4ZFCA

Crystal structure of akr1c3 complexed with glicazide
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
315
structure length
315
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In vitro inhibition of AKR1Cs by sulphonylureas and the structural basis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldo-keto reductase family 1 member C3
total genus 118
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2015-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4zfcA00
4QBXA 3GHRA 1ZGDA 1QWKA 1SM9A 2PDFA 4PMJA 3UYIA 3BUVA 4YU1A 2FZBA 1AZ2A 1XGDA 4JIHA 1PZ1A 2WZMA 2PD5A 1ZSXA 2PDIA 1Z8AA 4WDUA 1ZQ5A 3R6IA 5M2FX 4OTKA 4JQ2A 3EB4A 2ACQA 2A79A 4WDXA 4XK2A 1HW6A 4XVEA 4YVPA 3UP8A 4IJRA 4GCAA 2IKJA 4XVDA 1Q5MA 1UR3M 2PDKA 2VDGA 2HV5A 3LBOA 2HVNA 3CMFA 1K8CA 4Q3MA 2PEVA 1Z9AA 5LIWX 4JTAA 2HE8A 3FX4A 2IPGA 5AZ1A 1FRBA 3V0UA 3GHSA 3UZXA 3LENA 4YS1A 1VP5A 1S2AA 2HDJA 4QX4A 3ERPA 1LQAA 2IS7A 3D3FA 4H8NA 2DUZA 1AFSA 3U2CA 4XZHA 4G5DA 2I16A 1Q13A 3NTYA 3M64A 3WBYA 2PZNA 2ACRA 2PDUA 4FA3A 3UG8A 2PDBA 2PDCA 4H7CA 3UZWA 1ZUAX 4JQ3A 2PDMA 3CAQA 2BP1A 4ZFCA 3MB9A 3ONBA 1C9WA 3R8GA 2PDGA 3H7UA 3WG6A 3G1RA 2P5NA 1X97A 4JTDA 2I17A 2PD9A 2WZTA 3WCZA 3LUTA 4PUWA 1S2CA 1YNQA 3UZZA 3DN5A 1EKOA 1AZ1A 3LZ5A 5AZ0A 1YNPA 2FVLA 1T40A 4F40A 4DBWA 4PR4A 3O0KA 3GHUA 2FZ8A 3M0IA 2PDLA 2HVOA 4ICCX 4EXBA 2PFHA 2FGBA 4PRRA 4JIRA 4L1WA 1RALA 4LAUA 3RX2A 2R24A 4RPQA 5KETA 4YVXA 2IKIA 4IGSA 3H4GA 4QR6A 4R9OA 3G5EA 4PRTA 5JH1A 3FJNA 1JEZA 3V35A 3CAVA 4JIIX 4GABA 4GQGA 3VXGA 1GVEA 3LD5A 3UFYA 3N2TA 4FALA 1J96A 2R9RA 3R8HA 3ONCA 4Q7BA 4HBKA 1YE4A 2PDQA 4DZ5A 4WDTA 1LWIA 3UGRA 2AGTA 4LBSA 4WRHA 2IKHA 4LAZA 4YVVA 3LEPA 1HQTA 4JTCA 1MRQA 1RY8A 5C7HA 2PDWA 4XZLX 2C91A 5HA7A 3CV7A 4XAPA 4EXAA 5LIKX 2NVDA 1IEIA 3F7JA 1A80A 3Q67A 4QXIA 2DV0A 4JTRA 2CLPA 3H7RA 1EXBA 4WDWA 3MC5A 1PYFA 1YE6A 2FZ9A 4JQAA 4GQ0A 1AH0A 2J8TA 3LZ3A 4LB3A 4XO6A 4GA8A 2ACSA 3UWEA 3GUGA 1R38A 3LQLA 2DUXA 2FZDA 1X98A 3Q65A 1VBJA 2IQ0A 4AUBA 1XJBA 3EB3A 2NVCA 1OG6A 1ADSA 5DANA 3M4HA 4ASTA 2PDHA 3RX4A 2ACUA 3BV7A 2INZA 2PDPA 4XO7A 1QRQA 5HNTA 3RX3A 4MHBA 3KRBA 4DBUA 4PUUA 2ALRA 3EAUA 4WEVX 2PDYA 2HEJA 2F2KA 3UZYA 2PF8A 4WGHA 3V0TA 4JTQA 2BGSA 4I5XA 1S1PA 1S1RA 3CV6A 4XZMX 2F38A 5LIYX 1PWMA 2INEA 1AH4A 3GHTA 2PDJA 3COTA 3BURA 4LBRA 4XZIA 3O3RA 1X96A 2IPJA 2PDXA 3C3UA 2PDNA 2IQDA 5HNUA 3V0SA 3N6QA 3BCJA 1MZRA 4FZIA 1US0A 3T42A 3R58A 3CASA 1PZ0A 1M9HA 3QKZA 1MI3A 3B3DA 5JH2A 3P2VA 2QXWA 2IKGA 2HE5A 1RY0A 3V36A 4JQ4A 4NKCA 1PWLA 4GIEA 2ISFA 3DOPA 4GACA 3R7MA 1AH3A 1EL3A 3WBXA 4IJCA 4JQ1A 4DBSA 4LB4A 1Z89A 4HMNA 3LQGA 1Z3NA 2IPWA 3WBWA 5LIXX 3R43A 1EF3A 1XF0A 4FAMA 4L1XA 3S3GA 3R94A 1IHIA 2IPFA 3LN3A 3LNMA 5LIUX 1T41A 2BGQA 4XZNX
chains in the Genus database with same CATH superfamily
3ZMRA 3AS2A 3T7VA 3KVJA 2YKKA 3WN6A 1R3RA 5A95A 2V2DA 2HSAA 3G3MA 4KBXA 1PTDA 2QCFA 1UR8A 2RHGA 1KV8A 3CPGA 4WDUA 3WUEA 2PP0A 4JBRA 3NQ7A 5M2FX 4OTKA 3OGRA 4CN4A 1C8YA 2D0FA 3M47A 4AHPA 3T81A 1OIMA 1SJAA 2UY2A 9RUBA 3LLDA 3AIQA 4QTGA 3M0MA 4PCPA 4C6CA 4C5ZA 3TR9A 4L64A 2PDKA 2VDGA 2C0HA 3QXBA 3VIGA 3CMFA 1J0HA 3CV1A 2GYIA 3AXXA 5D38A 3S83A 1EZ2A 2OX4A 4ROPA 1WDDA 3PTQA 2J8GA 4NNCA 4HJFA 3V0UA 3W26A 4ACZA 4V27A 2O7SA 3CV2A 1TTIA 4XZHA 1MZHA 3VOIA 1EIXA 1NDVA 1HKKA 4G6CA 3W24A 3BAJA 2DSUA 4HPJA 1OT1A 1MEHA 1ZY9A 2WV8A 2CYGA 3L2LA 4V28A 1WNOA 5D37A 1O5XA 7A3HA 1VLWA 1SFTA 4UB9A 3MB9A 4MDOA 5HOSA 1FA2A 5K4ZA 3LB0A 2C1HA 1ZZMA 3E6EA 3IVTA 4LY8A 5JXQA 4JTDA 4MLJA 3FOKA 4QAIA 1W8GA 3UCDA 3VX0A 4DJFC 3EMZA 1I1XA 4E38A 3FK4A 5K9DA 3G77A 5EMYA 3EWXA 3PBYA 2E40A 3IV3A 4A8LA 2X8RA 1ZJAA 2VFIA 3C4UA 3NOYA 1I2RA 4OJYA 4RLIA 2QDDA 4AB4A 5GNYA 2V30A 4UQEA 3GDRA 3BAXA 2Z2AA 2WMHA 2GGIA 3VZZA 2QJIA 4RDZA 3IWPA 3N15A 3I3EA 1XLKA 1MEIA 2Q02A 3B04A 4LS1A 5H91A 1HJXA 2WNWA 4HN8A 5FKYA 4ZO6A 3BH4A 3FV9A 3PZNA 4C6NA 4UTWA 3VO0A 4JCMA 2W79A 3SRFA 2QS8A 2ZA2A 5C6MA 2V67A 3LCGA 3ZVIA 1B3WA 1DORA 3VOGA 2ATMA 2NX9A 2OWXA 3W3OA 3S9YA 1UR4A 1TVPA 5HK4A 2D22A 4Z2JA 5I09A 4DELA 4CEUC 1DTNA 3C8FA 3WDPP 4DWSD 1GOQA 1LWIA 3ARVA 3UGRA 2IKHA 3JRKA 3MQTA 1HQTA 1UC4A 3CWNA 3IUIA 4Q6JA 3BJTA 5LHFA 4EE9A 3WDJA 1JPKA 5HA7A 3CV7A 4IQJA 4WKAA 1GZ1A 4K2SA 4X2RA 3RHGA 4P7OA 1KCZA 1LG2A 1L8PA 4KETA 3QFWA 4MWAD 1XV8A 4MJ2A 3F03K 3B9DA 5BYWA 4JTRA 1UZHA 1O1ZA 5EL1A 3MVTA 1EGZA 2CZEA 3MC5A 1VYSX 2JK2A 1VFUA 3LPGA 1O95A 3S2NA 4LYQA 3PTKA 2B0MA 1NIUA 2VC7A 1H11A 2QHAA 4PSRA 2A21A 1Q66A 2DUXA 5LNVA 3V4BA 3G2GA 1YQ2A 4F66A 1QUMA 2A7NA 3MHUA 3TAOA 2PGRA 4HNVA 4ZBCA 2BASA 3NZ1A 1GW1A 3ZSSA 1JXKA 4PMOA 1GQKA 4KGLA 2PA6A 1SZGA 3DKLA 4OECA 3RX3A 2DVXA 1KQZA 3CEUA 3W02A 3TYEA 1BF2A 3KRBA 3F5KA 2J7GA 5A6KA 3OGVA 5HMFA 1KCLA 5BW6A 3APTA 3TDFA 4GUJA 2J24A 4Q4QA 2CZDA 3DFNA 1JPMA 2I5QA 5I6SA 1J5SA 3C2VA 3CWHA 5CPOA 3OU8A 1QPKA 1FH8A 4H83A 3HQPA 4Z1BA 3LRKA 4UBPC 2XM2A 1DWJM 2J7FA 3N9KA 1RZMA 3COTA 1RH9A 1AJ2A 1F3WA 1ME8A 2X1RA 1UP0A 5C9WA 2OJPA 4BS0A 1N2VA 2WHJA 1BYCA 4OZOA 4J35A 4JTUA 1A5MC 4TTUA 3AIUA 2DJLA 2NV2A 5GJMA 3SSZA 1OX5A 3PWIA 3FGCA 3C2FA 2PCEA 4LANA 1MI3A 2CBJA 1GYLA 1X8CA 4WZHA 2NV9A 3PJXA 2ZTKA 1JRCA 1HNYA 2NUWA 3KAOA 3O05A 1TB3A 5HXMA 2JF7A 1GVSA 1ZJIA 1H7XA 3WDIA 2W92A 4C6MA 3WLMA 4AYGA 2BBFA 3B8WA 3C3NA 5G1YA 2QUNA 3PTMA 2EPNA 3R7MA 1EL3A 1LT7A 4Z42C 3R0UA 4MKNA 4C1KA 5HJYA 3SM0A 3FJ4A 4AZHA 2V5JA 3GFYA 3DKJA 3IV8A 4ZE4A 2XTKA 2I14A 1HGYA 4HT3A 1C9DA 4ZSTA 4Q8VA 2Y0FA 1GONA 1UD4A 3C0JA 2VDHA 1IHIA 1MYRA 4I9TA 5D8ZA 1H41A 3LN3A 3T05A 1GOKA 8XIMA 2RJHA 4JFSA 3WQWA 2O9PA 5KTLA 1EP3A 4DN1A 4H8UA 4ZEPA 5FEXA 3OVRA 2B7QA 1AK5A 2WQPA 3RLHA 3W7KA 2KX9A 3ARSA 3FEQA 2PGFA 4KCTA 3W2MA 5CGQA 3HTWA 1HVQA 2ZUNA 1XD1A 1E0TA 1R87A 4W84A 3E0VA 4L65A 1ZLPA 4DJEA 1QK2A 4O1EA 1Q5MA 3D0CA 4IISA 3MTWA 4JIQA 2DVTA 4W87A 1TR1A 2A85A 1F6YA 4EF9A 1I0BA 2E8YA 1L6WA 2BV9A 1F3XA 3MCNA 4KGJA 1J8VA 3EWYA 4F79A 1GK8A 4YS1A 4GJ1A 1CGYA 2WB5A 4C7FA 3EDEA 3QC0A 1I1WA 3MMWA 5CSRA 2ZE3A 3ARQA 5H8MA 2YDSA 3WD4A 4NZFA 4E6MA 1FBAA 1VFSA 2XIBA 2PDMA 2XH0A 3UBPC 4OKDA 3NM1A 1FH7A 1JUKA 3P67A 3NO5A 4H4IA 3NVTA 3MANA 5I3KA 4GX8A 1SFLA 2ZCGA 3N2MA 5ECUA 4X3ZA 3L4YA 4UCGA 3H2OA 2P5NA 1XHGA 1GVFA 4N2YA 1EO5A 1FWGC 3DBPA 2ZA1A 3NA8A 1JCMP 3PNZA 4OUIA 1F4HA 4PUMA 4P8WA 4XUGA 5A8QA 2A6LA 1B31A 1OBAA 4CNNA 1OGBA 3M0XA 1EP2A 4L9YA 3VIIA 4C6FA 3MS8A 4AZCB 1E6XM 3SFWA 4UTLA 2BY1A 4YVXA 2HS8A 2IKIA 1C7TA 4I5RA 3UNTA 4PTDA 1WP6A 1QNRA 4J5NA 4O4VA 3L21A 4E8CA 4FIQA 2DT0A 3ABRA 1SPQA 3TSBA 2PTYA 1R3VA 2TMDA 2C71A 2QPUA 4IMFA 4NYUA 5IRPA 2J9ZA 3VILA 5ABFA 4L6HA 2YLLA 3GD6A 3HZ3A 1HKVA 3A5FA 3K46A 5CPQA 3E38A 1WUFA 2CIPA 3TFCA 2AGTA 4S3BA 1V6YA 1TMLA 1WCGA 3QZ6A 2GK1A 4P7LA 4GIYA 3EA2A 4I7WA 4GVFA 1W8SA 1WKEA 3UR2A 3OG3A 3W1QA 3PZIA 2GUBA 3DC0A 3OYXA 4IQEA 1LF1A 2QQ6A 3A3XA 1Z6KA 3EEZA 3M07A 2X1SA 2FJUB 1OEPA 3WNMA 1ADDA 4WR3A 3B0PA 2E6YA 3DG3A 1SSDA 1E0UA 3B8TA 3SEPA 4AYSA 1A5LC 1AQFA 1DJWA 1XLIA 1C7SA 5A6BA 2PLKA 1V03A 5KEZA 2HRWA 3RUBL 4ZENA 3AOFA 2ZUSA 1XINA 4A8NA 2CLMA 3P3BA 4MGGA 4KIEA 3UY8A 5DY3A 1IEQA 1JF5A 3H2AA 3M9YA 2QGYA 4KFPA 1KV5A 4P7QA 2YDAA 1OABA 3LRMA 3M46A 2BVDA 4F9DA 2E67A 1H7OA 1DJGA 3C6CA 2YSWA 3WF1A 1FWFC 2WZEA 4X22A 1VIZA 3M5ZA 3VM5A 4AC1X 4AXNA 1JZ3A 1FH9A 3KXQA 3Q37A 2XYLA 2Y1HA 1MRAA 1RV8A 2PWUA 4HQVA 1T0OA 3QMRA 1EYWA 2VI0A 4NZCA 3I65A 2NXIA 2Y24A 1O1HA 4ZQMA 5BU6A 3KBWA 1POKA 1Q65A 2POZA 4GYPC 4OU1A 3GDMA 4AFYA 3EAUA 5FF3A 3N04A 3HMCA 3M16A 3VKKA 3SDOA 3H21A 3U57A 4NZ3A 2PF8A 4G9PA 3NZRA 4I5XA 2CLFA 3ARWA 1PTAA 4Q7NA 3TROA 4QEEA 1SO6A 4IF2A 1BYBA 3MUCA 2PDJA 2BY2A 3DAQA 4HU4A 2O0TA 1UMYA 4XZ9A 4W8LA 4NAEA 1VC4A 3AUJA 1BQGA 5HWMA 5AYBA 5BWAA 2QCLA 1VHCA 4PMDA 4OV9A 2VC5A 4M6VA 3OHMB 3WDQA 2EO7A 3WJWA 5BMXA 4I8YA 3E12A 1T7LA 5JH2A 2WSRA 4N7QA 3Q58A 2PGEA 5EMUA 1A53A 2HWGA 3KHDA 1E4NA 1PX3A 1CI1A 2GSEA 3GVWA 3PSWA 3RG6A 5HR7A 4Q8UA 1MXSA 3WF0A 4NXKA 5CAHA 3PBWA 2Q3RA 4AAJA 2DZPA 4A8RA 3REQB 2VT0A 3AS3A 3MO7A 1SZFA 3NYZA 4LC8A 5CSSA 1IQ8A 2FZMA 2WW5A 1E5NA 4GYKA 5G5IA 2FPTA 4JQ1A 3IVSA 4HSOA 4J28A 4LB4A 4XKYB 4NJKA 1GHRA 3B9OA 1GW9A 2XJ7A 2AMXA 4HP5A 1XPGA 4F48A 5LSMA 1NY1A 1B3ZA 1TMHA 2V68A 5AB3A 2P53A 4O11A 2DVUA 3W1NA 1IIHA 1SFJA 1E6NA 2YCKX 1WZLA 3R5EA 1B3VA 1VFMA 1QWKA 5REQB 2YFNA 3CYJA 4PMJA 3DFSA 4PFHA 3RILA 1B3OA 1HN1A 1PZ1A 1PZ2A 3K8LA 4O1AA 1EDGA 4LUYA 1MW0A 3OVGA 4ZR8A 2WMIB 5KINA 1LROA 1VJIA 3ITTA 4NVTA 5CSYA 3VKDA 1J0YA 4PEKA 1DXIA 2FHBA 4J3TA 2V3DA 1VLIA 3HA1A 1OFRA 4GCAA 1OCJA 3UQNA 3F5LA 2BXYA 1W9BM 4POCA 3MPGA 4NNBA 2HV5A 4RNFA 4E4PA 4AWSA 3EMQA 2FTYA 2OEJA 1WZMA 3RPMA 5IFTA 4Q3MA 3W74A 2HISA 1BRLB 3SZ8A 4PC8A 2ZUTA 3W6MA 3V5FA 4QS5A 3DFHA 5AZ1A 1I2NA 3UZXA 2P8CA 4IX0A 2GOUA 1L6GA 1WPCA 1XBYA 5MF5A 4UTTC 1OX4B 2HZGA 1GKPA 1T96A 3PTDA 3PZUA 2ZXBA 1H7RA 1ECEA 1GCYA 4IP7A 2H8XA 4JCLA 2DW7A 4Z2LA 1PL9A 2PDCA 3UY7A 3LBMA 3FAXA 5CZ0A 1CGXA 3N19B 1EGMA 4V1YA 2X2GA 2V3GA 2MNRA 2WKGA 3B0VC 1W9DM 4O19A 1V51A 1SW0A 3G1RA 4YWIA 2I17A 1H50A 1QW9A 1XM3A 3QYQA 1TQXA 3WMCA 2YLAA 4DJFD 4I6KA 3J7HA 3RCNA 3U0HA 3P7YA 1PIGA 4AF0A 2WNNA 3N2XA 4OBTA 2OOGA 1U5HA 1U5JA 2YPIA 3GC5A 4E5TA 1V3JA 1GQNA 3GHUA 1TO3A 4W5UA 3M0IA 3DX5A 2BMBA 5MKGA 2QJJA 1EJXC 4XTIA 2CZ5A 3URBA 1JNEA 2PFHA 4U2ZA 4H8HA 3EX6A 1DWGM 4PRRA 2WJDA 2NQJA 5ABEA 1ODUA 1A5NC 4DNMA 5CC7A 1XUUA 6XIMA 1ZBCA 3ELFA 5CPSA 3IVUA 3LCIA 1SQ7A 4EVZA 4Q8OA 5A5WA 3NEHA 2CKSA 4HNLA 2ASHA 2AMGA 1I6NA 5FEWA 3W76A 1Q3NA 3MI6A 3IUDA 1GYMA 2G50A 1UH3A 1H5YA 4ZVJA 2REQB 1S39A 1OGSA 1OZQA 4B2DA 2NLIA 4K8EA 1N8FA 4C6DA 1M7OA 3AIBA 5M1TA 3VC6A 4M7TA 2WM1A 3GYEA 3LV6A 4HU0A 1JPIA 3TSMA 2OYMA 2YCJA 3W7DA 4Z2HA 4ZXLA 7TAAA 3HG4A 1P6BA 4IL0A 1NWTA 2NQ5A 2OX1A 5A6AA 1KM2A 4PUKA 5LIKX 4O0QA 5KSWA 2XIMA 2DT1A 5CQ1A 2Q8LA 1M7JA 3QHNA 2GZXA 1M65A 3WFAA 1YNYA 2Q6ZA 1FX6A 2GJNA 4YYFA 2OQHA 2OQYA 1TYGA 1CTNA 1XR2A 1AH0A 1ENUA 2GWNA 1H09A 2J8FA 4AIEA 4ACZB 1ISXA 4JOMA 4WHBA 3Q65A 4C5YA 4BHYA 4NASA 2W91A 3W7LA 5FIPA 5DMYA 4YCOA 1V02E 1K6AA 4QG9A 2QULA 2DUAA 4ZGYA 4D6FA 3KVMA 4O8AA 4GMEA 3FNDA 1YW1A 3W01A 3IK4A 1ISWA 3FDGA 3C2YA 4PTWA 1UC5A 4LU0A 1E51A 1NTHA 4DF1A 4QJ5B 3W7CA 1VFFA 4FX8A 4KCWA 2R94A 4WGHA 3V0TA 1GNXA 3UXAA 3QV6A 2A3BA 2XIJA 5LIYX 4M24A 7REQA 2TPSA 1TCMA 2QCHA 1GQIA 5C9UA 2IPJA 4TTGA 3CMJA 2QJGA 1NWUA 1W1YA 3C3UA 1S5VA 3BCJA 2E5CA 1US0A 2G5WA 2HBVA 1I9CB 5CC6A 3GKAA 1EXPA 4ZO9A 3IGHX 4MNJA 2HE5A 3VGBA 3V36A 1OB0A 1V3HA 3ZM8A 1XLLA 2GQAA 2RAGA 2ZUWA 1VH7A 3SECA 4V33A 1VPQA 1TZ9A 3OP2A 3GSMA 4GIEA 3R1ZA 1W9VA 1KRBC 5CJMA 3RLGA 4DIAA 4L9ZA 1UKSA 4FB7A 3SGGA 4GO8A 2XVLA 1ITXA 4DBSA 3A3HA 3FLUA 1ISZA 3AYRA 2X7WA 3VX1A 3NUKA 1BKSA 3MI2A 1X38A 3DENA 3WBWA 2W3ZA 1EF3A 1SO4A 3O9NA 4HHPA 3S3GA 4TUFA 2Z24A 1FWJC 1PSCA 4S3GA 1P6CA 4F0LA 3G22A 1FUYA 4F0KA 4XZNX 1AODA 4HNTA 2Z2UA 2XVNA 1IZKA 4PMZA 4AZBA 3TJLA 3PPCA 1AZ2A 5CBIA 1XGDA 2VZSA 3I10A 1RR2A 4GNKB 5MHBA 4K68A 1B1YA 3QR3A 3BPWA 2CBUA 1IR1A 1W3JA 2VL4A 3VNYA 1AMKA 2YL5A 1W6TA 1E6QM 1K6WA 1A0EA 4ZQNA 1EBGA 3UA3A 1OD8A 2VCCA 4FLOA 1Q6QA 3NYDA 3HO8A 1TQJA 2FTPA 3SJ3A 4ZFMA 1N8IA 1TWWA 1LOSA 4UQCA 2XIQA 2AKMA 3B0YA 3FGCB 3TWBA 1Q6GA 3NPVA 4M82A 4LH8A 2ZTJA 3AMCA 4ICNA 4D2JA 3E74A 1AL8A 2XN1A 1UIOA 1TV2A 1TZ7A 2VZTA 3CIXA 4Q4RA 5F2MA 3WELA 2R91A 1Z42A 3S1UA 4LOCA 1FRBA 1FWDC 1KGWA 3LPFA 2CZVA 2DEPA 1Q6EA 4PODA 4GY7A 3EX1A 3U9IA 1ZAHA 1W31A 2XISA 3NQMA 3NTYA 2VC9A 4JFVA 2GQ8A 3MMUA 2CBVA 4KKXA 4ZQOA 2CW6A 4G2DA 2W6RA 3TN6A 4IT1A 1C9WA 4F0RA 3RF9A 1BSLA 2QDEA 4H01A 5I3HA 1EQCA 3BAIA 4FXSA 2EPLX 3ID7A 3S1XA 5F1VA 4WXZA 3WD2A 3UJFA 4GIRA 3MV01 3WQDA 1A5OC 2EBNA 3BJSA 4YTUA 1GZGA 1ONEA 3NZGA 3ZFHA 1TPB1 2Y8KA 1UD6A 6XIAA 3PBGA 4W85A 3I7SA 1B57A 1T8XA 3AHYA 3L4WA 1RUSA 1ELSA 2UWFA 1E6RA 3KTXA 3ARXA 1C90A 1FWCC 4JN7A 4JYEA 1F6PA 1WUEA 2ZX5A 3QGKC 2F6XA 5DCBA 6REQA 1XKJA 2REQA 3I68A 3CQJA 3LCXA 1JF6A 5HJLA 2J27A 2DJXA 3WJYA 3M0LA 4LALA 2AL2B 3CUIA 1CGVA 1O6IA 5JH1A 4K7VA 1TVNA 3WEMA 3UA4A 3LMYA 1X6UA 1SW7A 2E9BA 1UWUA 3LD5A 1H7NA 2GLKA 1W2PA 2ZZ5A 2Q09A 1SZNA 5E0KA 5CSUA 1JG9A 2FFIA 2R8WA 1LL4A 1PB0A 2VZVA 1VBRA 2P50A 3AWNA 4H9YA 5G4WA 3K2GA 3N12A 1HJSA 3H54A 3W71A 2PWHA 1H3GA 1B3XA 1FCQA 3B03A 4EXQA 4L61A 5AHMA 4RNIA 3GNXA 4W5ZA 5A6SA 3ITVA 1EJSC 4Y9OA 4JNMA 3L5AA 1O68A 4XD3A 2VTFA 8RUCA 5FJPA 2WVUA 3THUA 1DJIA 3N6HA 1JFXA 1XH2A 3G1HA 2V2HA 4L5ZA 4OBSA 2QAPA 5CLWA 2ZOXA 3WLKX 4CNSA 2CLIA 3PWGA 4UUIA 3AHTA 3VD3A 3F2BA 2ZX8A 3LY0A 1TWSA 3TQ0A 4B2DD 1KM4A 1XYZA 3GE7A 1XLHA 2C8NA 4GQ0A 4KWWA 3P6LA 1OX4A 1YXDA 1GTEA 3LXCA 2VWTA 1RP8A 3GIQA 1PDYA 1IGWA 2XSAA 3MSDA 3ZJ8A 1VBJA 2PTDA 3WMLA 1K9FA 2DH2A 5FJRA 3DFTA 2EJ1A 2RUSA 3DG6A 3IS4A 4PULA 1XLMA 4DBDA 5I3JA 5G1MA 4US5A 1T8QA 4D1IA 1XG4A 5EMKA 4ZOBA 3WLSA 3XISA 3VFCA 2J62A 4FI4A 3PM6A 2NX1A 3DI0A 2WKLA 4DYKA 4BF7A 4QLLA 4HTBA 2A3EA 4PCTA 3GAYA 2D2GA 1CT5A 1W0MA 3UVIA 1LJYA 2D2HA 1EPVA 2YCEA 2BWGA 4HCDA 5M3WA 2Q8ZA 1UUMA 4F0MA 1UWQA 4IJBA 1HKMA 2A3LA 3BURA 2WMFA 2WYSA 1P0BA 1R6WA 1N55A 4FX6M 1QR7A 1FWTA 4QE4A 5HNRA 1EJTC 5EBAA 3WMBA 2JBMA 5FL1A 3CZEA 4YYCA 3N3TA 2WJEA 1Z32X 1OZMA 1XSJA 4FZIA 1V6WA 3STEA 3T42A 1KBJA 2ZZ2A 3ARTA 2J79A 1DXEA 1UA7A 2YIHA 1UYQA 2E5BA 3PPFA 3LI0A 2YBVA 5LNSA 3GLCA 4Y9NA 4ZOCA 3ARUA 4BWLA 2WCSA 3GTHA 3AU6A 3GH7A 4CQDA 2QIIA 3RLVA 1HKWA 2G3NA 2ZFAA 3L23A 2JQXA 4W7WA 5C0QA 4O53A 2D1ZA 2PZ0A 2OO0A 3E2QA 2Y61A 5CZKA 2HQAA 5D33A 5I23A 4YN5A 2CLKA 3WKZA 2OZ8A 9XIMA 3A13A 4AD4A 3VDAA 4GH3A 1E72M 4PB4A 4K8HA 4HMNA 1XBVA 4D71A 1Z3NA 5DF0A 5HMEA 2GJXA 2PURA 1TE1A 3OA3A 2GL5A 5DQPA 3S2JA 1J6OA 2RDUA 4ZO7A 4J2PA 3RO8A 1GG0A 5H1WA 2GJXB 3RGTA 3RRXA 3STCA 2H9AB 1YXYA 3EX4A 1JYVA 1FHDA 2JGYA 1R7AA 3DZ1A 3DBNA 1DHKA 1V8EA 1P1XA 4FOKA 1SSGA 3GW0A 4GVGA 4JIHA 4LUSA 2OT1A 1KKRA 3CUGA 2FPYA 3S5NA 4F2BA 2X09A 3CAWA 2TAAA 3WSUA 3KRUA 3W22A 4PCNA 1BLIA 1G4PA 4D6EA 4DWSA 4QEHA 1Q8AA 2DSZA 1EBHA 1DWAM 2P8BA 2ZC1A 4M19A 4NSBA 4DLMA 2FTWA 4XISA 2PP1A 3VYLA 3M0KA 1YXCA 3NXLA 1Z9AA 2O7QA 2FVKA 2AGKA 2IUZA 3WX7A 3S47A 1MUMA 1JAEA 3W7QA 2OEKA 3K5XA 3DYMA 4YNGA 4QX4A 3USBA 3U2CA 2I16A 5I00A 2CWNA 1ML1A 3TC7A 1Q4WA 4L4MA 2VHLA 1B4EA 3SJNA 4X9SA 3OZMA 2DORA 1CNVA 4BQ4A 1D3GA 2O9RA 4AEOA 5B80A 4HPXA 4K7YA 4IXHA 2X30A 1RAKA 1R0MA 4YL2A 3SBFA 1XIBA 2ALDA 2PMQA 3CUJA 1Y0EA 4EK7A 4LSBA 5DLCA 1X97A 4RE2A 1P7TA 1LQ0A 3FCPA 4PUWA 4FX7A 1YNQA 4JGDA 2E9LA 3T07A 1RPXA 1BXBA 1OC6A 1Q6DA 1Q2SA 1OT2A 3ALGA 2ICSA 3QF0A 3T0BA 3VIHA 3WLJA 1LT8A 2PI6A 4OHQA 1U83A 1OF8A 1QU4A 4UFHA 4LS0A 2IQTA 4EXBA 4HIBA 1XLFA 1D9EA 2O4QA 2WMIA 3SCUA 2O9OA 1QFEA 2C79A 3G1XA 2YZ5A 3TW6A 3WQ4A 4JIRA 1RALA 1H7PA 1MQQA 3T8LA 4MYAA 4QITA 2C13A 5CH9A 1YPFA 2PRMA 2VXNA 3URAA 4REQA 1EZWA 2Z0IA 3N18A 1QNOA 1LLWA 1ZPTA 4GABA 4DWSC 5FI8A 1RHCA 3DFQA 4IMGA 3PP7A 1FCVA 1IEWA 4FALA 1OQFA 1OSEA 3DG7A 2MANA 5JBEA 2CITA 3THCA 3ZOAA 3L0NA 3M5VA 2Q01A 5C54A 5I24A 5F7UA 2PBGA 2ZBTA 3R79A 6ALDA 1KFBA 2J66A 3BAWA 4H7VA 5EA9A 4LVAA 1B0IA 2V6AA 3N9RA 2NLYA 2EPOA 5E6YA 1I2OA 1Q85A 2VCBA 4XZLX 5BRQA 1MW3A 1H1YA 1V4YA 3G1AA 3W28A 1XIGA 2VFFA 1DQXA 9CGTA 4HPNA 3IANA 4R33A 2FH8A 3A22A 1M68A 1NOFA 4LEFA 1GOOA 3B9AA 4Y2WA 6REQB 1EXBA 1FDJA 5A94A 4PBGA 2W66A 3W70A 4U28A 1XRTA 4WOQA 1X39A 6ENLA 3NQCA 1PCKA 2XH4A 1KXHA 4S38A 2WOQA 1BWLA 3OGSA 1BGAA 3E5PA 1R38A 3RO6A 3NL3A 1JQXA 3GB6A 2I9UA 2GPTA 4IFKB 1ZRQA 4FEZA 3TMQA 3B0UX 2J9YA 4OFCA 4DEFA 7XIMA 1U1UA 1XGEA 1JRBA 5AC7A 2ZZ4A 1E1EA 3WQOA 2D2JA 4W7UA 1E9IA 4KF1A 3NSXA 4N0RA 4EF8A 4C91A 3RX4A 1SYTA 1PV8A 3WQ5A 2GDVA 3FA3A 3A5VA 4QCFA 1QBBA 3UWWA 3BSGA 3T55A 2Z00A 4J3XA 2DW6A 2HJPA 4J3VA 2E1WA 4S3AA 2QLYA 5E6ZA 3L0GA 2UBPC 1Q6CA 3UPMA 4URIA 3TMLA 1RBAA 3WNOA 3JS3A 5C71A 5HQLA 4O10A 3KFTA 2QCMA 1FDYA 3TA9A 2BVTA 2D3LA 3GHTA 3O3RA 3KOWA 2VDIA 2YCLA 3HB9A 1T6MA 1K77A 1AW5A 1F05A 3BLIA 4AIBA 3LHYA 4S3EA 3T0AA 5DRIA 4B5NA 3HPSA 3UG3A 3GNNA 3E2VA 2XUCA 4UR8A 1UKOA 4MUPA 2J47A 2JKAA 4DJDC 2WM0A 4YLWA 4WK9A 1E43A 3NXFA 4H9XA 2V69A 4XSLA 2ZZ6A 2EJAA 4NU7A 1L6YA 2BOFX 4TX8A 1RY0A 3MY9A 3MI3A 3ITLA 3WJSA 5HWJA 4EWJA 3H2NA 4NKCA 3CM4A 1VYPX 3WYZA 1NDYA 1CXIA 1M04A 2OEMA 2ISFA 4N9CA 1GG1A 3R10A 4XIAA 1QK0A 3IIOA 5T8GA 4CCEA 2OLHA 2PWFA 2X7VA 1NP2A 3NSNA 5EY5A 4H9VA 2QVNA 1HVXA 1XYBA 1ITUA 4IPIA 4QHRA 1WZAA 4WSJA 1TVLA 3G0XA 1TWIA 4ATDA 5DBUA 3OLGA 1DE5A 3CTLA 3AHZA 3MT1A 4KFNA 5BXTA 5FESA 3F1QA 4UTKA 3P5ZA 1I2PA 3XIMA 3HQ1A 2DSWA 3FHQA 1XCXA 3UYIA 4QJ4B 2FZBA 4N9EA 3N11A 3CHEA 4CD5A 1BFNA 5T91A 4AY1A 1KM1A 1KFKA 3G24A 3K8KA 3W7IA 2YGYA 3GG0A 3U6WA 4ZA0A 4AZCA 3KVKA 4IMCA 2ACQA 2OGJA 4F0SA 4JTFA 2PWDA 2BSLA 2P1FA 2TYSA 2IKJA 4UTWC 1ZFJA 4C65A 4BY3A 1WXYA 2UY3A 3C5QA 3CBWA 3POCA 4Q7IA 2YX0A 4JYDA 4LF2A 4KRZA 1NP0A 3VI2A 3IGUA 2WJFA 4Q4PA 1HJWA 1UW9A 3L5MA 1LLZA 3S4TA 2Y63A 4ONVA 1XLBA 1CLKA 3S9IA 3ERPA 1NF7A 2IS7A 3D3FA 2DUZA 5AY7A 5XIMA 2V82A 4DHGA 2FZNA 1D3HA 3WH9A 1HL2A 2XVPA 4EOUA 4XB3A 1G1YA 1W91A 3VCCA 3W1AA 2YA1A 1TPH1 2Y4SA 3HPFA 3HGOA 4HYWA 3TLQA 1OK6A 4AD2A 2BP1A 4YHEA 2E77A 3WY1A 3KBSA 2ISVA 4DLFA 2NV1A 1YIXA 4AF0B 2A3AA 4PGLA 4MMWA 3R89A 2CHNA 1JNDA 4QQ3A 3GTIA 3LUTA 5H2ZA 3SCTA 3WQGA 2VRJA 1AZ1A 2OOFA 4HPHA 3LZ5A 1Q6LA 5LGXA 3CPUA 4PMXA 3T0DA 3CB3A 3AS1A 1S3TC 3FXGA 3W7GA 1QJWA 1XDLA 4GUGA 1MEWA 3S1GA 1XICA 1W5QA 1QPOA 2BODX 4JL1A 1VYRA 2ZWYA 4GIAA 4D6DA 4JXCA 1EPXA 4A3HA 4QDWA 4LVDA 3H23A 3IK2A 3XINA 3F2CA 3K8MA 4MNLA 1EGVA 2UY4A 3HJZA 1DYSA 2WSKA 4YPJA 3WLPA 3LDVA 2GOKA 3FJNA 4Z1YA 1SW3A 4NQ1A 1KBKA 3ITXA 2E5DA 1PBGA 3FY1A 5D2XA 3SRHA 2XGZA 4E0CA 1FVPA 2X1UA 2CZFA 4LCRA 3ALFA 1W1B1 1KFCA 3OHIA 4S3KA 1Q6OA 1V0MA 3ITGA 3MU7A 3PAJA 3TWAA 4B5WA 5DO8A 4NYYA 3R8HA 3ONCA 3L0KA 3PZ9A 4F2UA 3F4DA 3VDBA 3L67A 4P8XA 4P61A 4QRNA 1TWZA 2CBIA 5BWFA 4G7EB 4MVAA 3BO9A 1AD1A 4WDTA 2JKEA 1DE6A 4Z08A 4ZXOA 2FMOA 1QAPA 2QDHA 3QTGA 3KUMA 3SUWA 5BRBA 1FDZA 1RY8A 3RM4A 5CZJA 2G4FA 4H2HA 1J0KA 3QPEA 4IPPA 4LUTA 1E71M 1VHNA 2ZADA 3LCWA 5C2GA 3T9PA 1CW2A 3L9CA 1LG1A 1W9XA 4IPNB 1I75A 2G3MA 2X05A 1QVBA 3SUSA 2E4TA 1RQHA 3H7RA 4LXFA 4WDWA 3WLIA 1Q6RA 5CCZA 4LYKA 2FZ9A 4US6A 3ZLHA 2H8ZA 1UR9A 4HKPA 3THDA 1UR0A 2DPEA 3A9IA 4TQTA 3UWEA 3SW6A 2WVTA 3GVRA 3ZLFA 2QZRA 2FZDA 1KXTA 1K9DA 4J9JA 1W17A 3CS2A 2TSYA 3WLHA 1QBAA 4UTFA 5E9XA 1XIFA 1AL7A 5HWNA 3L66A 1I0DA 3N1AA 2HXUA 1E15A 2YW4A 2V5LA 4ASTA 4LPCA 4GPNA 4GLEA 3WBEA 4NJHA 3R12A 1QRQA 1WQ5A 2ZXQA 4AY8A 4DI8A 4XUYA 4DBUA 3S2CA 1X7FA 4KEUA 3B05A 4FXFA 4WEVX 4HGXA 1Q6FA 5DMMA 3S0CA 4IFRA 1R3YA 2GJLA 2XSXA 4L4PA 2ZUUA 1QW7A 3CUXA 2ZUMA 4QJ3B 4QLKA 2Y5EA 5GNZA 1PWMA 3E02A 1WDPA 4EIVA 1XYMA 1UUOA 2EPKX 2QNEA 3NQDA 3WF2A 1V3LA 1X96A 1G94A 2IQDA 1IF2A 5L6UA 5IM51 1K7EA 3RJYA 1CB7B 3HU7A 4Q22A 3T6CA 1XIHA 2GQ9A 4FLQA 1E0XA 4A3QA 1FCBA 3CWOX 4R85A 1R9YA 3LG3A 5IHRA 3DECA 2XU2A 3BL3A 2PLJA 4M3PA 2IKGA 3TUUA 1WA3A 4J3ZA 2R1MA 1GVYA 4GOAA 3BG3A 2WSQA 4FO4A 1TZZA 4R53A 5A69A 5AHLA 2GVYA 3CH9A 4O15A 2VFHA 4YIWA 5LKYA 2BOGX 3P5YA 2CCRA 2OB3A 4YWSA 3BDKA 3WK2A 4GACA 3RXZA 2XIIA 2WBGA 3SCOA 1WKFA 3ITYA 1TX0A 5C70A 1A4MA 1Q45A 4KESA 4NJIA 1A47A 3KWSA 4KEMA 2OT0A 1FWAC 3W82A 1EEXA 2VEKA 3T4CA 3NR0A 3WEZA 4DWSB 4HNOA 4Q33A 4XX6A 3NJ3A 3APGA 2VELA 4UCFA 4CD6A 3R0DA 1QI4A 1A3HA 4FOUA 1XLEA 1ZGDA 3S42A 1JL8A 2RDWA 1W37A 1MUCA 2J4GA 3BOFA 1MDLA 2DT2A 3QSTA 3RPDA 3M0JA 2WZMA 1G6CA 3NPWA 4AWEA 1NJJA 4K6AA 2ZQ0A 3VK5A 3BMWA 3SN4A 3O15A 4JD4A 1EJVC 1F07A 4HNUA 3AALA 1RSCA 5IBXA 4XK2A 1JIBA 4G7EA 4ZB0A 5FCZA 2YA0A 3U4FA 2GK1B 3KBNA 1PHWA 4NJGA 1V0KA 4W8AA 1VZWA 3PULA 1EYEA 2QF8A 1QI0A 3RN6A 2G96A 4J1OA 3BARA 4C6OA 1GOIA 1KRCC 5JIWA 5C5YA 2NQHA 3GU2A 4JZ5A 4MYXA 4IICA 3VD4A 3B40A 2YCLB 5LIWX 4S39A 3UWYA 4L56A 1KXQA 5U4NA 4KH2A 4DPQA 1A5SA 3A6OA 1OJXA 3QGVA 3NQVA 2XWEA 2WWCA 4YTQA 1JZ8A 4FNPA 3EOLA 1R7OA 1UP2A 4H8NA 3O6DA 3PZOA 3TQKA 3LS9A 2JGQA 1RJQA 2Y8UA 5BROA 2PUZA 5IDIA 2OMAA 4H1ZA 1RLCL 1SMDA 1OFDA 3AIRA 3M7WA 4Q8NA 3WF4A 1TUFA 4JQ3A 2QCDA 3CAQA 4ZFCA 3AZRA 3KRSA 1U1JA 1XLJA 2FGZA 4EANA 3MP5A 3OJGA 5AC4A 3W1UA 1BEUA 2V8ZA 2J13A 3E9AA 1DEDA 1W1VA 1UB3A 3KVLA 5C2CA 2DZSA 4DO5A 4XTDA 1KCKA 2G8ZA 3TC6A 3DN5A 1P7TB 1LBFA 4O0KA 3W75A 2ZKMX 5AZ0A 1YNPA 1JCNA 7REQB 3HGJA 4F40A 1KA9F 4DBWA 3DC8A 2BY3A 3AYVA 3VKBA 1ZTVA 3EWCA 3PAOA 1IXPA 4WKHA 4NNAA 2I5GA 2AOSA 4N6EA 4GC3A 5CPMA 5HR6A 1K1DA 2QPSA 2VOTA 3LK6A 1TPDA 3WD0A 1O7AA 1XLAA 3ICJA 4LAUA 4X63A 1O5QA 4WJEA 2VM8A 3W0KA 3BG9A 3GR7A 1ZBVA 4Z1AA 3H7VA 1KLZA 1JEZA 4JTSA 3TQVA 4AMAA 6TAAA 1ODZA 1A5KC 2GGEA 3H4XA 1GZJA 3VINA 1TCDA 3QJAA 4AU0A 1OFQA 4JNYA 2YJQA 3HPXA 3DYPA 4PMVA 4Q7BA 4HBKA 2VO5A 5A3HA 3W00A 2XN2A 1LDCA 1E6PA 3D47A 3S2MA 3B9NA 5BU9A 1K8XA 1UZ1A 3V18A 3TAKA 4DF0A 4UTMA 3UW6A 2MUCA 4JIEA 1ITQA 2J74A 1V3IA 1C29A 1XC4A 3P61A 2VUNA 4REQB 1M01A 1MNSA 1MMFA 3HOJA 4XWUA 4F2TA 4A05A 1DXFA 2KAUC 3DFYA 3VZXA 2DZTA 4LVBA 3H8AA 1F7BA 4KRUA 1FFQA 2G41A 4JTHA 3L2MA 2BTMA 4Y9PA 2WVVB 1E9ZB 4JFWA 4QG6A 2XGIA 3LCHA 1RP9A 4IPLA 1FWNA 2P76A 1LRNA 4QS6A 5CPTA 4CUCA 1V7AA 2LLEA 4S3JA 4F3HA 4MY9A 1GQJA 3KDNA 4M80A 3N25A 4ORMA 1VPYA 1VFOA 3M5XA 2QPXA 4PMNA 5JBFA 1R85A 3CJPA 4V1XA 3EB3A 3SRDA 5ENLA 4W9TA 3BVJA 3U7BA 1OG6A 4ZMGA 3QPYA 2NSXA 1JCJA 3G8EA 4G56A 1SJCA 4XG1A 5CPNA 3MMTA 1P0DA 1QOPA 1B90A 3CB8A 3WUGA 3TW9A 3FIGA 1NARA 2YA2A 4LRTA 4MF4A 1DJQA 5J8LA 1H0GA 4LAOA 1JQVA 5HATA 5D9PA 1GWJA 5AHNA 3PUDA 3SIZA 3OQ8A 2B7PA 3UERA 5JIPA 2P10A 5EB8A 3UXIA 2E68A 3GKFA 4NZ5A 4HOWA 5HBFA 4DF2A 4A6GA 3UYCA 4FLSA 4L6DA 2BGSA 4ZL1A 1S1PA 1V6TA 4PB3A 1IYXA 4J2MA 1Y5VA 1JULA 3UR5A 4UNLA 1GPFA 3WUBA 3W38A 3THQA 2QR6A 3EOOA 2C14A 4LBRA 4XZIA 4W4QA 1Y7VA 2PCQA 5JBDA 2Z1SA 2C1GA 3GXTA 3O6CA 1EIBA 1CXFA 4UTTA 1QNQA 1V5XA 3H55A 4CN6A 4MZ1A 2F9RA 3DUGA 1UKTA 1IT0A 3W2JA 3MHGA 3MUY1 3QRHA 1J4EA 4XAGA 3VKJA 1A5AA 1FWSA 3WFLA 7PTDA 3OBKA 3WLRA 4QLJA 1PUDA 3QLDA 3VUPA 3F5JA 1NH6A 4LCSA 2ON3A 2G4JA 4WJ8A 4EPBC 1UBSA 3H4WA 1TV3A 4HHLA 1DIOA 4U5IA 2G3JA 1ICQA 5B7ZA 2F8QA 1REQA 3QR0A 3EGJA 4DYEA 5BXPA 1VBGA 4TVDA 4IFKA 1XSKA 3CZGA 2H9AA 5T9CE 3VMNA 4O1CA 5SWUA 3LPOA 3UXKA 4HD5A 3SQMA 1X6LA 2G3IA 3TCEA 3TZFA 1R8LA 2QAFA 2BVYA 3O6YX 3T0TA 4INFA 4R3UA 1O5KA 2YBUA 3QKEA 1S3HA 2XN0A 2HK1A 4UOJA 4ICMA 4EX4A 2VQTA 2NT1A 4WX2A 5DX7A 1UIPA 3NDZA 4DJED 2C19A 4TV6A 1MFUA 4C6EA 3SUUA 4JY8A 3GG1A 3G1FA 1AW2A 3CMGA 3AYSA 4C6QA 3UR8A 1UHVA 1MUWA 1VENA 2H3BA 4BEUA 1JUEA 4JR5A 1TPUA 3AMKA 1J9YA 1PAMA 5CBBA 4XBJA 3AMLA 3GXMA 2Q71A 3GH5A 3UJ2A 3GXIA 1MFVA 2JIWA 4C6BA 1VEPA 2HVNA 1HL9A 4BQ3A 5I79A 1V02A 4O18A 4MFEA 3CZKA 2QV4A 4A4AA 3QC3A 3RM9A 6A3HA 2WZHA 3EA1A 3NGFA 3VZYA 3YPIA 2W9MA 4V15A 4ERIA 2VEPA 3IJIA 3LENA 3A3WA 3V1HA 1B3YA 1PVNA 3HG5A 1I2QA 1F8MA 3O6AA 2SFPA 1LWHA 4R88A 3NGJA 2QJHA 4WJXA 3VNLA 1JZ4A 5HAOA 3TXVA 1WOBA 4PUNA 3V1PA 2GDQA 3SY5A 2A3HA 2EGZA 3W88A 3F4WA 3EYPA 1BVWA 2BXVA 2VVNA 1ZUAX 2ZUVA 1XLGA 3KE0A 4XAYA 1UG6A 4HJWA 1V0NA 4GINA 2OSXA 4O50A 1YDNA 4WGXA 5DELA 1IGSA 1H1NA 2ABBA 2A1YA 1KM6A 1G0CA 2W27A 3QBUA 1R30A 1RQBA 2JEQA 2TODA 2NSOA 3FEMA 4NUWA 1X1OA 5AYZA 3M5YA 4IXXA 1UQYA 4MAVA 4GUIA 1EB3A 3VFLA 4A22A 3OZYA 1W3TA 1WAUA 3AQUA 3VIKA 3CZ8A 4UZSA 1UR1A 4GBDA 2FZ8A 5IXEA 3N4EA 4MAZA 4ZO8A 4IH3A 2BNJA 1UH4A 4NIRA 5U7SA 3RX2A 1MNZA 2R24A 3RCMA 4C1NA 1EHNA 3E2SA 1ME9A 3TP4A 3H4GA 2DFAA 2POTA 3HGSA 4HK5A 1KC7A 3GK0A 1IZCA 4RXFA 5GJPA 4JFTA 2OKTA 1XRSA 3NAVA 5B7YA 1WV2A 3GVVA 3AZTA 1F3TA 3IPWA 2B7NA 1CEOA 1CLVA 4GXMA 3TEVA 1JDAA 2GVEA 3DHUA 4IMDA 4IGMA 4H9UA 3UNDA 4F4RA 3Q4DA 3JU2A 4UTUA 2PC4A 3GNPA 4YCPA 5HINA 3GDBA 2Z1BA 2XH2A 4UMBA 4BI5A 1IT7A 2HPMA 2BS9A 2VEFA 1HGWA 4IIBA 1NOWA 1CIUA 3WL0A 2RGMA 4LUTB 1ZCCA 4CQ9A 1WZKA 1V3KA 2AL2A 2Z1XA 4HU8A 2OWCA 1UWAA 1EC8A 1Z48A 5DN1A 3PVFA 3NFUA 4H6RA 4MWAB 3TFXA 4ECLA 3H2CA 2HROA 1JGIA 4TVCA 2WAGA 1LQ2A 4CCDA 1KFJA 3EWWA 3HPZA 1G4TA 3EKGA 2WK2A 2GJRA 3CGTA 3W2LA 2BG5A 2CC0A 4JIPA 2EHHA 3TYCA 1Q2RA 2QCEA 2D73A 5G4HC 3ANUA 1CX9A 1W32A 3WNPA 3W73A 3IJDA 4NAFB 1V6UA 3NQ6A 3VNIA 3VU2A 3BOXA 1BWKA 3GYCA 1OCQA 3LNPA 3I3BA 1EJWC 3B4YA 2ZXDA 4JHMA 2A7RA 2INZA 2Z4GA 2PDPA 1J6PA 4XO7A 4GUHA 4ZZ9A 2WHKA 3VD9A 3O0FA 2J7BA 3OODA 2YCIX 1UH2A 1G4SA 1HG3A 4QDMA 5G2HA 5BZAA 1TV8A 1FXQA 4EPKA 5H6HA 3PR2A 3PUOA 4UQ9A 2BHYA 1Y65A 3PUGA 2INFA 2R1NA 1J11A 3WZ0E 4YTSA 1HUVA 4W89A 1LL7A 4LCQA 3W7NA 3CV6A 3R13A 4AIOA 1J12A 5CC5A 3KM8A 1TV5A 3T44A 1E0WA 1WAWA 2GSJA 5DCEA 3KBJA 1ZNNA 2OTDA 1Y8BA 3BLEA 1WDWA 3KDOA 1O94A 3GVQA 4C1NB 3AXKA 3CASA 4LNYA 1PZ0A 3H12A 3ZT6A 3MKCA 3N17A 3AIWA 2CLLA 4B3ZA 4DB7A 2A5HA 2QJMA 1W1IE 4NRSA 1HZYA 3WENA 3S8HA 2ESCA 4AZ7A 2WANA 2DSVA 3RR1A 1A49A 1HP5A 3SAZA 1AUSL 3CO8A 1LOQA 3AWOA 4HTYA 3MZNA 3DH7A 4HK7A 5E9AA 1PS9A 1IWPA 3MWAA 4M6QA 5IFPA 2GVJA 4CQBA 1TKKA 5K7JA 3VMOA 1JAKA 2PRHA 2Y70A 1TWDA 4Q4OA 5LIXX 1GEHA 4WY0F 1KM0A 1VGAA 1XF0A 1IWBA 3W87A 3EDKA 2WNZA 4JKMA 3AAMA 3UZJA 4DM1A 5DXXA 3ZJ7A 2XZ7A 4H19A 1TELA 3GXNA 4C6KA 3OVQA 2PLMA 3L4TA 4GH1A 1T41A 5TNVA 2XG9A 4JDYA 2CHOA 1WXZA 4WIWA 5D4YA 4B5VA 3PPHA 4BQ5A 1WDSA 3BUVA 2ZRYA 1Y5XA 4R7OA 2J7HA 1G69A 3PBUA 1AQHA 4IUOA 3GFZA 4FP1A 5HUOA 2A0NA 3JZUA 4J3UA 5I07A 4RCXA 8XIAA 2D23A 4Q8QA 4IIEA 1MXDA 2VGIA 2VCAA 1L8NA 3O2LA 3L4ZA 3TVAA 5CG7A 3KHJA 5FAGA 1DJYA 2J78A 4DPPA 3CIWA 5DRCA 4WY0A 3FJ6A 3IJLA 4GWEA 2FDMA 1XS2A 3T08A 1L2UA 4E3VA 3GIPA 4GYJA 4NF7A 5D9NA 1JXJA 3KL5A 3QTPA 5A6TC 4FHAA 4NX5A 3TTOA 2DIEA 4RW3A 4FR6A 2RDXA 1UROA 5GQBA 1MW2A 3T4WA 1DJHA 1XRVA 1FP8A 3AI0A 3M64A 3GTFA 4XKMA 1VKFA 3MW7A 2ONEA 1A3WA 3K13A 3UT0A 3HG2A 3EDJA 1EEPA 3KLKA 4WSHA 4IIHA 3QMSA 4MPKA 5AN7A 1GKRA 3EWBX 2G0WA 3SGUA 3G8RA 3B8SA 4GY1A 3PB2A 1ONXA 1TJ1A 4NAEB 2F2HA 3MYPA 3ZR4A 3TX9A 2WPBA 4WSKA 4IPJA 2PD9A 3VIPA 2WZTA 3WK3A 2Y7FA 3LM3A 4K1WA 2ZX7A 7TIMA 2J7CA 3M6DA 3GXDA 4PTNA 3C2RA 3BG5A 4JHZA 3P8IA 5EFDA 1T40A 3G6LA 3QY7A 4HSNA 1UKPA 4WOZA 1UWSA 1TA3A 2C3ZA 4H3DA 4PSPA 1SO5A 3HN3A 2L5HA 2V38A 4FF5A 3A12A 3RLUA 5HANA 2PDLA 1W5MA 2Q8XA 3VD5A 1PEZA 2FQIA 2Z1WA 1ZAIA 2XDFA 1M7PA 4QR6A 5AHFA 1ONRA 1KRMA 4PRTA 3VKAA 1IEXA 4A29A 1FFRA 4OE7A 4DQWA 2OSYA 1YEYA 1RQEA 3N3MA 4FMVA 2AKZA 2GJPA 3BICA 3VTRA 4UTIA 3EPOA 1BHGA 1C8VA 3ZIZA 4GX9A 1TTJA 1AQMA 3WNNA 1GYNA 1Q7ZA 1GEQA 1EC7A 4QG8A 3BLLA 2W5FA 4IX2A 5FEZA 1LUCB 4WRHA 1H61A 4Z1DA 4PBFA 4LAZA 3EOUA 3E0IA 2GUYA 5KZ6A 3O7UA 1FKWA 1SUXA 5ABTA 5F2IA 1OF6A 2PDWA 5AOUA 1W3KA 2C91A 2ZVRA 2YDQA 1UUQA 4M0XA 1JZ2A 4CQCA 1OADA 1CB2A 3OPSA 3T8QA 3APYA 1B9BA 3Q67A 1LL6A 5JU6A 3VGFA 3KOXA 3KBMA 3U8GA 1R86A 3NQ8A 4MG4A 1MQRA 4OVXA 3OIXA 4JX4A 2HPIA 5BCAA 5L9FA 1YE6A 5LNWA 4QE5A 1WOAA 3TN3A 3AYTA 2CXGA 4LB3A 2HNHA 3AJ7A 4PTVA 5A6LA 1F5ZA 1J5TA 5A6JA 1G9HA 4RNJA 1TUXA 2E7FA 1UA3A 2NVAA 4JS3A 1XYLA 3OW1A 4GI8A 3H22A 1CENA 3P82A 4H04A 4PBEA 4LY4A 1BWVA 2HK0A 4AUBA 1OCBA 2D0GA 1GHSA 4AISA 4H6KA 1NFPA 2XFRA 1ADSA 4LWWA 1PE1A 2PP3A 3POHA 3HV9A 1XIJA 2ACUA 3SUTA 1U1HA 2VVSA 1A5BA 4FXRA 4AX6A 3DGRA 3H53A 1M1BA 2Z1KA 4K1GA 1XLDA 3CIVA 4TR9A 1MDRA 1JUBA 3WQ8A 1BSIA 3W7RA 4JYFA 4E2VA 2Z28A 1TRDA 1I8JA 4DUVA 1Z69A 3BSHA 3NQAA 1TRIA 2WHLA 5GNXA 3BK0A 3P80A 2B81A 4W88A 3LXAA 4DJDA 2X0HA 5EGRA 3SURA 4R9XA 1FWIC 1F3EA 1JDEA 5TF0A 3NIYA 4HOZA 3N2BA 3EDFA 1M9HA 4M7SA 2A2IA 2Y6ZA 3NQGA 3GBEA 2H3DA 4ERGA 4L9XA 2C16A 2Y62A 3GTXA 1CWYA 3KW3A 2ABAA 3ZO9A 1CDGA 2FIQA 3BLDA 4HZ7A 5FJOA 3W4RA 3HPAA 4XSMA 2YB1A 1LTDA 1YLVA 1HXJA 1W5PA 2P0IA 4EACA 4P5UA 1B5TA 3TTSA 3GQYA 3QZEA 4XBKA 3SSJA 1B30A 4RNHA 4U31A 1OM0A 3P0WA 4Z17A 4CEXC 3W7HA 5I78A 2G3FA 3GWQA 4UTJA 4NZ1A 1BVZA 1OC5A 4CU7A 1SJDA 3AHXA 3BAKA 2YYUA 1FHLA 3C2EA 3GDLA 2CU0A 3P14A 4YMZA 2D20A 2WMGA 3FYOA 4FSAA 3T78A 3UWUA 2PPGA 1J2WA 5LA1A 3AUOA 4PB5A 3GS6A 2J7EA 3OLEA 4J40A 5DT7A 4DI9A 3NQFA 3N6JA 2PDFA 5LA2A 4YU1A 2VKZG 4YHGA 1W1TA 4N4PA 1BXCA 2BFGA 2WSYA 3BW3A 3LI1A 3GDKA 4QJ1A 4R27A 1DBTA 4CNOA 4BI6A 2PD5A 5G2IA 1P48A 2VURA 1DKWA 1EUAA 3AXIA 4CVUA 2VENA 5CEWA 3ATZA 5CGMA 1B9ZA 3RITA 3K30A 3PG9A 1JZ5A 1L2QA 3WD1A 3OTRA 3N4FA 1SGJA 5TIMA 2NWSA 4IIFA 4Z2KA 5A6MA 3TC3A 2VJXA 1D7KA 2I9EA 1UR3M 5KZDA 2DDXA 2PWGA 1FTXA 3ZS4A 2HCVA 4XBSA 3BAYA 3RK8A 2DZWA 4XAZA 2NWRA 3NZQA 2E6FA 1DIEA 5FJIA 4LAMA 4DBEA 1W3NA 4MB3A 3GHSA 3PZQA 1VP5A 1ONWA 1E4IA 3RR4A 1S2AA 4OV4A 2PGWA 3UWZA 2WC4A 2GGJA 1N7KA 1Q13A 1T5AA 4LJ3A 1GGOA 4PEEA 1FP9A 4GUFA 3O07A 4D72A 2V3EA 2OVLA 4IL2A 3B97A 3VAVA 4H7CA 4NG3A 4IIGA 4LV4A 1KGXA 3M43A 3MHFA 2WVSA 1QNPA 3AROA 2P88A 1EP1A 1WYIA 1VBHA 4KRTA 4NY2A 3CXOA 3IIZA 4MTVA 1X8FA 4B15A 1YTKA 1JZ7A 2Z1VA 2WZIA 4H6QA 1QPQA 1J2BA 2H90A 1XIEA 5K2ZA 1EKOA 1EOMA 4DUWA 3GX9A 2AAAA 1JYXA 5CPLA 2BHZA 3MP3A 1L6SA 1VR6A 1MWOA 2YDRA 3EPNA 3HV8A 3TTEA 1K02A 4I7UA 3EOEA 3FAWA 5HULA 4JNZA 3M1ZA 3AJXA 1OC7A 3P62A 5EPDA 3FVMA 2FGBA 1KTCA 1PO9A 4S2BA 2I5IA 3W9ZA 3HMJG 1DL3A 4AHQA 1LWJA 3OYZA 4RE0A 4Y8EA 3BQ5A 4MIMA 3T09A 3QVQA 4RJEA 4UFJA 2FHCA 3NURA 1BRLA 3V35A 4AMCA 3PANA 1UZDA 4C1LA 5C55A 4R5EA 4WF7A 3LA4A 1PIIA 2WC7A 2O92A 3CHCA 3EKLA 3W2NA 2E28A 2PAJA 3UVAA 5E0FA 6CGTA 5T9BG 2W0UA 4WD0A 2FLIA 4UR7A 3TYUA 1DVJA 2BGNE 3NL6A 2OG9A 3PC0A 2WCAA 4NXSA 3UJEA 1XCWA 4NHVA 4JTCA 4J3WA 1ZCOA 1NSJA 1AW1A 4HCLA 3WQEA 2JE8A 4JL2A 2DT3A 3EXTA 3P0XA 1KWKA 5BOFA 1VJSA 3MKVA 4FF7A 4O14A 1EFZA 1QNSA 4D6IA 2OWWA 2EEXA 3UGVA 3W7OA 2V5DA 1WB0A 1XXXA 1WE5A 3WK1A 4RKAA 5K4XA 3QPZA 3LU2A 4WQ6A 4TXEA 1G01A 1EQPA 4I7VA 3G0UA 1AJ0A 4XO6A 3I7RA 3FA4A 4EP8C 5D09A 5F4XA 9XIAA 4MWAC 1O4UA 3OZOA 3TN5A 3NM3A 1BG9A 3N73A 1MW1A 2NZLA 4NAFA 5A8GA 3VUSA 1XJBA 1TREA 1KFWA 2EG7A 4GZIA 2ANUA 3GZ3A 3QEZA 4HB7A 4B3KA 2R82A 2UV8G 3F4NA 2Y7EA 2PDHA 5FF2A 4CVWA 1PZ3A 3BV7A 3GAKA 3K4DA 1V77A 3EOSA 4RK8A 1P0KA 4I9AA 3QH2A 4MHBA 4Z0JA 5M5DA 4MNMA 5BMWA 3MSYA 1F9CA 4CD8A 3B8VA 1J93A 2RFGA 3DHFA 1BF6A 3HQNA 1T99A 4IUGA 4C60A 4LRSA 1LCOA 3UZYA 2ZZ7A 1SU5A 1W9PA 4PCSA 4GI6A 3EWZA 4XZMX 4HHHA 4UNKA 2E09A 2FHFA 4OOZA 1VD6A 3VMPA 4XV0A 2C6QA 1KR0A 2ATSA 3GNRA 5CBJA 1M7XA 5HNUA 2GFTA 4PL2A 5I3GA 4B91A 3P81A 3IJQA 5HNNA 2E8ZA 4ZB5A 4MWAE 5FF7A 1RLDA 1DIKA 3LMZA 2WHMA 5D2YA 4DZIA 2XIOA 1C3FA 1KD0A 2CETA 4JTTA 1ZJBA 2JALA 3HURA 3W81A 1E70M 2EG8A 1Z44A 3RPTA 3VNDA 1HIZA 3SCPA 1MVYA 3BMXA 1XL9A 1E40A 1XC6A 2NQZA 3ZZ1A 3L12A 3IAQA 2D3NA 3IIXA 2O56A 4AC7C 1R46A 4IG2B 3IARA 5AC8A 3MUXA 2QJNA 3WBXA 4MADA 3QHMA 2QUUA 3LLFA 1HJQA 3TXZA 1ZBKA 5KMYA 2AQWA 3KRZA 4W93A 1V7YA 4FNUA 1CZ1A 2WWDA 4O0ZA 5FL0A 4L7ZA 1E6SM 2NW0A 2JEPA 4H9ZA 1XCFA 1FWBC 2ISWA 1ALDA 4M81A 1E9LA 4QBXA 2FVMA 3QZAA 3EWDA 5AVHA 1Q63A 2Y8VA 2O55A 4ADSA 3ORWA 3MVIA 2NXGA 3L4UA 1BQCA 2ZIDA 1XW8A 1ZSXA 2UZ9A 1ECQA 3R25A 4WXYA 4CD4A 4UQAA 4GZEA 1ZQ5A 2QUTA 1UBPC 2YXOA 3LERA 3W25A 5C9XA 1TV4A 3LV5A 1YPXA 4IGNA 4XVEA 2QCDB 3GIYA 1XD0A 3U2ZA 2PE4A 3I4EA 3VC5A 4OOUA 1RXOB 3NL2A 2GWGA 4LS2A 1TMQA 2X1IA 3FA5A 4MZ8A 1W1PA 3WQVA 1GOWA 3LGEA 4ZB2A 3T40A 1ISVA 1HO1A 4E2DA 1KM3A 4C6JA 2DP3A 2VD9A 4HZ6A 4CCCA 3A23A 2I1OA 3UXDA 4O12A 5A8NA 4RXGA 2I57A 4AZIA 2E0PA 1ISYA 3CU2A 1EA0A 3MUZ1 5CLTA 5FEPA 3MDWA 4M29A 1SMAA 1W56A 4W86A 2QUMA 3REQA 4WUIA 4AEFA 1X1ZA 1MSSA 2GVLA 3CL6A 3FSUA 3MP4A 2BOEX 4H9TA 5BOOA 3TV8A 1TR9A 1PXGA 2NXHA 1JCXA 4G7FA 4TMCA 1YADA 3C0QA 1OIFA 3NNTA 4BI7A 3KTSA 4XZBA 3WG6A 5DMLA 5A1AA 5CZTA 2J9XA 1S2VA 4DJFA 1TTPA 3VIFA 1LBMA 3S6DA 2C0AA 5LNRA 4NJJA 1F74A 1QI2A 4U10A 3WL1A 2DY3A 4Y6GA 2OLAA 1NU5A 4D6GA 4JHOA 1K70A 5FSDC 4RV3A 1LUCA 3R11A 1DOSA 2PODA 3V7PA 2DGAA 2A7PA 2ZRWA 4QQUA 4HVXA 4L1GA 1YDYA 2V0TA 4OWGA 3CZLA 4BJHA 1VIWA 1PCWA 1GQLA 1PKNA 3TU9A 2B4GA 4PRWA 3N2OA 2O9TA 5I77A 3WH5A 3KCOA 3A4AA 2WLYA 1ESWA 4JIIX 4JN8A 4EKJA 1BTMA 3S2LA 1HF6A 1XBXA 2FJKA 3VNZA 4E4FA 3UFYA 1XUZA 1SJBA 3URQA 3M44A 1JJKA 3LTPA 4GC4A 1B4KA 4DJDD 5D2TA 2R9RA 3VGDA 4PA8A 1IZJA 1R2TA 4X60A 1H62A 3NQEA 4DZ5A 1TA3B 1UJQA 3B8DA 4DO7A 3URNA 1TG7A 4JTKA 6TIMA 5TQLA 1C8XA 2XHYA 5DXYA 2F6UA 1DTUA 3GM8A 5I02A 1YX1A 5D02A 3PZTA 1QHPA 1KTNA 4H8VA 4AD3A 4XAPA 4EXAA 3MZ2A 3DDMA 3TJXA 1ICSA 2BLEA 4FNQA 4LTSA 4ILSA 2AQVA 3CYVA 1UD5A 5I5RA 1V3MA 4GVIA 1KO0A 4ATLA 1YDOA 2Y5SA 4LW7A 1KKOA 4AZGA 1UQZA 1A3XA 2J8TA 3WLQA 4AVOA 1W5OA 3QN3A 2Z26A 1VQTA 3W29A 2C18A 4U4MA 5GVJA 4H6EA 1K4GA 3GC4A 3CK5A 3LPPA 1X98A 3I7QA 3ANVA 2WLZA 3RU6A 2FB2A 4DWDA 1WO2A 1NWSA 4EAMA 1IV8A 2D69A 3H6OA 3R8RA 1GJWA 2CXEA 1FHVA 2PS2A 8CGTA 1Y5WA 4FOJA 3WEOA 3R0KA 3HG3A 4IIDA 5E1QA 2QCGA 2VQUA 1JDCA 4KFOA 4ES4A 2EXOA 3U5YA 3I6RA 2VGBA 3OZPA 3IAPA 3E2RA 2DQXA 3PWAA 4Y96A 2IXVA 1E0VA 4X0VA 4EWND 1QHOA 1E4LA 4ZQPA 2ZDRA 3ZJKA 2ZXAA 1DWFM 4I9MA 1S1RA 5I3FA 5DBTA 2R14A 2WSPA 1ICPA 2XFFA 1XDMA 2INEA 2D24A 4CU8A 1OYCA 1X6NA 3USZA 3NSMA 1H1ZA 4BWLC 4O52A 3LSBA 4DXKA 4W8BA 3TR2A 1EDTA 2R1LA 3R4IA 1XH1A 3QQ0A 1MO0A 1TIMA 1M03A 3K1DA 3NOEA 5C9ZA 3DI1A 4A8IA 1DJNA 4UMCA 3A4WA 3CT7A 3QKZA 5IOBA 2Z7KA 1BTCA 2QW5A 4B5XA 3A21A 4C7DA 1GKQA 4F9JA 2Y5JA 4DZHA 3G3DA 1HO4A 4M1BA 1Q7MA 1NELA 4TU1A 4WKFA 4Y9MA 4LYPA 4JEJA 2ZX6A 1F2JA 3EKZA 4BQ2A 4IWWA 1EF2A 3L5LA 3RRAA 3RMEA 1H49A 3INPA 1NDZA 3ECQA 3T0CA 4GBUA 3WH8A 1BYDA 4KEZA 1KBIA 1NDWA 3W1PA 3BLKA 3KOYA 3STFA 1XIDA 4GJJA 4LNCA 1JR1A 1VS1A 4MJMA 3WMSA 1XQLA 3TOPA 3FYPA 1RD5A 2ZRUA 1QPNA 2A4AA 3LNMA 3CTTA 5ABGA 4U3AA 4UMAA 4B90A 1DV7A 1EDQA 5K9XA 4GYFA 1M3UA 2Y7DA 3VOHA 3GBDA 5FACA 4LF1A 3LXBA 4I8DA 3RYSA 3MBFA 3WQ6A 4AY7A 4X61A 4GFIA 1RA0A 4QCEA 1LRTA 1ZAJA 2NX3A 1HW6A 4JEQA 4MM1A 4YVPA 2QVHA 3SB0A 1OX6A 4IJRA 4PTXA 1SR0A 3E49A 3BZJA 2ZZ3A 5LA0A 5H8UA 4U3CA 4P7RA 1XKYA 4JN6A 1GVRA 4UQDA 3SUVA 1XH0A 1GPWA 5I7GA 2PEVA 3SY1A 2VGFA 3FFSA 4FNTA 4MUZA 5BOEA 3FX4A 1CCWB 2IPGA 4G1KA 4DXVA 2FFCA 5AFDA 3BW4A 5D2WA 3T1GA 4CU6A 4U2YA 3RAOA 3WO8A 3V5OA 3L4VA 1F8IA 2X41A 3LGGA 2GGHA 2R6OA 3WDHA 3TYDA 1AFSA 1QXLA 5A8MA 1XBZA 3E3HA 4M5PA 4TV5A 4WY0B 4UFIA 2DQWA 4RZ6A 1LYXA 1N82A 1YBQA 3P74A 1X7IA 1YBQB 1HX0A 4A35A 5A8OA 3UZWA 4R7WA 4ML4A 3VPLA 3ITOA 3IRSA 3MJYA 4ML9A 4LGXA 2E1DA 4I9JA 5C9RA 4ZQCA 1M6JA 1R3QA 1W3IA 5ABFB 1QO5A 4K3ZA 2QT3A 1A4LA 1XI3A 4QM1A 3TLLA 3UU0A 3SADA 3ZSTA 5HPCA 3CL8A 3RIKA 1D7FA 3SN0A 3NDYA 3HIJA 1OYAA 4BCEA 3ZJ6A 2FVLA 5I2UA 1QTWA 4RZ5A 3R2GA 1W54A 4PMUA 3TJIA 5A2BA 3GNDA 5I3DA 2QGHA 3CHFA 1E1FA 4V2XA 3VOCA 4E8GA 4S2CA 3VABA 1V79A 3A24A 4AEEA 1EUNA 2X16A 3GH4A 1G7VA 2GUUA 4ICCX 4Q32A 1O12A 3BLOA 1FWWA 1HP4A 4D6HA 3MJMA 4FK9A 1SO3A 4HN4A 2IMRA 3NG3A 4AZ6A 3L7RA 1E5JA 2WNQA 3MA8A 1BAGA 4S3DA 2P3ZA 5PTDA 2CWXA 1V6XA 4D8ZA 1EJRC 3THAA 5HMDA 2DZBA 1JYWA 1C93A 5LXXA 3B4UA 3JR2A 1ZB5A 3WUFA 4O1DA 3MKKA 3W6YA 3VKCA 4HYRA 2HS6A 3K1GA 3MUIA 1SZEA 3EA3A 4US5D 4UZUA 3CAKA 3BGJA 3LEPA 5CC3A 1KQYA 1OGGA 2Q3OA 3AS0A 3IJ6A 5C7HA 1RBLA 3C56A 3VVGA 5BXSA 4O13A 5I03A 2VR5A 4BZYA 4JTGA 2OPJA 4X9YA 1P6WA 2NVDA 2V5BA 4GHRA 4Q8MA 3E0FA 3QV9A 1VCGA 4O4WA 1A80A 3OA5A 1KNWA 5JQ9A 4B5TA 4MLRA 1TPC1 3TW7A 4JAWA 2F7FA 3RMJA 3T2PA 1F6KA 4MKSA 4KWOA 3VOJA 2RDTA 4PMQA 4QGCA 3U5UA 1FHUA 3ZR5A 4YTRA 4KQNA 2EPHA 2PC8A 5KZEA 3S5YA 4Y8FA 3TE9A 2PF0A 2VX6A 1W3HA 1CECA 3TTQA 4XQ6A 3DXIA 2EQDA 3LTSA 1S5MA 2IQ0A 4LVGA 4HMDA 5FJTA 5M03A 5AYIA 4TVUA 3PNUA 1MXGA 1QHZA 1XYAA 1DJXA 2NVCA 2X42A 3WIJA 3PK7A 2VGGA 4QNWA 4MOZA 3E5BA 3HF3A 2VFDA 2WPGA 3QV7A 1H7WA 4ZQRA 2FB3A 2VZUA 3UPBA 3RFAA 1C92A 1J01A 3W53A 2PU1A 3SN1A 2PDYA 2V2CA 4XD6A 4JFUA 1E56A 4PTMA 1TPVA 3WH6A 1K7XA 1OINA 2RJGA 3AICA 2O4MA 4KWVA 2F6KA 3MO4A 1L9WA 1VCVA 5LYRA 4JX5A 1D8WA 3LGDA 1CGUA 2YFOA 1KM5A 3ZT7A 3I3DA 1BVNP 4IMEA 4UOZA 1W5NA 1JCLA 3ZVHB 3KX6A 3N6QA 1PHQA 3D5HA 4RV8A 1ZU8A 3HFYA 4AZ5A 4DXXA 4LX4A 4P7NA 4O28A 1XP3A 4Z2IA 5K9CA 1C8QA 2I7GA 5MKGB 5C8BB 3STGA 3K4WA 5D30A 3QOKA 2GGGA 1PDZA 1XWYA 1YDVA 1XG3A 2BX7A 1TPEA 1OY0A 4KCVA 3ABXA 2XVKA 4PMRA 1AH3A 3BXWA 3M0ZA 3WLOA 5G1TA 4B4FA 3AXHA 2OZ3A 3CHVA 4NX0A 3DEQA 3QLLA 4FXJA 4DAIA 1IEVA 3AISA 4LYRA 4GZ7A 3ARPA 3UCCA 1GVIA 2JIEA 1M41A 4HNCA 2IPFA 4QSFA 2YBTA 3N4AA 4RE3A 1YYAA 5LIUX 3F4VA 3E96A 3PSVA 1CBGA 3QY8A 4UQBA 3LHVA 3STPA 5GJNA 4H00A 4PUJA 2DZVA 4RPPA 1E3ZA 1WDRA 3H70A 1NVMA 5CXPA 4DZAA 1R2SA 4K8GA 1Z8AA 4UFKA 1TPWA 4M6UA 3LSCA 3GU9A 1RVGA 2ZYFA 5FAJA 3WJZA 2A79A 5M17A 2OR2A 4M51A 4AG0A 1NM9A 1C91A 2E25A 3GXFA 5I0DA 2VZOA 4B9ZA 2YR1A 3ABQA 4K36A 4XVDA 7ODCA 1JCYA 1O66A 2OZ0A 1I45A 3UJRA 3V16A 5IDZA 4KS0A 3NO3A 1KCXA 2OGYA 4TMBA 1UR2A 3QOMA 5EFFA 3C86A 3NO1A 3TIMA 3VNKA 2BZNA 1U22A 1UD8A 4IMAA 4MJZA 3CO4A 3QQ1A 1FQ0A 2YXGA 3D46A 2YB4A 4BA0A 4LUIA 3GVGA 3WBAA 4FIRA 3SCRA 3SCSA 1VPXA 2PZNA 3L2IA 3KOFA 1KTBA 4UFLA 1TE6A 4UR9A 4MPQA 1UMLA 1WDQA 3IRDA 1DHPA 1G5AA 4EPDC 2OSWA 1GUVA 3ANYA 1VFHA 3ONBA 1TJPA 3ZXWA 3FJLA 4M6PA 3WQPA 5EKYA 4YTTA 3G0SA 5I3IA 3U2EA 3M41A 5EMMA 1H0IA 2JKPA 1JD7A 2QMKA 2Z2BA 3I4KA 3RCYA 4BF5A 3CQKA 3UESA 3AU2A 1NF0A 4JTEA 3AXMA 1S2CA 2G37A 3JVAA 3WLNA 4KPLA 1KFEA 4DX3A 1GJPA 3TYBA 2HVMA 4B4HA 1WBHA 2X0SA 3GW3A 1XQKA 1R9ZA 3BANA 4PR4A 2W67A 1QI5A 1P1MA 1S46A 1OHLA 2XH7A 3ZT5A 1LZOA 1FY6A 1AQ0A 4L1WA 3OIHA 4DAFA 3VGEA 4RPQA 1PYMA 5E09A 3MCOA 5H8PA 3CLMA 3E0LA 4IGSA 3RJXA 3OOQA 4R9OA 1FWEC 5CG0A 3GC2A 2XVGA 5CZSA 4HA1A 3CAVA 4LAKA 4IM4A 4NP7A 1GVEA 1IWAA 5J5RA 1EH9A 3TK7A 1S5WA 2CPUA 3W1TA 2XINA 3W1RA 3EMCA 2ODOA 3MSGA 1QI3A 5EBUA 2ZRVA 3PPGA 1VRXA 3GR8A 3UZ5A 3VIJA 8A3HA 4YVVA 4FR1A 4HZ8A 4IQDA 4ZTXA 2ZA3A 2CFFA 3SFKA 7ENLA 3IUHA 3QFEA 4UWMA 3IACA 3VIOA 3NPXA 2ZDSA 4IG2A 3QSRA 1R3SA 2J25A 4RL3A 4HCHA 4MZYA 2PTZA 3DESA 1IEIA 5EMLA 4HMEA 1LORA 3I6EA 4IGHA 3VE9A 2WCGA 4QXIA 3TONA 3OG2A 2CLPA 4HNNA 3TCSA 2X0YA 3E0WA 3MDUA 3EPMA 4NT0A 3GUGA 2Z27A 3MUAA 2FYMA 4GI4A 4TO8A 4J7RA 3VGHA 3DHDA 1IXQA 2R1KA 1J18A 4BF9A 2WBKA 2F61A 4KW2A 2JF6A 3WD3A 4PMYA 1EJUC 1P5BA 2PRLA 2E6DA 1EJ7L 1CGTA 2C1IA 3D3AA 3UXLA 2VYOA 2VEMA 1K9EA 3UG4A 2Z6IA 4L4OA 3QM3A 1W3LA 2W4XA 3PN8A 3TZNA 4G1NA 4PUUA 4O8RA 1EWEA 4GJIA 3W83A 3BW2A 5LGZA 1KXVA 3BGAA 2F2KA 3DU0A 1YTDA 2AQOA 2ZC8A 2OKOA 4A3RA 2CLEA 3NZPA 4ZE5A 5DFAA 3N14A 2OYLA 3ES8A 1CXEA 3CH0A 4PUDA 2EKGA 3VCNA 4MY8A 3Q2DA 4ERAA 1CLXA 1ME7A 3SO7A 1LRQA 3IIVA 4RZ4A 4WCJA 3O16A 1NFGA 3GG7A 2A6NA 2E9MA 2Z7GA 2X1TA 1VFTA 1UP3A 3B3DA 3CNYA 5XINA 1OFPA 5AECA 2ZWZA 2QEZA 2XWDA 3SY8A 1P4CA 5HPOA 4J27A 4HA0A 3DFPA 3W6LA 3TH6A 1KB3A 3BE7A 3S9ZA 5J04A 5DEZA 1EWDA 3HQOA 3AO0A 3WF3A 4A2RA 2GDUA 4C6LA 3ZWSA 3CUHA 1K8YA 2V3FA 2PTXA 4H9MA 3A9BA 2W61A 3GXPA 3CEPA 4C7GA 2DZXA 1V93A 3AIVA 3PB0A 5GPRA 1OCNA 3Q45A 3BC9A 3OVPA 1RJRA 1YKWA 4KEVA 5HDRA 1H60A 3WK0A 1S38A 3M6YA 3W84A 1WX0A 1XLCA 1XIIA 1TSIA 2VEGA 4DRSA 2OODA 3O1NA 3R94A 2HNEA 1NWRA 4S1FA 5A6BD 3EB2A 1B54A 3WH7A 1RCQA 5I06A 3N2CA 1M5WA 3BCFA 2P3EA 1G67A 3FSTA 2EF9A 4RX0A 1J79A 1KR1A 1B2YA 3S6OA 3NVDA 4A3YA 4AWUA 3UF9A 1RD6A 4Q4MA 4CN1A 2V81A 1EO7A 5D05A 3G1DA 3ZWTA 3WQFA 3P84A 2DU2A 1RVKA 1DQWA 4GXPA 3R6IA 3VE7A 4MFDA 1NEYA 4KWUA 1RJPA 1ADOA 1JYNA 4JTIA 3S1WA 2I56A 1VAHA 3UP8A 3V5CA 1SZRA 1JFHA 5D9MA 1HFBA 4AVNA 3UCQA 1QOXA 3AFBA 1HTIA 2ZRXA 3WNLA 1YTEA 1J0ZA 1E3XA 1OD0A 3ZYZA 4GKTA 4NILA 1US3A 3VA8A 5LZLA 1J0IA 3FXYA 3TNBA 4JTAA 1US2A 4AXKA 4MB5A 1CYGA 1H51A 3ABSA 3LYEA 3KP0A 1RBOB 1TTQA 4A2SA 3W1XA 1IIGA 3PJTA 1OFOA 3VOFA 1QMLA 3EX2A 3AIEA 2DIKA 4N9BA 1POJA 3G6MA 2BVWA 4D8LA 4G5DA 2BB0A 2J77A 3SIMA 1S2TA 1VJZA 3EX3A 2PTWA 1V6VA 1P0EA 2VUYA 1E1CB 4ADUA 4ZSUA 1WXJA 1R9XA 3BGGA 3R8GA 3N13A 1ZP4A 4Q6XA 2J7DA 4HA4A 1PJ9A 4OT7A 3W7MA 5C2XA 1Q8JA 3BSMA 1FWRA 4MDPA 1HJUA 1V08A 3UZZA 1XSIA 3PBMA 2ZVIA 3A4JA 4GG9A 3Q94A 3TYZA 1JI1A 4RR4A 2J6XA 2OCZA 2VX4A 3WJXA 3RDKA 4DVOA 3ENLA 1OFBA 5DY2A 1SVDA 3RM8A 4C6PA 1R3TA 1U33A 1KFLA 2FKPA 4TOQA 3KEHA 1XISA 2BDQA 3G1YA 3QW3A 2NUXA 4ZCWA 1SFSA 3C52A 1JI2A 3AMDA 2OYKA 2QV5A 1HJVA 2VR4A 1QO2A 4FPSA 3HBLA 3VXGA 4E2OA 4B5UA 5XIAA 1ZL1A 1JZ6A 4KWSA 1OFEA 4QFUA 3N2TA 3LTYA 1NQ6A 2CLOA 4F8XA 3CHDA 4YXGA 1FWHC 2CHRA 3M0VA 3QW4B 4KCUA 4RDYA 3VCRA 1EX1A 4M1RA 2EAWA 3OEXA 1OVDA 3L4XA 1RCXB 4JKKA 3UJSA 3MWCA 1LOLA 5IBXC 4CD7A 4NI8A 3ZLGA 3EXSA 3V75A 3ARRA 3CPRA 2PB1A 4CCZA 4D1JA 3W7JA 4JDBA 3F7JA 4RZBA 3MYOA 4Z1CA 3S46A 3BLFA 4CNPA 3RU8X 1QCWA 4ALDA 3FVDA 2OFJA 1I4NA 4P8UA 2VC6A 4N6FA 4AQLA 1DPMA 5ECVA 1YHTA 4LV9A 3LZ3A 4GE8A 4QSHA 2QCCA 4C6IA 4GI9A 2ZRZA 4GRSA 1N8WA 4WVXA 3ZVHA 2RH9A 4QE1A 1A5CA 3CT2A 4M8UA 3GTNA 4PFMA 4ATWA 1DWIM 4PZVA 3C2OA 3FDKA 5D9OA 3L65A 2HTMA 4N4QA 5REQA 1UKQA 1TIWA 1E1CA 3F4CA 2VFGA 2ALRA 2ISSA 3H24A 1VCFA 1F4AA 3ABZA 3SQLA 4PH6A 2V5KA 4GGHA 4IOTA 5E0CA 3OBAA 3H2FA 3WQCA 5BRPA 1PTGA 3PG8A 4JTQA 3GR4A 4H2CA 3QY6A 3TSDA 1K9TA 3JUGA 3S5OA 2AAMA 3TYAA 1UPMB 3FYYA 2WQDA 3SCQA 1TJ2A 1YPIA 3LHZA 1X1NA 4R7JA 2PDXA 4GZJA 3UD6A 1DP0A 3CUZA 1TFVA 2VP8A 2OELA 2PU0A 4PCFA 4S23A 2VEIA 3R58A 4E2BA 1W9UA 3QR1A 3NCOA 1GORA 3LM7A 3QV8A 3H2MA 3I6TA 2QXWA 5HMSA 1XFCA 2WC3A 1UD3A 3DCPA 1XYFA 5D04C 4JQ4A 4IQLA 5T26A 5TBOA 3G1VA 3FN9A 1O60A 3G18A 3D6NA 4P2VA 4K39A 4DUXA 1FKXA 3OQEA 1PKYA 3GZAA 2PWEA 4DUOA 1OG0A 1E55A 1XDJA 1ZHAA 3PHAA 1LLOA 2TRSA 1IT8A 2Z29A 3QMTA 3UETA 2IPWA 2XFYA 1G4EA 1YMYA 4GK8A 5CGTA 2VX7A 3TOYA 4B16A 3CZJA 1GVOA 1AMYA 2GQ3A 2CERA 4L1XA 4GFSA 1TPFA 3LHWA 3SCVA 4GQQA 1J0JA 1G7UA 2EG6A 2V5CA 3GY1A 3TN4A 4AH7A 2BGQA 1DWHM 3GHRA 5HJXA 1ZBWA 4HK6A 4HPGA 1SM9A 5AYXA 1O5RA 1V0LA 3B8IA 4DO4A 3K4AA 2ZICA 1AD4A 4LT9A 3MCMA 3C0SA 3SI9A 1VF8A 4JKLA 1PIFA 3LHTA 1QDSA 2F84A 1PPIA 3OB8A 3NWRA 4JICA 3MMDA 4JQ2A 5CJ5A 5TAOA 2J6VA 4DNH