2WVVB

Crystal structure of an alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
450
structure length
446
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAKLYRDALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of the Reaction Coordinate of Alpha-L-Fucosidases: A Combined Structural and Quantum Mechanical Approach
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords ALPHA-L-FUCOSIDASE
total genus 164
structure length 446
sequence length 450
ec nomenclature
pdb deposition date 2009-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2wvvB02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wvvB01
2WBGA 3RJXA 3EBVA 1BLIA 4MNLA 3A3HA 5E09A 4AY1A 3GXNA 4U31A 2OWWA 2FYVA 4NXKA 5I3DA 2D0HA 3VGGA 1KWGA 1M03A 3HG4A 2X09A 3BMVA 5GNYA 1UYQA 3UERA 3OGSA 1OGGA 3DX2A 3GZAA 5ABEA 4AIUA 2XIIA 1VFUA 1ITCA 2VL4A 1UZ1A 3VX1A 4LYRA 5FCZA 4KGJA 3CUJA 1Q4NX 2JEPA 1NWUA 1GZJA 3WNKA 3VNYA 1UASA 2XGIA 3BSGA 4PMZA 3CV5A 4UFLA 3B8SA 2ZUMA 4UQ9A 4PMUA 1WP6A 2XFRA 3VGDA 1GCYA 1EH9A 3S5ZA 2XVKA 2ZXDA 1BG9A 3BLPX 1JZ7A 3F4VA 1E71M 3S2CA 3WQ8A 2FH6A 1HL9A 2DGAA 2EJ1A 2D20A 3VMOA 3OLIA 3M46A 3VSTA 2RGMA 3VTRA 2EBNA 1ESWA 3QOKA 3VGEA 4M81A 1W2VA 4XZBA 2DSVA 3KE0A 4HMCA 2WCGA 4EKJA 5ABGA 4DUWA 3DHUA 3BCFA 1CGYA 3S5YA 4JKKA 2Y5EA 3GBEA 1LL6A 3D3AA 2WHKA 3DHPA 3OB8A 1OIMA 2YL5A 1VEPA 4L4OA 2VX6A 2F1AA 2BVDA 4OIFA 1W3HA 4ZFMA 1OWQA 2W63A 4C7FA 1PEZA 1UR1A 1G01A 3WD4A 1ITXA 2QPSA 3CPUA 3K1DA 4U2ZA 3W26A 2X1IA 1V03A 1EDTA 1WDQA 3CH9A 1LF1A 2CIPA 1EDGA 3A4XA 2CBJA 5D9OA 1ZBVA 1QPKA 2Y24A 4U5KA 6TAAA 3HN3A 1W1PA 3B9DA 5CG0A 1H1NA 3WDHA 4HZ6A 3SCUA 5C8BB 5CGTA 2WW5A 1PX3A 1KCLA 3WKZA 4Z2KA 5CXPA 3WNLA 1OT1A 2J7FA 3RM4A 1Z32X 1OIFA 4HU0A 3AIVA 1E40A 4ZE5A 2ZWZA 4XZWA 5A6BA 4PCSA 1WZKA 5DFAA 1CGTA 2WM0A 4FLRA 1JF5A 3K46A 1UKOA 2IXUA 3ZOAA 3BSHA 2WMIA 2EEXA 1CGUA 2J62A 3VIFA 2C8NA 1E15A 1LL4A 1H0IA 1PAMA 2EPOA 4UQBA 4S3KA 4TTUA 4LX4A 1ZBCA 5HBFA 1UWRA 1YQ2A 3MSGA 4H8HA 4TXEA 4B16A 4Z2IA 2ZIDA 1US3A 3L4TA 3J7HA 3KEHA 4GIAA 3FHQA 1GONA 3CHDA 1U30A 1E4MM 4AZ5A 1SYTA 1J0JA 1JGIA 1EIBA 3ARYA 4J3VA 4UQCA 1MW3A 3VDHA 3AS0A 3WL0A 4MB3A 3UG5A 5I23A 1ISWA 2XM2A 3EDEA 2VTFA 1HNYA 5IHSA 1CXKA 2EACA 4ZEPA 5A8OA 1CZ1A 4BZYA 3GXPA 3TP4A 1C91A 2G8ZA 4LPCA 3VU2A 3WBAA 1CGXA 3HG2A 1KQYA 2BHYA 2GK1B 4PCTA 2W67A 5I78A 4CN1A 2XIBA 5EFFA 1B2YA 4HZ7A 3L4XA 4FNUA 3WFLA 5AC5A 4QFUA 4JKLA 6A3HA 2BVYA 1KTBA 1GPFA 3T0AA 3POCA 4UQAA 5ABHA 1MQPA 3OIHA 4P7LA 2ALWA 3B9EA 2WMKA 3QHNA 1WE5A 1E6PA 1OD8A 1H3GA 3SCQA 3CZ8A 2CEQA 1GOKA 2FHFA 1CNVA 2V3FA 1Q6EA 4RE2A 3DX0A 5GNXA 2DIJA 4DO4A 1CGVA 3AS2A 2XUCA 3VSUA 3WMCA 1R85A 1UOKA 1DWJM 3ZM8A 2WYSA 2WMFA 1PBGA 3WMSA 3AYSA 2J7BA 4GQQA 3SUWA 1JZ5A 4TVUA 1MFVA 4JCLA 3PZIA 3PZOA 4FNRA 2XVLA 4D6EA 3FAXA 5LA1A 1E56A 3MI6A 4JFSA 3AXXA 4CD8A 4J3XA 4RL3A 5BXRA 4LXFA 3W37A 1HKKA 5LA2A 2HVMA 1E0WA 4UTFA 5E9AA 2F7QA 2J74A 4AXNA 1XCWA 4LQ1A 1NWRA 5M3WA 3PTMA 4QDMA 3CLWA 2J78A 1QI0A 3GXTA 1JD9A 2GDVA 1EQPA 3TTSA 1ISYA 3W6LA 2D22A 4DWSD 2E40A 1E5NA 1FP8A 4W86A 4A3HA 5BYWA 2YLAA 4ZXOA 4CD4A 5FKYA 1MFUA 4W5UA 4AZCA 1YHTA 3VDCA 3UETA 4D6CA 4DWSA 1FP9A 3MS8A 2DEPA 4DUVA 3WL1A 1V6WA 3AROA 3MUY1 3CBWA 1QNRA 1NOUA 1GQKA 2OW7A 4U5IA 2YA1A 4XB3A 5AYIA 2DSUA 4GZEA 5I79A 3BUBA 1BYBA 4W87A 1G5AA 3RDKA 2J7EA 1OGBA 3VM7A 1VENA 1W32A 4NZCA 4PSRA 4NZFA 2QMJA 4HPHA 1H4PA 1DWIM 3MU7A 4HU8A 2WKGA 4JFUA 1UUQA 3PZNA 5E0CA 4ML4A 3T09A 3TTQA 3VIGA 3AOFA 2BY2A 2VX4A 4CU6A 1OD0A 3BLKA 3H54A 3G6MA 1FOBA 1B0IA 1BHGA 4AZ7A 4P8VA 1H09A 2RGLA 4TVDA 5JBDA 2VUYA 1UR0A 2XSAA 2WBKA 3W0KA 5E0FA 2O9RA 1E4LA 3GNRA 3VMNA 2UY5A 1CXFA 4V27A 3KLKA 2V3DA 3D5HA 3AXHA 3RPMA 5A6JA 2DSZA 4PTWA 2CBIA 2WSKA 3UG3A 4GI6A 4GI9A 4H8VA 1QHOA 2O9TA 3PZTA 1UA3A 4YN5A 4FLSA 4P7RA 2ZUSA 2V3GA 3S6TA 5D9MA 3WH9A 1EXPA 2WVVB 1NQ6A 3BAWA 3DX4A 2YL8A 2J47A 4OUEA 2D0FA 2CYGA 2EPNA 1R46A 2GJPA 3A22A 3AMKA 5IDIA 2D73A 2CKSA 4CN6A 4MJ2A 2Y8VA 4Z2JA 1V0NA 4OZOA 1V3JA 3BAJA 3AHZA 3POHA 4FNPA 3VSVA 4JCMA 1QNPA 1CENA 1GQJA 1JDDA 4Z2LA 1PZ3A 2ZX6A 1JAEA 1QI4A 4CGTA 4AD0A 2EPKX 1OGSA 4UFMA 3L4YA 5M17A 1IZKA 1UWIA 3WUFA 5DO8A 3CUIA 4DM2A 1TVNA 3ARXA 1A47A 1W9UA 4HP5A 4JIEA 5CQ1A 1QW8A 3UR8A 3W24A 1KFWA 3LXBA 4F79A 2DT0A 1PPIA 4FLOA 3CO4A 3OLGA 2OW6A 1F4HA 1NARA 4DUXA 5JBEA 3VKKA 1GQLA 1QHZA 1TQVA 4D71A 1XCXA 1CXHA 1TCMA 2UY4A 4PTXA 3U5UA 2WMGA 4MPKA 3SIMA 1B3VA 1V3HA 3ZJ6A 1H41A 1HN1A 3VIPA 4UQDA 1BQCA 1GHSA 2VX7A 2ZX7A 4JHOA 1V0MA 5EMYA 4D72A 5EB8A 1FA2A 3B9AA 2NW0A 1LLOA 5FOOA 2ZUTA 1OM0A 4AW7A 4W88A 2CPUA 1AQHA 4D1JA 1IZJA 1F4AA 3PTQA 4K68A 4JFWA 2DH2A 2DDXA 1L0PA 1XRVA 4PMQA 2OSXA 3WF0A 3BVWA 2ZX5A 4DO6A 4AC1X 2IGTA 3RM9A 3BAXA 3VM5A 1FFRA 3AZRA 4V2XA 3DDGA 1TA3A 1J01A 4QCFA 2D3LA 3LX9A 4PMXA 3BXWA 2WANA 3NUKA 1L8NA 2JEQA 2J75A 3WY2A 4P8UA 2EXOA 1XSKA 3EMQA 2XFYA 1KBKA 1H2JA 2FGLA 2J7DA 1HTYA 4U3AA 3TV8A 2OYLA 1OBAA 1R87A 4FLQA 4AD2A 3WDQA 4C7DA 1WB0A 1W91A 3QOMA 1BGGA 1R33A 3CZGA 3RO8A 4OGZA 2B31A 1B3WA 1D2KA 1KTCA 1B3XA 5BXTA 3EDJA 1K9FA 3VD3A 5LYRA 2J7GA 3HZ3A 1VFMA 2ESCA 3WD2A 5EBAA 2G3JA 4ACYA 3VNZA 4CN4A 3D4YA 3ARPA 1KGXA 1WPCA 2CETA 3SCWA 1NWTA 1TQWA 1CXEA 3CUFA 3WQ4A 2BNJA 5D4YA 1R8LA 2YFNA 3WH5A 4M82A 4GQRA 3A4WA 1HIZA 2W62A 2PWGA 2NT0A 1VF8A 1JD7A 5D9PA 3OZPA 4WSKA 3VOCA 1LL7A 3ZMRA 5IXEA 4JFTA 1VIWA 1TQUA 3L4UA 1R7OA 1WDPA 3VMPA 1IV8A 1TE1A 2GJXB 3GBDA 4NXSA 3MUIA 2CCRA 1ZL1A 4B3LA 3PZ9A 4Q7NA 4CCDA 1UWTA 3NSMA 1LG2A 3LMYA 1HJXA 2D0GA 3WH6A 3G6LA 3U7BA 3RJYA 2VZSA 1OINA 1UWQA 1X1NA 2DT3A 2XVPA 1NOWA 3K4AA 1XGZA 4KWUA 4MB5A 2W91A 1Q6FA 5JIWA 1CBGA 5FL1A 1HJQA 3BAKA 1Y7VA 1BVZA 4WLCA 3AIUA 5CJ5A 2PC8A 5F7UA 3OGRA 3EDDA 1ZB5A 4M8UA 4GPNA 1GHRA 3BAYA 2WC3A 4CD7A 4N0RA 1UWUA 1CGWA 2VURA 3O2LA 4CD5A 2PBGA 3BUDA 1E4NA 2D3NA 4JHZA 2XGBA 4ATDA 1MXDA 3SUTA 2WZEA 1R86A 3WENA 1BGAA 2WLYA 3AMCA 1PX4A 1W9BM 2UY2A 1XYFA 2WC7A 2G41A 2WCAA 1W1YA 3QHOA 4UNIA 4B9ZA 4PMYA 4F9JA 4M80A 4MTVA 2YJQA 4ATWA 1E43A 1QW9A 3D51A 3I3BA 5LA0A 1GUVA 4KRTA 1QWNA 2ZX8A 1TFVA 2VCCA 2VQUA 1J10A 3BGAA 4AD3A 4B3KA 4QCEA 4ZXLA 1V6XA 2A3EA 3CHCA 1XH0A 1H49A 3W53A 2GK1A 1BYDA 4MADA 1UD6A 3GH5A 2XHYA 1BYAA 4MAZA 2WZIA 4W5ZA 4NZJA 1HT6A 1KXVA 3CGTA 5CPQA 3TOPA 2Y4SA 1GQIA 2A3HA 2XTKA 2WXDM 1KBBA 2ZWYA 4F66A 1EA9C 2BV9A 3JUGA 2Z1SA 1ECEA 1WZAA 4GKLA 3A24A 5CSUA 3WUBA 1QNOA 5I24A 3SCPA 4AD1A 2YDRA 4DO5A 3W27A 4IPNB 2E8YA 4AEFA 3ARUA 5A6AA 2Q8XA 2F7RA 2ZX9A 1KCKA 2ZUUA 4AISA 2YLLA 4CVWA 3H53A 2OLHA 2TAAA 3I3EA 1TQTA 3ZT5A 3OZOA 4AD5A 4D6HA 3PZMA 1LWJA 3MMDA 4ATLA 4R5EA 2E4TA 3I3DA 2E0PA 2CESA 4UOQA 5EFDA 4F9DA 1ZJBA 2F8QA 2V3EA 1C3FA 1S46A 1XC6A 3WY1A 7TAAA 1TUXA 5I6SA 1QWUA 4TUFA 3L4WA 1KR1A 3LPGA 4D6FA 1M7XA 2ZUVA 3WNOA 3A4AA 4OOZA 1HP5A 1JG9A 3MANA 3CZSA 1O6IA 1W9PA 1MWOA 1GVIA 4CCEA 4UOZA 4W7WA 2YL9A 2PWFA 3AFBA 1LG1A 1E6QM 1UHVA 1UR2A 2ZXBA 2OYMA 1BF2A 2IXVA 2WWCA 3W4RA 3WQWA 3AIWA 4IPLA 2IUZA 4WKFA 1W1TA 2X05A 5A6BD 4R27A 1EOMA 1N82A 2OWXA 4UR9A 2WHMA 5FL0A 1E5JA 2VR5A 2AAAA 4D6GA 4MDOA 3CIVA 1JIBA 4W85A 3HU7A 1R34A 1UWSA 5A6LA 1QI3A 3HG3A 3F5KA 1V02E 4URIA 1VJSA 1XYZA 4D6DA 3VINA 2VVNA 1EQCA 3VIHA 2YDQA 3IGUA 3SCOA 3EJRA 1W3JA 4OBRA 2WZHA 3DECA 3WY3A 2VRQA 3N9KA 4XUYA 1HJUA 5ABFB 1UKTA 3CC1A 1CXLA 1PX8A 5BXSA 1W9XA 4DM1A 4M24A 1JYNA 4GINA 1J18A 2J4GA 1UD3A 5A8QA 1FH9A 1GORA 1X6NA 1CIUA 1HF6A 3D50A 3IJ7A 2O9OA 3AZSA 2CXGA 2JF6A 3KWXA 1FH8A 1I1XA 2G3NA 3TTOA 3KL3A 4CD6A 4ACZA 1BG4A 5A8NA 1BTCA 3APGA 2HISA 4ZE4A 2BVTA 1M04A 4OKDA 3THDA 1NOFA 3T08A 3ARWA 3TONA 1AQ0A 1HX0A 3A23A 1C93A 1KGUA 2DQXA 3WNPA 4BS0A 4AIOA 4J3SA 5HDRA 5GQBA 3EYPA 4HMEA 3AHXA 1RPKA 2YOCA 5CLWA 1B3ZA 5HPOA 3ZT6A 3NDYA 4AMWA 4W93A 4JL1A 4MJ4A 2YDSA 4PBGA 2VOTA 3H55A 2XN0A 3NIYA 4X0VA 2VO5A 1OCQA 4AD4A 5D9NA 1BYCA 1NH6A 3MMUA 4MB4A 3LPFA 3ALGA 1XSIA 1KR0A 1JNEA 2WMJA 3GXFA 1UD5A 2Z1KA 3EDFA 1UZ4A 3PTKA 2DIEA 4C7GA 4GXPA 1WZMA 2X0YA 1C8QA 3L4ZA 3PZUA 5DEZA 4AZIA 1FHDA 3NDZA 2VX5A 2WMHA 2E9BA 3AQUA 4WJXA 3CTTA 3BUQA 1UD4A 3EDKA 4QAWA 1UD8A 1UQZA 1WO2A 1BSIA 1DEDA 4X0NA 2V38A 2QMKA 4P7NA 1AVAA 2YA0A 1W9VA 1PIGA 5ABFA 1V0KA 3CZJA 2CHNA 3T0BA 1C90A 2CBVA 4UFJA 1JAKA 2J77A 1JFHA 1HVQA 1E70M 1V6UA 1JYXA 3VD4A 4PYSA 3ARQA 3HMCA 1E6XM 4U2YA 5DMYA 1W3LA 3OBAA 3F5LA 1QI5A 2YIHA 1J0YA 1VEMA 3PZVA 4UOJA 5BRPA 3PN8A 3WIJA 3DYMA 1CWYA 2D24A 3W29A 1ZBKA 3WFZA 3BMWA 4QLJA 4H04A 3HJEA 4HOWA 1GOIA 2JIWA 1KXQA 3BAIA 3SCNA 4AYGA 3CUGA 1MW1A 3WH8A 3M7SA 3VD9A 1DHKA 3NCOA 1E4IA 4TOQA 3OLDA 3GDBA 2OWCA 2D23A 4P8WA 1JDAA 1DP0A 1MW0A 1XHGA 3SCRA 3VIKA 4HOZA 4P8XA 1G9HA 5BWFA 1MQRA 2BXZA 1V3LA 2WCSA 3DYOA 5IHRA 3WF1A 2W4XA 2O92A 3GNOA 3T2QA 5I2UA 2GUYA 1UR9A 3L2LA 5GPRA 4AMCA 2XVGA 2JALA 5AC4A 5E1QA 2FE0A 4HOXA 3VIMA 2WVTA 2ZE0A 4BCEA 2ZOXA 3ZJKA 4EAMA 3K8LA 1HVXA 1RP9A 1WZLA 2F18A 2XFFA 4MDPA 2OYKA 2WVVA 3CMGA 5A1AA 1JZ6A 1HXKA 1TA3B 1JZ8A 3N13A 3ALFA 2WK2A 5I0DA 1SMAA 4NX0A 1C92A 1QOXA 3CZEA 1UA7A 2EO7A 1H5VA 4PTMA 5KEZA 1JXKA 3F5JA 3MKKA 4PEEA 1OT2A 2QF8A 1TVPA 4PSPA 1MW2A 3L4VA 1Q6DA 3AZTA 1HKJA 3WNNA 1O7AA 3QHMA 3A6OA 5DT7A 3WQ6A 1NM9A 2DSWA 5A2BA 2GFTA 3N11A 1K9TA 4D6IA 4E8CA 4JAWA 1E6SM 3AIRA 3AMDA 1K9DA 1KXTA 2YL6A 4FF5A 2JE8A 2WVUA 4DWSC 3M6DA 4DWSB 1K6AA 4H2CA 1D7FA 4LYPA 1D3CA 2GSJA 3NSXA 1WCGA 3WNMA 2ZICA 4PN2A 3ZO9A 4W8LA 2VVSA 4NSBA 3WY4A 1E0VA 1TG7A 1ODUA 1DWFM 1FH7A 1CEOA 3MV01 1RP8A 3WUEA 4M56A 1QNSA 4UFKA 2DT2A 1RH9A 4FMVA 4NRRA 2DT1A 4WK9A 4GO9A 4W8AA 1J0ZA 3RM8A 5DT5A 3EJTA 2X8RA 3ARRA 3W28A 2VRJA 3WN6A 3NJ3A 2D2OA 4NRSA 3WF3A 4PUEA 2A3AA 3IAQA 4MNKA 4D1IA 1UH3A 3K4DA 1J0IA 2PF0A 1OSEA 3RMEA 2YFOA 1KB3A 1BFNA 3OA5A 1B9ZA 3VUPA 1EHNA 2E9LA 5IFPA 3LPOA 3EMZA 2VI0A 1DWAM 3AXIA 1EO5A 1XSJA 4KMQA 2VCBA 1GOMA 1OB0A 1BVNP 2NT1A 2JIEA 3AHVA 4IM4A 4Y7EA 4EE9A 4AIEA 2MANA 2UY3A 1VFFA 1C7SA 4TVCA 1B1YA 4AMXA 2C7FA 1E73M 4CU7A 1VEOA 1V0LA 5TD4A 3GM8A 3D52A 4V28A 3BLBA 4WSJA 3CHEA 2VZTA 2FGZA 1ISVA 3N04A 2PWDA 2XWDA 2X2IA 1JZ2A 1ZJAA 1QNQA 3WSUA 3EMCA 3FY1A 1UD2A 1UH2A 4P7OA 1TZ7A 4W8BA 1W1VA 3M07A 3DX3A 2FHBA 3WDPP 4PMDA 3UESA 2BS9A 2BY3A 3ECQA 5E6YA 2VRKA 2WLZA 1GJWA 3NSNA 2J7HA 2F7OA 1E0XA 1FFQA 3EJQA 3WD0A 5CPTA 3IAPA 3VPLA 2WPGA 2EAEA 1CXIA 5A6SA 3GXIA 3KLLA 2VZOA 5C70A 5A6MA 4B9YA 2YBUA 3GYCA 5JUVA 1R47A 1I1WA 3AHTA 4E4PA 1WAWA 2O9PA 4PMRA 1KGWA 3IJ8A 3N12A 3U57A 1CDGA 4BQ2A 1XD0A 1EHAA 1CYGA 4J28A 3MSDA 3DX1A 4TX8A 3AJ7A 4GI8A 2GJXA 4AEEA 1ZU8A 4Z2GA 1QHPA 1TMQA 2E8ZA 5A95A 3UR7A 1BPLB 2XG9A 3GXMA 4IUGA 1M53A 1SR0A 4H7VA 3UEQA 5A69A 4LGXA 1FHLA 3BVXA 1H0GA 1E6ZA 3DC0A 4UCFA 1EDQA 3E1F1 4JKMA 2WWDA 3WUGA 4UQEA 4JFVA 3UCQA 4GZIA 1G1YA 2GVYA 3EJPA 3BH4A 3PZGA 4HA1A 4J3TA 3U5YA 4M29A 2QLYA 2YBTA 4AZHA 1C8XA 3KZSA 2BHZA 1HKIA 4QLKA 1UR4A 1ODZA 4P7QA 5E6ZA 5BROA 1QX1A 2YKKA 1KXHA 3SUUA 3WQVA 2XN1A 2GDUA 4F8XA 3ZT7A 2J79A 1J0HA 2JF7A 3ZJ8A 4B15A 1UKQA 3ARVA 4CUCA 3AHYA 5E70A 3NYDA 2PWEA 1G0CA 1G94A 4UFIA 4YHEA 3FHAA 3IJ9A 1J11A 1V02A 1EGZA 3N17A 3AMGA 1W3KA 5BRQA 2WAGA 2VJXA 1LJYA 3MV11 4H41A 5CPSA 1JYVA 4S3JA 2WHJA 2D1ZA 1E3ZA 3UG4A 4HMDA 9CGTA 4U33A 2W5FA 3THCA 5A2CA 3VIOA 3SCTA 1MVYA 1C8YA 5HNNA 3SCVA 1JI2A 3CHFA 4AZCB 2DPEA 1W2PA 5M03A 1KWKA 1JL8A 5CZKA 3GTNA 2F7PA 3LRLA 1A3HA 4PMNA 2CERA 4H8UA 3SEPA 3ZQ9A 1R7AA 2G3MA 5CSYA 2J25A 1E1EA 4YHGA 4AZBA 1O7DC 4OOUA 3LPPA 4A4AA 2VZVA 4AWEA 3AIEA 2E3ZA 4BF7A 1TR1A 4RE3A 3WDIA 3GXDA 1GW1A 1NP0A 3LRKA 1HWWA 2UWFA 1PS3A 1PIFA 3MMWA 5DF0A 1U2YA 4ACZB 4FNTA 3U7VA 4AZGA 5A6KA 5BCAA 1GOWA 1QVBA 2WB5A 2DH3A 2XJ7A 2PB1A 1JF6A 2VR4A 3HG5A 1RD6A 5M5DA 3EJSA 3OG2A 3D4ZA 2VNCA 3W6MA 4CCCA 5FD0A 1NWSA 2X2YA 3BUIA 2ZXQA 1H11A 4CKQA 1Q6GA 2EABA 1UKPA 1JDCA 3N1AA 1JNDA 4MB1A 5I77A 3N15A 3AS3A 1J12A 4HZ8A 5AYBA 3PHAA 1GVYA 1E1FA 1GJUA 3AMLA 4AZ6A 5BXPA 4X9YA 1JI1A 4WKHA 4XX6A 3KL0A 3RCNA 2EPLX 3AIQA 5ECUA 1HKMA 3BVTA 3LXCA 1VJZA 3VVGA 3WEZA 4MNJA 3ZIZA 1UKSA 3ZR5A 1JZ4A 2XWEA 2PBOA 1HP4A 4ZENA 3DYPA 3CZLA 1SZNA 1I75A 1C7TA 3QR3A 3BCDA 1DWGM 5HXMA 4BQ3A 1K9EA 3VGBA 3VD7A 2F61A 8CGTA 4KGLA 2XM1A 2XVNA 3ARTA 5A3HA 2J7CA 3AYRA 2VQTA 1US2A 4GO8A 3VIJA 4BA0A 4E2OA 1UH4A 3CUHA 3A21A 3ZJ7A 2Y2WA 3VILA 5A94A 5JIPA 2WNWA 3RILA 4BQ4A 3RIKA 5A8PA 2VZUA 2QHAA 2EADA 5GNZA 4OJYA 3W25A 1XH2A 4UFHA 2JFEX 3WBEA 1B30A 1E6RA 5CLTA 2VC9A 2CBUA 2W61A 2WC4A 3FNDA 2VT0A 2E9MA 1HJSA 1HXJA 3GNPA 3AISA 1R75A 5HOSA 4W7UA 4Q22A 2CNCA 1WKYA 3T2PA 1E3XA 5CGMA 2VMFA 1MQQA 2AOSA 3SCSA 3VIIA 2A3CA 3AS1A 2X2HA 1JFXA 3O6AA 4J27A 4W84A 4HPGA 3IK2A 3WQ5A 2BXYA 1VAHA 2CITA 1TQSA 2W92A 4CVUA 3VD5A 3SUSA 3T0DA 2WSPA 3II1A 4UZUA 2ZUNA 5D8WA 1E72M 1VB9A 1CLXA 1CTNA 2PI6A 2CHOA 2YA2A 1ZBWA 3SURA 3GH4A 2NSXA 2XN2A 2X0HA 4XV0A 4M1RA 1HJWA 4HA3A 1P6WA 3T2OA 3BUPA 1JYWA 4EANA 2V5DA 2Y8KA 5A8MA 4U3CA 4N42A 1QBAA 4A3YA 4RE4A 2WHLA 2XPKA 1LQ0A 2CKRA 1V6VA 1LWHA 4FNSA 1QBBA 3CZNA 1PJ9A 3WEMA 1E55A 3FXYA 4Z2HA 7CGTA 2QPUA 1U33A 3L2MA 2VCAA 3VDBA 3VX0A 3BC9A 1DWHM 3AIBA 7A3HA 5I5RA 3AICA 2V5CA 4PMOA 4QP0A 4TTGA 1SFSA 3IANA 1XH1A 1WDRA 4WIWA 1JXJA 3K8MA 4PMVA 3PBGA 3WF2A 2QV4A 4OBSA 4KH2A 1SMDA 4WKAA 2ZXAA 2BY1A 3DDFA 3MUZ1 3WEOA 4AYSA 4L4PA 1MXGA 3MUAA 3ARSA 1E6NA 4FK9A 2FHCA 2WKLA 4CU8A 2FH8A 3ZR6A 3ZSTA 1EOKA 1NP2A 1XV8A 2EQDA 1GNXA 1X6LA 3A47A 1AQMA 1WDSA 1ZS2A 1V3MA 2F2HA 4NI3A 2G3IA 4HTYA 3OLEA 3LRMA 3VO0A 1HL8A 4KRUA 1GOQA 6CGTA 3CMJA 3ARZA 8A3HA 2W66A 1J9YA 3CZKA 1WNOA 1UQYA 2ZUWA 2GJRA 5KZ6A 2EPMX 4BQ5A 2WMIB 1DTUA 4J3UA 3FN9A 4IISA 3VGFA 3BVUA 3K8KA 4NF7A 5A2AA 4WF7A 2OSWA 5AY7A 1VBRA 3WF4A 3MO4A 2G4FA 3BVVA 4J3WA 5IFTA 3PZQA 4GZJA 4JZ5A 3KL5A 4HA4A 2BHUA 1BAGA 1Q6CA 1UG6A 3TA9A 4EK7A 2XSBA 3O9NA 4TX6A 1JZ3A 1B31A 4PUDA 3EJUA 1V3KA 3QGVA 3VGHA 4LYQA 4QLLA 3W38A 3WD1A 1GOOA 2WVSA 2A3BA 3FW6A 1ISXA 1AMYA 3TTYA 3OGVA 2J8FA 4FNQA 3FAWA 1B3YA 1QI2A 1W9DM 2BFGA 5D8ZA 3SUVA 3W81A 1V6YA 1EO7A 1HJVA 3WDRA 4W89A 2FDMA 4E8DA 3WDJA 1T0OA 1ISZA 3ZSSA 1PZ2A 3VDAA 3WELA 1MYRA 3N18A 5FIPA 1VRXA 1E9LA 4PTVA 2F1BA 2BY0A 1B90A 4PRWA 1J0KA 3W82A 3GH7A 1CLVA 3WD3A 1VBUA 2X2JA 2C0HA 2OSYA 1V3IA 2AMGA 2DSKA 1M01A 2J8GA 3WMBA 1CPUA 4J7RA 4MAVA 4JL2A 3A5VA 3WH7A 4UZSA 3AI0A 3LXAA 2XYLA 1UR8A 4MNMA 4D6JA 1XD1A 1IT0A 4YPJA 5C71A 1KQZA 4W7VA 1VFOA 5HPCA 2PWHA 5JBFA 1V08A 1CECA
chains in the Genus database with same CATH superfamily
1MH5B 4IK7A 3EBVA 3WTUA 4ZCWA 1BLIA 1HYRC 1ZIAA 2PTVA 3ABLB 4CC4A 5F9JA 3U9WA 3RL1A 1K03A 2E09A 3QV9A 2OJEA 4KOBA 4U31A 2OZNA 4PV9A 1JN6A 5FLUA 3QPZA 4ELMB 5K39A 2OWWA 4HJSA 2WINA 5C0CB 4EMZA 2YK1H 5IW6A 2V8ZA 3PB2A 2C71A 1BOYA 4KRPD 2V2TA 4CQDA 2UZYA 3KM1A 2ESVD 3O2WH 3F64A 2X09A 4JZNB 5TIMA 1SBSL 3BMVA 1UYQA 1P53A 3UERA 1YX1A 1BXUA 4YDJB 1DJZA 43CAB 1H0DA 4MXQC 1OFQA 4NS0A 5GIRB 1A25A 1CE1L 4Q4EA 5CMAA 4M7SA 3W70A 1TZHB 4JPVL 5D7JB 5ABEA 4AIUA 1FNGA 1VFUA 4FHKA 3CH1A 2P5WD 3LNHA 3HUJA 4NC2B 4TLSA 1AOZA 4Y9MA 1A4KB 1Z66A 5T1KA 1G7PB 2UXVA 4XP9L 4GFXA 2YRZA 4JZNA 3TEXA 3GTHA 2Y8UA 3UZZA 3V4LA 2CLIA 1DQQA 4WTZA 3CN4A 3WMPA 2HBVA 1EPVA 4NC1E 4Z3FA 4CVZA 2YARA 1Q4NX 1QR4A 2JJWA 3MJ7B 4YHKL 5KVFE 4X2RA 3CH1B 3SCMD 1LNUB 3TE9A 1Q72H 2FQGA 2RH9A 3L5AA 1PD6A 1EFQA 3BSGA 5ABDE 1U6AL 2DYPB 1FSKB 5KJ4A 2WB1A 4KDVA 2RB8A 1R6WA 5F97E 4NUJA 4RXGA 1G5GA 3ASOB 1FRBA 2QDDA 4OHQA 4PMUA 1U8LB 3RU6A 1EPXA 2D69A 2HXUA 2BW4A 2XFRA 1HINH 3Q1SH 4EAYA 3DSNB 4H88L 3OG3A 3UWYA 2QVMA 3S7GA 3ULUD 3U2OA 5CC5A 4ADUA 1UTDA 1RURH 3OTRA 4GYPA 2CLLA 3LB6C 4XNZC 4QKTA 3V18A 2GBUA 3ZGHA 5KS9E 3DO7A 4MKNA 4KAQH 4UNKA 2FH6A 1E9QB 1X5YA 1X9RA 4P8QA 1HL9A 3QJXA 1WV2A 2EDWA 4YK4B 3FC8A 3OLIA 4HGMA 4IHBA 4TUKL 5AKVA 4LCWA 1Y0LB 2AK4E 1E9QA 5DJXB 2CNYA 2PO6D 3VSTA 1KELH 1KMGA 2WYZA 1EJWC 2QJIA 5DJYB 4IXHA 3W88A 4DFHA 5F7LB 4HMCA 3GI8H 3ILQD 4EKJA 4HPNA 3QA3A 1PG7W 2XA8L 5ABGA 3D3VA 1BQRA 1KPVB 1KN2L 1I8UA 3IU4L 3L9EA 3NRQA 4DUWA 1GGBH 1CO1A 3DHUA 5TJWK 3S35H 1H51A 1OFDA 5BZZA 4B2DD 2X1PA 3SGDI 2BVWA 2P8MA 4JKKA 5CGYC 4FA6A 1BOGA 1T6WA 1QFUH 3WNJA 3D3AA 4QRPE 5C0IA 4JZOA 4IRJB 3DHPA 3L45A 5DYOA 5KVGH 1SGJA 2WHKA 4IFKA 2CJSA 5DUML 2F53E 4AW4A 4F7MA 3O6FB 4X4MA 1ROCA 5C3TA 4ZMTA 1CK0L 3TBWA 1BQGA 1YEJL 4INFA 1AZBA 3AREC 3ML8A 4HHMA 4L4LA 1KOAA 3CM4A 3W1TA 3ES6B 4OIIL 3TVMC 1IBFA 2FWOA 4PJ7B 4M1CD 2V7NB 1NPJA 1OWQA 1U8NA 4NO3B 2N7AA 32C2B 3VFNB 3WUWG 5E8OA 3U36A 1LUCA 4UM9B 1J6PA 1ZHBA 1ITXA 3BW2A 3K71B 5A5WA 3WD4A 3PFMA 2Z93A 3LLDA 3UU0A 4FF9A 3HE7D 3K1DA 2ZZ5A 4PRIE 1CE6B 5BS0D 2X1IA 4K94C 3HRZB 1V03A 2HV5A 4XUGA 4AQAB 4IFOA 5EZJB 2C3VB 3WKML 2V0AA 5E8OB 3U36B 1LUCB 2XBZA 2B4GA 3L5MA 2Y24A 1NIFA 4W6YB 3NGJA 1RV6X 4ICNA 4NAEA 3WLLA 4B9JA 2XT1B 3ALXA 3HN3A 3LQAC 4DGVL 3B9DA 3M0ZA 3AT9A 4AXWB 5CG0A 4B4HA 4TVSa 4RBPH 1TQXA 3O8XA 4NT6A 4LL1A 3PP4L 1OE1A 3JQOB 5C0BB 4PCFA 4Y9OA 5DMMA 2ZAIA 3LKRA 3N6JA 1A3QA 3NZHL 3FO1A 3KJ4B 4OCWH 2AJXH 3BGFB 1W9VA 2WHVA 4M5ZL 1KCLA 3B4YA 4WGWB 1NIUA 3UYIA 4Q8TA 4WI9A 4Z2KA 1PKQE 2H6PB 2DFAA 4QF1A 4RW5A 5LIXX 4IEFB 2VDOL 2XQ0A 3WNLA 1OIFA 1FHGA 2X44D 4WHDA 1UT2A 4XAKE 5AW2B 3CSYA 4XZWA 5MERB 3VUAA 2GABA 4EN3B 4UV4H 3D39D 3IEAA 3G5XA 2GTZA 1SDDB 3M16A 1JZHA 4XMPL 3U0WL 3K46A 5TE4L 1GVQA 4J2QA 5H35A 5FKAB 4GYJA 2EEXA 3A64A 4NRXB 1K7XA 5GRVL 4LDEB 5C9ZA 2A6KA 2NY1C 4G70B 4G9DB 4BFGA 1W2KT 4ZS7L 3LGGA 1A6UH 2Q2EB 3WTSA 4LEFA 4RX4A 1DQML 4OF8A 5K9KB 2AW2A 1BWMA 3QUZB 3QWOB 5ID1A 1S5TA 4LASL 3NPSC 4UQBA 1TV2A 5I30H 1ZBCA 1FJ1B 3MSGA 1WAAE 2V9UA 4PJIA 4FABL 3MNVB 5DYFA 4KTDL 4G9DA 5D1QD 1D5BB 2KZHA 3PBUA 1AD9B 4AVFA 1S5HB 1IAKA 2QGDA 1KPUB 4NRZA 1D7DA 4UR8A 4Z2IA 3KEHA 4JQIA 4L1TA 8XIMA 5HDLA 1UOWA 5EZOH 1L7TH 3H9ZA 4JG5A 5IVZB 3SYOA 5IROD 5E1AA 3UZEC 4X9SA 1SDYA 2E9IA 3LKOB 2C3ZA 5IBXA 1CLZH 3F5WA 3IMUA 3IS1X 1J2BA 1HHIB 4DGYH 2CUHA 4LMQI 5BRZA 4MB3A 3VU1A 1FNSL 5DVMA 1U91B 3VKAA 3MJGX 5E9DB 3P54A 1T03L 4QXVA 2CAKA 2VTFA 1CXKA 4KBPA 3WN5B 3FDKA 5D7SL 4UF7C 1PQZB 3NDYE 5JTWA 3LTYA 4ZEPA 2Q8BH 2CO1A 3MX0A 4ISVB 5CEXB 5I1IH 5I6XB 1AS8A 3L3GB 4AKQA 5G55A 12E8H 1JSYA 5GS0L 2PLTA 1TTCA 4PN2A 2YUXA 3MRMA 4WV1C 2AS5M 1DLFH 5BU9A 4L8BA 3TP4A 3GLAA 4DPAX 4JTDA 4NZ8A 2GK1B 3U7AA 4DQOH 2VP8A 4NAFB 3WUWB 1TPH1 3GD6A 3M5YA 4N8CH 2XIBA 3L3GA 3II3A 4K71B 4MSWB 4HZ7A 3EYFA 5EFFA 1IGJB 2YMOA 3AITA 3L4XA 5ESVA 3FRUB 5KTEH 3QBUA 2EIDA 1U9KA 2WOBA 4K71C 4OZFA 4RZCB 4KF1A 3LN5B 4JY4A 2C9UA 5I8EB 3OHIA 1WUEA 1ZS8A 1RZIA 3US0A 4ZXBD 4YBHA 4DBWA 3QJFB 3FCBA 1SPQA 4NI8A 2Y7GA 4J8QA 5IBLD 3HRZC 3WS6A 1UROA 1JS4A 4UNVA 1TIMA 1ZQ5A 4YL2A 1KTBA 1GPFA 2Z2BA 3X17A 2AJ3A 4E9XA 2RGSA 4KTEH 4UQAA 5JHLA 3AQYA 2VEFA 1MQPA 3RNDA 3HI1B 5ABHA 2ALWA 2LAAA 3B9EA 3MNMA 3WOVA 4D0BA 2GKIA 2CE6A 1JXFA 3QHNA 1Q2SA 1BZEA 3PGCA 3N5AA 4OB5H 1VACB 2WLIA 2EDKA 3CLFL 3ROLA 3NQ8A 1VKXB 3MLSL 3CZ8A 3SCQA 3D87B 4P2QD 3EBGA 3GVGA 4OTKA 4GFSA 1NDGB 3HMWL 3U83A 5BS0A 2JLLA 5JIMA 1SVCP 3IGSA 4ADJA 3QCUL 1NICA 3QZAA 4ELDA 2R39A 1GW0A 5DURD 4RE2A 1P4BH 3ELQA 5GZNA 1O9WA 2G2RA 4M8QA 2NY3D 4G8FB 4L64A 3H1ZA 4DO4A 2BOCB 4G43B 1UCBH 4G8IA 5KS9B 2AL2B 5C7VA 4NBXB 5FDWA 5HHXL 3RL2A 1FL5A 3P60A 1CGVA 2MNUA 3CK0H 3AS2A 2VZ3A 3O41A 1E30A 3VI3F 3VSUA 5KBPA 2PTXA 2XUCA 2I69A 2F74A 3QC3A 3NO3A 4ODSH 2ALDA 3DX7B 4YMPA 1R85A 3WMCA 1R9XA 2QQ6A 3BFOA 5TH2A 1AZNA 2Y7QA 2IFFL 1SM3L 3NIDF 5FKPA 4L1WA 3WJMA 3S5LA 1T89C 1U1HA 3VDBA 3AYSA 5BW6A 1RZQA 2V5KA 4RDYA 3MRPA 4AMKH 4W68A 4NN7C 1IE7C 1P48A 4OAWB 5JXQA 1Q6QA 4FA3A 4O2FB 3VWJD 3GIPA 4BSWA 3H2MA 4XTDA 1DJGA 2XVLA 4PJBB 4PJ5E 4JGNA 4OCRH 1PLBA 1EP1A 3GDLA 4X0KB 1XCQB 2A6DB 4MWAB 1NKRA 3C09B 1YJDC 4L8SB 4WI7A 4PB3A 2ZPKH 3CFJB 1F7BA 4J3XA 4U6TA 5D8JH 2F7IA 2J9YA 5AHFA 3LY6A 5BXRA 1YO4A 3B7TA 1TZIA 4LXFA 5FUOL 4YSEA 1HKKA 3B56A 4A6GA 1CFBA 3VG0L 1E0WA 4BSVB 2YZ5A 2GVGA 4QAMB 5DD6A 5DCCA 4FXFA 2F7QA 4KKCC 4L8SA 1WBJA 1ASQA 3NJMA 4YR6A 3HC4H 3RGHA 3SGJA 4LCQA 3L1EA 2CO4A 4OFIA 1AKJD 3RVUC 3S5SA 4XX5A 3TX9A 4Y4KC 2NX5B 4GY0A 4TLTA 2Y22A 3CLWA 2NZ1A 5HMEA 3K72B 1I60A 2JH2A 4K3DL 3VXRA 1XSOA 4IYKA 5DJAA 4JQIL 1SSDA 2NXZC 5MEQA 4OKVA 1RA5A 4YE4H 3CK0L 3DEQA 1YSOA 4FFTA 3TA4D 1WEJL 5HYJD 2WUBL 2NZLA 4CVZB 2D22A 3WBWA 3FYIB 4JY6A 1RJPA 3OVRA 3IPBA 1AH3A 1I1AB 2Y6SC 4HWBH 4WI4A 1E5NA 4A3HA 4L1SA 1LO4L 5FYLE 2PDNA 2WO4A 1TUPA 2YLAA 4KJQC 2HRGA 3S36H 1IT7A 4OVXA 5FYKH 2EKJA 1YHTA 3VDCA 3D6NA 1RZFL 4JQ1A 4KTDH 4Y8DC 5J1AA 1WXJA 3UETA 4DWSA 2OMUB 4GKZA 1FN4A 5L9DH 1HEJC 1X5XA 1MI5E 3RTQC 1TQBB 5DS2A 3S8FB 3A3XA 2DL2A 1FVCB 1QAPA 4C60A 4XISA 4WFED 3WL1A 3EJZC 3ZPDA 2CBQA 1W80A 4KDTA 1G4RA 1TJIH 3D3VB 1QRNE 1XBRA 2BS8A 4OJFL 2I1OA 3NAAL 3RA7H 4O00A 1XGUB 2OW7A 5EUKA 3O4LD 3VXUE 4ACPA 1G6CA 1PS9A 3VH8G 2OEJA 4XB3A 4GZEA 4XAWL 1NAMA 1CDYA 1AI1L 3OGCB 1BYBA 1G5AA 4W87A 1A6VL 4XMPH 3R2GA 2J7EA 4HN4A 3RDKA 4KZEH 4EXBA 5HR6A 3TF4A 3SDAD 4CNPA 4G72B 1A53A 4PRAB 3DG3A 4U6XA 3S37H 1FPTH 3MCG1 3W73A 2ONEA 4PSRA 4I5BA 3TBTA 3KYOA 5CBIA 5DC2A 1RUQL 1H4PA 4HU2A 2DY3A 3UZXA 2PP3A 1BZ9B 1T99A 4OGAC 5T3ZE 2BVUA 4L29A 5CIPA 1CI1A 1GTHA 1LO0H 2X9ZA 3UO8B 1XUZA 5FJJA 4WDTA 1Z89A 4JFUA 1UUQA 1MVFA 4LRSA 5E0CA 3T09A 4L4TB 4HHGA 1LE9B 1F74A 4DLFA 4IMLA 5GRVK 3WIFA 3AAZB 3AY4C 3LCWA 3PANA 5DY3A 4JVUA 3AOFA 3F7KA 3JBG7 4KROB 3IDIA 4CU6A 1P0BA 3CD4A 1OD0A 3P0YH 4QHMA 3V0HA 2ADGA 3HPJB 4G7YH 3MLWL 4EEEA 3PRZA 2Z00A 4NQQA 2O56A 4XO9A 2DUAA 2QNEA 1N5AB 3QULB 2ZRUA 4U1NB 5KANG 3BO8A 4GX9A 1AE6H 1FFTB 1A4CA 1BHGA 3F58H 3NH7L 3QDGD 1R0AL 1MRDH 2XKNB 4HUXA 4HJIA 4HK3J 1G9EA 3HFYA 4AL8C 4H9YA 5HHME 3QIWA 4TVDA 1T83C 4XBEL 2QSTA 1H7WA 5H94A 3CE1A 4XVSH 1BJ1J 5LBGA 2WBKA 1KCZA 5A2FA 2ZRVA 3IIXA 3W0KA 3VGAC 4FYQA 1A4JB 5ANMB 2NLIA 4OFYD 4XP4L 1CXFA 4HIXL 2AJVL 2V3DA 4HUXB 4JN2B 5ALBL 5KS9F 2TSBA 3UWQA 1NL0H 1G7JA 2AEOA 3CX5J 3C8FA 2N1KA 3EOUA 4Y8FA 4WOQA 1A3RH 5CINL 4MZRA 5EO0A 2HG5A 1SHWA 3T3PE 3QRGL 3IJHB 5AW5B 4BR1A 4O9HH 1DE6A 3DBXB 1LO0L 3NA4A 1A5BA 3KXQA 3PZTA 1UA3A 1OAJA 2NYZA 1AG1O 1OABA 4FLSA 1YEGL 4HSHA 4P7RA 3SJ3A 1XF3B 4Z17A 3UNDA 1SJVA 3N44B 5LCVH 2WZPD 2ZUSA 4FFWC 4BH7A 5FECB 1EJSC 3NPUA 1MFAL 1R5VB 2AQQA 3O3DA 2JXMA 4QRRB 1A7NH 2HKHH 2WYTA 2IDTA 3FDGA 5D9MA 5TPWH 4P5RA 2R56L 4EF8A 1P84K 3ARDA 5B3NA 2WVVB 5MF5A 2PMQA 1K02A 3MOAL 1GGTA 3GC2A 3SGZA 4KY1H 4YDIL 5FHAL 5H35B 4DI8A 1ICTA 4PRPD 3MYPA 1DVZA 3U9IA 3T9PA 4DVOA 5IMLB 3RB7A 2FQDA 5I0XA 1ELSA 3FK4A 3OJ2C 3S6OA 1KCUH 4FB7A 4OUEA 2BDQA 1VRSA 2HUHA 4CADB 4EUPA 4XZUB 5E8EA 3GUTB 3D2UA 1E4XL 4KV5F 1JGEA 2ADIA 1ZXKA 4QWWC 4S3EA 4PVMA 5T3ZD 1AJ2A 4G5ZH 1ZWIA 5DVNA 3HPXA 3TNMB 5SX5K 5GVJA 1AANA 1H5BB 4GUPB 5E08L 2PD5A 4KXZI 2MPAH 1V0NA 3LEPA 3F2BA 1AQDB 2NNCA 4X7SH 1E0TA 3POHA 3P9LA 4FNPA 1XDTT 4NLHA 1CB7B 2YZ1A 5L9DL 1ZRQA 1IBGH 5E9DA 1KPUA 1SUJA 1XEUA 3DSFH 4P5TC 3FQWB 4FTVE 1QRKA 2QW5A 3CIXA 1CENA 3K6SA 2UY7A 3JWDC 1GQJA 1JDDA 1NDVA 2BSRA 1G7VA 3EB2A 4GUJA 4XODA 1JAEA 1LK2B 4CGTA 4DT2A 5HHQB 2EPKX 2WUBH 3RXZA 2ZTJA 5BUPA 3B8TA 1PXGA 3W1LA 5D71L 1RHHB 1JWUA 1V93A 1LK2A 1DYZA 4RUBA 1CF8H 2PLCA 1IZKA 1IQDA 5DRXB 4O51B 5DO8A 2GJZB 3H9SE 4KQ3H 5HANA 4ORZC 4MWAE 5JQIB 4FTVD 1MI5D 4HIQA 5GS0D 4NJHA 4J3OG 1MNUL 5TAOA 1IGJA 4UQ2A 3I9GH 4JO2H 4LGPB 3GO2A 2H3NA 1TV5A 1T7YA 3QZLA 4OT1L 3WQCA 3BWWA 4HBQA 2YK1L 2OQJA 2ZOKB 3ERXA 3NEXA 5MEPB 3RGVB 3APYA 4E2VA 4X4YB 2FATL 5E8PA 2AJSH 1X1OA 4QDPA 2CJ3A 1MREH 1PKQA 4EI6A 1S1RA 4PJAE 2OI9B 2DT0A 5E8PB 2EH7L 4DN3H 1K4CA 4M1BA 5ABAA 4AT6A 1PYWB 4ZMAT 2OULB 5D2LE 1LO5B 3PJWA 1F4HA 3NQBA 5CJNA 3S37X 3VFGL 1PYWA 3WKNA 2C79A 3REQA 1EVTC 1W15A 1NCCH 2OL3B 3KCLA 3L1FA 5F3FA 5JHLL 5JBEA 5C0GA 3REQB 2BC4A 1PO9A 5XIAA 1SFHA 4HUMB 2GB2A 4YK4C 3VVVA 3COOA 1TEYA 1PU0A 2K7QA 4XOEA 4PJ7E 1ACYL 5CUSL 5KVEE 5JOEA 1UXSB 2PU0A 1F4YL 4XVEA 3ZJ6A 3FB8A 5AUMA 2VM9A 2OCJA 4U1LA 4UINH 4OVUA 2OJ1A 2AAMA 2IKHA 3VH8A 1YMMB 1D9KD 3FFDA 3TBSA 5SV4A 2AMXA 3BWSA 3T8XB 1JRHL 4YDLB 1T5KA 4Q4MA 5I28A 4JHOA 5E6IB 4R6UA 3D3VE 2PCPB 1ZDSA 4UDTB 4FIQA 3S3PA 2VEMA 3RVXC 4RMUA 5HQLA 4TV3A 4PJDA 1WAEA 4HS8H 5EZLB 4H9TA 1IVTA 5F21B 4FFVC 3WQDA 1FA2A 1NQKA 3P02A 3LMJL 3OOQA 1FVDA 3HB3B 4JW3A 1D3HA 2PCPA 1YTEA 1PG7H 1ZA3B 2XZ9A 2IDSA 3A3WA 4HNNA 3SDCD 3ETTA 4MSSA 4RJEA 2WINB 4IDLA 3FUHA 1MDLA 3SY1A 1ADDA 2CZVA 2R1XB 3ULVD 2Z29A 4R53A 3CDZB 5A40E 3PTQA 1JCYA 2CG9X 5E0KA 4UMSA 4F8QA 3EGDA 3P2BA 4PJIF 1A0EA 4Q4KA 5DS8B 3ESPA 2FLIA 1ZENA 5I2IA 4CQ9A 2GSGA 5CCHE 1XRVA 1H5YA 4C6NA 1M3IA 4M7LT 1YQVH 5IQ7L 3BVWA 3MCNA 3WEAA 5FF4A 2QELA 4ZQKA 3G0SA 3TR9A 4DO6A 2CA4A 2OO6A 3KAOA 2IGTA 2IOMA 3UZJA 5GGRB 2OCFD 3QCTH 5DEFA 3VM5A 5SX4I 3Q45A 4LY4A 1NSNL 5CAKA 1P9MA 4V2XA 2C26A 1FVPA 1HHHB 3GZPA 2QUMA 2I9TA 1G7IB 3N41F 5FEWA 5CEZD 5D5MB 4O4YL 4AU0A 1IT8A 6XIAA 2BNRD 4FZ8L 5AW6B 3P3UA 2FZBA 4GNVA 3DXAA 4JO4L 1ZHKA 4FERA 3G24A 2E5BA 1V5JA 1TA3A 2H26A 2QFRA 3WGVB 1SZGA 5A7EA 2AQPA 3NQGA 1CFNA 3LBMA 2QGYA 4B5TA 1L8NA 1BD2E 3QZNA 1KRAC 2ZSVA 1LNUA 3R4RA 4HUNB 4IU3A 4LHUB 4N8PA 5ANME 5FGBC 1ETJA 3R0KA 4P8UA 3OMAB 4TQHA 1FWCC 1SW7A 2IAMC 3VFRA 1M68A 3KVDD 3QV7A 3QUZD 5E9XA 4U3AA 3BGMB 4F33A 4L6HA 5I8KH 3TJ4A 2AZUA 4JO3L 4G8AC 3WL9B 1R87A 1OBAA 2XICA 4IGHA 5I1GL 3IK4A 4FLQA 3RZCD 1DV7A 2E7LA 1FCGA 3N1QC 4KCTA 4KFZC 4UAOC 2NVDA 2O26U 3RPTA 1KJ2B 1BGGA 3C5JB 1CBVH 5LKYA 4GAFB 5I1HL 1ZVHA 1S7QB 4ANXA 4XXCC 2B31A 2GOUA 4HYTB 4MOZA 1RIVL 4WO4D 2JQZA 1D2KA 1KTCA 4LUSA 4NZ1A 2UYLB 3MSPA 3WI9A 3RDTC 4QSFA 4HFUH 4OF5A 1VFMA 5DEJA 1RHFA 3T2LA 3TNNB 1WGOA 3LOTA 2R1YB 4ACYA 2Z31D 1V27A 4YO0A 1EFXA 2JV6A 3VNZA 3KOXA 1C9WA 2EVHA 3KTSA 2IBGA 3D4YA 5FO9B 2PTDA 3DFQA 1KGXA 1AZUA 3HN5A 4M8VA 4BK5A 4WVXA 3VZXA 5EORH 1DBMH 3KXFA 2CETA 1EUTA 3ZXAC 4Q32A 1KC7A 1FGNL 3DVNB 2E6FA 4PN6A 3GC5A 3SQBB 1KLGA 1G7HB 2FUQA 4NN6B 2E59A 5AW7B 5J6HA 2BNJA 2YFNA 3QR2A 3EX6A 5D4YA 1GW6A 3I6GB 3TIDA 3A4WA 4JVWA 4LOFA 1VF8A 3PWGA 1JMZA 4GKOA 4Z7OE 4B9IA 3OZPA 5BOOA 5KBKA 4EZMA 1Z3GL 5B4MC 5DT1L 1HCZA 2DRUA 1ETZA 4JFTA 5EU5A 5F71A 4JQ3A 1RZKH 2Q3ZA 2HUEA 3OODA 3L4UA 2BGQA 5H91A 2C15A 1IV8A 1TE1A 2GJXB 4NXSA 5ACLA 1NC2A 2D03H 1BFVH 3FX4A 3BIAX 1FWAC 2KT6A 4LVNB 3PZ9A 4AQAA 3CFBA 2DZSA 1JF1B 4F80A 5LA1A 5F0LB 2K8MA 3N29A 5CBEB 4KESA 4Z7WB 1EIXA 4RAVB 2K4AA 3LMYA 4M7JL 5IMKB 4R0LA 2HFEA 4HG4K 1S8DB 1ZTXH 4KRNA 1LBLA 3H9HA 1WBXA 2W0LA 3I75A 4GSDH 3TN0D 5CFHA 3W0WE 4IMEA 2VZSA 4EZLA 3U7BA 2B15A 3KGUA 3MO1B 4LDOB 4ZK8A 4ZO7A 1UWQA 4WFGD 2IC2A 2UXFA 4Z7WA 5DJ2A 4ENZA 5KYNA 3HE6D 1JCXA 4IRZA 3QFEA 2X9YA 1CBGA 5FL1A 5JIWA 4R0LB 1HJQA 3VA8A 2VLJD 4M93C 1Y7VA 3MRCB 5FGCB 2K6YA 1F11B 3IDNA 3JWOH 1RK6A 4WLCA 5D2LB 1TVBB 3HOGA 3CHPA 4C6KA 3P8JA 1FAKT 3CVHL 2PC8A 4LPYA 2OS7A 3KXFE 5DJ2B 3EDDA 4YQXL 4OLZH 5IB5A 2V17L 1IM3A 1PHQA 5IK3A 4EN3A 3ULUC 3AB0C 5LXGL 5ID0A 2NR6D 5H8UA 1A9VA 4FTDA 4MF4A 1WS8A 5C6WH 5D8JL 2WC3A 1DVQA 1Z9OA 2J43A 2YQ2A 4FQXB 5JOPD 1ZWIB 4CD7A 1K4DB 3MACH 4L7ZA 4C5ZA 1YTKA 1S5IL 1YUHA 5FACA 1NDWA 4GG6A 2VR3A 2A4CA 3QYCA 4HT1L 1AH0A 4F27A 2AJXL 2FX9L 1YXDA 1M7OA 1T6VN 2PBGA 5BVJA 1KJ2H 2QV5A 4P9ML 1B3JA 1E4NA 2D3NA 2Y06L 1H3TA 4FQXA 3V5FA 2O93L 4TLUA 4MJIA 2VC2B 3N41B 2HX8A 1P7TA 2WXHA 1BGAA 4KWOA 1FLRH 1RUKH 2A83B 3AG2B 4ZB0A 2Z27A 1TIWA 2I7SA 4KJWC 4MD5B 1PX4A 2WMPA 4YEEA 4YH6A 4AM0B 3E2VA 4NM4L 2W95A 1UJ3C 1BZDA 1JJUA 4ICXA 5HHXH 2G41A 3QHOA 4JQXA 2XH2A 1LP6A 1LRTA 4PMYA 3KYNA 4I87A 2QCFA 2FZ3B 2DOCA 2WJZA 4B41A 3HV8A 3AY2A 5C0AA 1E9YB 5BRZB 2YJQA 4ATWA 3B83A 3ZKMC 1ZGLM 2PSNA 4OCMC 4KX7A 2Y89A 3K5XA 3N3TA 2R2BB 3OV6A 3MC5A 1QW9A 1R38A 3S0CA 1CYXA 4MDIB 8RUCA 1GAFH 5LA0A 3V7MA 1Y5VA 4NKMB 4C1KA 3A5FA 5D1XC 1PLGL 3KP1A 1LLAA 3PPSA 1J86A 4FQJL 2YAHA 4OM1L 4HLZH 4L23A 4PS4H 3WS6C 1ZGLP 2VCCA 3IACA 4K8EA 1J10A 3KPLB 2AQWA 3UZ5A 2MNWA 4FQCL 1Q0EA 3BGAA 4NB7A 2DD8H 3SGEH 1BVWA 3QIBC 1T20B 5C08B 1KFGA 1UC4A 2YUZA 1V6XA 1BLNA 2ENYA 2G5UA 3NQEA 3HPLB 1B6DA 1T0MA 1A9EB 1GZQB 3FEQA 4BWTA 2GK1A 4DPRA 4UCGA 4MADA 5FV1L 3MXVL 3LSOA 1Q94A 5BZDB 4ZA0A 4P23A 3ZTJG 1K4CB 4Q74A 4FQ1L 3NTCH 5DHVB 5JLZB 3UJFA 2G60H 4RZCA 5B7MA 5J13B 4PWFA 1HZYA 4LT7A 5MI0C 3VFUA 3OG6B 5DGRA 4GQPH 4KI5E 5DUBB 2IBZY 3QJFA 4O2EB 1OZUA 2F5AL 4OGQC 5I5IA 2WBJC 1T7WA 3BPNC 2HRLA 1MCKA 1MCPL 5C6MA 4BA8A 3INOA 3JV6A 4O2EA 3RFZB 4XMLL 3FHEA 5A2LH 5EMUA 3BLEA 2ICCA 5EO1B 1PNDA 3VXSB 4ONVA 2ZOLB 1PUDA 2XWTB 3RTLA 4ECLA 2Z1SA 2R2CA 3BZ4A 3S97C 3WUBA 6XIMA 2QSVA 3SCPA 2GJ6B 5L88L 2YDRA 4DO5A 1W8NA 2XV6B 4QIRA 3W27A 5BOEA 2E8YA 2P7TB 4YSOA 2Q8XA 5HR7A 1REQA 1RQEA 1DPMA 4BJLA 2WKOF 1KCWA 3KPPA 3I7RA 1NGPL 5CCJA 5MHSD 1L9QA 4AENA 1N3NA 1KCKA 3SO3C 4XP5L 4YUEH 3TIMA 4AISA 5FO2A 2CQVA 1XGPA 3HN8A 3OKYA 1YNTB 1YPZB 4KROD 3SO3B 1U8CA 4F9PC 3JU2A 3CVHH 3HR6A 1SQ7A 4DP5X 1RJLA 1SXAA 2DM4A 3HOJA 1HXYB 4LAOA 4S1QL 1WJ3A 2AXWA 2OLHA 4DK6A 1DSFH 4XOBA 4F7EB 3MGAA 1LWJA 2VHLA 2Z4GA 2OOFA 3E49A 3MMDA 3BKMH 1EF3A 5IROC 3I3DA 3QXUA 4UAHA 3MDJA 2YMTA 2VJ0A 4UOQA 2CESA 3MRKA 3D9AH 1PTDA 3FJ4A 1ZJBA 3DRTB 3I74A 1PCKA 4OLWH 3HBLA 3GRGA 4GIRA 3LKQB 1S46A 1YEJH 2ZBTA 3D85A 3WY1A 2A38A 3MLTB 3SPCA 7TAAA 1M9HA 2J9ZA 2YB1A 4P2OD 2MCMA 4WFEE 2EDDA 5CN2A 5E4EB 5BUAA 3R6IA 3B2VH 2FJGA 3ZDWA 1E50A 1U93A 1FE8L 4JX5A 4OD2A 3DU0A 5D7KD 1X4XA 3ZTNH 1DIOA 1RFDL 4Z7OB 4JE4B 1ZHKB 5TE4H 1ENUA 3VXRB 1O0VA 2ADAA 4RNJA 3A4AA 2R29L 4J3OC 4BSVA 4X6FA 3EYUL 1HP5A 1AHKA 1LP9A 4Y2DC 2WYHA 2F58L 3LDBB 3CZSA 4R4FL 2ISDA 4EDWL 1ADQH 3VB9A 2AXJA 1XGTB 1RU9L 3GMNB 3QJHA 4YR6B 1MWOA 3ZYJA 5D5MA 2WLLB 2TPSA 2WZ0A 4UOZA 1O6VA 1XGTA 5K59E 4JJ5B 4TQ8A 3AFBA 3KEDA 4MZ1A 1IEQA 1FI8C 5DSCA 4GXMA 3W7KA 2RJGA 1DIDA 2IXVA 3UBFA 2GVEA 4I6KA 3VACA 3K1KC 5DK0A 5I09A 3WQWA 4H25A 3CH8A 4HV8B 3TN4A 4LLUA 4DAIA 3FU7B 3ALPA 5H8MA 3U2ZA 4XWOC 4K1WA 2WO5A 1QZNA 2L7QA 1ZE3C 4OECA 1ZV5A 4HWEL 1JIBA 1FP5A 2VL5B 3QP3A 3WJJC 3RO6A 5J11C 3UGRA 4GRWE 1RK0B 5BZWB 1S3TC 3F5KA 2VWEE 2P4AB 2GHZA 3PNZA 2AV1A 3QORB 4ZUSA 4ZTEA 3C5JA 2R7EB 4Z7QE 3KBVA 1KCXA 1G43A 5JIDA 5HUPA 1HNFA 2DYPD 2H3DA 3BIBX 3BN3B 4H0HB 5KYUA 4XP6L 4H0GA 4PHZA 3RP1A 2NY3B 3N6QA 3U30C 2Q1EA 4V1YA 4WCYH 4L6OA 3SCOA 3CYJA 5E24E 2YD7A 4GSDL 3ME0A 1Z6KA 4PP1C 2WZHA 1DQQB 5HDWA 1FWSA 2VRQA 3QFWA 1IRAY 3W1MA 4V33A 3A12A 3LV5A 4JFZH 3MC0A 5I8KL 4MJID 3L81A 1KKRA 1F3DH 2WQSA 3L5LA 5ABFB 4AITA 4WEVX 4FFYA 5SX5H 3RB5A 3SKNB 4H9ZA 5CZ0A 4HNUA 3WIAA 1JNNH 5CU5A 1WFMA 5KYWB 4JQXC 3FTVA 3HZMB 4N02A 3BZ5A 3WE1A 1G9ML 1YMHA 2XXGA 1OTSD 4M24A 1SO5A 1XDJA 3P62A 1J18A 4DM1A 3ZZLA 3KM2A 2WSDA 4AIXA 3C61A 3DNKA 4YSUA 2FUTA 3NVDA 4PGDA 1UVQB 5TQ0H 5M1TA 1JK8B 3ISRA 3PCYA 4KUCD 4P5KB 4AEHH 3NXFA 1F13A 5D93C 1QK2A 3LQLA 1X6NA 2QQNH 4NILA 3BT0A 3D50A 3RGVC 3ZE2B 3NL3A 3DGGA 2L0DA 4TSBH 2HSAA 4KKZA 2CXGA 2JF6A 3S1VA 3DV4A 4QMEA 1I1XA 1ASPA 3U2EA 1U5HA 2OR9L 3TTOA 4GP4B 4IUOA 4NM8H 3SPIA 1BG4A 1QMLA 1BTCA 2Y3AA 2CDGB 5EV7A 3APGA 4MA8H 2E7BA 3FTUA 4R3SB 5D7IB 3UTPE 2E68A 2FB2A 3P6LA 4O15A 1M04A 4KVNH 5EFIB 1YY9C 2FTWA 4NKOA 3X1NA 1NOFA 2O55A 3H3PH 1HCVA 3MRCA 5DQ9A 2F0CA 4F9LA 2VSMB 1YNKL 1HX0A 3GSXA 3IDXH 3PHSA 4I4WA 3QH3B 3GNMH 4X9GA 3KWTA 2Y0SA 5C08E 1TYGA 3L3KA 4B5XA 2VDPH 3D48R 1XGDA 4QR6A 1OF0A 2WOYA 2YAMA 1ZK5A 4LLWB 3KYKH 5FECA 4JQ2A 3BD4A 3LOWA 3GS7A 5EC2B 3UAJC 4BS0A 1MPAL 4MJJA 5LBVA 4J3SA 2VAAA 1YMMD 2YGOA 4ZDHA 5H37A 1FQ9C 2PP1A 3GD1C 5K4XA 5TQ2L 3IJHA 5E23A 2GFBB 3AHXA 3IRPX 3PC0A 5HNTA 5J0BA 3GC4A 2E56A 3DVIA 4V1DE 3UO1H 5HPOA 2M8XA 3TFBA 2C3HA 1F4WH 4PRIA 1VERA 1MAMH 4R4NC 4GEJA 4B9CA 4AVHA 5GHWH 4AMWA 2NSMA 2JKPA 2PDKA 2VAAB 2VGBA 2XN0A 3FU0A 1ZALA 2XZ7A 3CYVA 1QFEA 2GBVA 2GFBA 5B1BB 3D3VD 3I02A 1OCQA 2XIJA 1P5VA 2NYYC 1BYCA 1EEPA 3LIZL 5JBFA 2VD9A 4X2PA 5GGTH 1J9RA 4O14A 5DLCA 1I1YB 3FO2B 2VLLA 5T1DH 2J71A 4MB4A 4F58H 1REIA 3ALGA 5LGYA 1JNEA 4NM8L 3R7QA 1KYAA 5IV2A 1FFPA 2H3BA 1UZ4A 1XIEA 1T7VA 2K45A 4WEUD 1AFVH 4KKAD 4KTGA 1AJZA 1T22A 5HDBB 4G7EA 4XKYA 2BIPA 1QRNA 3PQYB 1R3QA 1J48A 1HH6A 3P3RA 4I88A 1H3PL 5F7EH 4FL4C 5LZLA 3BUTA 4J4PD 4KVPA 3VXPA 3T0EC 2DBLL 3GMRA 3M45A 4I77H 3STZB 1P1XA 1R2TA 2FYYA 2VN5A 4O13A 4AZIA 1FHDA 3BZGA 1H15B 1NDTA 1RI8A 1V7ML 3O2DA 3WSQL 2E9BA 1BYNA 4MGXA 3BD5A 4M3HA 1LDCA 4ZX5A 1MCOH 1S7RB 1ME8A 3BUQA 2QCHA 2KPNA 4S1FA 3EDKA 1KRCC 1XQ4A 3UIZA 2I9UA 1WTLA 1WO2A 4L2LA 2AHIA 5EMJA 1XPYA 4JIRA 1DCLA 3UXAA 1MSSA 4X0NA 4P7NA 2NY0C 2O4MA 5IESH 3DK0A 2CRYA 1FL6A 4O51A 1V0KA 2ZNWA 1H5BC 3VJ6A 1EB3A 2X1XR 3PB0A 1BP3B 1A6PA 1UB5A 3DPBA 3NN8B 4PI2A 5CP7B 3T0BA 3G6AA 2XWJB 3BOXA 5IJVB 2B14A 4Y5XC 3ULUL 4NO5A 1QFWH 1ZLSH 3OKMA 1JYXA 1E70M 1V6UA 1MHPL 4S1QH 2LTQC 1WTGT 1UB6A 3C6LD 5IB4B 2B5IC 5C3LD 3HMCA 4Z76B 3HKFA 2HE5A 2DDQL 1G0DA 3BZFB 5DMYA 1KM5A 1YBQB 1W3LA 3NIDB 2YIHA 1QLEH 4S1DC 5E1GA 3CO8A 4CSPA 1N0LA 3VRLE 3OKMB 1HIMH 2D4DA 2WCPA 2PR9A 1J9TA 1CWYA 4RNRA 2IAMA 3MHZA 4PJ8D 3RWGB 5JPNB 1ZBKA 4YTSA 4WK0B 5LNSA 4H6QA 4N2YA 5E6UB 3IRZA 3GK0A 3UBXA 4HOWA 1YNLL 4L80A 3HURA 1PDKA 2WQRA 4GRLA 2JIWA 3UA3A 2P47B 2DAVA 4XO4A 3QV8A 4L37B 3QKEA 5DT1H 3G22A 4KPHH 5BOJA 4CILA 1OCBA 5ECGA 3ATFA 1D7BA 3QFJA 3LLXA 4MD0B 3TQKA 1W5MA 3V0DA 5IGXH 3LD8B 3MBWA 3JWNE 3O4OB 4AEHL 2BOFX 4NQUA 2K78A 2F53D 4P8WA 2H2PC 1DFBL 4YTTA 3IFOA 4MM1A 3JTBA 2QR0A 1EVUA 5T1LB 1SEQH 4QNWA 4OE7A 3MRHA 3MBEB 4G6AC 3T81A 4PIRF 1VF5C 2P8CA 3NZRA 4XNXL 1UG9A 4QGYA 1HS6A 2X1WL 3LZPA 4XNZB 3KBNA 4TTDD 3KRZA 3V9CA 4P8XA 3JZYA 1UENA 5GRWA 4WIQA 2YQ3A 4HSNA 5EU6E 2BXZA 3PAZA 4O9HL 2YN5A 1OM3L 5HDOA 3EXSA 3W75A 1W0VA 5ABTA 3PR2A 4LRTA 2EYRA 1YYLL 1E0OB 5G4NA 5AB3A 5CINH 3EO9H 5AZ2H 3VWKC 1NCWL 5FJIA 5LXXA 5LAXA 2O92A 4MZYA 5I2UA 3FSOA 4H8WC 1I8LC 2JTDA 3P30H 1W16A 4PGEA 4S1RL 5HGBA 5DS8A 1XIWB 1UR9A 1LTXA 3V0AC 2Y1HA 1TFHA 3D85B 3GSNB 4K38A 1MPAH 1P1VA 1DJSA 5HJYA 1XIWA 1NMBL 3PGDB 4DETA 4XBEH 3TNOA 1H8OA 4GW5B 3TN6A 2DQWA 2ENSA 4TUJA 2OLSA 5IOKA 1XLBA 4ORIA 4XPGL 5E1QA 5C0JA 3CFKA 2QHRL 4KOCA 3RVTC 2Q10A 3V16A 4Z1CA 4QISA 4FXKA 4IK6A 2J6VA 3AT8A 1I7TA 1U92A 2E47A 3DH7A 5F9OL 4NAJA 3ZVVA 1SJMA 2Z7GA 4N2BA 3V3WA 4FC3E 4AYFB 1JPGB 2WVTA 1E9PB 1ZVNA 1A4AA 2O5YL 4Y6GA 4BCEA 3P0YL 4LSVL 5GGVL 2Z92B 2ZOXA 3ZJKA 3QUMH 3K8LA 2JQMA 1RERA 5AKQA 1DN0B 1PAZA 1WZLA 2O7QA 2PDPA 2XFFA 2OYKA 3NSFA 3EYSH 4L8DA 3MZ2A 4P3DB 5D1QB 1YEKL 5FI8A 4FALA 3IGFA 5H37G 2A4EA 5E2VL 3SJVA 2EIBA 4AC4A 2P5WE 5JZ7D 3V95A 2P53A 4L4MA 3VFTA 1QFPA 1JZ8A 3V0WL 1HU8A 3KPSD 1IT9H 1SMAA 2KZKA 2DMHA 1PE1A 5DI8A 2YEZB 3VFGH 1QOXA 1U3HC 2F58H 3B7UX 4C54A 2Y7LA 2RQ8A 3X12A 2UWEF 2VR7A 3CZEA 5I1EH 3KPRE 4QRRE 3LYEA 4QE4A 5C7HA 3B0PA 4JTTA 2HX7A 2XJKA 3SDDA 5HGHA 4JFOB 3D0CA 1DJHA 1PCSA 5HYJB 1KM3A 1TVPA 4TUUA 4IGBC 2QF8A 2L7JA 5C3IA 3H22A 2NZ9C 3D2TA 3M7WA 4GC3A 4OT1H 5J04A 3UX9B 2R7EA 2X2GA 5ALCL 3CJJA 4XZ4A 4PS4L 1A5FL 4KK5C 4X6DF 5F1KC 3SKMA 5ACZB 1O7AA 4JTLA 4FI4A 3QHMA 4LLMA 3L16A 3NZ8B 1HKLL 3EO0B 1ITUA 3KAAA 3N9GH 3R18A 5KETA 2EZ0D 1YNQA 3MLUL 3V8CA 1R5IA 2H5UA 1IMHC 2JGQA 2HKAA 2NNXA 5I1AB 5JPMA 1D5MA 1KBLA 3C6LA 3NCYS 3AIRA 2W9DL 3AMDA 1I1AA 1K9DA 1KXTA 3VFOA 2PP7A 5F1OB 4NT0A 3NZ8A 4PWJA 5I66B 1ECQA 1E8ZA 4DWSC 1KFAL 2V8MA 3KRUA 5I7GA 3U9PH 1EJ7L 1QACA 1MHCA 1S7XA 3M6DA 3NXLA 1UMYA 1FG2A 4DWSB 2YBGA 3EWWA 3S8HA 3O4OC 4JICA 5C92A 1UT9A 2HTKC 1D7FA 3FIGA 1M5WA 4YSQA 2YUWA 1WCGA 2RD0A 4UI2A 3EFOB 1BA9A 4KFOA 1DE4B 1RZKL 2QZ5A 4KFMA 3SDDC 3ZO9A 5IF0A 2VDML 1LLZA 1ACYH 1GR7A 5CUSH 3REVB 4EIZC 5K9QG 1P5BA 2R6OA 4LS0A 5C55A 3UW6A 2WLMA 2WV3A 3CXDL 1FH7A 4RKAA 3DMMD 2ISSA 3MV01 2HPIA 1RP8A 4K39A 1NGYB 3W7RA 3L3KB 3SE9H 1AHMA 2DWTA 4DLMA 2IH1B 2R9HD 4HH8A 2YCJA 3FCTA 3KYMB 3W0WA 1D9EA 3MA7A 3EGXB 4Z77B 4FMVA 1RH9A 1W5NA 2DT2A 3CDYA 3SQOH 2VDNH 4WK9A 5K39B 3FJNA 3PUCA 2XETA 1UPMB 2Y85A 4BQ6A 1KBJA 2O0TA 4O50A 3DRQA 1JZJA 3EJTA 3KWWB 2PPCA 5E99L 3RWDB 1G84A 2ZA2A 3NQ7A 1H50A 4IP5A 1UZ6F 4C4UA 2VRJA 1NC4B 5ID0B 5DRNB 3HMXH 2DQEL 1NF0A 4HCHA 3WF3A 4XNMB 5ISZB 2VLMD 3S0PA 4YBLC 1A4KA 5T1KB 4XPTL 1P5VB 3IDYC 5KN5A 4O02B 1GYCA 2HBXA 1IWPA 4CNIA 1UH3A 1TVBA 3K4DA 2A73B 4O2CB 5I16A 2F5BL 1PTAA 1X8FA 4W4NA 1KKOA 5AC7A 1MCBA 2EDHA 2XN9B 3FMGH 4NOBA 1OAQL 2FL5B 3MJ7A 3PP7A 1QPPA 1TSHA 1WWAX 3OA5A 1B9ZA 3SBPA 3ZLHA 3VUPA 1EHNA 4EN2A 2E9LA 4JRXE 3EMZA 1X5IA 1TE6A 2FJFA 3AXIA 3GIVB 5E2WH 2VR6A 4KMQA 2A73A 4O2CA 1IC7H 5EO9B 5EZIL 5I16B 3LERA 4MGGA 3QQ9C 1W0WB 2CNZA 2NT1A 3GDTA 4WO4C 4UDUB 3WHXB 3WQFA 3TS8A 4Y4HB 3AHVA 3CU7A 4TXVB 3O3EA 4EE9A 5E9NA 2MANA 4QXGL 5DGQA 4JDEB 3L9CA 4J6RH 3E0IA 4GBXB 3G1RA 1E73M 3FU3A 1VEOA 4HNLA 3D52A 4V28A 1MFEL 4IRZH 5AVTB 1AGFA 1RIHL 2FVMA 1GVFA 5JXEA 4HGWA 3RUBL 3BLBA 3G6JF 4DVBA 1U83A 2Q3OA 1BD2D 2EO1A 4WI5A 4WW2B 4KKBD 4ICCX 3BQUC 3B2MA 2NYKA 1UP3A 4M4RB 1P7QD 3N04A 3RVVD 3BQUB 4ZOCA 4H01A 3N25A 5DO2C 1DVFD 3D0AA 3MCYA 3LS5H 3LAFA 4MAUH 3WSUA 3EMCA 1QZ1A 1VPXA 3PPHA 4DZHA 2FVLA 2INEA 3TA3D 4LF3B 2PODA 4HT1H 3KOWA 1UD2A 2F54D 5F7WC 3PVFA 4H7ZA 2Z65C 3UTSA 3VFVA 1TZ7A 4LJ3A 3NIGF 4M3KB 4OCRL 2WWNA 2G60L 3NIGE 2XY1A 3URQA 5D7LA 1BLNB 2NCMA 3VFVB 4HALA 4JO5A 5FAAA 1R9YA 4PMDA 1MFDL 2BS9A 3T7VA 1RXOB 3NSYA 5E6YA 4X9HA 5D7LB 1YEGH 3T2NL 5KYYB 1W1ZA 4HNCA 1NGQH 2J8UF 3UTSE 3GSQA 3N1MC 3P0GB 4MQ7A 1XGEA 3S6DA 3REWA 5AKTA 2DVUA 5D96B 4LVOC 1X9UA 1U8OA 2WOQA 2F7OA 3GJEB 3EEZA 3WD0A 2Y5QA 1KB9K 5EOCH 3NZ1A 3SY8A 3IAPA 1AR1D 5E7FA 1RQHA 3WU1A 3FQYA 1KC5H 4A1RA 2A74B 2YGNA 3VPLA 1VFLA 1S5HA 2HG0A 3VB8A 2Z7WA 3UCCA 2CLOA 1NUGA 5IB4A 1MG2C 3L1GA 5H2BA 4X8CA 1D5ZB 3RTQA 3P2VA 3ISIX 2Y1YA 1VR6A 3GMLB 3SBRA 2OTWA 4L3FA 4RFOH 3SJVD 2ORBL 4A68A 3L5XL 5DEGA 2NXYD 5LBSH 1DL3A 3BPWA 1CD0A 1SQ2N 1DBAH 3ARDD 1QTYT 3WLWC 4YGVA 5I1KL 4PJIB 3NQMA 3C8KA 1I1WA 1RY8A 4PRPA 2BNRA 2YAOA 4QXUL 3AHTA 3RWCA 1SRDA 2OOGA 4X83A 4F2TA 1IM9B 1NCBH 5C0NC 4E4PA 4Q8VA 3Q2CA 4IH3A 3TPKA 1WAWA 1UYWH 4PMRA 1KGWA 3MCKB 4QRUA 3QIBB 2D03L 1N3NB 2HCZX 3CL6A 1XXFC 2YRLA 3N12A 3U57A 2QR0B 4BQ2A 5I3JA 1UFUA 4PGLA 1L9NA 3FB7B 3DX1A 5EY5A 5KSWA 3PHOA 1JGLL 1HOEA 4LSTH 3UJJH 1KW1A 3IMVA 4K2UL 4DEFA 4DXVA 3CXOA 4Q8OA 2H4EA 1NGQL 4Z2GA 1BWVA 4OCNC 3KDMA 2PXYD 4PIBA 1QHPA 3UGEA 3W7NA 4UILL 1F3RB 1F90H 3P9WB 5JA9A 1JWMA 2R8SH 1IXOA 1VHCA 1YPFA 1W0VB 1BPLB 2XG9A 5IFAL 3PY2A 3UPBA 2QGEA 4AENB 3FB7A 4LRNH 1AG6A 3HE6A 1Y8BA 2W79A 4FOKA 2ZKXA 4H6RA 3GSUB 1DBKL 4RNFA 2ICEA 3CPLA 4LCWD 1ZPTA 2YD6A 4NQSB 2VFGA 5KBDA 4B3ZA 2BWDA 4WGVB 5LNRA 3GSUA 2APVA 1YEFL 2ZNXA 1H0GA 1EDQA 4UXDA 1BZ7A 4LHJB 5AEAA 4G6ML 3W74A 3C60D 3TNBA 2P46B 4NO2A 4JFVA 4GZIA 1PF3A 4WO4B 5A7BA 1G1YA 4LVDA 1MVUB 4AYID 1PG7L 3BAEL 1BMWA 4MPQA 2IANB 3BD3A 4ZZKA 3PZGA 4HA1A 4J3TA 3TU6A 4K7PY 1SN2A 4AZHA 3SQSA 3VXQA 4HCRA 5K7JA 1XH3B 2NNRA 3GPSA 1LZOA 3KHDA 1JWSB 1X98A 1I9RH 1VFAB 2QJMA 3RBGA 1IC7L 1OAXH 1MNNA 4JTGA 3MRLB 3VXUD 3M0JA 1UA6L 1GYVA 4JTRA 1F58L 2XACC 4UUJA 3SUUA 1FWNA 2N3JA 4X5WB 3CV1A 3Q5YA 4M43H 4KHXL 1DEEA 4QLWA 3N2BA 2D2HA 1FX6A 3ZJ8A 3VOFA 1I85C 3QUGA 2ZXEB 4RNIA 3CSGA 1FL3B 4FQHA 4C56A 1QWHA 3KVPA 5LHDA 5FLVA 1F6YA 1K77A 3H2FA 4RFNB 3LU2A 2IKJA 3AHYA 3EX4A 5E70A 1INDL 1S9VB 2PWEA 3G9VA 1HE8A 1U8HB 2OSLB 2VGGA 1T2JA 3TBBA 4FX6M 4M7LH 3VNJA 1AXTH 1W8EA 4Y5YC 5EL1A 4HU4A 3FHAA 1XCQA 4I9AA 3U0WH 1CIDA 1GGBL 2BSSA 4YC2B 1ERNA 1I9JH 5KUKA 2F53A 3S4SA 4Q8UA 2ZXWB 1WFOA 2KKQA 1XG4A 4I7UA 5CPSA 3UXKA 3DETC 5CD5C 1RZIB 5LCVL 4C6JA 5SWZA 3D12B 1E3ZA 3MRRB 1G6VK 4FKHA 4N0YL 4MXVE 2G5RA 3P0WA 3RPDA 4F7TB 3WLTA 4CQ8A 4EVZA 3RWFB 1IR2A 3THCA 3TZVD 4ZL1A 2TYSA 4Z18A 3O0FA 1EXHA 3SCTA 1MVYA 2WP3O 1C8YA 1S5IH 4GAYB 1VYRA 3G5VB 4KH9A 5FWRA 1HZKA 2HVOA 4LUTA 5HNNA 3TDFA 1CG9A 5FO8B 4L18A 4ZNEA 2G0LA 3QXDA 4RRPG 5I1HH 3IUHA 3SY5A 1MKFA 4GQ9L 4M19A 3O8XC 5D1ZB 4FG6D 2BNQD 1S5MA 1LP9F 1A3HA 5HD8D 4QT5A 1PZUB 4PMNA 2NNAB 1NCBL 2AQ1A 2DDQH 2H1LM 1OG0A 1JPDX 2XZCL 1UWXH 2OXHA 4NRYB 3B8VA 2Y36L 3ZQ9A 1JUBA 3F7RA 2BG5A 2KH2B 2G3MA 4RGMC 1HW6A 2PDHA 3E12A 1DBAL 1M57B 3HAEA 3TN0A 5HBBA 5ICXA 1E1EA 5CSYA 4YHGA 3U7WH 4OOUA 4PJ9B 3O2DL 1QO3A 2I32A 3FA4A 2DQJL 2VZVA 4P2OB 2AABL 4XVUD 3GHTA 4AWEA 3LCHA 4NRYA 3ESVF 3N9GL 3GIZL 3IDJA 4UYPA 3QUHA 4NKOB 3W1NA 4GT0A 4LKXA 3TIEA 2HMCA 4AF0B 5F93C 4PM1A 3LNPA 2WUCL 3GXDA 2P5EE 1NP0A 3ISYA 1KUMA 1KG0B 2I07A 1LO3L 3LRKA 4ODHL 2OMNA 3QR1A 4OZFG 1SDAB 2J66A 2UWFA 1PS3A 2DQDH 3PP3K 4EN3D 2VM4A 4PJBA 4QHRA 4RDQF 4UOW1 3CUPB 4XAGA 1JN6B 5FCUH 4ZDHB 3MMWA 1TTJA 1IC4H 5DYOB 2Y6ZA 5REQB 1WZ1H 5DLMH 3CQ0A 3UH8A 3QRLA 4HEME 1U8IA 5A6KA 3BE1H 3MP3A 1LBMA 1GOWA 4KI5F 4PCPA 4P2YA 2IPUK 3PV6A 4OTXL 4PJCB 1QLEB 3UTZA 1DSYA 1AP2B 2DH3A 4DQOL 4LK4A 2FEDC 3NA9L 3UTZB 5M5DA 1J1PL 5J6HB 2A9NH 1F5WA 1C16A 2EXTA 3D4ZA 3LS5L 2Q7YA 1PKYA 3W6MA 5LSMA 2ALRA 4BQ8A 4KCWA 4XB8A 3IVKA 5FD0A 3IU3B 2D2JA 5GZND 1NWSA 1PWLA 2AXFA 4Z7NF 3BUIA 4CEUC 3FH5A 3NAAH 5KZMA 1H11A 3DVGA 2XFWA 1SXNA 4W4OA 4D9QD 1WDDA 4JG9A 3S3CB 5B8CC 1GL4B 1QNZH 5FHBL 3N1AA 3CQHA 3O4LE 3CPRA 2UX7A 5F7FA 2PDJA 3N15A 5I77A 2N0KA 1J12A 4HZ8A 4HCFA 1E7VA 4WI0A 3PHAA 4GRLC 2WAQA 9PCYA 1W0YT 4Q52A 4EQ2A 1Z7AA 4HC1A 4NNPL 2MKLC 4JY5L 3RK8A 3V9FA 5B1JC 3EH3B 4XX6A 3Q65A 1NGZB 1LO4H 1NZRA 4O58H 4X4ZA 3UZQB 4N1HB 2PDQA 5LGXA 2NQ9A 1E90A 2V5RA 1I4FB 3BVTA 3S3SA 5TQ2H 1YPZE 1HKMA 4BI6A 1WBXB 1QAWA 3I75B 4FAAB 4N87A 2X4PB 5G2NA 2ZAGA 2RDXA 4GBDA 4NY2A 2J1WA 3BH8B 3ZR5A 5JORA 3NZSA 5JHBA 2ACSA 5I0VA 3OIXA 5DHMC 3TCEA 5EF1A 5HJXA 1TPXC 2OJZH 4GNKB 4OZHE 1LEKA 5L2JB 1HP4A 2FZMA 1V8HA 1KCSL 2A4ZA 2Q6WA 3DGCR 4HCRL 3V10A 5IEHA 2QF7A 2XIOA 4Y5XA 3ZZSA 3IDGB 2Y7DA 4NASA 1N8ZA 1SZNA 3WYZA 4R88A 1DANT 3QUYA 1ND0A 3OU8A 5HXMA 4Q4SA 1JNLL 2ZQKA 3FFCE 3LD8C 3VGBA 4A8RA 3WKPA 2FR4A 2GAZB 4NRXA 1GMEA 2F61A 4FR1A 8CGTA 4ZTXA 4FA8A 3LNGA 2VDMB 4IFKB 4HOMA 4WTXA 2XNAB 5A3HA 3V5CA