1LA 5K3VA 4ZOCA 5FSEC 2I56A 3DN5A 4CNSA 1ITQA 4EXQA 2J24A 4XTDA 4RE2A 1XDLA 4M7TA 1TMQA 5A6KA 5G1MA 3I6EA 3GC4A 4OUEA 1E9YB 4IGHA 3GE7A 2F38A 2YW4A 3H7UA 3W1TA 3TLQA 3C8FA 4DXVA 4HZ8A 2ON3A 1F3WA 3UD6A 3NDOA 1Q6GA 3SFWA 3WMLA 3EDDA 2GVGA 2G3MA 3P14A 1IZCA 4KWOA 4C6QA 3AOFA 1AJ2A 3H24A 2VFDA 2YX0A 2WNZA 1UD3A 3W7EA 4MTVA 1V6XA 3TJIA 3UG3A 3G1FA 5FF7A 5A69A 1FWAC 3GR8A 2OT1A 2OPJA 1PIGA 4IMGA 4DWSC 4Z2IA 2E6FA 3K8MA 4WR3A 3W1NA 3UZYA 5F2GA 4RX0A 1W37A 1A3XA 2G96A 1KNWA 2QUVA 3WD2A 3FAXA 1US2A 4WKFA 4OE7A 1HIZA 3GR4A 4ZOAA 4Y90A 2AGKA 2XGZA 1FWTA 2V2DA 1LL4A 3GBEA 2P0OA 2VCBA 1EC9A 3U7BA 4B5SA 4M0XA 4M1RA 1I9CB 4MPQA 1M41A 1CYGA 3W2LA 4AZCB 3FCPA 2Z2AA 1S38A 4FX7A 3CMGA 5HMDA 3KBJA 3POCA 1JL8A 1DKWA 4KIEA 4S3BA 1UWUA 2ZZ1A 1F3EA 5HNUA 4HJFA 3WD0A 5TF0A 2WO5A 3CMFA 4IPPA 1HKIA 4D72A 5I24A 3IPWA 1J18A 4J7RA 4BY3A 3OVPA 2YA1A 4JYEA 4AUBA 2Q6ZA 3LRLA 2IS7A 2PDFA 1XQKA 2I9UA 2WMKA 1ZALA 3QZEA 1CXKA 3URQA 3VE7A 1AK5A 3UR8A 2WYSA 1L9WA 4HSHA 3A3WA 4Y9OA 4FX8A 5EGRA 3WDRA 1M9HA 3VC6A 3FJ4A 1C93A 3ZIZA 1HJSA 4Y2WA 2H8XA 3SIZA 3M7SA 3QPYA 4LVDA 1W1PA 4K8HA 1ZTVA 4JIQA 1JXJA 2X30A 5HA7A 4UTWC 1KWKA 2BSLA 1MUMA 3TW6A 1CGXA 3P2VA 1S5NA 2CLMA 2VURA 1PX4A 4MYAA 3PBMA 1WOBA 3K4WA 3NQBA 3LY0A 4ATWA 4AY7A 1KKOA 3OGRA 3IJDA 5A6JA 3ME3A 4ZTXA 4J3WA 2OSXA 3QYSA 1KXTA 3W84A 2BFGA 3CB3A 4O17A 2BNJA 3NZ1A 4KEVA 1DIEA 2E5DA 3H2NA 5AYYA 4K7YA 1CX9A 1K4GA 1TWWA 3KVLA 2PWHA 5F2IA 4QRNA 1CW2A 1FWHC 4AZ6A 1F3TA 4MWAD 1A5KC 3OIXA 2PDHA 3EDJA 1XW8A 4ZXLA 1XLDA 1RHCA 1R9YA 1PDZA 2YDAA 1FXQA 2B7PA 4E3TA 4TMCA 3S6OA 1XIBA 2NQLA 3WLJA 2PF8A 1LL6A 3CC1A 1OVDA 1YEYA 5AECA 2V3EA 3MT1A 2NVDA 3KTSA 3M41A 5F7UA 2FZDA 1N55A 3EX1A 3XINA 1DXIA 4AIUA 4BZYA 5BRQA 3SJ3A 1Z42A 1ZJAA 1XICA 2QDEA 4GNVA 3T4WA 3B8WA 3W7JA 2W79A 4GXMA 1CPUA 3V5CA 4O0ZA 2ZDSA 5E1QA 3UPWA 3RIKA 1OFAA 2BLEA 4IPIA 4PGLA 3BLIA 2DUZA 2ISSA 2IXUA 3MTWA 1RR2A 2PDLA 4XZIA 1J0YA 4A22A 1KCZA 4HOWA 3HGJA 2J7FA 2NSXA 1UHVA 4AYSA 4P8VA 5JXQA 1C8VA 3EKZA 2VMFA 5AHLA 3U4AA 1TWZA 1CI1A 1HN1A 5I6SA 2R9RA 3IIXA 1JUBA 3VD3A 4GABA 1QR7A 2NQ5A 1W3IA 3TYEA 2AMGA 3KWXA 1YRRA 2BHUA 3T44A 1VBHA 1FDYA 5CSRA 5D33A 2WSPA 5HAOA 2Q8ZA 1QNSA 2IQTA 3VGGA 1SFTA 3GX9A 4C6OA 1XD0A 3G1HA 5DX7A 2WZHA 4AYGA 3PWAA 4DM2A 5BNKA 5LNWA 1VFSA 4YVVA 3TW9A 3WF1A 3AJ7A 2I57A 4WHBA 1TR9A 4ZO9A 3CL8A 3UJEA 4XAYA 3VOHA 3MCOA 3MB9A 4IG2B 4A3QA 3FJLA 4ADTA 1BVWA 3S5SA 3VCRA 2WVVB 3VNMA 1M03A 5DMLA 1PXGA 1HW6A 2X1RA 3UY8A 1OYBA 3QVQA 4F48A 5EFDA 3TFXA 2CLOA 2PDIA 3C3UA 3VCCA 1E1FA 3V16A 3TVAA 4IGNA 3VD4A 1VEMA 3DGRA 1S2TA 1EGMA 3N14A 1JVNA 1QVBA 2ALDA 2GGGA 3W7KA 4EF8A 1SJAA 3JR2A 3L4XA 1SZFA 2JF7A 5CXPA 3A12A 4NP7A 1I2NA 3DAQA 4YL2A 2QHAA 4LALA 5AYZA 4OIFA 1M7JA 2GOKA 3PJXA 1THFD 4KW2A 3TW7A 5A8GA 4L4LA 3PC0A 7CGTA 3LPGA 3TC7A 1Z48A 2PBGA 1Z32X 3R10A 4UWMA 1JNDA 1Q6CA 4MJZA 5A6LA 5LGZA 4YN5A 1HJXA 2XU2A 4OU1A 3MKCA 4Q8OA 1CENA 1YKWA 2OZ0A 3CK5A 2DIKA 4CD4A 3IANA 1B31A 2XTKA 4RPQA 1V7YA 3G6LA 4GFIA 1UPMB 3UG5A 3KS6A 2QVHA 4S3GA 1CB2A 3SN1A 3M5XA 3FV9A 1SFJA 4MYXA 5C9XA 4AWEA 4CEXC 3U48A 3NO1A 4GIEA 2UV8G 3EB3A 4HPGA 3MUXA 3LCXA 4Z2GA 5F4WA 2V6AA 3FJ6A 3WQ6A 1B54A 2HPIA 3BAXA 4LCSA 3AUOA 4AZGA 1KRMA 5TD4A 2YYTA 3NSNA 3U57A 4AZ5A 1CXIA 2C1GA 1HL9A 4XBSA 1OADA 1UD8A 3M5YA 1JRCA 4LVFA 4PMRA 4OTKA 1EJ7L 2BGQA 2XFWA 2WHKA 3ITTA 3T2PA 1RY8A 2WSYA 1DJWA 2QJHA 3EA2A 1EWEA 1A4LA 5E5CA 3TNBA 5AOUA 3BK0A 4PMNA 2QMKA 5KETA 1I2RA 2VWTA 3UA3A 1W1VA 3APGA 3LD5A 4W84A 2QJMA 2JEQA 2XVPA 4UCGA 4ZO6A 3NZQA 1H41A 5AY7A 4QS5A 4IIDA 1U5VA 2I5IA 4A8RA 5AYIA 1JCNA 3NUKA 4ZQRA 1VJZA 2A2IA 1PKMA 4F4RA 1E73M 1GJWA 1VPYA 2ZZ5A 3VXGA 1D3GA 3REQA 3AIRA 3PBGA 4M6PA 3EBVA 3LZ3A 4UXDA 1R3QA 1T8QA 2TRSA 2HS8A 4AD4A 4WLCA 2DW6A 3G5EA 4O10A 2ZVRA 1HJQA 3PB2A 3C2FA 2DJLA 4U28A 2H90A 4B9ZA 4O57A 4QLJA 2CESA 4LXFA 5M5DA 4AVFA 3LZ5A 3EWWA 4MGGA 3SZ8A 4IZGA 4A8LA 4RE4A 2YCLB 3BL3A 3SCNA 2IKHA 1UC5A 3ARRA 1GYLA 3WK0A 3G22A 2GJNA 3BSGA 3WF3A 3W2MA 2YKKA 4ZE5A 3HG2A 2D73A 2ZX8A 4IX0A 1J0ZA 3OVRA 3FYYA 1T6MA 3W71A 4E4FA 3AMKA 4HHPA 4QGCA 1X97A 3IRDA 4XUGA 4TVUA 1JUKA 7TAAA 9RUBA 2BVDA 3IV3A 1MXDA 4GUIA 5FEZA 4PZVA 1L8PA 1EXBA 1WKDA 3A47A 4HCDA 3N9RA 3STCA 1PKNA 3USZA 3TKFA 4BQ2A 1VJIA 1DWJM 3KOWA 4G7FA 1TTPA 4DIAA 2F61A 4TX6A 1JQVA 1YNYA 3O8AA 1NWRA 2A7NA 4DRSA 4H1ZA 1S2WA 2FYMA 1BHGA 3VTRA 2G8ZA 5H2ZA 3O0KA 5RUBA 4UZSA 4DJED 3N17A 1GOWA 2R8WA 3W1LA 2POZA 1EH9A 4HA0A 1NP2A 1M1BA 4BQ4A 5AFDA 3EMQA 1BYDA 4GA8A 1DOSA 3W7CA 4JPGA 4EP8C 4AZHA 2V68A 4D6JA 4CNPA 5H91A 2WB5A 2POTA 3DZ1A 1FWRA 1B3YA 4MG4A 5DCEA 3SSZA 3C2OA 1HKWA 4GYJA 5L6UA 3ANYA 5AHMA 4LJ3A 4W7WA 3HPXA 2Y88A 2W92A 1B57A 5FJOA 3P8JA 3FAWA 4M29A 5D04C 4ZEPA 1MWOA 4CGTA 4HU8A 2REQB 2VJXA 4PMXA 3GXFA 3E2SA 2ZE3A 3VVGA 3VIOA 4DPPA 3NQ2A 3B9NA 1BVZA 5LIUX 3WQEA 2VFFA 2HEJA 4NF7A 9XIMA 1JF6A 1GYMA 4PR4A 2WV8A 4NILA 3F5JA 1O12A 1C8XA 1OK6A 1PDYA 4LS2A 3LSCA 3CEPA 3U3HA 2YCEA 4GJJA 4IL2A 1EF2A 5G2WA 2AKZA 5LIXX 1VFLA 1BWKA 4JIIX 3EWCA 3C2VA 3P80A 1I8JA 3GH7A 3VINA 2E5BA 1WXYA 4F0RA 4RDYA 1TO3A 5CQ1A 3I3EA 3AIVA 3QZAA 1MEHA 3NQFA 1DBTA 3WLMA 3KBWA 1W9XA 3W01A 4C6BA 3ICJA 4H8HA 1YNPA 4Y8FA 2FZ9A 2E5CA 2XHYA 4I8YA 3USBA 1OX5A 4GI9A 2PDXA 2ICSA 3MSRA 4EF9A 3ARWA 4R34A 1GT8A 3BOLA 4DO5A 1EJWC 3W82A 4N6FA 3HA1A 3KRUA 3QV6A 5CGMA 1IEXA 1V0NA 2PPGA 1OT1A 2FDSA 2C15A 4JFSA 1P6CA 2A1YA 2E09A 4R33A 4W86A 2BDQA 5TNVA 4XBJA 3Q94A 1E1EA 2ZWZA 5CC3A 3PBVA 1OX4A 3MYPA 1AH4A 5AHIA 4IFRA 2BXYA 8CGTA 1CNVA 3E5BA 3PZQA 3SN0A 3WZ0E 8XIMA 2YL5A 3WBYA 1Q66A 1C3FA 2ABBA 2FVMA 3TAOA 3WUGA 4ATLA 2HMCA 3WMBA 1UMYA 4QITA 3GWQA 1F74A 4L7ZA 3B4UA 2CEQA 4LV9A 4QJ1A 2E9BA 4NAEB 1L6YA 3BGJA 3S4TA 3D0CA 4KWUA 4K8GA 5BRBA 3W72A 2ISWA 4HK6A 1W2PA 3N34A 3UJRA 4AD5A 4REQB 1UWQA 3SRHA 3JZUA 3V0UA 2XWDA 3QGVA 4O4VA 2E7FA 4US6A 3W1XA 4AX6A 2MANA 4QNEA 4OUIA 3S0CA 1QASA 3TYAA 4GLEA 4IQJA 4H8UA 4GI8A 4M1BA 3NO5A 3OPSA 3LEPA 3M43A 3ISIX 5HWMA 4A29A 3PZNA 4V1YA 3O1NA 1XGDA 2Z1XA 1V6VA 3N2MA 2WMJA 4NYUA 2WWDA 3IUDA 4ROQA 4XAPA 4O1EA 2YFOA 1VCFA 4WSJA 3BICA 2V30A 4KIRA 3G0UA 3L66A 4L9ZA 3CO8A 4UTHA 5FAGA 4Z2JA 3GYCA 1QOXA 3GAYA 5A6MA 3BO9A 1TRIA 3AI0A 4LAUA 4UNKA 2V38A 4HK5A 2GJRA 1F6KA 4H8NA 1G5AA 3BMXA 5GVJA 1W5MA 1QHOA 4QAIA 4ZB2A 1QPNA 2CNCA 4RW5A 1NDZA 1E40A 1JQXA 3W86A 3WD1A 4EK7A 1FWSA 3W7DA 1JD7A 5AC6A 2VEFA 1Q2SA 2VQTA 1VP5A 1GKQA 3AHYA 2W91A 3CUIA 3UZZA 3P93A 2EKGA 4ERAA 1TMHA 2Y7GA 1FWIC 4B4HA 3RM9A 3W6LA 3PZ9A 4NJHA 1RUSA 2VOTA 1VR6A 3W1PA 5CEWA 4ZFMA 3DI1A 1V51A 1EC7A 1V93A 3KX6A 3VZXA 1TA3A 1SYTA 2INFA 1T96A 2NLIA 1AW2A 4UFHA 3MI3A 4DF0A 3UCCA 3VNJA 3TXVA 3PZGA 4HU4A 1NOUA 3UW6A 3W74A 4DELA 3VMOA 4Z2HA 4PUNA 3RPDA 2XN1A 3LBOA 1XYMA 4B91A 3N2TA 1ISVA 5EMKA 3M7WA 4LWWA 4O52A 1NY1A 3SI9A 2WCAA 4LY8A 1EQPA 3CJPA 4PCPA 1B3OA 5AHNA 1VFFA 3A3XA 3QN3A 1V02E 1GVFA 4G7EB 1G4EA 1JRBA 2QNEA 2QPUA 1UJQA 4G8TA 3SECA 4IF2A 3H4WA 4MNMA 3URAA 1WXZA 3R58A 3M5ZA 8RUCA 1WKEA 2VP8A 4J9JA 3SQMA 1TQJA 2OU4A 5KINA 5KZ6A 4XKYB 1LRNA 3AJXA 3NG3A 3LXAA 4JQ4A 4F0HA 3OLIA 2VZVA 5BMWA 5HWNA 3TTOA 4AISA 1PEZA 4B5TA 3UXLA 3RF9A 3WFLA 3TN6A 2VD8A 4JTAA 1XS2A 5C70A 1XFCA 1RJQA 1Z8AA 5I09A 5A2BA 1XBYA 3B0VC 2DEPA 2WNNA 2R94A 4DJFC 1ZBVA 3SBFA 2QAPA 3QGKC 3TH6A 3VDAA 1VH7A 1GZ1A 4H9TA 2JALA 4HCLA 3UXAA 3WNPA 1W54A 1JGMA 2PDYA 2PDGA 1ZY9A 3BE7A 3SURA 3CLWA 4GY0A 4BK9A 2RDTA 3N15A 2Y63A 3KL0A 4IHCA 3RDKA 2G95A 3K30A 4DLMA 1FCVA 3OB8A 3J7HA 1UWRA 1GQLA 3K4AA 2Z6IA 4N7QA 1ZSXA 3ECQA 3DXIA 1OG0A 2AL2A 1A5NC 2FTYA 2OWXA 4LUSA 5K2ZA 2OOFA 3NYZA 3R8GA 3BQ6A 1OFPA 4O16A 2FHCA 4BA0A 1K70A 4O1FA 4PTWA 1GOMA 2V82A 4O28A 4OQVA 4MIMA 4PUKA 1AQHA 3ES7A 3N6HA 3S5YA 2WPBA 4AXKA 1UKSA 5EU9A 5GQBA 1QWKA 4HMNA 2NX9A 4AC1X 1JCTA 3ARYA 4IP5A 1L2UA 1UASA 1VIWA 3HQNA 1AW1A 4XV0A 4K8EA 4DWDA 4GO9A 5F2LA 5I07A 4BEUA 2YZ5A 5FIPA 3BZJA 3P5YA 2PD5A 3TP4A 2DVXA 1J0HA 1M04A 1QK2A 3FHQA 4O1AA 3O3RA 4OECA 2OYKA 3M16A 3FSTA 2E3ZA 3GZAA 3WLNA 1VBJA 4RXGA 4C91A 2YXOA 4WCJA 1F8IA 2CLLA 1EP3A 1D3HA 4KKXA 2XSBA 1GTHA 5D2YA 4H9XA 5F4SA 2GWNA 1HJWA 2GVLA 5AC8A 4RKAA 4NZJA 5LXXA 2DH3A 1MW2A 3B4YA 3MMUA 3KL3A 1P1MA 5HNTA 3BLDA 1P4CA 3KM8A 4TR9A 2G50A 4D2JA 1Q65A 4CD8A 1R47A 1ZS2A 2QGYA 1L8NA 3NL6A 1JPKA 3KEHA 2CBVA 1R3WA 3BW2A 4LH8A 4C5YA 4PC8A 3D6NA 1FX6A 3O2LA 2OTDA 3ZJ7A 1DJNA 4HTYA 3CLMA 3FFSA 3S9ZA 4INFA 3WX7A 1PUDA 2HK0A 4ATDA 3LTSA 1OSEA 3MCNA 4PA8A 1JAKA 5ENLA 1V0MA 3TLLA 3AWOA 5A6TC 2PGFA 2YXXA 3WJWA 4LS1A 1VQTA 5DELA 3OG3A 2F6XA 3YPIA 1SZEA 2QYGA 5BOFA 1LP6A 5ABFA 3I3BA 4GBUA 4L5ZA 4S23A 1LLWA 3GU1A 1NWUA 1Q63A 1FRBA 1G7VA 1YTDA 3WJSA 5HQMA 1EGVA 3IJIA 4CQAA 3QOMA 4L4PA 4ML9A 4ZQOA 2NXHA 3TCEA 3S5OA 4TV5A 1H0IA 5DRCA 5E6ZA 3HBLA 4KEZA 4NRRA 3BLFA 4YHEA 1MMFA 4V2XA 1WQ5A 1LROA 4K38A 4GY7A 2D0FA 4HJWA 1S39A 1X8FA 2KZHA 1HGYA 1PYFA 1PTDA 1GVRA 5D9PA 3MDUA 4PODA 3O0FA 3MBDA 1FXPA 3SY5A 3UG8A 5CGQA 4GVGA 3R5EA 1EOKA 3IJ9A 4RNHA 4IFKB 4CU7A 1Z41A 3E3HA 5H1WA 1TUFA 5PTDA 1B90A 4DBDA 2VGGA 1WDSA 3P0WA 4RE0A 3MKVA 4H83A 4Q4KA 4HGXA 4GIRA 3L4YA 1DJZA 5AVNA 2J9XA 3H53A 5IM51 2VFHA 3VIGA 4NXKA 4O8AA 4LY4A 3AMCA 3ZWSA 4B5VA 1S1PA 1U30A 3ZYZA 3R7MA 2GJLA 3GFZA 1V77A 3M6DA 5J5DA 2ZYFA 4RE3A 3GFYA 3V7PA 3FOKA 2QQ6A 1QNQA 2WCGA 3MI6A 2XJ7A 3MP5A 5GNYA 1F73A 2WNQA 4Z2LA 3ENLA 3O16A 2FTPA 2PWGA 4F9DA 3TSDA 3WDQA 5BMXA 1A5UA 4LCRA 4NZ1A 1EYEA 1GTEA 3ZO9A 3O6AA 3UYIA 3IVSA 4Q6JA 1O68A 2ZUSA 5EFFA 3GIQA 1PHQA 1UOZA 2YBTA 2YPIA 2PAJA 5A5WA 1WUEA 3T2QA 3N13A 4FLSA 4R27A 1UMLA 3RGTA 2PUZA 3GFXA 3KL5A 2AMXA 4CD6A 5CPOA 3POHA 2O7SA 4UQCA 4QE5A 4JTHA 4DYJA 4IJRA 7PTDA 3W25A 3QY7A 2Z28A 3GO2A 2HE8A 4XD4A 3MKKA 3T55A 1XIJA 4ZSTA 2GJXB 4MOZA 3A4AA 2CWXA 5EMUA 2ASHA 2XVNA 1TWIA 1CXHA 1JZ5A 1VEOA 1B1YA 4AHPA 4XX6A 1QI4A 5CJNA 1LQAA 3WO8A 4HPHA 1W1YA 2GVEA 5CSUA 1TB3A 1TV8A 2SFPA 3EYPA 2OKOA 3ABRA 3UPBA 3PZIA 5FESA 4P8XA 3SCWA 1T99A 1JDEA 1H51A 3MYOA 4X9YA 5IHSA 3BSMA 3A4JA 2IXVA 2HTMA 2Z1KA 1CECA 4YTRA 2IPJA 4KCVA 4KCUA 4NYYA 2XIMA 3CUGA 1QW7A 3OA3A 2VZTA 3U0HA 3ABQA 1TREA 2ZICA 4NU7A 4AQLA 3UWVA 1ESWA 3G24A 1ONXA 1T7LA 5C9ZA 2OEKA 4G9PA 1A50A 5M1TA 1E56A 4NQ1A 4XZHA 4FA3A 4O50A 1OCQA 4HB7A 1KCXA 1YPFA 1XLCA 5F1UA 2V2HA 4WIWA 4IGSA 4HSNA 4L9XA 3E6EA 1LBLA 3THUA 3I4KA 2E4TA 1BQGA 4A35A 2VQUA 2VT0A 4AEFA 3P3BA 3SRKA 2WMIB 3ITYA 5C7VA 3GUGA 1SO3A 3CZJA 3JS3A 4PRWA 3KBVA 3S5ZA 3L21A 4NJJA 4W7UA 1H60A 3PM6A 4YTQA 2GUUA 1W9BM 2A3LA 1IZJA 3S6DA 4XIMA 5DANA 1HQTA 1G4TA 3NO3A 1NH6A 4JTSA 3MZ2A 1ITCA 1AA1B 3KOYA 4YTSA 1U5JA 2I5GA 2YL8A 4HYRA 1OFEA 3EX6A 4GHRA 4W9TA 1ZUAX 2HV5A 3LHVA 3RJYA 4OGZA 1E1CA 1J0KA 3C3NA 3W7IA 4B3ZA 4QAWA 3QJAA 1OZQA 4B5NA 1XV8A 1GYNA 4GUHA 2DZSA 2Z1VA 4Q4MA 3FKRA 2FHFA 2NX1A 4K1WA 3VAVA 5D2XA 5I79A 2XZ7A 4JTQA 2NSOA 3T42A 3K1GA 1H7PA 3OZMA 3U2OA 4D6HA 4M80A 3HO8A 5LIYX 1ECQA 4UB9A 3AAMA 3GUWA 3GW3A 2F7FA 2OB3A 2HSAA 2PDQA 1EHNA 3W23A 1JXKA 2EJAA 1ODUA 1XCFA 3L23A 2FGZA 1V3MA 1RP8A 4IIGA 3F2BA 1UKTA 3SADA 1B3XA 2NUWA 4Y6GA 5A95A 3APTA 4XD3A 3G0XA 3W38A 2GLKA 3TQVA 4JQ1A 3NWRA 4PYSA 3M44A 4G5DA 4JICA 2J25A 2JGQA 4JHMA 1US3A 3PB0A 4Y9MA 4Z0SA 4MVAA 3EDEA 2Q01A 3DG7A 3PK7A 3DHPA 3HMJG 4GC4A 3NPVA 4PMOA 5A2AA 4AWTA 3HTWA 1IR1A 4GMEA 3S5NA 4O1BA 4M6UA 1ZBCA 4QE4A 1PO9A 3P0XA 4MY1A 4R9XA 4DJDA 2C13A 2GGIA 4K39A 4GH3A 4Q4QA 4BQ3A 4NNAA 1PTGA 2Y8UA 1AD4A 3TQKA 2VC6A 3DI0A 2J7CA 3QMRA 4KBXA 2QAFA 1KGUA 4JAWA 4UMCA 3NQGA 1W91A 4H04A 1EJVC 2Z2UA 3WJYA 3FEMA 4R5EA 4JS3A 3P5ZA 3BGGA 2ZDRA 4PB4A 1EF3A 1ZENA 4MNLA 4ES4A 4GYFA 1Q5MA 3OLDA 3OOQA 3WD4A 1SW0A 4O1CA 4JY9A 2FZNA 5DMNA 3LV5A 2A7PA 1KM5A 4BKNA 3GY1A 2CKRA 2Y8KA 2DIEA 2AKMA 3WQCA 4W8LA 4GZIA 5T8GA 4MJ2A 4HNLA 2FJKA 3WEZA 1K6WA 4KCWA 1OB0A 2QJNA 3B97A 4I9MA 2ATSA 3W37A 4ZR8A 4JIPA 3APYA 3CHEA 4HQVA 4M3PA 1MYRA 4G56A 1H7WA 1X8CA 4KS0A 3A3HA 4AIBA 4BFAA 4M6QA 1XUUA 5FJPA 4RNJA 4HSOA 3CUJA 1C91A 4B2DD 2I9EA 2PLKA 3V5FA 3L4UA 1A80A 3CQKA 3RLUA 1BEUA 3PPHA 3MBFA 4AMAA 1GVQA 2XVLA 2ZTKA 2YR1A 2NQHA 3VM5A 4L1XA 4ECLA 1NOWA 4IUGA 1FDZA 1UBSA 5LNRA 3LMZA 1A0DA 3TR2A 3OGVA 3KZSA 2VC5A 4DUOA 3UESA 1BGGA 4B3KA 2ZUTA 5ECUA 1E4LA 4GQGA 2Z1BA 1H49A 2EG8A 5K9XA 3D3AA 3OYXA 2A7RA 1L6FA 3HGOA 3G2GA 2FFCA 3MMTA 3EKLA 2UBPC 4Q22A 3TYZA 2ZUUA 3M1ZA 3CWOX 2GVJA 1ML1A 3DC0A 5HNRA 3OW1A 2XIJA 1CXFA 1RXOB 3RX2A 4NI3A 2ZA3A 3TYBA 1PHWA 2XSAA 4NAFA 4Q4OA 1ZJIA 3NZGA 4UCFA 4K36A 2HS6A 3G0SA 3BG5A 1UIPA 4B9YA 6XIMA 3CM4A 3IAPA 1V4YA 1EPVA 1EJUC 3HGSA 3SGUA 4H3DA 4A8IA 2XUCA 3VIKA 3WLSA 1IE7C 1OCNA 4I7VA 1XQLA 1XRSA 2E28A 2DZBA 2ZFAA 1ZFJA 3B3DA 3QQ0A 1AUSL 4P5UA 1F5ZA 2VRJA 3RPMA 1KO0A 3AXHA 4R7OA 1SMAA 3NTYA 4URIA 4KWSA 2QJIA 5J04A 5CC5A 3KAOA 3GDRA 2E1DA 4JD4A 5BWAA 5FJTA 1XSJA 4KERA 4D6CA 1QHPA 4F79A 4C5ZA 1OF8A 6TAAA 5AN7A 5I02A 4H9VA 2JKEA 3QBUA 1MZRA 4TOQA 4PMZA 3IIPA 1VGAA 3KBMA 3CYVA 5IHRA 3AIQA 4R88A 4X2PA 2OX4A 2YBUA 7REQB 4C6FA 2ZZ4A 4DWSD 3C0QA 4AZIA 1UR2A 1XLGA 2WXDM 1XCWA 1KKRA 1XBZA 4IMCA 1L6SA 4F0KA 2WZIA 3GQYA 1BF2A 3MVTA 3MO4A 1U33A 1Q6QA 1OBAA 4R9OA 1TQXA 2OMAA 1AZ1A 4I3GA 1Q6DA 1BLIA 3UCDA 1EWDA 1HL8A 3I6TA 2PWFA 5CPTA 5TBOA 5E93A 2DW7A 3TQPA 1ONWA 1QAPA 4EX4A 4YHGA 5BYWA 4Z17A 2EQDA 1E4NA 4P8WA 3L4VA 1WB0A 2I1OA 4TV6A 2CBJA 2ADAA 3KVJA 3T78A 3GD6A 3PS7A 5EPDA 1JJKA 4LV4A 2D69A 1MXGA 4X60A 2G3IA 3W26A 4GRSA 4FS9A 4M56A 4Q8NA 3GC5A 2XH0A 2NWRA 1JAEA 2WSKA 4EKJA 1R5YA 3C6CA 4AVNA 1XI3A 3T4CA 1IEVA 3FX4A 1LQ2A 4YMZA 1R0MA 4GVFA 2G3JA 3M46A 1NM9A 3O07A 5M3WA 4P8UA 3AQUA 2B81A 1E9ZB 3QRHA 4DN1A 1JEZA 1YX1A 3QLLA 3C2YA 3OLGA 3AS1A 2XGIA 1XCXA 3GVGA 4PRTA 3ES8A 4DX3A 3OYZA 4AHQA 4N0RA 3C52A 4M5PA 1TPVA 1BRLA 2DORA 3P62A 2CLEA 2PA6A 1JPIA 5HMFA 1A5CA 4CCZA 2AAMA 1CGUA 2XSXA 4JTDA 2EKCA 3TROA 4RNIA 2BXVA 3E1F1 4J1OA 1KLZA 4I6VA 4Q7BA 2GJPA 4MFDA 1KCKA 1KBLA 1E6XM 4UFJA 4LW7A 3UVIA 3EOSA 4JXCA 4W88A 5A6SA 2XPKA 3LXBA 3NURA 4LRTA 4UFLA 3E0WA 2B4GA 3W22A 4AFYA 1CTNA 4L80A 2AQVA 4J4KA 1D8WA 4AWSA 2A3BA 4EACA 3O15A 3QV8A 2Y7FA 3W75A 4C7DA 2E0PA 3CWNA 2WSRA 4B92A 1RJRA 4GUGA 1IT8A 5HNNA 3O05A 1E0UA 3COTA 1BAGA 5D2WA 1E9LA 4UQDA 1R8LA 1QTWA 3DUGA 4JHZA 3FYOA 3RU6A 2HDJA 2XG9A 2DGAA 1CEOA 3M0VA 1Y65A 3CZ8A 4GUJA 1AG1O 2DSVA 4JL2A 2HWGA 1O1HA 1EIXA 2Q71A 2JKPA 3UR5A 1TZ9A 4OOUA 4AEEA 1ONEA 4CN4A 1HP4A 3VIJA 5CZ0A 4NNCA 1E0XA 2Y61A 3A9BA 4FF5A 5CPMA 1IXNA 4I9JA 4FXRA 2ZZ2A 1O66A 1LRQA 5H8UA 4LYQA 4DWSB 4IMAA 3W1RA 1X39A 2ZADA 2OQHA 1X38A 3KCOA 4FNRA 5C0QA 3N73A 3B8IA 3LPFA 4YJ5A 2PFHA 1PWLA 2CHOA 4UR7A 1OFBA 4H6KA 1J10A 2RDXA 2INEA 2PP0A 1E6QM 4IQLA 1XIHA 2WZMA 2NV2A 4DBWA 4F2UA 5I3HA 3RMJA 3A9IA 2HXUA 1PTAA 4E2OA 2QPSA 3NNTA 4MKVA 1E3ZA 4M19A 1K9EA 3LLDA 3VOIA 4DYEA 4OJYA 3TYUA 2ODOA 3A21A 1WAUA 1IGSA 2VCAA 4X0NA 1FP9A 4XKMA 4FNSA 4PBFA 2NT0A 4ZO7A 1TTJA 1P5BA 3OVQA 3KBNA 1R2SA 4JTKA 3WMCA 1RA5A 5F4XA 4Q8QA 3CZKA 4LRSA 1SJDA 4S3CA 1XGEA 5GPRA 3WDPP 1PX3A 3A22A 1EB3A 2FVLA 3RCMA 2NW0A 3AS3A 4FXFA 3LRMA 1C92A 1E71M 3BJSA 1W8GA 2WHLA 1IT7A 4HYVA 3OJGA 1H1NA 3CS2A 4FALA 1W8SA 3LN3A 1ITUA 1SR9A 2UY2A 3CASA 4LC8A 2IPFA 4UR8A 1S46A 3TZFA 4HOXA 3N6QA 2BVYA 3GHUA 3KZPA 4GCAA 2ZTJA 4ALDA 4ADUA 5D02A 1SVDA 4PB5A 3QR3A 3DKLA 4U2YA 1U1HA 3TONA 1W9DM 2TSYA 5EL1A 2W66A 2J6XA 2EO7A 4JX4A 3K4DA 5G4HC 2ZE0A 3M0IA 3QHNA 1N7KA 2E67A 3H7RA 2GK1B 1W1TA 1B0IA 4LU0A 1PL9A 4ZA0A 1UWSA 1U5HA 3LXCA 1WDDA 4OBRA 1WYIA 3UWYA 4KGJA 2RJGA 2Y2WA 1P0EA 3GTXA 1AQFA 3ANVA 4A3RA 2OVLA 1S2UA 1XLIA 4US5A 1A3WA 1RY0A 3SN4A 4JKKA 2X0YA 1A53A 4IWWA 1B3VA 3OLEA 3IJ7A 1TZ7A 2YLAA 5BXSA 1WP6A 4H7CA 5FI8A 4IISA 4Q8WA 3WSUA 3CXOA 2QDHA 1IV8A 2BODX 4AF0A 2OODA 3HZ3A 3OG2A 3DFSA 3W29A 1P1XA 1OFRA 3N2OA 3E9AA 3S1WA 3G8EA 3VU2A 3BAKA 4BS0A 3EPOA 4U4MA 1OYAA 1R9ZA 1UZ1A 4LEFA 1WNOA 4KESA 1LWHA 2J4GA 2IKIA 3WQPA 1UP2A 4LUTA 3PBYA 3W4RA 4CLMA 2DV0A 2DVTA 1B4KA 4PMJA 2CZVA 3VM7A 4N9CA 3TSMA 1MUCA 3GBDA 3ITCA 4G1KA 4V15A 1JZ2A 2AL1A 3GAKA 1BSIA 3WEOA 2G3NA 1X6NA 2W3ZA 1V6WA 4HNCA 1YADA 2HVOA 2CLPA 3L2IA 3GVWA 2GQ9A 3R13A 4GKLA 4S38A 3STPA 3UYCA 1E15A 1VFHA 5F1VA 1Q7QA 3GDTA 2F2KA 5D09A 2V5KA 5A8QA 2I17A 5MKGA 5A1AA 1OHLA 2JK2A 4O8RA 3ABSA 4H9ZA 5CBJA 2CHRA 1HGWA 3HFTA 4Y8EA 3M5VA 4F8XA 3SGGA 1OFDA 2HNEA 1KV8A 3AMGA 4NHVA 1ELSA 1FWDC 4A3UA 2YSWA 5FF2A 3LLFA 3C86A 3TE9A 2J6VA 3GNRA 3T0AA 1NDVA 3N11A 1OQFA 5EY5A 3IVUA 4J3SA 4I5UA 4DUWA 4PUJA 1XBVA 4LB4A 5BCAA 3ITOA 3WQOA 1GOKA 2Z00A 3FK4A 1KB3A 1JIBA 2PU0A 2AL2B 2NUXA 1XYLA 4LUSB 3T0CA 3JZEA 5G5IA 2GL5A 1XC6A 2NQZA 3TC3A 1FP8A 4GQ0A 4WGXA 3U2EA 3R11A 5I2UA 8TIMA 1MO0A 1WDQA 1ISWA 2E40A 1GOQA 2FMOA 1HTIA 1WOAA 3BURA 3FA3A 1CDGA 1K7XA 3QHOA 3N4FA 4NZ3A 2ZX7A 1J01A 4AH7A 2VM8A 3G1SA 5FEPA 4CVWA 2VGIA 4RDWA 4A6GA 1Q6OA 4NSBA 4DNMA 4QM1A 1UKOA 3V5OA 1F61A 2EEXA 1ZGDA 1IXOA 3RRAA 2BHYA 3A24A 3GXNA 3W2NA 2E6AA 3PJTA 2UY4A 4XSMA 3VFLA 5D4YA 1A5MC 1KA9F 1SSDA 1XPYA 3CQ0A 4JBRA 1EBGA 1W32A 3CZEA 5CH9A 4V33A 2YJQA 1VYSX 3GG8A 2E25A 3N12A 3N2XA 3T40A 5FA5A 4IM4A 3DG6A 4H8VA 2J88A 4OVXA 2J75A 4M8UA 3VK5A 2D1ZA 3B05A 1L2QA 4TMBA 1HUVA 4KWWA 1BKHA 5LHFA 3DH7A 4AZCA 2RJHA 3BSHA 3VI2A 3UBPC 3W0KA 1TCMA 3LCHA 3KLLA 3KXQA 4B16A 3VO0A 1XLFA 4G6CA 4LYRA 3T9PA 3T05A