3CUIA

Cellulomonas fimi xylanase/cellulase cex (cf xyn10a) in complex with sulfur substituted beta-1,4 xylotetraose
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
314
structure length
314
Chain Sequence
ATTLKEAADGAGRDFGFALDPNRLSEAQYKAIADSEFNLVVAENAMKWDATEPSQNSFSFGAGDRVASYAADTGKELYGHTLVWHSQLPDWAKNLNGSAFESAMVNHVTKVADHFEGKVASWDVVNEAFADGGGRRQDSAFQQKLGNGYIETAFRAARAADPTAKLCINDYNVEGINAKSNSLYDLVKDFKARGVPLDCVGFQSHLIVGQVPGDFRQNLQRFADLGVDVRITELDIRMRTPSDATKLATQAADYKKVVQACMQVTRCQGVTVWGITDKYSWVPDVFPGEGAALVWDASYAKKPAYAAVMEAFGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exo-beta-1,4-glucanase
publication title Probing the binding sites of Family 10 and 11 Xylanases with extended Oligosaccharides
rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
total genus 133
structure length 314
sequence length 314
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2008-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3cuiA00
3T0DA 5I23A 4XZBA 1TFVA 3AXXA 1QI2A 1DWGM 3PTKA 4OUEA 5E9AA 1UD4A 3B9DA 2ZUTA 3PTQA 1NWTA 5M5DA 4JKKA 1V0MA 1EO5A 4HZ7A 4M29A 4PCTA 4U2ZA 3VGFA 3AHZA 1EDTA 1GOOA 3AQUA 4AD1A 4PMXA 4AWEA 4JKLA 3LPOA 4W7WA 2V3DA 3DYPA 2WMIA 3UR7A 2MANA 3OZPA 3FN9A 5LA1A 5GPRA 1VB9A 1W9XA 4MB4A 1E73M 1VRXA 1BG4A 3VU2A 1V02E 2VVNA 1EA9C 3VDCA 1EOMA 4AZCA 4HOWA 1WZKA 9CGTA 2D22A 1V3HA 4UZUA 3F4VA 1OT1A 1FA2A 4UFJA 5GNZA 4ML4A 5GNXA 2XFFA 4PCSA 1AQ0A 1C8QA 1XSKA 3VIOA 1EGZA 2VCBA 1TA3B 3UESA 4CN4A 3BC9A 3LPGA 3WF0A 2CNCA 1B1YA 1V0LA 3L2MA 1GOKA 3F5JA 3A4AA 1CXFA 1H1NA 2CKRA 1HP5A 2IXVA 5KZ6A 5HXMA 1FH7A 3FNDA 2J74A 3CIVA 2XGIA 3N1AA 4MAZA 4BQ5A 2BY0A 3I3BA 3K4AA 5I24A 3VMPA 2D20A 4TX8A 4MB3A 3RJYA 1UWQA 4XV0A 4E8CA 4U31A 1CXKA 2WHKA 1TMQA 3WNKA 4D1IA 2D2OA 1UYQA 4RE3A 1Z32X 4OOUA 3GM8A 2VT0A 1MW0A 2A3BA 2PBGA 5E6YA 1WDRA 1TE1A 3AIWA 4CKQA 2ESCA 1J0ZA 2WC7A 1J12A 1NOFA 1PX3A 3WD0A 2ZIDA 1TUXA 2EPNA 1GJWA 3I3DA 2E8YA 3G6MA 1UA7A 4WSJA 3L4WA 1XH1A 1KWKA 3WMSA 1JFHA 4KRUA 2CEQA 3CZ8A 1QHPA 4CD5A 4JCMA 5CGMA 1M01A 1UR2A 2XG9A 2JF7A 1PZ3A 3W27A 1BGAA 4P8VA 1CGYA 3ZM8A 4U33A 3VINA 2YDRA 2WK2A 3OLDA 2CITA 1XD1A 5LA0A 2DSUA 1QNPA 4HP5A 4M56A 1M53A 1K6AA 2A3HA 3NCOA 5GNYA 1E6XM 1D7FA 2XHYA 4YPJA 1W2VA 1E72M 4RL3A 4B9YA 1NP0A 3WFLA 3T08A 5CSUA 3WUBA 1QVBA 1RD6A 1C93A 4W84A 1HJSA 1MVYA 3GDBA 3W53A 2PF0A 4IUGA 4Q22A 3SUUA 4EK7A 2GK1B 2XVNA 2IXUA 2OSYA 1JZ3A 1JGIA 3RO8A 5AYIA 2HVMA 1DWFM 3OIHA 5HPOA 2XVPA 3AMCA 1R87A 1B3XA 5CZKA 1DWIM 1E5NA 1JYVA 2XVGA 5BXPA 3GZAA 1W1VA 1UD3A 2FHBA 3EYPA 4XX6A 1YHTA 3OGVA 3VUPA 1CENA 4WKHA 4CD4A 3EMCA 1HT6A 2XYLA 3MMWA 2ZWYA 1Q4NX 2WWCA 2XWEA 3GXIA 1V6VA 5HDRA 4S3JA 3L4XA 3UCQA 3CHEA 3D5HA 1RP8A 4W8BA 3AS3A 1CTNA 1ISZA 4MTVA 2D23A 3VD7A 2XPKA 5A6AA 1PAMA 2W66A 2GDVA 3ZJ6A 5A94A 1VFFA 2YA2A 3AICA 3WMBA 2DDXA 2DT3A 1VEMA 2J7DA 5CJ5A 1R86A 5ABFA 1S46A 4P7RA 3AHTA 3SUVA 1ITCA 4D6GA 1WDSA 3GYCA 4HA3A 2CBIA 5CPTA 2ZUWA 3ARPA 1HIZA 4KMQA 4R5EA 3AZTA 3UG3A 2XSAA 3W0KA 4PMZA 1ZJAA 2YDQA 3FHAA 1OGGA 3K8KA 1VFUA 5M17A 2D0HA 3ZT7A 2WNWA 4UR9A 1XCXA 1E4MM 4D6HA 1QI3A 2VC9A 1W9PA 4F66A 3ZMRA 2A3AA 1E4LA 4J3VA 1JIBA 1E15A 3L4TA 4M81A 5D9MA 1UWRA 1WDPA 1WCGA 2XM1A 5E6ZA 3ZR5A 1V02A 5C70A 3WSUA 3HJEA 3IJ7A 2W4XA 2WCGA 3W28A 1K9EA 2VX5A 1X6LA 1ZBWA 5CLWA 1Q6DA 4LX4A 1CYGA 2B31A 1OT2A 4GI8A 3WF2A 1VF8A 2WVVB 3O9NA 4D71A 4D6IA 1XSIA 3SURA 1JZ5A 2XSBA 1J0YA 1OGSA 2GVYA 1UZ1A 3WL1A 2WC4A 2CBVA 2G4FA 1UWTA 1GZJA 3AMGA 3A3HA 4EANA 3U7VA 1NQ6A 4IISA 2J7GA 1W3KA 1VEPA 2VUYA 1CGTA 3U5YA 3WUGA 3VTRA 1NM9A 5CXPA 1UD2A 3AIQA 3W24A 3GH5A 5A2CA 3CUHA 1G94A 4AIUA 2XM2A 1TA3A 4EE9A 2A3CA 1OSEA 2QPSA 2WZEA 1EQPA 1UKQA 1ZBKA 3SUSA 3TONA 1KCLA 2YIHA 2CESA 4W86A 3GH7A 3WH8A 1LL4A 2TAAA 4C7GA 3AHXA 3MU7A 2OSWA 2VL4A 2J7HA 2ZX8A 3POHA 3U57A 1MQQA 2RGMA 3ZO9A 4Z2HA 2DH3A 2VCCA 2QLYA 1JZ6A 4P8XA 4JHZA 1GQLA 1B30A 3ZT6A 1FP8A 3TTYA 5BYWA 4JCLA 1KXVA 3GNOA 1TVNA 2ZX7A 4TOQA 4KWUA 3VD4A 1BVNP 1SMDA 4JFVA 2J7EA 3SCVA 4ACZB 1D2KA 1US3A 1H5VA 3K8MA 2IUZA 4KRTA 5A6BA 4PMDA 2V3EA 3M7SA 1I1XA 4B16A 2BY3A 2Z1KA 4DWSD 4KGLA 2XWDA 3GXFA 1W1PA 5D9PA 4PMNA 2WHJA 3VIKA 1ISXA 1KBBA 1V3JA 3OLIA 2BFGA 3VNYA 2BS9A 5DO8A 3PZ9A 4NRRA 4X0VA 4GKLA 4AZBA 5C8BB 3AS2A 3NSNA 3WENA 3IAQA 4EKJA 3AS0A 4TTUA 2VOTA 3WDPP 2EJ1A 1CXEA 1M7XA 1JG9A 1B2YA 4HZ6A 4HMDA 5CGTA 1WKYA 3WBEA 1W2PA 2EPOA 5DT7A 2PI6A 3UEQA 3HN3A 1BYCA 1NARA 5E0FA 3WMCA 5JIPA 3VMOA 3IK2A 1V6YA 3VGDA 1JNDA 4J3SA 3WQ8A 3RM4A 4HPHA 1QNOA 2X8RA 3MMUA 1HKJA 2CCRA 2GK1A 4J7RA 5HOSA 4WKFA 1JZ2A 1XSJA 4QLJA 2QMKA 3JUGA 2YL6A 1R85A 4TVDA 5BXSA 4PN2A 1QPKA 1E0XA 3GBDA 1Y7VA 3PZTA 4IPLA 2VO5A 1MXGA 4QAWA 4P7QA 1XD0A 5A1AA 1UD6A 1B3WA 4E2OA 3VVGA 3RPMA 1FFQA 1UH4A 3ZJ8A 4Y7EA 3WNMA 1UQZA 1E1FA 2WW5A 1UKOA 3FXYA 4AZGA 4ZXLA 1JF6A 3THCA 4A4AA 2J8GA 3ALFA 1UH2A 4CU7A 4AIOA 5AY7A 4UOQA 5DEZA 4Q7NA 1GOQA 1V6UA 3BAYA 1JF5A 2JF6A 1GOIA 4W93A 5A8PA 2WMJA 3L4YA 2WMKA 3AHVA 2Y8VA 4B15A 4ZEPA 5M03A 1BAGA 1KB3A 4RE4A 3B9EA 1GQJA 2YL9A 4AW7A 5FOOA 1CXHA 1K9DA 2J7FA 1EDGA 1AQMA 1RP9A 1CNVA 4PSRA 2F61A 4UFKA 4M8UA 4CCCA 1CBGA 2GJXB 2J7CA 2FH6A 3PZNA 1BTCA 4AYSA 4GI6A 5FCZA 5DMYA 2E40A 2OWWA 2YLLA 3VO0A 1ESWA 3BAWA 1EHAA 4A3HA 3ZJ7A 1A3HA 1VFMA 1E9LA 3CZLA 4UQCA 5CPSA 5HNNA 4WKAA 1CEOA 4F9DA 5I6SA 2JALA 4H04A 3RDKA 4ZE5A 1DEDA 4AMCA 1VBUA 6CGTA 1H3GA 4CVWA 3WD1A 2EEXA 4J3UA 5FKYA 2DSVA 3WQ4A 4ACYA 4FLOA 4UTFA 2UY2A 3EDFA 3NSMA 4UFHA 1W32A 4B3LA 3TP4A 4AZ5A 2VZUA 3WD4A 3QHNA 3IJ8A 1UD8A 2ZX5A 3GNRA 2WVVA 1E0VA 2ZE0A 1DWAM 1ZBVA 3AMKA 1E70M 3I3EA 4A3YA 4D6DA 4M1RA 1EO7A 4HU0A 3CHDA 3SCOA 2NW0A 3WNLA 1E3XA 3ARWA 2J7BA 3IJ9A 1XYZA 4OBRA 4GINA 2VZOA 4RE2A 2WVTA 2DT1A 3NYDA 4LQ1A 4JHOA 1QHOA 4BQ3A 2QHAA 5JUVA 4AZHA 4AXNA 2OYKA 2CPUA 1XCWA 1KGUA 3RM8A 1CGXA 1CWYA 3VGBA 2O9OA 1MWOA 4EAMA 1WAWA 3TOPA 4NSBA 2WMFA 3N17A 2WKGA 4MADA 1E6QM 2VURA 4HZ8A 3SCQA 3SEPA 2GUYA 5A6JA 1HL9A 1HP4A 1LG2A 1IT0A 1G5AA 2FHFA 4LYPA 2DEPA 1J0HA 3VM7A 1V0KA 2J4GA 3WIJA 5CG0A 2NT1A 1GHSA 3PTMA 3WDRA 3IANA 2E9BA 1U33A 1ODUA 1JNEA 5CLTA 1IV8A 4CCDA 3WFZA 1GPFA 2DGAA 3WH7A 1NP2A 4WIWA 3CHFA 1UQYA 3RIKA 3WD2A 4UFMA 3AIRA 1JAEA 4CU6A 2CBUA 3VIIA 4ACZA 3AYRA 4D6JA 2BNJA 1BPLB 1LL7A 2XFYA 2WMGA 3ECQA 2FH8A 3ZOAA 2DSZA 4MDPA 1FHLA 2DT2A 2J62A 3AXIA 3D3AA 1DTUA 1GORA 3VDAA 3WQ6A 3T09A 2WWDA 4PMYA 4WJXA 3AMDA 1LWJA 3WNOA 2ZUVA 4PMOA 3CGTA 4OIFA 4TVUA 4GPNA 3VD5A 2GJRA 4M82A 4P7NA 2YBTA 1ISWA 4HTYA 5A2BA 2J8FA 1JYXA 2O92A 1BYBA 2ZWZA 3PZGA 6A3HA 1W9UA 3K4DA 1U2YA 3VIJA 1J18A 2EXOA 5ABEA 4QP0A 3DHPA 4LGXA 4KH2A 5ECUA 1UD5A 1QI4A 3VGHA 1RPKA 3ZQ9A 1CGVA 1E6ZA 1TZ7A 5D4YA 4GZIA 1V3KA 4H8VA 3WQVA 5BXRA 2YL8A 1L8NA 1QNSA 2GFTA 4ATDA 1W9VA 1C3FA 1JAKA 1OM0A 3CZGA 1CXIA 4P7OA 1UWSA 4W87A 2W5FA 3VGGA 1ZJBA 5A6LA 3TA9A 1NWUA 3MUY1 1QNRA 5I79A 3W6LA 2GJPA 4W8LA 4Z2GA 7CGTA 2DPEA 4U3CA 3WKZA 1W91A 3ARUA 4WLCA 1R8LA 5BROA 4UZSA 4Z2IA 1V6XA 4U3AA 4X9YA 3WQ5A 5A69A 8CGTA 4MNKA 3WL0A 4V28A 3K8LA 2JFEX 4QLLA 5AC5A 5EFFA 1PPIA 5FIPA 2VRJA 1CLVA 3A47A 1GQIA 3AS1A 3MO4A 3VDBA 3ZJKA 1ITXA 1WNOA 1DHKA 3TTSA 3CUIA 5A6BD 1ZS2A 5I2UA 1C90A 1X6NA 2G3IA 2VZTA 4WSKA 4PRWA 4U2YA 3WELA 3WF4A 4N0RA 5A8NA 1FH8A 1QBAA 4ZFMA 5D9OA 1XV8A 1H41A 1BSIA 1OWQA 2OSXA 1E1EA 4CCEA 2CETA 3CMJA 1QI5A 1JZ7A 2C0HA 5KEZA 1LG1A 2WKLA 2PWGA 2E9LA 4OBSA 3AI0A 2QPUA 3WDJA 3EMQA 3J7HA 1UKSA 2GJXA 5EMYA 4W89A 3AHYA 3T2OA 2WSKA 5I77A 4YN5A 4R27A 4YHEA 1B31A 1TCMA 5DT5A 1GONA 1BYAA 1PIGA 2X0YA 4AISA 1BHGA 4ATWA 4JAWA 2AOSA 2CIPA 3VD3A 2BHZA 3CBWA 1V0NA 1UKPA 1EDQA 1JZ4A 4W88A 3AZSA 4F9JA 2AAAA 3EDKA 3K1DA 3ZSSA 4AD4A 5IFTA 4XB3A 5IDIA 1XGZA 4L4PA 2JIWA 3BH4A 3SCPA 1G01A 4PUDA 3VX1A 3PZQA 2E9MA 1JD7A 3OA5A 3WNNA 4X0NA 1E56A 2WANA 1O7AA 1XRVA 3DYOA 3DECA 2ZX6A 4H41A 3VIPA 3VKKA 2D0GA 2V3FA 2WZIA 2EQDA 3WEZA 3PHAA 1FH9A 1HJVA 2VVSA 4AZCB 5FL1A 2NT0A 3GBEA 2EPMX 4FLSA 2CERA 1G0CA 1BLIA 4MB1A 4C7DA 1OGBA 2VZSA 3VNZA 5DFAA 3N9KA 1H2JA 4J3XA 3AIEA 3WF1A 1JD9A 2UWFA 1LL6A 2F8QA 3FAXA 5TD4A 5LYRA 3AIVA 1QNQA 4D1JA 1UKTA 1W9DM 4UFIA 1C91A 4MAVA 1RH9A 1SYTA 4AIEA 4URIA 3B9AA 2GDUA 4GO8A 4AD3A 4BQ4A 1KGWA 2J75A 4IPNB 2YBUA 4AC1X 2ZXQA 4NI3A 4CU8A 1SR0A 4PBGA 3CZKA 1E5JA 1FP9A 3WUFA 1AVAA 4MB5A 2VTFA 4IM4A 4JKMA 2RGLA 3ARSA 3VIMA 4BF7A 5M3WA 1KWGA 3FHQA 2FHCA 2JE8A 1V3IA 1GCYA 2UY3A 1ZB5A 1LLOA 2BY1A 5BRQA 4DM1A 3VD9A 2PC8A 3BMWA 1H49A 2XIBA 5BXTA 1ODZA 4JIEA 2XJ7A 2Y4SA 1KXHA 1WDQA 4PTXA 1CDGA 2VMFA 1MFUA 1UR0A 1HKMA 2BVTA 3TTQA 4PTWA 4Z2LA 3BXWA 5IXEA 3BCFA 2EPKX 1I1WA 4FF5A 4MNJA 2VX6A 5BCAA 5BWFA 3ARQA 1C7TA 3CLWA 5CSYA 1QOXA 1AMYA 1OB0A 4UQDA 1V3MA 4NF7A 4PMVA 3W26A 1BG9A 1UZ4A 3GTNA 1BQCA 4KGJA 1CLXA 2EO7A 3CZEA 2V5DA 3MSDA 3ZR6A 1LJYA 3UG5A 3WDHA 3AISA 3NJ3A 1ZBCA 2XGBA 1MW1A 1WO2A 2G3JA 1VIWA 5CPQA 2Y5EA 1BVZA 1JZ8A 4UQEA 3MV11 3DC0A 3S2CA 1BGGA 1HKIA 4DUXA 3PZVA 3CZJA 1HVQA 4PUEA 5CQ1A 2EBNA 1CGUA 3M07A 1HN1A 4HU8A 3WH5A 1MQRA 3W37A 3M6DA 2PB1A 5FD0A 5ABGA 3SCWA 2BHYA 5BRPA 2QV4A 2UY5A 1A47A 4W7VA 4H7VA 2C8NA 3T2PA 1KR0A 2Y8KA 4PTMA 3HU7A 1DWHM 1ISVA 3UR8A 4F8XA 4HOZA 4GO9A 4JFTA 3LPFA 3N13A 2VX7A 2BY2A 3BLKA 1WZLA 2WHMA 2F2HA 5I0DA 2X05A 3N11A 2G3NA 1GNXA 2XVKA 2ZUNA 1IZKA 3CUFA 5A8OA 3VDHA 3TTOA 3POCA 2XTKA 3F5LA 4AEEA 2WSPA 1GJUA 2BHUA 2VRQA 4BZYA 3ZIZA 4FLQA 3MUIA 1EH9A 4Z2KA 2W61A 4PYSA 3AOFA 1J0IA 4BA0A 1K9TA 3SCTA 4HPGA 1NH6A 1JI2A 1NOWA 3LMYA 3MS8A 3KL5A 3GXDA 2UY4A 3QGVA 2ZXAA 4CD6A 3AXHA 4H8HA 3DHUA 2WZHA 1UA3A 4GIAA 3RM9A 1PX8A 2VR4A 1TG7A 4FMVA 1HX0A 1F4AA 4UQBA 1VEOA 2V5CA 1UR9A 1UR8A 3O6AA 2WCAA 2OYMA 2FGZA 1SFSA 1V03A 1QHZA 3SUWA 1W1YA 3MSGA 1UH3A 4J28A 8A3HA 4C7FA 1KXQA 4TVCA 2XUCA 1HL8A 3AZRA 4QFUA 1OD0A 2X2YA 2ZICA 3CUGA 3BAJA 1KR1A 5A6SA 3AIBA 3QR3A 3U5UA 4B3KA 4D6EA 1FHDA 5D9NA 4E8DA 3NDZA 3BAIA 4OOZA 2J79A 4AY1A 5E70A 2Y2WA 1XH0A 2BVYA 1OD8A 2WMHA 2ZUMA 4UFLA 1V3LA 4BQ2A 3U7BA 3A6OA 5DF0A 4PSPA 3ALGA 3PBGA 1ECEA 2W91A 3L4ZA 1J0JA 1W9BM 3W6MA 3AIUA 2VNCA 4P8UA 1R7AA 3BAKA 4P7LA 3W25A 1PJ9A 2HISA 4QCFA 3G6LA 1F4HA 1J11A 4YHGA 4XUYA 1KFWA 3CTTA 2PWHA 2YL5A 1UOKA 2BXYA 3OBAA 3QHMA 2DH2A 4AD0A 2E8ZA 1WP6A 3WQWA 3ARYA 1EOKA 3FW6A 3VOCA 5A6MA 1H0IA 2G41A 1K9FA 4HA4A 4W5UA 1JDAA 3WH9A 3T0BA 2WXDM 4AD5A 3SCUA 3ARTA 1CECA 5AC4A 4UCFA 1D3CA 4J27A 4D6CA 1WZMA 4WK9A 2YJQA 2V3GA 1IZJA 1KGXA 4UQ9A 3WBAA 4MJ2A 3BAXA 3BSGA 4GQRA 1X1NA 4HMEA 3A4WA 2VZVA 1DP0A 5LA2A 1CIUA 2CBJA 3RMEA 1Q6GA 2DIEA 1C8YA 1PEZA 2OLHA 2Z1SA 5A6KA 1V6WA 3CO4A 1W1TA 3VILA 3LPPA 4HMCA 3N15A 3N04A 2Q8XA 2XVLA 1QW8A 1CGWA 1OCQA 1JXJA 3N18A 4ZENA 4CN1A 1KQZA 4LPCA 1HJWA 1OINA 2VX4A 1E0WA 2QF8A 2VQUA 5HBFA 4JZ5A 4LYRA 1CPUA 7A3HA 1KQYA 3OB8A 4JL1A 1B90A 1TVPA 2E3ZA 1LWHA 2G3MA 3OZOA 6TAAA 4M24A 3WDIA 1W3JA 4K68A 2YLAA 4M80A 4DUVA 5A2AA 1WE5A 1B3VA 4GZEA 1OIFA 1FFRA 2PBOA 2WPGA 2WCSA 2D24A 2VCAA 1E6NA 2O9TA 1UWIA 3CUJA 3WH6A 3ARRA 3OGRA 4JFUA 3EDEA 2WBGA 1MFVA 1NWSA 2YA1A 1I75A 3WNPA 1Q6EA 1J0KA 1JDDA 2OYLA 5I78A 3VM5A 2CHOA 1ISYA 3NSXA 2YA0A 1JXKA 1XHGA 4PMQA 3KL3A 1BFNA 3A4XA 3KWXA 5JBEA 3EDJA 1GVIA 3THDA 2D3NA 5GQBA 1VFOA 4JL2A 1SMAA 3S6TA 3MUZ1 1O6IA 1CXLA 4TX6A 1KCKA 4V27A 1H11A 4V2XA 4QDMA 1BF2A 2VRKA 3ZSTA 1MQPA 4F79A 1UR4A 3O2LA 4XZWA 5FL0A 3VIGA 1UUQA 4HA1A 2OWCA 1GQKA 1WPCA 3WF3A 1R7OA 5A8MA 1E3ZA 2O9RA 3W29A 3MV01 2D0FA 3GH4A 2X09A 3F5KA 3MANA 4L4OA 3VIHA 2JEQA 4UOZA 1H4PA 1E71M 1HJXA 2VQTA 3SCRA 4P8WA 4OKDA 4FLRA 4JFWA 5A3HA 5A8QA 5I5RA 1EQCA 4GI9A 2J47A 4QLKA 1JDCA 1NOUA 5D8WA 2WHLA 1L0PA 3AMLA 4CGTA 3W38A 3FY1A 3OLGA 2ZXBA 1PZ2A 2XIIA 4UOJA 3VGEA 2A3EA 1UG6A 4S3KA 1V08A 4CN6A 3B8SA 1E55A 4H2CA 1VJSA 3HMCA 3NUKA 4ATLA 3W82A 1Q6CA 1XC6A 4DWSB 2WLZA 1NWRA 1G1YA 1C92A 3T2QA 2WLYA 1AQHA 1BYDA 3OGSA 3EMZA 2ZUUA 3L4UA 3PZMA 2XFRA 4U5IA 3SCNA 3DYMA 3OG2A 5EFDA 3ZT5A 4PMRA 2EPLX 3OLEA 4W85A 1E40A 1VAHA 4WF7A 1C7SA 1E43A 5IFPA 3AFBA 1GW1A 1ZU8A 3BSHA 3BCDA 2V38A 2CHNA 1UHVA 3QOMA 5JIWA 4CD8A 3AJ7A 7TAAA 3ARZA 3SIMA 2WMIB 4CUCA 3PZOA 3M46A 2G8ZA 3CH9A 3VX0A 5E09A 3UETA 4AZ7A 2BV9A 4UQAA 1E4IA 4DM2A 4DUWA 3ARXA 4ZE4A 1UR1A 1OBAA 2DQXA 2FGLA 3QHOA 1LQ0A 2DSKA 2PWDA 1DWJM 1J9YA 3GXMA 4ZXOA 4MPKA 1J10A 2PWEA 3KE0A 4TUFA 3SCSA 5E0CA 2FDMA 2CKSA 3BGAA 2E4TA 3NDYA 1KBKA 1B0IA 1VENA 2CYGA 2JIEA 3KEHA 3CHCA 4JFSA 3FAWA 1QI0A 2DSWA 1MW3A 1G9HA 1MW2A 2C7FA 2E0PA 3QOKA 4MDOA 4HOXA 1E6SM 1P6WA 1TR1A 2O9PA 2WVUA 1JFXA 2J78A 3WEMA 2VR5A 2W63A 5A95A 1GOMA 4B9ZA 1H09A 1QBBA 1PX4A 3WY1A 1JL8A 3PZUA 2D3LA 4U5KA 5JBDA 2Y24A 3RILA 2DIJA 1CZ1A 2JEPA 3PZIA 3RJXA 1H0GA 4J3WA 2W67A 1E4NA 1PBGA 1XYFA 1HJQA 3WUEA 1C8XA 1VBRA 2WAGA 2BVDA 4MJ4A 5EB8A 3EBVA 4CD7A 2CXGA 1HXJA 3SUTA 2WM0A 3T0AA 4DWSC 2WYSA 2J77A 1E6RA 1MYRA 4CVUA 1FOBA 4TXEA 4PEEA 4MNLA 4GQQA 1EXPA 2X1IA 4GXPA 5C71A 3MKKA 3CMGA 4W8AA 4AEFA 2WBKA 3BMVA 3PN8A 1QW9A 5AYBA 1W3HA 2YDSA 1JYWA 3RCNA 4PMUA 1VJZA 5IHSA 1HNYA 4D72A 1JYNA 1N82A 1US2A 1Q6FA 1UWUA 4H8UA 1J01A 3APGA 4E4PA 2AMGA 3WDQA 2YKKA 1LF1A 2W62A 1B3ZA 4GZJA 2WC3A 3AROA 2ZOXA 4TTGA 1U30A 1GVYA 4Z2JA 1M04A 1EHNA 3NIYA 1XH2A 2VI0A 4MNMA 2X0HA 3N12A 4N42A 1HJUA 1GHRA 5IHRA 3BLPX 1HKKA 1WZAA 2GSJA 4D6FA 2ZX9A 4BCEA 2J25A 2ZUSA 5D8ZA 3VPLA 3WEOA 5I3DA 3WN6A 1B9ZA 1KXTA 2YOCA 3CPUA 2WB5A 1M03A 2VJXA 4J3TA 3IAPA 1GOWA 4NZCA 4PTVA 2NSXA 4W5ZA 2PWFA 3WD3A 5ABFB 1YQ2A 4QCEA 2ZXDA 2W92A 5HPCA 4AZ6A 3AYSA 2BXZA 3K46A 3W4RA 1ZL1A 2D1ZA 3VMNA 3GNPA 4OZOA 1B3YA 1EIBA 1W3LA 2WVSA 4UNIA 1GUVA 5EBAA 3EDDA 4NRSA 1HVXA 4AD2A 4OJYA 3L2LA 3UERA 3MMDA 4BS0A 4AZIA 2DT0A 1JI1A 3MUAA 1OIMA 3ARVA 3KZSA 4LXFA 4FK9A 5ABHA 1E6PA 3VIFA 4W7UA 1HF6A 3KL0A 5JBFA 3UG4A 5F7UA 1MXDA 1WB0A 1PIFA 2OWXA 3W81A 3E1F1 3II1A 2QMJA 4LYQA 4DWSA 3L4VA
chains in the Genus database with same CATH superfamily
4C6KA 3T0DA 5I23A 3B0XA 3PTKA 5E9AA 4OUEA 4OTKA 3N73A 5C55A 2J9YA 3QH2A 1NWTA 4AVFA 2E7FA 1OFBA 2PLCA 3OOQA 1AZ1A 1TWWA 3T07A 3M0JA 4HZ7A 4AFYA 2O56A 1S5MA 4PCTA 1EJSC 3IWPA 5G1TA 3AHZA 2UV8G 3LMZA 2VGGA 1GOOA 4P5UA 4UNKA 1Q63A 4JKLA 2NQLA 5DCBA 1RJQA 5IOBA 4S3DA 4F2BA 1XLGA 3E5BA 3LCGA 2WMIA 1XUUA 2V68A 5GPRA 3GDMA 1VB9A 3E2VA 3CAWA 1BG4A 3NR0A 2RDXA 3QV7A 4BKNA 1LRQA 9CGTA 3UXDA 1V3HA 2VC7A 1PXGA 2RJGA 3F4VA 1OT1A 2Z2AA 1FA2A 4UFJA 4CNNA 2F2KA 1C8QA 3WFAA 1EGZA 3WYZA 1WX0A 3ONBA 3HQOA 4L1WA 2FPVA 1DJIA 4DBWA 3FX4A 2CNCA 2R82A 2DQWA 4Z0SA 2GVGA 1J96A 3UGVA 3H7RA 4BEUA 4M5PA 1H1NA 4IG2B 4J2PA 2IXVA 5KZ6A 3MVTA 1A5CA 2HQAA 2XGIA 1GTEA 1PL9A 3EGJA 4LY8A 4NZ5A 5I24A 2D20A 4MB3A 4O0QA 4E8CA 3NEHA 1AH0A 4DLFA 3WNKA 3PY2A 4N4PA 1Z32X 2QDHA 1SFJA 4OOUA 4AHQA 2QJMA 3GE7A 1OX4A 2DW6A 1J0ZA 4A2SA 3STPA 4C6LA 1J12A 2EPHA 4AQLA 5G4EA 2E8YA 4R33A 4WSJA 1TB3A 2VM8A 5C6MA 3PB2A 3ZLGA 4KRUA 3KZPA 3TDFA 2NX1A 4CD5A 3BURA 4G9PA 5CGMA 4LVDA 4JTDA 4WXZA 3TR9A 1B54A 4JEQA 1UR2A 1WV2A 4NKCA 1WDDA 1REQA 2I57A 3W27A 3RXZA 1BGAA 2AL1A 4YVXA 3VINA 4MYXA 2QJGA 4RZBA 2WK2A 3OLDA 1XD1A 2DSUA 4HP5A 1NJJA 1K6AA 2XN2A 1H5YA 3NCOA 1E6XM 3NQ6A 3ZR4A 4CNTA 4O54A 3F7JA 1O4UA 2CLLA 3DZ1A 5CSUA 3GDBA 2DZWA 2QEZA 4FXJA 2AMXA 4CQ9A 2IXUA 2F9RA 3Q65A 2VFDA 1UBSA 4JIIX 1JZ3A 3RO8A 1Y5VA 2XH0A 2HVMA 5JXQA 4EWND 3UCCA 3QV9A 1DWIM 4GKTA 1IEXA 2XVGA 5BXPA 3GZAA 3OA3A 4BEQA 2J8TA 5HMFA 1KRMA 3EYPA 4XX6A 3Q58A 3W01A 3FYPA 4LUTA 1HT6A 4IIGA 5FESA 1XBZA 2XWEA 2Q09A 2QCNA 1JPDX 3L4XA 3MKCA 3D5HA 3FVDA 1RP8A 4H7ZA 3L9CA 3VD7A 5A6AA 2VFIA 1AL7A 1FKXA 4Q8QA 4HQVA 5A94A 1H7NA 1VFFA 1L6FA 3U2ZA 2ISSA 1SZRA 2HMCA 3MCMA 3SUVA 1WDSA 2PGWA 4GYFA 2PDQA 1R9ZA 5FJUA 2Q3RA 4YU1A 2ZUWA 4M51A 4QJ3B 4KMQA 4UTUA 3AZTA 3JRKA 2OR2A 4PMZA 4JXCA 3B05A 3FHAA 3QR0A 3VKAA 1FVPA 2ACQA 3WJZA 3RX2A 3A23A 3ZMRA 1E15A 1YXCA 3UPBA 5RUBA 1RPXA 3EWUA 3TYCA 1TTJA 1OYCA 1WDPA 3HQ1A 1OFPA 4MWAE 2IQDA 3S5OA 3B8UA 5K9CA 2WCGA 4ADTA 3W28A 2VX5A 2R6OA 3V35A 4LX4A 1CYGA 2B31A 3WF2A 2WVVB 3PAOA 4WY0F 3O9NA 3RPTA 4D6IA 4HPJA 1XSIA 1ADDA 3LX9A 1JZ5A 1J8VA 3FOKA 4IL2A 1OQFA 3U8GA 1UWTA 4C5YA 3AMGA 4H19A 3U7VA 3G18A 4BWLC 1NQ6A 2J7GA 2XFWA 5C5YA 2VUYA 4HBKA 3U5YA 3WUGA 1KFJA 5CXPA 3DHFA 3E02A 2X40A 3RPDA 2C91A 4AIUA 2XM2A 3HPZA 1K8ZA 1R38A 2QPSA 1UKQA 3MSRA 3OIXA 1XYLA 2F6XA 3SW6A 3IIZA 1SFLA 3GH7A 1YTEA 1JGMA 1LT7A 2PDUA 4IG2A 1JULA 1K4GA 2OFJA 3JZUA 1RVKA 5C9UA 2J7HA 3OG3A 4E3TA 2WKJA 2RGMA 3DI1A 3ZO9A 1JZ6A 1G6CA 4ZB0A 4JHZA 1EGVA 1HO1A 3TTYA 1MUMA 4B5TA 5LGZA 4Y9OA 2ZX7A 4TOQA 3SCVA 1VGAA 4ACZB 1D2KA 1US3A 1H5VA 2P10A 2PDXA 4I90A 1JCJA 5G4WA 4Q8VA 4KRTA 3WLLA 1I1XA 1DIDA 4IJBA 3DOPA 4AYGA 1KBBA 2PSNA 2Z2UA 2BFGA 3LD5A 3QJAA 5DO8A 3PZ9A 2V67A 4GKLA 4AZBA 3NSNA 4GE8A 4KBXA 4TTUA 3W7RA 1M7XA 3UZJA 1JG9A 2NLYA 3L66A 4YS1A 4FOJA 4F48A 1KD0A 4QEEA 1QOQA 3WBEA 4A6GA 1UOZA 3K1GA 2EPOA 3WBWA 3ZFHA 3WLJA 3UW6A 4KIRA 3UEQA 1BYCA 1XFCA 3IK2A 1V6YA 5D33A 1SVDA 4IPIA 3UWUA 3HZ3A 1VCGA 3RM4A 4HU3A 5K4XA 2VHLA 2VOMA 5A5WA 2CCRA 3TW9A 4J7RA 4WKFA 1A50A 4DJEA 3GHSA 3GVVA 4QLJA 4NVTA 4WVXA 5XINA 2QMKA 5BXSA 3GBDA 1E0XA 3PZTA 1IIHA 4B4FA 4IPLA 2VO5A 4ES4A 1O5KA 1XD0A 5A1AA 3TYZA 4O53A 2W79A 3RLVA 3RPMA 3ZJ8A 3BL3A 4KCTA 1E1FA 4C60A 1PZ1A 1CT5A 3FXYA 3DHDA 4AZGA 4ZQNA 1JF6A 1T99A 4YWIA 4A4AA 4M19A 9XIAA 4QG6A 3BAYA 4JTAA 3VAVA 4C6PA 4QDWA 3FLUA 4W93A 4HK6A 3BW2A 4I9MA 3GIQA 2G50A 4CQAA 3AHVA 3VNLA 3GSMA 4OGZA 1HTIA 3SQSA 4RE4A 4ILSA 2YL9A 3C0JA 1ZAIA 4PCNA 3PPGA 1RALA 1RP9A 4CCCA 1KM3A 1P48A 2PFHA 4M8UA 2FH6A 5FCZA 3UXAA 3O3RA 2VWSA 3FJ6A 1ESWA 5LIKX 3BAWA 3NURA 1E9LA 4UQCA 2JALA 4A3QA 1X1ZA 4DF2A 4YCOA 3W7GA 5CBJA 3CHVA 1VBUA 4GY1A 4LRSA 2EEXA 3GVGA 2PTDA 3WQ4A 1SZFA 4FLOA 5F4SA 4UTFA 1JQXA 4BF5A 3WK2A 1ADSA 1DHPA 2NSOA 2QW5A 4FEZA 2WVVA 2ZE0A 3HO8A 3DDMA 1E70M 4M1RA 1EO7A 3IJ6A 1VJIA 2F6KA 3IJ9A 3P82A 3BWWA 1XDLA 1VH7A 2ASHA 2GQ3A 3MW7A 2Y7FA 3LRKA 2CZFA 1OC7A 4QJ4B 1WXYA 2CPUA 4Z42C 3INPA 4FIQA 2G4JA 1RCOB 3QV6A 4RJEA 3Q2DA 1JEZA 6PTDA 2WMFA 2WKGA 2VURA 1LG2A 3STGA 3KP0A 2J4GA 3EXSA 2NT1A 1Q2SA 3PTMA 1Q8AA 3WDRA 2A7RA 1ODUA 3VDGA 3DUGA 3WFZA 3XINA 1GPFA 3MWCA 4C6MA 4DLMA 1VFLA 3WD2A 3AIRA 1JAEA 4CU6A 4ACZA 3S6DA 4D6JA 4K7VA 1LL7A 2OZ0A 1DQXA 2WMGA 1DJQA 4O8RA 1XC4A 1FHLA 2J62A 5AHFA 4C6OA 3NZRA 4XD6A 1P0BA 2YPIA 3NOYA 4WJXA 1UMLA 3EAUA 2NXIA 2RDUA 3OODA 2ZUVA 4US6A 5I3FA 4O0ZA 3CGTA 2DUAA 3UG8A 2E09A 1XIBA 4GPNA 3VD5A 3PWGA 4HTYA 1ISWA 3PJWA 3VIJA 5F2LA 3L68A 1QI4A 3T9PA 3SZ8A 3GFXA 4A35A 4NIRA 5C7VA 1CGVA 5FSDC 4H8VA 4ZSTA 1LOQA 1UMYA 2PMQA 2Y0FA 3ATZA 3SIZA 3HB9A 1C3FA 1JAKA 1T6MA 3K13A 3L65A 4RUBA 1L6WA 4O4VA 4W87A 2W5FA 3VGGA 4GUHA 4Z2GA 4JNZA 2W0UA 3USZA 1EBHA 1ZAHA 2FFCA 4KT2A 4UZSA 1FDZA 1V6XA 4HNTA 2V2HA 8CGTA 3WL0A 2JFEX 3V0UA 5AC5A 1EPXA 4IMCA 2OCZA 2FZNA 1FWIC 1GQIA 1HGWA 3MO4A 3WO8A 3ZJKA 1ITXA 2AAMA 4GWEA 4JOMA 1EC8A 2XN1A 3G8RA 2GGJA 1G7UA 2RKXA 3WF4A 4WJ8A 3LA4A 4ZFMA 1XV8A 1H41A 3N34A 5I3IA 4IXHA 2CETA 2C0HA 1VLIA 4KF1A 2QQ6A 5KEZA 1RJPA 1LG1A 2WKLA 3VOJA 1NDZA 2PWGA 3ABOA 4FP1A 2PU1A 3G3DA 3E38A 3V5CA 2QPUA 3VKDA 3WDJA 3I65A 5TBOA 4G7FA 3W84A 3BLDA 3T2OA 4DXVA 5I77A 4YN5A 5AZ0A 1A4MA 1B31A 3SO7A 5CPLA 2YSWA 1UBPC 1H7WA 2PDNA 1BYAA 1PIGA 2HEJA 2R1PA 2X0YA 3QY8A 4ATWA 3VD3A 4O8AA 1V0NA 1B3OA 2D2GA 1JZ4A 1K77A 3RITA 1IEWA 4N9CA 1VYPX 4XD4A 4L64A 2OJPA 3KOXA 1G01A 4PUDA 5DRIA 1N8IA 1NVMA 1VLWA 3GIPA 1IR2A 4DJED 1W5QA 3OA5A 2GQ8A 3FKKA 5KZEA 3V5FA 1XRVA 3DECA 1EPVA 3QN3A 1PYMA 4H00A 4HCDA 1OJXA 3GX9A 1KM1A 3H2AA 4H9XA 4F3HA 4AZCB 2XDFA 4ZQRA 4K2SA 4Z1AA 2C6QA 2NT0A 2EPMX 2CERA 3GTIA 2XN0A 1YMYA 1BLIA 4MB1A 2GVEA 3TX9A 3VNZA 1JRBA 1JD9A 3KBNA 3MYOA 3LUTA 1FQ0A 1SW0A 4EXQA 4QAIA 3EB2A 4ORIA 1TJ0A 4D1JA 5BOEA 3PBMA 1U83A 3JVAA 1RH9A 4H1ZA 1SYTA 1R3TA 4ZO7A 4HVXA 4FNPA 3LLFA 4GFIA 4XD5A 1W3TA 1JCYA 2J75A 3U4FA 1W8GA 3IIVA 2ZXQA 3AJXA 1QASA 3SSZA 1FP9A 3EPMA 2RGLA 1XYCA 3P5YA 2Z28A 4BF7A 5M3WA 1KWGA 1YNQA 4NHVA 3H6OA 4AIBA 4FIRA 2JE8A 4JTFA 4DYEA 5BRQA 1UCWA 4XO7A 5BXTA 2BTMA 4Q8TA 2WM1A 3UWWA 3GB6A 2VMFA 2H3BA 4DBSA 4IFKB 3VNDA 4ZOCA 1O95A 4XK2A 1DXFA 4MNJA 3VI2A 2VX6A 1Z42A 5BCAA 3ARQA 1LBMA 3LU2A 2C14A 3GG7A 4PMVA 3PULA 1QK2A 2A79A 1BG9A 4H6KA 2ODOA 4JX6A 3B4YA 5HQMA 2AQVA 4MOZA 6TIMA 3GW3A 1SUXA 1QATA 3NJ3A 1ICPA 3TYEA 4UTWC 7ENLA 2ZE3A 3G24A 3OBKA 3RU6A 2XGBA 1MW1A 4L6OA 4IMDA 4GH1A 2O7QA 4UQEA 3NYZA 1AL8A 3C56A 4DUXA 3PZVA 3CZJA 4B4HA 1HVQA 4AB4A 5T9CE 3WH5A 1MQRA 2PA6A 1C9WA 5FD0A 3SCWA 1P0KA 2UY5A 3HG5A 4YWSA 1KR0A 4PTMA 4WD0A 1DWHM 1ISVA 1OFEA 3UR8A 3E2SA 3ZLFA 4JTKA 2VX7A 4JIHA 5BOOA 2DZUA 3N11A 3LRMA 4WHBA 2R24A 1UB3A 3A5VA 3CUFA 3DFQA 4O14A 2HROA 3CQKA 4LF2A 2HE5A 1GJUA 2VRQA 1CI1A 2Y85A 3R13A 4FLQA 3CXOA 4X9SA 1EBGA 1J0IA 1JCMP 4BI6A 4BA0A 3GUGA 4H4IA 1YPIA 2V2DA 2QUTA 1M7JA 1JI2A 2OB3A 5BWAA 5D2WA 3MS8A 4IWWA 3KL5A 3RN6A 3QGVA 4ADSA 4BFAA 1N2VA 4S38A 1S2UA 2VR4A 4FMVA 3SY5A 1F4AA 5CC5A 3ZS4A 1VEOA 3LCXA 1Q6QA 4JBRA 4NT0A 4HSOA 3HA1A 1I6NA 2QAFA 1W1YA 3UY8A 3MSGA 3Q4DA 8A3HA 4LVFA 3BJSA 3LTPA 2BVWA 1KXQA 4TVCA 4PTDA 1OD0A 4O1AA 1S1RA 1EGMA 2ZICA 3GHTA 2PCEA 3U5UA 1DBTA 3SAZA 1FTXA 5D9NA 3W2LA 2PC4A 4TR9A 3BAIA 4OOZA 1EYEA 4AG0A 1XI3A 2X30A 4S3EA 4KPLA 3HV9A 4NQ1A 3LRLA 3QGAC 2NXHA 1WXZA 1WKDA 1YDNA 4PSPA 2OXNA 4UCGA 3W6MA 5AC7A 3B40A 4AX6A 3NQBA 4ONVA 5ABTA 3BAKA 3GIYA 4P7LA 3W25A 2HISA 2WQPA 4QCFA 2GUUA 2NUXA 5B7ZA 1YKWA 3CPGA 3OBAA 2BXYA 4AD0A 4GGHA 4ERIA 2E8ZA 5CC6A 1WP6A 4UMAA 2X41A 3EEGA 2IKHA 1AD4A 1EOKA 5A6MA 3A13A 3T8LA 2FJKA 4W5UA 1W6TA 4LVAA 2IS7A 4L9YA 5AB3A 4Q8UA 2X1UA 3SCUA 1FWCC 3ARTA 1ME8A 2J66A 3AO0A 4EWJA 4UCFA 4LB3A 1HG3A 1R3RA 3M5YA 4J27A 4WK9A 1I2OA 2V3GA 1MMFA 4UQ9A 4P61A 1D3GA 5EYWA 1DP0A 3R11A 4RZ4A 4LVBA 4D2JA 2Z1SA 2OLHA 1V6WA 2OG9A 4HMCA 3N15A 3B0UX 1JXJA 3T0TA 2VQUA 5HBFA 3IUHA 1E9ZB 2I14A 7A3HA 2HVNA 1K8XA 4IFKA 1XINA 4JTSA 3RK8A 3W7OA 1DIKA 2E3ZA 3TN5A 3OZOA 3WDIA 4IMEA 4PRRA 2A21A 2I7GA 4IUOA 2YLAA 3NVTA 4DUVA 2RJHA 2XIMA 3QSTA 4HJWA 4REQA 3OYZA 3ZWTA 4BJHA 2D24A 2TYSA 2VCAA 4QHRA 2DFAA 1T8XA 4LAUA 1K7FA 3AWNA 5REQB 3EDEA 1TV4A 1J0KA 1JDDA 4FF7A 2PDMA 4H2HA 2WNQA 2CHOA 4H6EA 3ID7A 1WBHA 1XHGA 4WX2A 4DVOA 1TWZA 1W3NA 1N55A 5GQBA 3NO1A 3PBVA 3T81A 1O6IA 4V27A 3LHTA 1H11A 3ZSTA 1MQPA 4F79A 3NQAA 4WUIA 4XZWA 3VIGA 1UUQA 3OVQA 1WPCA 1TCDA 1FWRA 3CWHA 3NZQA 5G4HC 3G0XA 2I16A 3QEZA 4GG9A 4K6AA 2OEKA 4KWWA 4RR4A 3RO6A 1BEUA 3CQ0A 2P0OA 1YEYA 2GZXA 4ASTA 3SCRA 2EJAA 5SWUA 4OKDA 4AC7C 1I2PA 4IMFA 4GYKA 5M2FX 5I5RA 4GI9A 1XPGA 2HSAA 1NOUA 5D8WA 3AMLA 3C0SA 1O5QA 4GCXA 4R7OA 4UOJA 3VGEA 2PTWA 1SJBA 1UG6A 1SPQA 1IHIA 2Z26A 4S3CA 3L5AA 4CN6A 5FJJA 4H2CA 3HMCA 4DWSB 1G1YA 1C92A 2GWGA 1X7FA 2WLYA 1GWJA 1SZGA 3QTPA 3DYMA 3OG2A 3ZT5A 2EPLX 4YTTA 1E40A 3VNJA 4WF7A 3CM4A 4NZ4A 1ZJIA 1OFDA 3AUJA 4CQ8A 2NWRA 1UHVA 3PNUA 3COTA 5D03A 4CQDA 5DRCA 3VZXA 3IACA 5CZJA 3IS4A 3CAQA 4W9TA 2G8ZA 2ZRUA 4WDUA 1EC9A 3LHVA 1P4CA 2DJXA 5I3GA 3FK4A 5LHEA 5G2HA 2V9DA 3B8VA 3H4GA 3QHOA 1R2TA 2HNEA 2DSKA 4TIMA 4AX7A 4IQEA 3M5XA 1J9YA 3GXMA 4ZXOA 4MPKA 3H23A 3T78A 3KE0A 3ZVHA 3PBYA 5E0CA 1QTWA 3CWOX 1T40A 3BVJA 3BGAA 3WQOA 1RY0A 5TNVA 3CL8A 3W1QA 2JIEA 1Z6KA 1DE5A 2ZVRA 5AYYA 3ITTA 2GGIA 3MHUA 3W2JA 3QC0A 1MW3A 3NGJA 1OZMA 5FF7A 2E0PA 2YGYA 3IVTA 3NQCA 4FXRA 4MWAD 4MDOA 2OQYA 2W63A 4HB7A 2J6XA 1LCOA 4DYJA 3WY1A 4C91A 2CZVA 2D3LA 3NDOA 4U5KA 3V36A 2Y63A 1CZ1A 4IIBA 5AFDA 3PZIA 1H0GA 2ZQ0A 4OV9A 1MUWA 3EEZA 4ZQPA 1E4NA 3B0PA 3G3MA 5E93A 1MEWA 1D9EA 1H62A 1XYFA 1HJQA 4JTQA 4JQ2A 3R79A 2DVTA 1QPRA 4I7UA 4KERA 4XAZA 1KLZA 5LIYX 3LQLA 1JRCA 3S4TA 2WYSA 1E6RA 1UPMB 4CVUA 1A0DA 3C61A 4K38A 2VGFA 4TXEA 3A12A 4PEEA 2I1OA 4GQQA 1EXPA 5F4WA 3V4BA 1NF7A 1XR2A 2HS6A 3CMGA 4W8AA 3BMVA 3RU8X 3HPAA 5AYBA 3LV5A 3UZYA 2Q02A 3I6TA 3R2GA 1US2A 5F2GA 1KBJA 1J01A 4JN8A 3H24A 5REQA 4FB7A 3PANA 2YW3A 3LXAA 2W62A 3P84A 2BOGX 3AROA 3YPIA 1U30A 3HQNA 1GVYA 4Z2JA 2QKFA 3W73A 2C3ZA 1XH2A 2PEVA 2VI0A 1NAL1 3CJPA 1GPWA 3M6YA 3BLPX 1JPIA 1WZAA 2GSJA 3I6RA 4GXWA 3FCPA 3WEOA 3WN6A 5BMWA 4EX4A 4DI8A 2YOCA 4Y2WA 1M03A 1WA3A 2VJXA 3CQIA 1T7LA 2Y61A 1GOWA 3UWVA 5MHBA 2NSXA 1ZUAX 4AVOA 2PWFA 3UT0A 2AL2B 3PFMA 1ONRA 1FWDC 4AZ6A 4LUIA 1ICQA 1Z7AA 3W4RA 4LT9A 4HPXA 4LY4A 3LZ5A 3R0KA 3FSTA 3EDDA 1G4PA 5FF4A 4AD2A 3BMXA 3KRSA 3L2LA 3T4WA 3C8NA 2VWTA 3ZZ1A 2X1SA 4BS0A 2GDQA 3H53A 4QS5A 3MUAA 1CB2A 3EKZA 5D32A 4FK9A 5ABHA 3K30A 1BXCA 3VIFA 1HF6A 3NVDA 3KL0A 4YYCA 1EUNA 4M0XA 5KZMA 1OVDA 3KRBA 5F7UA 3W81A 3W7HA 4DWSA 3OJGA 4QROA 4QNEA 5LGXA 2ISVA 3UWEA 4XZBA 1TFVA 1DWGM 1UD4A 3T8QA 1JQVA 3BJFA 1HQTA 5DXXA 2A2IA 4JKKA 4UTJA 1E9YB 1V0MA 4BI7A 4U2ZA 4O1EA 1Z48A 3AQUA 4PMXA 5IRPA 3TZFA 1R2RA 2F6UA 4FNRA 2MANA 3TQ0A 3FN9A 5LA1A 1W9XA 1E73M 1VRXA 3C52A 2ISDA 3V0TA 2VEGA 3GW0A 3VDCA 3EWYA 2E67A 4HOWA 1WZKA 5H8PA 2D22A 4EAYA 2WQDA 3GXTA 1S5TA 1AQ0A 2VCBA 2Y6ZA 4Q33A 3UESA 4CN4A 4JTIA 1UZHA 2J88A 2E5BA 1GOKA 3L2MA 3F5JA 4YTRA 1HP5A 5HXMA 1NF0A 3FNDA 1SR9A 2J74A 2HPMA 1IIGA 1RBLA 3N1AA 4MAZA 4X2PA 4BQ5A 1DKWA 3RJYA 2WZTA 1CXKA 3KS6A 3GHUA 3I10A 4D1IA 2D2OA 4RE3A 2VT0A 1WDRA 3UCDA 2ESCA 3EOSA 4KFPA 4LALA 3THAA 3UJFA 1RZMA 3WD0A 3I3DA 5ENLA 5AVHA 5CJMA 3G6MA 4DNMA 4QITA 3WLMA 3WJSA 2VEMA 1QHPA 4JCMA 1AG1O 3CV1A 1KFKA 4L6DA 2XG9A 4FR6A 4XIAA 3IEBA 4XKYA 1WKEA 4P8VA 1K3UA 1GYNA 3SQMA 3PWIA 1RBAA 2YDRA 1TPUA 5LA0A 1LBLA 1M53A 3MUCA 3MO7A 3ME3A 5KTLA 4Q4PA 2ZRXA 1GW9A 4DPPA 2XHYA 4BK9A 3CWNA 3WFLA 1QVBA 4GH3A 3RR1A 4PEKA 4IUGA 5AYXA 2B0MA 1O5XA 2QDEA 5EMLA 5D02A 4L6HA 2XVNA 2DVXA 3I7RA 3TCEA 5HPOA 2XVPA 5CZKA 2H8ZA 1E5NA 4RCXA 1JYVA 1HL2A 3UY7A 2FHBA 3LLXA 1YHTA 3EWCA 3OGVA 1CENA 4CD4A 3EMCA 3VK5A 1SO3A 3TA6A 2ZWYA 3U3HA 1Q4NX 1AK5A 3N2TA 2BASA 4N4QA 1XW8A 4YVPA 1F3EA 3ZLHA 3QPEA 4S3JA 4KWOA 2W9MA 5DN1A 3NM1A 3H2NA 4W8BA 1CTNA 1ISZA 2QCFA 2XPKA 3RGTA 4ICCX 1PAMA 3CQHA 1TPVA 1MEHA 1BTMA 2PLKA 2YA2A 5T91A 3TXVA 3WMBA 4O19A 1X96A 2AL2A 5CJ5A 3KHJA 4J1OA 5CPTA 1HIZA 3UG3A 4DYKA 3G1XA 3W0KA 4MY9A 1ZJAA 4E8GA 5FEZA 1Q6OA 2C1HA 5C0QA 3ZT7A 4UR9A 5I02A 3A22A 5JH1A 3DENA 4KEMA 4GUFA 1E4MM 1PTGA 4QISA 2VC9A 3CL7A 2XINA 4F66A 1XIDA 3B4UA 1A5BA 1E4LA 2EG6A 4J3VA 1QJWA 1OC6A 3D46A 1U1JA 1FXPA 3H26A 4MKVA 3QMSA 4M81A 5D9MA 1WCGA 4DZIA 3GXNA 2XM1A 2FVKA 5FI8A 5E6ZA 5CKSA 4GJ1A 1V02A 3KDNA 3ZYZA 3HJEA 3ABZA 2W4XA 2DW7A 4MIMA 1XRFA 2OVLA 5LNWA 1F3TA 2ZBTA 4D8ZA 4YYFA 3A21A 5CLWA 1Q6DA 4JTCA 2VD9A 4QQ3A 1CW2A 2ICSA 3TU9A 2OPJA 3SURA 2E6YA 1J0YA 1M3UA 1YDYA 1Q3NA 5JQ9A 3E0IA 4JQ1A 5I06A 3U2CA 2VGIA 4DJEC 1NM9A 2VC5A 4INFA 1UC5A 3P5ZA 1UD2A 1IT7A 3GH5A 2ACSA 1YPFA 3CUHA 3TN6A 3EWDA 5HINA 3SUSA 4GUGA 1K6WA 4DZAA 4Q4RA 4JIQA 4W86A 1XIEA 2O55A 3IK4A 3KHDA 4FNTA 3M5ZA 2TAAA 1FXQA 3MKVA 1XGEA 5ECVA 3U57A 1QNVA 4ZBCA 2QLYA 3R1ZA 5LIXX 4P8XA 1H50A 4ROPA 3ZT6A 2JK2A 1FUYA 3GNOA 3UQNA 4LNCA 3VFCA 2REQB 2GVJA 4WQ6A 1R3WA 1KFLA 4LCRA 1O66A 3C2FA 4AEOA 1M7PA 3VZYA 2BGNE 4PMDA 1RD5A 3S9YA 3AXKA 2BY3A 4UTHA 1Y5WA 4DWSD 3O8AA 4KGLA 2XWDA 3GXFA 1W1PA 4PMNA 3EWXA 4TMBA 1ISXA 1V3JA 2VUNA 3LHWA 2VFEA 3QKZA 3EOLA 4G6CA 4NRRA 4GD0A 4OUIA 4X0VA 5C8BB 3AS2A 2R1KA 5HNUA 1Z8AA 4JTEA 2A6LA 2EJ1A 3PJXA 4NNBA 3S1GA 5CPOA 1W0MA 3R6IA 4LOCA 1Q4WA 4ZB5A 4HMDA 4AVNA 1DJZA 3OP2A 1U1UA 3CB8A 4NP7A 5DT7A 2BG5A 2PI6A 3K2GA 3HN3A 5E0FA 1NARA 5C54A 4IJCA 1V7YA 2ZRWA 3LCFA 3RLGA 3QZAA 3VGDA 2VENA 4LW7A 4K1GA 1QPNA 2ON3A 1HKJA 3KLKA 2X42A 1Z9AA 1XSJA 5HQEA 4NX5A 1EP1A 2PODA 4I6KA 4A8RA 4PN2A 1Y7VA 1OADA 4S23A 3H2MA 4QAWA 3W23A 4JD4A 1BRLA 1QWGA 1UD6A 1B3WA 4E2OA 3VVGA 2H9AA 1FFQA 1IYXA 3WNMA 1UQZA 4HSHA 3S6OA 1A5KC 1A5UA 4PUKA 3G1YA 4J35A 1H63A 1G69A 3ALFA 1UH2A 2P1FA 1MI3A 4DO4A 4FXFA 4NAFB 1KRCC 5DEZA 3N4FA 1EP2A 1P5BA 3NQDA 5DANA 5H2ZA 4UC5A 2WMJA 2WMKA 1JCXA 2QVHA 2Y8VA 1VPQA 5JU6A 1KB3A 3BV7A 2EG8A 2QCDB 4QNWA 4E6MA 1Y0EA 1K9DA 2B7OA 2ATSA 2J7FA 4R9XA 1CNVA 4UFKA 2F61A 3NTYA 4HNUA 1CBGA 2GJXB 2J7CA 4IGHA 3PZNA 4LUYA 3WQCA 5H91A 2OWWA 1XXXA 2TMDA 1OY0A 4WZHA 3T05A 3ZJ7A 3H4WA 4ZOEA 3CZLA 5HNNA 5I6SA 2V0TA 1SW7A 3RDKA 3PPFA 3SSJA 1GKQA 4ZE5A 4ENLA 1DEDA 4AMCA 2EG7A 6CGTA 3LBMA 1ADOA 2E25A 1PB0A 3LB0A 5E1QA 5FKYA 2DSVA 4ACYA 4IH3A 2QCMA 4LTSA 2UY2A 1RV8A 2ZRZA 4FSAA 3TP4A 3Q37A 2CWXA 2VZUA 3WD4A 1XBXA 3IJ8A 3GNRA 1I4NA 3CU2A 2CZDA 4O4WA 3CNYA 5DBTA 3FFSA 3M0IA 2JQXA 5HANA 3CHDA 3S1XA 1F5ZA 2NW0A 2GOKA 1WDWA 1S5WA 1HGYA 1ZSXA 2GOUA 4RE2A 3NYDA 1O12A 2PDBA 4LQ1A 1V93A 2QHAA 5JUVA 5EMUA 4AXNA 4GIRA 7XIMA 3RM8A 4IP5A 2O9OA 3HGRA 2PP0A 1WAWA 3DBNA 5BW6A 5H1WA 4MADA 4GJJA 1TWDA 3SCQA 1Q85A 1W8SA 4UTMA 3D6NA 3DU0A 1HP4A 3R7MA 1VHNA 1IT0A 4OBTA 4LYPA 2DEPA 3BW4A 5B80A 1J0HA 1V0KA 3WIJA 3BARA 2ABBA 3N19B 3URBA 3IANA 1U33A 1AODA 5F4XA 4XZMX 1KBLA 3E0VA 1NP2A 1W54A 1EJRC 4NNAA 3N9SA 3QV8A 5D38A 3E74A 3RIKA 2CHRA 4LVGA 3KVMA 3VIIA 2REQA 4M7SA 3HJZA 5CBBA 1KFEA 1VCVA 2XFYA 1W1A1 3UNTA 1R2SA 1S2TA 3ZOAA 1M68A 4FX6M 2DSZA 4HNVA 5A8GA 1FWJC 4AF0B 1XLMA 1JVNA 3NAVA 5LNSA 1YTKA 1DTUA 2Y7EA 3W3OA 2WWDA 5CAKA 1ZNNA 3AMDA 4GA8A 4KQNA 3WNOA 4PMOA 4PODA 4ZQOA 4A8NA 1TPH1 4UIOA 1GEHA 3FA5A 3QMTA 1LRTA 4DO5A 1TPFA 4P7NA 4M82A 3R89A 5A2BA 3AWOA 2QDGA 1JYXA 1AJZA 1BYBA 3PZGA 3K4DA 1IGSA 1J18A 2EXOA 3W76A 1DJXA 3B3DA 5ECUA 1ZGDA 4F40A 2ZTKA 2PRLA 3VGHA 3ZQ9A 1E6ZA 1WXJA 4XBSA 2ZRVA 3KRZA 3N2MA 3A5FA 1AW5A 5A6TC 2YL8A 1QNSA 3EA3A 1XGDA 2X7WA 2NQ9A 1UASA 4ZL1A 1H7XA 4GUJA 3DBPA 4P7OA 1A5AA 3TFCA 4K1WA 5A6LA 1NWUA 3L0GA 3MUY1 1QNRA 4JTJA 3W00A 3W6LA 3AU6A 1UC4A 3TW7A 2DPEA 2Y8UA 2QCHA 4U4MA 3HGSA 1W91A 4WRHA 2POZA 3UJEA 3S1VA 1R8LA 1I45A 1POKA 4X9YA 4L7ZA 3Q94A 4XZLX 1AMKA 3K8LA 4QLLA 1XRTA 3QZ6A 3RCMA 4B5WA 2EHHA 2VDHA 4FNUA 4HHMA 3OQ8A 2VRJA 1CLVA 1PSCA 1WNOA 4RNFA 5BU9A 4GLEA 1F7BA 5U4NA 5HNRA 4N0RA 5A8NA 4DEFA 2ISFA 5D9OA 1OWQA 3S5NA 4MY8A 4ZO6A 3N3MA 4CCEA 3E2RA 1M65A 1X98A 4YXGA 4RDYA 2QCDA 2E9LA 4OBSA 3AI0A 1T5AA 3WK0A 4TQTA 2OEMA 1R0MA 4Q6JA 2ZA2A 1J6OA 3UXLA 3EMQA 4C5ZA 1UKSA 2XIJA 2GJXA 5EMYA 3BUVA 4MKSA 2OO0A 3IGSA 4YHEA 2A4AA 4Y9NA 1YPXA 1NEYA 1Z69A 2CIPA 1H1ZA 3E96A 2ZKMX 4QTGA 4FAMA 3CBWA 3IIOA 2CLIA 4KFNA 3U2EA 4S3FA 3K1DA 3ZSSA 4AD4A 5IFTA 1F2JA 2JIWA 2FQIA 3BH4A 3SCPA 4UMBA 1V51A 4EIVA 1PZ0A 3WNNA 3KDOA 3WLHA 2WANA 5CZTA 4A22A 4H41A 3SADA 2V3FA 4IIFA 4B3ZA 4XISA 2VVSA 5FL1A 3GBEA 3IJQA 1OGBA 2VZSA 2O4MA 5DFAA 5DY2A 3G22A 3VA8A 3WK1A 3N9KA 3JZEA 1DJYA 1LL6A 4IMGA 5LYRA 3MCOA 6ALDA 3UPMA 1UKTA 1XDMA 4NJHA 2J6VA 4ZQCA 1VIZA 4UFIA 1C91A 4WSHA 3R12A 1V77A 4QXIA 5LSMA 3GTHA 2BOEX 3LM7A 3VOFA 8TIMA 3W70A 4GO8A 2ZA1A 2YBUA 1VFTA 2NQ5A 4G1KA 4HNLA 4NI3A 3CZKA 4XQ6A 1QU4A 1KTBA 5IBXA 1AVAA 4JKMA 3ARSA 3C3NA 4XWUA 5HNTA 4JS3A 2NX9A 4KETA 3NQFA 2FHCA 3URNA 3IRDA 5JH2A 1V3IA 4NJKA 4Q8NA 2BY1A 4DM1A 4DO7A 1MNZA 1TJPA 2PC8A 3BMWA 4H6RA 2V5LA 2XIBA 1ENUA 4QG8A 3SRDA 2I9UA 3DKJA 2XJ7A 2NQZA 1KBIA 4JTGA 3DX5A 5CAHA 5F1VA 1XL9A 2Y4SA 1WDQA 2HXUA 1HKMA 3S3GA 1ONEA 3W9ZA 3BSMA 5IXEA 2EPKX 5L6UA 4NYYA 3O06A 2LLEA 2HS8A 1XDJA 3KBWA 4F0KA 1T96A 3MA8A 1QOXA 1AMYA 3DI0A 1L6GA 3S9ZA 2GQAA 3G1AA 1SO4A 3HG4A 4KGJA 4HYWA 4XVEA 2GL5A 3M0KA 2V5DA 3MSDA 1BXNA 3P74A 1QK0A 4O50A 5HUPA 4LC6A 3MHGA 1VIWA 5CPQA 1JZ8A 3MV11 4X2RA 1PVNA 6XIMA 1LUCB 2QIIA 1PDZA 2F7FA 2X1TA 2BOFX 2PP3A 3EPOA 3PWAA 4Q32A 2PB1A 3UVAA 1CCWB 1BWLA 4HD5A 2PTYA 2A0NA 1TPC1 1A47A 3LSCA 3UNDA 4WOZA 3T2PA 3HU7A 3R8GA 1ZZMA 4HN4A 3G1FA 3N13A 1RBOB 3GR8A 2Z00A 5I0DA 4LJ3A 3HFTA 2XVKA 1GYMA 4DXXA 3TYAA 3LTYA 5A8OA 1B4EA 5FACA 3VDHA 5B7YA 3POCA 4YIWA 3E2QA 2WSPA 4PTNA 1I0DA 3G0UA 3H2FA 3BG5A 3M0YA 2YYUA 4Z2KA 2W27A 3T4CA 3EB4A 4PYSA 4TMCA 3LEPA 3U48A 3U4AA 1K9TA 2V2CA 3DFNA 3PS7A 1H60A 5HMSA 5D05A 1EEXA 3M0LA 3QW3A 1XIMA 3W83A 4F0LA 4MG4A 1I2QA 3GXDA 1Q7ZA 4H8HA 3DHUA 1NTHA 1UA3A 3RM9A 3LM3A 5FF2A 4C6EA 3G0SA 2QJHA 1UR9A 3STEA 5J5DA 1NFBA 1I60A 1V03A 3MT1A 1CB7B 2PP1A 4J28A 2XUCA 4JTUA 4QFUA 3AZRA 2YXOA 4ZSUA 3PB0A 3UXKA 3BAJA 1KR1A 3VC5A 5A6SA 1K03A 3MJMA 4NYUA 4D6EA 1YYAA 3B03A 4E8DA 3U0HA 1KFCA 4EACA 1HUVA 1W1IE 3M41A 4L1XA 4AY7A 1Z44A 1TPWA 5CG7A 5CC3A 4R85A 1XM3A 2BVYA 3VKJA 4BQ2A 3U7BA 1EP3A 5DF0A 4HTBA 3WK3A 4O28A 2E6AA 5KMYA 3L4ZA 1OFQA 1BXBA 1IF2A 2VNCA 1F05A 1R7AA 2FKPA 1LZOA 5CEWA 3G6LA 4DNHA 2FTWA 4YHGA 4XUYA 1W5PA 3CTTA 1UOKA 1LTDA 2ZZ6A 2DH2A 4JN7A 1THFD 3NFUA 3EWWA 1GT8A 3GNDA 3ARYA 1LORA 1H0IA 3TK7A 1K9FA 1B57A 1KM0A 3NGFA 4DELA 4HA4A 1PCWA 4LC8A 3S2NA 1SZEA 3M0VA 3BQ5A 1H7OA 1TTPA 3T0BA 2WXDM 4JQ3A 3QY7A 2B7NA 3JU2A 1CECA 2OU4A 1VCFA 1D3CA 1WZMA 2YJQA 4ZA0A 2NQHA 1IZJA 1KGXA 4MJ2A 3CAVA 3W1TA 3VOHA 3BAXA 1D8WA 3BSGA 1X1NA 2QT3A 4CNSA 1M7OA 3A4WA 2VZVA 2DY3A 4Y6GA 5LA2A 1CIUA 2Q3OA 2CBJA 3RMEA 2R94A 4US5A 1C8YA 1BKSA 3MC5A 1PEZA 3W2NA 1W1TA 3W7EA 3VILA 3NA8A 5HK4A 1QW8A 2CLKA 4MZ8A 1OCQA 3N18A 4ZENA 4CN1A 4FPSA 1TR9A 1I9CB 4LPCA 1HJWA 2VX4A 3H70A 5C9ZA 4F2TA 1R5YA 4JZ5A 4J40A 2YCEA 3F1QA 1KQYA 5FJRA 4KEUA 4GX9A 3MHFA 2V5JA 4JL1A 1B90A 1U22A 3EXTA 1LWHA 2G3MA 1KO0A 5G1MA 2C79A 2PDPA 1Q7MA 5KZDA 4PBFA 4M80A 3ERPA 3IGXA 1B3VA 2V81A 1FFRA 3EWZA 3GO2A 2FB3A 2C13A 1FWEC 3GG8A 3CLMA 5BMXA 2GPTA 3GDKA 3KBMA 3ARRA 4JFUA 3OQEA 1MFVA 1NWSA 2QNEA 1Q6EA 3DFPA 3UJ2A 1LUCA 1ISYA 3NSXA 1TQJA 4ML9A 3IUDA 2X1RA 1JXKA 4H9TA 1KLYA 3A4XA 2OKTA 3PUDA 4HPNA 1GVIA 3CPRA 5BZAA 2CLEA 4AWUA 1VFOA 1SMAA 2ZZ5A 3OW1A 1OZQA 3TJIA 2J13A 3NXLA 4QDMA 1BF2A 2VRKA 4FR1A 2Q01A 4A3RA 3O2LA 1AW1A 3TJ4A 4NZJA 3HPSA 5FL0A 2ZVIA 4O15A 2DJLA 3U9IA 3W1MA 4HA1A 2P53A 1GQKA 3WF3A 1R7OA 5MF5A 4U28A 2YZ5A 1E3ZA 1LQAA 2ZDSA 2X09A 4L4OA 3RLUA 2NUWA 2JEQA 4UOZA 1H4PA 1E71M 1HJXA 4JN6A 4W4QA 4JFWA 4UB9A 2J47A 3S5ZA 4QLKA 5TF0A 1OX5A 3NL6A 4JQ4A 4UTLA 2OMAA 1GZGA 4CGTA 1IE7C 3FY1A 3LOTA 3TYDA 1OF6A 2XH2A 5I00A 2Z6JA 3E49A 1BSLA 1VJSA 1AA1B 1Q6CA 1XC6A 1NWRA 1PWMA 4I9AA 3KM8A 3PZMA 4MPQA 4U5IA 4QGCA 4NY2A 2VR2A 3DG7A 1X6UA 1E43A 2QUVA 3IPWA 3AFBA 3PBWA 4NUWA 2I5QA 1ZU8A 2C1GA 1C8VA 4QQUA 5JIWA 5EMJA 4KWSA 4CD8A 3WLRA 3ARZA 1N7KA 3RFAA 3M46A 1GVQA 3QKEA 3DFYA 3OO2A 4AZ7A 1ZQ5A 4ZVJA 3ITLA 4UQAA 1E4IA 4DM2A 1XQLA 3S2JA 1F74A 1Q45A 2SFPA 7REQB 2RH9A 2TSYA 1K8YA 2VDIA 3LV6A 3SCSA 2VC6A 3IVUA 2FB2A 1SGJA 1R3VA 4MZ1A 2E4TA 3NDYA 2CYGA 1ZCCA 1F6KA 3FAWA 4GRSA 3GLCA 4X60A 1G9HA 4N7QA 3H2EA 1EJUC 3H21A 4O13A 1JFXA 2J78A 2WJZA 4PFHA 5A95A 5FF0A 1IT8A 2GSHA 2PAJA 1QAPA 4PUWA 1JL8A 3PZUA 3S2MA 1DORA 1HZYA 1YXYA 3VFLA 1SFTA 2WJEA 3CYVA 3E5PA 2PRHA 1GVOA 3TJXA 3GG0A 2VYOA 4GUIA 3GTXA 3E6EA 1C8XA 2PWVA 4AMAA 4M6PA 4MJ4A 1TRIA 3REQB 2PDGA 4MJMA 4ZMGA 1HXJA 4LBSA 4L5ZA 2WM0A 2XZ7A 3FXGA 3O1NA 2AQOA 4DWSC 1KRAC 1POJA 3DKLA 3ITCA 5BRBA 1D3HA 3GAYA 4PUMA 4F2UA 2QF7A 2X1IA 2QGYA 4GXPA 1JJKA 5C71A 3MKKA 2A6NA 4AEFA 2WBKA 1K70A 4JYFA 1QW9A 1PKLA 1W3HA 5KETA 1DXEA 3RCNA 4HYRA 4PMUA 4JTRA 5HJLA 4UWMA 3K4WA 2YFOA 3DC8A 1JYNA 5AHLA 3S46A 1B5TA 3T40A 4E4PA 2AMGA 2POTA 1ZLPA 4XZHA 2YKKA 2X0SA 1B3ZA 4H83A 2ZOXA 5D37A 2DZBA 2DV0A 2FZBA 1J5TA 3N12A 1JUEA 1UP2A 3A4JA 3H55A 1GHRA 1OFAA 1HKKA 4C6CA 4D6FA 2CLHA 4AUBA 4BCEA 1JPMA 2J25A 4JYDA 3VPLA 5I3DA 3URAA 1XKYA 3TUUA 3CPUA 2WB5A 1Z89A 2Z1BA 5LNRA 4NZCA 4PTVA 2NV2A 2ZC8A 2I9EA 4PL2A 1YQ2A 1RA0A 2ZXDA 4AHPA 2W92A 2AKMA 4NL1A 3AYSA 4US5D 2D1ZA 1B3YA 1XICA 1EIBA 1W3LA 4UNIA 1V7AA 2H8XA 3VKBA 3EOOA 2NLIA 4DY1A 4IIEA 4EPBC 1V5XA 1ZP4A 4GX8A 4UUIA 4GZ7A 4AZIA 2ONEA 2JKPA 3ARVA 3KZSA 5TQLA 3VNMA 1E6PA 4MLRA 1ALDA 4W7UA 4R7JA 5D2VA 3PUEA 1YE6A 3UG4A 4JPGA 1F76A 3LCWA 3IV3A 4F0HA 3E1F1 7TIMA 3II1A 3QQ0A 1YNYA 3L4VA 4JYEA 4DBUA 2GGEA 3AXXA 3L12A 3RMJA 3TH6A 1R9YA 4MY1A 2PLMA 1GG1A 1SO6A 4MKNA 3PTQA 2BP1A 1EJVC 1KTNA 1EO5A 1O1HA 4M29A 3VGFA 1PWLA 2P5NA 4A3UA 1VPYA 1UZDA 1WUFA 3CV7A 2YFNA 4W7WA 4R3UA 3UR7A 1SW3A 2UBPC 3OZPA 3TNBA 5HUOA 3U2OA 1IR1A 4OFCA 3VU2A 5BU6A 1FCBA 3BG3A 1XIJA 1EA9C 1TQXA 2Z0IA 2XZ9A 1K02A 1IZCA 2OOGA 4ML4A 5GNXA 7REQA 3VIOA 1TA3B 2P88A 3BC9A 1OHLA 4LV9A 1V0LA 2P0IA 3GVWA 1CXFA 4PC8A 3V0SA 2CKRA 4Z1CA 1PHQA 4JQAA 2WNNA 1MZHA 2BY0A 3K4AA 1X8CA 1UWQA 4U31A 4CCZA 1O1ZA 1UYQA 5CZSA 3GM8A 5E6YA 2PBGA 3KBSA 1A5OC 1TE1A 3TLQA 3KWSA 3AIWA 4CKQA 3C6CA 3QY6A 2GWNA 2WC7A 2ZIDA 1TUXA 3M5VA 2DZSA 5DELA 1NIUA 3L4WA 1XH1A 1KWKA 3SJNA 3KRUA 3NQMA 1JFHA 1OFOA 1Y8BA 3H12A 3CZ8A 1AD1A 5CJNA 3W1AA 3DG3A 1ZHAA 1M01A 3BCJA 2PD5A 1UIOA 4HJFA 1BWVA 2JF7A 4HYVA 1PZ3A 3NO3A 2C18A 3MCNA 3MJYA 3REQA 3ZM8A 4U33A 3HM7A 2NZLA 2BMBA 4R53A 3B0YA 4ZO8A 2CITA 3WQGA 3UJSA 1QNPA 3WQPA 3VOGA 2A3HA 4HKPA 4IICA 2VEKA 5GNYA 1D7FA 1J2WA 1N8WA 3BOFA 3S2LA 4B9YA 3L23A 3T08A 4JR5A 4W84A 3M1ZA 2PF0A 4Q22A 2GUBA 4Q7BA 2OSYA 3OEXA 3W74A 2FTPA 1R3YA 1MXSA 1PS9A 4GNVA 5AYIA 2G5WA 3AMCA 1R87A 4K7YA 1B3XA 2CXEA 5DCDA 1W1VA 1UD3A 3TR2A 4GOAA 4RLIA 1XX1A 2Q8ZA 1KFBA 3VUPA 1VBHA 4WKHA 3VE9A 3A9IA 3NL5A 2XYLA 3W1RA 4DWDA 2WWCA 1VHCA 5KINA 3O15A 2JGQA 4O1DA 3UCQA 1QRQA 3CHEA 4ALDA 4MTVA 4H9ZA 2JBMA 2W66A 2GDVA 5HJXA 4D9PA 3VXGA 3QQ1A 4HU4A 4RV8A 2DDXA 2DT3A 1VEMA 2J7DA 2Y89A 1R86A 4P7RA 3AHTA 4B5SA 4C6DA 4UTTC 3QLDA 1ITCA 4D6GA 4MWAB 4I8DA 2ZZ2A 4HA3A 4V1YA 4I9JA 4QS6A 1RLCL 3JS3A 1KC7A 3K8KA 4Y9MA 1PCKA 5M17A 2QPXA 2RAGA 3CTLA 3FJNA 1PO9A 3BG9A 1XCXA 3RHGA 4D6HA 4LAMA 1QI3A 3ICJA 1W9PA 1ICSA 4OT7A 2A3AA 4I7VA 1JIBA 1KM6A 2PTZA 2DU2A 3PG8A 5EPDA 3AXMA 1UWRA 5KITA 5C70A 1EJTC 1XUZA 3WSUA 3XIMA 3GWQA 1XRSA 4MUZA 1GG0A 3IARA 4XAFA 1K9EA 1TV8A 1X6LA 4FX8A 3VC6A 3HPXA 4WGXA 3ITGA 2GVYA 1UZ1A 1TTQA 2WC4A 5FJTA 2CBVA 2G4FA 3M9YA 3TN4A 1GZJA 3A3HA 3R58A 1OX6A 5J8LA 5CPNA 3HURA 4IISA 1TRDA 1VEPA 1CGTA 4I9TA 5CBIA 3VTRA 4OE7A 1W3IA 3EX3A 2PDIA 3W7PA 3AIQA 4B92A 1EF3A 3W24A 3ITYA 4HNOA 3NQ2A 2PDKA 1B9BA 2VEIA 1G94A 1EXBA 3A24A 1TA3A 2CLPA 4EE9A 1EQPA 1ZBKA 3AU2A 3TONA 2CESA 3WH8A 4RDVA 1LL4A 1JCNA 2TRSA 1XISA 2CU0A 4C7GA 5MKGB 3AHXA 2OSWA 1TPDA 2VL4A 1W1ZA 1AQFA 3POHA 1OK6A 2C19A 3B97A 1MQQA 2DH3A 2VCCA 2CWNA 3PJTA 1EFZA 1GQLA 4A8LA 2YYTA 1DQUA 1FP8A 1G7VA 3BLOA 3DFTA 4JCLA 3TSDA 2VD8A 4KWUA 1BVNP 2XIQA 2J7EA 3K8MA 3CT2A 3M0HA 4ICNA 2A7PA 2YDAA 2IUZA 5A6BA 4A2RA 1A4LA 2E68A 3PG9A 4UMCA 4C1KA 3OPSA 5HWMA 3FJ4A 1RVGA 4Q7IA 2Z1KA 4GNJA 4GVIA 2WHJA 3M0XA 3VIKA 1RA5A 1SO5A 3OLIA 2CZEA 3BLLA 2FFIA 1KCXA 3GFYA 4NU7A 2KAUC 4L56A 3D47A 2VOTA 4PA8A 1ITUA 3WDPP 3KUMA 1CXEA 3WLSA 2HZGA 2D2JA 3KOZA 5CGTA 3LY0A 4C6FA 1WKYA 1N8FA 3C2YA 3V3WA 1W2PA 2Q71A 4REQB 4A21A 2CW6A 4Q4SA 2D2HA 3TSBA 4IT1A 5EBUA 5K4ZA 3VMOA 5LIWX 2W3ZA 2BB0A 1VP5A 1GVFA 4HPHA 2WV8A 1OYBA 3MMUA 1H1YA 3EZ4A 4YTUA 1JZ2A 2INEA 3NPUA 1A5SA 4LAKA 4J5NA 4R9OA 3C86A 1K8CA 3IVSA 3JUGA 4TVDA 2G3FA 3BQ6A 4ADUA 3S8HA 2R91A 3DGRA 3NWRA 1KW1A 1MXGA 3W7KA 2OZ8A 5E9XA 1X8FA 1UH4A 2VEFA 3C2OA 4Y7EA 3C3UA 2WW5A 3N2OA 4IOTA 1ZY9A 5XIAA 9XIMA 3D3FA 3GFZA 3THCA 1F73A 4KCVA 4KRZA 4K8HA 1PTAA 3IV8A 4AIOA 2OODA 4Q7NA 1ONWA 3DG6A 5XIMA 4HNCA 3TC7A 4U10A 1GOIA 5L9FA 1RQHA 1VYRA 3UWZA 3UF9A 3ABRA 5HMEA 3L4YA 2D69A 4ZEPA 4MWAA 1BAGA 3UZ5A 5M03A 3B9EA 2D73A 3ANUA 5FOOA 4E5TA 2C0AA 1X7IA 1EDGA 1NSJA 1AQMA 2QV5A 4LUSB 3HBLA 3RAOA 1BTCA 4AYSA 3S1WA 3TE9A 2OEJA 4E2VA 3VOIA 3S83A 4L9ZA 1H7RA 3BZGA 2VFGA 1F8MA 4DB7A 1EHAA 2NWSA 3CAKA 3E12A 1A3HA 2PPGA 3S47A 1PKMA 4FI4A 1LROA 3L0KA 4F9DA 4H04A 1DV7A 4LV4A 3LTSA 4S1FA 5AHIA 1H3GA 4CVWA 4J3UA 1EB3A 1IXPA 3Q45A 3QM3A 4EPDC 4UFHA 1W32A 1Y65A 1FRBA 4N6FA 4AZ5A 3QHNA 4EVZA 2INZA 4CNPA 2XGZA 2V6AA 1E0VA 4AWTA 1ZBVA 3EPNA 4A3YA 2FGBA 2XU2A 4ZOBA 4DBDA 4D6DA 3LGEA 2DORA 3SCOA 3WNLA 3ARWA 4ZR8A 4DUOA 1XG4A 4OBRA 2CZ5A 4QG9A 4GINA 1OFRA 2ZDRA 2DT1A 1UP3A 1VBJA 4JHOA 4BQ3A 3ZVHB 1PKNA 3NM3A 1UPPA 5I09A 3TEVA 1RK5A 5TIMA 1G4EA 3DXIA 3K5XA 4CNUA 1PIIA 1YIXA 4EAMA 1MWOA 4IGNA 4UNLA 3TOPA 1QT1A 3N17A 3T6CA 4HZ8A 3SEPA 1XWYA 5A6JA 1E0TA 4LAZA 2NVCA 3ANYA 1P7TA 3CH0A 2FHFA 3S5SA 5MKGA 1VFSA 4RNJA 1SSDA 1C29A 3CIXA 5F1UA 2NXGA 3G8EA 1JCLA 2WZMA 2E9BA 1JNEA 5CLTA 3N4EA 3SI9A 1WUEA 3H7UA 1Y5XA 1QR7A 4WIWA 2HPIA 1UQYA 4KIEA 4UBPC 6REQB 2CBUA 2HV5A 3AYRA 2YW4A 2BNJA 1RUSA 5AZ1A 3ECQA 3KW3A 3KLLA 1AZ2A 4Z1BA 4DI9A 2YXGA 4MDPA 1UR3M 2QUNA 3AXIA 2DT2A 4FX7A 3WJWA 1K4HA 3VDAA 5FJOA 3WQ6A 5C2XA 4PMYA 4RK8A 5C9WA 2L5HA 1VS1A 3F2BA 1LWJA 1OCBA 1QOPA 3LERA 4OIFA 4NAEB 3FEQA 1QPOA 4TVUA 3NL2A 4DJDA 3PSWA 2OZTA 1KTCA 2PUZA 3B06A 2J8FA 3KFTA 4TX9A 2VFHA 4WEVX 1U2YA 5ABEA 4QP0A 1T0OA 4KH2A 1UD5A 3W1XA 1LRNA 1LDCA 2Z29A 5D4YA 3T7VA 4GZIA 1FWSA 1V3KA 2AKZA 4N02A 1TYGA 2GFTA 1L8PA 4LBUA 1SM9A 4HCHA 3CZGA 4JTHA 1UWSA 4AH7A 1ZJBA 1PTDA 3SY1A 3TJLA 3TA9A 4KCWA 2GJPA 3ABQA 1H51A 3ARUA 4WLCA 5BROA 3G77A 3WLIA 3GDTA 5GJNA 4K39A 2C15A 3KVJA 3MBFA 5A69A 3A64A 1VQTA 1S2AA 2QULA 4J3ZA 4LCQA 3GC5A 3G1DA 5EFFA 3RX3A 3TMQA 5FIPA 3ISIX 8RUCA 4LEQA 3H2OA 1X39A 1F61A 1T8QA 1DHKA 3CUIA 5A6BD 1ZS2A 3LI1A 5I2UA 1X6NA 2W6RA 3AAMA 2EKGA 4PRWA 4U2YA 4WSKA 3LHUA 1QFEA 1QBAA 5IBXC 5FEPA 1XLBA 1BSIA 3LNPA 3GZ3A 4WDXA 4H9VA 1E1EA 4JX4A 2B4GA 1QI5A 3UU0A 1U5VA 2GYIA 5H6HA 2H6RA 1I2NA 1TIMA 1FX6A 3KVKA 3HGOA 2X7VA 4LUSA 4W89A 2WSKA 2FZDA 2Z27A 4I5UA 5DT5A 1U5JA 3QR1A 5G2WA 1BHGA 2AOSA 2BHZA 4XD3A 1EDQA 3AZSA 1Z41A 2X2GA 4JTTA 2OO6A 2BXVA 3SQLA 4L4PA 4JICA 5FJIA 2P8CA 3B04A 3VX1A 3PZQA 4AXKA 4DAFA 4S3AA 3TN3A 4X0NA 1E56A 3WJYA 3LGGA 1A0CA 1ZPTA 4YL2A 3DYOA 3LI0A 4XZIA 5HA7A 3VKKA 2A7NA 2EQDA 3WEZA 1DJNA 4A05A 1FH9A 5KSWA 3N25A 6ENLA 3W7NA 1G0CA 1KV5A 4EXAA 4RNIA 3VCCA 2XISA 3GDLA 2BZNA 3TWAA 3PNZA 4IMAA 1A49A 4JHMA 3AIEA 3WF1A 3CC1A 1YADA 3FAXA 5TD4A 4DJFA 1U5HA 1QNQA 1XIIA 4PB5A 1P6CA 1W9DM 2C71A 4LSBA 3Q67A 3UFYA 2ALRA 2Y5JA 1XLFA 2G0WA 4PR4A 2CC0A 1X1OA 4DRSA 1S5VA 4ZB2A 2ZZ1A 3UXIA 1QO2A 1SR0A 3WUFA 4FNQA 4IM4A 3TQPA 3W7CA 3FHQA 4GYPC 1TJ2A 2WSYA 1EUAA 2QYGA 4QDPA 6REQA 1GCYA 1LLOA 2V5KA 4XZNX 3TV8A 1X97A 4M1BA 4EF8A 3MQTA 4JIEA 5I07A 3LHZA 3M43A 3P62A 2RHGA 1XLAA 1KXHA 3SRFA 1CDGA 1HW6A 4X3ZA 2BVTA 3HOJA 1M9HA 1TPB1 3BXWA 3BCFA 4XKYB 1I1WA 2DZXA 4FF5A 5BWFA 2FMNA 1RHCA 1C7TA 2Q6ZA 2HXTA 5CSYA 4UQDA 1ZP3A 1UWAA 4O12A 4NAEA 4NF7A 3M4HA 4GK8A 3W26A 5HAOA 4NZFA