3CUIA

Cellulomonas fimi xylanase/cellulase cex (cf xyn10a) in complex with sulfur substituted beta-1,4 xylotetraose
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
314
structure length
314
Chain Sequence
ATTLKEAADGAGRDFGFALDPNRLSEAQYKAIADSEFNLVVAENAMKWDATEPSQNSFSFGAGDRVASYAADTGKELYGHTLVWHSQLPDWAKNLNGSAFESAMVNHVTKVADHFEGKVASWDVVNEAFADGGGRRQDSAFQQKLGNGYIETAFRAARAADPTAKLCINDYNVEGINAKSNSLYDLVKDFKARGVPLDCVGFQSHLIVGQVPGDFRQNLQRFADLGVDVRITELDIRMRTPSDATKLATQAADYKKVVQACMQVTRCQGVTVWGITDKYSWVPDVFPGEGAALVWDASYAKKPAYAAVMEAFGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the binding sites of Family 10 and 11 Xylanases with extended Oligosaccharides
rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
molecule keywords Exo-beta-1,4-glucanase
total genus 133
structure length 314
sequence length 314
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2008-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3cuiA00
1QW8A 2W62A 3FW6A 3AISA 3K4DA 1H0IA 2W61A 2XIBA 2WCAA 5I6SA 2QLYA 2YL9A 3T2PA 3MSGA 1GQJA 1UD4A 3UG5A 9CGTA 1UD8A 5IDIA 1JZ7A 3M6DA 4JL2A 1KWKA 1CWYA 1YQ2A 1J12A 3CMGA 2V3EA 3WF2A 1ISXA 1XH2A 3S6TA 1E72M 2J7FA 4PMUA 4AZCA 1UKSA 4GZIA 1V0LA 1CGYA 1E5JA 1UA3A 1L0PA 3CHEA 2WC7A 1G01A 1WDQA 3NJ3A 1S46A 4W8AA 5A6JA 5I23A 2YLLA 4OBSA 3SCSA 4OOUA 4AMCA 1LG2A 5DEZA 2XSBA 2X2YA 3CUIA 1C90A 1H49A 1I1WA 2VRJA 3W6MA 4LQ1A 1GOWA 5BXRA 1GW1A 3DHUA 1OD0A 1E56A 2VJXA 3WH9A 1V3KA 3PZQA 3T0AA 3OLGA 1E70M 4J3XA 4CD5A 1G1YA 3N15A 2WXDM 1JDDA 1MVYA 2YDQA 3VILA 2VZUA 4UQDA 4X9YA 5A6AA 1GOQA 4XV0A 1XD1A 1V6UA 2F61A 3WDRA 4GXPA 4PMRA 4B3KA 2WNWA 2D0HA 3DYPA 3PZVA 1KQZA 5A6KA 2PB1A 3W24A 1BG4A 3IJ7A 3VIPA 1B31A 3WSUA 8A3HA 2ZUWA 2Y5EA 2Y2WA 2E8YA 1LLOA 3PZIA 3QR3A 3VM5A 2ZOXA 4UOZA 1V3MA 4ZXLA 3ARZA 1C3FA 1CIUA 3A6OA 1MQPA 3EMCA 3OB8A 2OWXA 3CHDA 4LYQA 1M03A 1SFSA 3HJEA 3A4AA 4MB3A 1UZ4A 1R7OA 3AFBA 2BY0A 2XSAA 2PF0A 3CUHA 1PAMA 2V5CA 1HN1A 4D71A 3VD5A 3GNOA 2J47A 2D1ZA 2WMHA 3KWXA 1QNOA 3ARQA 1BVZA 7CGTA 1QNSA 4CD6A 2QMJA 1FH8A 1V6YA 3GH5A 2F2HA 5A6BD 4UZUA 4DUWA 2BY3A 1WZMA 2YDSA 2EQDA 1UUQA 1ZJAA 4BQ2A 3AICA 5CG0A 5JBDA 1DWAM 2HVMA 4CU6A 1GQKA 4PMYA 1H3GA 3PZTA 4PEEA 3RJXA 4EAMA 4NI3A 2VZTA 2CHOA 5A1AA 1W3JA 3UERA 2WSKA 3T2QA 2UY3A 3BGAA 3VGEA 2IXVA 4X0VA 1UH4A 1J11A 2GJRA 3AIQA 3AIRA 4Q7NA 3WF1A 3AZRA 3GDBA 2AOSA 3GBDA 3BCFA 4R5EA 5BXTA 3VDAA 3OA5A 3CUJA 1OGSA 4JKKA 3CO4A 3EMQA 1KGWA 2Y24A 1JZ5A 3EYPA 3GXDA 1HX0A 1TR1A 5KZ6A 2WKLA 4CCCA 1BF2A 4AXNA 4ZENA 4XB3A 1WDSA 4XZWA 1VFUA 3SCPA 1KXVA 2DPEA 2DSZA 4H8UA 4YN5A 3RM9A 1U33A 4MNLA 4C7DA 1V3IA 3CZEA 4CCDA 2WC4A 3CUGA 1FOBA 1GJWA 4HPGA 1N82A 3DC0A 4E2OA 2V5DA 1UKTA 1BLIA 1IV8A 3MS8A 2BHYA 4D1JA 2WCGA 1R87A 1QNRA 2G3MA 1TCMA 5EFDA 1GPFA 4R27A 3U5UA 2XGBA 1A47A 3WENA 4MAVA 3MANA 4H41A 1TFVA 2VQUA 2PBOA 3SCUA 3ARWA 2XPKA 2VCAA 3U57A 2X09A 3WNPA 4MNJA 3K8LA 4UFIA 1KXQA 1M7XA 1PPIA 2XTKA 1K9DA 1ITXA 1CGWA 4NZCA 4PMXA 5A8QA 4KH2A 1EH9A 3GNRA 4P8XA 4JIEA 2CBJA 3GXIA 2GJXB 1FHDA 4URIA 3VD9A 1RH9A 3T09A 4PUEA 2CHNA 4DWSC 1VF8A 5IXEA 2E0PA 3ZR5A 2CBIA 5CSUA 3WL1A 1NOFA 3WD0A 3RPMA 1PZ2A 4CUCA 4AZIA 5LA1A 1PBGA 1WP6A 3N12A 3OLIA 3TTYA 3WNNA 1E73M 3WF3A 3WH5A 1BYAA 1UD2A 1HVQA 3BAIA 1HF6A 1JZ6A 1M01A 1QI4A 4CU8A 1EA9C 3AOFA 3AMKA 3EDDA 1H4PA 2J25A 1WAWA 2WMGA 4RL3A 3WD3A 4WKAA 3GH4A 3A47A 2VX6A 2ZX6A 4NSBA 5KEZA 2BV9A 4LXFA 4EE9A 2OSWA 4W7VA 1K9FA 4D6HA 2TAAA 2CPUA 1MXDA 2J8GA 3IAPA 1UWQA 3LPPA 5FL1A 2GUYA 5HOSA 3TTQA 1CPUA 2OYKA 4GO8A 2YBTA 2ZE0A 1E71M 5EB8A 1MFVA 1XHGA 4H2CA 3VPLA 3UR7A 2J75A 3MMWA 1EDQA 2BVTA 1SYTA 4HA3A 4DWSB 1WE5A 3PZNA 4RE3A 3ARVA 2QV4A 5A8NA 2O9RA 3K4AA 1VEMA 3EBVA 4AZCB 4P7QA 3BAYA 3EDFA 5A6MA 1JI2A 4W87A 2J7DA 2JE8A 3K1DA 3TONA 1C91A 3L4TA 1JDAA 3VX1A 2OLHA 4V2XA 4NF7A 4TUFA 4AIEA 5D9PA 3UG4A 4LYPA 5DF0A 1J0IA 3UESA 1G9HA 4KRUA 4E4PA 4B9ZA 3I3BA 2UY5A 2VX7A 4TX6A 3AROA 4K68A 1Q6CA 3OLDA 3RMEA 4LYRA 1Q6GA 4PMQA 3VD4A 2J77A 3AMLA 3L4VA 4U3AA 4XZBA 1CGTA 3B9EA 3QOKA 3U7BA 1UQYA 1Q4NX 1UH2A 2DQXA 3WDPP 3AS0A 1W1YA 3KL5A 5I0DA 2ZUUA 4BF7A 1Q6FA 2WVVA 1V0NA 2PC8A 3VNZA 2XVLA 4CD8A 4AIOA 1EHNA 4UFLA 2BHUA 4HU0A 1Q6DA 3ZSSA 1MQQA 7TAAA 4X0NA 1E3XA 5CXPA 2X05A 1BG9A 3O2LA 1QPKA 3VDHA 4AD0A 4HA4A 1EO7A 4JFTA 3AZTA 4IISA 3ALGA 5EFFA 4MTVA 1CYGA 1NH6A 4D6CA 4AWEA 1OGBA 4GIAA 1WZLA 3BLKA 1VBRA 3W6LA 2IUZA 4MNKA 3WDQA 1B3ZA 4H8HA 4M29A 1W2PA 1MFUA 3FHQA 3ARUA 2W5FA 2WHKA 2YKKA 1CTNA 4PMNA 3FAXA 2EPKX 2BNJA 3OGRA 1X6LA 1DWJM 4HZ8A 2D24A 1VB9A 4UFJA 1V6WA 1W3HA 2FGZA 1VEOA 4P7RA 1BYCA 5ECUA 1JZ4A 1E55A 1EOKA 3AMCA 4U5IA 1ZBCA 2XYLA 4AW7A 4FMVA 4HMEA 4MPKA 2A3AA 4CD7A 3OLEA 1WKYA 1WPCA 3THDA 4F79A 1TA3A 2WK2A 3VMPA 1OWQA 4D6FA 2VRQA 3UEQA 3LPOA 1BSIA 3RDKA 1NQ6A 3VGFA 1GHSA 1Y7VA 1UR4A 2OSXA 3D3AA 2VMFA 3WY1A 2XHYA 4GQQA 1LQ0A 1JXKA 3AS1A 1IT0A 5HBFA 4LGXA 5C70A 4M56A 1EXPA 4B15A 1TMQA 3AMDA 1XC6A 1KB3A 2WMJA 3GNPA 2ZUMA 3NDZA 4W5ZA 3VNYA 5FCZA 2YJQA 2E8ZA 3BC9A 1WZKA 1HP4A 3NDYA 2WSPA 2QPSA 2J7EA 2WHLA 5CQ1A 1PJ9A 1Q6EA 2OSYA 2WB5A 3GYCA 4A3YA 5CLTA 3CZLA 4U3CA 3ZT5A 5ABFB 5A2CA 1H5VA 5GNYA 2NW0A 2VCBA 1JAEA 5I78A 5ABGA 4ZE4A 3EDKA 1EQCA 3CHCA 1E6NA 2GK1A 3W82A 3E1F1 1KXHA 4EK7A 1CLXA 4PUDA 3KZSA 1JIBA 3KE0A 4XX6A 3W53A 1EDTA 3MV11 4RE2A 2XWDA 3BAXA 3F5LA 1E6SM 1KCKA 5A2BA 5A6BA 1WDRA 3L4UA 3BAWA 1UR2A 2PWFA 2RGMA 1WB0A 2VC9A 4KWUA 2O9PA 4QFUA 2ZUNA 1QHPA 3SCVA 4EKJA 2WWDA 2ZWYA 1XGZA 2Z1SA 1O7AA 3ARTA 3WDHA 1DHKA 3ARRA 1QBBA 1AQMA 1HJWA 2EPMX 2CERA 3PTMA 1PX4A 3TOPA 3AS2A 4AZ7A 1B3XA 1QBAA 4U31A 4JFSA 1ZS2A 2V3GA 3VIOA 3SUUA 2W4XA 5A6SA 3M46A 4OBRA 3WQ5A 1VFMA 2PBGA 4U5KA 4Y7EA 2XVGA 4AZ5A 5D8WA 1GORA 3B9DA 3M07A 4MDPA 1NOWA 1CGXA 3WF4A 1VJSA 1JYXA 5ABHA 2VI0A 4DUXA 4J7RA 1EDGA 1GJUA 3NSXA 4WF7A 2J74A 3AQUA 2DDXA 4QLLA 1QI0A 2VZOA 1CXKA 3THCA 1V3LA 1GUVA 5BXPA 1RP8A 1GVIA 1LG1A 2WBKA 1JFHA 2J4GA 4UQAA 4UR9A 1UOKA 1PZ3A 4M1RA 2CYGA 3BSGA 5ABEA 5FL0A 1XRVA 5C71A 1R85A 4W93A 3CZGA 3POCA 4AEEA 2DSKA 3N18A 3WD2A 4MB4A 5IHRA 2D2OA 4L4OA 2AMGA 5M5DA 3WFLA 3VDBA 2WPGA 1XD0A 4W7WA 3VX0A 5LA2A 1OGGA 2XVPA 1B3WA 2JEQA 1HIZA 1OINA 4TVUA 2DH3A 1W1TA 2E9MA 2ZUTA 1JNDA 2WWCA 2G3NA 2DT0A 4TOQA 1KCLA 1PIFA 2G8ZA 2J7BA 4DM1A 5A8OA 5A95A 3DYMA 3T0DA 5FIPA 4F9JA 4M24A 4U2YA 3RIKA 4TVDA 1KR0A 4AD3A 4GKLA 4W86A 3MKKA 1JL8A 1HJUA 4UOJA 4YHEA 1NARA 4PSRA 2J79A 3DYOA 3N17A 3WH6A 1XCWA 2VOTA 3OIHA 2FH6A 4CN6A 4DUVA 2EBNA 1VENA 3WH7A 3GXMA 3AIBA 3WKZA 1PIGA 1CECA 1PX3A 5GPRA 1JYNA 2V3FA 3SUTA 1XYFA 1C7SA 4XUYA 2C7FA 3TA9A 1IZJA 2YIHA 3WUFA 1W2VA 3BLPX 5AC4A 3AIWA 3AYSA 1L8NA 1TZ7A 1EQPA 4AD5A 1OSEA 3MUY1 1O6IA 4QCEA 4MB5A 3SCTA 2NSXA 1D7FA 1UD3A 3I3EA 4WKFA 2WLZA 2XGIA 5DO8A 1E6XM 2C8NA 5A69A 4PTMA 1W1VA 4JFWA 1Z32X 2UWFA 2E9BA 5CGMA 3BH4A 4F9DA 1BPLB 3MUIA 1JYVA 1XSIA 4JZ5A 4BQ3A 1JGIA 1NWSA 4MJ4A 4PYSA 4ZE5A 1GCYA 1CDGA 5E6YA 4WSJA 1D3CA 3FY1A 2G3JA 1W9PA 1QNQA 5I5RA 2X0YA 5DMYA 5A3HA 3BXWA 4N0RA 3IANA 1WZAA 1E15A 2BHZA 2VURA 3PBGA 4WK9A 2QF8A 4RE4A 1OT2A 3KEHA 3VIJA 5A2AA 5BXSA 4J3TA 3VGBA 2VZSA 2VVNA 3VOCA 2VO5A 4JHOA 2X8RA 3EDEA 1C8YA 2FDMA 1NM9A 2PI6A 4QP0A 2ZIDA 1XV8A 4OKDA 4WLCA 4W5UA 1UA7A 1B30A 3EMZA 4FLQA 4Z2JA 4Z2IA 4Z2KA 5D8ZA 2VX5A 2WANA 2Y8VA 5GQBA 1E4IA 2DT3A 3O6AA 2CESA 4QDMA 2A3EA 1HVXA 4HP5A 2CNCA 2VX4A 3MMUA 3W81A 3GTNA 4PTWA 4IUGA 3J7HA 1RPKA 2CXGA 1BYBA 1CNVA 1UYQA 2O9OA 4QCFA 3RJYA 2C0HA 3L2MA 2XM1A 3AHXA 1EGZA 1OBAA 2UY2A 4AZBA 3L4YA 1CBGA 2VZVA 3ZIZA 3DECA 2VTFA 1J9YA 4WSKA 3VU2A 1GONA 4S3KA 3ZJ7A 1I1XA 4W88A 3SCOA 1JF6A 2B31A 2JEPA 4NRSA 1CGVA 1V02E 4GI8A 2WZIA 4JHZA 2EO7A 4PMDA 2VUYA 2AAAA 3PZGA 1C8QA 4W89A 1US2A 3ZT7A 1BTCA 2WVTA 4D6EA 4LX4A 3W26A 4YHGA 3VM7A 2D0FA 2XFFA 1BQCA 4GZEA 3O9NA 4UNIA 4ACZB 3BMWA 1KR1A 2G4FA 1MW0A 3WMSA 1LWHA 2CBUA 4J3SA 4WJXA 4UZSA 2OWCA 1A3HA 4AZ6A 5D9OA 3HN3A 5I2UA 1UWSA 5EMYA 2EPOA 1H09A 1VEPA 4HMCA 2CIPA 4QLKA 4J3VA 1LL6A 1DP0A 1UWRA 5IFTA 1X1NA 3WQ4A 1V0KA 4Q22A 1H41A 3CLWA 1GQIA 5DT7A 1EHAA 3VIHA 1GNXA 3RM8A 1E1EA 1HNYA 3SCQA 2CCRA 1XSJA 4GI6A 2GK1B 2ZX8A 2WVUA 3NYDA 2XUCA 1UH3A 3SEPA 3ZQ9A 3UR8A 1UR8A 4ATDA 1VFOA 2HISA 2YL5A 1ZJBA 2IXUA 2E40A 1H0GA 5JIPA 3BSHA 3ARPA 4H04A 4JCLA 4CN1A 3I3DA 1FA2A 3NSNA 4KGLA 3SCRA 2WMKA 2JF7A 2YOCA 4TTUA 1DEDA 3GH7A 1W3KA 4NRRA 3T0BA 2ZXDA 4FLSA 1JZ8A 2CITA 4JL1A 1GZJA 4PCTA 2EJ1A 4PSPA 1B3YA 1K9EA 1E9LA 1NWUA 5E6ZA 3CPUA 2GSJA 5EBAA 3WNMA 3OGVA 1VBUA 1HKJA 1IZKA 3TTSA 3ZM8A 4JFUA 1M04A 3GXFA 4CKQA 1E0VA 1WCGA 4CD4A 3OZPA 4D6GA 2RGLA 1JYWA 4OOZA 4MJ2A 3WQVA 3U7VA 4M82A 3PZOA 4UCFA 1ZB5A 1DWIM 1UR1A 1MW2A 1R86A 1OIFA 2WMIB 4W7UA 3FAWA 5HNNA 4JKLA 4D6DA 4UFKA 3WBAA 3GBEA 3RO8A 4V27A 4DWSA 2DGAA 1WNOA 3PZMA 3VTRA 1KFWA 2FHBA 1BGGA 1F4HA 1E6ZA 3AHTA 1BVNP 1XYZA 4PTVA 2D3LA 2D23A 2OYLA 4JCMA 4P8UA 1FFQA 1ZBVA 3SUSA 4MDOA 1FFRA 3AJ7A 1LWJA 3N1AA 4J3WA 4KRTA 3WBEA 3IAQA 3WFZA 3ZT6A 1KWGA 1ECEA 3WUEA 3VIGA 3JUGA 1H2JA 2JFEX 1HKKA 1JAKA 5E0FA 1NP0A 5CGTA 3CTTA 3CHFA 3WDIA 3AXXA 2DIJA 3LMYA 3W29A 2OYMA 2XWEA 2W67A 2W91A 5CZKA 3VMOA 2DSWA 1E43A 3WDJA 3OGSA 2PWGA 1VIWA 1JI1A 4U2ZA 2WAGA 1M53A 4ATLA 1OCQA 3KL3A 1E40A 1VFFA 3BCDA 4HZ7A 2ZX9A 1SMDA 3VMNA 4BS0A 3AXIA 1J0KA 1W9BM 1QI2A 4HA1A 2MANA 1B90A 2VRKA 3A4WA 3ZSTA 4KMQA 4OUEA 5CJ5A 2WW5A 4P7NA 1V08A 4PTXA 4PMZA 4AY1A 4JFVA 4A4AA 1OIMA 1WO2A 5CLWA 5FOOA 2WCSA 4OJYA 5JBFA 4ACYA 3HU7A 3WQ8A 3MSDA 3VGDA 1CXLA 1EIBA 4A3HA 4MADA 4C7FA 5BWFA 3BMVA 2WKGA 1XH0A 2E9LA 1MQRA 4UQEA 4LPCA 5E0CA 2J78A 5CPQA 3SCNA 1B9ZA 1HL8A 3WL0A 1JZ3A 1ZU8A 3LPGA 3VUPA 3N04A 3LPFA 3VO0A 1XSKA 1R8LA 4UTFA 1KBKA 4PRWA 4D72A 1FP9A 2XG9A 2YBUA 2W63A 3WUGA 1V02A 4HPHA 1W32A 2VQTA 5HDRA 1ZBWA 2WYSA 2ZICA 4BZYA 3L4XA 1JNEA 2BFGA 1UG6A 3VIKA 4Z2GA 4M8UA 4PN2A 3S2CA 2DIEA 1V3JA 8CGTA 1FP8A 3D5HA 2YL6A 2XVKA 3CIVA 4JAWA 5E09A 4E8DA 1OM0A 2BY1A 1QI5A 2G41A 4EANA 1E6RA 4FLOA 3WH8A 2QMKA 3WEOA 1GHRA 1LF1A 2D20A 2BXYA 3L4WA 2WVVB 3ZJ8A 1ITCA 2WHJA 2VCCA 1E3ZA 1BYDA 1CXHA 1LL4A 4CVWA 1E0XA 2Y4SA 5CSYA 1BAGA 1CZ1A 3NIYA 5C8BB 1E1FA 2JIEA 1B1YA 1VJZA 2GJXA 3EDJA 3WUBA 2D3NA 1H1NA 3NSMA 1HL9A 3IJ9A 4KGJA 3ZJKA 3PZUA 3RILA 3KL0A 1U2YA 3PZ9A 3AYRA 1HKMA 2XVNA 6A3HA 3SUWA 3BAJA 1OB0A 1NOUA 2NT1A 4P8WA 2ZWZA 3WQWA 4CCEA 3OZOA 4GO9A 1ODZA 5I24A 4Z2LA 1CLVA 3CUFA 5AYBA 3PTQA 4AIUA 3WELA 4OIFA 5FKYA 3N13A 3II1A 3WQ6A 4CVUA 5AC5A 1G0CA 4AD2A 2GFTA 1BFNA 3AHVA 2J62A 1RP9A 3W38A 1F4AA 1W9XA 2GVYA 4UQCA 1K9TA 4P7LA 3W0KA 3AMGA 1E5NA 3G6MA 1JG9A 5HPCA 1D2KA 2DT2A 2WMIA 3K46A 4AZHA 5A94A 1JFXA 1HJVA 2JALA 3BAKA 3ARXA 5D4YA 4BQ5A 4PMVA 2V38A 3G6LA 1AVAA 1VRXA 3PTKA 2PWDA 3N11A 1QW9A 4M81A 1QOXA 2VR5A 1AQHA 2WHMA 5E70A 1MW3A 3VGGA 4H7VA 3HMCA 1C92A 2QPUA 4UFHA 3F5JA 1E4MM 2CBVA 2ESCA 1X6NA 2WBGA 2XM2A 3VDCA 5JBEA 1V6XA 3QOMA 1CENA 1TVPA 1RD6A 1V6VA 1JDCA 4DWSD 4D1IA 2YA2A 5DFAA 3SCWA 3AXHA 3APGA 4GI9A 1JF5A 1G94A 3WIJA 4AD1A 5BRPA 1AMYA 1DWHM 5AY7A 2W92A 4HMDA 1V03A 2NT0A 4HOZA 5JUVA 1EO5A 3K8MA 1TE1A 5IFPA 1C8XA 4FF5A 3RCNA 1SMAA 1UR0A 3TTOA 4E8CA 1UKPA 1W9DM 2CKRA 1C93A 4P8VA 3U5YA 2D0GA 4BQ4A 4J27A 4DM2A 2X0HA 4GPNA 4CU7A 3CMJA 3ZJ6A 3QHMA 2XFRA 5I77A 1HT6A 1HKIA 4ZXOA 3MUZ1 3AS3A 3MU7A 3UETA 2DEPA 2X1IA 2UY4A 3MUAA 3W27A 3QHNA 3GM8A 2FHFA 2VNCA 5IHSA 1GOIA 1J18A 4ZFMA 3L2LA 2ZX7A 1TA3B 2YDRA 4B3LA 4HZ6A 1EOMA 3UG3A 5HPOA 2V3DA 4QAWA 5LA0A 1ZL1A 4H8VA 4W8BA 1J0JA 3ZO9A 4AEFA 4BCEA 1E4LA 1U30A 1MXGA 2J7HA 3TP4A 3F5KA 4F8XA 1JXJA 2E3ZA 1MWOA 4CN4A 2O92A 1CXFA 1LL7A 2F8QA 3PN8A 3A3HA 3POHA 3VD3A 3WMCA 2FH8A 1DTUA 2VT0A 3WEMA 4UQBA 1QHOA 2WZHA 1ZBKA 4L4PA 1I75A 3M7SA 2XJ7A 2ZXAA 3WNOA 3AHYA 1JD7A 2DSVA 1GOKA 5BRQA 1CXEA 1FH7A 1J0HA 1LJYA 2ZUVA 5TD4A 3PHAA 1B3VA 1GOOA 1UWTA 3AIUA 4TXEA 5M3WA 4TVCA 3L4ZA 5ABFA 5BYWA 1SR0A 3ALFA 1E4NA 1ISVA 2E4TA 2Q8XA 1MW1A 1VAHA 2PWEA 4MNMA 1W9UA 4HOWA 2WLYA 3UCQA 4V28A 1QVBA 1NWTA 2BVYA 2Z1KA 5FD0A 1HP5A 1GOMA 2D22A 4PBGA 3ZOAA 3OG2A 2DH2A 4UOQA 1NP2A 3T2OA 3CZKA 1J0ZA 2ZX5A 4ACZA 2WVSA 4QLJA 4YPJA 1B0IA 1JZ2A 1UR9A 1BGAA 2A3CA 4MB1A 2BVDA 2GDUA 4HU8A 3K8KA 2XFYA 3SIMA 3VINA 4HOXA 3W28A 3WMBA 1DWGM 6TAAA 5HXMA 2JF6A 1HJQA 3FXYA 4S3JA 1QI3A 3VGHA 3DHPA 2CEQA 1ISZA 3SUVA 5AYIA 3VD7A 4J28A 1UD5A 1AQ0A 4GZJA 1C7TA 2Y8KA 4N42A 3WEZA 1P6WA 3FNDA 1US3A 2EPLX 3W25A 2ZUSA 3MV01 1OD8A 2GJPA 2J8FA 5D9MA 1XH1A 4AISA 2J7CA 1DWFM 3ZR6A 3VIMA 1HJSA 3CBWA 3FN9A 1NWRA 1KQYA 5GNZA 3NCOA 2G3IA 3CZJA 1ESWA 3B9AA 3NUKA 3AIEA 1CEOA 1UHVA 5I3DA 3MMDA 1W91A 2YLAA 1J01A 2ZXBA 3CZ8A 3W37A 2BY2A 4HTYA 2WM0A 4ML4A 2W66A 4WIWA 1E6QM 3W4RA 1W1PA 5I79A 4TTGA 2EPNA 1XCXA 5LYRA 2BXZA 4W85A 2VL4A 3F4VA 2A3BA 1ODUA 1UQZA 3VIFA 1R7AA 2A3HA 3B8SA 5A8PA 1UD6A 2DSUA 4FK9A 1ISYA 3N9KA 2YA1A 1FH9A 3ECQA 5A8MA 4W84A 3QHOA 3ZMRA 1GVYA 2BS9A 1BHGA 3WF0A 4D6JA 5A6LA 3SURA 2ZXQA 4AD4A 4B16A 5BROA 1UWUA 4UFMA 2JIWA 4P7OA 3ARYA 3IK2A 4JKMA 3ARSA 5D9NA 1QNPA 5M17A 4D6IA 2OWWA 1H11A 4W8LA 4U33A 3OBAA 3WD4A 4CGTA 4PMOA 1PX8A 2PWHA 3WD1A 5F7UA 4BA0A 5DT5A 3AIVA 1UWIA 2XIIA 1W9VA 1E0WA 1V0MA 1UKOA 2WZEA 4M80A 4MAZA 5CPTA 2YL8A 3T08A 4J3UA 4IM4A 3WNKA 5JIWA 4UQ9A 1JD9A 6CGTA 1YHTA 2WC3A 1MYRA 3WN6A 4ZEPA 4PCSA 1UZ1A 4AZGA 1KGXA 2EXOA 1KBBA 3RM4A 3VKKA 1J0YA 1QHZA 4B9YA 5CPSA 3FHAA 3AZSA 1KXTA 4AC1X 2QHAA 2GDVA 1CXIA 3WNLA 5GNXA 3VIIA 1HJXA 1OT1A 1CGUA 1UKQA 4IPNB 1PEZA 1B2YA 2YA0A 2EEXA 1GQLA 2WMFA 3AHZA 4Z2HA 4AYSA 1ISWA 4IPLA 2VVSA 4OZOA 1HXJA 2CETA 3IJ8A 4FLRA 4GQRA 4F66A 5M03A 4C7GA 5BCAA 5E9AA 2DT1A 3VVGA 2VR4A 1TUXA 1G5AA 2CKSA 1J10A 1FHLA 2J7GA 1WDPA 1TVNA 2FGLA 7A3HA 3QGVA 4ATWA 3GZAA 1E6PA 1KGUA 3AI0A 3A4XA 1V3HA 2O9TA 4WKHA 1W3LA 2FHCA 4TX8A 4GINA 3CGTA 3MO4A 1K6AA 3CH9A 1TG7A
chains in the Genus database with same CATH superfamily
2W62A 3AISA 2VWSA 1H0IA 1RA5A 4KCTA 4M7TA 2CXEA 3KFTA 2W3ZA 5CZTA 2ZA1A 9CGTA 1SFJA 4JL2A 3PWIA 1J12A 3QKEA 3WF2A 1ISXA 4B2DA 3QC0A 1V0LA 5H1WA 3DFPA 2ZTKA 3H2EA 2ZVRA 3GIPA 4DF1A 3RNDA 4TMCA 2OXNA 3HV8A 4OBSA 3MCNA 5DEZA 1KA9F 3WLSA 5AC7A 3CUIA 2D73A 1I1WA 1RBOB 3DHUA 2HE5A 3WH9A 4AQLA 4M5PA 1PYMA 3P74A 1F73A 4RV3A 2Y85A 2PDXA 4R7JA 4KCUA 4IQJA 3DU0A 3EWYA 4LFYA 4JTDA 3N9SA 2V5JA 3UZWA 4AX6A 3LHVA 2VZUA 4X9YA 1EP2A 1SR9A 5LNRA 4IJBA 4XV0A 1XD1A 1V6UA 2E68A 7ODCA 4B3KA 4JGDA 4QEHA 4PA8A 2NWSA 2PB1A 4PCNA 1CLKA 5LNVA 3VIPA 3GHTA 2Y2WA 1FHUA 2E8YA 3QR3A 3VM5A 1V3MA 1T40A 4X22A 4ZXLA 5M2FX 3PUGA 4IJCA 3CHDA 1M03A 1SFSA 2GQ3A 2PPGA 3HJEA 3A4AA 4LBRA 3W7EA 1UZ4A 1S1PA 5FJJA 2HNHA 2BY0A 2XSAA 3FEMA 3WLOA 4BY3A 1QDSA 4D71A 1MMFA 3TQPA 3GNOA 3O0KA 3FEQA 3KWXA 3BANA 3LLFA 2PU1A 4H6RA 3LCFA 1ICSA 2RDWA 1G69A 4HHMA 1CB7B 2FB3A 4EXBA 1UUQA 2YCLA 5CG0A 3AICA 4FX8A 4JTSA 4CU6A 4GH1A 2XIOA 3PZTA 4A8NA 4EAMA 2CHOA 2JKPA 1W3JA 4XSLA 1JUKA 3VGEA 2IXVA 1LT7A 4DF0A 3FFSA 3S8HA 3GDBA 2AOSA 3QQWA 4NQ1A 4B92A 3KCLA 3OA5A 1ZENA 1GGOA 2TPSA 2Y1HA 5LIUX 3T07A 3W7PA 3KOXA 4OBTA 1JZ5A 1PKNA 2NX3A 3GXDA 4L6HA 3HF3A 2FVKA 5C9WA 4YN5A 3BLIA 4BI7A 4IP5A 4CCDA 2WC4A 3B4YA 3I6EA 1FOBA 4HPGA 1N82A 3LGDA 1GYMA 1XIEA 4Z0SA 1BLIA 3AXMA 3OP2A 4XTIA 2BHYA 2P8CA 3DUGA 4M3PA 4D1JA 3GS6A 1XW8A 1FBAA 5AC6A 3KLLA 1SZFA 4PFMA 2ZKMX 3IUHA 4AF0A 3ABSA 1OFAA 1WKEA 1TV5A 3O07A 4LANA 3SCUA 3EEZA 3LTPA 3WNPA 1IWBA 3VE9A 1KXQA 3C0SA 1WBHA 4Y8EA 3KHDA 5XINA 5A8QA 1XPGA 1CI1A 2PU0A 4NJHA 4JIEA 4Z0JA 2CBJA 3T6CA 1IEXA 3T09A 4PUEA 2CHNA 3S2MA 4DWSC 5FJOA 2ZZ1A 5HQMA 4J1OA 3A24A 3VCRA 1QR7A 5CSUA 4IP4A 3WL1A 1TR9A 2V5BA 5H8PA 4YYFA 4JY9A 4MKVA 3N12A 3TTYA 3WNNA 1E73M 1NDZA 1QJWA 3WF3A 4O53A 3CV1A 1UD2A 3E38A 1FTXA 2C1HA 4V1XA 1HF6A 1JZ6A 2NLYA 2GSEA 4CU8A 1PKLA 1S1RA 3IIPA 3AOFA 3AMKA 3UA3A 4XVEA 2Z25A 4XKYB 2NXGA 1H4PA 4ADUA 1F76A 1TRDA 4RL3A 3GH4A 2Q01A 3UPWA 1XS2A 3CV6A 2VX6A 3SN1A 1LTDA 4DYKA 2BV9A 2E28A 1XLDA 4EE9A 2I56A 3N6HA 3IAPA 5FL1A 1TO3A 3TTQA 1XLCA 3ELFA 4AVOA 2ZE0A 1IGWA 1G7UA 1GZ1A 4E2DA 4HJWA 2FDSA 1EDQA 2BVTA 4HA3A 4DWSB 1WE5A 3PZNA 4RE3A 3WLIA 3TCEA 2ZZ5A 2HPIA 1VEMA 3BAYA 4YJ5A 3W83A 3EDFA 1SJAA 3H53A 3TFXA 3I7RA 3VX1A 3K1DA 2VD9A 3L4TA 4S39A 2J66A 1J0IA 5DF0A 1G9HA 1ELSA 3LGEA 4FX7A 3V5FA 4KS0A 2VX7A 2YFOA 4K68A 3BSMA 2J6VA 2OEMA 2X40A 4HN4A 3RMEA 3E0IA 3GD6A 1S2VA 3E2SA 1CGTA 3RO6A 3IJQA 1OF6A 4DUOA 3WDPP 3AS0A 1W1YA 4MJMA 2C0AA 5I0DA 1XLBA 1P5BA 4JS3A 1V0NA 1R2TA 3ZXWA 4LAMA 2PC8A 1QK0A 1X39A 3A3XA 3EB4A 2XVLA 2IPJA 4AIOA 3C8NA 4IPJA 4POCA 1W6TA 3D3FA 1U1JA 3CHVA 1MQQA 7TAAA 4JIHA 1XIFA 1TV3A 4LB4A 4JEQA 2X05A 2C1GA 4S3EA 1TWZA 3GTHA 3PF3A 3DHDA 2AL2A 1XRFA 4HA4A 4AD0A 1SM9A 1ME8A 4US5D 2PZNA 1XG3A 5CH9A 5EFFA 3R12A 1W5OA 1UW9A 4AWEA 3U2CA 3W6LA 4D9PA 2IUZA 1MNSA 3KTSA 1T7LA 2YPIA 4H8HA 4LUYA 2FFCA 1W2PA 2ACUA 1MFUA 5G4HC 2V63A 4IMEA 3VC6A 3OEXA 3OGRA 1PO9A 4QS5A 4C6BA 1KBLA 4UNLA 1V6WA 3DCPA 5BZAA 2WM1A 1XQKA 1BYCA 3IVUA 1JZ4A 1NF7A 4ZTXA 2XYLA 3W72A 3S42A 2VUNA 4MWAB 1GEQA 2DP3A 3GDTA 3OPSA 5CCZA 3DFSA 4H9VA 4L56A 3V1PA 4CQ9A 2VRQA 3RDKA 1GHSA 1UR4A 2YCIX 2XHYA 1SW7A 3AS1A 1AK5A 2YFNA 4US6A 3CT2A 1IT0A 4LGXA 5C70A 4B15A 4WDUA 3AMDA 1XC6A 2AQOA 1R30A 1WKDA 4NG3A 2PUZA 5CZSA 3VZZA 2FJKA 1K02A 2QPSA 5CQ1A 3CXOA 2OSYA 4Y8FA 3HQOA 2WB5A 3QMRA 4L9XA 4L64A 2NW0A 1UZHA 2OZTA 1FHVA 2AQWA 2PDIA 4KIEA 3EDKA 1EQCA 1E6NA 1HW6A 2HPMA 3VAVA 4DELA 3OYXA 1KTNA 3LX9A 4IXXA 4Y6GA 3KE0A 5DXXA 3MQTA 2QUUA 2BGNE 3WK0A 1XKYA 1SO4A 3BAXA 1OCNA 3KRZA 1KCKA 5EMLA 1Q6RA 3C2YA 4WDTA 1SFTA 1M7OA 2ZUNA 1QHPA 4EKJA 5C2XA 1GVRA 2VDHA 1XGZA 1DHKA 3O1NA 3ARRA 4L7ZA 1HJWA 1S2AA 2EPMX 3PTMA 3KOFA 5H8MA 1VHNA 1XIMA 3AXKA 5CG7A 2W4XA 3NM1A 3EKZA 3WQ5A 4QE4A 4AZ5A 4DIAA 5D8WA 1DIDA 1GORA 5A5WA 1NOWA 3SRFA 3WF4A 3TWAA 2BXVA 1VJSA 2XIMA 2A21A 1XKJA 2V8ZA 3W1LA 3URNA 4YVXA 2GGHA 2J74A 2PDJA 5DELA 4GKTA 5LHEA 1V3LA 1KC7A 3O6CA 1RK6A 3QTGA 1SO5A 3BL3A 1MZHA 4F40A 3KP1A 3W7NA 1GVIA 1RD5A 2ON3A 8RUCA 5IRPA 4UR9A 1UOKA 1PZ3A 2PWVA 1P0BA 1FY6A 4NASA 2GUUA 1YE6A 5AZ1A 3PUDA 3A5FA 4H01A 1UWAA 1RLCL 4AEEA 1UC5A 2DSKA 5XIAA 4HQVA 4ZOCA 4UB9A 1R46A 4ZODA 2AMGA 4O15A 3OW1A 3VDBA 4IIDA 4W7WA 3AYVA 5LA2A 3N2MA 2B0MA 4QSHA 2XZ9A 2JEQA 3UXKA 2PWUA 1PDYA 1J4EA 2ZUTA 1JNDA 3P8IA 2YW3A 2DT0A 4DM1A 3EXSA 2GVJA 5A95A 2QKFA 4F9JA 4U2YA 4TVDA 1L6FA 4AX7A 2PGEA 1HJUA 4N7QA 4DNHA 4UOJA 4YHEA 4PSRA 3ITYA 3AU6A 4AEOA 4X60A 4EXQA 3P67A 1PIGA 1B57A 4B5XA 2V3FA 1XYFA 1IWPA 3AUJA 1XIJA 3AIWA 1GK8A 3STCA 2YBVA 4LUTA 1LRQA 1D7FA 1T41A 3P81A 5CPNA 4RK8A 3I3EA 5JXQA 1V8EA 1YTKA 4BEQA 5DO8A 2C8NA 5A69A 4PTMA 4LV9A 1EKOA 1A80A 3N29A 3W7IA 2E9BA 9XIAA 3RCYA 4JDBA 3BH4A 1BPLB 3MUIA 2WQDA 1X6UA 4JZ5A 4HTBA 4FXSA 3WK2A 4GABA 5IM51 4WXYA 3QY6A 1R3SA 1K1DA 2P0IA 4WZHA 2E09A 1EFZA 2HS6A 1GCYA 4UUIA 1S2CA 2QCFA 3Q58A 1Z69A 5HNRA 3WBYA 3RLGA 3UF9A 5I7GA 1A5LC 1U83A 3VI2A 2PC4A 5FJUA 5A3HA 1WZAA 1E15A 2BHZA 1LROA 4RE4A 3KEHA 3VIJA 3DI0A 5BXSA 3VOCA 4JHOA 5DMNA 4KWWA 2X8RA 1C8YA 1RHCA 2FDMA 2OJPA 1PS9A 2ZZ3A 2ACSA 5C9XA 2YXGA 4WLCA 5FSEC 2VKZG 3L66A 3UZ5A 3H4XA 3UZXA 1B30A 4FLQA 4Z2IA 4Z2JA 3TQKA 2P3ZA 5D8ZA 4DJFA 3R11A 3A21A 2WANA 2Y8VA 1YDOA 3QGAC 3VNDA 5GQBA 2CESA 4G7FA 4RR4A 3QYSA 4OUIA 2O4MA 3OBEA 3Q94A 5DY2A 4GE8A 5C2GA 3IVTA 3MKVA 3KVMA 3M5YA 1CNVA 1SZEA 3RJYA 4BR1A 2C0HA 4H4IA 1EGZA 1OBAA 5D04C 2PE4A 4JIIX 1TB3A 4AZBA 2G4JA 4NUWA 2B7OA 2I16A 3ZIZA 1DJYA 1J9YA 5AHNA 1GONA 3A13A 5BNKA 3ZJ7A 2MUCA 4HK6A 1O66A 1AL8A 1Z48A 3DN5A 1F6YA 3K2GA 3NQAA 4PEKA 3ZLGA 4JHZA 3NDOA 1A3WA 1THFD 4GUFA 3LN3A 1DPMA 3O05A 4D6EA 3TR2A 2XFFA 4RNHA 1U5HA 4UNIA 4GUHA 3BMWA 1K4HA 4UZSA 2OWCA 3R89A 2WZTA 5I2UA 3DDMA 4TO8A 4GYKA 3S1GA 3KDOA 5C6MA 5DLCA 4F4RA 2CLLA 2CWNA 3S5NA 1X1NA 1R5YA 3EPNA 3TFCA 4DXXA 3ITOA 1Q65A 1E1CA 4Q8TA 4FA3A 1EHAA 1GKRA 2HDJA 2IKIA 1KNWA 4L61A 1I2NA 2H3BA 3VZXA 1P1MA 2CW6A 2YZRA 1H7NA 4KQNA 1XSJA 3UPMA 3CYJA 3IWPA 3HG4A 2GK1B 3GWQA 2QCDA 1ITUA 4LVDA 1LDCA 2WVUA 3NYDA 4JBRA 2KAUC 4B4FA 2NUYA 4JIQA 1DIOA 4RNFA 4PBFA 3UR8A 2HNEA 4PC8A 3UZYA 2PGFA 3B8IA 2I17A 1XYAA 4IIHA 4MM1A 3SSJA 2Z6IA 3TN4A 3SCRA 4IMFA 5FJRA 3HPSA 3PUOA 1K7EA 1JZ8A 4J2PA 3WJZA 4PCTA 1K9EA 1NWUA 4M0XA 3WNMA 1HKJA 1IZKA 3TTSA 3ZM8A 1M04A 1FCBA 5E93A 1W8GA 1JUEA 2NXIA 5FJTA 4LB3A 1LT8A 2REQA 3WQVA 3U7VA 2OU4A 4M82A 1ZB5A 2BTMA 1MW2A 2WMIB 3SIZA 4AY8A 4UFKA 3B04A 3GBEA 3RO8A 4Y2WA 2DGAA 5CEWA 3PZMA 2HZGA 1DJNA 3PANA 1BVNP 3N2XA 3B40A 3KBWA 3LSCA 2D3LA 4K38A 4ZCWA 3BCJA 4XD6A 3YPIA 1DHPA 3S5ZA 4RV8A 3EZ4A 2OGJA 3NQCA 3FOKA 4IT1A 3KM8A 3WUEA 2J9YA 3NL3A 3VIGA 2JFEX 3KTCA 3CWOX 5G2IA 3CTTA 3USBA 3W29A 4NY2A 4L80A 1XLFA 3VMOA 2W6RA 4DO6A 3WDJA 1XYMA 3PJUA 1M6JA 4RNIA 1VIWA 1JI1A 4U2ZA 4GACA 4WSHA 2D2GA 3KL3A 4HKPA 2BBFA 3PPCA 1E40A 1WXYA 4IPPA 5HATA 1V08A 3L67A 3BLFA 3RR1A 3G1YA 3GX9A 3FGCB 4A4AA 3FDKA 2OQLA 2J9XA 5CLWA 2QS8A 3MTWA 4UCGA 3WLMA 3MA8A 5JBFA 1EUAA 3HU7A 3VGDA 4CNPA 4WD0A 4A3HA 2R24A 3HFYA 4PB4A 5GJMA 2IPFA 2C19A 1QWGA 1G4TA 4ZOEA 1HL2A 6REQB 1MQRA 3SGZA 4KFPA 3W73A 3GG1A 3QV8A 1ONXA 3GXTA 5CPQA 3ZFHA 3VNMA 1WXJA 4GNVA 1B9ZA 1VFTA 1JZ3A 2VXNA 3A9BA 4IMAA 3LPFA 1AH4A 1MI3A 3G18A 4O19A 1FP9A 2XG9A 2YBUA 3WUGA 2FYMA 5CPOA 2YGYA 4HPHA 3TKFA 4R9OA 1JNEA 1OCJA 3S1WA 3M43A 5G2HA 4MGGA 3H2FA 4M8UA 2VGBA 3S2CA 3PBWA 3ME3A 3B05A 2XVKA 3CIVA 5EMJA 2QCMA 3IIOA 1W1A1 2BY1A 1VCFA 1WA3A 3O06A 2G41A 3TTEA 1BD0A 4FLOA 4HPJA 5HJLA 1VYPX 4ONVA 3L4WA 1YEYA 3ZJ8A 1VJIA 1MEWA 4GVHA 2WHJA 1FWSA 1J8VA 1E3ZA 1F9CA 1JVNA 3W87A 1F5ZA 1CXHA 4IIEA 2PDFA 5XIMA 1BAGA 1EZWA 1KKRA 2QVHA 3UJ2A 4J3ZA 1K77A 1K3UA 2GJXA 3ZS4A 3MO7A 5KTLA 2D3NA 3NSMA 4RKAA 3ZJKA 1H60A 2NVDA 3WCZA 4C6FA 3RILA 1U2YA 3AYRA 5HWNA 3AALA 3BAJA 1OB0A 1EBHA 1CW2A 3NZPA 1RJPA 1KV8A 1IXNA 2ZWZA 3WQWA 1TPDA 1HFBA 3PG8A 5I24A 3WK3A 2TYSA 4DWDA 4Z2LA 2PP3A 4Z1YA 2Z1VA 2O4QA 3IIVA 5I02A 3KVJA 4F3HA 3C86A 3LXCA 4UIOA 3TNOA 1BFNA 2NVCA 4HCHA 2DZBA 5EMUA 3FYYA 1F4AA 1W9XA 1F7BA 4UQCA 4JTFA 3O8AA 3KCOA 4GGBA 2WMIA 4KRZA 1A0EA 3E2QA 3LMZA 3BAKA 5D4YA 5TIMA 4PMVA 4HJFA 1N2VA 2V38A 4Q8QA 4KESA 4HNLA 4UTHA 3H2CA 3WBXA 3V5OA 4LEFA 3QFWA 2VR5A 4Q4QA 3S46A 4F2BA 4HU4A 1QMLA 4Q4OA 4FNSA 3HMCA 3NQGA 2QPUA 4C91A 5J5RA 4O52A 2AMXA 1DQWA 3R8RA 3FIGA 1TMHA 1DQUA 3DZ1A 5DFAA 1VPYA 2CLEA 3APGA 2PGWA 1JF5A 3LBCA 4CQDA 4Q8VA 1TQJA 1U5VA 4AD1A 5BRPA 3JS3A 1MXSA 5AY7A 1DWHM 4HMDA 1YDVA 3ITXA 3M0LA 4HOZA 2FGBA 3K8MA 1F6PA 4IIBA 3UZJA 4E8CA 3UVAA 4G56A 4KBXA 4TR9A 2FFIA 1LQAA 4UTIA 3VA8A 4C6MA 2X1UA 1G4EA 1J2WA 3RX4A 3MUZ1 4LY4A 3AS3A 3MU7A 2MNRA 3APYA 3SY8A 2X1IA 3TQVA 3KOYA 3QHNA 3GM8A 2VNCA 1OY0A 3UWEA 1GOIA 5LGXA 2ZX7A 3FKRA 3M6YA 4QAWA 4H8VA 3IJDA 4IL2A 5BOOA 3KBJA 4BCEA 3AYTA 1KBJA 4F8XA 5LIKX 1XDJA 2NWRA 4K1WA 4LCSA 1LL7A 1DTUA 3WEMA 2A5HA 3HGSA 2GL5A 2XJ7A 5HUOA 3WNOA 2DSVA 1GOKA 5K3VA 2QJJA 1CXEA 1LJYA 3PHAA 4ES4A 3GXNA 1MRAA 4J4KA 1I6NA 4IWWA 1FWBC 2Y62A 5F2IA 1VS1A 1T6MA 2PODA 4ERGA 4HOWA 4L65A 4V28A 1TV7A 2Z1KA 3G1RA 1T99A 3NQEA 3MSYA 4PBGA 3LM7A 1NP2A 2NV1A 3CZKA 1JUBA 2ZX5A 4ACZA 2WVSA 1TIWA 1K8CA 2AKMA 4HNCA 3UWZA 2Y7FA 4MB1A 1TZ9A 1F3EA 3K8KA 2Q02A 4UTTA 3SIMA 3F4NA 1Q7ZA 1Z42A 3V0TA 3WMBA 2NQ9A 5LNSA 4JN6A 3FXYA 1YBQA 2WZMA 4F48A 1I0DA 1F8IA 1AQ0A 1C7TA 4Q4RA 4IH3A 4LC8A 1US3A 2QJMA 2ZUSA 1XH1A 2F38A 3ZR6A 4YVPA 3RRAA 3U4AA 1N7KA 3NURA 4BK9A 3CBWA 3FN9A 1NWRA 1U1HA 1LOSA 4CLMA 3VOJA 2Y7EA 1OHLA 2QVNA 2ANUA 1ZALA 1P4CA 3OVPA 2FMNA 3B9AA 4ZO9A 3TSBA 3P84A 1W91A 3EOUA 2ZXBA 3CZ8A 1GPWA 3QV7A 2BY2A 2QJGA 1YPXA 4AVFA 4GG9A 1GVQA 3TXVA 2XSXA 2Y61A 4LT9A 4AFYA 1LYXA 4GI4A 1F3TA 1E6QM 4PTNA 4XAZA 1EP1A 3BMXA 2R1NA 2JKEA 5I79A 1JULA 2J27A 2QDHA 3UWUA 2BXZA 4W85A 2VL4A 3QPZA 2A3BA 3PB0A 3CK5A 4QIUA 3VIFA 1GYNA 1E0TA 3B8SA 5A8PA 4KFNA 2DSUA 4CEXC 1OABA 3IJ6A 5D37A 3A4JA 3LQLA 3ZMRA 2BS9A 1BHGA 3LCHA 3T0CA 5BROA 2E5BA 3ARYA 5FAJA 3IK2A 3ARSA 3SGUA 2ZC8A 1H11A 4W8LA 1YXCA 4IF2A 4O1AA 4PMOA 3ES8A 3ZLHA 5F7UA 4EAYA 2OOFA 2XIIA 4HHLA 5I3KA 4GIYA 5FEWA 2YL8A 5JIWA 4UQ9A 1Y5VA 2FZ8A 3O16A 2YX0A 2INFA 3ZVIA 2W0UA 4ZR8A 4F0LA 2DZVA 2QHAA 3RAOA 3BARA 3ERPA 4ROPA 3WQEA 2XH2A 3BJTA 2Z29A 1B2YA 3CQHA 4ZSTA 3G77A 2FB2A 4K1GA 2YA0A 2EEXA 3GHRA 2WMFA 3AHZA 4Z2HA 4AYSA 4IPLA 1LORA 1TWDA 3T4WA 1IXQA 1OC7A 3D47A 4C7GA 5BCAA 4H9XA 3LOTA 2ZADA 2ZBTA 2RDUA 3VVGA 2VR4A 1FHLA 4U10A 1WDPA 1AMKA 1YYAA 2ZA2A 3TYUA 3AI0A 3IEBA 1NU5A 3A4XA 3L0NA 3KLKA 4GBDA 4ZQCA 2FHCA 4GC4A 3OG3A 4GINA 1RBLA 2H8XA 2EJAA 1S5VA 3MO4A 3Q67A 3BZJA 4L6DA 4WDWA 4MIMA 1FCUA 1A5SA 1K8YA 4F2UA 2IKJA 3FW6A 1TPWA 5DCDA 1W37A 3M1ZA 1NF0A 2WCAA 3U2EA 1GQNA 2BP1A 4RJEA 2QV5A 3GVVA 3N25A 1JZ7A 3W2JA 2P1FA 5EKYA 4CNSA 4IGMA 1XH2A 1QPOA 1E72M 4AZCA 3U48A 4GZIA 3S6DA 1WQ5A 4AAJA 1CGYA 4UR7A 1E5JA 1F74A 3NO1A 5HWMA 3CHEA 1G01A 3VOIA 2PZ0A 4MYAA 8TIMA 4OOUA 1LG2A 4TV5A 4O14A 3E6EA 1KM0A 3BUVA 4XWUA 1XBZA 3K30A 2X2YA 2VRJA 5DCEA 4LQ1A 1GW1A 5FACA 1E56A 4FIQA 5AHMA 3TLLA 3RX3A 2VJXA 4S38A 3W7DA 4C1LA 2QCHA 5I3HA 3UWWA 1E70M 3I7SA 3HGRA 4CD5A 1G1YA 3B0UX 1MVYA 4PMJA 3VILA 1MSSA 3SECA 1FUYA 3CWHA 3WQOA 4JICA 3G24A 1FWNA 5FJIA 3MZ2A 1EUNA 1LQ2A 5HR6A 3G0SA 3N4AA 4YCOA 1A50A 4ECLA 3SRHA 1H7PA 4PMRA 2VDGA 3M0JA 3HPXA 2WNWA 2D0HA 3DYPA 1R3WA 3OODA 3PZVA 3OQ8A 5BMWA 5AZ0A 1LLOA 4NHVA 3VDGA 2ZOXA 3ARZA 2BDQA 5K7JA 3PC0A 1CIUA 3W76A 5CBBA 2XIJA 4K7VA 1I2QA 4FXJA 3EXRA 4MB3A 2QUNA 1YNPA 1VP5A 2PF0A 3CUHA 1HN1A 1SO3A 4NJGA 1Z44A 3VD5A 2FZ9A 3ITLA 2WMHA 4EX4A 5BW6A 4B5VA 1GZGA 7CGTA 2HK0A 3AO0A 1POKA 4XTDA 4CD6A 4GX8A 4DAFA 2XH4A 4UZUA 4DUWA 1JCNA 5KSWA 4O18A 2EQDA 4BQ2A 4OQVA 3WG6A 1DWAM 2HVMA 1GQKA 4Q8UA 1H3GA 3W7OA 2P50A 4YS1A 3RJXA 4IMCA 1FWWA 1O60A 4EPKA 3QRHA 3L21A 3R7MA 1VLWA 6XIAA 2OLSA 1DIKA 3N2CA 4QITA 3BGAA 3W74A 4UMCA 3AIQA 3AIRA 4DJEC 3SZ8A 3AZRA 4IMGA 4A29A 3NL2A 4GFIA 4GH3A 3FLUA 4LWWA 3CUJA 1A3XA 1R3YA 3GIQA 1OGSA 3SN4A 4Y9AA 1KGWA 1VGAA 1XLJA 1AUSL 3LHZA 3JW7A 4ORIA 1HX0A 1TR1A 3DERA 5KZ6A 3MWCA 3BW2A 1L6GA 1UP3A 1XI3A 3RR4A 1BF2A 4ZENA 4XB3A 4HCDA 2DPEA 3T40A 4DPQA 4MNLA 4C7DA 3WO8A 3HO8A 3CUGA 3H12A 2R8WA 5I07A 1BXBA 4QX4A 3DC0A 5ENLA 2GQ8A 2V5DA 1UKTA 2B81A 4L9ZA 3MS8A 3P8JA 3UXAA 4REQA 4O1DA 3UWVA 3W2UA 5IBXA 1FWCC 3VFCA 4NNBA 3U5UA 1EEXA 1JPKA 3DFYA 3NZRA 1XIGA 3WENA 4XBSA 2YCLB 3NPUA 1TPVA 2B4GA 1GW9A 2P3EA 3TUUA 3ARWA 3U57A 4AF0B 1PTDA 2A85A 4ICMA 4MNJA 3K8LA 2DZTA 4UFIA 1PPIA 2XTKA 1POJA 5CC5A 1S3HA 1K9DA 1CGWA 4PMXA 4HGXA 3UGRA 1EH9A 2PDQA 1AQFA 4MWAD 2C79A 3VD9A 1Q85A 3SY5A 1RQEA 4HSOA 1X1ZA 1FQ0A 1NFGA 5HWJA 5KITA 5IXEA 2E0PA 3L7RA 2CBIA 3LGGA 3CQIA 2Z26A 3WD0A 1PZ2A 4IIFA 2TSYA 4AZIA 2ZRWA 4I9MA 3UFYA 3RPTA 2NZLA 3WH5A 2QPXA 1BYAA 1HVQA 4NAFB 3M16A 1JR1A 1Z8AA 4WCJA 1EA9C 4UBPC 1Q6QA 2P5NA 4UTKA 3EDDA 1WAWA 2RUSA 3N19B 4WKAA 1X96A 3I10A 5DN1A 5KEZA 1MNZA 3I4EA 1HZYA 4HBKA 1X8FA 1Q6OA 1I2OA 1H1YA 4DI8A 5C55A 5KINA 5G4EA 4W7VA 3W6YA 3W07A 3BOLA 2CPUA 1MXDA 2RHGA 2GUYA 5HOSA 1CPUA 2OYKA 5GJNA 4G6CA 4IG2B 3M7WA 1MFVA 1J93A 1R9XA 3N2TA 2J75A 4UTWA 1K4GA 4DYEA 4JN8A 3LLXA 3ARVA 2QV4A 2PGRA 3EBVA 1PTAA 4DEFA 3MP5A 2NV2A 4HB7A 4W87A 3DI1A 1JDAA 4V2XA 4TUFA 2PURA 3UGVA 3UG4A 4LYPA 3NGJA 1S3TC 4KRUA 2HQAA 2PDLA 1I2RA 3TA6A 2XGZA 3RG6A 4GRSA 1TVLA 4CNOA 3QZEA 1P6CA 2ZCGA 3DBPA 2ISSA 1OX4A 1Q6CA 3OLDA 5K2ZA 4PCPA 4YLWA 3VD4A 2J77A 1IIHA 3W7HA 3QOKA 2PEVA 1Q4NX 1TPUA 4BWLC 2INZA 1RXOB 3NQMA 1GT8A 3H70A 2WSQA 2VEMA 1Q6FA 2OZ8A 3VNZA 4RPQA 4CD8A 4A8IA 4TU1A 1V6TA 1TCDA 4CNUA 1GKQA 1Q6DA 1E3XA 1QOPA 1QFEA 4Q4KA 1QPKA 4ZL1A 2ATSA 3VDHA 3UY7A 3TAOA 1PXGA 2Q8ZA 3ALGA 1RY0A 1PHWA 2A7RA 4JTGA 4A05A 3TC6A 4D6CA 2I5IA 4H7CA 2R94A 4N2YA 4GIAA 4M7SA 4LUSA 1WZLA 1VBRA 1OEPA 4LH8A 3P61A 2FZBA 4RNJA 4QSFA 2WHKA 5AKQA 3FAXA 2EPKX 4MLJA 3GYEA 1X6LA 1VB9A 4A22A 1R6WA 4UFJA 4QS6A 3T9PA 3R1ZA 4P7RA 3T8QA 1KRMA 5D33A 1E55A 4PUNA 4FAMA 3AMCA 1VFLA 1EC9A 3L5MA 4MPKA 2A3AA 4CD7A 1WPCA 5CSSA 4GUJA 3SFWA 4QAIA 2Z1XA 4KEVA 3SI9A 4A2SA 3PFRA 3GR4A 4A21A 3S2NA 3GDMA 2PP0A 1HGWA 1NQ6A 3VKBA 4KIRA 4JTIA 2OSXA 1OK6A 2VENA 3WY1A 2QUMA 4GQQA 4MLRA 3C52A 4O0ZA 3E9AA 3GHSA 3GTXA 1YMYA 1ZCOA 1XC4A 2NX9A 4M56A 1TMQA 3U2ZA 1D8WA 3COTA 3GAYA 3K4WA 4GX9A 3IIXA 3VNYA 3WZ0E 3P80A 5FCZA 2TODA 2YJQA 1PJ9A 4BFAA 3LHWA 3KAOA 2BMBA 5CLTA 3CZLA 3T1GA 3ZT5A 1UBPC 4EPDC 3QKZA 5GNYA 4JQ4A 3CL6A 3TYAA 3C2EA 1BQGA 2GK1A 3N4EA 2NUWA 2OX1A 4XZIA 4QG9A 3LG3A 4EK7A 2RAGA 1Q2SA 4GBUA 3LBMA 5D32A 1P7TB 3KZSA 1JIBA 4XX6A 3W53A 4LF2A 4Y9PA 3TXZA 4UTWC 1DORA 3FDGA 1E6SM 3BAWA 1UR2A 4INFA 2RGMA 1WB0A 4KWUA 3L5LA 1SU5A 2FZDA 5PTDA 5BMXA 2WWDA 4BEUA 2ZWYA 1YBQB 2Z1SA 1Y8BA 3SW6A 4HNUA 2R6OA 1IEQA 4K2SA 1XIDA 3GVQA 4AZ7A 1QBAA 4NJIA 3A22A 4U31A 3SADA 1M65A 1O5QA 4JFSA 4DJDC 1ONWA 3VIOA 3SUUA 5A6SA 1BRLB 3M46A 4K36A 2ACRA 1EL3A 4H3DA 4Y7EA 2XVGA 2G37A 4AVNA 4LUSB 1GJPA 1ADOA 4FALA 4Z1AA 4BHYA 5HULA 3N6QA 2VI0A 4QDPA 3O7UA 4R3UA 4GVIA 1LOQA 2YCKX 4WF7A 3T8LA 3AQUA 4GWEA 1PE1A 2BZNA 1GUVA 5EPDA 2XU2A 1JFHA 2J4GA 3MI3A 4UQAA 4KFOA 4LUIA 3CLMA 2H6RA 2C91A 1A5UA 4M1RA 5ABEA 3BSGA 4AC7C 1CX9A 2FJUB 5C71A 3OHIA 3DFQA 1Z7AA 3CQJA 5K4XA 1FDJA 4DBWA 3UY8A 1FWHC 5IHRA 2D2OA 2E67A 3T44A 2F2KA 4L4OA 4LBSA 2A6LA 5M5DA 3G1DA 3WFLA 2QUTA 3LY0A 3EB2A 3VX0A 1Q45A 3EXTA 2XVPA 3IUIA 3MHFA 4TVUA 1T96A 1W1TA 4GUGA 1BEUA 1W5PA 2WWCA 1VBGA 3GXPA 3AWNA 4HNNA 1KCLA 4XKYA 1V4YA 3NA8A 4DZHA 1DJWA 1PKMA 3DYMA 1SW0A 3NO3A 4M24A 2DW6A 3H6OA 3RIKA 3W1UA 2DORA 1N8FA 1KR0A 1L2QA 2J79A 1X97A 4GYFA 2BVWA 2VOTA 4CN6A 4DUVA 1QOQA 5IDZA 2Y8UA 2X1TA 2FPTA 3SUTA 1C7SA 3S5OA 2W9MA 1IZJA 2QCEA 4O0QA 1CCWB 3AYSA 4RXGA 1EB3A 1TZ7A 3SJ3A 4KEZA 3BOFA 5CSRA 4Q6XA 3SCTA 1UD3A 3NPXA 1KFLA 4I5RA 5TQLA 3B8DA 4FPSA 3EX3A 1G4PA 2O7QA 4I9JA 3RU6A 5H6HA 1W56A 1W1VA 3HJZA 3NQDA 4JFWA 1Z32X 3JU2A 3BLDA 5CGMA 1SJDA 1XFBA 5F1UA 2J88A 1V7YA 3QQ0A 3MDWA 4D8AA 4B5NA 4BQ3A 1S2UA 4LAOA 3P7YA 4PYSA 3GB6A 1CDGA 5E6YA 5HR7A 4JTTA 2V2DA 1TJ2A 3FY1A 1D3CA 3C56A 1QNQA 5I5RA 2X0YA 4N0RA 4JTUA 3IANA 2INEA 1O1HA 3EX6A 2QF8A 4ICNA 1VC4A 3FCPA 4FO4A 4AWTA 3CIWA 3E0FA 1TJRA 2VZSA 4X61A 4NZFA 3WYZA 4EWJA 3I65A 2BG5A 3UXDA 1NM9A 2ZIDA 4NNCA 1XIHA 1XV8A 3RLVA 6XIMA 3H2NA 4OKDA 1PZ1A 3SQLA 2E1DA 2UV8G 3QH2A 3DFNA 4K8EA 1EF2A 1EZ2A 1XBYA 2QIWA 4HYRA 4YMZA 4O17A 4BI6A 2V82A 1E4IA 5T91A 4QDMA 1HVXA 3UU0A 3W81A 4PTWA 4LEQA 5CGQA 1W1IE 3MJYA 3L0GA 1K03A 4QCFA 3AC0A 3L2MA 1YLVA 3QY7A 2ZZ7A 3D6NA 1PWMA 4GQBA 4YL2A 3FV9A 1NDYA 3L4YA 3OTRA 5LNUA 3E74A 3VU2A 4S3KA 1I1XA 1SUXA 1K8XA 2CZ5A 3SCOA 1DTNA 1JF6A 4NRSA 4BF5A 4XIAA 3VKAA 1V02E 1O12A 2E77A 4GI8A 1KFKA 2E6FA 1SSDA 2WZIA 1YIXA 1E9YB 3UNDA 4PMDA 2VUYA 3PZGA 3FKKA 4C5YA 1US2A 3DXIA 5C0QA 3LNMA 2WVTA 4LX4A 2CFFA 1FWGC 1QWKA 2G96A 2GOUA 2D0FA 4GZEA 1HKVA 4C6OA 4ACZB 3BO9A 4GVGA 1KR1A 2G4FA 3ABRA 1MW0A 4Z1CA 2CBUA 2O0TA 3LHTA 1EIXA 3IGUA 1LP6A 1H09A 2D2JA 3W2MA 2CIPA 4PUJA 1BXCA 4J3VA 2B7PA 1T0OA 1B5TA 1DP0A 1W0MA 3UNTA 5IFTA 2ADAA 3O6YX 5AHIA 1V0KA 2PDYA 1GQIA 3TVAA 4M1BA 3PFMA 3VIHA 3DH7A 3TJLA 5C7HA 1KBIA 3RM8A 1RVKA 3R0DA 2BSLA 3SCQA 1Z3NA 3IRSA 2PAJA 3GC4A 2G0WA 2XUCA 4IX0A 4E5TA 3C8FA 3THQA 1NQKA 3L9CA 3ZQ9A 1UR8A 1AL7A 4ATDA 4QXIA 1AW5A 2YL5A 1ZJBA 4NNAA 2IXUA 2E40A 1M5WA 5JIPA 3ARPA 3MYOA 5EYWA 1HO1A 3VFLA 2HK1A 3WBWA 2Z24A 2PLMA 2WMKA 3R94A 3W01A 2YOCA 1XIBA 3W3OA 2CLFA 4NRRA 1B4KA 3T0BA 3QGKC 3Q4DA 4YTRA 1OCBA 4HK7A 1FCVA 4DJDA 1GZJA 3BJSA 4XUGA 1IYXA 3QSRA 4WJ8A 2EJ1A 3WLRA 4LCRA 2GSJA 3C0LA 1VBUA 4QE1A 1NIUA 4CQCA 4CD4A 3OZPA 4MFDA 2RGLA 4O54A 1H62A 4FNQA 3G1HA 1SW3A 1UR1A 1R86A 1OIFA 3BQ5A 2PS2A 4JKLA 1EJTC 2HRWA 2NVAA 2POTA 1KO0A 1F4HA 1E6ZA 3AHTA 3V3WA 4MWAA 1JDEA 1TYGA 2OYLA 1EP3A 3CWNA 1FFQA 4HYWA 4MDOA 1FFRA 2JGYA 4DF2A 3AJ7A 3A3WA 4GJJA 2PDMA 3NQ8A 4J3WA 4KRTA 4LS1A 1H2JA 1NSJA 1NP0A 5FAGA 4ZTYA 3WDIA 4CNNA 3LMYA 1HGYA 1Y65A 2OTDA 2OYMA 2W67A 2W91A 5CZKA 2DSWA 5FF7A 1XLEA 1TQXA 3OGSA 4QJ5B 2PWGA 5I03A 1OCQA 3VE7A 2DQWA 4I9TA 2ZX9A 2YB1A 3VMNA 3N2BA 3FA5A 4QJ1A 1J0KA 1QI2A 1B90A 2QUVA 3KRUA 3T05A 3TDFA 1O1ZA 3A4WA 3KS5A 3TYZA 3ZSTA 3EOSA 1GTEA 3UVIA 5CJ5A 1QPRA 4P7NA 4AY1A 3S1UA 3QMTA 4WDXA 1XDLA 5E1QA 1DXFA 4LAZA 3UYCA 2WCSA 4ZSUA 4ACYA 2I5GA 3VABA 1CXLA 1EIBA 4AXKA 4HSNA 5BWFA 2WKGA 1XH0A 3HPAA 4FB7A 2E9LA 3EWXA 2GUBA 5KETA 5AYYA 4LPCA 2GQ9A 3C0QA 1KFJA 1O94A 3FJLA 3WL0A 1ZU8A 3GDKA 3N04A 3QR0A 3GG7A 1XQLA 3SSZA 1LUCB 3VO0A 2NQJA 1R8LA 3CTLA 1EEPA 2W63A 4OGZA 4IGHA 7TIMA 4MZ8A 4O16A 2RDXA 2CZVA 8XIAA 2VQTA 5HDRA 1ZBWA 3B9OA 1UG6A 2OKTA 2A2IA 1XJBA 1V3JA 2A6NA 4E8DA 4JAWA 1IT7A 3NG3A 1QI5A 3CJPA 4I5UA 3WH8A 3BICA 4AG0A 2D20A 4MY8A 1FWDC 2BXYA 3B0XA 3KVKA 4G2DA 2GJNA 5CBJA 2KX9A 2BOFX 1LL4A 4PFHA 4K3ZA 4FR6A 1M7PA 4XG1A 1CZ1A 3NIYA 1PIIA 4GJIA 4QM1A 5D2WA 5I3GA 2PTZA 2PRLA 1E1FA 1RV8A 2JIEA 5T9CE 3WUBA 4BI5A 2ASHA 4KGJA 1FX6A 2HE8A 1TWSA 3KL0A 4B5TA 5DBUA 4IFKB 1RUSA 3PZ9A 1RVGA 1HKMA 3I68A 6A3HA 2WQPA 3BTNA 1AODA 3UWQA 3LA4A 3NXLA 3TYEA 4CCEA 5LNWA 5C5YA 3P5YA 3TK7A 1F05A 1M1BA 1DL3A 1ODZA 3G1AA 4XAFA 2NUXA 4EIVA 5ABTA 3W2NA 5IBXC 3CUFA 5AYBA 1ML1A 4E4FA 2E7FA 4OIFA 4CVUA 1ALDA 4AD2A 3BW4A 1ITQA 1D3GA 5CC6A 2GGIA 2GVYA 1K9TA 4P7LA 1Q4WA 3AMGA 5HPCA 2NV9A 4P61A 4UTLA 3ARXA 1AVAA 1VRXA 3PTKA 2PWDA 3N11A 4MY1A 1I8JA 1MW3A 3UJRA 1G4SA 4NZ1A 4Y9MA 3HQ1A 1SO6A 1C92A 3Q65A 3F5JA 4NL1A 1E4MM 1X6NA 2WBGA 3VKDA 3VDCA 3URAA 1CENA 1TVPA 1EC7A 3G3MA 3UP8A 1RD6A 1V6VA 1ZP4A 4DWSD 2YA2A 4A2RA 3NVTA 1JDFA 3AXHA 1E1CB 3U0HA 4GYPA 3MVIA 1P43A 4GA8A 2NQLA 1RALA 3WIJA 1AMYA 3IS4A 2VFFA 1ZFJA 1XLKA 2HTMA 3FVDA 2ZQ0A 3B3DA 3FA3A 4WGHA 1MUWA 2DIKA 1TV4A 4PB3A 4E38A 4RZBA 1OK4A 2CC0A 1C8XA 4FF5A 1UR0A 3TTOA 5AB3A 1UKPA 1W9DM 5EBUA 2CKRA 4Z42C 2ACQA 4BQ4A 4Z1DA 1KLZA 4KWVA 3FXGA 4J27A 4DM2A 1W17A 4ERAA 2R1LA 4CU7A 5B80A 3CMJA 4C1NA 1PB0A 1HT6A 3R8GA 5I77A 1JQVA 4BF9A 1JGMA 1PL9A 4J2MA 3UETA 2DEPA 2C15A 1V79A 5IHSA 3EWWA 1M9HA 5L9FA 1WAUA 4F0RA 3NTYA 4ZFMA 3L2LA 3SB0A 4B90A 1DJHA 1EOMA 4QJ4B 2Y5JA 1H61A 1R3TA 3V75A 4JR5A 2JQXA 5EGRA 4Q8WA 4ZB0A 2XDFA 3V7PA 4AEFA 4FOUA 1MXGA 3F5KA 1BXNA 4AHQA 4CN4A 2O92A 1CXFA 3EX4A 3PN8A 3VD3A 4D8LA 1US0A 4EF9A 3WMCA 4PULA 4JPGA 4LVBA 5FF3A 3P62A 2WZHA 3ZVHA 2ZXAA 3HPZA 3AHYA 2QCGA 5T9BG 1JD7A 1TUFA 4MZ1A 1J0HA 3WLJA 2DVUA 4HK5A 4TXEA 1S5WA 1V93A 2Z2UA 2PDBA 4TVCA 1XPYA 1VR6A 4RW3A 4MPQA 4FOKA 2FZNA 2OKOA 5G1TA 2OODA 1TPB1 1VAHA 3CS2A 3FJ6A 2BX7A 4DX3A 3NQVA 4LNYA 3RITA 7PTDA 2WLYA 9XIMA 2BVYA 3CAVA 5CKSA 4ZA0A 2D22A 2Y63A 4IHCA 1J6PA 4E3VA 1VIZA 3C61A 4UOQA 3T2OA 3SFKA 3T4CA 3GAKA 3OVQA 3W2KA 1BGAA 4QR6A 2BVDA 2GDUA 4HU8A 1OQFA 1FKXA 3U9IA 1DWGM 6TAAA 5HXMA 2JF6A 2R9RA 4N9BA 2GVGA 1UD5A 3NVDA 3GLCA 4S3AA 3WEZA 4O10A 4N02A 1WDDA 1EJXC 4JTRA 4O57A 2GGEA 3MV01 2GJPA 2J8FA 4E2BA 3IK4A 1ZSXA 1KQYA 1MEHA 3B8UA 3NCOA 2VC6A 3ABZA 1FDYA 3W2LA 3KZPA 1R3QA 4Y9OA 4PODA 3MC5A 4ZVJA 3PWAA 3CV7A 3AIEA 3WLHA 1UHVA 5I3DA 4JTCA 3MMDA 2YLAA 2QDGA 4PBEA 4S3BA 3SN0A 3LRLA 4HTYA 2QYGA 2WM0A 4ERIA 4GGHA 1D9EA 3VOFA 3RFAA 3TX9A 1FCQA 7REQB 3OZYA 3PSWA 1R9YA 3GG0A 4O8RA 3W02A 5EY5A 5LYRA 3CB3A 1A5CA 3VNKA 1ODUA 4DLMA 1UD6A 3DG7A 3HMJG 3MCMA 3LZ5A 4FZIA 1A5MC 2YA1A 3MZNA 1V7AA 3ANUA 4JXCA 3V0SA 1XUUA 2Q6ZA 3DX5A 2RJHA 3QHOA 1GVYA 1TTIA 4V15A 2HJPA 5LIXX 4P7OA 4DXVA 3V18A 4JKMA 5D9NA 3GG8A 3GUGA 2PDWA 3WD4A 4CGTA 5HQLA 2R1PA 3WD1A 3NEVA 3CMFA 4BA0A 2P88A 3AIVA 4AUBA 1W9VA 1B3OA 3T08A 4IM4A 3WNKA 1EPVA 1JD9A 4C6EA 4FSAA 3STPA 2Q3RA 4ZEPA 1XIIA 4EACA 2EXOA 1U22A 2ABAA 4IQLA 5G5IA 1QHZA 4B9YA 3AZSA 3BDKA 4N6FA 2AL1A 2ZTJA 3WLQA 4H6QA 4MHBA 1FWEC 3QYQA 1CXIA 5CJMA 1LBMA 1P48A 1P6BA 1CGUA 1UKQA 4RDYA 4S3GA 3TIMA 4MWAE 1SZRA 2EF9A 5LHFA 3F2BA 2VVSA 4OZOA 1HXJA 4WVXA 4GQRA 4F66A 5E9AA 4IGNA 2ZDSA 1TUXA 4U28A 1BWLA 1X38A 4NAFA 3RU8X 2FGLA 2R1MA 1MDRA 4ATWA 7A3HA 3GZAA 4REQB 3TZNA 2OX4A 4B5UA 3TAKA 3VOGA 3RN6A 3S4TA 1SJCA 2LLEA 4LS2A 2DZAA 3TNBA 4AWSA 4YCPA 4OTKA 4PR4A 3DG6A 3UJSA 1TG7A 3QLDA 1K6WA 3TW6A 3MB9A 1IE7C 1H7OA 3TCSA 2XIBA 1PWLA 3BJFA 2QLYA 3T2PA 3MSGA 1GQJA 1UD4A 5J8LA 2FMOA 4M51A 1ZUAX 2A4AA 1KWKA 4S3DA 4Q8OA 4WXZA 1CWYA 1YQ2A 4XBJA 3CMGA 2V3EA 2AQVA 2J7FA 1UKSA 4KETA 2QQ6A 1UA3A 1L0PA 2WC7A 4GCXA 1WDQA 3NJ3A 3LHUA 5I23A 2V5LA 3MYPA 4HPXA 2YLLA 4GNKB 2GJLA 3SCSA 4FNPA 2XSBA 3MHUA 1Q7MA 4H9UA 3LI0A 3IGHX 2OT0A 1C90A 1H49A 4MWAC 1XL9A 3E0VA 3W6MA 1OD0A 3NO5A 1A53A 3LTYA 3T0AA 3MUCA 4NZJA 2DW7A 2IQTA 3N15A 3W1RA 4FXFA 3N4FA 3UT0A 1ICPA 3W22A 3TW9A 1EBGA 6PTDA 1KM5A 2HROA 3C3UA 1Z89A 1XISA 1CB2A 1KV5A 4GXPA 1HO4A 3KVLA 3A9IA 3WLKX 3W24A 7REQA 4A8LA 3IJ7A 3QF0A 3WSUA 8A3HA 2Y5EA 3PZIA 3WLPA 5BOFA 3G1XA 1UASA 2HMCA 4UOZA 1C3FA 6REQA 3A6OA 5AVNA 2ZC1A 3EMCA 4WR3A 4C65A 2I9EA 4RDZA 1J6OA 4IOTA 1HG3A 3ANVA 2Z1WA 3AFBA 5EA9A 3G1VA 1TSIA 3EOLA 3W1TA 3M0YA 3DIPA 4OV4A 2GGGA 3W7KA 3OO2A 4IIGA 2J47A 1V5XA 4KCWA 1QNOA 3ARQA 2L5HA 1QNSA 3PK7A 2QMJA 3EOOA 1FH8A 1V6YA 3GH5A 2F2HA 2XFWA 5A6BD 4FI4A 4DN1A 1WZMA 2CU0A 3R58A 2ZDRA 2OLAA 4JIPA 4NZ5A 1XLMA 3V35A 3RMJA 5K4ZA 1I45A 3GR7A 4PMYA 4AWUA 2XZ7A 4GVFA 1VHCA 4JX5A 4NI3A 2VZTA 4LNCA 2DFAA 4Z08A 4Q3MA 1PKYA 3UERA 2UY3A 5FF4A 3LI1A 5RUBA 2GJRA 3M0VA 1WBJA 3PUEA 4GY7A 3WF1A 3BCFA 4GC3A 4R5EA 5BXTA 3VDAA 4JKKA 4JIRA 1ZP3A 3CO4A 3EMQA 5EMKA 2PDHA 3EYPA 3KX6A 2WKLA 2V69A 4QGCA 4GNJA 2C14A 4AXNA 4XZWA 1WDSA 3MI2A 3SCPA 3TJIA 2DSZA 3RM9A 3UQNA 1V3IA 2B7QA 4PL2A 1GJWA 2DU2A 4WGXA 2ONEA 4DBUA 2PTDA 1IV8A 1TJPA 3P3BA 5LGZA 4ZFCA 3EWBX 2TRSA 2WCGA 4XZLX 4QG6A 4YWIA 2G3MA 4R53A 3P6LA 4R27A 3OBKA 1TJ0A 1IIGA 3E02A 1R2RA 3NL5A 2XGBA 1DOSA 3WX7A 1A47A 3SR7A 1TFVA 2PBOA 2Q09A 2VCAA 2FPYA 3CYVA 4I7VA 3PVFA 5EMMA 1TX0A 3ONBA 1M7XA 1R38A 4MKNA 1UUMA 1ITXA 2ZE3A 1REQA 2C16A 2IQ0A 4LVFA 4NZCA 4NVTA 3I6RA 5D38A 3GNRA 4P8XA 3GXIA 3PS7A 2GJXB 3EWDA 3W1QA 1XCFA 4JD4A 3S3GA 4S1FA 4DJFC 2QAFA 4LRSA 2ZA3A 3ZR5A 5D30A 1QK2A 1QRQA 1NOFA 3NZGA 4E4UA 1Y0EA 3RPMA 1PBGA 4K8HA 4O1EA 3GNDA 4DO5A 1DV7A 1AH0A 3PJXA 1NFPA 1Z41A 3BAIA 3B0PA 1TWWA 2C3ZA 2BASA 2DVXA 3LQGA 1OYCA 1S38A 3CAKA 2GWNA 2WMGA 3A47A 1KFEA 4DNMA 2ZX6A 3N14A 4B91A 3CPGA 4LXFA 2VR2A 2ALDA 2OSWA 3G1FA 4AH7A 9RUBA 2JKAA 4RZ4A 1H7XA 4D6HA 3PTDA 2TAAA 1RZMA 1A5AA 1UWQA 2XIQA 3D46A 3ITTA 3LPPA 4PZVA 5LIWX 4FNTA 1SSGA 4HNTA 5EB8A 4H2CA 3VPLA 4C6KA 3UR7A 3MJMA 4JNMA 3MMWA 2QIIA 3CQKA 1SYTA 4Q8MA 5HMSA 3G8EA 5A8NA 3OA3A 3T0TA 4L1GA 1Q3NA 5D09A 1I9CB 4KWSA 4FHAA 3TONA 1UIPA 4DRSA 2OLHA 4AIEA 3T55A 5D9PA 4RUBA 1Q66A 2QT3A 4E4PA 3TJXA 2ZRVA 3HA1A 4B9ZA 2X16A 1NEYA 4JYEA 4TX6A 3DOPA 1ZCCA 3TU9A 1TTQA 3QXBA 2VFIA 4IFOA 4PMQA 3B8VA 3B9EA 3U7BA 1EA0A 1UH2A 4CQBA 3W85A 3TROA 4NXKA 4LRTA 3KL5A 3PBUA 5BRBA 2J6XA 4Q4PA 3LV5A 5EU9A 4P2VA 1XYLA 4XD5A 1EHNA 2FTYA 2BHUA 4HU0A 1A5KC 3P60A 2Y89A 1EGVA 4OE7A 1R2SA 4J35A 3O2LA 2ZFAA 1ONRA 1QASA 1ZJHA 3NOYA 2XH0A 3C2VA 3MWAA 4O4VA 4MTVA 1J5TA 3H2AA 1CYGA 1NH6A 4OVXA 1YKWA 1OGBA 2ZRUA 1E51A 3BLOA 1W5QA 2V9DA 2X41A 3SY1A 1IR1A 4MNKA 3WDQA 5FA5A 3ES7A 1W8SA 3VUSA 1RY8A 2W5FA 3F1QA 4HHHA 3EA2A 4H9TA 3TN6A 2EG7A 3MKCA 3S2LA 3ITVA 1NJJA 3CPRA 4UTUA 4XK2A 2I7GA 4FP1A 1W3HA 1VEOA 3GNNA 5FF2A 1IR2A 1LCOA 1IQ8A 5ECUA 4TIMA 4GYJA 4UXDA 5C7VA 3UXLA 4U5IA 2OQHA 4FMVA 5D2TA 3THDA 3TQ0A 4I6KA 2DUZA 4F79A 2PSNA 3RRXA 1ZGDA 1AJ2A 4NX5A 2WK2A 3VMPA 5HNTA 1OWQA 3UEQA 2ODOA 3LPOA 1BSIA 1Y7VA 5CC3A 3D3AA 1P0NA 4GZ7A 4RW5A 2H3DA 4G7EB 5HBFA 1SFLA 2Y0FA 1EXPA 3DBNA 3A12A 3SRKA 1TWIA 2WMJA 3GNPA 5FSDC 2ZUMA 3NDZA 5HUPA 1EX1A 4C6DA 3NNTA 2OMAA 4GMEA 4O28A 3BC9A 1WZKA 3HM7A 3MUXA 3NDYA 2WHLA 1Q6EA 5B7YA 3NM3A 2E25A 3P5ZA 3UA4A 4UC5A 3GYCA 2GWGA 2D2HA 4I8DA 4W9TA 5A2CA 3S0CA 2VCBA 3URQA 1WXZA 1JAEA 3ABOA 5I78A 1YTEA 4ZE4A 3QW3A 3G5EA 3CHCA 1L6YA 2PDUA 2UZ9A 1U1UA 5J04A 1TV2A 1EDTA 3MV11 5AYXA 1JQXA 4RE2A 2XWDA 4HZMA 3M5VA 5A2BA 1WDRA 3L4UA 3DFTA 2CWXA 2PWFA 1K7XA 1NDVA 3W1MA 2VC9A 5U7SA 2F84A 2O9PA 4QFUA 3SCVA 1YDYA 1QTWA 4ZB5A 2JK2A 1O7AA 3ARTA 3VYLA 2CERA 1PX4A 3C5QA 1B3XA 1B4EA 3WQPA 1ZS2A 2CLHA 3U8GA 2V3GA 3Q2DA 3IACA 2NQZA 1VFMA 4KEUA 1S5TA 2QAPA 4ZMGA 4MDPA 3S9ZA 5FI8A 1VBHA 3QLLA 1F3WA 1JYXA 3PPFA 2QXWA 5ABHA 2R1KA 1EDGA 4J7RA 3NSXA 4QLLA 2VZOA 3MP3A 2QGHA 3M64A 1PYFA 4MUZA 3CAWA 2CLMA 4WEVX 2GVEA 1RP8A 3BURA 1TIMA 3M41A 3R6IA 4XAYA 2WBKA 1EJVC 3ORWA 1H51A 1TKKA 1ENUA 1UUOA 1EJ7L 4FS9A 5FL0A 2VEKA 3RK8A 1Y5XA 1XRVA 4W93A 3CZGA 3POCA 3MP4A 5AYZA 3BG3A 4MUPA 3N18A 2Z0IA 1EJUC 1HTIA 4C6IA 2GDQA 2ALRA 4GCAA 3S5YA 2WPGA 1VD6A 4QNEA 1WV2A 1OVDA 4NZ4A 1OGGA 1HIZA 1OINA 5HMEA 2X7VA 4DAIA 2DH3A 2E9MA 3M47A 3DEQA 1I4NA 3V0UA 1TPEA 2G3NA 4TOQA 2VFDA 1I2PA 4JY8A 5DXYA 3I6TA 3SM0A 3ABXA 5FESA 3G2GA 3JZEA 4HNOA 1XM3A 4AD3A 4GKLA 4O50A 3MKKA 1JL8A 3HG2A 1NARA 1FDZA 1XYBA 1EWDA 3WH6A 1OG6A 3OIHA 1Q8JA 2FH6A 3M0MA 1VENA 1UIOA 3LERA 3WH7A 3GXMA 5DY3A 2RDTA 2QGYA 1KLYA 1KM6A 4XZHA 3RHGA 3WKZA 4XQ6A 2NQ5A 5GPRA 1QCWA 1VH7A 3CUZA 1DJGA 4XUYA 1ZRQA 2C7FA 2YIHA 1W2VA 2FKPA 3BLPX 5AC4A 2CZDA 4AHOA 3NYZA 4NYYA 1L8NA 5FEZA 2WSRA 4L1XA 4AD5A 2FIQA 4UMBA 1KFBA 3MUY1 1O6IA 4QCEA 4MB5A 2NSXA 1MEIA 4WKFA 4K6AA 2WLZA 2XGIA 1E6XM 2OO6A 3SO7A 4PUUA 5HJXA 4LAKA 4OT7A 2J13A 4NJKA 2UWFA 3TZFA 1Q63A 1OX4B 2I57A 1XSIA 1W5MA 5DRIA 2DZPA 1NWSA 1VCGA 3L23A 3UJEA 3R2GA 4ZE5A 3IPWA 4E2VA 4MOZA 4XVDA 4WSJA 2A7NA 5D05A 5BU6A 1YADA 4DQWA 5DMYA 3F7JA 3RCMA 4O1BA 2VURA 4WK9A 1KCZA 3LD5A 1OT2A 3FJNA 3NXFA 3EX2A 1TELA 4J3TA 1JPDX 2G3FA 5FEPA 4J9JA 4QP0A 4JX4A 4PH6A 1XDMA 4M6QA 2PDNA 4DO4A 4W5UA 2WNZA 1W3NA 1OYAA 4H6EA 4Z2KA 3MDUA 1RK5A 4PL1A 2VX5A 5C2CA 1Y5WA 3U4FA 2E6YA 2DT3A 3S83A 2A3EA 3MPGA 4PUKA 2CNCA 2VX4A 2QR6A 2Y5SA 1XFCA 3GTNA 1RPKA 1KD0A 5JQ9A 1BYBA 1GOXA 3W7LA 2CZFA 3AHXA 3F4WA 2UY2A 3PWGA 3TYBA 1ZAJA 1CBGA 2VZVA 3DECA 4WSKA 2HS8A 2PP1A 3RF9A 1E0UA 4GLEA 2DZWA 1XGDA 3BG5A 4RX0A 3IUDA 1CGVA 2H9AB 2RFGA 3QZAA 3OOQA 2EO7A 3BGGA 3WJSA 2QJIA 1C8QA 4UR8A 4W89A 4A3QA 1BTCA 2DUAA 4K39A 2Z27A 3W26A 4YHGA 3VM7A 1BQCA 3HBLA 4PUMA 2OGYA 3WMSA 4J3SA 3QSTA 4YXGA 2PCQA