2WVVB

Crystal structure of an alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
450
structure length
446
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAKLYRDALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-L-FUCOSIDASE
publication title Analysis of the Reaction Coordinate of Alpha-L-Fucosidases: A Combined Structural and Quantum Mechanical Approach
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 164
structure length 446
sequence length 450
ec nomenclature
pdb deposition date 2009-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2wvvB02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wvvB01
3GH5A 1EIBA 5ABFB 4ATDA 1W9DM 2UY2A 1MW1A 4AXNA 1GOQA 3K8KA 1PEZA 1TFVA 2WCSA 1DWFM 4JL1A 2QMJA 1E15A 4W5ZA 1HX0A 2WANA 4U31A 3RM4A 3LRKA 2E3ZA 3WBAA 4DM2A 1H41A 1JZ5A 3A5VA 3VUPA 3G6LA 1KR0A 3OGVA 1JYNA 1QNQA 1ISZA 2G3JA 1E3ZA 3N11A 1AQMA 4MDOA 4ACZA 2Y24A 3BGAA 2XIIA 1H3GA 2QV4A 4UQEA 2CETA 4Z2JA 2YFOA 3CZNA 3D4YA 1E6QM 1JD7A 1QX1A 3VGBA 2A3EA 2BY2A 3RMEA 3WKZA 3RILA 1VFUA 4AZIA 3N18A 1C7TA 2F7QA 1UZ1A 4S3KA 3PZ9A 1FP8A 1W1PA 1CPUA 2WCGA 2AOSA 4GXPA 3VIGA 4P8VA 5D9MA 4FF5A 5GNZA 1KR1A 2W66A 4DM1A 4AZ6A 1E6SM 2WLYA 3ARRA 4W7WA 3TTYA 1EHAA 1TCMA 3PHAA 3SCVA 1QWNA 3VD9A 5JIPA 4BCEA 2A3HA 1J0IA 1J0HA 2D0FA 2PWDA 4JL2A 5C71A 1BLIA 2G3MA 5FIPA 1E73M 3ZQ9A 3SCSA 3BMWA 1QI2A 4ZE5A 3AIVA 1E6NA 2GUYA 2WVVB 3WENA 2DSUA 4P8WA 1JYXA 3WY1A 1NARA 2EPNA 1IZJA 3CZSA 4HMCA 1AVAA 1BAGA 2F7RA 3OLGA 4GIAA 3W38A 1EOKA 1B3YA 3PZOA 1BVNP 3LPFA 1WZLA 3EDEA 5FL0A 4HU8A 3EDKA 2E9BA 1JF5A 3PZMA 4UFLA 2XVLA 1JGIA 1OT1A 1J11A 2DSKA 1WNOA 2CESA 2D23A 4GI6A 2EPMX 3TA9A 3GZAA 5M3WA 1GHRA 2YOCA 4X9YA 3CV5A 1QNOA 3GNRA 5CSUA 3SCOA 2VZSA 3VO0A 3ZMRA 3MANA 3FXYA 2WSPA 2Y8KA 4FLQA 2J4GA 4J3XA 3BXWA 1BYAA 5BRQA 2XHYA 4BS0A 1VB9A 4MNLA 1D7FA 3WIJA 2DPEA 1BYDA 3MI6A 5A8OA 2GFTA 3UR7A 2NW0A 2OW6A 4AZHA 1CXLA 1V6YA 1NQ6A 1QHPA 2EPOA 3T0DA 1B30A 2GK1A 2J7DA 1KXQA 1CGWA 5I23A 2YBTA 2GDUA 1QVBA 1L8NA 3ZO9A 2Q8XA 1CENA 5CPTA 2MANA 2XPKA 4QLJA 4W88A 2AMGA 4ZENA 4GO9A 4AZGA 2WVSA 5HDRA 1BQCA 4Z2GA 2E8ZA 3DHPA 3RPMA 3AS0A 2ZX5A 2WZHA 3L4TA 4WJXA 3N17A 5DMYA 3BCFA 1GNXA 2XYLA 3ZJKA 1JDAA 3CUJA 3K8LA 4W8AA 2WMJA 3D5HA 3SCQA 2W62A 4HA1A 3VGDA 1F4HA 3NCOA 1GPFA 3PBGA 2QF8A 3MUIA 2WKLA 1W3LA 5AC4A 4AZ5A 1E9LA 4TVCA 1C93A 2BHUA 1IV8A 4M29A 3WH6A 3BAWA 2ALWA 4PBGA 1DWGM 3E1F1 4X0NA 3VIOA 3VD7A 5HPOA 3EDDA 3OG2A 5IXEA 1XH2A 2EADA 1UUQA 4NXSA 5ECUA 1UD8A 4HPGA 1PIFA 3EJQA 1X1NA 4HZ8A 2TAAA 5GNXA 1W2PA 1PZ2A 3WDQA 3WF1A 3VX1A 1VIWA 1XYFA 3CZJA 4MJ4A 1ZBCA 3DHUA 4QAWA 5A3HA 4X0VA 3TONA 4WSKA 3TP4A 3WBEA 1OIFA 2XJ7A 1W3HA 1UR0A 1R87A 1PX3A 1G94A 1UD2A 2WMFA 4YHGA 1CNVA 1BVZA 3BVWA 3BVTA 4D6HA 3W6LA 3K1DA 2X2IA 1ZS2A 1XD0A 4PMXA 5A8PA 4D1IA 1W1YA 1WDSA 4DWSB 5E70A 2XGBA 2VQTA 5A8QA 4JFUA 1XCXA 4NRRA 2CKSA 5BWFA 2DSWA 4EKJA 1UASA 2VZTA 2X09A 3AI0A 1HP5A 5CZKA 3VU2A 2BXZA 1HKMA 1UHVA 1V6VA 1JF6A 3W53A 2O9TA 3DDGA 4P7OA 3VKKA 4BF7A 2D0GA 2GK1B 3ZIZA 3DECA 1I75A 3EJRA 3PZUA 3W4RA 4DO4A 1M03A 5AY7A 3ARXA 3WMCA 3OGRA 1EDGA 3WY4A 3T09A 2FGLA 2XVGA 4W84A 4WKHA 5CPQA 3AIBA 3GH7A 2DT2A 4D1JA 2W92A 3H54A 2RGMA 3HMCA 5I5RA 4BA0A 3MV01 3WMBA 2CHOA 4UQDA 4ATLA 4CUCA 1MQQA 3AMCA 4HA4A 3WDHA 2BVTA 9CGTA 2X05A 4CCDA 1BSIA 5D4YA 3ARTA 4C7FA 3WH9A 3MMDA 4JIEA 1VFOA 3ARQA 4WLCA 3BAKA 1KXVA 3FHQA 2ZXDA 1C8YA 4LYRA 1XH1A 1KCLA 4W85A 1FA2A 4P8UA 1FHLA 1K9TA 1C8QA 4CVWA 3DX2A 3L4VA 1CXKA 4CGTA 2D1ZA 1VEPA 2PBOA 3A4XA 3L4WA 1AQHA 5FCZA 3KLKA 4ATWA 1LL6A 3ARSA 3O6AA 4GKLA 1PS3A 1QWUA 3GXFA 2WAGA 3WDJA 3PTKA 1H4PA 3IK2A 3VGHA 4AC1X 4OBSA 2GJXA 4WSJA 3LXBA 5E6YA 4Z2KA 4OKDA 3MSGA 4N42A 3A24A 2ZXAA 4DUVA 3AHYA 3CMJA 4PCSA 3W27A 2ZUTA 1E72M 3WQ5A 1XD1A 3BC9A 4CD6A 4YPJA 4HOXA 1US3A 4CD5A 3EJUA 2YA1A 4TX8A 1SYTA 2VL4A 2G8ZA 4LX4A 3FY1A 1BPLB 3VGFA 2WMKA 5BXTA 5ABFA 2J7FA 4W7VA 5EBAA 1LG1A 1QNSA 4HA3A 5ABGA 4JFVA 1MW2A 4CN6A 3WF4A 2FE0A 2F1BA 2W67A 4LYPA 3EJPA 2J79A 1HXJA 1ISXA 5JBDA 1PPIA 4PMNA 1VJZA 1V0NA 1DEDA 2EACA 2J25A 2ZX8A 1NP0A 1JFXA 1TVNA 3DYOA 1B3VA 5AYIA 1VFFA 2FHFA 3VGGA 1EO7A 5BXRA 1EHNA 2D22A 5A6JA 3O2LA 4XV0A 1E6PA 1NP2A 2X1IA 1Q6DA 4UQAA 2VOTA 3WD4A 4FNSA 1EDTA 4OBRA 1E43A 2XIBA 3W37A 2FGZA 4AMWA 1UA3A 4E8DA 1GOWA 4MDPA 3VSVA 1XSIA 1EXPA 1Z32X 3AIRA 3BCDA 4RE2A 1U2YA 2XSBA 4QCFA 1NM9A 5EMYA 4NI3A 1W1VA 1I1WA 1FFRA 3ZT5A 3OLEA 3BVXA 1AMYA 3AHZA 3AMGA 2VR5A 1NOWA 2VZVA 3CBWA 1V3IA 1CEOA 3L4YA 3RIKA 2XTKA 3GXIA 4HMDA 2JIEA 1KTCA 4CU7A 1BFNA 2IXVA 3NYDA 2ZX7A 3B9DA 8A3HA 4DWSD 3VIPA 3CUIA 1V3MA 3EMQA 2VRKA 4PTWA 4H8UA 2ZUUA 3AIQA 1M53A 1TQUA 3AS3A 3QR3A 2YA2A 4XX6A 4PMYA 1GOOA 5AC5A 1KQZA 2ZOXA 2WVVA 1ISVA 1R75A 2VRJA 3BAXA 1JI2A 3NUKA 1BG9A 3SCUA 5CGTA 1NWRA 1QBAA 4M8UA 4Q22A 4TTGA 1V6WA 1GCYA 2IGTA 4UFMA 4W7UA 2F1AA 1SZNA 4KMQA 4FLOA 1OIMA 1RD6A 2J77A 3FAXA 3RDKA 2D3NA 4M80A 4W8BA 3U7BA 3W82A 1LL7A 1DWHM 2FDMA 3CZ8A 1E0XA 3WD0A 3AXIA 5IHSA 1MW0A 5CSYA 4P7RA 4AISA 4ZXOA 3GM8A 3W28A 1E70M 1ZJAA 3A23A 3CIVA 5A6SA 4XZWA 3AYSA 4U2YA 2WWCA 1HKJA 4PMVA 3HJEA 1HJSA 5LA1A 5JUVA 4AMCA 2QPUA 4D6JA 2EABA 1EQCA 3M07A 4P8XA 3K46A 3VINA 2YDQA 1G0CA 2WC7A 1UD4A 2E4TA 5D9PA 1KB3A 1BTCA 4M81A 3CO4A 2CBJA 2QMKA 1VEMA 2XSAA 1CWYA 4XUYA 2F61A 1UKTA 2VVNA 3N13A 1UR4A 3IJ7A 2VCBA 4U5IA 1TR1A 3QGVA 2ZXQA 1DWAM 1HJUA 1D2KA 1B1YA 3T0BA 4C7DA 3VMNA 1O7DC 1L0PA 3AFBA 2DIEA 4KRTA 1H2JA 3PZNA 1GQLA 1IZKA 1TQWA 1HTYA 1ECEA 2X0YA 2YFNA 1UWIA 3MSDA 4BQ2A 4KGLA 3T2QA 4UOJA 1CTNA 1UWTA 5HPCA 1E1FA 1WP6A 2XUCA 1UA7A 4B9ZA 1D3CA 2WWDA 1B3WA 1R47A 3S2CA 4D71A 3D3AA 2DEPA 3QOKA 3MKKA 3JUGA 2PC8A 3GBEA 1HT6A 2OSWA 1O6IA 1E4MM 4CKQA 2BY0A 3CH9A 2Y5EA 5GQBA 4UOQA 3WDRA 2XVPA 3VDAA 1RP9A 3OIHA 7CGTA 2YIHA 1DWIM 4D72A 1WZAA 5A6MA 4MNJA 3W24A 4EE9A 4AW7A 2WVTA 1XRVA 1HJXA 5I0DA 2WHMA 4LQ1A 2VO5A 3U57A 3VIIA 5I2UA 4GQQA 2ZUMA 1EO5A 3PZTA 3D50A 2F7OA 1MYRA 3QOMA 2JF6A 2YA0A 1V0MA 2DT0A 3VGEA 1PBGA 3VMPA 3HN3A 1CGTA 4J3WA 2FHCA 1BYBA 3WQ4A 1A3HA 5BROA 2J7EA 4CU8A 5C8BB 2HISA 4CCCA 4D6IA 4OOZA 3BLBA 1HIZA 4UQBA 3QHMA 3ALGA 3SUVA 1QW8A 4HMEA 3LX9A 3BAJA 4J3SA 3L4ZA 5IFPA 1UWUA 4MB3A 5IHRA 4AY1A 3DX0A 1M04A 3H55A 4DWSA 1T0OA 2J8FA 4QDMA 8CGTA 4F79A 2Y2WA 1B90A 4H7VA 3ZR5A 5JIWA 4HP5A 3AZRA 2BV9A 5A8NA 2DGAA 3PN8A 4GZIA 3J7HA 2ZX9A 1MQRA 3AZSA 3DDFA 1GONA 1W9BM 4PSRA 1WKYA 2EPLX 2YL6A 3M6DA 4CD7A 1KBKA 5A69A 1UR1A 1AQ0A 1RPKA 3L2MA 4S3JA 1B3ZA 5A1AA 1B0IA 5HOSA 1HL9A 1UD6A 1JFHA 4TVDA 1OM0A 3ZSTA 1FOBA 1CIUA 3BAYA 5A6BD 1MXGA 1XGZA 3D4ZA 1WCGA 4W87A 4M82A 4JFWA 3PTQA 3U7VA 3WH8A 4V2XA 1OD8A 3SCWA 2YJQA 1TZ7A 2VI0A 3KE0A 1Q6CA 4IUGA 1QI5A 4FNPA 2D2OA 1OT2A 1FH7A 1JZ4A 2G3IA 2OYLA 1KGWA 2BXYA 3VOCA 1KCKA 4L4OA 1CZ1A 1LQ0A 3VSTA 3AIWA 1DTUA 3IJ9A 2Z1SA 3HG2A 2IXUA 2G41A 3ECQA 1MWOA 3CUFA 2V3FA 3N9KA 3SCTA 3TTOA 2OSXA 4Y7EA 4AIEA 7TAAA 4U5KA 1W9PA 4UTFA 2GDVA 1V3HA 3KZSA 1KWKA 1EOMA 3M7SA 1OBAA 3AMLA 4HOWA 1HJWA 2CCRA 2B31A 3TOPA 1E1EA 1X6NA 3OZPA 3ZJ7A 1GOMA 1J0YA 3FW6A 2J8GA 3BUDA 2F18A 3SEPA 1KXHA 1C92A 3OBAA 2XWDA 4DUWA 3RO8A 2XM1A 3B8SA 3OZOA 2J78A 3NDZA 5M5DA 1R33A 1H1NA 3MUAA 5JBFA 1GQJA 3POHA 5HNNA 2VZUA 2ZWYA 3W25A 2OWXA 4PMQA 3ZT6A 3GBDA 3NJ3A 2WZEA 1ZJBA 2O9RA 1CBGA 4UQCA 4H8HA 4D6FA 1E4IA 1ITCA 2W61A 2V3GA 1VF8A 3PZQA 3UERA 1QI3A 4J3UA 3UG3A 5A2BA 3AISA 1CGYA 1JXKA 3AZTA 1GVIA 2WB5A 4H2CA 1WZKA 4V27A 2W4XA 4H04A 5I24A 1UH2A 2OYMA 4IISA 3I3BA 4XB3A 2V5DA 3WD2A 1A47A 4ZE4A 1K9EA 5BXSA 1UWSA 1VBUA 1WDQA 2VC9A 3SCNA 3AICA 4HOZA 3A4WA 1W1TA 1CXFA 4UOZA 1E6ZA 4Z2IA 4PUDA 1HF6A 3WEOA 2DIJA 5BXPA 4EAMA 3EJSA 4ACYA 1R46A 3GXTA 3AMDA 2YKKA 6A3HA 3WD3A 3LXCA 3SURA 3U5UA 5CGMA 4EANA 5E09A 5DT7A 3BAIA 3DX1A 4M24A 4NSBA 3MO4A 1Q4NX 2Z1KA 1H11A 3FHAA 1UKPA 1QI4A 5AYBA 3K4AA 2UY4A 1QW9A 2WZIA 2DT1A 2ZX6A 2UY3A 1LJYA 4JCMA 1CLXA 3MS8A 3A47A 1MFVA 3GXDA 3VIKA 4Z2LA 2ZUWA 4OIFA 3HU7A 3NIYA 1UR8A 1V02A 1JXJA 1R7AA 3WF0A 1US2A 4NXKA 4Q7NA 3NDYA 2XN2A 4NX0A 4MB4A 5GNYA 1ODZA 1OGBA 3SCPA 1UQYA 4GZEA 4AEEA 1GZJA 1OGGA 5A2CA 1NWTA 5FL1A 5E0CA 3BUPA 2XM2A 1UKOA 3BSGA 1XC6A 2VNCA 1CXHA 1NH6A 4CN1A 3CHEA 3LRLA 2O9OA 3CTTA 1JZ3A 1W9VA 4PYSA 1JI1A 3CGTA 4H8VA 2DQXA 3EMCA 4K68A 1Y7VA 4GI9A 2J62A 4N0RA 2WHKA 3LMYA 3BUQA 5A6AA 3VILA 4B3LA 1V3JA 3WUFA 3G6MA 4AD3A 2DH3A 1EH9A 3RM9A 4MB1A 4W89A 4W8LA 3KL0A 2F8QA 4WIWA 1J12A 1MVYA 2WHLA 5ABHA 2WCAA 4TUFA 1V3LA 1GQKA 1E55A 5EFDA 3BH4A 3UG5A 2BHYA 4AIOA 2Y8VA 5ABEA 1ESWA 5BCAA 3ARWA 4HU0A 1I1XA 1HVQA 4AZBA 2FYVA 3PZIA 4AD1A 5CLWA 2XN1A 1LG2A 4B9YA 4JKMA 1V02E 2G3NA 1UWRA 5DFAA 1JZ2A 3AHTA 2DSZA 3MMWA 1E5JA 5HXMA 2CHNA 2X2JA 2ZUNA 1JZ7A 3AS1A 1P6WA 4DO6A 1OD0A 1PX4A 3DYPA 3WNOA 3DX4A 4OGZA 3F5JA 1FHDA 1QHOA 2FH6A 2X2YA 3ZJ6A 2JALA 1W9UA 1CGUA 4JFTA 3O9NA 4DO5A 2J74A 2VX5A 1U33A 1HKIA 5DO8A 1NOFA 1CECA 4AD0A 3UG4A 4R5EA 4E2OA 1O7AA 4M1RA 4URIA 2VX7A 2JFEX 1HJQA 1VRXA 4AZ7A 3AIEA 1TQVA 4DWSC 3NSXA 2UWFA 1R8LA 4UFJA 1FFQA 3EBVA 3VNYA 1J0JA 3ARYA 1NWSA 4OZOA 2YL5A 4BQ4A 3BUBA 2CNCA 1FP9A 4FNTA 2VRQA 2CBIA 2JIWA 1OINA 1EGZA 3OB8A 5BRPA 5I6SA 4HZ7A 1B3XA 1ISWA 1H09A 6TAAA 2C0HA 1J9YA 4PTVA 1TVPA 1Q6GA 2YDSA 4LPCA 3CMGA 1CXIA 1QOXA 3WFZA 1XV8A 5CJ5A 2O9PA 5KEZA 2BVDA 3APGA 2VQUA 2XFRA 2V3DA 3AJ7A 4UCFA 1ZBVA 5C70A 1KGXA 2ZUVA 3II1A 2YDRA 1LL4A 5F7UA 3HZ3A 3WY2A 1B31A 1Q6FA 1E6RA 3AHVA 3B9AA 4D6EA 2ZWZA 2WKGA 2E8YA 3HG3A 4U3AA 4LYQA 3KEHA 3WH7A 1HWWA 2WC3A 1KBBA 1KWGA 3F5LA 3WF3A 3ZSSA 2D73A 5TD4A 5DEZA 1JDDA 3GNOA 3KWXA 3L4UA 5A8MA 1J01A 1HN1A 3RJYA 3AQUA 4CD4A 2JF7A 3POCA 3ARPA 2YL9A 2D20A 2CBVA 4TOQA 3WF2A 1V08A 3UETA 4F66A 2CKRA 3GDBA 3AXHA 4BQ3A 2XFYA 5A2AA 3W0KA 4IPNB 3T08A 5CPSA 2V38A 1E3XA 4PUEA 3UCQA 2CXGA 1LF1A 2EJ1A 5FOOA 3CZLA 2PWHA 3EJTA 3WY3A 3VVGA 4TXEA 4XZBA 4IPLA 1HL8A 1TE1A 1CXEA 1PAMA 2UY5A 4PMRA 1UZ4A 5D9NA 3WQ6A 2J75A 5DF0A 3WELA 1TA3B 1U30A 2OSYA 2CITA 2D24A 3IAQA 4GINA 1GHSA 4PMDA 7A3HA 3VD4A 1R86A 1H0GA 4FNRA 1OWQA 1XYZA 3ALFA 2VT0A 1SFSA 1HP4A 1NOUA 4AD2A 4WKFA 1M01A 1KTBA 1PJ9A 1V0KA 2ZUSA 3AMKA 2WMGA 3HG5A 3IGUA 2VVSA 3ARUA 4U3CA 1UOKA 4P7NA 1PZ3A 2E9LA 3UESA 1UKSA 1HNYA 5JBEA 2J7HA 2XWEA 1F4AA 4BQ5A 3SUWA 3WNKA 5E0FA 2W63A 1SR0A 1GQIA 4HZ6A 1G01A 3CHFA 4W86A 4NZCA 1QI0A 2NT0A 3F5KA 3S6TA 1E4NA 4RL3A 3UEQA 3WUGA 1UWQA 2QHAA 4TX6A 5EFFA 4J28A 2V3EA 2WM0A 2OW7A 3BLKA 2WNWA 1GORA 1SMAA 1BHGA 3QHOA 4FMVA 5A95A 3EYPA 3OLIA 3K8MA 2A3AA 1JG9A 2WC4A 4MADA 1IT0A 2ZICA 1CGVA 4D6DA 1B2YA 3A6OA 3L4XA 1XH0A 2PWFA 2OYKA 4J27A 1ZU8A 1EDQA 2WW5A 3WDPP 3A21A 1BG4A 3CZGA 4DUXA 3UR8A 1HJVA 2DT3A 4MAZA 4YHEA 3IAPA 3VIFA 2Y4SA 3VMOA 1VEOA 1K6AA 4JZ5A 2PWGA 3AYRA 3WNMA 2EEXA 2PF0A 3A22A 2XVKA 4PEEA 3BUIA 1XSKA 4F8XA 1UKQA 2F2HA 5D9OA 1JAEA 4OJYA 1TMQA 5HBFA 4UQ9A 1V3KA 4KH2A 4E4PA 4AZCB 3BVUA 3LPOA 4C7GA 3D51A 1DHKA 3ZJ8A 1JZ8A 3GH4A 2BHZA 4B16A 1BYCA 2VCCA 5I77A 1PX8A 4P7LA 1H0IA 1YQ2A 3TV8A 2J7GA 2A3CA 5E1QA 3BLPX 2V5CA 1S46A 3SUSA 4GQRA 3KL5A 1JDCA 1G9HA 1HVXA 2XVNA 3AS2A 4F9DA 3I3EA 3WN6A 3VDHA 1WB0A 1BGAA 5M17A 2NT1A 4ACZB 1X6LA 4A3HA 1CGXA 3KLLA 2IUZA 3N12A 3RM8A 2XN0A 3HG4A 3VDCA 1QBBA 3WEZA 1V03A 3WQVA 2EPKX 4IM4A 4MAVA 2FH8A 4F9JA 1GVYA 2JEQA 3CLWA 1JNEA 3OGSA 3WQ8A 4MNMA 1E0VA 1W9XA 1UD3A 2OWWA 2CERA 1UH3A 4NRSA 3WNNA 3CPUA 3RCNA 3B9EA 2YLLA 1PIGA 1LWHA 1JL8A 1QNRA 4U2ZA 4Z2HA 1JAKA 3VM5A 2VR4A 3CUGA 2OWCA 1LWJA 4NZJA 4RE3A 1JNDA 4LGXA 1ZBWA 1DWJM 5CQ1A 2WVUA 2EO7A 1C8XA 3AHXA 4CVUA 3AOFA 2GJPA 4GZJA 1KXTA 2WPGA 4PRWA 1R85A 3EMZA 2E40A 4BZYA 4E8CA 1FH8A 4CD8A 1E6XM 1J18A 2VJXA 1BGGA 4UR9A 2GJRA 1J0KA 4AD4A 4FK9A 1XCWA 4KRUA 2BFGA 4RE4A 4PMOA 5I3DA 1QPKA 1UH4A 3VSUA 2XGIA 4GPNA 2E9MA 1UR2A 5LA0A 3GNPA 3WDIA 3K4DA 1EA9C 2WXDM 4NZFA 2NSXA 2CBUA 2QPSA 1CYGA 2VUYA 2D0HA 5D8ZA 2VX6A 4QP0A 1ZL1A 3D52A 5DT5A 3THDA 3N04A 3ARZA 4D6GA 1JIBA 4JFSA 3THCA 2OLHA 3CC1A 4MB5A 4QLKA 2E0PA 4AD5A 3L2LA 1K9DA 4MNKA 3LXAA 1WDRA 2CYGA 1TG7A 1WAWA 2EXOA 4PTMA 3DC0A 1OSEA 2WMHA 3MV11 1UR9A 3AROA 4JHZA 2DH2A 4W5UA 1G5AA 5KZ6A 3F4VA 3ZT7A 3VD3A 4FNQA 3VD5A 2BS9A 3CHDA 5CG0A 1W2VA 2GVYA 1ZBKA 1KGUA 3WNLA 3MUZ1 5A6LA 2GSJA 2X0HA 4A4AA 3ZOAA 2VCAA 3EDFA 1WDPA 2WBKA 5FD0A 1ZB5A 2C8NA 3CZEA 1UD5A 2EQDA 4UFIA 3W6MA 3WFLA 3FNDA 4TTUA 2PBGA 1VFMA 3T0AA 2XFFA 1VJSA 1RH9A 3NSNA 2W5FA 3VNZA 1MW3A 2A3BA 5CXPA 4EK7A 4KGJA 1QNPA 3LRMA 5LA2A 1XSJA 2EAEA 1GW1A 1WO2A 2VTFA 1C7SA 1LLOA 1OB0A 2J7BA 3ZM8A 4TVUA 4WF7A 4M56A 4ZFMA 3WL1A 4AWEA 5FKYA 1GJWA 1BF2A 2VZOA 4OOUA 3WQWA 1VAHA 4J3VA 4FLRA 1TUXA 2YBUA 2BY1A 3EDJA 3TTSA 4V28A 4NF7A 1W32A 1MXDA 1HXKA 1GOIA 4ZEPA 2WBGA 2WK2A 5I78A 4ML4A 1R7OA 1C90A 2YL8A 4PCTA 3PTMA 2VX4A 3OLDA 5I79A 3LPGA 5E9AA 5CLTA 4AYGA 1G1YA 4WK9A 3VIHA 1JD9A 1W3KA 1QHZA 2FHBA 4JCLA 1E4LA 1NWUA 1K9FA 1W91A 3DX3A 2XG9A 4UFHA 3KL3A 1MQPA 5IFTA 2CEQA 2CPUA 3I3DA 2VURA 1GUVA 3VIJA 3GXNA 2DSVA 4MTVA 4MJ2A 3MU7A 5A6BA 3N15A 3MUY1 3VM7A 2PB1A 3W26A 4AEFA 1GJUA 1E56A 2F7PA 4GO8A 4D6CA 3QHNA 3TTQA 2J47A 3IJ8A 4QLLA 4QFUA 1N82A 3RJXA 4PN2A 3VDBA 1UG6A 2W91A 3ZR6A 1MFUA 3MMUA 5BYWA 3CHCA 3N1AA 1GOKA 4P7QA 1SMDA 1M7XA 2PWEA 5A6KA 1B9ZA 1JYWA 1WPCA 2JEPA 2WMIA 3W81A 1ISYA 3WEMA 2ZE0A 5IDIA 5E6ZA 2BY3A 3GXMA 4AMXA 2AAAA 4A3YA 2G4FA 4CU6A 4CCEA 1TQTA 3BVVA 5D8WA 3BSHA 2YLAA 4JKLA 1E71M 4OUEA 2X2HA 1V6XA 1JYVA 3AIUA 1WE5A 2X8RA 4JAWA 1J10A 4J7RA 1E5NA 1OCQA 5GPRA 1JZ6A 1CLVA 1Q6EA 1TA3A 1TQSA 3CUHA 4CN4A 3S5YA 2EBNA 4ZXLA 4UNIA 2ZIDA 2D3LA 1RP8A 2ESCA 1J0ZA 4L4PA 2JE8A 6CGTA 1VENA 1HKKA 1V6UA 3PZVA 5LYRA 2WHJA 4MPKA 1CDGA 2VMFA 2ZXBA 3WH5A 4WKAA 3SUUA 5EB8A 2WYSA 4HTYA 4YN5A 2CIPA 4B15A 3IANA 3SUTA 2RGLA 3DYMA 4B3KA 2C7FA 2BNJA 4JHOA 1KFWA 1UYQA 2O92A 4FNUA 3U5YA 3VIMA 4UZSA 4PTXA 4R27A 4FLSA 1VBRA 3VX0A 1C91A 3S5ZA 4QCEA 3WUBA 3FN9A 4PSPA 1R34A 3LPPA 4GI8A 1ITXA 3GYCA 3WMSA 1C3FA 3PZGA 1W3JA 4UFKA 1ODUA 2BVYA 3WSUA 1V0LA 3WUEA 1YHTA 1UQZA 4PMUA 1OGSA 5A94A 3OA5A 3GXPA 2PI6A 1E0WA 4LXFA 3H53A 2DDXA 1KQYA 1EQPA 3A3HA 3T2OA 3W29A 1H49A 2WSKA 3WL0A 2QLYA 1XHGA 4AYSA 3SIMA 1E40A 4W93A 4H41A 2HVMA 1WZMA 2GJXB 3VTRA 4PMZA 3ARVA 3T2PA 4UZUA 4HPHA 1DP0A 5M03A 3A4AA 4JKKA 1H5VA 3WNPA 4U33A 4KWUA 3BMVA 3GTNA 3CZKA 4AIUA 2J7CA 1FH9A 3FAWA 3WD1A 3M46A 3SCRA 4J3TA 2WMIB 3VPLA 2WLZA 3AXXA 3NSMA 4AZCA
chains in the Genus database with same CATH superfamily
4XBKA 5FJIA 2YK1H 4ATDA 2GC7C 1KPVB 4ODHL 3EUDA 3FSOA 3UAEA 1MI5A 1JWSA 3B3BA 4NUJA 1BKHA 4U31A 5FF3A 3WBAA 5I6OA 2E6QA 1KR0A 2G3JA 3Q58A 2XZZA 3N11A 1EC9A 4WD0A 1TVHB 1KEMH 1A4BA 4XBJA 2NX5D 4Z2JA 5CGYD 3VZZA 3LMJL 4MY9A 1CI1A 4G1MB 4OF5A 1JV5A 1D3GA 3RMEA 4HWZA 5I19H 3O2DL 4HYVA 5KS9F 2FLRT 3ULVC 1DIOA 1KC7A 4JEQA 5CF3A 2GIXA 2WBJD 3ARRA 1S2TA 2DOCA 4ZQTA 3L7EB 2DS4A 2FUQA 4YDZA 4JL2A 3DV4B 4P2QD 5FIPA 4DN1A 2IDSA 4WO4C 4C6BA 4AUUA 3GC3A 1E0OB 4YC2C 1MZZA 4PTUA 5HP5A 3BZDA 3U1SL 4PE8A 2E9BA 3PZMA 1UJTA 1LQAA 4WW1A 2DSKA 5LGJB 2ZWSA 5DBUA 3KYOB 3GZAA 1JOIA 3APCA 4HJJL 3ULAB 2NLYA 1RV6X 4JFPA 1A5MC 4YMPA 5IZ7A 3L13A 1J8VA 43CAA 4WI7A 4PIRF 5I0YA 3BOXA 3BXWA 3PL6D 4RMRA 4OWGA 4BS0A 4L1HA 1P0EA 1UC4A 1RKRA 3WIJA 1YN6A 3R8RA 1A80A 1QMUA 1PYMA 5A8OA 3UR7A 1OQXA 4NBXB 4TXVB 4DESA 4CC1A 1SO6A 4MDIB 5HDWA 1TKKA 2BRRH 4HSHA 2AJVL 3ARBA 1REIA 4L2YA 2XH7A 4W88A 3NO1A 4ZENA 3O3AB 3NGBC 2XCMC 5K1VA 3RPMA 1KT2A 3RL1A 3KBFA 3T5WA 3KPMA 4BK5C 2DMKA 5C9JA 4MCZB 4AEHL 2V82A 2XGZA 4LBUA 4JIHA 3GDKA 4XP9L 2P88A 5AC4A 2WZ5A 1A6VL 4GPVA 1F4YL 3THAA 3W7KA 3BAWA 1A1MA 1PL9A 4JO1H 2G5UA 4JXCA 5TE7L 1DXFA 2V5SA 5DC0A 4NXSA 3DX6B 5CP7B 2YMOA 1AO7E 2QKSA 1JPEA 1R5VB 1XYFA 2QR0A 1HK6A 1ZBCA 1TETL 2N0MA 1FFOB 2LW3A 4KF1A 3CBJB 3MV7A 4YK4B 1R87A 4JANA 3LHTA 4BBWA 3HS0C 7FABH 2J7LA 3BVWA 4GKZA 3WS3A 3PWLA 4LVAA 1XD0A 4HF5L 4C57C 4FXKB 4AIZB 4DWSB 5KWYC 1P84J 2VQTA 2JMRA 3TL5A 1FWBC 4HKJB 1VPQA 2VDOB 1V6VA 5EMUA 2F6XA 5E03A 1YECL 3LN5A 4IIQB 5GSRB 3VKKA 3ZIZA 3W4RA 3CN3A 1UM5L 2IQ0A 4YS4A 4HCHA 5FGCE 4WY7L 2H32B 1ALDA 3GZKA 4W84A 2NYYC 3RRXA 2PO6C 4HV8B 2RGMA 1H51A 4DP0X 5T5FA 4EZJA 1JZFA 4K55A 3B2UD 4MASA 2BVTA 2QVKA 4Q8PA 3ARTA 3U2CA 4YXHH 2ADIA 4LHQB 1CLZH 3O4LE 1R5IB 3BW3A 4BE6A 2ZXDA 5GIRA 1SM9A 3Q2NA 4TQTA 4IIZA 3TWYA 4PCFA 3R19A 1TE6A 2PBOA 1CLOL 3RRAA 4IBVA 2EXYC 4NLHA 2NY5H 1PS3A 2FT6A 1CFQA 4F9PA 5HDBE 2FX8H 2G2NA 1TZHB 5DD5H 1FWXA 4WSJA 4JQXA 4BINA 2VLJD 3OPZL 5CD3A 2CCWA 1NFDE 1QWGA 3ETBF 3FA5A 1BZEA 1EBGA 1VKXB 1RK7A 4JO4H 5REQB 1FZJB 1AZCA 4MGGA 2HPIA 3T0TA 2H0FA 4GQGA 3S42A 2NUPB 3EYFA 4DNHA 1AZBA 2O5YH 3N19B 2JELL 5JXAH 3S48A 1SXZA 3NIDE 3P4MA 8FABA 5C08E 3S5SA 3V6FB 1CX9A 4WGWB 1J8SA 1E6PA 1NP2A 1FYHB 4LEQA 1R9XA 5DZNA 4OBRA 3CQ0A 3B7SA 4JG9A 2ADJB 4AMWA 1GOWA 4KQ3L 3VFUA 3LRSA 3PF3A 4LVOB 2W38A 4K8RH 3AIRA 5D05A 4QCFA 1TO5A 4QRUA 3S36X 1UM6H 4BSVB 3OLEA 4XN5A 5EC1A 3DIPA 1BXBA 1QUMA 3RIKA 4NRYA 2VXTH 2H6UA 2E9IA 1R24A 1JZDC 4DQOL 3VIPA 4PTWA 3QR3A 5JORB 3BQUA 5AC5A 4FZ8H 1DANT 2MSPA 2FZ9A 3Q13A 1JZEA 3FQUB 3BAXA 2H8PA 3TZVC 2AV1B 3KPOB 1EVUA 2WIIB 3L3KA 1NWRA 5AD0A 4AJYV 4WW2F 2ZTBA 2Y6SC 1H7XA 4UFMA 3AAMA 3UF9A 4W7UA 1WFUA 3CWOX 1Y6MR 4NZ3A 4WFFE 4GRWH 2EEAA 4M80A 1LL7A 5I9QB 2BW5A 5E2TH 2E3VA 4PRPE 4NFBA 1J5SA 3W28A 4JEGB 1UZGA 4ZQMA 1RJZA 5J0BA 3AYSA 1R3IH 2XKNB 5LA1A 4WFGD 4D6JA 3WBYA 2AEQL 3T1WA 4XBPB 3QV6A 1FWTA 1NANI 3CFNA 4YOKA 3AO0A 5C07B 4Y2DA 3ZUNC 2N7SA 5FO8B 4G8GD 4PI0A 1UURA 4F58H 2VKXA 5L88L 5E5UB 4TTDC 2CZDA 3HRPA 4QOKB 2DIEA 1L7TL 1I2QA 1HIML 4AVIA 1NMAH 2GJNA 1E42A 5CJBA 2YZ5A 1YG9A 3MVTA 1YEDA 3TC9A 3B56A 2RJHA 4H4NA 2PYEE 1J5TA 2QUUA 4P49A 1UA7A 5EIVA 3AM8C 1MRDL 1A5FL 4OZGB 5FECB 3G08B 1F9CA 3OOQA 4HGKC 7CGTA 4JX5A 5A6MA 2PTYA 1A14H 3RNKA 1KCRH 2YPVH 4DKDC 3SQBA 4R9OA 4X9BA 3W2MA 3GBNH 2EIDA 2GKIA 3ARFC 5D1XE 3UTTE 2ITDB 5IW1B 4TLTA 2WJEA 1F11A 1S3KL 3MRRB 3RZCD 3WIAA 3PCYA 3WQ4A 1CTMA 4K23L 1K4CA 3TT1L 2YXVA 3ELQA 2J12B 2BSEA 2ODHA 3VFWB 2D2CC 5DXXA 4W9KC 4FZEH 1GAFL 4L0PB 3W86A 2ZKMX 3ULVF 3ABRA 5A6TC 5LNWA 3MCLH 3QH2A 2N0KA 5JPMA 3ZE0B 2ALDA 2V0TA 4J3OC 1DQIA 4PSRA 1RPKA 4J12A 1YIXA 1YYAA 3BZGA 1T80A 3UJ2A 4RWYL 3GTHA 2PGWA 1JFHA 4LSVH 1TJMA 4NC2B 5G1TA 1FBIL 3DK2A 4M82A 3U7VA 3DJZA 3FT1A 4LLMA 2R0ZH 3NAAH 3WTXA 2OYLA 3KWWB 4GRWE 3R79A 5EKYA 2OR8A 2IXUA 4IXXA 2HXUA 3H9YA 4GAYB 1A0DA 4UUJA 5G4OA 4DHLA 5KZEA 4IGNA 3CCHB 1P0DA 5IMKB 3P2BA 1OBAA 3OZPA 5H2ZA 1GOMA 2QT3A 1S9KC 5IVNA 2JJTC 2XINA 3URBA 4JHBA 1Z6KA 3B8SA 2UUDH 5IROA 4R84A 1GQJA 1G7VA 1LRQA 4O10A 1G7JB 2OWXA 3ZT6A 3SKJL 3EX6A 1D9KA 3BJSA 4LT9A 2QJNA 4QY8B 2V7HA 5EZOL 1PY9A 1EP3A 3RVTD 1J1XH 1U1HA 2LV4A 4HWEL 5A2BA 2PKDA 4ODTL 3QJUB 4Z7VE 1TPUA 1U8HB 2KLTA 1C08A 3T8LA 3MDJA 5M2FX 3FO1B 1MHCB 1I8LA 5BXPA 5AN7A 1F90H 4D9PA 1TV4A 1H3PL 1D5MB 3PJTA 2XN9A 3MBEC 1NJJA 3OV6A 4IMCA 5KBPA 3K4AA 2BVPB 3OKLB 2ZX6A 2NY2B 1TJIH 2CCVA 3SCMD 5EFIB 1BGXH 2ZUWA 4QXGL 2FJFB 8PAZA 2CZFA 3NG3A 1PZBA 2XTJB 3NDYA 3ZKQD 2QKIA 1JNHB 1ODZA 1WH0A 3PWNA 4PIBA 4F8TA 2E7CA 3ZE1F 3ZJAA 2R2BA 1GZJA 4JY4B 3QQNA 5C2UB 5B7YA 3CHEA 3B06A 3NVDA 1L2QA 2FWOB 4PJGA 5LGZA 3F62A 2Y0SA 3GQYA 2IS7A 3V0HA 1H9VA 3Q8AA 2AI0L 4MB1A 2XKUA 3EA3A 3V4PL 2FTAA 1V3LA 2PGEA 4IFRA 3VUSA 5EFDA 4AIOA 2UWEE 3GKWL 4PB5A 1T41A 1I1XA 3QUYB 5CLWA 1WC7A 3FN0L 1XDMA 5DFAA 1F8TL 3M0VA 3UWQA 5LHFA 3EADA 4QNPF 3RGVC 4LVDA 2YN5A 2YW3A 1PX4A 1B2WH 4FQXA 3DYPA 3WNOA 1WZ1L 3Q8FA 5ITBL 1PTGA 1EEQA 1FAKT 4LCUA 4ZFFB 4TQEH 2CO3A 4K37A 4R5EA 4FYSA 4CQ8A 1NTHA 1DEEB 1P9MA 4HHMA 1JS4A 4AZ7A 5FEZA 1UA6H 3EHBB 3UJTL 1U83A 1XMEB 2JIWA 4PREB 2IH1B 5C0BD 4K6AA 3VK5A 4Z3EA 3MLZL 2BCKA 2R4RL 3BPWA 5MENE 5CFHA 3WFZA 5MEPB 1WWAX 3C12A 3IUDA 5D1QD 1LEKA 2IBZY 3TXAA 5DD0H 2PE4A 1EC7A 4FE9A 3VFSA 3L08A 5FF7A 1D7DA 1E6RA 4CSSA 1XLCA 2AXFA 4K5LA 2IALA 4Z7QF 1UOZA 4A1RA 3MO1B 4TMCA 1OPGL 4L3EE 4P9HH 3RPKA 4OZ4B 5DEZA 4UM9D 5MHSD 1JDDA 5DZJA 1HN1A 3POCA 2DWDB 3W7GA 4NNXA 3W9EA 4PRIB 3W7QA 4TOQA 3MRNB 3GJFH 2YPLB 5KSVB 4G9DB 4MX7A 1D5ZB 1OL0A 3GSOB 2BVQB 2E6DA 2C4XA 4G8AC 4BSWB 3W57A 3MGOA 5D2NE 4JM2C 2PUZA 1G7IA 4AFYA 3GD1C 1J6OA 4LCQA 1B4LA 3EG9A 1TWDA 2HVKA 5D9NA 3OSVA 1I9RL 3R6IA 1ASQA 3FRPG 1MFBL 2ZOLA 4EI5C 3WIFA 2XPGA 3R89A 1XYZA 4QRRB 5JHDD 3P7YA 3TYAA 5I02A 1PF3A 4L8BB 4U6HA 4ZUSB 3F12B 7ODCA 5DVNA 3UTQA 3BLEA 2VVSA 4XSMA 4IRSA 1DFBL 3HMXA 1B0RA 1LK3H 2J7HA 4N8CL 4XN1A 3ROLA 5FS5A 3KWSA 1UYWL 2FJGA 1ZP3A 2F8VA 3H12A 3BLKA 2WLNA 3CWHA 3HFTA 4XPFH 3PRZA 5HNTA 3E6FA 2PLMA 4FR6A 3P84A 4PJXA 4N20A 4E9TA 3S97C 2APWA 1QG3A 4A7VA 2GIMA 3QJRB 4H25B 3U7AA 3AYRA 4XNUL 3WNMA 3QRGH 3K0WA 3VABA 1VHPA 1UKQA 2EE6A 4O2EA 3SDXF 3W7JA 5FHBL 2MTAA 5KSUA 1JEZA 2R1KA 5HYJE 5BV7H 4JFEE 2WNGA 2ENSA 1OARL 1JVOA 1A5AA 3PP7A 2V68A 1D6VH 3BZFA 2W5PA 3OAWA 4MKNA 4XVUD 2OCCB 1MWAA 4F8LA 3RWJA 1CGXA 3O6FC 2IUZA 1HE7A 3H9HB 5DXYA 2HKHH 1A5CA 1GVYA 4WXYA 1MCKA 1I8JA 4XH2B 5E8PB 5DD6A 2CWXA 1GTFA 4GNJA 1ICTA 4Z2HA 4AX7A 4IFKB 2R2EB 3VM5A 1NCBL 2OWCA 2CLMA 5GGSY 1OFRA 4KXBA 4M7KH 3L9YA 4AVJA 1A4KA 4A2FA 2HKAA 3QJOA 2QVTA 1Z3RA 2TYSA 2FIKA 3GRWL 5GS1A 1X9RA 4J3OF 2B4GA 2QGCA 3MRHA 4QRTA 4NP4H 1WWWX 4A6YB 5LA0A 1UT2A 3IJHB 5B1AB 1CYGA 2FEDC 4IMFA 5BQ7A 4J23A 1GG1A 4I7WA 1N2VA 1LVEA 5C09E 4MNKA 2F15A 3GK8H 3VXMB 1WDRA 2BS71 2G0KA 5AC6A 4MJIA 2Q7NA 3RPIB 1MHPL 1IEVA 3VGAB 2DV6A 3RWHA 1NGXA 2N01B 1XBZA 2A77H 4LUYA 4EE2A 1WDPA 3RCMA 1JUFA 2EQDA 3PPFA 3SBQA 1FNLA 2R4SH 3EOOA 3BL3A 3TJHC 1ZCCA 3VNZA 5GS3A 5BXFB 5JHAA 1E65A 2CLRA 1GTNA 2PPDA 3S34L 3QEUA 4PYGA 3WQEA 3WQWA 1VAHA 1L9MA 3MI2A 2QDEA 5DDHA 4UT6A 2JJWA 3DG3A 3L66A 5I74B 1S2EA 2C14A 4M5ZH 3S3BB 3NYKA 4ML4A 1XGRB 2YL8A 3KNBA 5I79A 5D33A 3HV9A 4JBSA 1W3KA 1OSZA 1UOLA 4XVSH 5F1OB 4A7UA 1HHKB 3BICA 1THFD 1MQPA 3FQNB 1YY9C 1S2WA 3TJPA 1X5GA 3FT2B 1C5DA 2ZYRA 4AEFA 3R58A 4KBXA 3QZOA 3ZYJA 4D6CA 4LPVA 1IC0A 3IJ8A 3OKOA 4JN6A 3HAEG 3L8QA 3I6TA 5DZVA 5AZ0A 5BRZE 4M00A 4P7QA 5DJ6B 5DLLA 1R9FA 5E8DL 3UTSE 4YNGA 2HT4D 3BGFC 1DSYA 1F02I 4CCEA 2HPTA 5D8WA 2V30A 4GGBA 4KHTL 1WE5A 4JAWA 3HB3B 4E8GA 5JIMA 4AV0A 1UB6B 2MOQA 4JLRB 2ESCA 4H2AA 2EUWA 4DGUA 4ZDHA 5HR6A 3PK7A 2QQQA 2XXCB 4OLZL 2VMFA 1XIFA 3WH5A 1SJDA 2IH3A 4Z3GA 5EB8A 4ZRGA 4B15A 1W54A 2VERN 5FK9A 2VGBA 3QLDA 5CC7A 2C7FA 3NH7L 1UYQA 1JUKA 4OGYL 2WOYA 3ZDXB 1XL9A 1F3JB 5JZ7D 5IT2H 4PSPA 2E1WA 2FVMA 1GWJA 3V5HA 3WMSA 5I3HA 4UFKA 4YFEA 3HPZA 4D7PA 3ATYA 1QOPA 1PSKL 5EUKB 3LI0A 4Y4KC 2JTDA 3PDOB 4IIHA 5BW7A 4OGAD 3DOSB 1TDQA 1DP0A 2ZA1A 2Y85A 1KC5H 5DD1H 3BMVA 3WD1A 1KFCA 5IB3B 4MNQD 4GWEA 3P0WA 3MLYH 3TPUA 1M9SA 4ELME 1E4KC 4Z8FH 3LH2L 1N5AA 2BNQE 4DP4X 5CR8A 5BOEA 4DGYH 1U5HA 3M9YA 3F4WA 3TA3C 4F37F 3N6QA 4A35A 7XIMA 4UMCA 3RM4A 2NY4D 2VN5A 4PJ5E 4LASL 3VCRA 5FUZL 3B03A 4NZUH 2Z2AA 4L4VE 4KZEL 2CETA 4GXUN 4XWUA 3R18A 3CK0H 1QO3A 1QT1A 2F38A 4NQVB 2KKQA 3GTVA 2I16A 3CNYA 1IGTB 5KTEH 4AF0A 1ZAIA 1UGKA 1BWMA 1AW5A 3LS5H 4UT9A 1VCBC 2D9CA 3ZLGA 1CS6A 4YXKH 5I8KH 3EH4B 2W0KA 3EPNA 2QGBA 3VCLA 1P5VA 1KCVL 2D3VA 3AXLA 3S88L 1CD1B 1WFOA 1UXMA 2PP0A 1R3JA 4HCRA 2ZOOA 2QGEA 4L5FH 5G4WA 4Y19E 1IZJA 3KCJA 1CICD 3VYLA 1MCNA 4HMCA 2F7RA 2CBTA 2Y7LA 1Q6RA 4OU1A 2DW5A 2LU4A 3CFTA 3E0GA 3HZVA 2XVLA 3A6BH 1X7FA 1KELH 4O17A 3MV9A 1F97A 3S2LA 4NYUA 4I0KA 6ALDA 2OMXA 2J4GA 5D2LA 3QWOA 3G6JE 1BYAA 4OM0L 3TU9A 4RGNC 3JZUA 3U0HA 1W0WA 5IQNA 1BYDA 1UJPA 1NCDL 1A65A 2HWGA 3BT2H 3MFGB 4ONGL 2ZZ6A 5F70A 3ESNA 4JG1L 4IU2B 3OQ8A 4UC5A 1QVBA 4OZFB 4QRQA 1LM8V 4HPNA 1WDAA 3RWIB 3VRLF 3GTIA 2MMXA 4IPJA 2PDIA 4MWAE 3DHPA 2E9JA 2XYBA 4WJXA 3CN0A 1F6LL 5HJ3A 5C7HA 5TIMA 3MNWB 3R1GL 3L3DB 5TGBB 3ARDA 3GR7A 1IV8A 2F74B 3W7DA 4X5RA 3PY2A 4ES9A 4PBGA 1KDIA 5BS0B 1UG9A 4PUBH 3VIOA 3Q48A 5F4WA 3MW7A 4AQ8A 5IXEA 5AVYB 1ZENA 3FQRB 3KAOA 5H8PA 1BQLL 4UTHA 1ME9A 3NZUA 3R4DA 4GG8A 1DQXA 2CKBA 1TMCB 1XIMA 3EWCA 5A3HA 3EAUA 3BOVA 2P8LB 5DI8B 4DEPC 1W3HA 1JRHI 3V75A 1KNOB 3L2IA 4N68A 4GUOA 3QKEA 4LP8A 4RIRB 2B0SH 4XE5B 2XY1A 4HEPA 2DZUA 4UIKH 2VZTA 4PV9B 4Y2OA 2O9TA 3LEXB 4Z1BA 2DRUA 4WWOA 2GK1B 4XO7A 4NRXA 5EU6B 1JGEB 2K0RA 5SX4H 2O4EA 3M1ZA 3STEA 1GZPA 1U91B 3C8KA 4L5FE 3AIBA 1TCDA 4HZ1A 3CFUA 2Z31A 5D5MA 5EBGA 3QV8A 3K6NA 3FRPA 1E9OA 4U10A 4MAYB 1O7DE 4LVNB 1X9UA 1EGMA 3PYCA 1JGLH 3K2UL 4L37B 1HZYA 1ZHKB 3V9EA 5KYXA 3IU3A 2X4SA 4ZMTA 4QHMA 4M61A 4MQXD 5HI3D 3KLKA 2QCHA 1BMGA 2R2CA 3PTKA 1NBQA 3FIGA 4LB4A 5F0PB 4L6HA 3MLUH 1FCCA 4G8IA 5DANA 5F96L 4CD6A 2VLKD 1I1FA 4RNRB 4OB5L 1CWVA 4M5PA 2APTA 1NPUA 4UYPA 4MHHG 1NDWA 2WMKA 4MGXA 4W7VA 4JFXA 4G7VH 5ECJE 2ZAHA 1QLFB 4I9JA 2F1BA 4EI0A 5KZCD 3K30A 1VJZA 2XISA 4Y4FC 4R96B 1RY8A 1YPIA 1UP3A 4M6OL 1F2QA 2Y7QB 4BKSC 4C6QA 4LOCA 5ICZB 4DJEC 2NY3B 4PLNC 3NIFE 4ZMYA 1NIAA 2YSWA 3MCOA 3N06B 4FRWA 1TPC1 3TBVA 1NM4A 3OJGA 1JGVH 1U2YA 5J6HA 2G30A 3NZSA 3KPRD 3VWKA 3NQMA 5D7KD 4PGBA 4O16A 1J48A 4APQD 3RTQC 3LVTA 3UAJA 2MFNA 1N18A 2NXYB 2BSCA 4EI6B 2A74C 5I1GH 3WYZA 1SUHA 3WLOA 1IQ8A 1JPGA 4NQED 2CLHA 4G1NA 3GDLA 1GOOA 1ECQA 4XNQB 4DAIA 2CLIA 4OJFL 3NUKA 1IGCH 1HNFA 4P5TB 4GX9A 2IGTA 4L29B 4CADB 3CFCL 5I15L 3W82A 4WVXA 4K3EH 2DQGL 2H9AA 2CK0L 4HCDA 5IW6A 3KPNB 2VDKH 3WJMA 1MW0A 4IIBA 1DVFC 2ZRUA 4AKQA 4AMCA 1DSFH 2EABA 3M07A 3CXFA 4O58L 4QHNA 2OJEB 3GFZA 4QTHA 4C47A 1UD4A 2Z8SA 4CLMA 2EYTA 4PJFE 3GS0A 4G43A 5D72H 3LB6D 4XAGA 1HEZB 4YWIA 4PY8J 2BSRA 3G5XA 3F64A 5KSBA 4M62L 4YUEH 4IGSA 1CB4A 4PJ9D 4EO5A 4LUSA 3TH2T 3T2QA 2GUBA 3UWYA 2R29H 4PBWD 1WP6A 5JMUA 2C7UA 1RBAA 4RZCB 4XNMB 3EGXB 4UMSA 3F8UB 1XFPA 4P2OB 4B3VA 3EGDB 3KW8A 3Q2CA 4LMQE 3KGUA 2DWEA 3KYNA 3HHRB 3VXQB 5HGHB 1OAXL 3WDRA 5I66A 4XCCH 3NSDA 2YIHA 5IY5B 5AEAA 2XXMB 4JICA 4YFLF 4ILSA 3EB4A 2WHMA 3OKDA 2HE8A 3UOAB 1WICA 3JWOH 1NANH 4YHIB 3ULUD 3H21A 3QOMA 1PBGA 5DJ2B 5C86A 3FOKA 1BX2A 2AEWA 3BLBA 3VJ6B 1ES0A 4FQLH 3ZDZB 3FCTA 4H7ZA 3CEUA 2AC0A 3B6SA 3FU6A 3QR2A 2PCXA 5IHRA 4Y9BA 4WI3A 4HUVB 4WWKD 1BMWA 3BEWB 4F79A 5DCCA 2H4EA 3DMMA 1E67A 3HAEA 4HP5A 3AZRA 2BV9A 1FYTB 4CD7A 5FGRA 1A7BA 3HE7A 3SKNA 1NEZB 1CI5A 2VDNH 1AO7A 3G2GA 3W85A 4S3DA 2DKMA 4ZQKA 2O56A 5JDSB 2Z0BA 2YLHA 1HESA 3KE0A 4A7QA 1SY6A 1UUMA 2D03H 3WXWL 3I85A 2BWGA 3C08L 5I1IH 4PUNA 4ZOBA 1Q94B 5LKYA 2PP7A 5JXEC 3KVDD 2QADD 3QI9D 4JDYA 3AIWA 4LIQL 5TK2A 2AQOA 2Z25A 4PS3A 3STZA 3CUFA 2AGJH 4BGDA 2YB1A 3G5VA 3GT6A 1NIDA 3R94A 3ROOB 3F58L 2HRPH 3EYQD 1NY1A 3GNDA 4HZLA 5ALBL 1QVOA 3B8VA 2GK0B 3UBGA 3ZHLA 3S3PA 5FR3A 5FA3B 3B7RL 1DQJB 4MOZA 3P4NB 3W72A 4R5VA 2X1OA 3DHJA 3JWDC 3QEQD 3CB8A 3FQTA 1GYNA 5DHXB 2HVOA 2Q3OA 4RDYA 4WUUE 4P5MB 5IJVA 5EUOB 2MEJB 5IVOA 5BVJA 1GVIA 4I0PC 4PRHB 2W4XA 4R97C 3L3OA 1DQDH 4YXLH 2CO6A 4MQTB 3PM6A 1VBUA 3CFQA 4MDRA 1CXFA 2ZC1A 4YTSA 4ADTA 4NWTH 1R2SA 4FYRA 2Y2YA 1R46A 2YKKA 3KS6A 4ENEC 4EANA 2IPUK 3R0DA 1SZGA 3KXFB 4WVRA 1LJYA 2A4CA 1AJ7H 1FHNA 3QNZA 2Z6IA 2XJLA 1HQTA 1BQHB 5B3SB 2X4PA 2ZPKL 3FKRA 3TT3L 1RIHH 3ULUL 4J1OA 5F72S 5F7EH 2UXVA 4ZSTA 4Z0XB 4ZTOH 1JZHA 5FL1A 3JWNC 3PQYB 2WQSA 1NOLA 4H8VA 3EMCA 2IAND 4L8DB 1Y18A 1XIBA 1FQ9C 5IV2A 4XSLA 2P7TA 3RVVC 4BFKA 3M1BA 1E9PB 3JVGA 4ZS6C 1X7QB 2F8QA 1V10A 3ILPA 5H1WA 1PEWA 2PLTA 3BH4A 3QPZA 3FFCB 1DJZA 1OV8A 1DQLL 3FN3A 4Y4HA 1K8IA 3QIUC 2WINB 1GVRA 1MHEA 4HISA 3IDMA 2ZUNA 4U1KB 1OD0A 2XFXA 2DQIH 3EGJA 2O30A 5DVKA 1D5IL 4LANA 3QRFM 3P0YL 4JPWL 3WSQL 2H26B 4LVHB 2DL9A 3U30C 1HJQA 3MBXL 4N0YH 1NCIA 4HZMA 2IG2L 2VSDA 3GUTB 3WKYA 3RPDA 3RDTA 3H3KA 2Z1PA 4H88L 4QYOB 1B3XA 4PTVA 2YRLA 3CMGA 1WWBX 1KEGL 4K3HA 5I2IA 1MREL 5IUCA 4MG4A 4BD4A 1K70A 2V3DA 4WTXA 1G7HB 2DW7A 3UPRA 2ZOWA 4PRBA 1AGDB 2JKEA 3KAAA 5F7UA 4MVBD 3HZ3A 4C58B 3M0KA 2QZQA 3QIWA 2N7AA 3I2CH 4JTUA 3Q3GB 5DURD 1IZCA 2J44A 5IM51 4RETB 5I6NA 1JPFA 4LOUC 2FLBT 4PD4J 1LO5B 2DYPA 2J8UB 4J1UB 3TCLA 5A8MA 4EACA 1MZYA 3EZ4A 2ONEA 4ZPTA 4ZG1A 3UACA 4OLXL 1QJWA 3F03K 3W0KA 5FUCE 4JY8A 4TU1A 1BOGB 3ME0A 2FB3A 4QXTB 3WQ6A 4QWWC 5BJTA 2BZCA 5KVMC 2ZCGA 2VD9A 2J5LB 3GR4A 4AQLA 1E9ZB 4KPHH 4U3SA 4Z7NE 2GSHA 3GSUA 3TKFA 3ARUA 3D0LA 1G7QA 3L6FA 5HYQB 1ZNNA 1IAKB 3NEEA 3H2EA 1M7PA 1YTDA 3TYZA 4BQ5A 4K3GA 3LN3A 3HPLB 2VJ8A 2R9HD 4LHJB 3CHFA 4PJEB 4QRAA 3GIQA 4C6OA 1Z5YD 2Q3ZA 1GSMA 4LLDB 2KT6A 3CC5B 4PBFA 2QSCH 2OW7A 3HPFA 3AWGA 3FA4A 4G72B 3CQKA 2A3AA 2GFBB 3V0WH 5I1DA 5CJQL 1UB5B 2KS0A 2HMCA 4BQ6A 4RDVA 3G5YB 2VGLM 3HMWH 1EDQA 1J05A 5BZDA 1R3LB 3XINA 1TTPA 2X4UB 1KM0A 5IHLB 3QIBA 4ZUVB 2J1WA 4N02A 5ID0B 2X16A 1JAEA 3DX7B 4KX9A 1P4BL 2AMXA 3Q2WA 5TE4H 4XCNA 3RVXC 4HNLA 4KH2A 4XP4H 4XK2A 4KK9D 2C1OB 1RFDL 2XU2A 5JW5A 2OLSA 5F44A 2D4DA 3D12B 2XVNA 2YMXH 3C5XA 4DP2X 4RAHA 4M1DL 1GYAA 3MA9L 2X7LA 4GXUM 2W07A 5B7ZA 1RZPA 4KNUA 4B5EA 4CC0A 4AQ1A 1GJPA 2XVBA 3OM3B 3WJWA 3DVNB 1QLEL 1TENA 3D6NA 3DGRA 1AH0A 3QUZD 1EUAA 5JH2A 4IQHA 5BOZG 4Z7VA 1DQTA 1N0LA 1CFBA 5E9NA 4XNZC 1X4XA 4JTAA 1MJJB 3HPJB 1PU0A 4GZJA 2V2CA 3PE9A 1KXTA 1BECA 1EJSC 5I3GA 3CH1A 3ATDA 1EEYA 3D34A 2ZXGA 1S7UB 3QC6X 1VH7A 2E7MA 3NL2A 4P23D 1SZRA 2AJYL 3VSUA 1J8HD 2NX9A 1NAML 3WDIA 1VZWA 4MRCA 2G97A 2WXDM 1EWDA 1CBJA 3MYOA 2BJML 3VRIA 5G2HA 4YDJB 3RL2B 3LXAA 4HNTA 2B7DT 3NRFA 4RMUA 3F4VA 1WOBA 1CYXA 4N2KA 4ABVA 4AJWA 2WJFA 2YAQA 2DQUL 4ZMNA 2VFEA 4O54A 1QSFA 1FZKA 2ESVB 5AOKA 4JFYB 4LCSA 1VJSA 4MFDA 2AJ3A 2PODA 5BQDA 1KNWA 1IB5A 1Q63A 1QRND 4R0LB 5D93C 4TVUA 1JJUA 4ZUTA 5KVEL 1AIFB 1KA9F 3FNKA 2WQAA 4UTTA 4FLRA 1WXYA 2YBUA 4V28A 4I0CC 1UM4H 3WKMH 1W32A 4ZEPA 3TV3H 4GAFB 2OM5A 5HBBA 4JTJA 1D5BB 2ZG2A 2FZ3A 4JCLA 3VXPB 3VVVA 5HMEA 4JO5A 5MHBA 3WHE0 4F7MA 4RMBA 3SY1A 2VENA 5ALCH 2VURA 1ZLDA 5JTWA 2KZHA 3OHXC 3KHOA 1SFTA 3MT1A 2DQJH 3TTQA 4BQ9A 1BQKA 5AW5B 2CUHA 3CHCA 4HC1L 1KLFB 4YAQB 4O00A 1SFJA 1HXMA 2ERJB 2VDRB 3U9IA 1I82A 5HYIA 4G7RB 1W5OA 1W8EA 5EO9A 4LSRL 3P73A 4I3GA 5F2FA 2VLMD 2ZTKA 1P48A 1CGSL 4N6FA 1JYVA 2KZ1B 2APFA 5GPRA 3ETTA 1MCJA 4MLIA 5ELIA 1SRDA 3EYSH 4L3EA 3AQDA 5K7JA 1NMCC 4GRMB 1V7AA 5HK4A 4YBLC 4Z18A 1PKLA 1JWUA 4N0CD 3RJOA 1UQSA 1ROCA 1L6YA 1I4FB 2P5WD 5D71L 2DP3A 4C65A 4PJIB 1K7FA 3RYMA 3VIMA 3CHSA 1KTKE 4MD5B 1C91A 1P6BA 3IVTA 3GYCA 1UACL 3VDGA 3PZGA 4Y1SA 3WK1A 4HS6A 1NC2B 4A29A 3ZFHA 4JNYA 4MYPA 3FJ6A 2XWCA 5AOUA 3GXPA 1CFVH 4UMGA 3DLQR 2GSIA 1EQPA 4J4PA 1GW0A 1SN5A 3HUJF 2WJDA 3WL0A 2OI9C 4YHLL 2B1AL 4DPCX 5KJRL 1DJYA 1I3GH 1HZHH 1TZIB 3T2PA 2Q7YA 4X4YA 1P4LA 1NC4D 1JZJA 4QROA 3EA2A 5IEHB 1FH9A 3FAWA 4MJ5B 1J87A 3FCSB 2JKXA 2OZ4L 2OR7A 5E2VL 3OX8A 2VR3A 5CJXC 7REQB 4AM0A 5AYXA 5H37H 1NCWH 2L7UA 3TOYA 1MW1A 4OFYA 3KLAB 2CMRH 2QCDA 4R3UA 1G7PB 2WMPA 2NZ9C 1HX0A 1OC6A 4ELKB 3MJ9H 2HWZL 2Y24A 2H0EA 3MMTA 3N2TA 4FQQA 1JD7A 4OGQC 2P5NA 4JGUA 4H40A 2XFWA 1VFUA 4JYEA 2K9UA 2A1WH 2IAMA 2IDQA 4JW3A 2CLZB 3I6KA 2AQTA 3INPA 3CIXA 2LLGA 4XCEB 3WXVH 1JPIA 4HMNA 5KINA 4FQCH 1EEZB 2Y88A 1FKWA 4X3ZA 2R0WL 1JHTB 3VXOB 1RZJC 3TTYA 1E1CB 1EHAA 3UYPB 3SCVA 3PJSB 3P0VH 5DYFA 2VOMA 3JR2A 3P8IA 4PV1C 3SBPA 4K5OA 4E0RB 2AJZB 5D7JA 1ZTXL 4AVKA 1X5FA 2YB4A 3H26A 2ZFAA 1PVNA 1NARA 3GSNB 4XGZB 2OVLA 3L3IA 3PF2A 1U42A 3MV8B 1NDMB 1FWFC 1AZVA 3COTA 4NCC2 2XRAL 1K4DA 5DMGD 4O1EA 3F4NA 3H6OA 3D9AL 2GSGA 5EEZA 2XXGA 4CW1B 2EPMX 4LCCA 4AH7A 3GLEA 5IIEA 2VXNA 5CSUA 3ZMRA 5I6XC 5ICUA 3FXYA 3GJFA 2E27H 2J2ZA 2XNAB 4OV5A 3ONBA 4KO5A 2I56A 1VB9A 1PY4A 3QUXD 1KFAH 2IDCA 2ICCA 4LHUB 3ARED 4C6MA 2ITCA 2LT9A 5DRZA 4PJ7F 3QG7H 5D5MF 2PR9A 3ERPA 4XN9A 3ALWA 3DX8A 5FEBA 2RFXB 3NRQA 1B3IA 5F4XA 5C09A 1ACXA 2IQDA 4CNIB 5HDQH 2XWXA 2GHWB 5IMOB 2R0KL 4GQ0A 5J11B 4HA1A 3VGDA 3SGEH 3B9NA 1PLAA 2CO4A 2HNEA 4J2PA 5EB9A 2PPGA 4OZHB 2B14A 3FJ4A 4QHRA 3LGGA 3CWGA 5CCKH 2P3ZA 3N2XA 1N7MH 1AYOA 1WYJA 3VD7A 3TLLA 1YMMD 3B5TA 2BVEA 2VDQL 4ODUA 4HZ8A 1KCUH 3K4ZA 1PZ2A 3ISIX 2OTUA 4U7MA 5CMAA 1RUKL 4ZZ9A 2VISA 2AJSH 1OIFA 3BO9A 3DFPA 4ZFZA 3MUUA 3UY7A 1L5GA 4KJQC 1U8CA 3IS4A 4M7JH 1BVZA 3QFGA 3DTUB 1U8PB 3K1DA 2OBGA 3W7LA 3N44F 1CFTB 4I7UA 2KERA 2O4QA 4N1HB 4LF2A 1KBWA 4B5ZA 3DGCR 2BW4A 4JFDD 2R23B 5LB1A 4ZXBB 4CNUA 4EP8C 3PC0A 4P04A 1AXSB 1SDDB 3ARXA 3G7TA 3T09A 5GHWL 3LDBB 1RJLA 3AG2B 5BRZA 4JY6B 3QRLA 3H8AA 1YEEH 1TCRB 3UTSA 3BW9B 4ZQRA 4H9UA 4X9HA 3SPCA 1OX5A 3VI4F 3S37L 4PWFA 1VFOA 1KXVA 3MKVA 4UTBL 4UTMA 4GSXA 3HFYA 5E08H 3DX2A 3RWCB 1O4UA 4C55A 3BAEL 1HAWA 5J4MA 1T03L 4W9IC 4PJAB 2AQPA 1N0XH 4GW5A 2NX1A 3NCWA 1PWLA 2NX5B 4P46D 2R27A 5LGYA 1A4LA 1OYAA 4P5KB 3GU2A 3WIIH 3P14A 2EEBA 5E6YA 3CHXA 3PWJA 3A24A 1OZMA 3HO8A 1LDPH 1FWHC 3NA9L 1SMOA 4OFIA 4HUUA 3P9WB 4L1GA 1E4XI 2NNAB 2CW6A 1BPLB 2GBUA 2EIZB 1GGIH 4RDWA 1JBJA 5EO0B 2WBJB 5EIIA 1SUXA 4E41E 1DQVA 5EMLA 2YBGA 4P2QB 2J25A 1B3VA 2GT9B 2H2PC 3DNKA 4XTDA 1ETZB 4RQQA 1Q6DA 2ZUQC 1NUDA 4H4IA 2P24A 1EDTA 1AUSL 2XIBA 5T1KA 1YSOA 1IQDA 2GLKA 4X4XA 3BKMH 3GLAA 3OZYA 1XSIA 1EXPA 4NZ8A 3EPMA 2WTOA 4ECLA 3NCXA 4NI3A 2YD7A 1IXOA 4I18B 4S39A 1L0XA 2VR5A 2ICEC 1QTYT 2XTKA 2VLRA 1T96A 3N43F 5DGRA 2CKNA 2IXVA 1U95B 3ARBC 3PL6B 3EMQA 3FB7A 5CBEA 5GS0D 5LXGL 2NRDA 3MROA 1HHGA 2WOQA 2FT8A 1SJAA 5CZ0A 2ZOXA 5CZVL 4L4VA 4Y0GA 2P1FA 3C2SA 1JI2A 1RQ5A 2IFFL 4ODBD 2VW6A 1GCYA 4MS8D 2VAJA 4JB9H 2J77A 1EZVY 3M1OA 5DQ9B 4HEPG 4P3DB 1A7PL 3US0A 3O6DA 4ZD3H 4L8SB 5IB2A 5J6GB 2RGSA 4AISA 3OVPA 2JJVA 3CIVA 1R3YA 4KKXA 1TPDA 1VD6A 3D69B 1UWAA 1VFLA 4K9EL 4ZGYA 4KFZC 1THCA 2DICA 3JT0A 3HN5A 3ERXA 4NQSA 4NAJA 4NDMA 1DORA 2H32H 4Y19A 3C0LA 2Q5BA 3U7YL 1HSBB 2AZUA 2IEPA 4H5SA 3P9LA 3T7VA 4GSDL 4Y5VA 3T8QA 2Z7UA 5C6MA 2FBJL 4DPAX 2X7WA 4GFXA 3NABL 2VKWA 5AW1B 2GDQA 3PHOA 3HS9A 2FD6L 3O45A 3MSYA 1GYVA 2WO5A 1HTYA 1ECEA 4IIFA 1UWIA 2FK9A 1CDCA 3USBA 1E27B 1I9JH 4F15C 2F53D 5GGRY 1S3HA 4ODSL 2OCJA 3FXGA 4AEIL 3FOLB 1FWNA 3NCBB 2OZ0A 1PG7W 3BESR 2XH0A 3EA1A 2OSWA 3KPPA 2BY0A 1SOKA 2W88A 4K2SA 5E9DA 5FM8A 1CK0H 4UTAH 1J96A 4DKEL 2R24A 1KJVB 1CCWB 2LAGB 4DJFD 4FOMA 1XR2A 1DVUA 4RFEB 2YA0A 4Z0BH 1TTJA 1OGTB 5FYKD 2Z34A 3MWAA 1A3HA 5D7SH 2ZZ1A 2HISA 2YQGA 1JTTA 4IL2A 4JHWL 4HMEA 1A3RL 1GHFH 5FYJD 5F89A 4F9PC 3K2KA 5CINL 4JQXC 4QDMA 1A6PA 1KCBA 1QHQA 3ECUA 4HJGB 1YW1A 2G3XA 4X42A 1TTBA 1FV1A 4LQFH 4R90L 3M6DA 3NTCH 1KBKA 3NBNA 3W7NA 3KHJA 5I76A 3DO7A 3LNEA 2VLJB 4OD1L 4YSAA 1T2QH 3ULSA 1SYVA 3RAOA 4PRDB 4LSTL 2DBLH 5GJSL 3D4CA 1W3TA 2BSTB 1U58B 1V7ML 1S5TA 5DYOB 2JK5A 1DBJL 4WDUA 3ENLA 5C97A 4HS8L 1KLZA 1PSCA 2G41A 3BH8B 4KRNA 1INDL 3IT8D 1VR6A 4O18A 2YBVA 15C8L 3QDME 4DZ8B 3CVIL 3P2VA 2EYRB 1Q9OB 5D9SA 1ZXKA 3ZKMC 1LEIA 2Q6WB 3OZLA 5E6ID 1FVDB 3SEPA 1Q1JL 2K8QA 1U3HD 5F88A 3W2KA 2WLLA 1OD9A 1CJYA 5FOJA 1H1NA 5HNNA 3RFZB 2ZWYA 4AG0A 3BQUC 4OFQA 5SWZD 3VD0A 3K2MC 2PDHA 5CEZH 1TT6A 2WZEA 1CBGA 4RZ5A 3S35H 2OG9A 3M5XA 2FB4L 1N6QH 3CFDA 4Z7OE 3S46A 1QI3A 4CCZA 4GG6F 4QTFA 3U36A 1RZFH 1WZKA 3ZX1A 1OP3K 3V0DA 5I1EL 1A47A 1K5WA 2YC1B 3SQOL 1MFAL 1WDQA 3SCNA 3AICA 2RDUA 3VFLA 1KJ2L 1H1ZA 3C2OA 2OJZH 4RAVA 1MRFL 3ISRA 3ZKND 3TVMD 1H7NA 2F19L 1LO0L 4ZR8A 2J72A 3SURA 1A6AA 2VSKB 1FG2B 3QK0A 4R3SB 3S2AA 3QA3B 5L6YH 2QQNL 1A7QL 3CVHL 3EOAB 3UH8A 1CLXA 5C0RH 3QYSA 1FORH 3KOXA 2E5CA 4WY0B 1Q6LA 2OR9L 4Y2DC 2YN3A 4Z08A 3QZEA 3PLYA 4G7EA 4PY8I 1ADQH 3C87A 1OGBA 3SCPA 1GZQB 1OGGA 5LXXA 1L4IA 3CXHK 5E0CA 3BUPA 2ZJSH 4S3BA 1E9YB 2O9OA 3CTTA 3Q1SH 1JZ3A 4NNAA 3Q05A 1JI1A 5FYJL 4G8GB 2W0LA 5AYUH 4Q6JA 4W9TA 1Z9PA 4IKKA 3N29A 4B90A 2YEQA 1LO4H 2UZXB 3RM9A 2VEGA 4CNOA 3AT8A 5DJCA 4O13A 5C9RA 2BHYA 4JG0L 2BPBA 3VWJB 2DZBA 1MDLA 5J8LA 2V6AA 1JZ2A 1MNZA 2X87A 1P2CB 3MOQA 2ZRZA 2WP3O 4Y7MA 3WFCH 4WJ5A 4TNFA 2BASA 4X60A 3F5JA 4O0QA 1PKOA 1DJIA 1GY1A 3LH8A 3O9NA 2BNRD 1R3TA 3GSVA 1YEHL 3MRLA 2EE0A 3P3RA 4L7ZA 3PR2A 4W68A 2PU0A 2A9DA 1CCZA 1OVZA 2X89D 2AQ2A 4BQ4A 4G1EA 2CNCA 1Z7AA 1F6PA 1OINA 2R8SL 5GRWA 3RIFF 3NSCA 4WUKL 4OLEA 4K3JH 1BBJB 2QCCA 5AZ2L 2I5YH 3L5JA 4IHOA 3OODA 2OMVB 3O15A 5HI4C 3APGA 5CEZE 3X13B 4PJFA 1L9OA 5AWNH 3IDUA 3V4PB 3RU8H 1FGNH 3HR6A 1BVLA 5IQ7L 5I3IA 4JPKH 4ZS7H 4P57A 1MCWW 2YDRA 4DXKA 1BM7A 1B31A 2EH7L 4XP1H 5F1IB 4LV4A 4AHOA 3B9AA 1Q8MA 2W80C 2ZWZA 4OW6A 1LO3L 3T0ED 5GZOD 3HG3A 1D6EB 4HJUA 3H9SE 4M8RA 4GIYA 2OMWA 1S5NA 4HKXA 1KWGA 2CA4A 3F83A 4QDWA 4OLUH 4FXSA 3GNOA 3KWXA 3RJYA 5K1NA 2KI6A 3VA2C 1BFOA 2V81A 3WF2A 2WYZA 4IGBD 3VXSA 4ZFCA 3MOBL 1DVQA 5IROC 5ADOH 1S2AA 3U9WA 4PGDA 4B3EA 1F5WA 1OAJA 1B3JA 4Q0XL 1D9KC 5CZXC 1B4JH 3WN5C 2XX0A 5JW4N 1ZA3B 3DIFA 4ZNEE 2R51A 2OSYA 2XV0A 3CTLA 5KYUB 5TQ0H 5AVRB 3MX0B 4M7LH 5EG6C 4PP1D 4IOIA 4EUPH 1M01A 1V0KA 8RUCA 3BZ4B 4G6KH 3T9WA 1GG0A 5LJYH 3C8FA 3BN3B 3QLLA 3UESA 4PW9A 4OLVH 1P0NA 4JTTA 4F7CB 3A67H 5D7LA 3FQWA 3UBFA 5GRJH 2A83A 5HHPB 5C0DA 4IS6B 4DQAA 1BYOA 3C86A 3LN4B 1I7TA 4NZRH 1EBHA 4Z7WB 4LGRB 3OLIA 2ZRYA 3I50H 3GGWB 3AUVA 4XD3A 3QQ4B 4HWNA 4DHGA 4KNQA 1H6UA 4DGWC 2QKIC 4PVMA 3MRFA 2WB7A 4QTIH 5K93A 4RK8A 3CZGA 2WQXA 5EY5A 3VIFA 1BIIA 3UJEA 1CYWA 2VSMB 4U6XB 2EEXA 4XZ4A 3SCMB 3PJLA 1HEHC 1QFWL 2MQ0A 1YNKL 2EYSB 1V3KA 3LPOA 4QO1B 2OTPA 1TWSA 1HYSD 1HI6A 3N1FC 4PUKA 2KQMA 4E38A 1YRRA 1OK8A 2AXJA 4Z0JA 3WN6A 2DI7A 1EFZA 4WU5A 4GE8A 4J3ZA 3F6JA 4AE0A 1K4GA 1TIWA 2H6PA 4ILDA 2EPKX 4HLZH 3TMLA 2VXVL 4TNVK 4FQXC 1W9XA 1IEXA 1FL5A 1S78D 4FA6A 4WUUA 4S1FA 5H35B 1KY6A 4AM0Q 3UTPD 3K81A 1TPFA 5J5DA 4YGVB 4X8CA 4P2RD 1LWJA 4W9HC 2R29A 4RE3A 1P9MC 3P0XA 3O8XA 3C5ZD 3CG8A 2DQHH 3NOIA 4S1RH 1QZNA 3HRZB 4YSQA 1M1SA 2E09A 2FZNA 1A6WH 4HUXA 4BFJA 4UR9A 2NV1A 1QPKA 4H9MA 3B7YA 3P77A 4LFHG 4I9XA 4J5NA 4GUCA 1NIFA 5C0BB 3X2QB 3ABLB 3HFMH 2OLHA 3NCJL 3L2LA 3S83A 2IMRA 5H2BB 4ZX3A 4WNJA 3BDXA 4JHZA 1G7LA 5TE6H 5D1QB 1ICQA 3HR5B 2TSAA 3Q67A 2X0HA 3T0CA 4OJCA 4WDIA 1F07A 1QCWA 1FE8L 1E9QA 1VFMA 1AC0A 2N1KA 2P8PB 1X5ZA 1OTUC 3MRQB 2J24A 3VNLA 1U8OB 1QNPA 2A79A 4O9HL 4UM9B 4ALAC 3W0WE 1GJWA 2JB5H 2ZQKA 1TUXA 4OGXH 3AZUA 4Y9AA 3EDJA 1LK2B 2RIKA 2PEVA 4AMAA 4CEXC 5KN5B 5TH2B 4N4YB 3V0VA 3EB2A 3CFJA 1QRKA 3TYCA 2VH5L 3C5SB 1XPYA 3MJ7B 4BUHA 3A6CL 1OTSD 4IRSC 3KL3A 4EN3A 2WXIA 3OKMB 2AXGB 1EO8L 1XL4A 3K72B 3N15A 1MFMA 3QJVB 4NQCE 4N5UA 2I60H 4KWVA 3QW3A 2ATKB 3VA8A 2EEFA 3PS6A 3C6SB 5ES4B 5H37G 3VE7A 2W91A 1MFUA 1RZIA 3NPXA 4IKJA 3FK3A 4RRPG 3ALXA 4WI2A 3MKGA 2KQNA 3MNZB 2WP3T 3FL7A 2PWEA 2W1NA 2WN3A 2JEPA 4QXUL 3N9RA 4PUJA 4M4RA 3QFJE 3AU6A 2PCEA 2BP8B 2MPAL 4Q8QA 1PNDA 4RLIA 2PP1A 4A3YA 4JQIH 2OK0L 4EZKA 3Q2VA 2Y6TE 1I1YB 3B4UA 1YEFH 4LL4A 4WI0B 1V6XA 2ADFL 5EO1B 4AL8L 1OCQA 1TA3A 1P7KB 4W4QA 2EBNA 2FATH 3S5YA 5EMKA 1RVFL 5JIDA 4UQ2B 1XF5B 5CEXB 3R11A 3PZVA 1FY6A 4PWJA 3BDKA 3UYIA 3CAVA 3WLJA 2NW2B 1MAJA 5HJDA 2XWRA 1O7VA 4HBKA 4LY8A 2NW3A 2YPLE 4XZ9A 4ZBJA 1KFWA 2LTQC 4A2GA 2Z4TA 3U4EB 4N25A 3AITA 3WFHB 1EK3A 3N2CA 2FQEA 2B20A 3B9KC 4LSBA 4PS8A 1IAOB 1SEQH 4A6YH 1P0KA 1IAMA 3MR9B 3F3HA 5TFSH 2Q8BH 1HZKA 2PDXA 3T1FA 1LM1A 3IFPA 1X9LA 1XHGA 1E40A 2PF8A 1F6KA 1MCRA 3D0VB 4QRRE 1F5ZA 1WZMA 1RK6A 4UZUA 5K9OB 4G83A 3H4FA 2B2XL 2BOBA 2GJJA 5HGAA 5FEXA 5IG7B 3DUGA 1BEUA 3KP1A 2H2SC 3G1VA 3VVWA 2NSOA 5GS1C 2BG5A 3BANA 4I90A 3THUA 1LRTA 1DZ0A 1G9NC 1HO4A 3ETSA 5DC9B 4GUIA 1E15A 2HJPA 3NIGE 1TTGA 3H6AA 2RQEA 4JDTH 3S4SB 2HH0H 3CYVA 2W9DL 1XTLA 1FG9C 4PI2A 3GMRB 3F7QA 5HJBA 2YFOA 1TZGH 3EZ8A 3M8OH 4XZNX 3C9NA 3T4WA 3WKZA 3RILA 4IGHA 2ROXA 2DEXX 3FH8A 5C0EB 1CPUA 3CJJA 3KGSA 1KRMA 3CL8A 1PHWA 4CMHB 3CL6A 4NN7B 3ZWTA 1VERA 1OEZW 1J0IA 3DKJA 4LCWE 3BOFA 2FJKA 1F41A 4OIBA 4Z5RB 5CJNA 4L65A 5T1LD 4GRLA 4LLUA 2VXSL 1TXKA 1L9PA 3D2UD 4PJHB 4PWHA 5GRZA 2R15A 3EDEA 3BPCA 5FL0A 1KO0A 4U0RB 5AW3B 1BW8A 3EO1A 4NAEA 5GS2D 3SD2A 5AYZA 3TNMA 1I60A 1WNOA 3VG9B 5AVTB 4KERA 4PPTA 1CT8A 4X9YA 3KHQA 4YBQC 3CUPA 4LUIA 2RJGA 1O6VA 2VFGA 4XRCA 3RAJH 4L8CB 1A1OA 4PB9L 3MBWB 1R0MA 3NSFA 1XGQA 4JYDA 2YYTA 1SZEA 2VXUL 2UBPC 4AZHA 3DROB 1B30A 2Y63A 3MA7A 2MANA 2NTSP 4GISA 4ZA0A 1PKYA 1UZ8A 5LIWX 2XYLA 2EVIA 2G75A 2K7PA 3TC6A 1N70A 2WUBH 1ZHLA 2W62A 3NCOA 1FWIC 3TF7C 4GOAA 1W3LA 2X6AA 3DGDA 4PJGF 4TVPH 3WH6A 2BC4B 3E1F1 4X9GA 4HQQL 2NY7H 1A5SA 1XR8B 5AKTA 2CDFA 5FF4A 2Y69B 2ZP9A 1T0NA 2EDWA 3WF1A 2E67A 5AB3A 1XB3A 3TBWA 2C9XA 1E6JL 3RP1A 1Q3NA 2MHAA 3RKPA 3H3PH 3SY0B 4ICXA 3MXWH 3WEAA 2PA6A 1G94A 4Q8WA 3DXAE 1A3XA 1E5CA 4E5XB 1TJGH 2DQTH 1IL1A 4D8PA 5XIAA 5F1NA 1S7QB 3O4LA 2PCQA 5HNRA 4U0QB 3US9A 4MDJA 1V8EA 3DURB 2PS2A 1CDHA 2WUCH 4M6VA 2M26A 2WQVA 1LE5A 2DSWA 3A4EA 1UASA 2CO7A 3ZZLA 1TJHL 1FH5L 1P5BA 1I7ZA 5ITFB 2HZHA 1FO0L 3EJRA 3PZUA 4N8VG 3DC8A 3OGRA 5JYMA 1XLKA 4XR8C 4NWUL 1TWZA 3SKOA 4LEOB 3WY4A 1JNNH 1H15A 3PBWA 1SJHA 3MYPA 3THMH 1NFDA 3IETA 3CV2A 4GEJA 3HMCA 1FL3B 1YC7A 2NLJA 2CHOA 3GKFA 2OMNA 1AFSA 2P3EA 5T9BG 4H7CA 3AG4B 2IOOA 4WUIA 1HSAA 1FNHA 2IMMA 2EXSA 5EU4B 3G24A 4C6DA 4QXVA 4FALA 4W85A 5IB5B 3L4VA 5C08A 5AW4B 5KBLA 4NAFB 1T7YA 1XIWA 3P3BA 5FCZA 1S5HA 5AB0A 3QJFA 1P7BA 4OBSA 1ZDSA 1RCYA 3VI3B 4PFMA 4ZZKA 3MSGA 1MJ8L 1E72M 1P53A 5C0AB 2YXMA 1GC1C 4GLRI 4MA7H 2G8ZA 1RZMA 1RJRA 3EIFA 4GYBA 2J7FA 5EBAA 3LEVH 1PKNA 2OA9A 4CJ1A 4CN6A 3WF4A 1BAFL 4ORZC 3SJ3A 5BU9A 4M8QB 1QSED 2HFFB 2EACA 1M4KA 2MCPL 1QDSA 1JNLL 5AYIA 4WCYL 5SWSB 3WQPA 4LBAA 1D8CA 1CICB 4TVPE 2X9YA 1M3UA 3D85D 5TDNB 4S1SH 3HE6D 2R91A 4PY7B 1T3FA 4HXBH 3HQOA 1F3EA 4HBCH 3SJVD 1XLDA 1ZS8A 5FSDC 4S3CA 5FA5A 4P3WA 3KBMA 1ORSA 1S9XA 5MKGB 1ZHNB 4PRPA 3X3FH 1K2DB 3DJRA 2Z8VC 3U1PA 5DMNA 5CZRA 2DTMH 1SQ7A 4Z7UB 1ME7A 8A3HA 1PZ5B 3VU1A 5ECVA 4I89A 4TV6A 2R1LA 4XCFH 1OX4A 4PJXF 4G8FB 1KQZA 3SDDC 4TUOA 2KH2B 4KFOA 5EOCH 2VRJA 1T4KB 2OLDA 1RVGA 2DD8L 1VACA 1DUYB 3VXNB 1ZVNA 5DJAA 4PLJD 1TQXA 3RDKA 3C60D 3C09C 1KN2L 2HT2D 3KPLB 1N5YL 3QRHA 4KRZA 2BWIA 1L2UA 5ISZD 5GRYA 2VR2A 4AYFB 3QZAA 4QRPD 3P80A 4ZXOA 2PYEA 1E70M 4AQ8C 3CHRA 4HFWB 4POZD 5JOEA 3T3MB