4ZFCA

Crystal structure of akr1c3 complexed with glicazide
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
315
structure length
315
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldo-keto reductase family 1 member C3
publication title In vitro inhibition of AKR1Cs by sulphonylureas and the structural basis
pubmed doi rcsb
source organism Homo sapiens
total genus 118
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2015-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4zfcA00
2I17A 4WEVX 3O3RA 3D3FA 4LAZA 1K8CA 2IPGA 1S2AA 4HMNA 3ONCA 3V35A 3LQGA 5AZ0A 3MC5A 4YVXA 5LIWX 1XGDA 3WBWA 3CASA 3H4GA 2WZTA 4PR4A 1AH4A 2ALRA 3CV7A 4L1WA 4GQGA 4JIHA 2HVNA 4G5DA 1RALA 2BGQA 4JIIX 2HVOA 3N6QA 2PZNA 4DBSA 4JTRA 4FALA 1ZQ5A 1Q5MA 2PDJA 3RX4A 3ERPA 3CAQA 3N2TA 4WGHA 2IS7A 1J96A 4GA8A 1R38A 4EXBA 1XJBA 5LIUX 4QXIA 2WZMA 4XVEA 4H7CA 4JTDA 4ZFCA 2C91A 1JEZA 1A80A 1X97A 1EL3A 3UGRA 3T42A 2ACSA 2PDUA 4PUWA 3GHUA 3LQLA 1YNPA 3G1RA 1S1RA 1OG6A 5AZ1A 4F40A 3V0UA 3MB9A 1Z89A 3ONBA 4JIRA 4WDWA 4LB3A 4MHBA 2IQDA 4FA3A 2HV5A 1RY8A 1AFSA 1ZUAX 2PDQA 2PDMA 2IKHA 4GIEA 4OTKA 3LNMA 3FX4A 3GHSA 4XZMX 2IPFA 3QKZA 4YVVA 3UZWA 3WBYA 2NVCA 3COTA 4RPQA 4PUUA 1PWMA 3WG6A 4WDUA 3B3DA 4ASTA 3EAUA 3O0KA 2PDNA 1Z9AA 1IHIA 1ADSA 1VBJA 1M9HA 1ZGDA 4YU1A 4JTAA 1S2CA 4XZIA 1ZSXA 2PF8A 3F7JA 2I16A 2DUZA 3CAVA 1UR3M 4XAPA 3M4HA 2IPJA 4ICCX 1US0A 3DOPA 1EXBA 1LWIA 4PRRA 4WDXA 1AH3A 5LIXX 3BCJA 2AGTA 2INEA 3WBXA 4JTCA 3RX2A 3LD5A 5HNUA 2F2KA 5DANA 4R9OA 3UWEA 4JTQA 2HE5A 3R8GA 5HA7A 1GVEA 1LQAA 1VP5A 1X98A 4GQ0A 1T41A 1Z3NA 4DZ5A 2PDPA 3GUGA 1YE6A 4IJCA 2IPWA 2PDIA 1X96A 2FZDA 4GCAA 1C9WA 4YS1A 2FZBA 3DN5A 5KETA 2ACQA 3Q67A 4DBUA 4NKCA 3UZZA 3WCZA 2PEVA 3UFYA 5LIKX 1HQTA 3RX3A 4YVPA 1S1PA 2R24A 3FJNA 4LBRA 3CMFA 5JH1A 3R94A 3LEPA 4PMJA 2PDBA 2IKGA 3LENA 1HW6A 1YNQA 2PDFA 1MRQA 2PDLA 4GABA 2PDYA 2HEJA 2IQ0A 4XVDA 2ACUA 2VDGA 1PWLA 4L1XA 4FZIA 3LBOA 1AZ1A 5C7HA 3BV7A 3Q65A 4FAMA 1SM9A 2PDXA 5JH2A 3VXGA 3KRBA 4QBXA 3GHTA 5M2FX 2PFHA 2FVLA 1MZRA 1EKOA 2F38A 3V36A 1EF3A 1FRBA 2PDCA 2IKJA 3C3UA 1PZ1A 2IKIA 3M64A 4JQAA 2FZ9A 1PYFA 3S3GA 1XF0A 3BUVA 3V0TA 2PD9A 3UP8A 1QWKA 3EB4A 3V0SA 2PD5A 1RY0A 4AUBA 2FZ8A 3P2VA 2NVDA 1PZ0A 2BP1A 4XZLX 4XZNX 3H7RA 2PDKA 2DV0A 1IEIA 4XK2A 2PDGA 4DBWA 1AZ2A 4XO6A 4LBSA 4H8NA 2J8TA 3LZ5A 4JQ2A 4XO7A 4JQ4A 4Q3MA 3R58A 3CV6A 3LZ3A 2INZA 3EB3A 2CLPA 3R43A 3UG8A 4EXAA 3R6IA 4JQ1A 4Q7BA 3U2CA 4WRHA 3UZYA 2ACRA 3GHRA 4XZHA 4PRTA 1YE4A 2PDWA 4WDTA 5LIYX 1AH0A 3H7UA 2HDJA 1Q13A 2HE8A 1Z8AA 5HNTA 2PDHA 2ISFA 2FGBA 3G5EA 4IJRA 2QXWA 3R8HA 1QRQA 4I5XA 4QR6A 1T40A 3NTYA 3BURA 4LAUA 3LUTA 4GACA 4HBKA 3R7MA 2DUXA 4QX4A 3UYIA 3UZXA 4IGSA 1MI3A 3LN3A 4JQ3A 4LB4A 2BGSA 3M0IA 2P5NA 2A79A 2R9RA
chains in the Genus database with same CATH superfamily
3GG8A 4CD4A 4CD5A 1OHLA 3G1FA 4FIQA 2GPTA 2GWGA 1YADA 3TXVA 4K8HA 1IXOA 4JPGA 4L4MA 3VGEA 5A8MA 4ZQPA 4WJEA 3WK3A 3BLFA 1WOAA 2HK1A 3H12A 4E8GA 3U5UA 1AW5A 5BYWA 2AL2A 3FSUA 4UFMA 2D3NA 3G6MA 1XPYA 3P7YA 4G5DA 4IP4A 5IBXC 1V79A 3CV2A 2RDTA 4W84A 3EX6A 3AXHA 3N6QA 4DLFA 3KCJA 1W9PA 4J3SA 1IT0A 3PS7A 4XBJA 4UC5A 3NR0A 4PEKA 3E2QA 1NF7A 3TYBA 3V18A 1EPXA 2ZXBA 2FZNA 2V2CA 3WDJA 5CC6A 1QO2A 5EL1A 3CU2A 4YPJA 1SO6A 2YDAA 4TXEA 5D9NA 4GD0A 2FJUB 3CB3A 3GB6A 3BAIA 1KBBA 5T9BG 1Q63A 1ELSA 1LROA 3CO4A 4PUNA 1F3EA 1H7WA 5I02A 5CSSA 1TA3B 2UY2A 1AW1A 1HKKA 3AIVA 1UD5A 3VM7A 1RCQA 2DIEA 4GVIA 2WJEA 4HN8A 5A6AA 3EOUA 3N04A 3GTFA 4HJWA 2NW0A 3WQ5A 5AZ1A 4GQQA 4P61A 2V9DA 2VZTA 4WDWA 3B9OA 4O1EA 3LX9A 5LA1A 4MB1A 4P8XA 2PDQA 3N25A 3V4BA 2P88A 3L21A 1LZOA 2QGHA 1LRTA 3N6HA 1R2SA 1E51A 4HKPA 1NP2A 2PTXA 1J0IA 2UY4A 4EPBC 3SRKA 3N12A 2WWDA 1PWMA 2PA6A 4K1WA 4CCDA 1ZENA 4M6PA 2NXIA 3DFPA 3KM8A 3ZLHA 3EYPA 1DJGA 2EPMX 3KRZA 3R0DA 1OCJA 4NL1A 1BGGA 4QGCA 5DT5A 1IIHA 1YPFA 3OHIA 1HJQA 1OK6A 4GISA 3M4HA 5I3DA 2BMBA 4KS0A 2UV8G 2G3MA 2WMJA 3S83A 2OOGA 3VIIA 1B3YA 1AH3A 2JKEA 4ATLA 1H41A 3H4XA 1FH7A 1V4YA 4NZCA 2Q3RA 2A7RA 3J7HA 2C79A 2YPIA 1GPFA 1ONXA 4PUDA 3OLDA 2E8ZA 2ZZ6A 1OZQA 3H21A 6ALDA 1ZJAA 4Q8MA 1W1ZA 3KTSA 4JTKA 3UWEA 4BEQA 1I0DA 3UETA 2HE5A 3T0AA 2A5HA 2BDQA 2PP1A 3YPIA 5AVNA 2WKJA 3KCOA 3CPGA 4UTWC 1FCUA 1GOQA 1K9FA 1TMHA 2G95A 4YWSA 3KVMA 3GNOA 4H8HA 2PUZA 3V75A 3TTYA 4ALDA 4IHCA 1W1YA 4V2XA 1W1PA 1KLZA 3SBFA 5D8ZA 4JZ5A 3KBMA 2J74A 1H7RA 5H91A 2PEVA 1TVLA 5I79A 3LK6A 4N9DA 3QH2A 3FVMA 2J9ZA 4WKHA 2VR2A 3M5XA 2DJLA 1E0TA 3MQTA 3WLIA 7XIMA 3N13A 2I1OA 5FIPA 1KNWA 2HEJA 4FMVA 2G4FA 4O19A 5AFDA 3O0FA 1BG9A 3IRSA 1RD6A 1JIBA 3KOXA 1PX4A 4MYAA 3ZXWA 1GVSA 3CYVA 3B0XA 2D2OA 3ORWA 1NOWA 2O7SA 3A22A 5EBUA 1VBHA 2ZX6A 3GIQA 2JIWA 1D9EA 5HANA 4HA4A 1YEYA 1TZZA 3AOFA 3MU7A 1CLVA 3W6YA 3VX0A 4UNKA 1VYPX 4C6QA 1T96A 3ARPA 2PWUA 4JY8A 1PZ1A 4C6FA 2P8CA 3W37A 2H6RA 2OLHA 3DFHA 3GDLA 3K1DA 4MWAB 1JAEA 3WQGA 5EMUA 1KGWA 5LXXA 3CHDA 1V3JA 4MY1A 4QFUA 4UZSA 5D09A 2FLIA 1L8NA 1G67A 3FAXA 2WMHA 3S9YA 4WLCA 3VDGA 1DJIA 4DJDD 1OCNA 4O8RA 3TR2A 3N29A 3P8IA 3AZTA 4LEFA 1AZ2A 2R8WA 2ZFAA 2QUUA 2BG5A 2AAMA 1ZU8A 1OEPA 4UQ9A 4AD2A 1ZBCA 2HS6A 3CZEA 4ES4A 2QZRA 3RCYA 1LORA 3NYDA 4GBUA 4PUEA 3LZ3A 3FDGA 1HO4A 2GUUA 2J7CA 4OE7A 4AXKA 3ARTA 3HGRA 3WEMA 5BU9A 4XAFA 1UKSA 4EF9A 3TW9A 1EUAA 1FCQA 2CU0A 1V3KA 4AD3A 1QHPA 3P3BA 1XCWA 4HU4A 3VFLA 5A5WA 3TR9A 1Q13A 3W7CA 2Y63A 4S23A 3T4CA 1KGUA 1Q6DA 2G3IA 1TPFA 5CZSA 1SO3A 1GJUA 3CXOA 5JUVA 4E6MA 3HPZA 2A1YA 4QR6A 4XUYA 1PJ9A 4RV8A 1GOOA 4F3HA 2X09A 4D71A 4C1KA 5D37A 1XIJA 4H2HA 1RH9A 1TV5A 1VYRA 2HMCA 4Z0JA 1YKWA 3W2NA 1ZZMA 1TJ1A 1UD6A 4UQCA 4U5IA 4ZO7A 1ME8A 4US5D 3IANA 1KV8A 2WM1A 3VCCA 3TYAA 2Q3OA 1GKRA 2V3DA 5HPCA 1OFAA 3GU2A 2X05A 1H7OA 4C5YA 2E09A 4KQNA 1KRBC 2E5DA 2V69A 4TMCA 4X9SA 5LIWX 3GIYA 4L6OA 4H2CA 1K7XA 3CL8A 4KEVA 1EIXA 1PBGA 2WZTA 2QCHA 4L1WA 1KM6A 1RALA 2VVSA 2PGRA 4KFOA 3IJLA 4K36A 1MW0A 2W6RA 3B04A 3VNZA 2R1PA 1W9VA 2ONEA 3S2MA 1HP5A 2WVUA 1HKMA 4J2MA 1LL4A 4OOUA 3CB8A 3B8DA 3QPEA 5AOUA 1MSSA 1O94A 5AHLA 5AHNA 3W7HA 1M68A 4GVFA 3LTPA 3WLTA 3VINA 1W9DM 1SZGA 3P62A 1W1TA 1VC4A 4K6AA 1JD9A 2I14A 1MQRA 1J5TA 1JR1A 3IGUA 2PTDA 1HKJA 2ZZ3A 2W3ZA 3UYCA 1BF2A 4HNCA 3HG3A 4YCOA 3GC4A 5C70A 3QFEA 1I6NA 5H8PA 4MHBA 5DCDA 5IHSA 3NZPA 4B91A 3CUXA 4DXVA 2IKHA 1W31A 3O6YX 4MJ4A 3RCNA 3VNDA 3GHSA 4XZMX 5DO8A 4B5UA 1HXJA 5GPRA 1FFRA 1IR2A 2DSWA 1Q4NX 3E0VA 3TAOA 4AZ7A 2Y8VA 3P0WA 4H4IA 4DELA 2GK1A 3V7PA 1MVYA 3NQMA 3EAUA 3GBDA 2J66A 1XGZA 1UWTA 1AK5A 3PF3A 1UUOA 3NM1A 4G8TA 1M9HA 3WQDA 4I7UA 4G9PA 3WK1A 4HU3A 1AD4A 1XYMA 2Q6ZA 4LUYA 2QDHA 5CCZA 3MPGA 3PTKA 1LOQA 1S3HA 3MV01 4J3XA 3GDRA 1ADDA 4HPXA 3RRAA 1OK4A 2W92A 4XAGA 1OB0A 2Y1HA 4US5A 2WM0A 3VAVA 4AF0A 1TPUA 3FFSA 4CN4A 3R10A 4NY2A 2R82A 2EEXA 5E6YA 4H6KA 4JY9A 2QDEA 4W85A 2Y8KA 4GIYA 4JTQA 3R8GA 2ZOXA 5HA7A 3H2MA 3NQAA 4ZZ9A 1DJHA 4O1CA 1B4EA 4KRUA 5DY3A 3VTRA 1O68A 1OCQA 1AL7A 3WD1A 3KEHA 1HG3A 2V6AA 2VGIA 1E6NA 1VJSA 3ANVA 3OJGA 2VL4A 3TH6A 2JKPA 2YDQA 3CK5A 1DL3A 4U5KA 3R5EA 1F05A 1HTIA 4FNRA 1O12A 2RJGA 5FESA 4QQUA 1Q6OA 1TQJA 2OB3A 2Z1VA 2CKRA 3DEQA 1I1WA 3W38A 3L5AA 5CG7A 4BF7A 8TIMA 3WD2A 4FOJA 2O9PA 1ZPTA 3GDTA 4O1BA 1CGXA 4UNLA 1B9ZA 1Y8BA 3MMUA 3OLGA 1XDMA 1B1YA 1D7FA 3VMPA 2XN0A 3E0WA 1IEWA 9XIMA 2VOMA 3RHGA 1W5QA 5DMNA 3VZXA 4NU7A 3BSMA 4F0KA 1PKMA 2WJFA 4A6GA 1DHKA 4LUSA 2Y7GA 1TX0A 3WNLA 3FA4A 4QJ3B 1VPQA 3MYOA 1JCJA 3RJYA 4RNFA 1S5MA 1VHCA 5FSEC 1CGWA 4CQBA 3NQGA 1PPIA 4TV5A 4Q4KA 3IGXA 1P0EA 2P10A 2FZ9A 1PDZA 2CBUA 2NV9A 3VIGA 1XF0A 3V0TA 4IFOA 4YTUA 2YX0A 4DBDA 3V0SA 4MKVA 4UTTC 3FY1A 2R1MA 3G18A 1XIHA 1SO4A 1NQ6A 2ICSA 1YPXA 3DFSA 4L6DA 1XLCA 3AO0A 3UD6A 4MOZA 1O66A 3ENLA 4LOCA 1LOSA 1R3WA 2Y5EA 2YR1A 2Z25A 3H2FA 1CT5A 2ZADA 3I68A 3RLGA 2YB4A 3T7VA 5M03A 3QOMA 2XGZA 3LZ5A 3UA3A 1QHOA 2XFRA 4QG9A 3C4UA 3REQB 3UR7A 4Z1BA 2WKLA 4TQTA 2Z6IA 1HUVA 1JQVA 3VZYA 3DFYA 5DBUA 4F48A 3R12A 4B3LA 5H6HA 4BI7A 7TAAA 2X30A 5HWJA 3VILA 2D2GA 1EWDA 1CEOA 1UG6A 4KPLA 4C1NA 4IJRA 4GI4A 2VQTA 5BWFA 3RJXA 4TX9A 2JBMA 3W82A 1MYRA 3WEOA 3OYXA 3GW3A 4Q4PA 4QDPA 4QX4A 1GVRA 3SY1A 1TJPA 1YHTA 3EZ4A 3A3XA 1D3GA 1VRDA 3M0IA 2I17A 4NP7A 4IUOA 2E6AA 5KMYA 2OZTA 1S2AA 4DB7A 3ONCA 3LQGA 4TVCA 2Y4SA 4A35A 5FJJA 3SO7A 2OWWA 3G22A 2VTFA 3MVTA 4JGDA 4Z2GA 4PR4A 1AH4A 4Q4RA 3TN3A 4F0MA 4NZ3A 3O63A 3W7RA 3AXXA 3T0TA 1ODZA 2EPKX 2HVOA 4F2BA 2XUCA 2B4GA 1IXNA 3GWQA 3NQDA 3W7OA 2PDJA 4DZIA 3RX4A 2WZIA 5BXTA 1HJVA 4PTXA 1UIOA 1JI2A 3TJIA 1X7IA 4KWOA 1PVNA 1VAHA 2P50A 5CC7A 5PTDA 4XVEA 1OC5A 2Z2AA 2QNEA 1I75A 1U5JA 4KCVA 2Z29A 1EO7A 1VFSA 4Q6XA 2RH9A 2Z00A 5BCAA 5C9WA 3RNDA 1QI2A 3TLLA 3W0KA 2NLYA 3IIOA 1R0MA 5LSMA 3BXWA 3BQ5A 4W4QA 3W72A 2NQLA 3FLUA 1EHAA 3MWCA 1SU5A 1W3JA 2GYIA 4YYCA 2H8ZA 1T5AA 4K68A 3ONBA 1DWIM 4HZ7A 2IQDA 2GSJA 4FA3A 1AFSA 3ARQA 3AU6A 4R53A 1E0XA 2NT1A 2FVMA 4OTKA 1JNEA 2A6NA 3W7GA 5CGTA 1WXYA 4CCZA 1K4HA 4MNJA 3WL0A 1A3XA 3CQIA 3AFBA 4FP1A 4OBSA 3VKKA 2WNNA 4Z2HA 3COTA 3WMSA 2AAAA 4ZBCA 3RUBL 1CGUA 2BOFX 3GY1A 3SCNA 1J2WA 3U2EA 3NO1A 1DYSA 3OGRA 3HA1A 3OU8A 2X41A 3WJWA 4ZOBA 1FWDC 1M01A 5CG0A 4XSLA 1DHPA 1YBQA 5J8LA 4H3DA 3TYUA 1U1UA 1JZ2A 4FNQA 3CAVA 4EANA 3SW6A 3UWZA 1QNOA 3I3EA 4DJFC 4LUTA 2QT3A 4QAIA 4LBUA 5FF7A 5DCBA 1E0UA 1LTDA 3NVDA 1CW2A 1KXTA 3VUPA 8RUCA 4NXSA 1S5NA 3MCOA 4DX3A 3VFCA 3I6RA 1KCLA 1V6YA 5DEZA 3HMCA 1SJDA 2GQ9A 4P2VA 4ZTXA 3NNTA 4XD5A 4IMDA 1OC7A 1ME7A 2XN2A 4L9YA 2DZBA 3S5OA 4PFMA 3W7DA 3KBVA 4RJEA 2XINA 1SPQA 3EX3A 1V0KA 4AVFA 4PULA 3IIZA 2ZDRA 4RW5A 4UXDA 4YS1A 3MUY1 1RHCA 3IIXA 5EMJA 1XRTA 1F4AA 2PWFA 2UZ9A 1RPXA 4BWLA 3G0SA 1SFTA 1ZL1A 1QR7A 2GZXA 4AX7A 1PCWA 3TC7A 3I6EA 1JXKA 3WLOA 4DZAA 5HQMA 2FKPA 2XM2A 3MW7A 3URAA 2GVYA 4LAOA 4NXKA 3AWNA 3AZRA 3U9IA 1LUCA 3H54A 3WQPA 1FH9A 3VGFA 1GGOA 1I4NA 1UH3A 3DHFA 5KITA 4QSFA 2WHLA 3VIMA 2OSYA 1XUUA 4TVUA 1R3SA 2AMGA 1L6YA 3QY7A 2EXOA 2W79A 3P6LA 1QW8A 5G1YA 1MW1A 4HN4A 4PN2A 1FFQA 3N14A 1UR8A 4MNMA 4L9ZA 4LH8A 1JUEA 1PHQA 1V3MA 4QBXA 1JCMP 3HU7A 2FVLA 3PB2A 4S2CA 3CTLA 1M7JA 2W4XA 1KXQA 4PTDA 1Q7QA 4H9TA 4KFPA 1WAUA 3DESA 4PMNA 1EB3A 3STPA 4MADA 1RA0A 2YXXA 1UR1A 1TWZA 2XSXA 3WMCA 4A3QA 2OVLA 4QJ4B 4X63A 4N02A 2EJAA 3IGHX 2G8ZA 1TJ2A 4J3ZA 2CC0A 3TWBA 4LU0A 4IF2A 5I7GA 3QR1A 1OIFA 4UZUA 3RCMA 4KESA 2BP1A 5D33A 3ELFA 5CPQA 3KWXA 2A4AA 3LGEA 5HBFA 1DE5A 1E40A 4IG2B 4UTJA 3WQOA 2CEQA 5I6SA 4GXMA 3JZEA 3W3OA 2DIKA 1B57A 1BYAA 4JQ1A 4FOUA 5ENLA 3T40A 3UZYA 4MSSA 3W23A 4E2DA 5BRQA 3WNKA 1NTHA 1UQZA 1X1ZA 3GO2A 5B7YA 3TA6A 2XVLA 3VKCA 3HPXA 3RGTA 3THUA 4AZCA 2ISFA 1MO0A 4EF8A 3NO3A 3S6DA 2A6LA 3STCA 4MKSA 4UNIA 1C29A 3WUEA 3GXNA 4HYWA 4AWEA 2FGZA 4IH3A 2ZUNA 3LTSA 1A5SA 2F61A 1H50A 4NZ4A 2BLEA 5H2ZA 3WJZA 4PB4A 4WF7A 1DIKA 1ONWA 2VZOA 2D0HA 2WPBA 4S2BA 1RV8A 3CL7A 3K2GA 2H3BA 4J1OA 2FB3A 4IP5A 2R9RA 2VKZG 1Z41A 3S0CA 2QAFA 4LFYA 3V5CA 2RGLA 3UWYA 1UH2A 2DT2A 3MSGA 1KW1A 3WNPA 4HP5A 4O15A 3G3DA 4DO5A 1E1CB 3FGCB 1J18A 4A3RA 2VRKA 1XQLA 2WMFA 1US2A 3ARWA 3CV7A 4XB3A 3AZSA 2HVNA 3HM7A 1MXGA 2RDUA 5HINA 2PZNA 1CXKA 1UD4A 2C18A 2QUVA 1SJAA 3OZPA 3L2MA 1REQB 2XVKA 1J6PA 4JFSA 5G1TA 3CAQA 4GFSA 5G1MA 2C1IA 1KRCC 3EA2A 1YLVA 2FFIA 5FACA 1CI1A 1WUFA 3QLDA 3NDYA 1XRSA 1FQ0A 4GVGA 4S3EA 1TZ9A 1B3OA 3L66A 3KP1A 2LLEA 3E6EA 1KA9F 1TX2A 1GZJA 2QIWA 2YLLA 5D2VA 4MUZA 3GW0A 4HA3A 2CZVA 4B5TA 4PTMA 3QMSA 3LLXA 1ISXA 4YWIA 1UJPA 1C9DA 3VCRA 3ZFHA 2WMIA 3E02A 2VUNA 3SDOA 3S9ZA 1C8YA 1JJKA 4JN7A 5BNKA 2CLHA 1MFVA 3W73A 1JPDX 3W84A 1OG6A 2PP3A 4FPSA 2G4JA 4MJMA 4H9UA 2P3EA 3EWYA 2ZRUA 5D04C 3OBEA 3LCLA 4LB3A 2FB2A 5F4WA 1Z32X 3QJAA 1KTNA 2PDMA 1TZ7A 2EPNA 4UR9A 5HUPA 1WDPA 5H1WA 3SCOA 3ABOA 3URNA 5C2CA 2WMGA 1P0DA 2PC8A 2PU1A 2FVKA 3P14A 3B05A 1L9WA 2BWGA 5A6LA 3I4EA 4TV6A 1VFLA 1EJUC 3VIKA 1TQXA 5FEPA 3BG5A 3WL1A 1KKRA 3W26A 1EQPA 2V5JA 1S5TA 4MDPA 5IBXA 2D0FA 2Q8XA 1OFDA 1KQYA 1DIEA 2X16A 3AALA 3W7QA 3T0CA 2BHZA 4L4PA 3IJQA 3TTOA 2FJKA 5HULA 1CB7B 2NX3A 2YL6A 2W61A 2HNHA 1VCGA 1X6NA 5E9AA 4MZ8A 2W66A 3WBXA 4ONVA 4B2DD 1FVPA 1A50A 4HNOA 3DX5A 5J5RA 3TTQA 3WJYA 1QPKA 3UWWA 2NSOA 1OFOA 2QR6A 4H04A 1XP3A 1IR1A 1NF0A 1AQFA 1Y65A 1XBVA 5HMEA 3KOWA 1IEQA 3W9ZA 3N2XA 1OBAA 4CU6A 3BGGA 1FA2A 2J88A 2QCNA 4O8AA 3ZMRA 4WY0F 2WHMA 2XIOA 3BW2A 1DEDA 3NL3A 3SGZA 1HQTA 2EG6A 4B4FA 3TYCA 1CIUA 5ABFA 2CZDA 1CXFA 1TUFA 5TAOA 1EA9C 3EDJA 3LEPA 4DPQA 5JVLA 1GPWA 2QUNA 2CXEA 3G6LA 4NJHA 1JPIA 3CUZA 2J7FA 1ZAIA 3WLMA 4DO7A 1J79A 1Q85A 4GZEA 4GK8A 1HJWA 1S5VA 5EGRA 4EPEC 2IQ0A 3DFTA 2ACUA 1LOLA 3ITTA 4R9XA 1LLOA 4L1XA 1CCWB 1Q6GA 1YX1A 2V5CA 1TR1A 1H7PA 1DTUA 2JALA 4L4LA 2YL8A 3ZOAA 2YA2A 1R5YA 2QULA 4PCNA 1SM9A 4HZ8A 4I6VA 1VFUA 1XHGA 2C1GA 3IK4A 2PFHA 2PWGA 1XYFA 4OU1A 5D9PA 4P8UA 4PRWA 3RRXA 4XKYA 1PTAA 3TU9A 3N4FA 5G4WA 1DOSA 4I9MA 4KCWA 2QF8A 3M64A 5K7JA 3UP8A 4UQEA 2OSXA 4KGJA 3PPFA 2XN1A 1Q7MA 5CPOA 3A24A 1PV8A 4Y9OA 3MS8A 5KZ6A 3AAMA 3ZT5A 4UTWA 2BASA 1KM0A 1A53A 3P80A 3M5YA 3UNTA 2JEPA 5E0CA 5E0FA 4Z17A 3PWIA 2PDKA 2DV0A 3WD0A 4AFYA 4V15A 4XK2A 5A6JA 4EWND 4M80A 1TMQA 3UEQA 2DVXA 3AIBA 4JN8A 1P0BA 4LUIA 1X38A 1CXIA 4Q8WA 3DCPA 1SFLA 8XIMA 4IXHA 3WQVA 5F1UA 2E5CA 1OT1A 2INZA 4GNKB 3S42A 3APTA 4B2DA 2D24A 2ZZ4A 4CUCA 3NQEA 1R3TA 4XZHA 4NI8A 2JQXA 5EFDA 5M5DA 3P60A 5DFAA 3B8TA 1EC8A 4QLLA 1ISWA 2A0NA 3WLHA 3WLJA 4WK9A 4CKQA 2HZGA 3A13A 4TMBA 3G1SA 2Y5JA 3G77A 1SO5A 2GSEA 1W5OA 4CD7A 5F2LA 1GCYA 2C0HA 1O5XA 4GKLA 4GXWA 2OLSA 5CLTA 1TB3A 2R1LA 3QQ0A 2WVVA 3GG0A 3GFYA 2YA0A 1MI3A 3W1UA 4UTUA 3ID7A 5KZEA 3EPOA 4UIOA 2BGSA 4QLKA 2GJXA 2VZVA 5FSDC 1W3IA 2PLJA 2I5GA 3TSMA 2ABBA 4ZO6A 1K9TA 1XH0A 3QF0A 3PP7A 3W00A 1DJXA 3THCA 3RPDA 4KWSA 3G0XA 2QCDA 1X1OA 1WZMA 1IEXA 1DJNA 4FNUA 3SRFA 3RITA 3H55A 3UVIA 1BVWA 2OMAA 2WB5A 3BG9A 2G3FA 5JQ9A 1W1A1 3UCDA 5BZAA 5FEWA 2V0TA 3LXBA 2VCCA 3L5MA 1SJBA 5D9OA 2OSWA 1UZHA 4AWUA 4GNVA 4GNJA 3TQKA 3OOQA 2CLLA 4UCFA 4AVNA 4PMVA 1N7KA 1EEXA 2TYSA 4DPPA 3K13A 1YW1A 3BWWA 2I7GA 2JKAA 4KWWA 4FHAA 3PB0A 3MA8A 5CSYA 5FJPA 3F4CA 4ATWA 3GU9A 3H26A 1UD2A 3HGOA 1ZS2A 1XL9A 3HQPA 3KZSA 1QCWA 1RLCL 2OLAA 3D47A 3SJ3A 4J3TA 1MZHA 3VE9A 4YYFA 2XGIA 4MAVA 4QE4A 4O18A 3G1RA 4CNUA 3SGUA 4GHRA 3IJ8A 4C6JA 1L2QA 3MO4A 2QW5A 1NWTA 4FNTA 2VJXA 1UMYA 1UPMB 1VEMA 2BSLA 3ITGA 1ISYA 4ZOEA 5LNRA 1GOXA 1EJVC 4HHPA 3MMWA 2E9LA 2C13A 1LG2A 3W1NA 1DWAM 1NDYA 1XC6A 3PM6A 1J9YA 2VMFA 1O5RA 3EEZA 3DH7A 1I9CB 4HT3A 3W1AA 3CQJA 2ZA1A 1OIMA 3U2ZA 3IPWA 4O53A 4AC7C 5EYWA 1SUXA 3B3DA 3W7LA 1P6CA 3VABA 3BLOA 3GAYA 3SURA 1BTMA 3WH7A 3AS3A 3RM9A 5DMYA 4PSPA 2ESCA 4B5SA 3CTTA 4C5ZA 4BK9A 2Y0FA 5T8GA 1BEUA 1F73A 2D1ZA 4JX6A 1Q4WA 4IFKB 4LV9A 4WDXA 1V3HA 2E28A 4IMGA 2X40A 3UWUA 1J8VA 4M7TA 3TCSA 1F4HA 2OELA 1K7FA 4D8ZA 2DH2A 3OLEA 1OF8A 5DANA 3UF9A 4V1YA 3DHDA 3K1GA 3A4JA 3HOJA 3RILA 1EGZA 4PTWA 4H6QA 3CWHA 5C5YA 2BVWA 3I65A 1F8IA 1IZCA 5DCEA 5BU6A 4OUEA 4O54A 5EMMA 1VKFA 3SAZA 3EOSA 2GJNA 3AMKA 3NPXA 3I4KA 3CNYA 3GNDA 3WDRA 3ZSTA 5KETA 2ZX8A 4GFIA 1WP6A 4IM4A 3RPTA 5I09A 1VIWA 3LU2A 3M43A 3WD4A 3I10A 1HNYA 2GQ3A 2KZHA 1PE1A 1W0MA 1UA7A 5L6UA 3FJNA 3LGGA 1KWGA 4LVDA 5EMKA 3N2CA 3CIXA 3WMBA 4LY8A 1YNQA 3AI0A 3HJZA 4AZGA 4H9ZA 3BTNA 4EWJA 2VGGA 4DJDC 1TIWA 3BW3A 1PWLA 5ABTA 1TPVA 4UTHA 4V1XA 1AZ1A 1TE1A 4ZOCA 1Q66A 1Y5XA 3SQSA 1UKOA 1TVPA 3I7QA 4HHMA 2DW7A 3BZJA 4Q4MA 3EDKA 1K77A 2NUWA 1XKYA 1QI3A 1XGEA 3W88A 4PL1A 4ERAA 4GUGA 3C3UA 1TE6A 3QW4B 3OGVA 2XDFA 4WD0A 1QWGA 3SR7A 3TNOA 4O13A 3QYQA 4GO8A 4DF0A 3OHMB 3LNPA 3ZVHA 5B7ZA 3FS2A 4RDVA 3K5XA 3VX1A 4G7EA 1TSIA 1XS2A 1A5OC 4AUBA 2QV4A 1SJCA 3NQFA 1SFJA 1P0KA 1AUSL 3CPUA 3VPLA 3R2GA 2OEKA 3CV1A 4ZQCA 3W27A 3E0IA 3PZNA 3SZ8A 3EDEA 4H8NA 1EZ2A 1I2PA 1K9EA 3W7MA 4MPKA 1DP0A 3IVSA 1RR2A 2OQLA 3FYPA 5DY2A 3RN6A 1OINA 1CENA 4WXZA 3HF3A 4UTLA 3O16A 1AODA 4HPJA 3LCHA 2RFGA 1BF6A 2A3CA 1RZMA 5FKYA 2ZXDA 2AOSA 3KRSA 3W1QA 2A3AA 2HDJA 3TZNA 3N4EA 3NPUA 4L1GA 5I3IA 1Q6CA 3L4TA 1QI5A 1A5KC 5KSWA 1U33A 1ZFJA 2WCAA 2PCEA 4DUVA 4GCXA 3QFWA 3FW6A 2YCEA 2CZEA 2NSXA 4RV3A 4PB3A 1V8EA 4HJFA 4O12A 1LL6A 3UY7A 3OIHA 1C91A 3O7UA 4NUWA 3LRKA 1XFBA 3GZAA 1XKJA 5T26A 5EMYA 3S6TA 2OQYA 3C6CA 3FJ6A 1NQKA 4W87A 2VXNA 1XLHA 3RLUA 4LF1A 5BXSA 2VEKA 3C2OA 3GRIA 2A79A 1J01A 1RVKA 5CBJA 2VCAA 3B97A 4CNSA 4UTTA 5C7VA 3HGJA 3P81A 4W9TA 2CWXA 3AQUA 3SFWA 5HWMA 3AYTA 4YMZA 5DN1A 3K8KA 1Z42A 3PZIA 4JKLA 3UPBA 2CXGA 4GQGA 4YXGA 4F0HA 2PF0A 3N15A 1E6SM 4LEQA 3BVJA 3F5LA 3SI9A 1SFSA 3C61A 4AZ6A 4ACZA 3MUZ1 1TA3A 3RMJA 3DFOA 3VE7A 4FALA 2VENA 5FEZA 4DUXA 1Q5MA 3UXKA 2WBKA 4FR6A 1OY0A 2J9YA 4JYDA 3RXZA 3BOFA 1UWRA 3VOHA 2I9UA 4FX8A 1J96A 1E4LA 1KBLA 3TN6A 4EIVA 1XJBA 1P0NA 1J0JA 3W1LA 2EQDA 1Y5VA 2IUZA 4HSHA 5ECVA 4IWWA 4H7CA 4GINA 2HK0A 3T8QA 3CZGA 4XZWA 1LYXA 3IUDA 3T4WA 1Z7AA 5I3JA 5LNSA 5FL0A 3KL3A 4E4PA 5C55A 4FEZA 1H11A 1FWCC 1G9HA 2TPSA 3DXIA 1DJQA 1XG3A 3LQLA 2BXZA 3F2BA 2R91A 5IFTA 3FK4A 4I90A 3PUDA 5JBEA 2OGYA 1ZRQA 4PBEA 1RK5A 1C8VA 1K1DA 4MWAD 1UH4A 3B9DA 1SZRA 2FTYA 2DIJA 4JX4A 2WCSA 3UERA 1EQCA 1YXYA 4DJFD 1YRRA 1RY8A 1ZUAX 1D7KA 4KCTA 4XIAA 1TPWA 4DF2A 4LT9A 1XLDA 1UR9A 3HG5A 4UOQA 3GFXA 4BY3A 3GUWA 1CZ1A 3XINA 1R6WA 2VFDA 3GVVA 3PZMA 4GOAA 3NG3A 2HWGA 2HQAA 2HISA 2V5BA 1ADSA 1EF2A 1FWAC 4CN1A 2KAUC 5I3HA 4H6RA 1EDTA 1XIDA 1EIBA 1O1HA 1NFGA 4DM1A 4OGZA 1BWKA 1XLJA 2Y6ZA 4UQDA 3CHEA 2FIQA 1GOWA 3EGJA 2I16A 3NGJA 4CVWA 4JIQA 3QVQA 5FD0A 7CGTA 3MI6A 1W1B1 4PUMA 3FVDA 3W1PA 2FZMA 3UBPC 1ICSA 3TTSA 3HTWA 2HBXA 3AC0A 4KRTA 3GX9A 4J3UA 2AGTA 2Y89A 2OPJA 4GI9A 4OVXA 1GT8A 3OG2A 3VIFA 1HGYA 1FKWA 4JN6A 4K7VA 1SZFA 4KFNA 3SM0A 4R9OA 5F7UA 3BO9A 5EMLA 3VMOA 2PGEA 4QROA 2ZX9A 4ADTA 3HIJA 1M5WA 2VP8A 5CQ1A 3LPOA 1GG0A 3RR1A 2VX5A 3DZ1A 1VP5A 4GQ0A 1KFEA 2C7FA 4N9BA 1WA3A 1XLBA 4IPNB 2XIQA 1BKSA 2G50A 4P7NA 1EJWC 2YW3A 4UFLA 3ARRA 4KRZA 1X96A 5AYIA 1FWFC 2X1RA 4NSBA 2GJLA 3O2LA 1EJSC 4J40A 3QYSA 3W07A 3MCMA 3KVKA 2HXTA 3EKGA 2FHCA 3F5KA 1P6BA 3LM7A 3OZOA 4JBRA 1F6KA 1FDYA 3VYLA 1KRAC 4JKKA 3SY8A 4XUGA 4YCPA 2PDBA 3LENA 3SECA 4HGXA 1HN1A 2PDLA 4S3GA 4MM1A 6ENLA 4PMZA 3UWQA 1XYBA 1B30A 4JNZA 4LQ1A 1HL8A 4ORIA 3AIRA 4REQA 4XIMA 2DZAA 2VDGA 3PZQA 3EOLA 2WZHA 3ANYA 3B40A 2CPUA 3MCNA 4KEMA 4LS1A 5HR7A 3TYDA 4GYFA 3GXTA 4JHOA 4UMBA 1F7BA 3FNDA 2WSYA 2Z24A 4MFEA 4FAMA 4ZXOA 3GNRA 2B7NA 2YL9A 3FV9A 2PU0A 1EWEA 4DJFA 4O28A 2Q8LA 4IGHA 1ZHAA 3OTRA 4F0LA 2OWCA 3NVTA 3HN3A 3U7BA 4U4MA 2GK1B 2WVTA 3KDOA 2IKIA 1LQ2A 4IPPA 3IACA 4DUOA 4ML9A 2ZUMA 2X42A 3E74A 4CU8A 1MEHA 3RG6A 4NAFB 2ISSA 5ABEA 3NPVA 2YDRA 3ABRA 2TAAA 3HFYA 1UKPA 3KTCA 1PAMA 3POHA 3LSBA 1TYGA 3FYOA 3E0LA 3QSRA 4WSJA 1ONEA 1VJZA 1UHVA 5CJMA 5EU9A 2PB1A 1V02A 1F2JA 3TNBA 4E4UA 4M24A 2AQOA 4Y6GA 1XLMA 1ZCCA 3AHYA 4HMCA 4Q3MA 4OIFA 2NUXA 3EB3A 2BHUA 3L2IA 4PMUA 3R6IA 2OT1A 2XWDA 1W3KA 2O9OA 3CYJA 4OQVA 1KWKA 2CBJA 2Q01A 1VBUA 3SB0A 3W6MA 4WHBA 4OKDA 2BY0A 3N9KA 4JFWA 5GVJA 2HE8A 2QCCA 1GWJA 3NQCA 2DT0A 4IPIA 4S39A 1MW3A 1T99A 3PBVA 1R3QA 4MB4A 3TYZA 3BAXA 1SSDA 2QMKA 3IV3A 1EXPA 2YZ5A 1RQHA 3EKLA 3WF4A 1DXFA 1A4LA 1BSLA 3NEVA 1W9UA 4C91A 4AZBA 1SYTA 4LRSA 3H22A 4EPKA 4TO8A 2GVJA 4Q8NA 3TDFA 3DYOA 1VYSX 1TV8A 2GJPA 4Z2IA 1POKA 1DPMA 1K8CA 2IXUA 4UOJA 2F6XA 4UQBA 5LZLA 1B4KA 3QV9A 1G69A 4GZJA 3H24A 1TJ0A 2VX4A 5D8WA 5AZ0A 2ALDA 4D8LA 4LUSB 2QJIA 3CM4A 3SJNA 3VNMA 2JF7A 1JFHA 4XD6A 2YIHA 4WKAA 4ZOAA 1H7XA 4S3JA 2HPMA 1O5QA 1V7AA 1OVDA 4JR5A 2V2HA 2REQB 3PWGA 1ITUA 4IP7A 2ZBTA 3ARXA 4O10A 3K4AA 1M41A 4WGHA 1O5KA 4NNBA 3S5NA 2YYTA 1GVYA 3N34A 4E2BA 1MXSA 1FWEC 1U30A 3OEXA 1ZJBA 4MIMA 1DWFM 4GVHA 3HFTA 3CZJA 3NZQA 4GYPC 3T05A 3UPWA 1EGVA 4RL3A 1FDZA 3GVGA 4PH6A 1N8FA 3UGRA 1QXLA 3MDWA 2ACSA 4TVDA 2X1TA 4HMEA 5JXQA 2PBOA 1E15A 3EXTA 4C6NA 3OB8A 1WCGA 4O4WA 5D32A 4AIOA 4DF1A 2EGZA 3TKFA 2ODOA 2VDHA 3PPGA 1P6WA 2ZKMX 3G1YA 4K38A 3M47A 1Y0EA 4F40A 4JEQA 3TMQA 1H2JA 4RKAA 1VB9A 2J4GA 2DZXA 3APGA 2ZYFA 3KE0A 3TXZA 4AWTA 2OFJA 1QPNA 3W53A 3AYSA 1LT8A 4KCUA 3WDPP 4AEEA 4GH1A 1SGJA 2QUTA 3EOEA 4I5UA 1WDDA 2OX4A 1XSJA 4CNTA 1I2OA 3CWOX 4X60A 4ASTA 1G0CA 3MBFA 3NO5A 2ZX5A 1KFWA 1EPVA 2VHLA 3C8NA 3NQ7A 2BHYA 2D0GA 5FA5A 3UY8A 2ZVRA 3KBNA 4HK7A 2PF8A 1E70M 2XIBA 3QR3A 1UR3M 1UC5A 1WQ5A 1VS1A 3DOPA 1RQBA 3CQ0A 1LWIA 1VLWA 1H0IA 4FNSA 3T6CA 5AVHA 1J6OA 2B7QA 3WNNA 1ZBVA 3GNNA 4NYUA 2PCQA 5HJLA 2QAPA 1H5VA 3FHAA 4DYEA 4BF5A 2FHBA 3IVTA 2C6QA 4M56A 4D72A 4H8UA 4HCLA 1NWSA 2ZC8A 1JF6A 3R89A 3QC0A 4WOQA 3DG6A 1LWHA 3S1GA 1I8JA 2IXVA 1T41A 4BS0A 3AHZA 3ZR5A 2IW0A 1E9LA 1JPHA 1VJIA 1E4NA 2J79A 3Q37A 2EO7A 3GYCA 1RAKA 2PDIA 2F9RA 3EPMA 2XYLA 1FWIC 4CNOA 4FXFA 1W1VA 2ZA2A 1O95A 5T9CE 5AECA 1UR2A 1DJZA 4C6IA 2EPLX 4H7ZA 2DQXA 3WBEA 3UFYA 2ASHA 3LG3A 1ZBWA 3CUIA 1E43A 3F2CA 3VGHA 3KLLA 1IXQA 3WBAA 3EDFA 4EK7A 2PDFA 1XSKA 3DBPA 2J27A 4TIMA 4ZQMA 3LHZA 2PI6A 4XV0A 3MDUA 1XICA 4K39A 4UMAA 2H90A 3BK0A 3M6YA 3RM4A 4GIRA 1Q6EA 1AMYA 3STFA 2WAGA 3GXFA 4AZHA 3K4WA 1H49A 2W5FA 1J2BA 3EWDA 4MNLA 2VT0A 3U4FA 4GJJA 2CHRA 3U3HA 4HYVA 1ZB5A 3GSMA 4MYXA 2JFEX 3W02A 3NURA 4OECA 5H8MA 5I77A 5A69A 2CWNA 3VOGA 4PE8A 1YYAA 2EG7A 4JQAA 4PBFA 5I2UA 2QMJA 1TELA 2GGEA 4E3VA 4WXYA 3P0XA 1TVNA 3DUGA 2J7BA 4WQ6A 1JYVA 3S8HA 2YZRA 3ARSA 4FXJA 3N4AA 4HPNA 2VD8A 1C8XA 1TG7A 1WDQA 1LCOA 4TR9A 5JIWA 1JCLA 2CLEA 1QNPA 2YW4A 4MZYA 3H7RA 3H2CA 2A2IA 2JF6A 4LUTB 4S1FA 3HPFA 4FF5A 4DBWA 1O60A 3QZAA 2V5KA 1Q2SA 4CQCA 3TJLA 4JQ2A 4LNYA 2BVYA 4CNNA 2E6FA 1L8PA 4C90A 3H53A 1H51A 2A3BA 3QY8A 3AROA 3R43A 3UG8A 3NL2A 3MTWA 4B5XA 3PHAA 1QASA 2Z7GA 1XX1A 3K46A 1YXDA 1N8WA 1NWRA 2HNEA 1W8SA 4JNMA 4HB7A 4H9XA 2ZWZA 1X1NA 3PFRA 3VIJA 5FJTA 5CC5A 4JNYA 2PDWA 2XIIA 3B8IA 3ECQA 2Q09A 4O14A 5A95A 4BR1A 2PLMA 5CH9A 4O50A 3W25A 1QJWA 4GUHA 1E1EA 1ZLPA 3R8HA 4G1NA 4ECLA 1A5AA 3CGTA 4MMWA 4MJ2A 4AMCA 4JTEA 3U57A 1V0MA 4PCTA 1L6SA 5CJ5A 4HU8A 1T0OA 1XYLA 4EAMA 4JEJA 4ZB2A 1CGYA 2YCIX 2E77A 1G01A 3VD4A 2E1DA 5I23A 3A4WA 1G94A 1QW9A 2P5NA 1KLYA 4W89A 5D2TA 4IGNA 1I0BA 3B8VA 1KTCA 3CLMA 4IQEA 3C52A 3NSMA 2IPGA 1UMLA 3MHGA 3APYA 4UMCA 1SVDA 1ZTVA 5MKGB 5ECUA 4I8YA 3GXDA 4IQLA 4IJBA 2FPYA 3EXSA 3FYYA 4JIHA 1MQQA 4C7FA 3BGAA 1V3LA 5CSUA 4UTFA 3M0KA 2VR4A 1KTBA 4DRSA 3T1GA 4C6LA 4EVZA 1OF6A 2FFCA 1H4PA 1UPPA 2Z1WA 1UOZA 5CKSA 4GA8A 3L4WA 4EXBA 2V5LA 2ANUA 3GAKA 4YTTA 1XFCA 1A5BA 1H1ZA 4I5RA 4GY7A 1WB0A 3QHMA 2OGJA 2QCLA 3FXGA 4RE3A 4D1JA 4Q4QA 3WLPA 3D3AA 4K37A 1U5HA 3IS4A 3HQOA 5MF5A 3KHJA 3OBAA 4C7DA 2GDQA 2A3EA 4XISA 2VFEA 1TCDA 3PPCA 4JHZA 4D1IA 2FHFA 1ZNNA 3UCQA 5AHIA 3M1ZA 3B0YA 2AGKA 4GIEA 4D6DA 3BV4A 1N55A 2FTPA 3ZS4A 1K8ZA 4QAWA 4AY7A 2PODA 2J7GA 5D38A 2DPEA 5BROA 4HHHA 3VCNA 1H61A 1PX8A 2J13A 4Z0SA 4NI3A 5HQLA 4PUUA 3WX7A 1TO3A 3VKAA 4DN1A 1XISA 2VWSA 1R9ZA 2R6OA 4QIUA 3L9CA 4WY0A 3BLKA 4HVXA 3EDDA 1ZGDA 1K7EA 4XZ9A 2H9AA 4GX9A 4YU1A 4IGMA 3TYEA 2XTKA 1BRLA 1J5SA 3WKZA 2PWVA 5LHFA 4NG3A 3PC0A 4UFKA 5D2WA 1B5TA 2E40A 4M1RA 3H2OA 1AG1O 4LY4A 3B9EA 2CKSA 2DW6A 4DIAA 2WHKA 5EB8A 2XFFA 1V03A 2GGHA 4V27A 3RAOA 3EEGA 3I6TA 4IFRA 2BS9A 2O55A 3ATYA 3EWZA 4I9AA 1OFBA 1V6XA 4A3UA 3VGGA 1XYZA 4ZEPA 3UW6A 3CZLA 2Z1BA 2O7QA 1GQJA 4AYGA 2QJMA 1KFCA 3T0DA 4INFA 4E0CA 4ZQRA 1EA0A 2R14A 2VO5A 3H70A 3PBMA 4M51A 4Y9AA 1HKVA 2VUYA 4IL0A 2WC7A 1BXBA 1JDFA 1F3TA 3WELA 1Q2RA 4OT7A 7ENLA 1WX0A 1I2NA 3VC5A 1L6GA 1RP8A 2GGJA 3C2FA 2WSPA 3TQVA 2FZDA 4GCAA 4D6JA 2DZSA 4MB5A 2FZBA 3M6DA 3UZZA 4U3CA 3GC5A 2V3GA 2ZZ2A 3C2VA 4HHLA 3TROA 3OG3A 5LIKX 3RX3A 2B7PA 4YVPA 3W1XA 1S1PA 5HJXA 5REQA 2OEJA 4LBRA 1BAGA 3A3HA 3VOJA 4LS2A 3THQA 2GFTA 4PMJA 5A8QA 3ABXA 3ISIX 1IV8A 4NZ5A 3MUAA 3EX2A 4ZSUA 1I60A 5G4EA 3NAVA 5TNVA 4CGTA 4NZFA 3WUBA 2ISWA 1BWVA 2V63A 2X8RA 5FJRA 4FZIA 4ML4A 4PL2A 2EAWA 1F6YA 4UBPC 3GE7A 1Q45A 1YNYA 1WV2A 4MJZA 4XG1A 1KBJA 3T2OA 1T8QA 1UJQA 2F38A 3ES8A 2ZWYA 3V36A 3OQ8A 3VIPA 3DHPA 4AZIA 5DT7A 1LL7A 2IKJA 2NV2A 3HV8A 3UR8A 1UIPA 3T81A 4W93A 3AXKA 1RQEA 4WX2A 1F9CA 3GR4A 2BVTA 2DZVA 3PZUA 5A8OA 3ZM8A 4N2YA 1CDGA 5CPNA 3FJLA 1SMDA 1A5NC 1AJ0A 4KW2A 2BV9A 3E2SA 3VI2A 5D03A 5BRPA 1IGWA 1TV2A 3HMJG 1TR9A 1XLKA 1H62A 2ATSA 5BWAA 2NVDA 3T2PA 3BJFA 4XZNX 2P0OA 5I03A 5F2IA 3AJXA 5ABHA 3L5LA 3JZUA 1AQMA 2OKTA 2VC7A 5EKYA 4A4AA 3T9PA 3PK7A 1WKFA 1Q7ZA 1OYCA 1BGAA 3MSYA 3KCLA 1W5PA 3HG4A 1R47A 1U5VA 3A4AA 4JDYA 3ZR4A 4A8IA 5AC6A 4DJED 2J7HA 6REQB 5D30A 4HQVA 4Z1DA 5G5IA 3T44A 7A3HA 2G5WA 4WRHA 4B16A 3QV6A 4Q7NA 1PTGA 4PRTA 2XIJA 4O1AA 2EHHA 4WDTA 1KKOA 2OKOA 4DJDA 1NSJA 2RUSA 5JBFA 1XI3A 4J3WA 3HQ1A 2PTWA 5D4YA 3UXLA 1M3UA 3AIQA 3WQFA 4Q22A 2VWTA 3MMTA 4A3HA 1RVGA 1L0PA 3GTXA 4XKMA 4PMRA 3SCTA 3STGA 3I3DA 1THFD 2VURA 2VEIA 3LUTA 2VNCA 1E1CA 3R79A 3ARYA 3UWVA 5HXMA 2QJJA 3MWAA 4YL2A 2XSAA 3NPWA 2OJPA 2KX9A 3PJXA 1WKEA 3CO8A 1EJXC 4PZVA 3LI1A 1JZ5A 3FEQA 3TJ4A 3NOYA 3D3FA 3MKVA 2PWEA 2BB0A 4LAZA 3SCWA 1B3XA 3CUGA 3BMWA 1REQA 1MMFA 2A85A 4LC6A 4HMNA 3OP2A 4ZO8A 1E6PA 4QRNA 4RCXA 3E49A 4WSKA 4UFJA 3WBWA 3N2OA 2VEFA 2G97A 1RJPA 4PYSA 1JZ8A 1NU5A 2TODA 4XKYB 4LW7A 1KR1A 4JTRA 3G24A 1PHWA 3EWUA 1ZQ5A 3ERPA 4ZQNA 3I7SA 4NZJA 3NWRA 3GG7A 3A21A 4DBEA 4Q8UA 1A47A 4Z08A 3EWBX 5CBIA 3WSUA 1ESWA 1PCKA 2WZMA 1K6AA 1XBZA 1I1XA 1A80A 1OYAA 4U10A 3WH6A 3PY2A 1UP3A 3TOPA 2J75A 2BBFA 4YHEA 2E4TA 2W62A 3N18A 4H01A 4DI9A 4IMCA 3VD9A 4OWGA 1IE7C 4PUWA 1X7FA 2B0MA 2ZQ0A 3LCXA 3H2AA 4PMXA 2WPGA 1XSIA 4S3FA 1UC4A 5DF0A 3WJXA 2X2GA 4HNNA 1R3VA 4LCSA 3GTHA 3WO8A 1HZYA 2OZ0A 2ZUUA 1C8QA 1BXNA 1GKQA 4TTUA 3HJEA 3GD6A 4H19A 3AIUA 3BL3A 1UKTA 2CITA 5BOOA 2YCJA 2YSWA 3ZSSA 4NILA 3WLQA 4R88A 2JIEA 3QKZA 5DRCA 3W7IA 3UZWA 4Z1CA 3BANA 3AJ7A 2HXUA 1B3WA 2NVAA 3B0PA 4LV4A 4C7GA 2PWHA 3CZ8A 2J24A 4GUIA 4HD5A 2PDNA 5CBBA 2XVPA 4H9MA 1JYNA 1B3ZA 3N2MA 1KV5A 2DY3A 1JZ6A 1W56A 2YJQA 1KCKA 4AYSA 4QEEA 1PXGA 3SCSA 4TX6A 3IGSA 3L4YA 4LC8A 2DUZA 3P67A 3NCOA 4M1BA 3TW6A 3FJ4A 2GWNA 2XSBA 5K4XA 3BCDA 1NDVA 3S47A 2GOKA 1NP0A 3W28A 2E67A 3JR2A 1EH9A 3WDQA 1J93A 4R85A 1YMYA 3DHUA 4G2DA 1CNVA 5F1VA 2W0UA 1ADOA 2R1KA 1AJ2A 4O17A 4JTCA 2CHOA 2XH4A 3V5FA 3NZRA 2GUBA 1UB3A 3QGVA 4LAMA 5K9CA 4KMQA 5I00A 2Y70A 1FWWA 2J62A 2WNZA 3SIZA 4DWSD 3U4AA 5LHEA 2XGBA 1ZY9A 2YL5A 4L56A 3QSTA 1JPMA 1G1YA 6XIMA 4S3CA 1Z3NA 4ZR8A 1GOIA 4LF2A 5A6KA 3GUGA 3KWSA 4NJJA 1C3FA 2YB1A 1YE6A 3PVFA 3S5YA 3F4NA 3FKKA 4MTVA 3L4UA 1LP6A 5AYZA 1OD0A 2VFFA 4RR4A 1UWIA 5HDRA 1GHSA 4FX7A 1FWTA 1E3XA 1QI4A 3OZYA 4Q8QA 2OT0A 3FHQA 3QY6A 4US6A 3VD7A 4EE9A 3CMFA 4DY1A 2GLKA 3DENA 1IF2A 4O0QA 1FP9A 4DAIA 1BYCA 3QLLA 2JGYA 3WFLA 3ITXA 1GNXA 2WZEA 4K1GA 3M0LA 4IMFA 1WZAA 1T8XA 2PBGA 1LDCA 3E12A 1HP4A 4MY9A 4BEUA 1E0VA 3CUHA 1UD8A 2FQIA 4LSBA 4AISA 3CUFA 4UFHA 1ICQA 2ZUTA 1PZ3A 2DFAA 3IV8A 3RYSA 4ICNA 1RD5A 2ZE3A 5B80A 1DIOA 3IUHA 3LHYA 1XV8A 4NJIA 3TWAA 4ZMGA 1EF3A 1XYAA 3AMDA 4EXQA 1GHRA 2E8YA 3ZJ6A 3BLLA 4I9TA 1EDQA 2OCZA 5DELA 4EOUA 2PD9A 4QE5A 1JRBA 1QWKA 5CEWA 3P74A 4RE0A 3TSDA 1W3TA 4C60A 1G7UA 2PD5A 2VFHA 3HGSA 4RNJA 5C9RA 4QG6A 3O6DA 3AIEA 3KOYA 2VEMA 3Q58A 7ODCA 5LA0A 3P2VA 5AHMA 4IIHA 2J78A 1IXPA 4ZE5A 2YOCA 4Z2LA 3BGJA 4MDOA 3UR5A 3QTPA 1XDJA 4LBSA 3P93A 1QBAA 1E0WA 1Y5WA 4HYRA 4GQRA 4C6OA 1QK2A 2OYMA 4TU1A 4U33A 2ZCGA 1WDRA 3LCIA 3N6JA 1XIIA 1OFQA 2YBTA 3DG7A 3TAKA 3UPMA 4FLRA 4OV4A 2D22A 1CLXA 3DI0A 1XW8A 2DSKA 3MZNA 4NHVA 4GQBA 2Y24A 2Z2BA 5JIPA 3T55A 3W4RA 3TQPA 1CXEA 2WOQA 5KEZA 1XM3A 1H09A 1CX9A 4TOQA 3V1PA 2RDWA 4AH7A 2PDHA 4C65A 1G4EA 2QXWA 3WENA 4Z42C 3S2LA 2Z1XA 2C8NA 3BURA 2XIMA 4BQ5A 3GR8A 4AXNA 1X8FA 4GACA 3BPWA 1BSIA 5FF3A 2OYKA 3EA3A 1EBHA 3TC3A 4LB4A 4AEFA 3JW7A 4U2YA 4QG8A 3QTGA 3LPGA 2AMXA 3CPRA 5HK4A 1QNQA 4QSHA 3O3RA 3W75A 3TCEA 4QQ3A 4MLJA 4RDWA 3FKRA 3GG1A 2GDVA 4ICMA 4NJGA 3A5VA 3DIPA 2Z2UA 2DVTA 1SW3A 1FWJC 1C92A 2ZUVA 4UTKA 2DP3A 3KHDA 4MWAC 5A6TC 3IK2A 3VOIA 2O92A 1AQ0A 2J6XA 4NVTA 1ITQA 3S6OA 2TSYA 5E70A 1J0HA 1Q8AA 3VOFA 3LHWA 5FF2A 5U4NA 4NASA 1ZP3A 1E9IA 4LNCA 4D6CA 2FGLA 1JEZA 4M6VA 4ENLA 2YGYA 5I07A 1JDEA 4BHYA 1UOKA 3KL5A 1PTDA 1VQTA 3LCFA 1TMLA 3GVWA 2AL1A 2ZX7A 3GHUA 1EZWA 1S2VA 4W5ZA 1YDYA 1V08A 1Q6FA 4EAYA 4J2PA 4RDZA 3CS2A 3TTEA 2ISDA 3UU0A 4H41A 4A2RA 4JIRA 2QYGA 4QCFA 4J4KA 1O1ZA 5D02A 5AYYA 4Y9MA 3O6CA 2NWRA 1YPIA 4CQ9A 2IPFA 2DU2A 4KWUA 2F8QA 3NSNA 1UD3A 2CZFA 3GK0A 1XD0A 1OFRA 4A8NA 1CWYA 4W8BA 3BLEA 5I3GA 3RPMA 3TW7A 4IFKA 3NGFA 4PMOA 3ARVA 2D3LA 4O57A 1XCFA 3BH4A 2VGFA 2QVNA 3MHUA 4XTDA 1BYBA 2XFWA 3TN4A 1HVQA 1R86A 4W88A 3SFKA 1X8CA 3CHFA 3RU6A 2OTDA 3WK0A 4GXPA 3BMXA 3ITCA 4L64A 4TX8A 4QS5A 1SW0A 3Q45A 3UJSA 5EBAA 1P7TA 3WFAA 4D8AA 1M53A 4W5UA 2IQTA 2DGAA 3RX2A 1PX3A 1E5JA 4GYPA 3VA8A 4NNCA 1FWBC 2EF9A 3C56A 3FN9A 4OOZA 4AMAA 2WNQA 1QNRA 1ECEA 2AQVA 3FXYA 1XDLA 4GO9A 2E5BA 3VU2A 2HBVA 2A3LA 2C1HA 4CNPA 2P8BA 3WNOA 4RNHA 7REQB 3WQCA 3G8RA 4ACZB 3HPSA 1JZ7A 3W2UA 3LGDA 5U7SA 3WMLA 4RW3A 1VFFA 3WLNA 4L61A 5CLWA 4YJ5A 3W81A 4CD8A 2ZZ5A 4WIWA 3O9NA 1PB0A 4NKCA 3JRKA 4LYPA 5IOBA 1LQ0A 3OYZA 2PP0A 3OODA 4CEUC 4LRTA 4JYEA 1DORA 5DLCA 4C1LA 1NEYA 3LI0A 3L0GA 3ATZA 2CBVA 4JS3A 3NOEA 5C9XA 1AA1B 4WGXA 3ABZA 3S46A 3LMZA 2CW6A 5BOEA 3S1WA 2ZXAA 4X2PA 3L12A 1QO5A 4U28A 1FX6A 1SZNA 2J7EA 2BXVA 5I78A 4HTBA 1AMKA 4BQ3A 4PA8A 4BA0A 3LOTA 4GG9A 3B8UA 3JUGA 3DYMA 2DSZA 5JH2A 1IZJA 3B03A 1SR9A 3KRBA 1V6TA 3NL6A 1B90A 2XVGA 5E5CA 4ILSA 4GZ7A 3TIMA 3L2LA 1V0NA 2X0YA 1MZRA 2H8XA 5KTLA 5BW6A 2QEZA 5I0DA 2FYMA 1PS9A 4N6EA 1JI1A 1Z44A 5CPTA 3DDMA 2V38A 1TCMA 4NNAA 2TMDA 3QN3A 1QDSA 6TIMA 3T78A 2C3ZA 3SGGA 2J8FA 5C8BB 4P8VA 4X9YA 4G56A 3V3WA 4AEOA 4J3VA 3AMCA 1CLKA 4OUIA 1FWRA 3GTNA 4PSRA 5FJOA 3DGRA 3PANA 4DWDA 1KR0A 3ITOA 3LCWA 3T8LA 1NDZA 1XIEA 2QJNA 2Y7DA 3LHUA 2FH8A 8A3HA 3TSBA 3KVJA 4HTYA 4N4PA 4XX6A 1IEIA 4JTGA 2YXGA 2VVNA 2F6KA 5C6MA 3GR7A 3D46A 4BZYA 4L4OA 1EUNA 2VDIA 1QNVA 4B90A 5LYRA 1U1HA 2ABAA 3AYVA 4JQ4A 3UG4A 3U8GA 5LNUA 3ANUA 2OQHA 3NJ3A 3R58A 5EPDA 1ALDA 1H60A 3BOLA 4EXAA 4JTHA 3UGVA 4S3KA 1JCYA 1TWWA 2VR5A 4DI8A 4PODA 3UT0A 2HRWA 3KOZA 1AH0A 4NQ1A 1KM5A 2ZUWA 4F2UA 1RCXB 5EY5A 1LM1A 1E6RA 5J04A 2ZRYA 5HNTA 4X3ZA 3TC6A 4ZFMA 3GXPA 1KBIA 3GQYA 5JBDA 2V2DA 1JQXA 3W76A 5BOFA 2YFOA 2DZWA 5AC4A 3QV8A 5KZMA 2OR2A 3PZVA 3R4IA 4X61A 1ONRA 3N2BA 1K3UA 4IGSA 5E0KA 1Q6RA 4P7RA 4A21A 2HPIA 4JQ3A 2EPOA 5BRBA 5A1AA 2YBUA 2HS8A 3IVUA 3IAQA 4REQB 3CIWA 1FXPA 1J0KA 5G2WA 3G1XA 4C6DA 1S39A 3LBCA 2OEMA 4PCPA 1UA3A 3ARUA 3S1UA 1XLIA 4GUFA 3URQA 3QC3A 3VMNA 3H4GA 2ALRA 3VGBA 4NAEA 3MUCA 2O4MA 1G5AA 3LTYA 2NX9A 3CEUA 5K3VA 3K30A 2EKCA 2J25A 1FWHC 3MANA 1FCVA 4B4HA 4UR7A 1UASA 3USZA 2IS7A 4MB3A 4ZCWA 4GUJA 2I57A 3CEPA 3EX1A 4M81A 5LIUX 1FTXA 5HMSA 3B9NA 3TFXA 4ZFCA 2O9RA 2PGFA 4H6EA 2FDSA 2OO6A 1AD1A 2ZTKA 4C6EA 1XC4A 3CQHA 2QJHA 3MZ2A 1JUBA 1LF1A 4QJ5B 1JYXA 4ORMA 2NQJA 1JG9A 1YNPA 1UUQA 4OJYA 2QCMA 3PBGA 3GIPA 1E5NA 4RUBA 1U22A 4UUIA 1XLFA 1RCOB 1YTDA 2Z26A 3AHTA 3TVAA 4ZXLA 1W5NA 2MNRA 2OYLA 5FF0A 3CAKA 2V30A 2XM1A 2QVHA 3KUMA 5TIMA 1EJRC 1KFBA 5GNZA 1GQIA 4AY8A 4Q8TA 5L9FA 1UROA 3ALFA 1JUKA 3LM3A 4Q32A 4WDUA 3E2VA 2FMNA 4IT1A 3O0KA 2J8GA 2P76A 1Z9AA 1OYBA 4P7OA 5MHBA 2O4QA 3DC0A 3VVGA 3SCRA 2V67A 3RR4A 1ZSXA 1HKIA 3UJ2A 3W24A 4LALA 1A5UA 1XIMA 4IIGA 1G4TA 4PRRA 2CLKA 4AY1A 4XSMA 1A0CA 1GTEA 3OBKA 3B06A 2Z4GA 3H8AA 3VIOA 3N19B 4HNLA 4XWUA 5HWNA 5GJNA 4HCDA 5DMLA 1JFXA 1DXEA 2ZRXA 2P1FA 1PIFA 4NYYA 2W67A 3C0LA 3Q94A 3DECA 4KWVA 3T07A 4EACA 3TFCA 3URBA 1OZMA 2UY5A 2JE8A 2POZA 4RZBA 1F3XA 1FCBA 1TPB1 2PDPA 3F4WA 2GJRA 3E96A 1JXJA 1QOQA 2CCRA 3NQVA 4A8RA 4ZQOA 5EFFA 4ZL1A 2ACQA 4I8DA 4CCCA 1VFMA 3S4TA 3WCZA 2DDXA 3N1AA 1HGWA 2CERA 2VC5A 4AD5A 3L65A 3C2EA 3WDIA 5AKQA 3G0UA 3OPSA 3MP5A 1WXZA 1RUSA 1TKKA 3LYEA 5HUOA 2PDYA 1OM0A 3QRHA 4DXKA 1FOBA 4K2SA 4M7SA 4XVDA 4JOMA 1UR4A 2VGBA 1BFNA 3S2CA 4D9PA 3MSDA 1R9XA 2MUCA 2W9MA 5JMUA 4F8XA 1JF5A 1V77A 1J12A 1GVFA 1W2VA 4O1FA 3W7JA 7PTDA 1XIGA 1OX4B 3GYEA 4DWSB 1AJZA 1UZ1A 2CFFA 2ZC1A 2PDXA 3AWOA 3VXGA 3OIXA 4NAFA 2Q8ZA 2YCLB 1Q65A 5AHEA 4HOWA 3GHTA 1DIDA 4P5UA 1EKOA 5G4HC 3VDCA 1XH1A 1KM1A 3UCCA 3EA1A 3QZ6A 3NDZA 1M6JA 2E68A 4QJ1A 2OX1A 3SQMA 3BUVA 3GDMA 1CXLA 3A12A 2VFGA 4OZOA 1XUZA 1EC9A 4GI6A 1RY0A 4M6UA 3PG8A 1KM4A 2B7OA 3C8FA 1VPYA 1GVIA 2JEQA 1PIIA 3MBDA 1TFVA 1ICPA 1XLGA 1E6QM 2NQHA 4UWMA 3W85A 3SN0A 5RUBA 2QS8A 1B0IA 2J8TA 1L2UA 4NZ1A 2E0PA 3IJ6A 1ITXA 2DT1A 2VX6A 3WN6A 4TTGA 3PBUA 3HG2A 2VD9A 3F2DA 3O05A 4PUKA 1GYNA 4Q7BA 2DQWA 5DQPA 3VDHA 3U2CA 3LSCA 1DJWA 5DMMA 1WO2A 2ACRA 2WLZA 3GHRA 3BSHA 3NZ1A 2V68A 1AQHA 1TPEA 5DRIA 3ZIZA 1YE4A 1BQGA 2XH2A 3H7UA 1H7NA 1N2VA 1YDVA 2NQZA 1YXCA 1QATA 1Z8AA 3PSVA 1RPKA 1TJRA 5CJNA 4B5VA 1QRQA 4UR8A 3VD5A 3LLFA 3H7VA 3UXDA 1EJ7L 9XIAA 2GQ8A 3PBYA 1W6TA 4CN6A 3TMLA 4MNKA 1UWSA 3EBVA 3UYIA 3CMJA 4KGLA 2QLYA 3RM8A 3NSXA 4RLIA 1MW2A 3LY0A 2INFA 3S5ZA 1P1XA 1LJYA 4JFTA 3K8LA 3PTMA 2Z7KA 1PUDA 3MKCA 4WEVX 1QI0A 1W17A 1XQKA 3L23A 2A7NA 3DC8A 2REQA 1EP1A 1Z69A 4CVUA 3P5ZA 2QCGA 2J77A 4JXCA 3M5VA 1IIGA 3AS2A 4JYFA 3WIJA 2DZPA 4AHPA 2EJ1A 3UVAA 3UESA 4ZSTA 3BC9A 1M7PA 5C9ZA 1WBJA 3ABSA 3S5SA 4NX5A 4Y2WA 3LA4A 4D6HA 1DWJM 4E5TA 4N6FA 5CPMA 4O4VA 1SQ7A 2D69A 4E8DA 5LGZA 3SIMA 3E5BA 3L4ZA 2Z6JA 2AL2B 3EMQA 2DH3A 2C91A 1J0ZA 2FPTA 3QPZA 1F8MA 3W2KA 1MWOA 1XH2A 3SSZA 1BTCA 3RIKA 1P1MA 2QGYA 4FI4A 3KTXA 3QGAC 4H9YA 3PUEA 5FAJA 4RX0A 4D6IA 3LDVA 1C7TA 5JU6A 6PTDA 1BD0A 1TV3A 4WKFA 3LPFA 2WQPA 3PJWA 1VENA 3WQ8A 1FKXA 3MV11 4DNHA 3E9AA 3QW3A 3W87A 3CLWA 3NDOA 4H7VA 1POJA 1GYMA 4UCGA 1LLWA 2FPVA 3SEPA 1V6WA 1TTIA 1JRCA 3I7RA 2Z28A 1VBGA 2BY1A 4LVBA 4LYRA 1ZP4A 4R34A 1J10A 2DZUA 1A5CA 3BQ6A 2CLFA 3D5HA 4M6QA 3UNDA 3PZOA 4HA0A 2EG8A 3RLHA 2VZUA 5IXEA 5H8UA 2E7FA 1FWNA 2D20A 1KRMA 2QPSA 3N3MA 1E9YB 1K4GA 4GBDA 3TX9A 1B9BA 3BLPX 2GGGA 4J28A 4H9VA 3GKAA 3L67A 4E38A 1FHUA 4IMEA 3F7JA 3TN5A 1LBLA 1WZLA 5A3HA 4ZB5A 2IPJA 2WSKA 1NJJA 4BCEA 4HSOA 2W91A 4CQDA 3BE7A 1H3GA 3M0JA 1YQ2A 1GW1A 5GJMA 2OO0A 3QHNA 2XFYA 3LHTA 4KEUA 3GZ3A 3BSGA 4IUGA 4JD4A 2QJGA 3VKJA 2PMQA 1B3VA 3NA8A 3HB9A 1GVEA 4R7JA 1HX0A 3H2EA 1LQAA 1EC7A 3PAOA 3T0BA 3UG3A 5AYBA 3CHVA 5CXPA 1D8WA 4NF7A 4N9EA 2D73A 3BMVA 1OWQA 3E38A 4ADUA 4FS9A 3WLKX 1HJXA 4HK6A 4TUFA 3UJRA 3CMGA 1QU4A 1TWSA 3WH8A 3G1AA 1XPGA 4XD3A 4CQ8A 4OBTA 2P0IA 3UJFA 4ROQA 1J11A 3FA5A 1P5BA 4E3TA 1KFJA 3PSWA 3GLCA 1X39A 2R24A 1TIMA 4BJHA 1DQWA 5A6MA 2JK2A 3MI2A 3KS5A 1ZCOA 2ADAA 3ARZA 1HW6A 5DX7A 3GDKA 2PZ0A 1KQZA 1T6MA 5A8NA 2GSHA 3GXIA 1WYIA 2QF7A 3GM8A 4G7FA 6TAAA 3AYRA 1GJPA 3CL6A 1QTWA 3P84A 3R1ZA 3MMDA 1TPDA 3Q65A 3WFZA 1IGSA 5FL1A 3VNJA 2HSAA 4J35A 4RK8A 3M46A 3E2RA 3WF2A 2WJDA 1S2TA 2EBNA 4DJEC 5GNXA 3DYPA 1S38A 3BOXA 4HZMA 1A3HA 4HU0A 1H63A 3VK5A 1VCVA 4QISA 2G3NA 3HZ3A 2HJPA 3VOCA 2RGMA 1EO5A 3PWAA 3IJ7A 1SW7A 5F2GA 3L7RA 1R2RA 2UY3A 3QM3A 4WY0B 5C2GA 3BAWA 2YYUA 2PTYA 4QCEA 2H9AB 2XU2A 4B15A 4JTTA 1IWAA 1BRLB 1XIFA 1XBYA 2V82A 1WDWA 1ME9A 4XAZA 4RXFA 2FZ8A 3QGKC 1PZ0A 1VEOA 1PKNA 3KX6A 1EBGA 4ROPA 4URIA 2PDGA 1NH6A 4S3AA 2RJHA 1BG4A 4AG0A 3SCVA 2V5DA 5CZKA 2I5QA 1CXHA 4Z1AA 4ZODA 2MANA 1SSGA 3OLIA 1JYWA 1TV7A 3CV6A 2BOEX 3AISA 3C5QA 2E3ZA 1V7YA 3QKEA 3IAPA 1V6UA 1A49A 2ZDSA 3CT7A 1JPKA 4LJ3A 1MUCA 4IZGA 5LIYX 3UA4A 3MY9A 1BHGA 1RBOB 5CZTA 2E6YA 4A05A 1MUMA 1XBXA 2AQWA 3G1VA 2BGNE 3FOKA 4O0ZA 4E2OA 5I06A 2Y62A 4G6CA 4AVOA 4X0NA 4V28A 2E6DA 4I5XA 3W74A 1JZ4A 1EP2A 2XH7A 2Y8UA 5REQB 3STEA 1RXOB 3GS6A 1RP9A 5D05A 3IARA 4HBKA 3OW1A 2DUXA 2D2JA 3UZXA 2ON3A 1GQLA 3LN3A 2VZSA 5MKGA 1HT6A 1KCZA 4WJXA 1VFTA 2PS2A 1YDOA 9RUBA 4F0RA 1W2PA 4RZ6A 3PPHA 3OA5A 4FXSA 3W1RA 1WZKA 1ITCA 4JFVA 1V3IA 2BZNA 4L80A 3L68A 3V35A 1TREA 2WYSA 3WQ6A 5A6SA 1R7AA 4Y90A 1FXQA 5E9XA 3UZ5A 3VM5A 4U31A 4W7VA 2CETA 1RBLA 3OZMA 5CSRA 3GTIA 1F3WA 1XD1A 4RXGA 3W7KA 3BJSA 3Q4DA 5K2ZA 4N0RA 4R5EA 2BGQA 3AXIA 4WSHA 2ZUSA 3QBUA 3TONA 5SWUA 1NVMA 3PG9A 3O6AA 2ZIDA 3N2TA 1HVXA 5HMDA 1GVOA 4O1DA 3SQLA 1EHNA 5HOSA 5AC5A 3A5FA 1QW7A 4IX0A 4NRRA 1A4MA 1KO0A 4LVGA 4QXIA 2RKXA 3CC1A 1IZKA 2BY3A 3L0NA 4DYJA 4JTDA 4KIEA 4YTSA 2UWFA 4ZB0A 3U0HA 4DUWA 2WMKA 1MRAA 4F9JA 3PZGA 2NQ5A 2P53A 1PZ2A 2BY2A 1VIZA 4WVXA 3C0SA 3PTQA 2ZZ7A 1GZ1A 5HR6A 2NLIA 3RDKA 1S1RA 1E4MM 1GZGA 4ATDA 3PR2A 4XAYA 5GNYA 3VUSA 1OABA 3W2LA 5FJIA 5K9DA 2Z1KA 3M44A 2HV5A 3LNMA 3KXQA 4DM2A 7TIMA 1LBMA 1PSCA 3CUJA 2VI0A 4LCQA 1IT8A 4QNWA 4S38A 3L4VA 3BAYA 3S9IA 4ZGYA 1PO9A 4S3BA 3W86A 4Y96A 4DWSC 5HNRA 1VLIA 4B5NA 4A22A 1E55A 4LVFA 1GQNA 1A3WA 3EOOA 1C7SA 4B92A 2R1NA 3DU0A 3F03K 1YDNA 4MZ1A 4CCEA 4GI8A 3D0CA 4DZHA 1IHIA 1VBJA 1FUYA 2B31A 4MWAA 1J0YA 4AD4A 2CHNA 2OOFA 3W7EA 2P3ZA 3QQWA 1PKYA 3M9YA 3SCQA 4DVOA 2ZTJA 4BQ4A 5KINA 3MT1A 3QHOA 1XLLA 1Z6KA 4IQJA 2VOTA 2RDXA 4XAPA 1E56A 3BAJA 4M82A 3EWCA 3KFTA 2YLAA 2ATMA 5AN7A 3B0VC 5BXPA 1K70A 4F66A 1OC6A 3VIHA 1V5XA 1M7OA 1ZJIA 1ENUA 4IQDA 4IIEA 3BCJA 4NT0A 4FOKA 1M03A 4LAKA 2A7PA 4ERGA 2XPKA 4FXRA 3LRLA 4BFAA 2PAJA 3UJEA 3LD5A 3ZYZA 5C54A 1A0DA 3WF1A 2QQ6A 4JKMA 1GONA 5AYXA 4M3PA 2XZ9A 2A21A 1EDGA 2D23A 1X98A 2O56A 3R11A 4GGBA 4GY0A 4D6GA 1VFHA 3CH0A 1WUEA 4MUPA 4AF0B 4DZ5A 2WQDA 2PRHA 3AHVA 2F2HA 3FA3A 3SN1A 4JCMA 2O0TA 3P5YA 4IJCA 5EA9A 4ZO9A 2ZRZA 1JCXA 1HL2A 1JAKA 4L65A 3DN5A 4QITA 4FLOA 2G0WA 4HCHA 2G96A 3CQKA 5G2HA 5ABGA 3WQ4A 2DVUA 3WY1A 3W2MA 2HROA 2RAGA 4UOZA 5JH1A 3MUXA 3AU2A 3FDKA 1MRQA 5I3KA 3VO0A 4GABA 3MI3A 1GORA 4G1KA 3SRDA 4P7QA 3OA3A 5FAGA 1BXCA 3IJ9A 4P8WA 3PAJA 1GW9A 1VR6A 4PUJA 3ABQA 1OGGA 3EPNA 4YN5A 3LBOA 4H8VA 3G1HA 4DAFA 1V0LA 3WF0A 1Y7VA 2WNWA 3I3BA 1LBFA 2PURA 1WKDA 3OVGA 3SUUA 3VKDA 2ZVIA 3L4XA 3U5YA 4QS6A 5DXXA 4U3AA 1GUVA 3SADA 1W3HA 3M16A 5IM51 1MFUA 3Q2DA 4AC1X 4JL1A 2VRQA 3A64A 4POCA 3S3GA 4YHGA 1UUMA 5IDZA 1ODUA 2G3JA 3B9AA 1F5ZA 3EB4A 1XYCA 4NJKA 3N9RA 2ZA3A 3VZZA 3NIYA 1IEVA 5AB3A 3E0FA 4KT2A 3VNYA 3LHVA 1NAL1 3PJTA 4PBGA 5T91A 3R8RA 1PKLA 1AW2A 1C90A 3NXFA 6REQA 2Y5SA 2EKGA 3U6WA 3CJPA 2Y2WA 2J6VA 1GEHA 4YNGA 1HL9A 1YTKA 5HAOA 3KBWA 2WVSA 4AX6A 3SN4A 1ZJHA 2VEPA 3S1VA 3PN8A 1G6CA 3GVQA 3WZ0E 1D8CA 3WQWA 1E6XM 1RA5A 1EFZA 4F0SA 4MF4A 4JTFA 4O0KA 2PLCA 4L6HA 5FEXA 1RK6A 1VD6A 2RHGA 3C0QA 2I56A 3O07A 3G8EA 3R0KA 1UR0A 3ZQ9A 1QMLA 2QPUA 4IIDA 1JDCA 1W5MA 4LX4A 4IIFA 2TRSA 3H4WA 4FF7A 4IXXA 1D2KA 4WCJA 4QNEA 5A2AA 4OV9A 3GBEA 2PTZA 2Z1SA 3LRMA 4IICA 3WJSA 2E9BA 5E1QA 4EKJA 4A2SA 5C9UA 1MEIA 1HFBA 3AS1A 4JFUA 3W1MA 4KKXA 5CPSA 4F2TA 4EX4A 4CLMA 3LV5A 4YTRA 4RZ4A 4IX2A 4PB5A 2CESA 2XWEA 1OSEA 2PRMA 4C1NB 1QBBA 4DXXA 4QDMA 5A6BD 4IISA 3CHCA 3WLRA 1UWAA 4ACYA 1QUMA 4I6KA 2C14A 2OZ8A 3F5JA 3SRHA 1NOFA 3MC5A 4A29A 3UG5A 2VCBA 4O16A 3QQ1A 2DSUA 2QDGA 4PTNA 2CLOA 5CZJA 3PNUA 4GLEA 4WJ8A 2WO5A 3TE9A 1KFLA 1H1YA 1F61A 4JIIX 3NEHA 2VELA 2QIIA 1S2WA 2Z0IA 1K9DA 2V3EA 1E9ZB 4JDBA 1JNDA 3ZJ7A 4ERIA 1TRDA 3TLQA 4JTJA 2C16A 4KBXA 1PYMA 1E6ZA 3MVIA 3RO8A 1JVNA 1S5WA 1EEPA 5F2MA 5AC7A 2BVDA 4DEFA 2CBIA 1X97A 4B3KA 2X7VA 5K4ZA 5LXEA 3ZWSA 2PC4A 1R2TA 2AKMA 4J7RA 4K8GA 4QLJA 1UP2A 3C86A 4Q8VA 2PGWA 3OVPA 1GEQA 3NXLA 4JIEA 2XH0A 3WH5A 3TUUA 1E73M 3B8WA 3PBWA 2R94A 2E1WA 4O52A 1R9YA 2NV1A 3MB9A 1M04A 1X6LA 4RDYA 3XISA 5I5RA 1V93A 2VC6A 3IIPA 5AC8A 4GKTA 1B31A 4KEZA 3W01A 3EB2A 4C6BA 2W27A 3UQNA 4GIAA 1O7AA 5HJYA 4H83A 3NUKA 3ZLFA 3UR2A 1W9XA 2XISA 3WBYA 2NVCA 4RPQA 1OQFA 4NX0A 4FNPA 4I7VA 1DJYA 1FWGC 1EP3A 3BW4A 8CGTA 1W1IE 2B81A 3PTDA 4HA1A 5M17A 4JTAA 3QV7A 2VRJA 4PGLA 4GYJA 1HKWA 1GOKA 1EOKA 3MP4A 1VHNA 1KXVA 3WDHA 4RPPA 1OGSA 1YTEA 1UZ4A 3A23A 3ZR6A 6A3HA 1EXBA 2OWXA 4ZVJA 4F4RA 5C71A 1R87A 1L6WA 2BODX 1GKPA 4HPHA 4RE4A 3LMYA 4UTIA 4LYQA 3GNXA 2QV5A 2NUYA 1YBQB 4W7UA 5A6BA 3OO2A 1WKYA 3AMLA 3REQA 4AD0A 4Q4SA 3TA9A 3ZT6A 1IWBA 5J5DA 1NM9A 1TTJA 2YBVA 3DG3A 4RE2A 5A8GA 1K02A 3CT2A 3A3WA 1JULA 4FSAA 3ALGA 2WSQA 2F84A 1TTQA 5TBOA 4YLWA 3EMZA 4KF1A 1F6PA 2IPWA 4PMDA 3ZWTA 1XR2A 1UBSA 3ITLA 1XRFA 4DBUA 4QM1A 4U2ZA 4Q4OA 3VNLA 5FOOA 6CGTA 4Z1YA 3RK8A 3W83A 1NARA 3IJIA 2PWDA 3NQBA 4Y8FA 4K3ZA 1DQUA 3NQ8A 3DERA 2BFGA 1VF8A 3B4UA 1XLAA 1GYLA 4I3GA 3WUFA 1LG1A 1T7LA 4GC4A 1H0GA 3BJTA 1MNZA 3RFAA 1XG4A 3F4DA 4J27A 3EWXA 2WC3A 3K4DA 4W8LA 2WK2A 4MFDA 3PNZA 3QXBA 4ZA0A 4LYKA 3BDKA 3DAQA 3AMGA 1CB2A 3HPAA 1LUCB 5IDIA 5TD4A 5M2FX 3VNKA 5D2YA 3TQ0A 2PDCA 3M0MA 5E09A 3TZFA 1TRIA 3CIVA 3IUIA 2JGQA 3RLVA 4DO6A 3IIVA 3UZJA 1S3TC 4MKNA 3NL5A 2Z27A 3MYPA 3USBA 1VBRA 2C71A 1Z48A 4H1ZA 4AWSA 3RMEA 5XINA 2ISVA 4B9ZA 1TV4A 2VQUA 3W7PA 4MG4A 5K9XA 2YDSA 5IFPA 3GH4A 5C2XA 5BMXA 4GE8A 5G2IA 3OQEA 3C0JA 2CZ5A 3W29A 1SR0A 5HATA 2NWSA 1P7TB 4K7YA 3II1A 2QKFA 1QPRA 4XO7A 4JTUA 4M5PA 2PPGA 4FX6M 1MQPA 5CZ0A 1BQCA 2CLPA 3LXAA 1DVJA 4D6FA 4Q7IA 4ZE4A 1HO1A 1XLEA 3TP4A 3FCPA 1LLZA 1W3LA 4JAWA 2Y61A 4BKNA 2Y88A 3GNPA 1ZALA 1EYEA 5F4XA 4DHGA 3KOFA 1CGVA 4UFIA 1W9BM 2GQAA 2J47A 4BI5A 1KGXA 1FDJA 2OZ3A 2I5IA 3KL0A 4HNVA 3O1NA 1QNSA 4M8UA 1EX5A 1P4CA 3KZPA 2ZXQA 3QMTA 3ITYA 3G2GA 5CPLA 4PFHA 3R7MA 3A4XA 2WLYA 3DGBA 4Z2JA 3NQ6A 2WBGA 3C3NA 4HOXA 3AUOA 1FHVA 3M0XA 3A6OA 4AZCB 3BCFA 4MGGA 3M0ZA 1UP0A 4N9CA 3UXAA 1Q3NA 1OCBA 1WPCA 2J7DA 2WSRA 3ZZ1A 1ZAJA 4I7WA 2FH6A 4YVXA 3N9SA 1Q6QA 3KBJA 1X6UA 4FO4A 2WKGA 4HZ6A 1E4IA 4L9XA 4QE1A 5TQLA 3MHFA 3B8SA 3F1QA 1QHZA 1CGTA 3ZJKA 2NXHA 1QAPA 4H00A 2I9EA 1R3RA 2PRLA 1K8XA 1YIXA 2WWCA 4DBSA 1HF6A 2ZE0A 1QK0A 3LLDA