4ZFCA

Crystal structure of akr1c3 complexed with glicazide
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
315
structure length
315
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title In vitro inhibition of AKR1Cs by sulphonylureas and the structural basis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 118
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2015-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4zfcA00
3LN3A 4GACA 4IGSA 2IS7A 2PDXA 4L1WA 1Q13A 1PWLA 5LIYX 4PMJA 2J8TA 2PF8A 2IKIA 4YS1A 1US0A 4GQGA 4LBRA 4JIRA 1HW6A 1A80A 1C9WA 2HV5A 4WRHA 3UZXA 3H7UA 2FVLA 2INZA 2I16A 2PD5A 2HDJA 4JQAA 3ONCA 2WZTA 4LAZA 3CV6A 4PR4A 4LB3A 2BP1A 5LIUX 4JQ1A 5DANA 4XZHA 1YE4A 1HQTA 1GVEA 2ACQA 3R94A 3UZWA 4XAPA 3P2VA 4QXIA 1AH3A 3ERPA 4DBWA 2HVNA 3EB4A 3CV7A 4PRRA 1AH0A 4EXBA 2IKGA 4JTDA 1S2CA 1X98A 1QRQA 5LIXX 1ADSA 2PZNA 4XZLX 3R8GA 1AH4A 3WBWA 2PDQA 2PDKA 2IKJA 4F40A 1MI3A 1X96A 3B3DA 3KRBA 3UFYA 4IJCA 3LZ3A 4WDXA 3GHUA 2FZDA 1RALA 1SM9A 5HNUA 5LIKX 3H7RA 2IKHA 4GIEA 3R8HA 4FAMA 1PZ0A 2P5NA 4IJRA 3R7MA 1ZUAX 4XO7A 4HBKA 3GHSA 4Q7BA 1PZ1A 1ZQ5A 1AZ2A 4WDUA 4ZFCA 3EAUA 4FALA 3S3GA 1QWKA 3M0IA 3R58A 3MC5A 2IPFA 2C91A 3V0UA 3H4GA 2ALRA 4RPQA 1MRQA 4JIHA 1RY0A 2PFHA 4DBSA 3CASA 3F7JA 3R43A 2CLPA 3NTYA 3LQLA 2FZ8A 2IQ0A 3U2CA 1MZRA 1JEZA 5AZ1A 4LBSA 3UYIA 1AFSA 4JQ2A 2PDLA 4YVPA 3CAVA 3RX2A 2F38A 4LB4A 2IPWA 1AZ1A 2HEJA 1X97A 1K8CA 1ZGDA 3N6QA 3LUTA 1XJBA 2DV0A 4MHBA 1XGDA 4QBXA 3UGRA 1IEIA 3COTA 2VDGA 2NVCA 1UR3M 4WDTA 3LEPA 2PDNA 2BGSA 1Z8AA 1M9HA 2HE8A 3N2TA 3LZ5A 4PUWA 1IHIA 3G5EA 2NVDA 2PDWA 1ZSXA 1YE6A 1R38A 4PRTA 3C3UA 4XVDA 2QXWA 1LWIA 4JTAA 4DBUA 4AUBA 2ACUA 5C7HA 3V36A 4OTKA 1S1PA 3V0TA 4JTCA 3FJNA 4XZIA 2HVOA 1PWMA 4WGHA 1Z89A 3UG8A 4PUUA 4YVVA 3MB9A 2ACSA 2PDMA 3V35A 2HE5A 4Q3MA 1S2AA 4GA8A 1Z9AA 1EL3A 4FZIA 4WDWA 4H7CA 4XO6A 2PDJA 3D3FA 2BGQA 1RY8A 3WCZA 4GQ0A 4H8NA 5JH1A 2PDUA 1T40A 5AZ0A 2IQDA 3M4HA 4HMNA 4GCAA 5HNTA 4L1XA 3BURA 4WEVX 2ACRA 3M64A 3DN5A 3GHRA 5HA7A 3Q65A 3BUVA 5M2FX 2DUXA 4GABA 3LD5A 3RX4A 3CMFA 4QR6A 2PDFA 1PYFA 1LQAA 2PDBA 4G5DA 3CAQA 4JQ4A 1S1RA 3O0KA 4NKCA 2PDIA 3LBOA 4XZMX 5LIWX 2FZ9A 2PD9A 3UWEA 2DUZA 2PDPA 2INEA 3R6IA 2R24A 1EXBA 3VXGA 3QKZA 4QX4A 3T42A 1FRBA 1Q5MA 2AGTA 5JH2A 1YNPA 2ISFA 2IPJA 3BCJA 3V0SA 1VP5A 1YNQA 2PDYA 2WZMA 3LQGA 3LNMA 4EXAA 4XVEA 4JQ3A 2PEVA 2PDCA 3DOPA 1EKOA 3GHTA 4DZ5A 2FGBA 4JIIX 3ONBA 1EF3A 4YU1A 2R9RA 1Z3NA 3UP8A 3G1RA 4R9OA 4LAUA 1XF0A 2A79A 4I5XA 3BV7A 4XK2A 4ICCX 1OG6A 3WG6A 3WBYA 2IPGA 5KETA 3O3RA 2PDGA 1T41A 2FZBA 3LENA 4ASTA 4JTRA 4FA3A 4JTQA 3Q67A 3UZZA 2F2KA 2I17A 3EB3A 4YVXA 3FX4A 3UZYA 3GUGA 3RX3A 2PDHA 4XZNX 1VBJA 3WBXA 1J96A
chains in the Genus database with same CATH superfamily
4F0SA 3KE0A 5DEZA 4E2DA 3KCLA 2XIOA 1EJRC 5GNXA 3VIOA 4M1RA 1FHUA 2QR6A 1W56A 2PF8A 2IKIA 5BW6A 1JYNA 2JF7A 1C8VA 5CJNA 5D05A 3ZWSA 3ZVIA 4U2ZA 2XN2A 2QJMA 2INZA 1V3LA 3RCYA 2PD5A 1YADA 1DOSA 4JDBA 2YXOA 1WOAA 1E6ZA 1U1HA 4QGCA 2F61A 4TTUA 1CIUA 3ITCA 3WUBA 4UOZA 4JQ1A 3ZLFA 1FHVA 4FPSA 4FP1A 4M56A 4H9YA 3MUZ1 5CH9A 1A3WA 3ZR4A 2GJRA 3W1AA 1AH3A 1YMYA 3GYEA 1VLIA 1B31A 1HL2A 1TPH1 4EXBA 3WH9A 4CCEA 4Z2LA 1J6PA 4MDOA 3M7WA 3NVDA 5AYXA 4IMFA 5F2IA 1LDCA 3TLLA 1JIBA 1XPGA 2EG6A 2OZ0A 4O8RA 3VKKA 4C6FA 5A8NA 5KEZA 4G7EB 3RFAA 4B90A 5K9DA 4W8BA 1FCQA 4TUFA 1VPQA 1W3LA 1MI3A 3GAYA 2A7PA 1RQBA 3WIJA 2XSAA 1UD3A 4LUSB 3LERA 5GJNA 4R9XA 1JL8A 1GW1A 3C0LA 2J47A 4H9UA 5LIKX 1W3JA 4B2DD 1C7TA 4A2SA 4YYCA 1H60A 2XIQA 2D2HA 3OLGA 3R7MA 3S83A 5JBFA 3ATYA 4I3GA 3USBA 1E56A 3IK2A 4HBKA 3RYSA 1EEPA 3VNMA 2O55A 3A6OA 1O6IA 3U7VA 3GNDA 4K37A 4DRSA 2P88A 4JAWA 3PBGA 1GQNA 1GHRA 4PEKA 2DORA 1P4CA 1TV8A 5E6ZA 5T26A 2ZRWA 2ZX8A 2TAAA 4E3VA 4MNKA 3NQ2A 2PWDA 3IIXA 4MKSA 5AFDA 3LLDA 2VEGA 2V69A 3TMLA 1ME8A 4Q8UA 3MHUA 1DXFA 3BAJA 4FF5A 5CAHA 1XIEA 1A3XA 1WUEA 3E38A 3B06A 3KL3A 1TV5A 4XBKA 4UFLA 4JIHA 1XH1A 4DBSA 3GW3A 3QPZA 3W70A 3M43A 4X0VA 1XG4A 1UROA 2IXVA 4IG2B 5HUPA 1M7JA 1LBLA 1MZRA 3TAKA 4QDPA 4OUIA 5LXEA 1XLKA 1BXBA 3GVQA 3TN6A 2F38A 3F5LA 1TJRA 1V6VA 1FP8A 4IICA 1D3HA 1H50A 2DJXA 3F5KA 3GNOA 4OUEA 1HO1A 1S2UA 1OB0A 3NZGA 2ZVRA 1WDQA 3H23A 3INPA 5DO8A 3TFCA 4PUWA 1PPIA 3ARXA 3THAA 1E6NA 3QC0A 3GDKA 3W1QA 3MU7A 3UWWA 2PODA 4O1FA 1CXIA 2VX7A 3I3DA 4JBRA 1AQHA 1PBGA 3WQ8A 3MT1A 1FX6A 5I77A 1YYAA 2ZC1A 1PCWA 3EX2A 2GVEA 3BWWA 1V3MA 1XLAA 3V0TA 2YCJA 2OZ3A 3IV8A 3W88A 4ACYA 2XYLA 4DI9A 4UTWA 1IIHA 1H7PA 1Z89A 5C55A 4EANA 5CC7A 3GY1A 4G9PA 3PUDA 3SIZA 1DORA 1CLXA 1UOKA 2HE5A 1GJPA 1BG9A 2ZZ2A 2ZC8A 3S6DA 1KCXA 4A22A 4FB7A 1OEPA 2H3DA 4J4KA 4Z1DA 2A5HA 2WAGA 2WO5A 4O18A 2ZKMX 1VBRA 1EC7A 1LT8A 3K13A 2CLKA 3QW4B 3L4WA 2BOGX 2E5BA 1EQPA 3GXTA 4Y6GA 4OBRA 1EP3A 4F8XA 2Z2BA 2P3ZA 2J7GA 2X2GA 1XRTA 3PG8A 5F4SA 2GJPA 3GD6A 5EPDA 3GVGA 1UASA 1MDLA 4MJ4A 3EWUA 2E6FA 3RX4A 4YTUA 3TTQA 3VU2A 4U3AA 1K6AA 3H2NA 4FK9A 2XIIA 3S2MA 3STPA 3TV8A 4P61A 3FOKA 4XX6A 2OWWA 3ATZA 4FLSA 4IXXA 4DZAA 3RNDA 2QV5A 4IQJA 2QPUA 1H0GA 3GDTA 2XFRA 5C6MA 1QUMA 3PR2A 4W5ZA 3WH6A 2QCFA 3VXGA 5I3KA 3LSBA 3T42A 2PF0A 1EXPA 5F2MA 1WBJA 4J2MA 4ZSTA 2CYGA 2Z2AA 2IPJA 3NZRA 6TIMA 3VCNA 3NURA 3ZJ8A 1H7XA 2YW4A 4AYSA 4C1NA 1K1DA 1BTMA 4KGLA 4EXAA 1JAEA 5AVNA 3S2LA 1I9CB 3DOPA 3PM6A 5A8GA 2EO7A 3QH2A 3CZEA 3REQA 1VCFA 3PBWA 1V02A 2FJUB 1UZDA 3SZ8A 2G4JA 1YEYA 1EYEA 1VEOA 1QI5A 4XK2A 1RCXB 4FNTA 3DHDA 1OG6A 2IPGA 4CN1A 1DWHM 3EB2A 3SAZA 5D8ZA 4DELA 1XSJA 4B15A 1K8YA 4CNTA 3SY1A 3Q67A 3PWAA 2BTMA 1XFBA 1LUCB 5LGXA 3T4CA 1DHKA 4OJYA 1B3YA 4HN4A 4PRWA 4O1CA 2YB4A 3F4CA 4PUKA 1RLDA 1TE6A 1VEMA 2J6VA 1RP8A 2F2HA 2V5LA 4CVUA 3TN5A 1KNWA 3WJZA 4BQ5A 3H2EA 5CPLA 2JQXA 4X2RA 4NILA 2AL1A 5A6SA 2OOGA 3DBPA 1JRBA 2J4GA 2HNEA 3U57A 3WQCA 2VD8A 1R87A 4HZMA 4NF7A 3C2EA 4Q8NA 1KBBA 5HUOA 2W0UA 1KRBC 1NWSA 1AL7A 1BEUA 1DYSA 3KUMA 3UPWA 3P7YA 4NRSA 4HK7A 4TIMA 1GVFA 5CQ1A 3DERA 4LAZA 3CV6A 3AI0A 4NNBA 3RK8A 3V16A 1HT6A 4IFKA 2VFFA 2I5GA 4V1XA 2GK1B 1V3HA 1ZAIA 3TQPA 4HSOA 2OPJA 8XIAA 5ABEA 2WZHA 5XIAA 1T6MA 3NUKA 5CG0A 2BVYA 1BVWA 2NX9A 3UXAA 4C60A 4FS9A 1O5QA 3TW6A 2NSOA 1CPUA 4F9DA 4X60A 3UA4A 3FA4A 1L6FA 4DQWA 1EWEA 3W6YA 2PDKA 1UKPA 2IKJA 3IARA 4TTGA 2QT3A 2ZA2A 4FNQA 5TBOA 1BRLB 2G4FA 1AK5A 3GIQA 3KVMA 1RALA 2R91A 4ZA0A 2NV1A 1P0NA 3P3BA 1PDYA 1IT8A 2G5WA 3M6DA 4S3EA 1NSJA 1RAKA 2C0HA 4AIEA 2DW7A 3A22A 2QQ6A 2EXOA 2Y63A 3MV11 4HPJA 4JTLA 3NIYA 3OGSA 4BR1A 2BDQA 3NPUA 3S5ZA 4ZSUA 1YTDA 4A3UA 2J88A 1EA0A 2OT1A 1SU5A 1BKHA 3WJYA 3T6CA 2R1NA 4QQ3A 4FX8A 5J5DA 4CN4A 3MC5A 3BJFA 1R3QA 1WXZA 3CT7A 3WQOA 3AO0A 1UPMB 5DCBA 4MWAC 4QTGA 4RPQA 3TJXA 1JPMA 3AXHA 5EKYA 4M6UA 3GDRA 4GYJA 3P67A 5D03A 1HXJA 1CLKA 1O12A 4MKVA 1NVMA 3FAXA 4LBSA 3WQPA 2ASHA 2GJXA 1JVNA 1MEIA 4N9CA 2I14A 3V5OA 1O7AA 3ABSA 5F2GA 4CKQA 3EA3A 5I02A 3UG3A 2X1UA 2BFGA 2OO6A 1M9HA 1TCMA 2Q09A 2Y88A 3UWQA 4GKTA 3E49A 3RO6A 2WNQA 4PMVA 3PPGA 1S5TA 2CZFA 3M0YA 3KTSA 1G67A 2DZWA 1HKMA 3CO8A 3G22A 4NZCA 1FWDC 3AUJA 3PAOA 4A8NA 1K7EA 1HG3A 3NEHA 3P8JA 5GVJA 4D8LA 3WH5A 1SUXA 2BVWA 2RDTA 2QKFA 2ZZ1A 4GGHA 4S3DA 1WV2A 2BODX 3VABA 3K4DA 3POCA 4GKLA 3S47A 1PWMA 2YIHA 3CU2A 2B4GA 1PKLA 2G3FA 1K02A 3KTXA 1M04A 4RE4A 1XIGA 5FF4A 1TJPA 4TX8A 4OGZA 6ALDA 2ZX6A 3V35A 1JNDA 4UTKA 2WBKA 4ZB5A 1TTJA 2XZ7A 4FZIA 3BGAA 4LTSA 4H7CA 5D2VA 3W00A 2C1IA 4DLMA 1I2RA 1L2QA 4GY0A 3EWZA 4XAFA 1ONEA 1T40A 3ICJA 2ZUVA 1GOOA 3EX1A 4ACZA 4HMNA 3LCGA 5IFTA 1AW5A 3BQ5A 3TSBA 3S46A 4TU1A 3GAKA 1RVKA 3ANVA 4PEEA 3WQFA 1GW9A 1XBZA 1AMYA 1JCMP 3ALFA 4UZUA 3S9ZA 2VUNA 2FHBA 4PMXA 3KLLA 3K30A 1OFQA 4W9TA 2DZVA 3AMKA 3TA6A 2ZFAA 3ITYA 1QBAA 4QJ1A 1VIZA 1TTIA 1W3IA 2HJPA 3OU8A 4LVAA 1CENA 2W79A 1AJ0A 3SCRA 2PE4A 2PDIA 1TR9A 1TREA 2GSHA 4I7WA 4A29A 3XISA 3VIHA 3IPWA 1R7OA 3QR0A 1JXKA 4QAWA 3DXIA 1EXBA 1X8CA 4RLIA 3G3MA 3RLGA 4REQB 3BGJA 3VA8A 4KRUA 3FW6A 2WC3A 3B0YA 1QAPA 2WMKA 3N4AA 4V2XA 5FEXA 3PULA 5G2HA 2TMDA 4NIRA 1NFPA 4JKMA 2J74A 3TWBA 2PDCA 1EKOA 3TEVA 4HZ7A 4JTEA 1HIZA 4JIIX 4AU0A 1DIEA 3KWXA 4A8LA 5DBUA 1K9DA 1QO5A 1Z3NA 4CD6A 3TNOA 3KAOA 2F6XA 5J04A 1F74A 5HPCA 1ENUA 3SI9A 5D30A 4Z2JA 3OYZA 5HMDA 3D0CA 4UTUA 1NIUA 1UOZA 3W1TA 3HG3A 2YR1A 1EJSC 3QLDA 3KBSA 3C61A 1JZ6A 4M19A 4XKYA 1UIPA 2R1KA 4ERIA 3FLUA 2VWSA 3UXKA 3E96A 2DZXA 1TKKA 2FGZA 3OHMB 4NI8A 4WOQA 5HK4A 4BFAA 4U28A 1DV7A 2QIIA 4Y2WA 3VGGA 1EO7A 5A8OA 3PBMA 1Z42A 3LN3A 3EOSA 3QY8A 2D23A 4L1WA 3TC3A 3RCNA 1H7WA 1RCOB 2PGWA 1ZJHA 3AIQA 3GVVA 3LM3A 2SFPA 5DELA 1XLCA 2QJJA 4AF0A 1OGBA 2DZBA 1TJ1A 3OQEA 2WLYA 4A4AA 2XISA 3NFUA 2J75A 4HJFA 3NQGA 4QNEA 2JKAA 4KIEA 3A23A 4EPBC 2ISVA 3VD7A 4ZO6A 1ELSA 4CD7A 4WKHA 4PTDA 1JQXA 4O0ZA 4BWLC 1LF1A 4GZJA 4JIQA 2J7EA 3EDEA 4Q4MA 2G97A 5I3IA 1MNZA 1E51A 1U5VA 4X0NA 1A4MA 4V33A 4PRRA 4MNLA 4KGJA 3GH7A 3TMQA 1C29A 1FWBC 3T08A 5FJOA 1PIIA 1V3KA 3VOHA 3DECA 3O6YX 4QLJA 1QT1A 2BHUA 1WKFA 3OG3A 1N8FA 3IJIA 3AIEA 3IGSA 2Z2UA 1MYRA 4O4VA 4K39A 2BS9A 2H6RA 4D6IA 4DO5A 4FX7A 3W23A 4KWWA 1J8VA 4BF7A 3GHUA 3REQB 3OA5A 3WLHA 1JCYA 3WDPP 4IQEA 4DJDC 6TAAA 1JI2A 4GI4A 1QDSA 1TWSA 4GIEA 1W2VA 4PCFA 4O53A 4D72A 3I68A 3MW7A 1ZUAX 3RXZA 3KRSA 1RK6A 1H09A 2GQ8A 2ZXDA 8RUCA 2C14A 1OJXA 4CEUC 4KRTA 4C6EA 4Q4KA 1MEHA 5DQPA 1ZQ5A 4QEEA 1TV3A 2CZVA 1JPDX 3MV01 1BWLA 3MUCA 1OFAA 4S3FA 3W73A 1UR1A 1F7BA 1VFSA 4RV3A 3QRHA 3N2XA 4M7TA 1KRCC 4D6FA 1EC8A 2ZDRA 3HF3A 5ABFA 1MSSA 2OYKA 3UY7A 4M7SA 1QK0A 3FDGA 1JPHA 2CETA 2J25A 2VCCA 3AIUA 4XKMA 3GU1A 3LV6A 3MWAA 4XZBA 4JTGA 4MWAD 2ZA1A 4H9XA 4HN8A 4GC4A 2FZ8A 3QYSA 3L2IA 1HF6A 2J8GA 4QITA 3CHCA 2VWTA 3NL6A 1OGSA 3L5LA 1E9YB 2DH3A 3EXTA 2XM2A 4YVPA 4NYYA 1EGZA 1J5SA 4JGDA 3V1HA 3TYBA 3BH4A 3QFEA 1R30A 5M17A 3A13A 4M82A 2YLAA 3SQSA 1G4PA 4JTUA 4IFKB 1F6KA 1IEIA 1OK4A 1UP2A 1ZLPA 1OC5A 1HL8A 7TAAA 1UR3M 3N1AA 4C5ZA 3FHQA 2CEQA 1UUMA 2E5CA 2QDDA 3M5ZA 4KFPA 1G7VA 1Z48A 1R2SA 4GNKB 1YE6A 3BLEA 1CLVA 3NQVA 5JXQA 3A64A 4FLOA 3U2EA 1EIBA 3KP1A 1SR0A 2XH2A 1CXEA 2BVDA 1UR0A 4DWSB 4QCFA 1UH2A 3RMJA 4AD1A 1SJDA 3M0HA 5MKGB 3TNBA 1LTDA 4ORIA 2WKJA 2XINA 4XZ9A 5DF0A 1TRDA 3NO3A 2IMRA 4D6EA 3BLKA 3WNLA 1CI1A 1GYMA 3A4AA 1C9DA 1TMLA 2XH4A 3KOZA 2V2HA 3S6TA 3EWXA 1S2AA 1L8PA 2OODA 3SQLA 4ZO8A 4RDZA 1G4EA 4WDWA 1TPEA 2OOFA 3ENLA 3BOLA 4I5UA 5D2YA 2Y7EA 1XLMA 1UBPC 3N4EA 5TQLA 1RY8A 4CU7A 4AIBA 4Q7NA 1ZY9A 3HQNA 4H8NA 3NOEA 2ANUA 4W88A 5ABHA 2EPNA 2I1OA 1F76A 1KLZA 5HWJA 2FB2A 5AHNA 1G01A 4US5D 4L1XA 1H1NA 4WEVX 2V67A 4I5RA 4RW5A 3KBMA 3NSNA 4C6QA 2A3CA 3LYEA 3O15A 4M8UA 3M64A 4LS1A 4W7WA 2ZWZA 3MS8A 3IIOA 2Y2WA 4LC6A 4GVHA 1X8FA 1AJ2A 2VZSA 4KCVA 4MDPA 1LP6A 1XLGA 2XGBA 3T2OA 5IRPA 4IPPA 3DHUA 1ISWA 3HFTA 1YKWA 3ISIX 3GG7A 2PCEA 2Y7FA 4NAEB 1AQ0A 3M0LA 3IJ8A 4LANA 1WDPA 4IXHA 2XJ7A 3PC0A 4GO8A 1BQGA 3G6LA 1WDSA 4GX8A 4JYDA 1F9CA 3IS4A 1LG2A 1JZ5A 7CGTA 1DWJM 3OVPA 4F79A 4S23A 2OLSA 3MO7A 2Y5JA 3RLVA 2AAMA 4X9YA 1LCOA 4J3WA 4DAFA 5EGRA 1EGMA 2OGYA 2XVLA 1CXLA 5IDIA 3N6HA 4JQ3A 2QF7A 3SSJA 3UY8A 1BYDA 2HXUA 1AMKA 2C1GA 1P5BA 5FCZA 3UP8A 1L2UA 1TMQA 4DUXA 2YXGA 3L5AA 4ZBCA 5CLWA 4WR3A 3N2MA 4WXYA 2QAFA 3MUIA 4TX9A 2X0YA 3JR2A 3N9RA 4M24A 1BGGA 3FA5A 1PYMA 4HYWA 4LS0A 4PA8A 4FA3A 1J5TA 1M01A 1TRIA 3MANA 2VFIA 4MNMA 1UR4A 4M80A 2R1PA 2I17A 2ZX9A 4IGMA 5CBBA 3C2YA 3ITGA 2CERA 8TIMA 4D71A 1UD5A 2PTDA 1PS9A 3OYXA 2IS7A 4ACZB 4QSFA 1MW3A 3WQ6A 3N9SA 3GXIA 5LIYX 4ZFMA 4YS1A 3PZIA 2BXVA 5BRQA 3W22A 1V0MA 4PUJA 3VAVA 4GQGA 4JIRA 1TX0A 4JTIA 3U9IA 2YLLA 4WRHA 3QFWA 5E9XA 1H1ZA 3M07A 3UPBA 4CU6A 3N13A 2DSZA 4KFNA 3U4FA 4KCTA 1K9EA 3NDZA 1RCQA 3ZS4A 1XH2A 1A0EA 2DT0A 3FY1A 3TN4A 4ZQOA 4ZE4A 1NTHA 4FXRA 3GNNA 1UWRA 2G8ZA 4PMNA 3SCSA 1GQIA 4C1LA 5I23A 1M3UA 5AOUA 2GQAA 1QNRA 4LEQA 4GZEA 1G5AA 3GTXA 4JN6A 1AH4A 2DZUA 3O1NA 4YNGA 3UGVA 3FFSA 2WKLA 1XDJA 4QG6A 3WBEA 3VKDA 3EMZA 2E6DA 3LHVA 1UQYA 3GG0A 2ICSA 4PODA 2CXEA 4YJ5A 1JAKA 4A3QA 2FZDA 2VX5A 1SPQA 1KR0A 1K6WA 5CGQA 2Y89A 5HNUA 3CC1A 4FAMA 5H6HA 2Y85A 5G2WA 2XVKA 4DJDD 3R13A 1D8CA 3MSRA 2E0PA 4LCQA 1ONRA 4H00A 4WGXA 3VIFA 2JGYA 1TB3A 1OZQA 3HU7A 3PTDA 4S3JA 1WP6A 4DJFA 2WJZA 4OT7A 4QSHA 7TIMA 1E0XA 1Q65A 4BF9A 3TVAA 2ADAA 4UTLA 1A5KC 1IGSA 3W29A 4XAGA 3R58A 2CKRA 5E09A 4S3AA 4DAIA 4R7JA 4M3PA 3V0UA 1P6WA 1IXPA 3UR8A 3BARA 4XUGA 3UBPC 3JRKA 3IANA 1BWVA 1QOXA 1K70A 3NPVA 3W07A 3RN6A 4WCJA 4NHVA 3T4WA 5EA9A 3T9PA 3S6OA 3EX3A 4AVNA 1POKA 1VHNA 2NX3A 2PGFA 3T8QA 2W5FA 1JDFA 2XIBA 4AF0B 3QY7A 4UTMA 3VOIA 3AISA 4US5A 3T44A 1TO3A 4MAZA 3WH7A 5HMFA 1D3CA 4NASA 2X1IA 1F6PA 2W67A 3MHFA 3A12A 5A69A 3UGRA 1IXQA 3TYEA 1M7OA 4YHEA 3COTA 1Q8JA 2VDGA 1B4KA 1Q4NX 4Y9NA 4A3RA 4HCHA 4JX6A 1P6CA 5FSEC 4RZBA 1RJQA 3LZ5A 1QNQA 3W75A 2W92A 3SUVA 4UMAA 1OIFA 2XHYA 4LAMA 1D7KA 2DP3A 1AD1A 2NQZA 2D3LA 4DYJA 4F2UA 1QW9A 4QIUA 2VHLA 3SGUA 2DSKA 3V5FA 3M46A 2EAWA 5K7JA 1UD4A 1NJJA 3SN4A 4AVFA 2FLIA 3V3WA 3AAMA 3WQGA 3W7DA 3WD0A 3EPMA 2C3ZA 5CCZA 3E2RA 1E4IA 2OU4A 2VFDA 3OG2A 3W01A 1W8SA 1IGWA 4QJ4B 2PPGA 2PDMA 5H91A 3I7QA 3R0UA 5DLCA 3ZIZA 4DF2A 1WZAA 3MDWA 6A3HA 4XO6A 1OFDA 1GKPA 2DW6A 1PX4A 1J10A 5M5DA 4KRZA 1OYAA 2P1FA 3M44A 4ZTXA 3B9DA 1QK2A 1QOPA 3CHVA 3H24A 2B7PA 2WZEA 3LGGA 4H9ZA 3JS3A 3N18A 3T0AA 5HDRA 3OVRA 5CEWA 1H51A 1GOMA 1CGVA 1JD7A 3VNZA 2QJIA 1NY1A 3A47A 2DUXA 5B7YA 5ABFB 3NZPA 4KFOA 5C9XA 5I07A 4CQAA 5KINA 4N4QA 2G95A 3DIPA 1S2WA 1J0JA 3WEZA 3ZT5A 5AC8A 2RJGA 1EO5A 3B8TA 1ISXA 5FEPA 2PD9A 3ZLHA 2YBUA 4XD3A 4FLQA 2O0TA 3MI2A 4KBXA 2ZXQA 1F8IA 4HSNA 3QSRA 4S39A 3G1YA 4G7FA 3W86A 3KZPA 4W87A 2CBVA 1BVZA 3VNJA 2EG7A 2PWGA 4Q32A 4PFMA 4HNNA 2AOSA 3PF3A 3WLSA 2E68A 4FNSA 2WM1A 1J79A 1R46A 3I7RA 2Z1VA 2WQPA 4I9TA 5K2ZA 1ITQA 4TX6A 3KHJA 4GBUA 1O5KA 1DXIA 4GJ1A 1M53A 1V6UA 4NZ4A 1KWGA 4KPLA 1GNXA 1M41A 4BWLA 1IR2A 4PCPA 4GJJA 2P3EA 1E9LA 1IWPA 4B91A 3ARRA 2XIMA 3AWNA 4EE9A 2I5IA 1MXGA 2D20A 5CZKA 3UZZA 3RIKA 2VDHA 3DESA 3H2AA 3P80A 4NG3A 4HIBA 3VIGA 5FD0A 4YVXA 3FX4A 4PUEA 1CGTA 1DJGA 1L8NA 3P8IA 1T0OA 2XTKA 4H2CA 4X63A 4Q4RA 4H9MA 4ADSA 1UWTA 1P43A 1G94A 2AQOA 3LRLA 3A4WA 1I75A 1H63A 4GLEA 2DY3A 2VVSA 3POHA 1GG0A 3ABZA 3GBEA 2CITA 2I7GA 4JEQA 1VR6A 4PTWA 4M81A 1US0A 3VGEA 2RDWA 5E93A 4P7NA 4LV4A 1HGYA 1I45A 4JD4A 4E0CA 3O06A 1FKWA 1J0IA 3UG5A 1WZKA 2FVKA 3VMOA 3MWCA 1QPKA 1WYIA 3QF0A 2OO0A 5A94A 4JOMA 1F8MA 1KGUA 4E2OA 1ISYA 1KFLA 4P8XA 1ICQA 4RXFA 3V1PA 3W2LA 3CMGA 2QVHA 3DG6A 3IV3A 1V6XA 3R94A 3UJEA 3JUGA 3KRUA 3HQOA 4U10A 4QXIA 2QCHA 1OYBA 4K68A 3WFLA 3CWHA 4DHGA 3MP4A 1FP9A 4LS2A 4LVDA 2V3FA 1IV8A 4RXGA 2WPBA 3N34A 3M5YA 2WWCA 3PFMA 3C6CA 4JX5A 5GNZA 4BQ4A 1SMAA 1E1CA 3H22A 1NDWA 4L64A 3B3DA 1Y5XA 3UU0A 5G4EA 3ZJKA 3EDFA 4J9JA 4QJ5B 2PWEA 4LCSA 4ADTA 3N04A 3W7LA 1PE1A 4O0KA 2VKZG 1SM9A 1HJVA 3KX6A 3N2OA 1CNVA 2XH0A 4OFCA 4HHLA 1SZGA 1PZ0A 1KWKA 4ZL1A 2E3ZA 4AXKA 2C79A 4IJRA 1HP5A 3HPAA 1PB0A 1ZJAA 3TTEA 3QOKA 2G41A 5KZMA 1OHLA 3K4AA 2OG9A 3LTPA 1I6NA 4RR4A 1SO4A 2BV9A 1XYZA 3NQDA 2R14A 3AHZA 4UUIA 5IFPA 1KBIA 5LSMA 2NXGA 1RH9A 1LQ2A 2BASA 3I3BA 3S5SA 1RQHA 4ZZ9A 1A47A 1GEHA 3STCA 3WF1A 5CSUA 1WQ5A 1HJXA 3G0UA 2O9TA 4IL0A 2E40A 3ARZA 1BFNA 1R6WA 2CWNA 2OGJA 2V3EA 3CASA 3PZVA 1FWCC 1JEZA 4R34A 3DFYA 4GUIA 3MMWA 4JR5A 3NNTA 1WOBA 2AKMA 4YCOA 3SB0A 2PDLA 4RNJA 5LNWA 8XIMA 3M1ZA 5FAGA 4TR9A 1PTGA 2QCDB 3L0GA 1TA3A 3JZEA 1JULA 2YL9A 3F4WA 2J27A 3HV9A 3EWYA 4FIRA 1W1A1 1J0KA 1VLWA 1V02E 3CO4A 1F73A 1BVNP 3DFOA 3IUHA 3OA3A 2V8ZA 2HTMA 2DIEA 3BV4A 4UZSA 4DBUA 1SFLA 4L9ZA 4ZB0A 5BXSA 2BX7A 5HANA 4TVUA 1XIBA 1UIOA 1XLEA 3I6EA 1C7SA 2ZUUA 3WLQA 3PTMA 3RAOA 1UQZA 4PTVA 2FTWA 2OVLA 1VFFA 4DF0A 3UG8A 1V7AA 1JFHA 3AQUA 2WLZA 1TVPA 1GYLA 3SURA 1JZ2A 2RGLA 2ACSA 3W85A 1Q7ZA 5BOOA 3CWNA 4B16A 1ADDA 3HMCA 3EKGA 4UFJA 4AY1A 2YB1A 3TQVA 3LV5A 3OLIA 1M65A 1V03A 2PP3A 2PDUA 4MJZA 1UWUA 3W9ZA 3A21A 1I0BA 1F3EA 2Y4SA 5FACA 2ZA3A 4DUOA 1XBVA 2FDSA 3FS2A 4UFKA 4ZB2A 4EVZA 5DMLA 4G1NA 3ITXA 3B8WA 3U3HA 3TW9A 4QLLA 4MY1A 5MHBA 4O28A 2PSNA 3GZAA 1N8IA 3RRXA 1UA7A 3TYZA 2WSYA 2PWUA 3CM4A 3NOYA 1LQAA 3OLDA 3L0NA 3WNKA 2WSPA 1A5BA 1XQKA 4E8GA 3NJ3A 5H8UA 1QNSA 4K3ZA 3W6LA 2RAGA 1UD2A 1XUZA 2QYGA 7ENLA 5AC6A 4M51A 1JZ4A 2REQA 5JH2A 4M0XA 1DJYA 3N2CA 3SIMA 2ISFA 1KBKA 4OU1A 1DJWA 3CBWA 4UQAA 3VKJA 2DQWA 4KT2A 4UOQA 1KV8A 4JXCA 2VX6A 4EIVA 2ODOA 1MEWA 3W7RA 2GGHA 2UY3A 3GLCA 2G3IA 1PEZA 4MB1A 3S0CA 4YTRA 1WDDA 4AWUA 3VNYA 4DO4A 2R9RA 2ZZ5A 4AX6A 5C9ZA 1SO5A 4HPHA 1XF0A 1W9UA 3G8RA 3DZ1A 3FV9A 1B2YA 4EOUA 3G77A 3H4XA 3SRKA 4ICCX 1MUCA 5CPNA 3UW6A 2WHKA 3GR4A 1TMHA 2FZMA 1OINA 2G3NA 3WLTA 4YTQA 4GUJA 4L56A 5G1TA 4MLJA 4ZO7A 3AIRA 3QJAA 1UUOA 1YQ2A 2VC7A 3NQ7A 4AZCA 2DSUA 2F2KA 5SWUA 5FIPA 3ITLA 3BOFA 1A5LC 4LYRA 1HP4A 1XX1A 3QPYA 3S1GA 3TW7A 6REQA 2X0HA 3UZYA 1A5AA 4ZOEA 4NNAA 2CBUA 2BY2A 2E77A 3S5YA 1OABA 1RPKA 3BG3A 3LXCA 3KBVA 1BYCA 1KRAC 4IF2A 1KFBA 2Z6IA 4Q6XA 5EU9A 5M03A 2BWGA 3SFKA 2OB3A 2VUYA 1J0YA 1ZBKA 2FVLA 4TVDA 3G1AA 1IT7A 3WLNA 5IBXA 4BI5A 4UIOA 4XAZA 1IEWA 2OTDA 4JQAA 1QHZA 3EA2A 5HAOA 4GQRA 1H61A 3PUOA 3FEMA 4NUWA 3FGCB 3Q45A 3D5HA 1C8QA 1LWHA 1XIJA 5FESA 1EX5A 2UBPC 1GHSA 4WXZA 4DBWA 1E0TA 1OG0A 1B3OA 2GL5A 1A5NC 3T0BA 2WSQA 1TV4A 5CLTA 1AH0A 4YN5A 3WSUA 2NV9A 4WJEA 1J0ZA 3I7SA 1XRFA 5A3HA 1XKJA 3IIPA 2PLMA 4EK7A 1UWSA 4Z1YA 3BL3A 2OQLA 4B4HA 3NDOA 2QS8A 4QRNA 3GTFA 2VRJA 3MDUA 1QI3A 1VFMA 3NQ8A 1I1XA 4XISA 3W38A 1NDVA 3D47A 4JHZA 4RE2A 4H6RA 1W3HA 3ZMRA 5F1VA 5J5RA 1VD6A 1VJIA 1GTHA 3TK7A 2BNJA 3VKCA 1T5AA 3CQIA 3MP3A 4UQDA 3TR9A 1VEPA 2ZICA 3EGJA 5E5CA 1S2TA 1TTQA 3BLFA 3W2NA 4WJXA 1MW2A 4G6CA 4WLCA 4GOAA 2X41A 2QNEA 1JPIA 5AC4A 1J18A 4H4IA 3DDMA 2F6KA 3BLLA 3GKFA 4MZ1A 2JKPA 2J7FA 1R0MA 3MSDA 1NFBA 3URNA 4KCWA 4L6DA 4NAFA 3IVTA 4PN2A 5IHSA 1QBBA 4B3LA 4AIOA 2DH2A 1UMLA 1MRQA 4Z2KA 1ZALA 4YIWA 1FH9A 3L4VA 5I0DA 2H3BA 1E4LA 3PUGA 3WLIA 2BY3A 2CLEA 2ZRXA 3BW3A 3LXBA 3LCFA 2ZRVA 4EPDC 3R0DA 5D9MA 3VGDA 1UJQA 5C70A 1Q66A 1F3WA 4H83A 3H54A 1JRCA 2TYSA 2F9RA 2IXUA 4FO4A 3BAYA 2FJKA 1EDGA 3H12A 3CK5A 3VM7A 1GT8A 1QVBA 4IPIA 4XTIA 2NVCA 3PG9A 4KETA 1Z8AA 1SQ7A 2CLHA 4PCTA 1IR1A 2C8NA 3N2TA 5BXRA 3KS6A 1E73M 3N73A 4E3TA 4WHBA 2PDWA 3KDNA 4J3UA 4PRTA 5BCAA 4AD2A 1DEDA 1GKQA 1BF6A 2NLYA 4WY0B 2ACUA 1M7PA 5E0FA 1I8JA 3GC5A 5C9WA 1E1CB 1YDOA 2EPLX 1P1MA 1JJKA 3NAVA 4E2BA 1Q45A 3HZ3A 4L65A 2ZTJA 4UNLA 7REQA 3WUFA 5A1AA 3N3TA 2WB5A 4HOXA 3VD4A 3E0LA 5LKYA 4YVVA 4I6KA 1DE6A 2J9ZA 3R5EA 3T09A 1V6TA 3SCPA 3PN8A 4J40A 3SCWA 4NZ1A 3PPFA 3VDAA 1H11A 2FH8A 2YW3A 4NZ3A 3NWRA 3GTIA 4C6JA 4X3ZA 3B8SA 3CB8A 1S3TC 3M9YA 1VPXA 3LY0A 1PZ3A 1KGXA 2FPVA 2J7HA 1K3UA 2C1HA 1EUAA 3OZOA 3FA3A 3OIHA 2FDMA 2B7QA 4ZENA 4TQTA 4ZXOA 3B4YA 1Q6CA 3HO8A 4JHOA 1SZNA 4JTKA 4ICMA 3LRKA 1I2NA 3VOFA 1BHGA 1GYNA 2GUUA 5E9AA 5BRBA 3LBOA 1QW8A 3QHNA 3BSHA 1K7XA 1Y5WA 4O57A 5DFAA 5E6YA 3WK1A 3NL3A 3NPWA 3EA1A 5A6JA 5DMNA 5CGTA 3WLJA 4GC3A 5C0QA 2P8CA 1XYFA 2VEMA 3W1NA 4CNSA 1EHAA 2JK2A 4J3SA 3WENA 3L12A 3SCTA 1TA3B 5T8GA 4LJ3A 4MB3A 4IFRA 1JFXA 1KXHA 1F61A 4Q22A 3V0SA 1KQZA 3DUGA 1Z69A 2ESCA 1KM6A 1JCTA 1J4EA 4NZFA 2Y61A 4PB5A 4H6EA 1EDTA 4PZVA 3CL8A 2VEFA 2YDSA 1OM0A 1EF3A 4YU1A 1TVNA 4LUTA 4R9OA 4QISA 4I5XA 2XFWA 3AXMA 4FI4A 4H8HA 2WJEA 1DIKA 2NV2A 4MFDA 2A85A 4ZCWA 3IUIA 3UERA 3W6MA 3S42A 4OHQA 2DUAA 4HCDA 3SGZA 5K4XA 2PDGA 2JBMA 4UCFA 5HMSA 3WLLA 7PTDA 5LGZA 4GNJA 3VIJA 3W0KA 4B5UA 4CVWA 3VZZA 4J35A 4JTJA 4CD4A 4AMAA 3QLLA 4U33A 3W24A 2GGJA 3PZMA 3NGFA 4J3XA 3BMXA 3O6CA 2X42A 2BXYA 1SFTA 3TC7A 3PZUA 3DYPA 1ONXA 2ZYFA 4MMWA 2PDXA 1REQA 4DO6A 2DT2A 2EGZA 3GUWA 1XCFA 4PMJA 3L67A 3OB8A 3KEHA 3QR3A 3U5YA 5DCEA 1C9WA 3R89A 4HA0A 2DEPA 2GGIA 4H41A 3GG1A 3HFYA 1RK5A 5AVHA 3W7QA 3ONCA 4J27A 1ONWA 1H49A 1PL9A 3L21A 3WLRA 1YIXA 4JX4A 1U30A 3WLMA 4IMEA 3N29A 3AMLA 1E6QM 2YYTA 3W7CA 1I2PA 4E38A 4IPJA 1C93A 1ICPA 2XWDA 3G0SA 2D0FA 1W54A 1I2QA 4HU8A 4I7VA 3QTPA 3E9AA 9XIAA 1KFEA 1UZ1A 1Q2RA 3LG3A 2F8QA 3W7HA 1WBHA 1EUNA 1Q6FA 3V7PA 4DUWA 1FWGC 3L2LA 1US3A 4XZLX 2UZ9A 3T40A 2REQB 2OSWA 4NXSA 3ABRA 2D24A 3T8LA 2PTZA 1ZNNA 2BHYA 4J3ZA 1IE7C 1XUUA 2VGGA 4C6IA 3M16A 4G2DA 3AZRA 2GWNA 1SR9A 2ZCGA 2A1YA 2R8WA 3ANUA 5EMYA 2XN1A 4M5PA 1MDRA 4ES4A 5AN7A 3W3OA 4GVGA 3ZXWA 4GHRA 2CLLA 1UYQA 2OJPA 4H6KA 4S38A 1R3WA 4D6CA 4MPQA 4F3HA 1UP0A 2HMCA 3O6DA 3TR2A 2VZOA 1F05A 1GORA 3TCSA 3VUPA 1W3TA 2FFCA 3IRDA 4JN7A 1U5HA 3OBAA 2W27A 1GPWA 3H21A 2DT1A 4AZCB 1GVYA 2ZE0A 5AB3A 5HBFA 4V1YA 1A53A 3VI2A 4LVBA 3FK4A 5LNUA 6XIMA 1J2BA 7ODCA 5AYYA 5A6LA 1DHPA 1DPMA 1XYMA 3VD9A 4JFWA 4PCSA 4B9YA 1G6CA 1F2JA 4DVOA 1W1YA 3W2JA 2DVUA 3FCPA 3LLFA 4EWND 4H8UA 1V7YA 3NTYA 3ARSA 3W7IA 3SRHA 3M0MA 1S3HA 4KKXA 4MJMA 2WANA 4JNYA 3LPGA 1FQ0A 1GWJA 2VRKA 4O11A 5PTDA 2IPWA 1G4SA 3N6QA 3OHIA 1UA3A 3II1A 1DBTA 1XJBA 2HISA 3RPMA 2R82A 4BY3A 1SSGA 1SYTA 4O1BA 3CJPA 1RBLA 4PGLA 2Y0FA 4HU4A 5KZEA 1WZLA 2PZ0A 5FF2A 4EP8C 3AXXA 3HPSA 1L6SA 4IUOA 5EBAA 1LL4A 2GVGA 2JIWA 4CCZA 3QSTA 2VFEA 3EBVA 2RUSA 4FF7A 5REQA 3MI3A 3GXMA 1TPWA 3HB9A 1VIWA 1ADOA 4UMCA 5LA0A 4OTKA 3U6WA 1FWFC 5H2ZA 4E6MA 2ZDSA 4NX5A 2R94A 4K7YA 3TU9A 1MZHA 1FOBA 2NUWA 3L4XA 3Q2DA 1DL3A 4GRSA 2WOQA 4Q3MA 1GOWA 2QHAA 4S2BA 4C7GA 1KBJA 1QI4A 1SJCA 1QHOA 2J7DA 2Z1BA 4GQ0A 1KFJA 5I3GA 2VGFA 2NZLA 4WUIA 1FDZA 4U4MA 1QMLA 3WZ0E 4MUPA 4FEZA 2WNWA 4LXFA 4LUIA 4C6MA 1VENA 5D09A 4HZ6A 1VAHA 2PRHA 3QXBA 3T07A 2V5BA 1C8XA 3U2ZA 3CH0A 9RUBA 3BUVA 4NAFB 1EX1A 3GS6A 1LYXA 3BLOA 3GB6A 3W1XA 2DZSA 2QJNA 3RLUA 1XLHA 1V3IA 4UTTA 1EJTC 1IXNA 1OFPA 3MUY1 2YFOA 1X1OA 4GPNA 1R3TA 5F1UA 3L4YA 5EMUA 2QUTA 3KVKA 4AZ6A 3DU0A 3W1UA 3IJDA 3QC3A 2QCEA 3SSZA 1PTAA 1JCJA 1TQJA 3MJMA 3QKZA 3LI0A 1RHCA 4P8VA 1UCWA 4AXNA 2W62A 1YNPA 4FXSA 3JVAA 4PSRA 3BCJA 3UR2A 3UR7A 5I79A 3CUJA 4AZ5A 2B7NA 3RM8A 5K9XA 3WNPA 4DLFA 3ZT7A 4N9DA 1PVNA 1J6OA 4GJIA 2VEIA 3AJ7A 4MUZA 6ENLA 4H3DA 3KCOA 3QBUA 4AZHA 4V15A 3BV7A 4DJEC 1JQVA 4PBEA 1M6JA 3WMLA 4IGHA 4HNCA 4GX9A 4D6GA 7REQB 3RU8X 3S9IA 1M1BA 2VYOA 1VC4A 4PUDA 3WF3A 3ZFHA 3HTWA 3ZJ6A 1EJXC 3I6TA 2PTWA 4QQUA 1EOMA 2X05A 1VBJA 3P0WA 3W1PA 5LHFA 1G4TA 1AG1O 4N6FA 1P6BA 2CIPA 3S1VA 3NA8A 4KWVA 1VQTA 1YPIA 1O4UA 3EYPA 1D2KA 1WKDA 5H8PA 1VFLA 5HINA 2VQTA 2E1DA 3CUIA 4QNWA 1KM3A 1AODA 1J93A 5F2LA 3LGDA 3VKAA 4JDYA 3PZOA 3SY8A 2V5DA 1E6PA 2FPTA 1LL7A 1G69A 3BJSA 3C56A 5XINA 1WX0A 2HDJA 4ORMA 4WF7A 3EPOA 4RE0A 3VNIA 1F3TA 4S2CA 3B8UA 3G2GA 4XZHA 4A3HA 1TPFA 1YE4A 3OZYA 3TC6A 3PJXA 4EWJA 1XYBA 3N3MA 3H53A 4PSPA 2CESA 1DQWA 1XRVA 1YLVA 4QG9A 1SZFA 1P0DA 3CLWA 1J0HA 3AU6A 2YL6A 5JU6A 1FWJC 5LA2A 4XWUA 1QRQA 1EJ7L 1S46A 1PKNA 4GK8A 3B04A 4GFIA 3HV8A 1O94A 2PDQA 1OCBA 4JICA 2HK1A 3QV6A 4PMQA 1X6LA 3IGUA 4F40A 3TSDA 4CNOA 2WMIB 3OGVA 1QPRA 4WKAA 3B8VA 3TTSA 3U2OA 4GE8A 4I9AA 2GWGA 5XIMA 2HS6A 3FVDA 1HN1A 2QMKA 2XDFA 1KFCA 4LUTB 2HPMA 1WB0A 3VNKA 4C91A 4IQLA 1FTXA 5DXYA 3KS5A 3LMZA 5JIWA 1UC4A 1EBGA 3MCMA 4Z0SA 5CZTA 3S1UA 4ZO9A 4MTVA 3SEPA 1E0VA 2ZZ7A 1EDQA 1VRXA 4NXKA 1AZ2A 2VMFA 3VK5A 4JFSA 1VYSX 3EXSA 3EAUA 1FFRA 5HJYA 3I4EA 1E4MM 1JUEA 3UZ5A 2P53A 2CKSA 4C6DA 3ZJ7A 3WY1A 1BD0A 1P1XA 3EOUA 3BCFA 2ALRA 3ZVHB 1OVDA 3MQTA 2FMOA 4LSBA 4EPEC 2INFA 3TTYA 1KO0A 3SR7A 1EPXA 2QV4A 3U7BA 1GOIA 3DAQA 4TO8A 4UBPC 3RDKA 4E2VA 4JFVA 4Z2IA 1XW8A 7A3HA 3NQEA 1X97A 2VXNA 2DJLA 1MQQA 2CHOA 3HN3A 2V5KA 3TJ4A 3U8GA 4AEOA 1DJNA 2WVUA 3NZQA 1ECQA 1OSEA 3DX5A 3CUHA 1V51A 4XUYA 1GQLA 3ABXA 5G5IA 4UFIA 1K4GA 1DQUA 1A0CA 4QS6A 3VOJA 5BRPA 3C0QA 1BLIA 4HNTA 3FKRA 1W0MA 2QDHA 1DIOA 4BI6A 1RUSA 1W1TA 4JL1A 2XIJA 2OKTA 1J01A 1W8GA 1XC6A 2B0MA 1QNVA 3V36A 8A3HA 5I24A 3RGTA 5B7ZA 4CEXC 3W1MA 4PUUA 3PNZA 2WYSA 3I6RA 4I90A 3WJWA 1W6TA 3NXFA 1YXYA 2VC9A 4QG8A 2D2JA 4IUGA 4Y8FA 1LBMA 2HNHA 4C6BA 3ZSTA 3ARQA 3R1ZA 3VFCA 4GNVA 2BGQA 1VYPX 3K46A 3MHGA 4GI6A 4UC5A 1LM1A 1R86A 1DWGM 4KMQA 3KL5A 1FXPA 5EL1A 1PKMA 2J77A 3EDDA 4HNLA 1RJPA 2P50A 2Y62A 2E5DA 4B2DA 3B8IA 3DFPA 1AW1A 3N19B 5M2FX 4A8IA 1GCYA 1MW1A 1N2VA 3LD5A 3W7EA 3GC4A 4CU8A 5DBTA 4HYRA 4O12A 3CMFA 5T9CE 3W53A 3MSGA 2CLFA 1W5OA 4RDVA 3HGSA 4NKCA 4ALDA 3QHMA 5CPSA 2YDAA 1TE1A 4DN1A 5HATA 2ZQ0A 3UWEA 4CD5A 5EY5A 3W2MA 4FLRA 1KTCA 4KEVA 2R24A 4HYVA 4D6JA 3N12A 3OP2A 2NWSA 2OLAA 3PB0A 1W1PA 5G2IA 3QGVA 3QTGA 4IMGA 4CQ9A 3PZTA 1NP2A 3MSYA 1L9WA 4UWMA 4YHGA 4DZIA 4IL2A 1VP5A 4CQDA 4GYPA 4NSBA 4KWSA 4P8WA 3LNMA 3WN6A 1E6SM 4LUYA 2FGBA 2J79A 4WSJA 4BZYA 1LZOA 1VFHA 5M1TA 3ONBA 4LF2A 3CQ0A 4MLRA 2VQUA 1W3KA 2DIJA 1W9BM 3HG2A 3S2CA 4N42A 4BQ3A 3BW4A 3UCQA 3NQAA 3AUOA 4M6PA 4Z2GA 1OD8A 4XTDA 2NQHA 4DJED 2FZBA 4Q6JA 2OEKA 1PO9A 2QCMA 3PBYA 4RDYA 2C7FA 1TPDA 2PWHA 3VUSA 4W84A 1MWOA 3VILA 3APGA 3FJ4A 1XINA 2NQ9A 3S4TA 3R2GA 1O60A 2VOTA 4B3ZA 1JYXA 4PTXA 4KWOA 3GYCA 4OECA 2XSBA 4X61A 4C6CA 1E6RA 4WKFA 2NUYA 2CBJA 4UTFA 4WQ6A 3L7RA 2BVTA 3O05A 3P60A 3PTKA 1Q6GA 3UWYA 1TV7A 1KRMA 1N82A 1HJUA 1DTNA 2C15A 1XIHA 2VD9A 1EP2A 3KZSA 4GBDA 4INFA 4ZGYA 1XWYA 5CBJA 1W9DM 5HWNA 3UXDA 1KB3A 3NQ6A 2WMFA 1Z6KA 3RU6A 3S2NA 1A5UA 1HJWA 5CPQA 3W81A 1O95A 4R5EA 4R88A 4O19A 5BU9A 2WBGA 4RUBA 5DANA 5HNNA 3KBJA 1YRRA 1HKIA 3UZJA 2XFFA 1QASA 4FHAA 1H5VA 2VFHA 3QYQA 1PUDA 3ERPA 5L9FA 4LCRA 3W87A 3URBA 1ITCA 3CV7A 4QEHA 1FWWA 3LBCA 3P14A 3MKVA 2ZTKA 3VYLA 1I2OA 1YBQA 2F84A 4L4LA 5FJTA 1WKEA 5GJMA 3DC8A 4JYFA 4JTSA 1C91A 4CNPA 3OO2A 4NT0A 2O7QA 1O5XA 2OEMA 1EC9A 4UB9A 4E8DA 4A8RA 4QHRA 3KRBA 3E2SA 4LY4A 4UTHA 3PTQA 2WNZA 2ZZ4A 4KS0A 5BOFA 4L9YA 1PX3A 1EIXA 1DJZA 1O66A 3CUXA 3PUEA 3R8HA 2YCLA 2OYMA 4DX3A 1UB3A 3LBMA 3NO5A 3U4AA 2X1TA 3OLEA 5GQBA 1OADA 4AB4A 3O63A 3DKJA 1H4PA 3ID7A 1PZ1A 2UY2A 3AHTA 1JCLA 3HMJG 4D1IA 3ZOAA 1W5NA 3GNRA 1EJWC 3ZT6A 3F03K 3ES8A 4OQVA 1R3SA 1D9EA 1GOKA 2IPFA 3PK7A 4JFUA 1ZRQA 5CJMA 3IUDA 4DPPA 1KD0A 3WL0A 3LTSA 4IX0A 5JVLA 3VDGA 3PNUA 2Z4GA 5KZDA 2G37A 1V08A 1OD0A 1HX0A 4MADA 4EAYA 2XSXA 3U2CA 2EEXA 4O15A 2QDEA 4JQ2A 5BMXA 2J8FA 2WXDM 5CZSA 1KLYA 4PFHA 3B9NA 1KM5A 2PWFA 3RILA 4JN8A 5AKQA 3T2PA 5CJ5A 1XD0A 2A0NA 2ON3A 2ZUSA 3TXZA 4F9JA 2GSJA 4MHBA 1P0KA 1VBHA 4TV5A 4GMEA 2XVPA 2DPEA 2RDUA 3UD6A 4LY8A 2PDNA 3EDJA 2ZUTA 4W85A 3G1XA 4LV9A 4NZ5A 2WVTA 2QEZA 1ODUA 5E0KA 5BROA 4GQBA 4FNUA 1GKRA 1DKWA 5I3JA 3C3UA 3G3DA 3SCVA 4XVDA 3QGAC 5D33A 3WMSA 3LMYA 2WSRA 5A6MA 2XVNA 4DUVA 3P82A 4LW7A 1VGAA 1TIWA 1PV8A 2Q3RA 3VNDA 4JYEA 1ZFJA 3G1FA 3PZ9A 1NM9A 1UPPA 2VI0A 2QPSA 3WNOA 3LCHA 4NNCA 1TZ7A 4UQCA 4W7UA 3VIPA 1ZBWA 3E0VA 2QDGA 3DG3A 4IP7A 1W9PA 4CD8A 5K4ZA 4LNYA 2KX9A 2O9OA 1TPUA 1V79A 2JF6A 4R85A 3WCZA 1RXOB 1E15A 1CEOA 5G1MA 4A3YA 2IQTA 4CNUA 1BSIA 4B3KA 3MYOA 3KHDA 1MNSA 1FCUA 4F0KA 2H8ZA 1XBXA 4LC8A 3SBFA 1HUVA 1H3GA 1IEVA 3TYUA 4IWWA 5LNRA 4RZ4A 4DJEA 1JD9A 4CQCA 1NP0A 3LSCA 2RH9A 4XD6A 1KV5A 5HMEA 5CG7A 2VRQA 4DWSC 3WNMA 2PLKA 4QR6A 2ZVIA 4GUGA 2Z26A 3AYRA 5CXPA 1T96A 5C5YA 2YGYA 3O8AA 2V6AA 3MVTA 3AMGA 1UD8A 2WVVA 1WNOA 3BAIA 4IIFA 3PZNA 4BKNA 3HGOA 3WLPA 1JUKA 1XQLA 3WDRA 1FRBA 5AYZA 5DMMA 1EHNA 4N02A 3KOXA 1TWIA 3IJ7A 1A5OC 3TLQA 3R4IA 4HNOA 3URQA 1F3XA 3THQA 1UR9A 2VVNA 3DFTA 1KCKA 4RK8A 1BQCA 1OWQA 2WZMA 5AY7A 4FOUA 3HG4A 1LL6A 4KESA 5IM51 2J13A 1BG4A 2Z1WA 3MMUA 5G4HC 1UJPA 1TVLA 4Q8QA 4C1NB 4DPQA 2OYLA 2QLYA 4GZIA 1F6YA 3DGBA 3STFA 5CPOA 3LLXA 4POCA 3A3HA 4A05A 4LRTA 5CKSA 3EPNA 4ASTA 2EPOA 2ZUWA 3BAXA 2BOFX 2A3HA 4UFMA 4O1DA 3CUFA 2OXNA 4HD5A 4L61A 2BGNE 3EB3A 4CGTA 4EPKA 5ECUA 4TMCA 1FFQA 1CB7B 4NJHA 2O92A 4HMCA 4IGSA 2R1MA 2WPGA 1E43A 3VIKA 1XS2A 2CCRA 5HXMA 4XBSA 4K1GA 4JEJA 3S8HA 4IMDA 4XIMA 3LGEA 4JCLA 1PTDA 1R3RA 2OX1A 1X1ZA 2ZX5A 3O6AA 3WK3A 2J8TA 3ZWTA 2VGBA 5BXPA 1E70M 3SO7A 2X30A 4JY8A 2WZIA 1HW6A 1A80A 1LRNA 1XM3A 3QQ0A 3RM4A 4H9VA 4S3CA 1L6WA 1X7FA 1RA5A 5A6KA 3G24A 5D2TA 3NVTA 1H62A 1KW1A 5EMKA 2XGZA 5AHLA 4KEMA 3E0IA 3H2FA 4D9PA 3CUGA 2PGRA 1B9BA 3A9BA 4OWGA 2ACQA 3UZWA 1X39A 4DYKA 4RKAA 1B9ZA 5D9PA 3THDA 3LTYA 4R7OA 3GBDA 3CTTA 4H9TA 4Q33A 3DI0A 3IIVA 4PC8A 3AHYA 4UXDA 1S2CA 2VP8A 4EX4A 2PZNA 4AZBA 1BRLA 1A5MC 3TAOA 3QOMA 4JNZA 1MMFA 3BK0A 4M1BA 1UHVA 4Y9AA 1P7TA 5BZAA 1ZCOA 1SJBA 4HU0A 1OCQA 3KCJA 1X96A 3TH6A 2E9BA 5KZ6A 3LU2A 5BOEA 2VR4A 4MZ8A 2Z1KA 4WDXA 3CZ8A 4GD0A 4IIBA 3WEOA 4AWSA 3FJLA 4PMZA 1K77A 1OC7A 3C52A 3GTHA 5CSSA 1GGOA 5JMUA 2IKHA 4JFTA 1XLDA 3BC9A 1FWTA 3CPRA 3PP7A 2OZ8A 2OCZA 4LQ1A 5BU6A 3GO2A 4IISA 3BTNA 3ITOA 1GZGA 4Q4OA 2NWRA 4NYUA 1ESWA 3WLOA 4IPLA 1QOQA 4OIFA 4RDWA 4A2RA 4AEEA 3BAKA 4FIQA 3FSTA 1KCLA 1GOXA 2ISDA 1HGWA 2WHLA 4O8AA 2PP1A 2E9MA 1UMYA 9XIMA 4AH7A 3MA8A 4IP5A 1IEXA 4L5ZA 2P0IA 3QZAA 2FYMA 3BDKA 4E5TA 2E67A 1FDJA 4L9XA 3MYPA 1RP9A 3Q37A 1ZBVA 1K03A 2CU0A 2W61A 3R25A 1RY0A 4PMUA 2X0SA 1CWYA 2YDRA 3GNXA 2NX1A 3IACA 3RITA 2VENA 3W83A 2EPKX 4LGXA 3W82A 3WDJA 4XV0A 1E72M 1DWAM 1B54A 4JIPA 4M29A 4IOTA 3VMPA 5D38A 1AD4A 4LPCA 5HNRA 4MF4A 1ZGDA 4HOZA 1FWIC 2GJXB 1OK6A 1OIMA 2GVLA 4HHMA 1SO3A 2WCAA 4UR9A 1MVYA 3GM8A 1YHTA 4J5NA 1KBLA 3OQ8A 4HTBA 3BLPX 1UWIA 1YBQB 4RZ5A 4J2PA 3VE9A 4W93A 3B4UA 3VTRA 4JTAA 4GGBA 3UF9A 2VC5A 3FVMA 4F0MA 2V81A 1Q63A 4GUHA 5FJIA 2V9DA 1UH3A 4K8HA 7XIMA 3ABOA 1S1PA 1W2PA 2FQIA 2O4QA 3AYSA 4AWEA 5A6AA 2HVOA 2OQYA 4A6GA 2ONEA 3OOQA 3PSVA 1DXEA 1E3XA 3NPXA 3CHDA 1FUYA 3E1F1 1R3VA 1YTEA 3NZ1A 4EACA 2HK0A 2YCLB 3G1VA 4RW3A 3WUGA 5DX7A 1VCVA 3RJXA 4QLKA 1Y0EA 4ERGA 1VH7A 3HGJA 4FR1A 1UKSA 4HOWA 1TJ2A 3G1DA 1DJHA 2GOUA 4GFSA 3OPSA 2DSVA 2ACRA 3HJEA 2B7OA 4K8GA 4TXEA 5HJXA 1XGEA 4BHYA 1IIGA 3GHRA 4GIYA 2DQXA 1JF6A 5T9BG 4NP7A 1R47A 3RF9A 4N9BA 2I9EA 4I8DA 4CQ8A 2OFJA 3RCMA 4YLWA 4R27A 3M47A 5C54A 1IEQA 3I65A 3CV2A 3N17A 2Y5EA 4QJ3B 3MZ2A 1V5XA 5CGMA 5D04C 4DWSD 4BEUA 4G5DA 1HVXA 4Z0JA 4REQA 4PUMA 3R0KA 2FTPA 5DRCA 2CPUA 3PAJA 2FZ9A 1LOSA 1WDRA 2V2CA 2OEJA 1CGYA 2VJXA 3RR1A 1TZ9A 2POTA 2ZE3A 3R6IA 1WE5A 1FWSA 3NO1A 1OZMA 1G9HA 4OOUA 4AY8A 2C71A 4HT3A 4WX2A 2CBIA 5D37A 2ZXAA 4MKNA 4MWAA 2VZUA 5B80A 1YXDA 1YNQA 4D6DA 1ODZA 4XQ6A 1VFTA 2CC0A 2GVJA 3GHTA 3UWVA 3KOWA 1R2TA 1UZHA 3VNLA 5C9RA 3M5XA 4GI8A 6PTDA 4IGNA 1XGZA 1KR1A 1C3FA 1EA9C 5LYRA 4O0QA 1UH4A 4PL1A 3NSMA 4MJ2A 5A6BD 2EBNA 2FFIA 4AZ7A 1L6YA 4JZ5A 2AGKA 3O3RA 2W4XA 4GH1A 4Z1AA 3E74A 3QZEA 2BY0A 5DXXA 2H90A 4B5NA 1B4EA 4ZOCA 4EF8A 1JYVA 1ZP3A 3B0VC 4XZNX 3WBXA 2Q8XA 3WELA 2VURA 4GACA 1V0NA 4XKYB 1W1ZA 1Q6QA 3M0KA 3NYZA 1V0KA 5J8LA 3AFBA 5C8BB 1CT5A 4NL1A 1E5NA 3RHGA 3CYVA 1KQYA 2V38A 4U2YA 2UWFA 2W6RA 3DGRA 1XIIA 1YPXA 5CC6A 4OOZA 3KLKA 3BW2A 4LBRA 3LHZA 4HPNA 3VDHA 1D3GA 1S38A 3C2OA 3CZKA 5KITA 1OY0A 1IWAA 1R9ZA 3ZYZA 1KM4A 3NM3A 3UEQA 3USZA 2DIKA 2PAJA 5HR7A 4LYPA 2EPMX 3GX9A 4FOKA 3WD4A 3MPGA 2NVAA 4C6NA 1Q85A 3KBNA 1JZ7A 3F4NA 2YPIA 3Q4DA 2WVVB 5BNKA 5M3WA 2ZIDA 3HIJA 4QCEA 2Q02A 1P0BA 3VE7A 3ARPA 1K9FA 4LT9A 3VGFA 1X98A 4DNMA 2IW0A 4JIEA 4X22A 3QHOA 3WBWA 5H8MA 4BI7A 1NOFA 3GQYA 3UJFA 4PTNA 1LRQA 3ZQ9A 3UWUA 4EKJA 4PULA 1FWEC 3SDOA 4W8AA 3EOOA 3TA9A 2O7SA 1XICA 1KC7A 2P5NA 1Q6RA 2GFTA 5D9OA 2NQJA 1IZCA 4HPGA 1LG1A 1QNPA 1T8XA 1DJXA 3QV8A 4DXKA 1R9YA 2JEPA 4D6HA 4C5YA 4NRRA 2OKOA 4Q7BA 1EQCA 3E5BA 3GU2A 1G1YA 2FVMA 5CPTA 4ERAA 1QXLA 5I03A 3GSMA 3ARYA 4ZFCA 1AL8A 2AQWA 2QZRA 3UNTA 3PPHA 1XL9A 3C8NA 1E6XM 2A3EA 3D3AA 4F48A 3AIWA 5AHIA 3A24A 2JALA 1UKOA 3P0XA 1QNOA 2VM8A 1TZZA 2C91A 3BG5A 5LNVA 3WQVA 5BWFA 4RE3A 4LAKA 2CLOA 1TX2A 3W1LA 2IUZA 3EWDA 3BVJA 5BWAA 1HL9A 4HNVA 2PFHA 4GVIA 1TWDA 2QUNA 3VO0A 3R43A 4GXPA 4CQBA 3WDQA 3C3NA 4GUFA 2OZTA 3WL1A 4W4QA 3GE7A 2GUBA 3LHWA 4HCLA 4S3BA 3AHVA 3OIXA 3GNPA 4AHQA 4I8YA 4C7DA 4L4PA 1TSIA 3TYDA 1CYGA 1JYWA 1JDCA 3ZR5A 2DVXA 4ATLA 4WD0A 1B3ZA 4PMYA 4ZE5A 1JGIA 1HJQA 3TIMA 1KM0A 2I5QA 3MP5A 4BJHA 3R79A 2JFEX 3LEPA 3CQHA 4XZWA 3S1WA 1JXJA 4UTJA 3THUA 4UQEA 5TAOA 4EF9A 3CAWA 4E4FA 2ZRUA 2NVDA 4DWSA 4ZXLA 3WEMA 1E9IA 5MKGA 2EKGA 4GIAA 4HGXA 3WF4A 4HA4A 3SUUA 2Z29A 3TN3A 3GDBA 3WD3A 1P7TB 1E3ZA 2WMHA 1EZWA 1T7LA 5TF0A 1QPQA 1L6GA 3W7OA 1W9XA 3QM3A 2AAAA 3L65A 2C6QA 4XZIA 2WQDA 3UA3A 1FDYA 2Y24A 3LCXA 4DIAA 2I56A 1MXSA 3AIVA 3L0KA 1V77A 3LPFA 1F07A 5A5WA 1W37A 4C1KA 4JY9A 4NJJA 3BGGA 1NH6A 2PDJA 3H70A 4O54A 3D3FA 1GPFA 3SUTA 3C2VA 3IJ9A 3T05A 1EOKA 3W7NA 3H2CA 1JDAA 2TODA 2J9XA 6CGTA 4GCAA 4O4WA 2FMNA 1TJ0A 4DO7A 5CAKA 1WDWA 3UJ2A 3DH7A 1YXCA 2CLMA 5IOBA 3OTRA 2NXHA 1VF8A 5A6BA 3TROA 3P62A 3EZ4A 3AWOA 3L68A 3IVUA 3HPFA 3P93A 3IRSA 4NAEA 1LLWA 2VC6A 4DJDA 2YL5A 4Y96A 4ADUA 2EF9A 3CS2A 3AC0A 3GU9A 1W1VA 4H04A 4AWTA 3V5CA 2Q8LA 2PDBA 1HKJA 3WJSA 1WXYA 2VZVA 2H9AA 1BSLA 4UR7A 2Z27A 4H8VA 3VDCA 2P0OA 1DP0A 4N6EA 1OFOA 3PWGA 4S3KA 5AHEA 1XKYA 3YPIA 2PDPA 3L4TA 5C2XA 3NEVA 1OBAA 4FXJA 3L9CA 3RR4A 4AHOA 2EG8A 3N25A 1Q5MA 3PFRA 3TOPA 3UCCA 3AROA 4IIEA 1Y7VA 1PKYA 1N55A 3L5MA 2VOMA 3VPLA 2CZEA 1TYGA 4DJFC 1BAGA 3OBEA 1NOUA 2CZDA 1ZJBA 1JPKA 2DFAA 1S39A 3KP0A 2HXTA 1GJWA 1NOWA 1W91A 2GVYA 3RUBL 4ENLA 1UUQA 4MYAA 3FYYA 3PS7A 2R1LA 3BSMA 3UT0A 2VX4A 3HGRA 1XLIA 5C7VA 2A79A 3CIWA 2V68A 2QCLA 3XIMA 3AXKA 1H7RA 2E4TA 4AQLA 3TX9A 3DEQA 2FIQA 5KETA 4DM2A 3VX1A 4UNKA 3SFWA 5A6TC 4DNHA 1CXFA 1RSCA 4U31A 4PMDA 4IH3A 2ABBA 1RV8A 4QP0A 1UWAA 1M68A 4IFOA 4G56A 4HPXA 4K36A 4HMEA 4MOZA 1PWLA 1DE5A 1TFVA 3S2JA 1EPVA 5TD4A 2J9YA 4QE4A 1S5NA 3EKZA 1BWKA 2QW5A 3AHXA 2A7RA 2PBGA 5EMLA 3CLMA 1FWNA 3FSUA 3ABQA 3T55A 4RNIA 3K8KA 4PR4A 2BP1A 1UKTA 1RBOB 1IQ8A 1WXJA 1IWBA 1QO2A 3P2VA 3QY6A 4W8LA 4PB3A 4R3UA 1X7IA 5FA5A 3NGJA 4Y9MA 3UVAA 2IKGA 3PVFA 1ADSA 2ZBTA 4XD4A 1ZAHA 3TQ0A 3MUXA 3MCOA 3MMDA 1A0DA 1BKSA 3KW3A 2C19A 3AS3A 5CPMA 2A3AA 4NVTA 4C6PA 4JKKA 4C90A 4NJIA 4MWAB 3TWAA 1XCWA 1JZ8A 2C0AA 2PRMA 3UFYA 1TIMA 3K1GA 2Z28A 3AJXA 4JPGA 4HU3A 1GVOA 5I5RA 2YKKA 1Q7MA 1FXQA 5FOOA 3EX4A 3V18A 3BG9A 3H7RA 3GZ3A 5FAJA 2NQLA 4AISA 4PUNA 4Z2HA 4L80A 3VFLA 4NJKA 1TELA 3F2DA 2D69A 4UMBA 2ZADA 4K38A 2NW0A 4XO7A 1SO6A 3VZXA 2OSYA 3WBAA 1EEXA 2J66A 3P81A 2P10A 4BF5A 1XISA 1VB9A 1U1JA 2VELA 4AVOA 1OYCA 4FALA 3S1XA 3KOFA 1QWKA 3M0IA 1G0CA 1GG1A 3A3XA 4O17A 1VYRA 3NXLA 2WSKA 4YYFA 5GPRA 1CTNA 3L23A 3H4GA 1O5RA 1QATA 3RMEA 3DC0A 4LVFA 5LZLA 4QS5A 1I0DA 5FSDC 2VTFA 4MYXA 5CZ0A 2GOKA 4QE1A 4IT1A 4UR8A 1CBGA 5AZ1A 3S9YA 4IHCA 1XLLA 1W3NA 4MB4A 1AFSA 3PANA 4DBEA 2V2DA 3WQEA 3UR5A 1UR2A 2VNCA 1K8CA 4NZJA 1LWJA 4P2VA 1X38A 3AU2A 3QVQA 3WLKX 3BPWA 3BSGA 3CZGA 1W31A 4NJGA 2MNRA 2WKGA 3LCIA 2HWGA 2BGSA 2HE8A 1Y5VA 5ECVA 4HTYA 4B92A 4V27A 3VOCA 1Z44A 1ZSXA 2QXWA 3SW6A 1XLJA 3TYCA 4IJBA 1S5MA 4FNRA 1DQXA 2HROA 3P5ZA 4ZEPA 2YA1A 3L2MA 4LOCA 4Z42C 3E0WA 5C7HA 3R12A 1GVIA 4TV6A 4UNIA 4O50A 1HO4A 2PI6A 4K6AA 3CUZA 1IZJA 4Q8OA 1KTNA 5LA1A 1RZMA 3R10A 2TPSA 1JZ3A 1B5TA 1CXKA 5AHMA 2BB0A 3MZNA 1WPCA 3VOGA 4Q8PA 5LHEA 5HJLA 2YZ5A 4QAIA 2I57A 2VCBA 4R7WA 5AZ0A 1FWHC 1JNEA 1BTCA 3IJ6A 1S5VA 4ML9A 4OKDA 3JZUA 1ZP4A 1CXHA 3N14A 3W1RA 2NSXA 1V93A 3WDHA 1TR1A 3RG6A 3ARVA 5HA7A 3WQ5A 3C86A 3LDVA 5FEWA 1TPC1 3T81A 2PBOA 8CGTA 1YDNA 4FR6A 4P7OA 4IIGA 3VCCA 3W02A 4CLMA 1QJWA 3DFHA 1F4HA 4OE7A 2QUVA 1K9TA 3OVGA 1UG6A 2E28A 2QGHA 3W76A 2FHCA 4GVFA 1RLCL 3WYZA 2G50A 2WHJA 2J62A 3QMTA 1XSKA 3ECQA 2JE8A 1KGWA 2X8RA 2C18A 4C6LA 2VGIA 3P6LA 1JR1A 2Q3OA 1CDGA 3CMJA 3T0TA 1HJSA 4AD5A 1XI3A 4Q8WA 3TUUA 1LBFA 1IT0A 4GXMA 4B5TA 2AGTA 4FMVA 4JCMA 1IYXA 1H7NA 4MSSA 4AX7A 3GXDA 3STEA 3CQKA 2V30A 4W5UA 3O7UA 1ITUA 3AIBA 3VC5A 3EKLA 1O68A 3EEZA 4H6QA 3LQGA 4F66A 4DJFD 1VZWA 1E71M 3DHFA 4N4PA 3E2VA 3RM9A 4MAVA 1LORA 1NQKA 3CEPA 3M0JA 4WVXA 4DM1A 5DCDA 5ABTA 1E1EA 3R8RA 1BXNA 3XINA 2E25A 3WKZA 2YCEA 3WG6A 3B40A 3EWWA 3ZZ1A 1GZJA 1VFUA 1VJSA 3O2LA 4HB7A 2RKXA 5GNYA 4LF1A 2X40A 5LNSA 1XYAA 2EQDA 4FNPA 2QUMA 5U7SA 4GINA 4ZVJA 3K2GA 4JL2A 4D8AA 1UWQA 4OZOA 5I7GA 3FDKA 1QW7A 3FJ6A 4JNMA 2P8BA 2BSLA 3TCEA 1RVGA 4G1KA 1I1WA 1KFWA 1WUFA 1IXOA 2ZOXA 3P84A 4KCUA 5ENLA 1LROA 1VFOA 2PU1A 2X1RA 3IEBA 3N6JA 3LHTA 1JF5A 3QEZA 2CHRA 4X2PA 2CLIA 2VEKA 1R5YA 2NUXA 3KVJA 2PC8A 2X7WA 1WAWA 1RD5A 4H2HA 3HPZA 2KAUC 3IGHX 2PB1A 2QCGA 3W25A 4CN6A 4L1GA 4GIRA 1KXTA 4J1OA 5FF3A 1B3VA 2OX4A 4LB3A 2OQHA 1YNYA 3F5JA 3OZMA 3CYJA 4FOJA 2H9AB 3GDMA 4XAPA 4MZYA 1PJ9A 1VCGA 2RGMA 5IDZA 4Q8VA 2Y1HA 3O9NA 1PIGA 2YFNA 1TWWA 1YDYA 3F2BA 1KXQA 4W89A 4JTDA 1C90A 4UQBA 3TXVA 1TTPA 2RDXA 3OVQA 3R8GA 4FSAA 4ML4A 1XSIA 2QJGA 1NWRA 2WW5A 1NWUA 4OBTA 2HQAA 4LEFA 3AMCA 1HZYA 3NYDA 4RPPA 2QGYA 1WAUA 2Z00A 2Z0IA 1EBHA 3LZ3A 5C9UA 4WZHA 5HULA 5JBEA 1IZKA 1RPXA 5GJPA 3W28A 1QI2A 3TONA 4W7VA 4ATWA 1R9XA 4V28A 3QMSA 4FX6M 4GH3A 1L0PA 3NCOA 3KM8A 3WMBA 2BY1A 3KTCA 2HZGA 3AOFA 3GHSA 1MQPA 3V4BA 3BMWA 4AHPA 5KSWA 5A8PA 5A2CA 2ZUNA 2FGLA 4ROPA 3B03A 3VGBA 4QM1A 1SFJA 3HA1A 2C13A 3VKBA 1OX4A 3GFZA 3GFYA 1FHDA 2HBXA 3VCRA 4US6A 2X09A 5D4YA 2ABAA 1N8WA 2PTXA 2A6LA 5I06A 1AVAA 3IWPA 3IJLA 1VJZA 4AZGA 5C2CA 3W37A 4ECLA 1W1B1 3GIPA 4DYEA 4XG1A 1FHLA 3LI1A 2QCDA 3LQLA 2IQ0A 1A5CA 3H2MA 2Q8ZA 4DXXA 1UP3A 2E09A 4ZQCA 4LUJA 2QMJA 2E7FA 3CAVA 3RX2A 5FL0A 1P48A 4Z08A 4PYSA 1TV2A 3MTWA 1TUXA 1ZU8A 4GI9A 3LUTA 4A35A 1O1HA 1XGDA 4OBSA 4BK9A 3B97A 5C2GA 1AW2A 3MBFA 1U2YA 3W74A 3SUSA 4WDTA 3PZQA 1G7UA 3MY9A 1GTEA 5EFDA 1HVQA 3STGA 2J6XA 3J7HA 2OMAA 1R38A 4LBUA 4RV8A 4I7UA 1PHQA 1XPYA 3DKLA 2DGAA 3TZFA 2W63A 4AUBA 2Y8VA 4LYKA 2POZA 5DY3A 1LLOA 4C6KA 1A3HA 3S5NA 3OEXA 1KKOA 3D46A 2I9UA 4DBDA 4YPJA 3HM7A 1AUSL 1XFCA 1ZBCA 3I3EA 3WFZA 4Q4SA 4F0HA 1EGVA 1MQRA 4C7FA 1A4LA 5IBXC 3B0UX 1E5JA 3C2RA 5A8MA 3NDYA 3ZLGA 3W27A 2XH7A 2VO5A 4ZOBA 3OW1A 4Q4PA 4M6QA 1WKYA 1V8EA 3A4XA 2ZRZA 4N0RA 4CCDA 1ZL1A 4XD5A 4IMAA 3M0VA 6XIAA 3DN5A 5EBUA 3EMQA 2VCAA 3ORWA 4JKLA 1NEYA 2XWEA 3WD1A 3UNDA 1ZTVA 3ES7A 3MMTA 2DDXA 1M5WA 5FJJA 1IF2A 4NI3A 1AA1B 2WK2A 3G1HA 1PSCA 3DFSA 2QCNA 1H2JA 1K4HA 1KM2A 4QROA 1THFD 3W72A 2HPIA 4GWEA 2ALDA 1XC4A 2XN0A 1ZENA 4H19A 1W5QA 1FA2A 3AZSA 2WMGA 1YX1A 4UTIA 5ABGA 3K8MA 3N15A 1AQMA 1MXDA 1CECA 3VIIA 3G1SA 2JGQA 2PCQA 1ML1A 3O16A 1S2VA 3DI1A 4H7VA 1NFGA 4IX2A 3TE9A 4ATDA 2PTYA 3GIYA 1U22A 4E4UA 3H26A 5FJRA 4Z17A 4HA3A 4Y9PA 3SCQA 1OF8A 3H55A 5G4WA 3FEQA 2L5HA 2XZ9A 4PL2A 3QQ1A 1M7XA 3BLIA 3CTLA 5IHRA 1BYAA 4F2TA 3F2CA 1AJZA 2FTYA 4O14A 1GONA 3DENA 1LLZA 3GC2A 2X16A 3G1RA 4DEFA 3GH4A 1E9ZB 4GY1A 1A5SA 1NQ6A 1B1YA 2J7BA 1YTKA 3I10A 4IM4A 4Q8MA 2KZHA 3T1GA 3MKKA 3WNNA 3CL6A 3C4UA 5KMYA 1H1YA 1ME7A 2E8ZA 2R6OA 1B90A 5DRIA 3CEUA 5HQLA 3SADA 1HFBA 3CNYA 3SJ3A 5G1YA 4HK5A 3V75A 2PLCA 5T91A 2JKEA 1XDLA 3AS1A 4LVGA 1Y65A 2PP0A 3NG3A 3B8DA 2VFGA 2DZPA 4JS3A 3UJRA 1UKQA 2WCSA 3FIGA 3VZYA 2HS8A 1VBGA 6REQB 1JUBA 1QI0A 4KWUA 3MUAA 3B0XA 4YXGA 3M0ZA 3WK0A 3LNPA 4FXFA 5A95A 2PA6A 2BOEX 3B9OA 2HV5A 4LWWA 1R85A 2I16A 2A4AA 2E8YA 3FGCA 3GXFA 3LHYA 5HPOA 4JTTA 2FHFA 4O1AA 3L66A 1DWIM 3QW3A 1CCWB 5FI8A 4URIA 5I09A 1J11A 1GVEA 4AW7A 3LOTA 1POJA 5CC5A 2BXZA 4E4PA 5IXEA 2JIEA 1R7AA 1HKWA 1EZ2A 4BCEA 5CSYA 2Y70A 3S5OA 1U5JA 5F4WA 1EB3A 3SY5A 4HZ8A 1U33A 3W84A 2AQVA 1QHPA 1GVQA 1MW0A 3URAA 2ZZ3A 3QZ6A 2GYIA 2PLJA 3TKFA 4ZMGA 3W7MA 2V63A 2G3JA 2DZTA 1NAL1 3IAQA 4ZQPA 4LNCA 5L6UA 4U3CA 4J3VA 2CHNA 3CWOX 1FBAA 3CPUA 3RLHA 1EFZA 2VR5A 3UXIA 4MIMA 2OELA 3LRMA 2PWVA 4L6HA 2HBVA 3W2KA 3PBUA 1OX6A 3KVLA 1LOLA 4RCXA 2YYUA 3C2FA 2XUCA 4L4OA 2D3NA 2ZUMA 3EEGA 2O56A 4WDUA 3TTOA 5HQMA 4ZR8A 3SM0A 4KIRA 4AD3A 2PURA 1OCJA 4G8TA 1Q4WA 5EMMA 3ITVA 4F2BA 1KCZA 1R3YA 1XXXA 3RPTA 2ZRYA 1Y8BA 1TUFA 3PZGA 3W7JA 3CL7A 1B3XA 1FWAC 1SSDA 3A3WA 2EPHA 4WSHA 5H1WA 5CZJA 4PCNA 3W7GA 1UW9A 2EKCA 3D6NA 3L4ZA 3AS2A 4U5KA 1E0UA 3WD2A 1XIDA 2F6UA 1FCVA 3BLDA 3E2QA 1UR8A 4KERA 1AQFA 1E0WA 1CW2A 3VVGA 1OFRA 1R8LA 1ZCCA 1EP1A 2D73A 4NQ1A 5KTLA 1XCXA 4B5VA 4MY8A 3M0XA 2YA2A 3VINA 2NXIA 2HEJA 2UY4A 1FCBA 1NDZA 3NR0A 2XU2A 3EWBX 3HJZA 4MWAE 4ZQNA 2YL8A 3WDIA 3LCLA 4PMOA 2WM0A 3LPOA 2AL2A 1W5PA 4WY0A 2W9MA 3PPCA 4DY1A 2AKZA 1FH7A 4JHMA 3GVWA 3ELFA 1IHIA 2RJHA 3G5EA 3N11A 3OBKA 4UOJA 2YSWA 3K5XA 4DB7A 2D0HA 1LWIA 1SZEA 4MPKA 5AYIA 1GVSA 1SMDA 4YMZA 1N7KA 2OSXA 4K7VA 4N7QA 4A21A 3E02A 1J2WA 1SJAA 2BHZA 2ISSA 4KH2A 3THCA 2Z7KA 1XR2A 4HHPA 1LRTA 4N9EA 4JTCA 4X9SA 3SCOA 2V3GA 5K3VA 3UPMA 2VDIA 4GZ7A 5A8QA 3O0FA 1NDYA 4F4RA 1S5WA 4GISA 4GA8A 3M6YA 5F4XA 1EL3A 5JIPA 4DZHA 1P0EA 3C8FA 3DCPA 5HOSA 3WUEA 5JH1A 1CZ1A 3PWIA 3CIXA 5AC5A 5JBDA 2DVTA 3UESA 4WIWA 2Y7GA 5HNTA 3VGHA 2V5JA 4XSLA 4HSHA 4ILSA 5I00A 1Q6LA 2EJAA 3N4FA 4MFEA 2VZTA 3DBNA 5DMYA 1OX4B 4GCXA 4P7RA 5EMJA 1LQ0A 1W9VA 3K1DA 4MVAA 3CH9A 1E40A 4GO9A 4AIUA 1DJQA 1SZRA 5K9CA 3T0DA 4Y7EA 2GJNA 2O4MA 2PC4A 3VMNA 4YTSA 1XYLA 2NQ5A 4JQ4A 1BGAA 1YPFA 2HSAA 1ZJIA 3DFQA 3BOXA 1W1IE 5TIMA 1XP3A 5LIWX 1FH8A 2WNNA 3FHAA 1LT7A 1MRAA 1QFEA 3G6MA 2PGEA 1TCDA 4WOZA 3EMCA 1E4NA 3VC6A 2W91A 3BO9A 4QX4A 3WK2A 3KXQA 3EOLA 2QCCA 4IMCA 3ZM8A 4Q8TA 3LS9A 9CGTA 3LB0A 3DYOA 4QE5A 1DIDA 1DTUA 2GSEA 3UETA 3AMDA 3KRZA 2TRSA 1I60A 2WCGA 4D2JA 4ZQMA 3DHPA 2PDYA 3CZJA 1A49A 1C8YA 3P5YA 4XVEA 2PEVA 3IJQA 4DZ5A 3QMRA 3PJTA 2YOCA 1QPNA 1PCKA 3FKKA 4LAUA 3KDOA 5I3HA 1JDEA 3FAWA 3OZPA 2WMJA 1WO2A 2ATSA 1ZS2A 1CGXA 5TNVA 3T0CA 1SFSA 4IIHA 1H7OA 4JTRA 4P7QA 2D1ZA 1UZ4A 5I2UA 4AC1X 2ATMA 4H7ZA 1VHCA 2QUUA 1M03A 1ZB5A 4O1EA 3HOJA 5BMWA 4C6OA 1GVRA 3ZSSA 3MO4A 4PB4A 3WX7A 4U5IA 4IIDA 2QULA 2DZAA 4Y9OA 1MFUA 2YCIX 1PHWA 1Q13A 5F7UA 4XSMA 3NQMA 2V0TA 1BYBA 5I3FA 1EJVC 2GDVA 1EYWA 1REQB 1VS1A