3CUIA

Cellulomonas fimi xylanase/cellulase cex (cf xyn10a) in complex with sulfur substituted beta-1,4 xylotetraose
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
314
structure length
314
Chain Sequence
ATTLKEAADGAGRDFGFALDPNRLSEAQYKAIADSEFNLVVAENAMKWDATEPSQNSFSFGAGDRVASYAADTGKELYGHTLVWHSQLPDWAKNLNGSAFESAMVNHVTKVADHFEGKVASWDVVNEAFADGGGRRQDSAFQQKLGNGYIETAFRAARAADPTAKLCINDYNVEGINAKSNSLYDLVKDFKARGVPLDCVGFQSHLIVGQVPGDFRQNLQRFADLGVDVRITELDIRMRTPSDATKLATQAADYKKVVQACMQVTRCQGVTVWGITDKYSWVPDVFPGEGAALVWDASYAKKPAYAAVMEAFGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Exo-beta-1,4-glucanase
publication title Probing the binding sites of Family 10 and 11 Xylanases with extended Oligosaccharides
rcsb
source organism Cellulomonas fimi
total genus 133
structure length 314
sequence length 314
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2008-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3cuiA00
5FOOA 3A6OA 3ZT5A 2V5CA 2DH2A 3WIJA 3VM5A 2XTKA 1W9PA 5DF0A 6CGTA 2DIEA 3BSHA 3WUFA 2V3EA 1QBAA 2XWEA 1H0IA 2PBGA 1B3YA 4FLRA 1OB0A 4WSJA 3W26A 1JI1A 1CXLA 1B31A 4UOZA 3BAYA 2ZWZA 2ZX5A 3CZJA 1UKQA 5A6MA 1V3LA 4ZEPA 3PZQA 4L4PA 1KXQA 1E70M 3K1DA 3B9AA 2D0FA 2XSBA 2IXVA 1E9LA 4PEEA 5I77A 2HISA 5E6YA 3WEOA 3W82A 3WFZA 1HXJA 3PHAA 4UQCA 3WN6A 1VBRA 1TFVA 3UCQA 5FKYA 5BXTA 3GH5A 1V6YA 3SIMA 3WDHA 2YA0A 1UQYA 3MV11 5I23A 1MW1A 4F66A 1C7TA 1QOXA 1WCGA 4M8UA 1VJZA 2WHMA 5HPCA 4AIEA 1UWTA 4PTWA 4HOWA 5ABGA 3POCA 2PWEA 1TZ7A 3SUUA 4UCFA 3BAIA 2HVMA 2WZHA 1GUVA 1HL8A 1XD0A 2WWDA 2YDSA 3K4DA 1C8QA 3AMGA 3J7HA 1HT6A 5FIPA 1BYDA 3I3DA 1TVPA 4OKDA 4J3TA 2XIIA 2BY0A 4LQ1A 3MKKA 4NI3A 3VUPA 2YDRA 2RGMA 2WKLA 3MSGA 1ODZA 2PC8A 1JGIA 4D6FA 3AROA 5AYIA 2WSKA 1GQJA 4S3JA 2VCAA 4CN4A 4Z2JA 4ACZA 5KZ6A 1MQQA 4H41A 1CGVA 3WDIA 4NF7A 3ZIZA 1OSEA 3WMBA 5HDRA 1UYQA 3WDQA 1W1VA 2YLLA 2VUYA 5ECUA 1QVBA 3L4XA 4NRSA 2VNCA 1E3ZA 1JZ4A 1PEZA 1EGZA 1M7XA 1UUQA 1EA9C 1W9UA 3SCNA 1C3FA 3CZEA 4WK9A 4UTFA 3WF0A 4D1IA 5LYRA 3BGAA 3NJ3A 1W9DM 3WSUA 4A3HA 2WVUA 1LWJA 4WKHA 2ZUNA 1JFXA 4AD4A 1XH0A 4MTVA 5IHRA 3N17A 2VI0A 2WVSA 2G3JA 3AOFA 1UZ4A 4KRTA 5A6BA 1Q6FA 1V02A 4HA1A 3ZOAA 1G9HA 5IFTA 4P7OA 4MDPA 4BCEA 3ARQA 3A4AA 3PZ9A 3DYMA 2Y2WA 3EMZA 1FFRA 4Z2LA 4AZCA 3QHOA 2PI6A 4HZ7A 1MXGA 3WBAA 4JKLA 3NIYA 4AIUA 2J79A 4W93A 1E71M 4LGXA 1EXPA 2WMKA 2D3LA 3WQ8A 5A6AA 2WANA 3ECQA 1HP5A 4ZXOA 1CGWA 4D1JA 1HVXA 2O9OA 3OZOA 3POHA 4J3XA 1EOMA 4AY1A 2CHOA 1H2JA 4B16A 1UR0A 2WVVA 2WC3A 1E5JA 4PMRA 1UR4A 3RM9A 1ITCA 3AMKA 1VB9A 3PZTA 4PCTA 3IAQA 5BXRA 5HPOA 1L0PA 2WCGA 1HJXA 1V6VA 1CGXA 2CETA 1BG9A 1YHTA 1E1EA 2PWFA 1GJUA 2WCAA 3WUGA 1ZU8A 3L4WA 1H3GA 2W92A 3PTMA 2BNJA 4UOJA 2XFRA 3TTOA 4Z2IA 1JD9A 1G94A 4C7GA 1CNVA 3AIBA 3A4XA 4D6CA 4WKAA 4QLJA 3N9KA 2WHLA 3CBWA 1ZJAA 3AIWA 4JKMA 1OIMA 4PMXA 1HVQA 4PMUA 3K4AA 3WMCA 1J10A 2XUCA 2YLAA 3CMJA 4AEFA 4LYPA 3VGBA 2VCCA 4XUYA 1KQZA 1WZLA 4D6HA 3CH9A 2GSJA 2NT1A 1PBGA 2EEXA 2YOCA 3G6LA 3N15A 3CHEA 4H7VA 3AI0A 1UHVA 3HU7A 4M81A 1GJWA 5E6ZA 1V6XA 3UERA 1ZB5A 5D9PA 1BPLB 1U30A 2WMIA 2ZXAA 2ZUTA 1GOIA 4CD5A 4PMNA 4F8XA 3BAJA 3KL5A 1CXKA 5I78A 1JXKA 3WKZA 1QW9A 3VMPA 4CN6A 1FH7A 2BY3A 1AQ0A 5D9MA 1B3VA 2X8RA 3M7SA 1I1XA 1MW0A 2VVNA 3NUKA 3B9DA 2XVGA 1MWOA 4IUGA 2XVLA 2GJRA 4JFVA 1NWTA 1QW8A 1ISYA 1J0KA 1QHZA 2QMKA 4GO9A 1EO7A 1VENA 3VIPA 5CG0A 1DWAM 4JL2A 4Z2KA 1XD1A 4X9YA 3WF1A 3PZVA 3W28A 1B30A 3ARSA 5BWFA 4CCEA 5AYBA 4CD7A 4ATDA 3MV01 3PZOA 1A47A 1JZ6A 2V3DA 2FHCA 1XSKA 5A8QA 3OLGA 2VX7A 1WDQA 9CGTA 3WMSA 3NSMA 2A3CA 3WH8A 3VIIA 4K68A 4E4PA 4XX6A 5GNYA 2BVYA 8A3HA 2XPKA 4JL1A 1QPKA 1CECA 1RPKA 1UR2A 3AZSA 4AZBA 2WHKA 2CHNA 2VX5A 3A47A 3GBEA 4HMDA 5HBFA 3GDBA 4P8VA 2J25A 1UKOA 4OBRA 1B2YA 1KBKA 4PSPA 3MUAA 1MW3A 3PTQA 3WNNA 4IPLA 5M17A 1VJSA 5FCZA 4ZE4A 1ISVA 3ZT7A 4MNLA 2D0HA 2YL9A 1K9TA 3ARPA 3T0AA 4WF7A 1G01A 1LG1A 3APGA 1CXHA 2W67A 3AICA 3MUZ1 4ML4A 4EANA 2G41A 1MFVA 1LG2A 2CYGA 1UD5A 1IZKA 3RO8A 4LXFA 4RL3A 3RMEA 3DYPA 2JALA 3ZR6A 3W6MA 4CKQA 3KL0A 4W5UA 4HZ8A 4B9ZA 5JIPA 1VRXA 3OA5A 2GK1B 1OCQA 4OUEA 3VM7A 2EJ1A 3EDFA 1KQYA 4Q22A 1EHNA 2WVTA 2YKKA 1G0CA 4MB3A 5CQ1A 1KCLA 1V08A 2ZWYA 4KH2A 1JXJA 3N13A 4X0VA 3VD3A 3MSDA 4UZUA 3WUEA 3GBDA 1E6SM 3I3BA 1OINA 2J7DA 1X1NA 3ZQ9A 4BQ2A 2VT0A 4PYSA 1C92A 4F9DA 1V0KA 3TOPA 2DT2A 1UWIA 1E5NA 5I24A 2C0HA 4QDMA 3VIFA 2CBUA 3E1F1 3MMWA 3NCOA 1QNQA 4YPJA 1LLOA 3U7VA 1DHKA 1V3KA 2WMHA 2OWXA 4JKKA 2C7FA 5CGTA 3VD4A 1O7AA 4W7UA 3N1AA 1F4HA 2G3MA 3QHMA 4PMQA 3WL0A 4CD4A 1J0HA 3FNDA 2FHBA 2ZX8A 4KGLA 1L8NA 4DWSA 1E0WA 1WE5A 1WO2A 1WKYA 1E3XA 2OYLA 4Q7NA 2D2OA 2PWDA 1OM0A 3ARUA 2WC7A 2QPSA 4KWUA 2OSWA 3D5HA 3ARRA 4D6EA 3VDAA 1KCKA 3WQ4A 2VZVA 3ZM8A 1CXIA 3ZJ8A 3SCRA 4QCFA 4B3KA 1C7SA 4JFTA 2ESCA 2XVNA 1TCMA 4GQQA 1E0VA 3B8SA 3M07A 1WDSA 1ECEA 2VZSA 5E70A 2VR5A 3WQ6A 4RE2A 1QNOA 4LPCA 3RIKA 5M3WA 1SR0A 5DT7A 4FK9A 1XGZA 4U31A 5E09A 1R85A 4ACZB 2JE8A 3PZUA 1GOOA 2W63A 4M56A 1VEPA 3UR8A 1P6WA 1J0JA 2E8ZA 4MNMA 1FFQA 3ARVA 3L4YA 3CUJA 1MYRA 5JBFA 4MDOA 2AOSA 3AJ7A 1ESWA 3GM8A 3SUWA 5I0DA 2Y8KA 3UESA 4MJ4A 4AD0A 5A8NA 1CYGA 4LX4A 2ZIDA 3VIJA 4A3YA 1JYNA 1B0IA 5A6JA 1KBBA 1PIFA 2CCRA 1HKMA 4P7QA 5D9OA 2WMFA 4JHZA 3W4RA 1WZAA 4WKFA 2VC9A 5BRPA 3TTSA 2O92A 4H8UA 1BYAA 1DP0A 4MADA 1GQLA 1JF6A 3VMNA 3VGDA 3SCUA 5LA1A 3AMDA 1Y7VA 3IJ8A 2A3EA 5JUVA 1U33A 4V27A 2E40A 3KZSA 1RD6A 4J3WA 4UQDA 1NP2A 4TVDA 3VILA 3WQWA 2MANA 1HKJA 3SCQA 3WD4A 1E4NA 1X6LA 4AZCB 3VU2A 1V0NA 3M6DA 5AC5A 5A6LA 4PTVA 1W9XA 2BV9A 3VDCA 2QPUA 2Y8VA 5GNZA 4KRUA 1DWFM 3BAWA 1KWGA 3RILA 1GOQA 1NM9A 1B9ZA 2DIJA 3F5JA 4BF7A 1BSIA 4E8DA 4CU7A 4W8AA 3CUHA 2EPLX 4BQ4A 1NWUA 4GZEA 2W66A 2WVVB 1R87A 3CUFA 2BS9A 1UH3A 5BROA 3WENA 1M03A 1JDAA 3IK2A 2D23A 2ZXQA 2XGIA 2CITA 1QI0A 1GOMA 2DH3A 1VF8A 1B90A 2UY3A 2WK2A 3ZSTA 4YHGA 4MPKA 1QHPA 3W6LA 5C71A 2CIPA 1QBBA 4UFLA 2VVSA 4AD5A 4AIOA 4GKLA 2BY2A 2D1ZA 2VRKA 3LPOA 3WDRA 3WF2A 3SCPA 4RE3A 4PTXA 3D3AA 2PWHA 3B9EA 5E0CA 1GORA 1UG6A 3EBVA 5ABHA 5EBAA 3II1A 1H0GA 4BQ5A 1PPIA 1U2YA 4A4AA 1XSJA 4JCMA 4ATWA 1UH4A 4PUEA 2YBTA 4Y7EA 3U57A 2WXDM 4MAVA 2JIWA 3TONA 2A3HA 1TA3A 1BF2A 2OSYA 4X0NA 1IZJA 2WHJA 5DT5A 4UFIA 3BMVA 1PAMA 1E43A 3EDJA 1HP4A 1V6WA 3AHZA 2WMIB 1OD0A 3N04A 3SUSA 3WD3A 4H8HA 4P8WA 3RJYA 2NW0A 2NSXA 1JYXA 1E1FA 1CXEA 1OWQA 3GTNA 5CZKA 2A3AA 4OZOA 2ZICA 1BTCA 5A8OA 1Z32X 1E4IA 2D0GA 1GONA 1VFOA 5JBDA 3ZSSA 4LYQA 3PZNA 3BSGA 1J01A 1J0ZA 1QI5A 1V3IA 1GHSA 1W2PA 3AQUA 4D6JA 3AXIA 5C70A 1EOKA 4CCCA 5CXPA 4CVWA 3FN9A 3VD7A 3ZJ6A 1GQKA 5GPRA 4M80A 1UOKA 2CBVA 3IJ9A 5A2AA 2B31A 4R5EA 1W9VA 4FMVA 3KEHA 3QHNA 3AZTA 3W25A 4W5ZA 1ZBVA 2ZOXA 1BYBA 4JFUA 1UA7A 4CD6A 4DM2A 2VZUA 3AIVA 3T2PA 4PMVA 5CLWA 1E55A 3AS1A 3SURA 2XVPA 3GXIA 1CWYA 1H09A 3CLWA 4JAWA 1JZ7A 3W0KA 1BAGA 3NSXA 4PMDA 3VPLA 1PIGA 3K8LA 3GZAA 2XWDA 4P8XA 2CPUA 3EDEA 1WNOA 5EFFA 5ABEA 4ATLA 2J8GA 1NQ6A 4AW7A 2CBJA 3WH7A 2E0PA 2WAGA 1HJVA 1CDGA 3CGTA 1CEOA 2GFTA 2GJXB 2OSXA 5A6KA 2W5FA 5JIWA 4DWSC 1JI2A 1C93A 5EMYA 2WM0A 1QI3A 3NDZA 2QF8A 3VGHA 4GIAA 3WNOA 1RH9A 2FH6A 1TVNA 3EDKA 1WP6A 5DMYA 1JFHA 4PMOA 3F5KA 2EO7A 3W37A 1GVIA 3HN3A 3WY1A 3BH4A 1JYWA 1ISWA 5LA0A 3RPMA 4H8VA 2WWCA 4PTMA 1JAKA 4DUWA 3UG4A 3VMOA 3ALGA 1R7OA 2J8FA 2ZUUA 2ZE0A 4GINA 4GO8A 1KB3A 3CMGA 1HIZA 2PB1A 5I2UA 4AZ6A 4CN1A 2JF6A 2V5DA 4HA3A 4TXEA 4M24A 2PF0A 1I75A 5A95A 2XG9A 4FLSA 3G6MA 1HN1A 1FHLA 2ZUVA 4PN2A 7A3HA 3LMYA 4HPGA 3TTQA 1TG7A 3S2CA 1OD8A 2CBIA 5GQBA 2E9BA 3W81A 3WL1A 1OIFA 1KXVA 1NARA 3WD0A 1TMQA 2Y24A 1KXHA 4OBSA 2W62A 1GNXA 1Q6CA 5A6BD 2CXGA 3VNYA 5FD0A 4P7NA 2FH8A 3BXWA 2VRQA 5HXMA 3KL3A 1BG4A 5E0FA 1QNSA 1R7AA 4WSKA 4UFKA 1XH1A 4DWSB 1EIBA 4J3VA 4AMCA 5BCAA 3OZPA 1JZ3A 1X6NA 3OB8A 3TP4A 3CZKA 2JEQA 2X1IA 2WW5A 1MVYA 2VX6A 4MNKA 4MAZA 1EDGA 2IXUA 3N11A 5AC4A 4EE9A 3WDJA 1V03A 2GJPA 5A8MA 4UFHA 2UWFA 4C7FA 2G4FA 2EXOA 4PUDA 2JFEX 1G5AA 4AEEA 1PZ3A 4QLKA 6TAAA 4UQAA 4U3AA 2ZX7A 3LPPA 2OYMA 4RE4A 4EKJA 4M82A 3AIRA 3MMUA 1BGAA 1E40A 1XCWA 3ARYA 2X0HA 4DUVA 2Y4SA 2E4TA 5BYWA 4HU8A 4HMCA 1PJ9A 4HPHA 5A69A 1K6AA 3JUGA 2J4GA 3GNRA 3T08A 3ARTA 3THCA 3WQ5A 2DSUA 3DC0A 4EK7A 4MNJA 5BXSA 4HU0A 4NSBA 2X05A 1QNPA 2FHFA 5IDIA 2BVDA 1V0LA 5A2CA 1IT0A 2ZXBA 2ZXDA 2NT0A 4URIA 4P7LA 3OG2A 3WNPA 3AHXA 5EB8A 2DSVA 3WEZA 3WELA 1JF5A 3EMQA 3FAWA 1SYTA 1RP8A 2YBUA 3GXDA 1UQZA 1LL6A 3MUIA 3VD5A 2XM1A 1BGGA 1UWSA 4FF5A 1EQCA 3AISA 2EPMX 3OGVA 2CERA 4HMEA 4TVUA 1KXTA 1Q6EA 1OGSA 1E6NA 3VIKA 1HJUA 3LPGA 4DM1A 7CGTA 2WKGA 2RGLA 2Z1SA 4KMQA 2FDMA 3N18A 1F4AA 1GPFA 4D6GA 3A3HA 1JNDA 1H11A 1MQPA 1R8LA 2XVKA 3OIHA 1NWRA 3K46A 1V02E 4F9JA 3CUGA 5D9NA 5A1AA 4W84A 4WLCA 1MXDA 1DWHM 4W8BA 4HZ6A 1JIBA 2WB5A 1ZL1A 1W3LA 1UR8A 4V28A 1BYCA 1CGUA 1ODUA 3VKKA 4YN5A 6A3HA 3T2OA 4QP0A 2YA1A 1SFSA 2DT0A 4HA4A 2BFGA 5C8BB 3WBEA 4TOQA 1D2KA 1ZBWA 3ZT6A 1W3KA 3BAKA 3VIHA 1AQHA 5F7UA 3T0BA 4H2CA 2DGAA 4L4OA 1DWJM 2PBOA 4W85A 2DSKA 3VGGA 1GZJA 4OJYA 4KGJA 1UR9A 1B1YA 3NSNA 1H4PA 1C90A 1XRVA 3N12A 2J7FA 1D3CA 1CENA 4AZIA 5CGMA 3BCFA 2XHYA 4PMZA 2Z1KA 1DEDA 1KWKA 4GI9A 4GI6A 2F2HA 1B3WA 4PBGA 2XFYA 3SCVA 5IFPA 4MB1A 1VAHA 3ZR5A 4JFSA 3GYCA 1EDQA 2OWWA 3DECA 2V38A 1OT1A 1EH9A 1I1WA 5HOSA 1OBAA 5CLTA 2YL5A 4W8LA 3VINA 4U2ZA 2J7BA 2VRJA 3WD1A 3VGEA 4D6DA 2EQDA 3WFLA 4WJXA 1H1NA 5LA2A 2DEPA 1VEOA 3FXYA 4GXPA 3AYSA 1VFUA 5D4YA 3VIOA 4UNIA 3VDHA 1JL8A 4U33A 3WH5A 2DDXA 1ITXA 2D22A 2VJXA 2DSWA 4IPNB 3VO0A 3AS3A 4W7WA 4BA0A 1XCXA 3CIVA 1E6PA 1OT2A 3GH7A 4CU6A 3AMLA 1BHGA 4XV0A 4TVCA 1EHAA 3VX1A 5CPQA 3ZMRA 2VOTA 4XB3A 4M29A 3WQVA 1XHGA 4TTUA 2XGBA 1E6XM 2WMGA 1W9BM 3L4VA 2X2YA 2GK1A 2BY1A 5BXPA 4AZ7A 5M5DA 3A4WA 4E8CA 4OOUA 4BZYA 4MJ2A 1W3JA 2X09A 3AHYA 4DWSD 1Q6DA 5EFDA 4Z2HA 1VEMA 1CBGA 3CHFA 1V0MA 2Y5EA 2F61A 5A94A 8CGTA 1E56A 1FH9A 3WH9A 4C7DA 2D3NA 3VD9A 2QV4A 3F5LA 4GI8A 5BRQA 2CESA 2WSPA 2JEPA 5A2BA 1KGUA 4ZXLA 5JBEA 1YQ2A 3AMCA 3SEPA 1CTNA 2D20A 1NOUA 4P7RA 1J11A 3M46A 4B9YA 1HF6A 3HJEA 3MMDA 4HP5A 4BQ3A 1PX8A 5CPTA 1ZBCA 3PZGA 5ABFA 3EMCA 4PSRA 5HNNA 2YIHA 2VTFA 4ZFMA 1H41A 2XM2A 1UD8A 4XZWA 4PMYA 4J27A 4JCLA 3IANA 1WDRA 1MW2A 1NOFA 1HKKA 2DPEA 1UD4A 1Q4NX 1V3MA 1TR1A 2J7EA 2VCBA 1E72M 4MB4A 4U2YA 3FW6A 4HOXA 3UG3A 2X0YA 2V3GA 3NYDA 1KGXA 1W32A 4OOZA 1JNEA 3DHPA 1WZMA 1UWRA 3AZRA 3AS0A 1BVNP 1PZ2A 2EBNA 3BCDA 2BHUA 4U5IA 4U5KA 1K9EA 3QOMA 5I6SA 2CEQA 3VTRA 4GQRA 4W88A 3RDKA 2ZUSA 3ARWA 2XYLA 2EPOA 3T09A 1GCYA 4HTYA 2VX4A 4YHEA 2UY4A 4AXNA 2DQXA 3PN8A 1UKPA 1VFFA 4D6IA 1CIUA 1B3XA 3MANA 1WDPA 4N42A 4B3LA 4N0RA 4QCEA 2TAAA 1W2VA 1S46A 3VVGA 4W89A 4W7VA 4ZE5A 1BQCA 1E6ZA 2GDUA 1IV8A 3ARZA 3CUIA 1JDCA 3ALFA 1E6QM 2BHZA 1H5VA 5IHSA 3ZJKA 1KR0A 2VQUA 1XYZA 1QHOA 2QHAA 3W53A 1JG9A 4AISA 5CJ5A 1JZ5A 4CD8A 1BLIA 2GUYA 2F8QA 1PX4A 3RJXA 4WIWA 2J47A 1TE1A 4JIEA 4AZHA 1H49A 3IAPA 2OWCA 2J7GA 2ZX6A 3DHUA 4CVUA 3HMCA 5M03A 4TX8A 2OLHA 5A8PA 3WUBA 1FHDA 2ZX9A 3KWXA 1UZ1A 3GXMA 3ZO9A 1RP9A 2EPNA 2BXYA 2J62A 5I3DA 3WEMA 1HNYA 2YJQA 4J28A 2W91A 5E9AA 2VR4A 7TAAA 4TX6A 3CZGA 2CNCA 3EDDA 1A3HA 1N82A 1LWHA 1LL7A 4LYRA 2J78A 1K9DA 2YDQA 5CSUA 4JHOA 4QAWA 2GVYA 3TTYA 1G1YA 2A3BA 3BLKA 2WCSA 3MO4A 4JFWA 1NH6A 1JAEA 1CGYA 3VGFA 1XC6A 1J12A 2DT1A 1WAWA 2WZEA 1KGWA 1ISZA 2WBGA 2QMJA 1OGBA 5FL0A 1C8YA 1XV8A 3AIEA 1J9YA 1UD6A 2W61A 1GVYA 1UWUA 1D7FA 3T0DA 4PRWA 1FA2A 2V3FA 3AS2A 4H04A 1XYFA 3ZJ7A 3WH6A 3BC9A 1AVAA 4B15A 2G3IA 1NP0A 1V6UA 4JZ5A 2BVTA 1EDTA 2WYSA 3AFBA 4IM4A 4P8UA 1CZ1A 1DTUA 2JF7A 3ARXA 4PCSA 3MS8A 1CLVA 3QGVA 2BXZA 1UKSA 2WNWA 4UQ9A 1XH2A 3OBAA 4D72A 1HKIA 4TTGA 4CCDA 3GNOA 5KEZA 2WLYA 3OGRA 2J77A 1KR1A 3AXHA 2CKSA 2GDVA 4AYSA 1J0IA 1QI4A 3AHTA 4AD2A 1UWQA 1V3JA 3W29A 3O6AA 1C91A 1M53A 1BVZA 1KFWA 1GW1A 1E4LA 3RCNA 4D71A 2EPKX 2WBKA 1VBUA 1EQPA 1US3A 2J7HA 2WC4A 1LF1A 3BAXA 2E3ZA 4J3UA 1SMAA 2VURA 3F4VA 4BS0A 1CXFA 4UFMA 1HJQA 1C8XA 2CKRA 2G8ZA 3K8MA 2YL6A 4IISA 1EO5A 2VQTA 3T2QA 2DT3A 2OYKA 5A3HA 3CZLA 1MFUA 3I3EA 3OLDA 1AQMA 2C8NA 1UR1A 3L4TA 3AIQA 1MQRA 1ZJBA 4UQEA 1UA3A 4AWEA 1E0XA 3GH4A 3DYOA 1E4MM 1JDDA 4AD3A 3FHQA 1M04A 1UD3A 1B3ZA 4AZ5A 4UFJA 5DFAA 1PX3A 4XZBA 3SCSA 3WD2A 1HJWA 1LQ0A 1CLXA 3MUY1 4GPNA 3UETA 4J3SA 4CU8A 4UR9A 3VIGA 2WLZA 3EYPA 3SUTA 3L2LA 1FP8A 2J74A 5D8WA 1ZS2A 2O9RA 3OGSA 1JYVA 3CZ8A 1QNRA 5IXEA 5DO8A 2YA2A 2W4XA 3AYRA 4W87A 5TD4A 4EAMA 1OGGA 4GZIA 3UEQA 4M1RA 2QLYA 3AIUA 1GOKA 1E6RA 3U5UA 1E15A 3QOKA 2FGLA 2XSAA 4UQBA 3PBGA 4HOZA 3THDA 3RM8A 1ZBKA 3VDBA 4QFUA 2UY5A 3FHAA 4U3CA 3CTTA 1E73M 4W86A 1R86A 1LJYA 4Z2GA 2GJXA 2XFFA 1FH8A 1WB0A 1BFNA 4AC1X 5I5RA 3IJ7A 1TUXA 3U5YA 3GNPA 4OIFA 4TUFA 2VL4A 2E8YA 3NDYA 1NWSA 2JIEA 1US2A 1HL9A 3MU7A 1DWGM 3QR3A 3FAXA 1W91A 2XJ7A 3O2LA 3PTKA 3K8KA 1W1YA 3VOCA 4AZGA 1CGTA 4F79A 3TA9A 1DWIM 1WPCA 3CHDA 1XSIA 3CHCA 3BLPX 4DUXA 3FY1A 1SMDA 3S6TA 1FOBA 2Q8XA 4CUCA 1LL4A 4E2OA 4ZENA 3VNZA 1JZ2A 1O6IA 2VO5A 5I79A 3WF3A 2VZOA 1AMYA 3CPUA 1Q6GA 5CPSA 5GNXA 1V3HA 2E9MA 3W38A 4FLQA 2DSZA 3SCOA 1J0YA 3O9NA 1GQIA 4V2XA 3AHVA 3CO4A 1QI2A 3U7BA 3L4ZA 2WZIA 2ZUMA 5ABFB 4ACYA 3L4UA 3VIMA 4NRRA 1VFMA 3BMWA 2AMGA 3LPFA 4GZJA 2FGZA 4UZSA 1W1PA 3W24A 5FL1A 5D8ZA 4FLOA 5CSYA 3SUVA 3W27A 3WNMA 3L2MA 1JZ8A 1WZKA 2O9TA 3VX0A 1FP9A 1NOWA 3SCWA 3WNLA 2BHYA 1UD2A 1VIWA 3UG5A 4AD1A 2J75A 5A6SA 1HX0A 1CPUA 1TA3B 4J7RA 4MB5A 1W3HA 2VMFA 2VZTA 2O9PA 2IUZA 1UH2A 1M01A 2G3NA 3OLEA 1GOWA 2XIBA 5AY7A 3SCTA 3GXFA 4S3KA 1W1TA 2D24A 2J7CA 2PWGA 4UOQA 1J18A 2AAAA 4NZCA 3WDPP 2YL8A 3PZMA 1HJSA 1GHRA 2UY2A 3UR7A 1UKTA 3PZIA 2WPGA 3WF4A 4R27A 4CGTA 1ISXA 1K9FA 2E9LA 5DEZA 4QLLA 2WMJA 3WNKA 2ZUWA 3KE0A 3RM4A 3AXXA 3OLIA 1JD7A
chains in the Genus database with same CATH superfamily
3EKZA 3A6OA 3V0SA 3GFYA 1AH0A 3WIJA 3N3TA 1W9PA 2B7PA 5DF0A 3UZYA 2DIEA 4I6VA 3C2RA 1PXGA 3WUFA 1LORA 1B3YA 4C1LA 2A85A 4QNWA 1WXJA 1B31A 4UOZA 4JQ4A 3TNBA 4MY8A 4D8AA 4F0KA 1WKFA 2FVLA 3PZQA 3K1DA 3N34A 3KBWA 2XSBA 3UNDA 3SRHA 1J2WA 4DO6A 3BPWA 2GWNA 4HYWA 3T42A 3W76A 3WFZA 5HWJA 2HRWA 1Q3NA 4RKAA 2BASA 3UCQA 3F4DA 4LUYA 1V6YA 1UQYA 3MUCA 4QDWA 4RNHA 5I23A 1MW1A 3NL2A 1QOXA 3MCMA 5JQ9A 4M8UA 2WPBA 3HQNA 3W84A 3S2LA 1VJZA 1W1ZA 2WHMA 3HIJA 3S9ZA 4FSAA 3NFUA 1TZ7A 3KCJA 2FTPA 1PTGA 4UCFA 3BAIA 2UV8G 3K4DA 1HG3A 1C8QA 4C6BA 2R6OA 5FIPA 1HT6A 2F7FA 2GGEA 4GBUA 1F6PA 1TVPA 2NV1A 2NQLA 2XIIA 2BY0A 2V68A 2J6VA 3W22A 4NI3A 3EXTA 3L21A 5IBXC 3MSGA 1ODZA 2QQ6A 4BWLC 1V6TA 2PTYA 4S3JA 2VCAA 4H41A 3GR8A 2ZRYA 2FIQA 5HDRA 4NIRA 5EGRA 5F4WA 4ALDA 1I4NA 1ONXA 3N9SA 2VUYA 5ECUA 1NIUA 1QVBA 3G1DA 5F2GA 3QQWA 4HBKA 4S39A 1E3ZA 2HPIA 5EMUA 1EGZA 1ZFJA 4L61A 3M5YA 4LC8A 2Z6JA 3A3WA 1EYWA 2XIOA 3CZEA 3N2XA 4WK9A 2ZZ3A 4XBSA 3FIGA 4QGCA 3WK2A 2X0SA 3BGAA 4HJFA 1GKRA 3CYJA 2PDMA 3ZYZA 4O17A 3WSUA 2WVUA 4A3HA 1LRQA 1QWKA 1PCWA 2DZAA 1TX0A 4H6QA 5IHRA 1R6WA 1M41A 3RO6A 2WVSA 3S2NA 3AOFA 5A6BA 4MG4A 3ITTA 3TZNA 2HNEA 2DVXA 3ZOAA 2Y70A 3HG5A 4CQ8A 2JKAA 5C7HA 4O0KA 4V15A 4RCXA 3DYMA 1IXQA 3PBYA 3MY9A 5BOEA 2PI6A 4NUWA 1H1YA 3NIYA 2J79A 3W7DA 4LGXA 1EXPA 3LTPA 5A6AA 3BARA 1HVXA 5IDZA 3POHA 1B9BA 4AY1A 3LTYA 2CHOA 5H2ZA 3ORWA 1Q7QA 3H24A 5D2YA 4NX5A 4B5TA 3DESA 1QW7A 3ITVA 5CC5A 1ITCA 1S2TA 2Q09A 1VB9A 3VKDA 1TTJA 1TWSA 5FAJA 1L0PA 2WCGA 1HJXA 3U0HA 3DC8A 1QU4A 2CETA 1OF6A 1E1EA 4JD4A 1OC6A 3WUGA 3VXGA 1ZU8A 1H3GA 2Z00A 3KXQA 3VFLA 4WY0A 4UOJA 1GG0A 2XFRA 3HPZA 4Q32A 5L9FA 3M0YA 5JH2A 1POJA 4JQ1A 1CNVA 1Z6KA 3A4XA 4LUIA 3SSZA 1TMHA 4QLJA 3N9KA 4IG2A 1XLIA 1OIMA 1D8CA 4NYUA 2R1MA 4HPJA 5HJLA 3L2IA 4MKVA 2E6DA 3UBPC 4AEFA 3CAQA 4XUYA 3GK0A 3EWUA 3OYXA 3CH9A 1ECQA 3HZ3A 2YOCA 3CHEA 4B5UA 4DJEA 2HSAA 4H7VA 3AI0A 1UHVA 3WQEA 1R3QA 3UERA 4LRTA 3QM3A 3RLGA 1T96A 1TRIA 1BD0A 1FDJA 4MSSA 4DXXA 2GL5A 3ANYA 1MUWA 1TV5A 1YE6A 1SQ7A 1O5KA 2X8RA 3M7SA 1I1XA 1N8IA 3CAWA 5CG7A 3S1VA 3CQ0A 3BZJA 3LM7A 3ITOA 4IUGA 2ISVA 1ZP4A 2PDUA 2OTDA 4OECA 1QHZA 4GO9A 4IQLA 4S1FA 1EO7A 1DJYA 1DWAM 2ZDRA 1XD1A 5AYYA 3WF1A 2X40A 4EPKA 1B30A 4ZR8A 1B54A 4O1CA 5BWFA 5AYBA 4ATDA 1IF2A 3UA4A 1R2SA 4GFSA 3M7WA 3EB4A 2FHCA 3CU2A 3V16A 1TX2A 1WDQA 9CGTA 3NSMA 3WH8A 3VIIA 4E4PA 1RJPA 4E3TA 3UGVA 3FDKA 2HE5A 2V81A 1ZUAX 8A3HA 2GQ3A 4OV9A 1UR2A 4AZBA 3A47A 3SN0A 4KF1A 5BOFA 4PB4A 1SM9A 1UKOA 3ONBA 3RXZA 4JY8A 4DJFA 5CBJA 1MW3A 4KQNA 3WNNA 1VJSA 4RK8A 3ZT7A 3BG9A 3PP7A 2D0HA 1CXHA 3MP5A 3AICA 4TQTA 4NAFA 4EANA 1IZKA 3NL6A 4F0SA 2HXUA 4RL3A 3MHFA 3DYPA 1EJTC 1A0CA 3KL0A 1TPEA 1VRXA 4D8ZA 1H63A 1RVKA 3VM7A 4FIQA 3IARA 3M0IA 3HQPA 4JOMA 3F2CA 1CB7B 3TJXA 2ZWYA 4X0VA 4JDBA 4CNUA 4UMCA 1EZWA 4HIBA 3BE7A 3V3WA 5B7ZA 4XWUA 3PBMA 1YW1A 3OZMA 1VS1A 4H9MA 3MB9A 1LZOA 2VR2A 3LYEA 3VOGA 4BQ2A 3NG3A 2DZXA 2Y85A 2I16A 5I24A 3VDGA 4GJIA 3IVTA 5CSRA 1QNQA 3CIXA 3R8HA 1SGJA 2WMHA 2ZCGA 4HCLA 3WMLA 2FFCA 1QO2A 1J0HA 5FJJA 3TKFA 1L6SA 3EOUA 3W7CA 4US5A 3QR0A 4K7YA 1L8NA 1GYMA 4FOUA 1TKKA 2YSWA 1V4YA 4NAEA 1E3XA 4YTRA 3BICA 2X1RA 2FJKA 4ZA0A 4AVOA 2QPSA 4KWUA 4A6GA 1ITUA 2ZVIA 4QJ4B 3COTA 3V5OA 4C60A 4R3UA 3ZM8A 1A80A 2I17A 3ZJ8A 3VE7A 4LB4A 3SCRA 4QCFA 4AMAA 2J6XA 3DFTA 1TIMA 4GQQA 1FHVA 3VNDA 3ZZ1A 3B8SA 2VZSA 4JTKA 3M0XA 2QCDA 4ASTA 4LPCA 3RIKA 3B04A 4IHCA 5FSEC 1XIHA 4CLMA 5TAOA 4PE8A 5FI8A 1Z3NA 1P6WA 1J0JA 4KCTA 4MNMA 3V7PA 3CUJA 4GISA 3L0NA 3MJMA 1ESWA 5I0DA 2I7GA 5D05A 5MF5A 2Y8KA 4XIMA 3UESA 4Q4RA 1XLHA 2E6AA 2R8WA 3PUOA 1NFGA 4LX4A 2ZIDA 4OGZA 5LNSA 3VIJA 4O1EA 5A6JA 3TSBA 4LTSA 4C65A 3GDTA 3W07A 4H8UA 3LMZA 4DO5A 4MADA 1JF6A 1TJPA 3LI0A 1L2QA 5AHLA 5LA1A 5AHMA 4U28A 4ADSA 1PO9A 2A3EA 3UVIA 2NWRA 3V5CA 1JCYA 3F4CA 1FXQA 3H6OA 2ZFAA 3LBMA 3P2VA 1A3XA 4H83A 1TB3A 3STFA 3NQCA 3WD4A 1E4NA 1LRTA 2VYOA 4RPPA 4NASA 3NQAA 4XD6A 5AC5A 5LIWX 1S2UA 2HWGA 1IR1A 2BV9A 1D3GA 2QPUA 1KW1A 4WCJA 3H2MA 1DWFM 4YXGA 4AX6A 3T7VA 3RILA 1GOQA 5CGQA 1B9ZA 2DIJA 1K7FA 4NI8A 1BSIA 4MPQA 1HGYA 4XKMA 3ABXA 3OEXA 4GZEA 2W66A 4MFDA 4PBFA 3O15A 1R87A 3CUFA 3OQEA 4EOUA 1S2CA 1Q66A 1MDLA 4L80A 2F38A 2BP1A 4XZLX 3W1PA 3MHGA 3Q94A 2DH3A 4IGNA 1SFLA 1DOSA 1QHPA 3O16A 2VVSA 3PG9A 4WY0B 2D1ZA 2VRKA 3TN6A 3WDRA 3IVUA 3D0CA 2DY3A 4RE3A 4PTXA 1A5UA 3GAYA 4REQA 1KKOA 4C6JA 1KM3A 1XIEA 1QO5A 3RR4A 1K8CA 1G4EA 1U22A 4BQ5A 1U2YA 4A4AA 4RXGA 4JCMA 3SAZA 4Y7EA 4QHRA 3U57A 2O55A 2JIWA 5G2WA 1TA3A 2FPTA 2OSYA 3FVMA 2WHJA 4X3ZA 4ZZ9A 1EF3A 4F2UA 2FZMA 1HP4A 3TIMA 1V6WA 3FXGA 4Q8QA 2CLIA 4IFKA 3F4WA 1W31A 3RJYA 1I2PA 5FJTA 4FXFA 1E1FA 4U10A 1CXEA 1VFSA 4GUIA 3OVGA 4CNTA 2AGKA 3GTNA 2RDWA 1AJ0A 2PEVA 1ONEA 4GRSA 1NSJA 4AIBA 2W9MA 3RMJA 1E4IA 1VFOA 4JTQA 3ISIX 3PZNA 2C1HA 4E4UA 4NZ1A 1PSCA 4Z1CA 3CAVA 4D6JA 3PR2A 2LLEA 1SO5A 4XBJA 4GVHA 1GQKA 3UR2A 3SADA 1W9VA 3KEHA 4HJWA 3UZXA 4GQGA 3OIXA 2E5CA 1ZENA 2HK0A 4DXVA 3LCWA 4JFUA 1UA7A 4DM2A 2QIWA 2PDWA 4DBEA 3T2PA 4PMVA 1S5NA 5K9XA 1QCWA 4DO7A 1CWYA 2YYUA 1LTDA 4JAWA 3UZZA 3KVKA 4PMDA 1K02A 3E0IA 3P14A 4P8XA 3EDEA 2C1GA 5EFFA 1SJAA 1TMLA 3V1HA 4ATLA 1S1PA 1S39A 3QLLA 2HBXA 3U6WA 1DYSA 2E0PA 3CGTA 2GJXB 4K3ZA 4Y9OA 3FSTA 1JUKA 2G96A 1T0OA 2QR6A 5JIWA 1C93A 4GIAA 3TMQA 3WNOA 1RH9A 3K5XA 3HGRA 3VE9A 3W87A 3EDKA 1TJ1A 3F5KA 3WY1A 1MXSA 3HN3A 1JYWA 2QDGA 4MOZA 1I60A 1JAKA 1KRBC 3UG4A 3MWCA 5MHBA 4XG1A 4FEZA 3N9RA 4GINA 3B3DA 3MUXA 4V1YA 1KM1A 2AKMA 2PF0A 4FLSA 1FHLA 1UJQA 1R3TA 5F2MA 3FKRA 3TTQA 1ADOA 1OD8A 5GQBA 4LVFA 1XQLA 4OBSA 2W62A 3N25A 2YZ5A 1GNXA 1Q6CA 5A6BD 4G2DA 1AZ2A 2OGJA 4P7NA 2FH8A 4HNCA 1A5NC 1VHCA 4HHMA 4GYPC 4JYFA 1QNSA 1QRQA 3N4EA 4FA3A 3O05A 4J3VA 2HJPA 3O6YX 1Z44A 3ICJA 4HHHA 2JEQA 1PHWA 2X1IA 3NQFA 5FESA 3TYZA 1UR3M 1BRLA 3UZWA 4MAZA 1EDGA 3FYOA 2ZA3A 3PPHA 3NWRA 1KRAC 4UWMA 1P1MA 3WDJA 1V03A 3RU8X 4Y9PA 5I3IA 3AUJA 2UWFA 2C3ZA 2V5BA 4ADTA 1G5AA 4UQAA 4U3AA 3RRAA 5FF3A 1A5BA 4RE4A 4HNNA 3EPOA 4IPIA 2V30A 4L7ZA 3N29A 2QCDB 4LS1A 1XCWA 1GVFA 2HEJA 3ITLA 3NO1A 1N55A 5U4NA 2VEPA 4LV4A 1F61A 2C79A 4UMAA 3FLUA 5CCZA 4IJBA 3GG7A 2J4GA 3T08A 2YW4A 3U9IA 3W23A 4K36A 3WQ5A 1TIWA 2VXNA 4EK7A 4B5NA 5BXSA 2FHFA 5IDIA 4AG0A 1YTEA 2ISWA 3MPGA 4GOAA 4WDXA 5C7VA 4Y96A 5A2CA 1KM5A 2PZ0A 1E1CB 5BMWA 3AHXA 1JCLA 5EB8A 1YXCA 3WEZA 3ANUA 2GOUA 1RPXA 3JW7A 2OODA 1RP8A 2YBUA 1K03A 1LL6A 3ABSA 4FZIA 4CNNA 4DJED 2XM1A 3EEZA 2SFPA 3FA5A 3ID7A 1EQCA 4GIYA 4X9SA 2VEKA 4TVUA 4XISA 1Q6EA 4IZGA 1OGSA 1SFJA 4KETA 3VIKA 3LPGA 4DM1A 2CW6A 2Z1SA 4KMQA 5L6UA 2FDMA 1F4AA 4D6GA 1JNDA 1H11A 1KNWA 4N2YA 5KZDA 1TTIA 2QJIA 1PV8A 1PB0A 3SN4A 1R0MA 1A5KC 1VBGA 3OIHA 1QOPA 2WSQA 1V02E 4WLCA 1DWHM 4RR4A 5BRBA 3UU0A 3B8VA 4DPPA 3H7RA 1W3LA 1F3EA 4YVPA 1WXZA 1ODUA 4YN5A 3BW2A 3TH6A 4O1DA 3VA8A 1R2TA 2DT0A 2G3FA 2WQDA 4HA4A 1RCXB 3IJDA 3WBEA 4TOQA 1UROA 1XS2A 3BAKA 1AQHA 3T0BA 4W85A 3VGGA 1AH4A 4EPEC 1XYCA 4KGJA 2C1IA 1B1YA 1IXOA 5D32A 1H4PA 2E25A 2OZTA 4WVXA 4WJEA 1C90A 1SFTA 1XRVA 3N12A 4JY9A 4RV3A 5CPNA 3H12A 1D3CA 5CKSA 3W2LA 3CL6A 1D8WA 3SZ8A 1XUUA 3LI1A 4DJFD 3R4IA 4KKXA 2GPTA 3HGSA 3FA3A 4H3DA 3SCVA 4NJJA 1VAHA 5DRIA 5HQLA 3KW3A 2OWWA 1OX4A 2EF9A 5HOSA 1I1WA 1EKOA 3MBDA 1J96A 3BJTA 3TC6A 4XAPA 1OBAA 5CLTA 2YL5A 4U2ZA 4NX0A 2J13A 4WXYA 3NZQA 5DELA 3CL8A 4JIPA 4QS5A 4YL2A 4WJXA 3FVDA 3H54A 1SJBA 4IFKB 2HNHA 2V6AA 2BOGX 1JL8A 1OFPA 4XTDA 3Q45A 3NM1A 3E3HA 2PDHA 1LROA 3GC4A 3S6OA 1GZ1A 4NNBA 1TWWA 3N6QA 4MKNA 1XCXA 4CU6A 2P3ZA 3AMLA 3MI2A 4RJEA 3S1GA 1L2UA 5CPQA 1GT8A 4KFOA 4XB3A 1EP3A 4FHAA 2XSXA 3BDKA 3M44A 1W9BM 2OOFA 5D37A 2ANUA 3BLFA 4NXKA 2YR1A 3WYZA 3A4WA 4US5D 2G37A 2X09A 3W7RA 3IACA 3R1ZA 4XZ9A 1N8WA 3VC5A 1VEMA 4EP8C 1NU5A 4FF7A 2Y5EA 2F61A 3NEVA 5A94A 8CGTA 1P4CA 4WUIA 4PC8A 3DERA 2ATSA 2QT3A 1DKWA 2I9EA 4GI8A 3WLNA 1E0TA 3KVLA 5C9WA 3W9ZA 1YQ2A 2C91A 4JTGA 4MUPA 1H5YA 3PBUA 3M46A 2ADAA 2F6XA 4LUTB 1KFCA 1ZY9A 3IUIA 3GIPA 1W56A 1I6NA 3HJEA 3HPXA 5K9DA 1VPQA 1S5TA 2VTFA 3A21A 4ZFMA 1VLIA 1H41A 4HYVA 4ZOCA 2XM2A 1UD8A 3SN1A 4PMYA 2GSEA 2XGZA 1ZLPA 3NAVA 2OKOA 3BJSA 1MW2A 1QASA 2DPEA 1IT8A 2J7EA 3TV8A 1E72M 4O0QA 1Q8AA 1HZYA 4L6DA 5J8LA 3TYCA 1KGXA 1N7KA 1W32A 1WZMA 3AZRA 2Q8ZA 1BVNP 4U5KA 4ZQRA 2CEQA 4W88A 5I00A 1OFBA 2IKGA 5LIUX 1T7LA 3FFSA 2OPJA 4HTYA 3RG6A 2QW5A 2UY4A 2DQXA 2FPYA 3SO7A 1UKPA 3BURA 1UZDA 1B3XA 3K4WA 1XL9A 4GY0A 3N6HA 3PNUA 4C6NA 4N0RA 3VNIA 2TAAA 1W2VA 4I90A 4KWWA 5D2TA 4GBDA 3E2RA 3W1UA 3CUIA 4DELA 1JDCA 4OWGA 2FPVA 3S9IA 1H5VA 5IHSA 4DN1A 3IS4A 2VQUA 3AUOA 3W53A 3MZNA 3NQEA 4AISA 4IIHA 4KCVA 3PTDA 3DFSA 1IIHA 5CZJA 1EWDA 2AL1A 3M5VA 4JIEA 3DFNA 3HMCA 5G4HC 1SZEA 1G7UA 3W1AA 3WUBA 1FHDA 5K9CA 4X2PA 4HMNA 3TFCA 4JICA 4UTJA 2QCHA 1TO3A 5G2IA 1M1BA 1VRDA 3WEMA 4D9PA 1BQGA 3KVJA 3GKAA 3WLTA 5E9AA 1UUOA 2EGZA 1IGWA 3G0UA 5I7GA 1A3HA 1VFHA 2FLIA 3HV9A 3JRKA 3TYDA 3KOYA 1K9DA 1Q7ZA 5DXXA 3TTYA 1XM3A 2A7PA 4KFNA 1J12A 4V1XA 1DV7A 5D2XA 4B5SA 1CX9A 2WBGA 4N9BA 1XV8A 3CB8A 4ZB2A 2XDFA 3URBA 1D7FA 3XINA 2V3FA 2NX1A 3GUWA 3WH6A 2Z1BA 3KTSA 3E6EA 1UASA 4JZ5A 1EDTA 4F0HA 4NZFA 3W7QA 6ENLA 3HMJG 1WYIA 5GVJA 3UJFA 3WO8A 1OG0A 2X7VA 1WOAA 2WOQA 1SU5A 3GNOA 3A24A 4FOJA 3T07A 2J77A 4J2MA 4AYSA 3P80A 1LUCA 1J0IA 4IMAA 5E5CA 3AHTA 4AD2A 2YB4A 1XYAA 3LENA 4GIRA 1YNPA 4XAYA 1BVZA 1VP5A 2V5KA 2WBKA 3OVRA 3OZYA 1PIIA 1VQTA 5BWAA 2WC4A 2XN1A 3THUA 6TIMA 2ZZ4A 2E3ZA 3NZRA 1EL3A 2Z2AA 1SMAA 3STGA 2V69A 3GNNA 4LAZA 3K8MA 2WNZA 2YL6A 2PCEA 3LCLA 2OYKA 4EWND 2C8NA 3P74A 4LUSB 3WBXA 1Q6QA 3N2TA 1XCFA 1UA3A 4AWEA 1FX6A 3QC0A 2FB2A 4JNMA 1JDDA 5JXQA 4AD3A 3CUXA 3FHQA 4XTIA 1QTWA 3LUTA 2DZBA 3A9IA 4AH7A 1DIDA 3ITXA 4PL1A 2V67A 2YDAA 4GPNA 4CU8A 2YX0A 3EYPA 3SUTA 1BTMA 2J74A 5D8WA 3L23A 1ZS2A 4LT9A 1I45A 4H9ZA 2PDYA 4PCFA 3TJIA 2E68A 4NHVA 5DO8A 2YA2A 2W4XA 2A21A 3GU2A 3G2GA 2VDIA 3AYRA 4JBRA 4B5XA 4EAMA 3IEBA 2G5WA 4M1RA 3N2OA 3U5UA 3QOKA 2FGLA 1K3UA 2XSAA 3PBGA 3KRUA 1ZBKA 1OFQA 5FF2A 2GVJA 3APYA 4U3CA 1E73M 3OOQA 3TR9A 1UW9A 4O54A 1WB0A 4M7TA 1MRQA 4TX9A 3U5YA 1RXOB 3R94A 3GNPA 1F2JA 1WUFA 1MSSA 3NDYA 1KTCA 1US2A 3MU7A 3QR3A 2Z28A 3FAXA 5HANA 3M5ZA 3V5FA 1XJBA 1KFBA 1ZAJA 3VAVA 5HR7A 3DG3A 5GJMA 2IQDA 3FY1A 4WGXA 1TTQA 3S6TA 3QMRA 1FOBA 1OFOA 2Q8XA 4E2OA 4YTUA 4ZENA 3A13A 1EUNA 3VNZA 2HS8A 3TW9A 4DPQA 2VZOA 3DI1A 1Q6GA 3BV7A 4XAGA 4M7SA 3W38A 2PLKA 4AWUA 1IYXA 1LRNA 3LHUA 3L4ZA 3WZ0E 1YE4A 3L4UA 1W3TA 3VIMA 3CV7A 6ALDA 4GKTA 4RW5A 3BWWA 1W1PA 5CSYA 2WJDA 1NDYA 3VX0A 4EF8A 4MZ1A 3NQBA 1KBIA 3WNLA 2FGBA 2J75A 6PTDA 2D73A 4H6RA 2QVNA 1HX0A 4G9PA 4M6QA 2R82A 4J7RA 1W3HA 3VKBA 3NXLA 3L65A 1RA0A 4GXWA 4FP1A 7ENLA 3W7MA 3QFEA 2G3NA 3IUDA 4Q6JA 2BMBA 4YTQA 1W1TA 3B05A 2PWGA 4CQDA 5G1TA 1XIBA 5EA9A 1P6BA 1IR2A 1XR2A 1HJSA 3CIWA 3W7GA 3Q4DA 1XW8A 4KS0A 4H6KA 4QS6A 1FWBC 4G56A 3T81A 2WPGA 4TO8A 2KAUC 4R27A 4O0ZA 4CGTA 1H7RA 2XH4A 4WGHA 1K9FA 3GXNA 3VK5A 2WMJA 1GKPA 3RX2A 2ZUWA 4GNJA 4B5VA 3WJZA 4LAOA 5FOOA 3E49A 1ALDA 3WJXA 2V5CA 2DH2A 4Q8VA 3WQPA 3EWCA 3HM7A 3WQDA 3BSHA 1GKQA 1REQA 2XWEA 1QPRA 2PBGA 2ZZ7A 2QDHA 1FDYA 4IMDA 4HCHA 1K8YA 3W26A 1NQKA 3MI6A 5I07A 1IEQA 1DJZA 3BAYA 1DJGA 1W1IE 2BOFX 2GZXA 4JYDA 1AJZA 1RQBA 3CZJA 2IQTA 4O16A 3KDNA 5A6MA 5EPDA 4L4PA 4S2BA 4C6PA 3UWZA 2D0FA 1J5SA 2IXVA 1ZJHA 1SO4A 4PEEA 5I77A 2HISA 4DAFA 1WKDA 1EJSC 4ZO9A 3WN6A 4E5TA 2B7NA 4PRRA 1UPMB 2GWGA 3OA3A 3QEZA 4JTDA 5BXTA 5CJMA 4ICMA 4RV8A 3MV11 4LNCA 3W1LA 3ES8A 3TC7A 3G3DA 1QATA 1X96A 1IGSA 4L65A 1TV2A 1ZHAA 3FS2A 4CEUC 4MWAE 3LXAA 2OEMA 1J8VA 2A5HA 1GUVA 1HFBA 3IIZA 1XD0A 2YDSA 3QMTA 3J7HA 4OBTA 2Z4GA 3I3DA 2ZRWA 4OKDA 4J3TA 4AWTA 3MQTA 4LNYA 1LUCB 4LQ1A 2FZ8A 3VUPA 3F2BA 1JGIA 1V7AA 4D6FA 5AYIA 4DF1A 4BKNA 1FTXA 4QG8A 3IK4A 1OABA 3ZIZA 1DJXA 1OSEA 3L68A 5CZSA 2VEFA 3KOZA 3LS9A 4K6AA 4LVBA 2GDQA 1JZ4A 4WOZA 3DUGA 1M7XA 1K77A 4HVXA 3PF3A 3SCNA 1A5MC 3W7JA 3BMXA 1OADA 3GG0A 4AD4A 5EYWA 3NO5A 2G3JA 3UW6A 1IEVA 3IRDA 3GSMA 5EKYA 1F8MA 4IX0A 3QF0A 4HA1A 5IFTA 4P7OA 4BCEA 3IV8A 4GY7A 1DJIA 3ARQA 2YPIA 3TU9A 3MSYA 1W0MA 3PZ9A 2Y2WA 1FFRA 3QHOA 4J1OA 5H6HA 2Z25A 3GO2A 5FF7A 1MXGA 4W9TA 3WBAA 1XBVA 2WQPA 1POKA 2OJPA 2D3LA 1MO0A 3S2MA 3G1YA 3MWAA 1CGWA 4D1JA 2X1UA 2BDQA 2PD5A 4J3XA 1BF6A 3KRSA 1LDCA 4WDWA 5HNUA 3SRFA 3CK5A 1AL7A 3LSCA 1H51A 6XIMA 1UR4A 2J66A 3RM9A 1FHUA 3IWPA 4PCTA 3IAQA 3LCXA 4HT3A 4N4PA 1XLGA 1YHTA 4ZTXA 5CEWA 4QJ5B 3A9BA 1NDZA 3L4WA 5AKQA 2PODA 2ODOA 2OQYA 1F7BA 3TTOA 4Z2IA 3I68A 2Z29A 1YDVA 1JD9A 1G94A 3AIBA 2WHLA 4ZSTA 3CBWA 4QEEA 3DG6A 4PMXA 3KBNA 1N2VA 1HVQA 3M5XA 5JVLA 3E74A 3RPTA 2HPMA 1J10A 1XG3A 4A8IA 2YLAA 4CNPA 1WX0A 1PKLA 3MVIA 1JPHA 2NT1A 3L5AA 1XG4A 2IMRA 4UR8A 2ZA1A 4DHGA 3HU7A 1GJWA 3C2EA 1V6XA 2OB3A 5D9PA 4TMCA 1U30A 2ZUTA 1H50A 4CD5A 3C2FA 1Q6RA 3LG3A 2FMNA 1ZAHA 5I78A 2QV5A 4J3ZA 1CB2A 4CN6A 1FH7A 5D9MA 1B3VA 1W8SA 1K6WA 1BXBA 2JBMA 1MW0A 1V7YA 3G1HA 3H4GA 1GTEA 1XPGA 3SRKA 2XVGA 2PDPA 2GJRA 1M68A 1TSIA 4IL2A 1ISYA 2IPJA 1L6FA 1W17A 3VIPA 1F5ZA 5CG0A 2PDJA 1OEPA 1HTIA 5HQEA 1ZSXA 2G95A 1EC8A 3DDMA 1GYLA 1Q65A 4CCEA 3PZOA 1TPUA 4MLJA 2DUXA 1SZGA 5A8QA 3WK0A 4GXMA 3KS5A 2VX7A 3QC3A 3MTWA 3SQLA 3O0KA 3C2YA 4UR7A 4HK7A 4XX6A 4YLWA 2QGHA 5GNYA 3RK8A 2XPKA 1QPKA 2ISDA 1KFEA 1RPKA 1UJPA 4H6EA 3GBEA 4HMDA 2WV8A 4DF2A 4Y9MA 4F48A 4P8VA 2P1FA 2J25A 3M4HA 4MIMA 4OBRA 1AW1A 1FWTA 1K1DA 1KBKA 2NXHA 4UTHA 3MUAA 4IPLA 3UZJA 3TX9A 4F2BA 1AJ2A 4ZE4A 3INPA 4EIVA 4NNAA 2OZ3A 3T0AA 1ENUA 4BI5A 4LBUA 1LG1A 3APGA 2W67A 1ZQ5A 4ML4A 2G41A 1MFVA 1M7JA 4ZB5A 3RMEA 3CLMA 4CKQA 1F6KA 2XIMA 4HZ8A 4B9ZA 1PL9A 2DIKA 5FSDC 1I9CB 1YXDA 3N4FA 2GK1B 1OCQA 4OUEA 3BJFA 3TSMA 1EHNA 3BOLA 1REQB 3WBYA 2WVTA 3T6CA 3S1WA 4S23A 1KCLA 1V08A 1YPXA 1JXJA 3N13A 1DTNA 3VD3A 3MSDA 1FWRA 2PAJA 3GBDA 3WLIA 4DXKA 3E02A 1E6SM 2OLSA 1UPPA 2POTA 2J7DA 4Y9NA 2CZDA 2CZEA 1C92A 1W5NA 1TPC1 1NFBA 3TLQA 1UWIA 1E5NA 3P0XA 3VIFA 2CBUA 1RLDA 2X2GA 3NCOA 1LLOA 3U7VA 1DHKA 2OWXA 3T8LA 1O7AA 4W7UA 3N1AA 2X16A 2G3MA 3QHMA 5H8MA 3WL0A 4CD4A 2VFGA 1O5XA 3R6IA 4GK8A 4FNRA 4FNUA 3UWWA 3KLLA 1EIXA 3TXZA 5HA7A 1MEHA 2H3DA 4FO4A 3PANA 1JQVA 4IUOA 3GB6A 1S5VA 4WOQA 3B40A 2OYLA 4YTTA 5EBUA 4DRSA 4Z0JA 3IIPA 3QKZA 1OFDA 2PWDA 4WHBA 1OM0A 3WQFA 2OSWA 3D5HA 5C2GA 3D47A 3WQ4A 3ABZA 4GGBA 1CXIA 1TUFA 2FMOA 1FRBA 1DPMA 1C7SA 2ESCA 3NYZA 1GEQA 3T4CA 4DLMA 4JGDA 3KUMA 3URAA 1XX1A 1WDSA 1F05A 5EL1A 1C8VA 4JTJA 5DY2A 4RE2A 3UJEA 4H9VA 4C6DA 3CQKA 5M3WA 1FWCC 1H1ZA 1E0UA 3I4EA 3T40A 3TAKA 2PGEA 2W63A 1W3IA 1T6MA 4M56A 2EPHA 4F0RA 2EKCA 3W73A 1FFQA 2PDCA 1GTHA 1CLKA 1MYRA 5JBFA 4MDOA 2AOSA 3SECA 3UWVA 3SUWA 1CCWB 3GKFA 2H6RA 3GVWA 4MJ4A 3APTA 3DFHA 5HAOA 1JYNA 1B0IA 4GJJA 3U4FA 2IPFA 1GOXA 1PIFA 1DJHA 4MFEA 4DVOA 3LHYA 8TIMA 1DJNA 1TE6A 1FKXA 1AL8A 2INEA 4TR9A 2VC9A 1YPFA 2WSYA 3TUUA 3TAOA 4GCXA 3ES7A 5FEPA 1XFCA 1DP0A 1GQLA 3VNLA 5BMXA 4DZ5A 4DNHA 1KFKA 2ALDA 1AD1A 4ZTYA 3IJ8A 4FNTA 4ZGYA 3KTCA 2J9XA 3D3FA 2E40A 1NP2A 3L12A 4H9XA 4TVDA 3PNZA 3H7VA 2O4QA 4A8RA 2B7QA 3SCQA 3SGZA 3OVQA 3G1XA 5BOOA 1H61A 4PTVA 1W9XA 1FQ0A 1KM6A 3VDCA 2CLFA 2DQWA 4DJEC 4XO7A 2Y8VA 1OYAA 4KRUA 1KWGA 4X63A 3FOKA 5FEXA 4FXJA 4EX4A 4W8AA 3CUHA 3CQIA 1QPQA 1YADA 4BJHA 5E93A 4J9JA 1UH3A 1B4KA 1VCVA 4R34A 3IK2A 3NA8A 1DXIA 1W3NA 2XGIA 4RZ4A 2CITA 2PURA 1JCJA 2Z24A 2V8ZA 3Q67A 1LT8A 3ZSTA 2WSRA 3W6LA 2I1OA 1K8XA 1QBBA 2A3LA 4UFLA 4GVGA 3CB3A 3KDOA 1SW3A 2PZNA 4EF9A 3WF2A 3A4JA 3SCPA 1I2OA 5E0CA 2CXEA 3P62A 1S3HA 3UP8A 5EBAA 1XGEA 1H0GA 4UCGA 1OZMA 2FQIA 4ATWA 1O1ZA 4GABA 3B0UX 2YBTA 4KEVA 2A3HA 1YTKA 3BLOA 3O0FA 4MF4A 1IZJA 4X0NA 3UPWA 5KZEA 2Z2BA 3DX5A 3EDJA 3AHZA 2NUYA 4K8EA 1VBJA 4YCOA 3VI2A 3SUSA 4C1KA 4ES4A 4HK5A 2E7FA 4P61A 2E5BA 1OWQA 1THFD 3LDVA 5DQPA 4HNTA 1WOBA 1BTCA 5A8OA 1Z32X 2D0GA 1GONA 2ISFA 3ZSSA 4ECLA 4LYQA 5T26A 1X1OA 3U4AA 4QE1A 1V3IA 3AQUA 3AXIA 2QUUA 4WSHA 1J5TA 3LHTA 3L9CA 3RX3A 3W2JA 5GPRA 1UOKA 1FCUA 4Q33A 2GVGA 4I9TA 3QHNA 4W5ZA 5AHEA 1KLYA 3QMSA 1BYBA 1RK5A 3DOPA 4C5YA 1H7OA 2VZUA 3QW4B 1LYXA 4H9UA 5CLWA 1E55A 4AVNA 4YS1A 3SURA 4CQCA 3C61A 3UG8A 3W0KA 1BAGA 3NSXA 1PIGA 9RUBA 3AO0A 2XWDA 3UF9A 5F4XA 4HPNA 1EJWC 1ICSA 4LH8A 3GG1A 2FZBA 3CEPA 2CBJA 4DEFA 3WH7A 2WAGA 1KA9F 3W7NA 1CDGA 5KTLA 2OSXA 3LM3A 4ZVJA 1W6TA 3ABRA 3KZPA 2O7SA 5EMYA 3NDZA 2FH6A 1O94A 1WP6A 2OT0A 2NLIA 3HV8A 3BH4A 3EX6A 1ISWA 2NVAA 3CHVA 2WWCA 4DUWA 2Z1XA 3ALGA 2J8FA 1TJ2A 3F7JA 2GUUA 3DGBA 4IQDA 1KB3A 5H8UA 3ZLFA 3FJLA 4KPLA 2VC7A 3GDRA 1EB3A 2BX7A 2JF6A 3HOJA 4TXEA 1V79A 1I75A 1P5BA 5A95A 4TMBA 3VZXA 2X41A 5HJXA 5JU6A 7A3HA 3B4YA 3SB0A 1Y5VA 3P60A 1OIFA 1TMQA 1TQXA 5D2WA 2DZWA 4QJ3B 1MRAA 2XH7A 5EY5A 5HXMA 3KL3A 1KM4A 4MLRA 4A35A 5E0FA 1TQJA 4HNVA 2Z6IA 1R7AA 3XIMA 5I3GA 4Y9AA 7TIMA 4I7WA 3LHZA 1SJDA 2GJNA 3B0XA 1JZ3A 2NUWA 3TP4A 1PUDA 3TQ0A 2WW5A 1W5OA 3NZ1A 4Q4OA 3R89A 3NPXA 3E9AA 2IXUA 3N11A 4EE9A 1GVRA 2GJPA 2IPWA 3FGCA 2EXOA 2JFEX 3QZAA 3LRLA 4IICA 3P5YA 3UD6A 3U48A 1UIPA 5J04A 5FA5A 2ZX7A 4DLFA 3LPPA 2O0TA 3NL5A 2R1LA 3AIRA 4AY8A 1BGAA 3GYEA 3ITGA 4IP7A 4DUVA 4D2JA 3LB0A 5BYWA 4HU8A 1PS9A 4HMCA 4KBXA 4WQ6A 1GW9A 5A69A 1TPDA 1K6AA 4IT1A 4UNKA 1SJCA 3ARTA 5HQMA 3D6NA 2DSUA 3DC0A 5HUPA 4GUHA 4RNJA 1M3UA 2I57A 4HNUA 4HA0A 3CPRA 3GE7A 1V0LA 2DUAA 2ZXBA 3A5FA 4CNOA 4UXDA 1OC7A 1KKRA 3OG3A 2NT0A 4URIA 2GVLA 1L6WA 3WNPA 2DSVA 1JF5A 3VOIA 1M9HA 1S38A 4FXSA 4Y8EA 4MGGA 3MYPA 3GXDA 1UQZA 3BW4A 3OJGA 5JMUA 3VD5A 2YZRA 1OC5A 3RX4A 3HURA 3AISA 2R24A 4KCUA 4H9TA 3MDWA 2ONEA 1KXTA 3T44A 2W27A 4J40A 3W1TA 2PDIA 1Z48A 7CGTA 4HKPA 3N18A 1GPFA 5C2CA 4GYKA 1G67A 1R8LA 2WZMA 1NWRA 3RITA 1US0A 4ZL1A 1BSLA 3PB2A 3LQGA 4M6PA 4W84A 1MXDA 5I3JA 4W8BA 4HZ6A 2TMDA 3WLKX 2WB5A 2CZFA 4ROQA 4V28A 3DFOA 3VKKA 1R3YA 1A4MA 3ZLGA 3OHMB 2EHHA 3QVQA 3GD6A 5CAKA 4K2SA 4LUJA 1SW0A 2OCZA 3VIHA 3TW7A 5K7JA 1T8QA 4O28A 4L4OA 2QIIA 2DSKA 3G18A 1VLWA 1IZCA 3NM3A 1NF0A 3NSNA 3E38A 4L9ZA 2P3EA 3HA1A 3PSVA 1JRBA 4GNVA 5FJOA 4HSOA 4ZB0A 1Q13A 3DFYA 2GGIA 2OLAA 3BCFA 3WCZA 4ZO6A 3TN3A 1DEDA 1K4HA 3NURA 1S5MA 1B3WA 2PDXA 3QPZA 1R30A 1JCXA 5AFDA 3FJNA 3K13A 3QY8A 4DO4A 1P0NA 4JFSA 1EDQA 3DECA 4QE5A 1OT1A 4ZOEA 1RCQA 4W8LA 5HUOA 3VCCA 3W70A 3EA2A 2J7BA 3CC1A 3B0PA 2VRJA 3WD1A 3B0YA 1GWJA 3LTSA 1YMYA 2EQDA 3WFLA 2HMCA 3M0ZA 1C9WA 2DEPA 1VEOA 2PDGA 4L1WA 1VFUA 1FWDC 2OVLA 4O1AA 2HVOA 3VDHA 2VFFA 4U33A 4DZIA 3MYOA 4JIRA 2DDXA 2GJLA 2VJXA 3OU8A 4O13A 3GU9A 4IPNB 1GVEA 4M19A 4NKCA 2YCKX 1LBMA 4XV0A 4B4HA 1PHQA 5GJNA 4I6KA 1EHAA 1P48A 4D8LA 3WQVA 1U5HA 1XHGA 4TTUA 3CJPA 2XGBA 4FOKA 4ICNA 4C6FA 3S46A 3L4VA 4X60A 2X2YA 1BWKA 4H9YA 1YTDA 2BY1A 2AMXA 1A0DA 3M0LA 5BXPA 5CPLA 3HGOA 4OOUA 5CH9A 2VD8A 3DXIA 1K70A 3R25A 1CBGA 4NZ5A 3HG3A 1F74A 1XLBA 1B57A 3T55A 4Q4MA 1YIXA 4UTLA 3UWQA 4IIGA 2CESA 2UZ9A 2JEPA 5EU9A 2NXGA 3IRSA 4WEVX 1VYRA 4J35A 4NJKA 4QDPA 1X98A 2XN2A 5JBEA 3SEPA 1CTNA 4JEQA 4LALA 1VFLA 5LXXA 2TYSA 1HKWA 4K39A 1EFZA 4E2DA 4BQ3A 5CPTA 3PZGA 4PSRA 5HNNA 5HMDA 3PJXA 4XZWA 2VC6A 1AD4A 1L8PA 1Q4NX 1V3MA 1TR1A 3WK3A 2VCBA 4MB4A 4GUGA 3BLLA 1Y65A 4QM1A 2P8CA 1QPNA 1JNEA 3DHPA 4NQ1A 4AUBA 1PZ2A 2BHUA 2V0TA 4U5IA 2JK2A 3QOMA 3RN6A 5I6SA 5CBBA 3VTRA 1OCNA 2WNQA 1QOQA 1KLZA 2ZUSA 3H7UA 1D7KA 4E6MA 2CLLA 3VC6A 4AC7C 4K1GA 3QW3A 3P81A 3T09A 1GCYA 3PN8A 4B3LA 1ME9A 3T8QA 5DBUA 1S46A 1Q4WA 3H2CA 4W89A 4NILA 4N6FA 2Z7KA 1EBHA 2J24A 3LV5A 1E6ZA 4QRNA 1W8GA 4DUOA 3MCNA 3ALFA 1ZZMA 3I7SA 1A5SA 1P0KA 1V51A 3KBVA 4ZODA 2QHAA 4ZQPA 1EJXC 1JG9A 5CJ5A 2FFIA 4KT2A 4PUNA 2F8QA 4WIWA 3ELFA 1R5YA 1TE1A 3C8FA 3QQ1A 3AWNA 1H49A 3IAPA 1RJQA 3O7UA 3FGCB 2VENA 4CNSA 2ZX6A 3DHUA 2XH0A 3QSTA 2OLHA 4F3HA 3GC2A 1O5RA 1U1JA 3SQMA 3ZO9A 2J62A 4IH3A 3EWWA 2YJQA 3DKJA 5TBOA 3S8HA 3CPGA 1E9IA 2VR4A 4NP7A 2VFEA 4TX6A 3CZGA 7TAAA 1MNZA 4HQVA 4LFYA 4H7CA 4XUGA 4LF1A 1EJ7L 2YDQA 2VFIA 4QAWA 3H4XA 4MZYA 2MNRA 1BWLA 2CLEA 3GTHA 2ZTKA 4JFWA 1NH6A 1JAEA 3P61A 3VGFA 2EAWA 1W5MA 2WZEA 1UMLA 1OGBA 1C8YA 4XD5A 2W61A 1UWUA 2QGYA 4DNMA 3BL3A 5EMKA 1OVDA 3TYAA 3NOEA 4B15A 4M5PA 1CT5A 2WYSA 3AFBA 4TV5A 3W2NA 1DTUA 2JF7A 3MS8A 4K1WA 5AZ1A 3QGVA 3OBEA 2FYMA 4UQ9A 3STEA 3NQDA 1XH2A 3OBAA 4D72A 1HKIA 3C86A 2JKPA 3M64A 4HK6A 5LHFA 3PFMA 3G1SA 5TQLA 5AHFA 2P0IA 3W00A 2QCGA 4I5UA 4C6OA 3W1XA 2QCFA 3QGAC 4MJMA 3VOFA 3W29A 1C91A 4E2VA 2OFJA 2PLCA 4LEQA 2EPKX 2J7HA 2L5HA 3KOFA 4MUZA 4JNZA 1BWVA 4PGLA 3PC0A 1AK5A 3TCEA 4HNLA 3FJ4A 4I9AA 2B81A 4UFMA 4ZOBA 3S5YA 1GVOA 2G8ZA 2XZ7A 3T2QA 2DT3A 4PFMA 5A3HA 3OLDA 1EJUC 3BSMA 4Z17A 4IJCA 3AIQA 3TJ4A 1MQRA 2EG8A 3QRHA 1KCXA 5DY3A 2DORA 1AW2A 1E4MM 4OU1A 1UD3A 4RNFA 1B3ZA 4AZ5A 2QUVA 1XIFA 4IX2A 4XZBA 3UA3A 2PMQA 1HJWA 4UTKA 1QMLA 4I3GA 2OT1A 1YLVA 3CXOA 4J3SA 5AC8A 1TV4A 3H2EA 2BWGA 2GLKA 3QLDA 1L9WA 4AXKA 4X22A 1JYVA 1QR7A 4H4IA 3VUSA 3CZ8A 2ZDSA 1QNRA 3GHTA 3R7MA 1AG1O 3CQJA 3DHFA 1H62A 5C54A 4RDZA 1MEIA 2CZVA 3V0TA 3E12A 4A8NA 4W87A 3QN3A 1R9YA 4GZIA 4GFIA 3AIUA 4QQUA 4MWAA 2BLEA 3LBOA 3S1XA 1EXBA 3FK4A 3RM8A 1W5QA 4QFUA 1QK2A 3CTTA 4W86A 4Z2GA 3OBKA 2GJXA 2XFFA 1VCGA 4UTIA 3MKVA 2XH2A 2P88A 1BFNA 4K8HA 3CV2A 3S9YA 5LZLA 4OIFA 2XU2A 2VL4A 4ONVA 5LIKX 2E8YA 1RA5A 4XQ6A 1P6CA 3PY2A 1OX5A 2JIEA 1MUCA 2XJ7A 3O2LA 4Q8PA 2A6LA 1LLZA 1W1YA 3UY8A 3VOCA 1CGTA 3O06A 3TA9A 1P0DA 2WO5A 1WPCA 2BTMA 1XSIA 1X39A 2TODA 3BLPX 3KCOA 2PP0A 1P7TA 1SR9A 5E1QA 3RHGA 2OKTA 4K8GA 3H21A 4OHQA 1LL4A 3LU2A 3HTWA 2DUZA 1JZ2A 1O6IA 3I10A 2GOKA 2VO5A 5I79A 2ACQA 3CPUA 1V3HA 3L0GA 3SCOA 1J0YA 3V4BA 1UB3A 1GQIA 1QI2A 2Y8UA 2ZUMA 2PDLA 3DEQA 1ZP3A 4KESA 4NRRA 1OYBA 4I9MA 1T99A 4Y90A 2AMGA 4GZJA 2FGZA 4ZOAA 5FAGA 2C13A 3W83A 2VUNA 4N9DA 1JZ8A 1RSCA 2VDGA 4DBDA 1NOWA 1XXXA 1UD2A 1TJRA 1VIWA 1TELA 1PDZA 4AD1A 3B9NA 3V1PA 3LZ5A 5A6SA 1ICPA 3W1RA 4MB5A 3AU2A 5LSMA 5KETA 2O9PA 2HV5A 1PKNA 4HPXA 4ORIA 1H7PA 1D3HA 1LBFA 2IKHA 1M01A 4QE4A 1GOWA 3SCTA 4S3KA 3NL3A 1WAUA 2D24A 3QPEA 3P93A 4J4KA 3WDPP 1E9YB 1Y5WA 4FNSA 2YL8A 4JNYA 4RDWA 4GLEA 1FBAA 1DHPA 3M41A 3P5ZA 4L6HA 4ORMA 2AGTA 2UY2A 2ACUA 3PZIA 4Q4QA 4FNQA 3MDUA 1XDMA 2INZA 1ISXA 4QLLA 5G5IA 1E1CA 3RM4A 1PZ1A 4PUWA 1YDNA 3NZGA 2XN0A 3ZT5A 2CWNA 4GQ0A 2PTZA 3LEPA 2XTKA 2GQ8A 2G97A 1GGOA 1WUEA 4NZJA 1LOQA 1QBAA 5DX7A 2C14A 3EOSA 4QAIA 4WSJA 1VCFA 1JI1A 1QPOA 4S3EA 3P82A 4RZ5A 4EVZA 6REQA 4HHPA 1UBSA 5HWMA 2ZX5A 3QZEA 2O4MA 3LCHA 1UKQA 4QNEA 1LM1A 5DCBA 1RLCL 1E70M 3B9AA 4O52A 1WDDA 2PRHA 4JTAA 1V77A 2C18A 1YPIA 2Z26A 1TYGA 3GH5A 3SIMA 3PPFA 1H7WA 3WDHA 2YA0A 1YBQB 4F66A 1C7TA 1WCGA 3B8DA 2D2HA 2A6NA 3LRKA 4AIEA 1GVQA 1UWTA 1XF0A 4PTWA 4Q4KA 2PWEA 5LNVA 1FUYA 3PPCA 1TVLA 1ZAIA 5HMSA 2GUBA 1HL8A 3ANVA 4PR4A 3SGGA 2C6QA 1BYDA 4ILSA 4WDTA 4GG9A 3MA8A 4OTKA 5XINA 1EP1A 3HFTA 3MKKA 3C0LA 3QGKC 2YDRA 2ZC1A 2RGMA 2PC8A 2Y7FA 2VFDA 3KAOA 3RNDA 2WSKA 1GQJA 4I5XA 4Z2JA 2VEMA 1MQQA 5KZ6A 3TROA 3MO7A 3WDIA 3WMBA 5C9ZA 4UTTC 1UYQA 1W1VA 2FZDA 4RDYA 4KWSA 3L4XA 4JIIX 4DZAA 3QV9A 1R3SA 4NRSA 3LNPA 3CMFA 2R14A 1M5WA 4AY7A 1EZ2A 1UUQA 3OP2A 4GZ7A 1W9UA 1C9DA 4UTFA 4AU0A 5LYRA 2O7QA 4LBSA 2W0UA 4ZBCA 1U1HA 1JEZA 4Z42C 1W9DM 3BUVA 4IJRA 4FX7A 4WKHA 1JFXA 1UBPC 3BG5A 3N17A 2VI0A 3UVAA 3CEUA 2YXGA 3VZZA 1UZ4A 2Q6ZA 4KRTA 3REQA 1K7EA 2ZKMX 4DZHA 1G9HA 2QCLA 4MDPA 4PEKA 1UOZA 1XIGA 4JR5A 1XBYA 3W3OA 3STCA 3WLMA 3EMZA 4JTFA 3VABA 2ZADA 1CW2A 4JKLA 4AFYA 4AIUA 3ZVIA 3NPWA 3VNJA 4W93A 3WQ8A 2HVNA 1BEUA 3ECQA 1OX6A 4ZXOA 5CPMA 1G4SA 2PLJA 3LV6A 3OZOA 5FJPA 3IJ6A 4IFOA 3SDOA 1R47A 1G4PA 4MWAB 1QWGA 3EA1A 2WC3A 1E5JA 3A5VA 4HCDA 3AMKA 3PZTA 3HJZA 1QXLA 4LUTA 1BG9A 3QV8A 2PWFA 1GJUA 1HO1A 4GUFA 1KV8A 1I2QA 4NJGA 3A12A 3NOYA 4AAJA 3ZWTA 3C5QA 3ZXWA 3T0CA 3TDFA 4C7GA 3EXSA 4WKAA 3G5EA 1ICQA 1ZJAA 3AIWA 4JKMA 1YRRA 5DCEA 3N2CA 3KX6A 4PMUA 2WZTA 2QUNA 1FWGC 1RY0A 1P7TB 1XIDA 2VCCA 1TR9A 1KQZA 1IHIA 4D6HA 2GSJA 1PBGA 4PZVA 4GGHA 4H2HA 3N19B 4M81A 3RYSA 5E6ZA 2PDNA 2PRLA 3GXTA 1BPLB 3SFKA 3W74A 1LCOA 3WLSA 4PMNA 2OZ0A 4F8XA 3BAJA 1Z7AA 1L6YA 1JXKA 3WKZA 3QZ6A 3FX4A 8XIAA 2VVNA 3NUKA 1MWOA 3EA3A 4JFVA 4FR1A 4H01A 1NWTA 1J0KA 1S2VA 4EXQA 3IIOA 3WLPA 5CBIA 4Z2KA 4X9YA 3PZVA 5I06A 3W28A 4CD7A 1A47A 1JZ6A 1XSKA 2GGJA 1EPXA 4NU7A 2OO0A 1A4LA 3OLGA 3IJQA 3VYLA 3EPNA 4C6QA 3PWIA 4K68A 5AHIA 2G0WA 2PGRA 3BTNA 1F3XA 2DFAA 2BVYA 4JL1A 3UXIA 3NR0A 4AWSA 4I7UA 1J2BA 2BZNA 2WHKA 2CHNA 1XFBA 3KFTA 3A3XA 2ZYFA 3BCJA 2MUCA 3GQYA 3KBSA 1HO4A 1B2YA 2QNEA 3UPMA 5AHNA 4B2DA 5M17A 4K38A 4M1BA 1ISVA 4KRZA 5A6TC 3N3MA 3ARPA 2YCLA 3MT1A 3I65A 1G01A 3H2AA 1JPKA 3H2FA 4IIBA 3FJ6A 1O1HA 4PB5A 4KERA 2CYGA 1UD5A 3RO8A 4LXFA 3FSUA 3HQ1A 4JIQA 3ZR6A 4Q4PA 3W6MA 4W5UA 1SSGA 3OA5A 4MVAA 3EDFA 5C9UA 4Q22A 3FEMA 4G6CA 2YB1A 3NTYA 4Q3MA 2YKKA 1G0CA 4MB3A 5CQ1A 3R13A 2RFGA 4TV6A 4KWVA 4NVTA 3I3BA 1T8XA 1E51A 1OINA 6REQB 4LCRA 5FF0A 3TQKA 3ZQ9A 3FDGA 2VT0A 4F9DA 1V0KA 3MI3A 2DT2A 4IMCA 2C0HA 4QDMA 2X42A 1TV8A 3E1F1 3B8IA 3GW0A 4GNKB 2A79A 4YPJA 2QCNA 4ROPA 1V3KA 1Q6OA 4JKKA 2C7FA 2Z7GA 3W2UA 4A21A 1TREA 4S3DA 1O5QA 4KGLA 2ZX8A 5D09A 2A7NA 4ZCWA 1DE6A 1YX1A 2OX1A 2AAMA 4DWSA 1E0WA 1WE5A 1KFLA 3N6JA 2NV9A 1XRSA 5LXEA 2P76A 3ARRA 4LUSA 1ELSA 1M65A 3MMTA 2V5JA 2RHGA 3W7HA 4MWAD 2XVNA 1TCMA 5C6MA 1E0VA 5T9CE 1JVNA 4C5ZA 2WNNA 5E70A 2OEKA 2VR5A 1QNOA 3WLJA 1KBLA 4S2CA 4FK9A 2QVHA 4U31A 2QJNA 1H60A 3EWDA 1R85A 3KOWA 3PZUA 1GOOA 3AXKA 3JU2A 3LBCA 4JX6A 3UR8A 1SSDA 3ARVA 2FTWA 1JPMA 3AJ7A 3GY1A 4G5DA 1X7FA 1QUMA 2CHRA 1OG6A 3DH7A 2P5NA 3L67A 4AD0A 1TWDA 5A8NA 5FJRA 7REQA 2WM1A 1VIZA 3PWAA 4A3YA 2PF8A 1ADDA 4M6VA 1M7OA 1HKMA 2O56A 1X8FA 5D9OA 2WMFA 4JHZA 3W4RA 1WZAA 1SUXA 4WKFA 3LRMA 3TTSA 5BNKA 3REQB 3UXLA 2R1PA 3LOTA 3VMNA 4CCZA 3BOXA 3VGDA 2PP3A 3W2KA 1Y7VA 3DAQA 4FS9A 4DBSA 1ZTVA 1F76A 4QG9A 4PUJA 3W02A 3KZSA 4J3WA 3V36A 4UQDA 5HINA 2PTDA 3BGGA 4BK9A 1X6LA 3M6DA 3RLUA 3A64A 2PWVA 5A6LA 4JTLA 1RD5A 1KBJA 1HW6A 3PUGA 3KHDA 5GNZA 2R9RA 3ME3A 2ACRA 3GTIA 3RR1A 5HWNA 3HPSA 3LERA 3F5JA 5EMLA 4BF7A 4E8DA 4KEUA 4BQ4A 3PWGA 1A49A 4L64A 3GFZA 5BROA 3WENA 1M03A 1JDAA 1UC4A 2G50A 5KITA 2D23A 1QI0A 1GOMA 3O6DA 4AYGA 3QYSA 3R12A 4IIEA 4FNPA 4MPKA 5C71A 2CIPA 4AD5A 3W7PA 3K2GA 4GKLA 4AIOA 3NQ6A 1WA3A 5REQA 4H8NA 2VWSA 3Q37A 4CEXC 5SWUA 3QV7A 3CV1A 5DMLA 4E38A 3D3AA 2YW3A 3P67A 3I6EA 1GORA 1FWHC 1UG6A 2PDFA 3EBVA 5I03A 2P8BA 3LHVA 3MW7A 2FDSA 1PPIA 2A0NA 5M2FX 2DVTA 3PSWA 1UH4A 3HF3A 3BO9A 1VHNA 1MZHA 2E6YA 4PUEA 2WXDM 2Z2UA 3LK6A 3BV4A 3BOFA 3UR5A 3KRZA 1YNQA 3UWYA 1BF2A 2QDDA 2RJHA 4H7ZA 3BMVA 4LF2A 3U2ZA 3EOLA 4A29A 4MYAA 1PAMA 3GR4A 3PFRA 3U8GA 4C1NA 4CQBA 3UWUA 1ME8A 1E43A 3URQA 5HMEA 3G1FA 2BVWA 4K7VA 5CAHA 3BQ5A 1DE5A 3MBFA 4H8HA 1PYMA 4OUIA 1OCBA 4TU1A 1NELA 4B90A 3IGXA 3GVQA 2CZ5A 1XKYA 4ZO7A 1TWIA 4IOTA 2ZICA 1IEWA 3W7LA 5JBDA 4LY4A 3UT0A 3BSGA 1U5VA 4KIEA 3GHRA 3TQPA 1GHSA 1W2PA 2FKPA 1G4TA 3QXBA 4CCCA 3W88A 3WX7A 3FN9A 1Q2SA 3ZJ6A 1XLFA 2NX9A 4DJDA 4Q8OA 4M80A 3IJ9A 1EA0A 3IVSA 5F4SA 3FA4A 3C0SA 1XDLA 3AZTA 3W25A 4A2RA 5F2LA 3W2MA 5G4EA 5I02A 4ZSUA 1RR2A 4CD6A 3W85A 4E2BA 2Y89A 3ZVHB 4XBKA 1YKWA 4I9JA 2RUSA 3AS1A 2XVPA 3GXIA 1ITQA 2Z1WA 4IFRA 4HHLA 4O18A 3K8LA 3GZAA 4B4FA 2CPUA 3GFXA 1UP0A 3SGUA 5ABEA 3NQMA 4AW7A 1GK8A 2C15A 1VPXA 1OZQA 4WXZA 2YCLB 2QUTA 2W5FA 4YWIA 1Q85A 3B0VC 1UCWA 1JI2A 2NQZA 3IIVA 5AOUA 3S4TA 1QI3A 2QF8A 3PAOA 3BANA 3UQNA 3GXPA 1QFEA 2Y5JA 4LU0A 4LW7A 5DMYA 1JFHA 4GI4A 3LLFA 2EO7A 3W37A 5FJUA 2DW6A 3ZFHA 2F2KA 4R7OA 3NEHA 4LCQA 2HTMA 2HROA 4GO8A 4JX5A 3CMGA 4N9CA 4C91A 3TFXA 2PB1A 4AZ6A 4CN1A 1A53A 4HA3A 2DW7A 4M24A 2H9AA 3KM8A 3PAJA 1HN1A 2ZUVA 4QX4A 2ZQ0A 3LMYA 1EUAA 1TG7A 5FEWA 2E9BA 2ZRVA 3WL1A 1KXVA 2QCMA 1NARA 5G4WA 3PB0A 1KXHA 3TEVA 1J4EA 2CXGA 4R9OA 3VNYA 1RHCA 2ZZ2A 3TWAA 3BXWA 4XD4A 4XZIA 3QV6A 1BG4A 3FKKA 3W7IA 2AQVA 4UFKA 4DWSB 4Q7BA 1EIBA 5AC6A 4AMCA 5BCAA 3OZPA 3TOYA 1X6NA 1J79A 3UXAA 4ERIA 1LP6A 4MNKA 3AXMA 2R91A 4FI4A 3B97A 3M0HA 3B4UA 4DI8A 4UFHA 4C7FA 4PUDA 1PZ3A 4QLKA 4MHBA 2PC4A 6TAAA 1RUSA 2BXVA 1AZ1A 1I2NA 2OYMA 3U2EA 4EKJA