2WVVB

Crystal structure of an alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
450
structure length
446
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAKLYRDALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ALPHA-L-FUCOSIDASE
publication title Analysis of the Reaction Coordinate of Alpha-L-Fucosidases: A Combined Structural and Quantum Mechanical Approach
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
total genus 164
structure length 446
sequence length 450
ec nomenclature
pdb deposition date 2009-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2wvvB02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wvvB01
3MI6A 4XV0A 5A8OA 2WPGA 1W9UA 1LLOA 3PZ9A 2BY0A 3W53A 1GUVA 1E6SM 7CGTA 2CKRA 1V3HA 1W2VA 1BVZA 2BVYA 1XSKA 2PWGA 3PTQA 1C93A 2XIIA 3II1A 4ATWA 1CXIA 1B3ZA 1A47A 1WKYA 4M24A 3GXPA 3VX0A 1CNVA 3BAKA 3VDCA 3T2OA 3IAQA 3K46A 5FOOA 2DQXA 3FHQA 1HN1A 4CGTA 4TVCA 2YA2A 2VZOA 3T08A 2JIWA 1FHLA 3VIPA 5I78A 1FP8A 3HG3A 2W91A 2ZE0A 4WJXA 2ZX8A 4JHOA 3KL0A 2J7HA 1XH1A 2WANA 1E6RA 2UWFA 3SUVA 4AEEA 3VNYA 4W7WA 3SCNA 1UR1A 1WCGA 1J0HA 4AMXA 1HXJA 5I23A 4AZ6A 7A3HA 2QPSA 3WQ8A 4E8DA 1V0MA 1AQHA 3SIMA 1C3FA 3PZVA 1I75A 3OLGA 1QNPA 1E40A 1YHTA 2RGLA 4JIEA 2EPNA 2YDQA 3VD7A 1RP8A 1VFOA 3CZSA 3WNOA 1EO7A 3W4RA 5BRPA 2EPLX 5GPRA 1D3CA 3VNZA 1B3WA 4JCLA 1E9LA 4DWSD 4M82A 5HXMA 2E9LA 4UQDA 3S5YA 1MW0A 3WUBA 3NIYA 3HU7A 2WVTA 3W28A 1D7FA 5A8QA 4B3LA 1MQPA 2WAGA 2UY3A 3AFBA 2ZWZA 3D4ZA 1CGYA 4ZXOA 6A3HA 3ARTA 4ATLA 1WDRA 4JAWA 4GZEA 3LXBA 3AZSA 4C7DA 4QCFA 1V08A 3HZ3A 3WD0A 2E4TA 3WQ4A 3VIFA 1GORA 1TQTA 1V0NA 2ZUSA 3NYDA 2X05A 4CD8A 3N18A 1GJWA 2WVSA 5A69A 2F1BA 4Z2LA 2WM0A 2YL6A 4GI9A 4LYQA 1UYQA 3FAWA 5AY7A 3BVXA 2VRQA 4PTWA 2Y2WA 3BAWA 4IUGA 5CJ5A 3VGFA 1TUXA 3WIJA 4LGXA 3LMYA 3VGGA 2PWHA 2FDMA 4KH2A 2NT0A 1US2A 1H2JA 2GSJA 3TTSA 1H1NA 3BUPA 4OIFA 1E4IA 1JF5A 2BS9A 4PMQA 4GIAA 3CHDA 3RO8A 1W1TA 2XGIA 2A3BA 2BVTA 4BF7A 1M03A 1UWRA 1BSIA 1OSEA 2ZUUA 5CSUA 1JYWA 1KR1A 2ZICA 3K8KA 4ACZA 1KBKA 3AZTA 2WBGA 5GNXA 1QWNA 4S3JA 3MSGA 4F8XA 4J3WA 3AYSA 4DO4A 2J4GA 3ZJ7A 5DMYA 2JFEX 4ACYA 4CU6A 1NM9A 4U2ZA 4PRWA 3CLWA 5HPCA 4CD6A 1JZ5A 2PWFA 3GNOA 1L8NA 4P8UA 3VDBA 3VPLA 2FHCA 2D22A 2HVMA 3VIMA 4J3SA 4P7QA 1KFWA 4FNQA 2IUZA 4HOXA 2QMKA 1R47A 4ZEPA 4WF7A 2J77A 4PSRA 5AYIA 2WNWA 3AICA 5E70A 3WUEA 1TFVA 2VURA 1RH9A 1X6LA 1TQSA 4NF7A 5FIPA 3ZMRA 1C91A 3NJ3A 4MB4A 4J3UA 5CGTA 4CVWA 1J0KA 5ABGA 3OGSA 1X6NA 2E3ZA 4Q7NA 3WY3A 1VEMA 3WNLA 3ARRA 3WD3A 1DWFM 1XSIA 1PJ9A 3MMWA 1KBBA 2D0GA 5A6KA 1JZ7A 1U30A 4CD5A 1OIMA 1W9BM 1OGGA 3GTNA 2WBKA 4BCEA 1W3LA 2WXDM 1JZ4A 2E9BA 2IXUA 3WDHA 3CUIA 4OOZA 1CXKA 3PTKA 5ABEA 1HKJA 4J28A 5E6YA 5EMYA 3T0BA 1JZ2A 1PBGA 2GUYA 3A6OA 3T2PA 3A4WA 1OT2A 2EXOA 1EQCA 1JI1A 1NWSA 4CUCA 3O9NA 1R85A 2J75A 3U7BA 3BAYA 1D2KA 3TTQA 4EANA 4NSBA 2PBOA 1UHVA 1M7XA 3KE0A 1B3VA 1PZ2A 3GZAA 1Y7VA 3LPFA 3NSNA 5JIWA 3B8SA 5IHRA 2CIPA 4NI3A 3VGBA 2FH6A 1CXHA 1ZS2A 1UASA 2QF8A 2ZIDA 4Z2JA 1NOUA 2VZSA 4OGZA 1H49A 4AIUA 1ITCA 1V3MA 3WH5A 4FNUA 3T0DA 1DP0A 1GOMA 1PPIA 3SCUA 4ZE4A 2QLYA 3BCFA 2XYLA 5HBFA 1CXEA 4B16A 1G9HA 1V6XA 3WUFA 1HP4A 4P7RA 5CLTA 1UWQA 1UKTA 4V28A 3WDIA 3EDFA 3N9KA 1QNRA 4M81A 1WAWA 3VD3A 1HJWA 4D6EA 3IAPA 1DWJM 2PI6A 2BFGA 4QCEA 1E71M 1W9PA 1CZ1A 1UA7A 1I1WA 1GOWA 1CIUA 2Z1SA 4GO8A 4TVDA 1QI2A 3AS3A 4IM4A 1E3ZA 4JL1A 3CH9A 3ARWA 2O9PA 4PN2A 3K8MA 4DM1A 1UH4A 4EAMA 3ZO9A 1O6IA 2GVYA 2ZXQA 4NZCA 1F4AA 4B9ZA 3POCA 3ECQA 2PB1A 1FFQA 7TAAA 1UKSA 2X09A 8A3HA 1ODUA 2BY3A 1CENA 4GKLA 1XYZA 5BRQA 1J11A 3ARQA 3KL5A 4Z2IA 2PC8A 4HOWA 4YHEA 3A21A 1CGUA 3EJUA 3K1DA 3VIJA 1K6AA 2VNCA 2YBTA 4U3CA 2V38A 4JFTA 1US3A 1GZJA 3L4ZA 3LRLA 1BAGA 4N42A 2X0YA 1TR1A 4W85A 2D3NA 1EIBA 2ZXBA 1BF2A 3TV8A 1BYBA 3LPGA 3ZOAA 1OBAA 1VB9A 2YJQA 5HDRA 5DO8A 1UD4A 2ZX9A 3WF1A 3BLBA 1J0ZA 4EKJA 2X2HA 4W8LA 2NW0A 1C8XA 1W2PA 5BXTA 1KCKA 4WKAA 1C90A 3RM9A 5AC4A 4W84A 2D73A 1C7TA 3L4VA 4UNIA 3WN6A 2XSBA 1ODZA 5GNYA 5A8MA 4AXNA 1BHGA 3UG5A 1JDDA 3VUPA 5FKYA 1V02E 3VVGA 4WSKA 3MSDA 3QOMA 4AEFA 4AY1A 3U57A 2J47A 4WLCA 1XGZA 1VEPA 5A3HA 1VENA 1BQCA 4U5IA 1HKKA 1TQUA 1IT0A 2XM1A 3DYMA 3D51A 5DF0A 3W27A 2Z1KA 4AMWA 4XX6A 4MNLA 3BH4A 1E4LA 2D0FA 2EBNA 4AZCA 1OD0A 3RJYA 3UESA 4LQ1A 5ECUA 5A1AA 4J7RA 1QHZA 2V5CA 1WZLA 1JYVA 2CETA 1BFNA 5CG0A 3OZPA 1R87A 1W1VA 3BVUA 1PS3A 4RE3A 1CDGA 3O6AA 4XZWA 5CQ1A 3WQ6A 5C70A 1FH7A 1QBBA 1CGTA 2D20A 1K9DA 1E15A 4Z2GA 4A3YA 4L4OA 2GJXA 3IGUA 2XHYA 3QGVA 4KRTA 4DO6A 1C8YA 4DO5A 4D6JA 2X2YA 4H8UA 4PBGA 4D72A 4OUEA 4A3HA 4TTUA 1E72M 4W7VA 3POHA 1C8QA 2WK2A 1Q6CA 2YKKA 3BCDA 3ZR5A 4JL2A 4OJYA 2X2IA 4CU7A 3HMCA 2ALWA 4GXPA 3BSGA 5AC5A 1KB3A 3S5ZA 4A4AA 3MU7A 2J7EA 5I5RA 2VZTA 4QLLA 2VR4A 4FLSA 4ZENA 4GQQA 1ITXA 4KGJA 5DFAA 1E0WA 3DX3A 2J78A 4UCFA 1E1FA 3NSXA 3SCPA 4OBSA 3G6LA 3FHAA 3B9AA 2WHMA 3VM7A 1EOMA 4UFMA 3IK2A 4H7VA 1WE5A 2GDUA 2O9RA 3RM8A 2WCAA 3HJEA 3RDKA 1BG9A 3CO4A 3EMCA 3EJQA 1W1PA 4JFSA 1EDQA 1LG1A 1XRVA 3PZQA 4PTMA 4PMVA 2CKSA 4EE9A 2E8ZA 1SMAA 4P7OA 3RILA 4OKDA 5DEZA 3CZGA 5E0FA 1UR4A 2CYGA 1E4MM 4JKKA 4E2OA 3BVWA 1WP6A 2F7RA 5IDIA 1JIBA 1AVAA 1NWRA 3W24A 3SCOA 2GK1A 4K68A 4XUYA 2ZX6A 1OD8A 1HIZA 2J74A 1V6YA 5BXSA 2DDXA 4TOQA 3SCSA 3W0KA 5A6LA 2OYMA 3W82A 3FY1A 2WLZA 4PTVA 3CPUA 1HJSA 2CITA 4D1IA 4BZYA 4UFKA 5GQBA 1CECA 4PCTA 1PX4A 2XVLA 3LPPA 4Z2KA 1E4NA 4KRUA 4W7UA 2D3LA 2V3GA 2VUYA 2VCBA 1UR8A 2G3NA 1ZB5A 1KGWA 4QDMA 3SEPA 2XFFA 3RCNA 2XFYA 2PBGA 2B31A 1UA3A 5JBFA 1BG4A 1YQ2A 1NOFA 3ZQ9A 2WMIA 2E9MA 4H41A 4F66A 4ZE5A 4MTVA 3WDJA 4W93A 2VO5A 4AIEA 4UR9A 1OINA 3VGHA 2V3EA 3GBEA 3W6MA 3WEOA 3CZNA 1QI5A 3ZT7A 3VIIA 3RM4A 5JBEA 1GHSA 4E8CA 3PZNA 1MW2A 3WBEA 1JYNA 1Q4NX 1OCQA 3GNPA 1HP5A 4C7FA 1KXVA 3WFZA 1GONA 4MDPA 4FNPA 1H11A 1E1EA 1V3JA 4CCDA 2FHBA 1KTBA 1E6NA 1Q6DA 1R7OA 2EACA 3VM5A 2OWCA 1HT6A 5DT7A 4UQCA 1SMDA 1V0KA 1HL8A 1J0YA 1MXDA 1VAHA 1UD8A 1JD9A 4CN4A 2J62A 3WDRA 1ZBVA 1UR2A 2JEQA 1UUQA 3AIEA 4U5KA 1JNDA 4WK9A 1GQLA 5I24A 4ACZB 2GJRA 2G3JA 4QFUA 3QHOA 3WF2A 4DUXA 2X0HA 1CGVA 3OGVA 3VD5A 2D1ZA 2OSYA 2VOTA 1KXTA 1VFFA 1JNEA 1XCXA 4CN6A 5E1QA 3AHYA 3ARPA 3ARYA 4BQ3A 4BQ4A 1HF6A 1CGWA 2CBIA 2WMJA 2OWWA 3WNMA 5LA1A 1GCYA 5CLWA 2WVVA 3EDEA 1E6PA 1WB0A 2WC4A 1HJXA 2FGLA 2CESA 3TTOA 3CMJA 3AIWA 2JEPA 4D6FA 3MV01 3F5KA 1K9FA 1QVBA 4JZ5A 1XHGA 4W87A 5FD0A 2PWDA 2QMJA 2FYVA 5IHSA 4EK7A 4HA3A 4Y7EA 4N0RA 3VGEA 5BROA 3VOCA 3WH6A 1JF6A 4UFLA 1JI2A 2WSKA 1TCMA 3BXWA 1UZ1A 2XTKA 1VFMA 1VBUA 3F5JA 4HMDA 1FH8A 1V3LA 4TVUA 2JE8A 2J25A 4MJ2A 1BYCA 2WC7A 1CWYA 1W32A 4J27A 1HJVA 3AROA 3CZJA 3RMEA 2YA0A 3WL1A 3EJPA 5JBDA 1ISXA 2W66A 5CSYA 2EPKX 3UEQA 1CBGA 1H3GA 2DT0A 4M8UA 3WNKA 2V3DA 4MAZA 1GJUA 3IJ8A 3BUQA 1X1NA 3WUGA 1QHOA 4LYRA 1NARA 1E3XA 5ABFA 3CZLA 4PTXA 4D1JA 1SYTA 1EDGA 4Q22A 5A6SA 2AOSA 1XH2A 5CPSA 3SCQA 1UG6A 3ZT6A 1KQZA 3H54A 3AI0A 3CHCA 4W5UA 4UFIA 1SR0A 4X0VA 2VJXA 3SUSA 4AZHA 1MYRA 2DSKA 2VR5A 2G3MA 4IPLA 3CZ8A 5CXPA 2OYLA 4MPKA 4H2CA 5A6AA 5IFTA 4HPHA 4RL3A 5IFPA 2F2HA 1E73M 2Y8VA 2EQDA 4ZFMA 1UR0A 2WCSA 2VX5A 1HJQA 3I3DA 4X9YA 2WW5A 3CMGA 2XN1A 1UQZA 5A6MA 1QWUA 3H53A 5EFFA 3BSHA 1MW1A 1QHPA 1UWIA 1V6VA 4B3KA 1NQ6A 4FNRA 1UD5A 2F8QA 3MO4A 3SCTA 4DM2A 3AXXA 4DWSA 2ZOXA 3AMCA 2FGZA 1BYDA 3VO0A 1B9ZA 4CD4A 2CBJA 5BCAA 4NZFA 3DDGA 3H55A 1XV8A 2EPMX 3WDQA 1R46A 1U2YA 3BGAA 1PZ3A 1GHRA 4V27A 3B9EA 4WKHA 1ESWA 5LA2A 4V2XA 3WD1A 1XH0A 3GDBA 3EMQA 2VL4A 3WQ5A 2F7OA 3CUJA 1JYXA 4HMCA 2YLLA 3WD2A 4FLOA 1OT1A 4AD4A 5A6BD 4JHZA 3S2CA 4P8XA 3AHZA 3GNRA 4OOUA 1CEOA 3L4WA 1H41A 1ZJBA 2VVSA 1UKPA 3VDAA 1WZMA 4AD3A 2YA1A 1R7AA 1VJZA 5E9AA 4XZBA 1BTCA 3DX2A 5E0CA 2C0HA 2XGBA 5D9OA 2YDRA 1PEZA 5I0DA 4B15A 1IV8A 3BVTA 3THCA 2YOCA 4AYGA 1AQMA 1HVXA 1TVPA 1TA3A 4UOJA 2CERA 2XVPA 1V3IA 4X0NA 1JG9A 1SZNA 4AYSA 1EDTA 3SUWA 1GNXA 5I79A 1E70M 1JZ6A 3PZMA 1C7SA 1JXJA 2JALA 1JXKA 3DDFA 5AYBA 3BAIA 2JF6A 4YN5A 1PIGA 3HG5A 3M07A 1LL4A 5IXEA 3OZOA 4WIWA 1O7DC 2EABA 2YLAA 2O9TA 3WY4A 2BNJA 2WWDA 3A5VA 4AC1X 3FNDA 1G94A 4AZCB 1UWUA 2WC3A 3TA9A 1B0IA 3MUY1 1OGSA 3MUAA 2OW7A 3GXDA 3N13A 4YPJA 4IPNB 1UWSA 3QHNA 2ESCA 1RP9A 3EDJA 3D52A 4IISA 4NRRA 1HTYA 1KWGA 3D5HA 3W26A 1G1YA 1LL6A 1PX8A 1M04A 1QPKA 2GJXB 3DHUA 1OIFA 1L0PA 1E5JA 5I6SA 5A95A 2WZEA 3NDZA 1NP2A 4D6DA 3WELA 1JDCA 1TQVA 2DH2A 3CHEA 3VMNA 3VINA 4UOQA 1VJSA 2BHZA 3LPOA 2E40A 1TQWA 1V6WA 4PMUA 3MUZ1 1AQ0A 4NX0A 1LJYA 5BXRA 1LQ0A 3UG4A 2CPUA 1B90A 1A3HA 1EGZA 4MB3A 3WL0A 3NUKA 4AZ7A 3CV5A 2J7DA 1OB0A 1KWKA 2V5DA 4CU8A 4HPGA 1T0OA 3QR3A 1XC6A 5BYWA 3WENA 3HG2A 1XSJA 3VGDA 1HNYA 4NRSA 2WMGA 1EXPA 1TVNA 3MMUA 4FMVA 4D6HA 2XPKA 1QNSA 2W67A 1MWOA 5CGMA 1MFUA 2DSUA 8CGTA 2VT0A 3D4YA 3K4AA 2GK1B 1W9VA 2DT1A 1R34A 1ZU8A 4UQBA 2XVNA 3CIVA 5A8PA 3NSMA 3MANA 1R75A 3HG4A 3SCWA 3M6DA 4JFWA 5BWFA 1LF1A 3ARXA 4PUDA 1H0IA 4U2YA 5HOSA 3WEZA 3BC9A 5D9PA 3A4XA 4PMZA 4PMRA 1NH6A 2XJ7A 4DUWA 6CGTA 2VI0A 1QI4A 2EEXA 3A23A 4JFUA 1ISYA 1DEDA 4C7GA 4W8AA 3ALGA 2J8GA 3E1F1 3WQVA 3AHVA 4AZGA 4PCSA 3WKZA 3VKKA 2XN0A 3VMOA 1BVNP 1S46A 3KLLA 2WMIB 2VCCA 2G3IA 3N12A 3KWXA 3LX9A 2DIJA 2CBUA 3OG2A 4KWUA 1JFXA 3I3BA 4AZ5A 3WH8A 1PIFA 4BQ5A 3DX0A 5TD4A 3KL3A 4AD0A 1VF8A 4OZOA 3EJTA 5CPTA 4F9JA 2W63A 1HVQA 3NDYA 1DHKA 2YFOA 1TE1A 3VIKA 3N17A 1V03A 3MMDA 1C92A 2TAAA 3WF3A 3DX1A 3WNPA 4Z2HA 3L2MA 2BXZA 3EMZA 1WZAA 1DWGM 2XG9A 5FL0A 3VD9A 5C8BB 3PZUA 3WEMA 5A2BA 5D4YA 1HX0A 5HNNA 2D0HA 1MQQA 1V6UA 2GFTA 4PMDA 3AIVA 2V3FA 3PN8A 1JZ3A 2FHFA 3FN9A 5I77A 4MB1A 4L4PA 2G41A 3PBGA 3LRKA 2F61A 3PZGA 3BUDA 4MNKA 1NWUA 3KEHA 2CNCA 4AISA 3AMKA 2VRKA 1PX3A 2J7BA 4B9YA 5F7UA 2J7CA 3WMBA 5EBAA 3AXHA 1B3XA 1EH9A 4CKQA 1JDAA 2W4XA 1QW8A 3RPMA 4PEEA 3B9DA 3APGA 1OM0A 1W3KA 1QI3A 3WF4A 2NT1A 2VVNA 3ZIZA 4TXEA 2EADA 4PYSA 1ZL1A 4W8BA 3SURA 1JGIA 2QHAA 3TTYA 2J7FA 4LXFA 4PMNA 1ISVA 3UETA 4HZ6A 4HU8A 1B3YA 5I3DA 1KGXA 4GZIA 3W6LA 3AMGA 3VDHA 1DTUA 1FH9A 1BYAA 2ZUTA 3M46A 1QNQA 1UZ4A 1VFUA 2X8RA 2UY2A 2WVVB 4ATDA 3UERA 2EPOA 2X2JA 3TOPA 1G01A 5BXPA 4JKLA 3GXNA 2WWCA 2YIHA 3AZRA 2CCRA 2CHNA 1VEOA 2YL9A 5M17A 4JCMA 2O92A 4DWSC 4U33A 1UD2A 2WSPA 1BGAA 3KLKA 1V3KA 5C71A 1J10A 3VIOA 2CEQA 3PTMA 1M01A 1NWTA 3AIRA 3UR8A 1W91A 1IZKA 3CTTA 2YBUA 3GH5A 3WBAA 2CBVA 1VBRA 2JIEA 2BHYA 2GDVA 3FW6A 5EFDA 4M56A 4UQAA 3BMVA 1H09A 3A22A 1WDPA 4FLQA 4J3TA 2XFRA 1GVIA 5A94A 5M5DA 1CXLA 1N82A 4GI6A 3I3EA 1HKIA 2ZWYA 1BGGA 1MVYA 2ZX5A 1E56A 1MQRA 1J12A 3AQUA 4NXSA 1HXKA 4MB5A 1B30A 1Q6GA 5ABFB 1NP0A 3BLPX 4RE4A 1E6ZA 3AMDA 4GO9A 4D71A 1FFRA 4R5EA 4UQ9A 4CCEA 3AISA 3QHMA 3W38A 3GXFA 2DT3A 3K4DA 3O2LA 4DUVA 4W86A 1WPCA 1HJUA 1CLXA 4M29A 2A3HA 3UR7A 2D24A 3ZT5A 4FK9A 1J9YA 3RIKA 5JIPA 1ZBKA 4D6IA 4PUEA 1GQKA 3EJRA 1E6QM 3SUUA 3AIQA 3PHAA 4PSPA 1NOWA 2BV9A 5M03A 3WNNA 1TZ7A 1W3JA 3VIHA 3J7HA 1MFVA 1E5NA 3GM8A 5I2UA 2AAAA 2OW6A 1QW9A 3W81A 2Y8KA 3D3AA 3MV11 3W25A 2MANA 1DWAM 3AS1A 1W9DM 6TAAA 1UH2A 1Q6EA 1TMQA 2OLHA 3OLEA 5KZ6A 1FHDA 2XIBA 2RGMA 3BAXA 1JD7A 4J3VA 2VX6A 4P7NA 2OWXA 2WMFA 3CUGA 4R27A 3IJ7A 4DWSB 2E8YA 2WMKA 4AD1A 4XB3A 2VRJA 3BMWA 1SFSA 3SUTA 4W88A 4UFHA 2EJ1A 1GVYA 3IANA 1GOIA 1DWIM 4HTYA 4QP0A 3ZR6A 4KMQA 3LRMA 2FE0A 3CZKA 1JAEA 1JAKA 1UQYA 3AOFA 5JUVA 3WH7A 4UTFA 3BAJA 3OIHA 3ZM8A 1EO5A 2WHJA 2BY1A 2VQUA 1OGBA 1QI0A 3VSVA 1V0LA 3WF0A 4H04A 3OLDA 3A47A 4M1RA 1EHAA 4HA4A 1R33A 3FXYA 4AW7A 4HZ7A 3GH7A 2Q8XA 4QAWA 4CVUA 2C8NA 4GQRA 2BHUA 2WKGA 4BA0A 4GZJA 2ZX7A 2DGAA 4TX6A 3BUBA 2Y4SA 1KQYA 3SCRA 3DX4A 3S6TA 2YL8A 2WLYA 4NXKA 1EQPA 4QLJA 2NSXA 4D6GA 2YL5A 3QOKA 5E6ZA 1H0GA 5A2AA 4GPNA 3WY1A 3M7SA 1TA3B 1KTCA 3DECA 4U3AA 3EYPA 2E0PA 4HA1A 1LL7A 5LA0A 1EHNA 2F18A 5D8WA 3AJ7A 2PF0A 1HL9A 3GXIA 3NCOA 4WSJA 4HOZA 4MNJA 1E55A 1QNOA 2J8FA 2VZUA 1HWWA 2DEPA 4MADA 1E0XA 3ALFA 2ZUVA 2UY5A 1UD6A 2WHKA 4RE2A 3ARUA 3T2QA 2XUCA 1WO2A 4D6CA 1GOOA 1WDQA 3T09A 3G6MA 1P6WA 4AWEA 5A2CA 5FCZA 4M80A 1ZBWA 3N04A 3WFLA 3LXAA 1WZKA 3U5YA 4TTGA 2OSWA 2WB5A 3A4AA 3AMLA 3L4YA 3K8LA 3WMCA 2Y5EA 2DPEA 2O9OA 3BVVA 2OYKA 3TP4A 2A3EA 4UZSA 1KR0A 1XD0A 1H5VA 1IZJA 1LWHA 3TONA 3EDDA 2EAEA 4AIOA 1J01A 2DSWA 1GQJA 2A3AA 3VD4A 1Z32X 4UQEA 1H4PA 3GBDA 2VZVA 1W3HA 4YHGA 3THDA 3D50A 5KEZA 1K9TA 2VQTA 1E6XM 1QOXA 4J3XA 4FNSA 3WDPP 2W62A 1OWQA 3VTRA 3LXCA 1KCLA 2C7FA 4JFVA 2DSZA 3F4VA 3CUHA 3W29A 3DC0A 3U7VA 4ML4A 3KZSA 2WHLA 2D2OA 2BY2A 3VSUA 1MW3A 1LG2A 1CLVA 4MJ4A 3F5LA 1GW1A 3OGRA 1DWHM 5FL1A 1XD1A 4UOZA 4S3KA 3BUIA 1QBAA 1KXQA 2EO7A 4P8VA 3AS0A 2VX7A 2QPUA 5CPQA 1UH3A 2VC9A 1UR9A 1GOQA 3PZIA 4WKFA 4AZIA 3L2LA 2XWDA 2ZUNA 2W92A 1FP9A 4FF5A 1B31A 2XSAA 3ZSTA 1WNOA 2WMHA 4AMCA 2XM2A 1JL8A 1B2YA 2VMFA 4P7LA 5DT5A 1E43A 3AYRA 2F1AA 2YFNA 2BVDA 1KGUA 3L4TA 3OBAA 3CUFA 4TX8A 3T0AA 3SCVA 2OSXA 1ECEA 1GOKA 2WZHA 3A3HA 1J18A 2XN2A 3PZTA 4HMEA 2F7QA 1QX1A 1R86A 1ZBCA 2UY4A 3VIGA 1TG7A 1CYGA 1O7AA 3GXTA 3ZJ8A 1MXGA 4AZBA 1CPUA 1W9XA 3DHPA 2ZUWA 3WY2A 3WH9A 4HU0A 3DYPA 1J0IA 4URIA 2WZIA 5ABHA 1PAMA 2AMGA 2FH8A 3MS8A 2YDSA 4MDOA 5A6BA 3EDKA 3OB8A 2QV4A 3GXMA 3FAXA 3L4XA 1ISZA 4UZUA 5E09A 2Y24A 2DIEA 4CCCA 3N11A 1JZ8A 3A24A 3W37A 2XVGA 4HZ8A 1GPFA 1FOBA 4OBRA 4LPCA 4CD7A 1LWJA 4MAVA 2BXYA 2D23A 3EJSA 3BLKA 4H8VA 3CC1A 2WCGA 4BS0A 3EBVA 3VX1A 2ZUMA 3ZSSA 3AIBA 1WDSA 2G4FA 4E4PA 3AHTA 1BPLB 2WKLA 1UKOA 1VIWA 3AXIA 3CZEA 4GI8A 2IXVA 4UFJA 3JUGA 1K9EA 3IJ9A 1V02A 3MKKA 4JKMA 2W61A 4CN1A 3N1AA 2VX4A 1KXHA 3L4UA 1U33A 9CGTA 1Q6FA 3ARVA 3ARZA 1XCWA 1G5AA 1ISWA 5D9NA 3WD4A 1GQIA 3VU2A 2XVKA 5HPOA 3CHFA 3UCQA 2CXGA 1UWTA 4W89A 5A6JA 5A8NA 3WMSA 1RPKA 4LYPA 4FNTA 3VMPA 1E0VA 1CGXA 4F9DA 2X1IA 2ZXAA 4GINA 1UOKA 3HN3A 2F7PA 1W1YA 2J7GA 1CXFA 2DT2A 3AHXA 4U31A 1VRXA 1UKQA 5D9MA 3VSTA 2ZXDA 2VCAA 1M53A 4AD2A 5CZKA 3VILA 1HKMA 4P8WA 4KGLA 3RJXA 3OLIA 5GNZA 1AMYA 3GYCA 1F4HA 4ZXLA 4QLKA 3GH4A 5D8ZA 5M3WA 3UG3A 4TUFA 2GJPA 3OA5A 3WSUA 5LYRA 1FA2A 4AD5A 4F79A 1EOKA 4W5ZA 3ZJKA 3CBWA 2A3CA 3PZOA 1JFHA 4FLRA 2DSVA 3AIUA 5EB8A 4HP5A 4MNMA 2WVUA 4PMOA 2WYSA 2W5FA 3DYOA 1CTNA 2DH3A 4PMYA 1UD3A 2G8ZA 1RD6A 1B1YA 4PMXA 1G0CA 1I1XA 1EA9C 1BLIA 2XWEA 2PWEA 2JF7A 4LX4A 4BQ2A 3ARSA 3N15A 2CHOA 2VTFA 3CGTA 1R8LA 3AS2A 4H8HA 1J0JA 2J79A 3ZJ6A 3MUIA 3U5UA 3WQWA 1ZJAA 1XYFA 2IGTA 4NZJA 2HISA
chains in the Genus database with same CATH superfamily
4QRPB 3GIQA 3FSZA 5DQ9A 5GGSY 2OMTA 3JV6B 2YBVA 3RITA 1KM5A 2Y7EA 5KZCD 5ACLA 1PKMA 5C0QA 1CXIA 1B3ZA 2B4GA 1KPVA 5L9FA 3R58A 1K3UA 2QW5A 4Y0GA 5FOOA 1V8EA 2DV0A 4X99B 4XI5C 1AD9A 3VIPA 2LE9A 1QNVA 1MCHA 3K6FA 1QO5A 3ETSA 3RHGA 1FWXA 1YJDL 5JPNB 4B91A 2E7LA 4N0UA 1HXJA 7A3HA 2AS5M 5IIEA 2BNUB 2KLSA 1OAQH 3TFBA 3ES6B 3GZQA 1QD0A 4JNYA 4F33B 2EPNA 4GQ9L 1VFOA 3CZSA 3MKVA 5JHDA 5GPRA 2XQYA 3E7JA 2YXOA 4HXAH 1ET5A 4NO0B 3VXRA 4HKZA 2CJTA 2XFXA 1R3WA 4OCWH 3LXBA 1YNLL 2J6EA 4C6OA 1Z5LB 3IMTA 4JG9A 1R3YA 3DGCR 3L48A 4ADJA 4QHKJ 4A2EA 3ZX1A 1QSEE 4GKZA 1SEBB 4PJAF 4MCYA 2OMUA 3VH8B 3V0GA 1A6PA 2H6RA 2F15A 3LMYA 1OADA 1FWEC 3DENA 3E0FA 1KCSH 3ECWA 4MXVF 1TTQA 4KQ4L 3ISYA 2GG1A 3SD2A 1XS2A 2OP4H 3O6YX 2WBGA 4AHQA 3QCVL 4J3WA 5DWUL 3TXVA 3S47A 3GR8A 3C6EA 4ZSTA 2IPUG 3Q3GA 1SY6A 5IVXA 4PPTA 3QFDB 3RDJA 4G82A 3V7MA 2R4RH 4HJWA 1KFWA 3EBIA 1LMKA 2A2IA 3HM7A 4Y6GA 4NS0A 5C0GB 1W1A1 3NJ3A 2ZRWA 1GYCA 4H5SA 2EDEA 5HHPA 4AYEC 3AVEA 5E4EC 3WNLA 4D9RD 4MA3A 2R29A 3V36A 1AGBB 2MNWA 3HC4L 4HCGA 4Z8FL 5IVZA 1XG4A 3LSCA 3K30A 3MC0A 3QHZL 5B1CA 1FZMB 32C2A 4X80H 4MJID 4TSCH 3QN3A 4KS0A 4F0SA 1GYVA 4EXAA 3ZKNC 3FT3A 1R85A 2WYZA 1H5BA 2FQEA 1UM5H 3GTVA 3IVSA 1NBCA 4NI3A 1FY6A 1TMLA 3HKZA 4E2VA 3OX8A 4NC2B 1HAWA 4BRJA 1ITCA 3SDXA 1P1XA 3L7EA 2ADFH 1LXMA 4KKBC 5CLTA 3K71B 2XKNA 2EDNA 3GSMA 3O4LB 2E7CA 3VD3A 5JW4R 3I7RA 1DWJM 1AYOA 1MCIA 4TVPD 3N9RA 3SQLA 4ONFL 3F00A 1CIUA 4OUIA 4MNQE 4FHAA 2NCMA 4WW2A 4HZLB 4HNUA 2O9PA 3NP3A 4IRJB 1ZTVA 1HH9A 1MUJB 5J7CC 1QEWB 3ESVF 2ZXQA 4DVRH 1JPSL 2OQJB 3QYMA 4JTLA 2PB1A 1XLLA 3G5EA 5IFJB 5I2IB 1IVTA 3M1CA 3NM3A 4G3YH 3MP5A 4GMTH 1CGUA 3I84A 2XXGA 3U9WA 2EICA 4NZUL 4ZQKA 5H37G 2AEIT 5TE7L 4MMYB 3MLTA 1TPWA 1U8LB 3GMPA 3HPLB 2ZXBA 4JFHD 3LPGA 4K9EH 2GJ6A 1KM6A 1AXIB 4DHGA 4PJ7B 4HJ0D 4DKFH 1V7ML 2N7AA 4UYPA 3BLOA 2WQUA 4V2BA 1QOKA 5T1DH 1AZCA 2QHRH 2WXHA 4Q6IB 2OJEB 1H7XA 2B20A 1H15B 3PQYB 4O2FB 4XNMB 3FUKA 1B0WA 4BFAA 3AJXA 2PXYD 3OJMB 1C1EH 1RUQH 3HZYA 2CO2A 4NNCA 4WXZA 1GQNA 1TSRA 2Q76A 2OL3H 4B6ZA 4U6XA 2M26A 4PP1D 5F3HB 4DO6A 4ZRGA 1JCLA 4UR8A 3Q6GL 3GK8H 3POHA 3V52L 4FF9A 4UAOB 4CC1A 3TXZA 1VCFA 1REIA 4LBAA 3S5ZA 4A4AA 1SZEA 2J7EA 1ZDQA 4HC1H 4Q7DA 3JV0A 4ZGYA 1MCQA 3G8RA 4BK8A 2DMBA 3KVJA 4L3AA 3IK2A 2E9WA 3N1PC 4HLJA 2NV2A 4JFSA 4TF4A 1ZAIA 3L3JA 2EVFA 4JTJA 1OP4A 1NWRA 2VLKE 4YYCA 4PRPB 4D8PB 3O6DA 5BQ7B 2OMXB 3LCFA 1S7QA 1MHHB 3FY1A 3KDMA 4O8AA 2OPCA 1CECA 5IHWA 1QRQA 4UV7H 2JK2A 3MRCB 1AG6A 3AG3B 2JB5H 3BOXA 1PNDA 2G3NA 5CSSA 1JWUA 1PDKA 3BE7A 4ZT1A 3CV7A 3S34H 3ZZLA 4OR1A 1YEDA 4O02B 4H88H 4OGQC 4OE7A 4JQ2A 5EIIG 2LABA 2V6AA 5AZEL 2WGXA 3MGAA 4JY4B 5HJYA 3BZGA 4HHWA 4GY0A 1OINA 3LKPB 3JBG7 4HWEH 1FL3A 4QF1B 2ZONA 4XMLL 4B0MB 2WD0A 5SWQB 1JPST 1JPFB 1QI5A 2TRYA 1UOWA 3W7CA 1UADC 2W5PA 2YUVA 2OXHB 4XVSL 3Q1EA 1H8OA 5BZAA 4CCDA 2FHBA 3RNQB 5IOBA 2HRLA 2IW0A 5C0CD 2D8KA 4HNCA 1VAHA 3F7VA 4GRWF 2MQ3A 1IM9D 5ECVA 3WS3B 4DP0X 4Z7UA 4ONGL 3WQPA 4DUXA 3NOIA 4L0ZA 4GJ1A 5I18L 5SWUA 2C1IA 3AU6A 3TCLB 4IF2A 3OVGA 3GSXB 4JMXA 5E8NA 5D1ZD 2EYTA 2PDHA 3HS0A 1E6PA 4L5ZA 3QYNA 3BLFA 2B1AH 1WB0A 3EW3B 4HQVA 1DEEA 1JPIA 1E2VA 2F2KA 3FLUA 5CEZE 1OV8A 1WHOA 5HMSA 2FLMA 2IMRA 4WW1B 3JTSB 4DGWC 2BVOB 2WTRA 4C5YA 1VBGA 5DEFA 1BYCA 3T8VA 1R0MA 4XVTH 1IAOA 1GOGA 3EJPA 4GKNB 1IKFL 4DXVA 1NAKH 2AJZB 2ZTJA 2I85A 5IUCA 4GBXD 4HYVA 3E6FB 1X1NA 2HWZH 2VGLM 5ABFA 2XIOA 5BZWA 3L65A 1ZPLA 4H25A 1Q7MA 5A6SA 3ZS4A 2YPLE 1XH2A 2TSBA 4LLYA 3TE9A 4W5UA 2O5XL 2VJXA 4FERA 3QZNA 4I3SL 4B2DA 4AEOA 4K7YA 3PIQA 2HPTA 1QVOB 4RL3A 2FDBP 4GXFA 4JDVA 3MV9A 1I1CA 4E36A 1Q5MA 3P3BA 4YO0A 2VC2B 2A0LC 2WW5A 1PWLA 4MXWL 3LZPA 3FKUS 1H3PH 2GGHA 4EXQA 2Y7QA 4YL9A 2DQCL 3RVWD 3JZEA 4JDZB 1JR1A 5TDOB 2YSWA 2RDWA 3RVUD 1KJ2B 4J40A 3DDGA 4FP1A 4QM1A 2K6WA 1ZT7B 1GHRA 1U95A 4HGWB 3QG6A 4P2OC 3ENLA 5C0RL 2F7OA 5LBSL 3UTSA 4G6AC 2GKIA 4P8XA 1L6YA 4O12A 1G9ML 3ZKXB 1E5AA 2Q6WB 4O1DA 2J71A 4TV5A 3BPOC 1LK2A 1J48A 3ABZA 4DKTA 4NQSA 1U58A 5E8PA 2R1WA 1JRBA 1A7RH 1UROA 4DJFC 3KLSA 1HVXA 3I6KB 2BVPB 5ESQB 4NFBA 2YPVH 2NY5L 2OJZL 1KENL 3BPCA 2V2WA 12E8L 3DDFA 4IRSB 1DTNA 3SKNB 3KW3A 2YD6A 4EIVA 2YLAA 3TYEA 2ZPKH 4GIPD 1Q4WA 1VRDA 1G94A 4HVBA 2DMGA 1UWUA 3B5TA 3EWCA 1FGNH 3VFMA 4Z7VF 5HHOA 5ITBL 4JMNA 2RD0A 4DNMA 3MTWA 1BWKA 3W26A 2UY7B 1LL6A 2QGDA 1JVOA 4PRRA 5E6RB 3WIHA 5I6SA 3BI9X 2HMIC 2WZEA 2BG5A 3BOLA 4HVXA 2ESVA 3M0KA 4A2FA 3QNFA 5LWYL 3IRZA 2E40A 3GBLA 4G8EA 4LARH 1TQWA 1V6WA 5AVQB 3WIIH 5DO2C 2YUXA 4Q97A 5K9OB 5D71L 1VGEL 3V7AE 3B9NA 3UW6A 1GVSA 1I2QA 3ORWA 1EUAA 1FV1A 1S7TA 2PDGA 2YXGA 4MJZA 3QTGA 1QACA 3U7WH 5H37H 3D3VE 4ANKA 3QJAA 4FMVA 1PKQE 5CBIA 5ABTA 5CMAB 2Y61A 1OD7A 3K4AA 4BH8A 3OD3A 1IHIA 4NUWA 3NQCA 2C71A 1YJDC 3MCYA 3CIVA 3UZZA 2XWTA 5AC6A 2CR0A 4ZBCA 1HS6A 1T6BX 5L9DH 2JKSA 4W9JC 5BU9A 4HULB 1H0IA 3VKAA 3MLYL 3BRFA 4LL4A 3BFOA 3DMMD 2A6NA 1D3HA 4HZMA 5E03A 3U0WL 5AAWA 2YPKB 4CDGC 5IMMA 2GT9B 1BVNP 1THCA 4C6QA 1PV8A 5D5MF 1CDYA 3QDGE 2AJ3A 4TULH 1TE6A 1VCAA 4R7JA 4MXQD 2V5BA 2GJZA 4MWFA 3CH0A 4GSDL 1QAWA 1CO1A 1MCOL 1MVUA 4I6KA 4CJ0A 5I66B 2CFFA 4PD4K 4IQJA 1PCSA 5KAQF 4B50A 3UGVA 2X3BA 5I77A 2VR2A 2V67A 3PBGA 4NP9A 5FO9B 2WXJA 5FDYA 3TBYA 1AGFA 3Q58A 4O1AA 1HZHL 4CKQA 4HKBA 5F6HJ 3W7IA 1E9PA 4F9LC 4RMUA 1ZL1A 2R0LH 1T80A 5FO2A 4HCRA 2PDJA 1RAMA 4PS3A 2R56L 1XDJA 2ZUTA 3VFTA 2ZWLT 3DH7A 2UY2A 4JKLA 3PP3K 3URAA 3VI4E 2IDSA 4TNFA 3AZRA 5C09B 1TRDA 2XH7A 4JW3A 4M7JH 1FNAA 4D9QD 3BT2L 1V3KA 4NQXA 3JV4A 4ALAH 3MGOA 1KT2B 1FWDC 1XH3B 2ITCA 1YEHL 3CC5B 5D7LA 1J9CT 2R14A 5TIMA 2B1OA 4Y88A 5HDQH 3H7VA 1F3WA 2Y5JA 4AENA 3MYOA 4M56A 2IKGA 3M1BA 1GEHA 2C15A 4AX7A 1QPOA 3GG1A 1TB3A 4J3TA 2XFRA 2BERA 2ZCHH 1N82A 2AQRA 3HGJA 1IL1A 1E56A 2Z7YA 4JRXB 4PJXB 5CCGE 3BGFB 1DVFD 1I3GH 4MB5A 5JW4N 3BLPX 3MCNA 2CH8A 3C60D 3W39A 2ZRVA 2YWZA 3UP1A 5JOEA 2J72A 3NPSB 2H2PC 1WQ5A 2JCCA 3U25A 1J9YA 4EZMA 5DRXA 4AQEA 5CU9A 1QDSA 3HS8A 2GAZB 4IIQA 1DIKA 2WQRA 4NAMA 5LQBH 2OX4A 1P0EA 3W25A 1E4XL 2O6DA 4LSBA 3OGCA 4HXAL 2VD8A 1UBPC 3BHBB 2UXVA 4C6BA 1INEH 4X6FB 3HMWH 4M5TA 5EWIH 1SY6L 4OCWL 4LBUA 1BREA 2QCFA 2FVMA 2GDQA 4C65A 3BQUA 6REQB 3UEZA 2X4UA 4FEMA 3FCTA 5IV2A 3VXSB 4NAFA 4R85A 2J5WA 4H8WH 2AJXL 1QZ1A 1ZLUK 3D5OF 1N2VA 5L0QC 4MFDA 3TXAA 1WUEA 4F1ZA 4KWVA 2WP3T 4TLSA 3O8XC 3WLQA 3TW7A 4BUQA 4J4PA 3BN3B 2R29L 3LOWA 5D96C 4S0TD 3I6RA 3X13B 4TX6A 5DJ8A 2YDAA 1NMCB 3G5WA 2YD1A 3T1GA 3BISA 5BVJB 2ZF9A 1U83A 3WK2A 5M95B 2E28A 2FCBA 5HHVH 3FT9A 3IDXH 2PF0A 3WMPA 1DANU 3GSNH 5DFTA 3D9AH 4RRPA 3T0WA 1F7BA 3MRLB 3C5XA 3O45A 5D2WA 1OSZB 3T2QA 3VZXA 3PHOB 1CT8A 4AWEA 4MJ5A 2VQ4A 3DK0A 1W1ZA 5E0KA 1ED3B 4XMPH 4TTGA 5JHBA 3VXOA 1S5MA 4JPVH 4HWUA 1LEKB 3VKJA 1Q72L 4JM2C 1CQYA 1IAIM 1XD0A 4PU2A 5FKAB 4X80L 1IZJA 5GSRB 5FLVA 3MO7A 5EUKB 3TONA 5IQLA 5D4IA 3OXSA 4GP5B 3OHXB 2FJHA 3KD4A 4N9EA 1KRBC 3CUXA 3WQEA 2VQTA 3ULUD 1D5IH 3LXCA 2OMZB 4WFFD 4JQVA 2CLZB 4R3UA 3AM8C 3BN9D 2KUTA 5FW8A 3FMGH 4NJKA 2G30A 2ZOTA 1MW3A 4BFIA 3K6NA 1J1XH 2CM5A 3P4OB 1XD1A 4UOZA 2H3XC 3BUIA 4MJIE 1QBAA 3FQYA 3EB2A 5AVVB 1KXQA 4PJ7F 3VXQA 1UJ3B 4W9GC 1UH3A 5D2LA 2WZPD 3K72B 3L2LA 2ZUNA 1C12A 1FZKA 4NQCA 5HVFB 4DVRL 4R5TA 3H3BC 4FADA 4F24A 3PFQA 1JTOA 2PYEA 1S5TA 3GMMA 4K5OA 2RDXA 2C3XA 2WKJA 3OPSA 2DJ4A 1O7AA 4Z9KB 1G1CA 3RFRA 4YE4L 3P73A 4YLQT 1DBAH 3H23A 1IWPA 2QCGA 5LAXB 4K9EL 4OJAA 3NCFB 2FWOA 2OLSA 3THMH 1KTLA 1AZVA 3A24A 1NKRA 1CB7B 3Q8AA 4WR3A 4KJYA 2FL5A 2BXYA 3Q06A 3S2AA 1XF3A 3BLKA 4H8VA 1AC0A 2ZUMA 3W7OA 1AHMA 3AIBA 5J57B 3B3IB 1WDSA 1BPLB 1JRHI 3TA3D 3VXGA 2E77A 3GQFA 4ODBD 3RYSA 3QFJA 1RUQL 5EBUA 5D9NA 3QK0A 3LM7A 2A5UA 4NO5A 4JHBA 3N1QC 1RPKA 1X9LA 3N42B 1E65A 3QI9C 2GUBA 2Q1EA 1E0VA 3MBED 4Q6JA 3WU1A 5LIKX 1PMYA 1UOKA 3OXRB 2OMWB 3QXVA 3AB0B 4LVEA 5IJDC 4IJ3C 1BVLA 3B2UC 4AQAB 1XMEB 3U1QA 3RZWA 3D3FA 5DMGC 2XWJB 2HSAA 2E27H 4B9IA 4FFVD 1IGCH 3UP6A 4HC1L 1RVGA 2DIKA 1ZHBB 5LYRA 3O06A 1SW7A 1WX0A 3DO3A 2XYCA 4L4VD 4QRTA 3QPEA 4WY7H 1TU2A 2DM4A 1UEYA 1E0TA 3BP7B 4GJIA 2P9RA 4RIRB 5I1DB 3DETD 2W5FA 5EF3A 1MRAA 1Y6MR 1KF9B 4Y5VC 3M5ZA 2A38A 1NC4D 1F1AA 3CGTA 4PYHA 3S35H 1INQB 4YNYA 1RUAL 4RLDA 2GK0B 3VXUD 3NCBB 4XN1A 3QDHA 4BRVA 5L2JA 4NZJA 3L4CA 4DQOH 2XV0A 1C5CL 3AQZA 4J3OD 4XMWA 2JB5L 2N7SA 1PXGA 5MHSE 2QGYA 2VDNB 3MRBA 5E5RB 3DUHA 2Q8BH 3WLBA 3S3DB 2ZE0A 2J7HA 4HWEL 4PJBA 2AXGB 2PTVA 1OC7A 2FDSA 3WCZA 4O0QA 2IMMA 4YEEA 5FUOH 3S37H 1ASPA 3L16A 4HNVA 1LK3H 3A4EA 4ANXA 1YHTA 4Y16D 4XWGH 3HVDA 3RVXC 2E86A 4ZAKA 2YXFA 4QG6A 4K3JH 3GFYA 1QBMH 2QHLA 3QIUD 4H4IA 4WWKB 3D0LA 1U92B 1G9MC 1YYCA 1CR9L 4WNQA 1MY5A 1SO5A 4UQDA 1RV8A 3SE8L 3X1NA 1NEZB 4C4BA 3KJ6H 5DC0A 3T0EC 1S6NA 5HGAB 4GNKB 5FF6A 3C5SB 4M5YH 2EDBA 1EZVY 5IY5B 3EYVA 4ATLA 4MIMA 3TBCA 3U46A 5F1OB 5FK9B 4NWUL 5HJDA 4QYAA 1V0NA 2XCMC 5I3KA 3MLRH 6XIMA 1SYSB 2NY5C 4PB3A 4PTWA 3W9DA 2P88A 3L54A 2BC4A 5E6UB 2ARWA 3VGGA 3K4ZA 2FIQA 1IBGL 2OMBA 3TJLA 1E4IA 2BS9A 1JNNH 4AI7A 2Y88A 4YHOH 2BGSA 1CQKA 1A6WL 3P9MA 5I30H 5CGYD 2PLKA 2GZXA 4A8IA 3UWEA 4XCEA 5CNHA 2E3VA 2J21A 2NLJA 4U2ZA 3GNOA 2P0OA 1NAKL 6TIMA 1T8QA 1EEYA 2Y5QA 2WB1A 1WUZA 4J3SA 3K3QA 2NY6B 2HWZL 1SVZA 1QMUA 4WHBA 4IMFA 5GGVY 3RY5A 4F9LA 1KTKE 3NCCB 1L6SA 3DFOA 1FDJA 5M2FX 4LRIC 4KKNA 5DBUA 3W7PA 4NDMB 4G8GD 3G6JE 1T96A 5AVSB 1FWRA 4UF7C 1OIMA 3VE0A 5SWZB 4AQLA 2WBKA 3CFDB 4LSRH 1B9BA 2WXDM 1JZ4A 5BVPL 3REVB 1A4KB 5HYFA 3B7UX 4LHJB 1FL6A 1H7NA 2DLGA 3T0BA 1H3PL 1XGTA 3BWZA 1MSPA 4ISVB 4NWTH 3EB3A 1EAPA 1MCNA 3P9LB 5FJRA 4JNMA 4YXHL 5F7FA 3CIWA 4KEMA 1PZ2A 1BF6A 2NRDA 4JGNA 3SYQA 4NQEE 4O58H 5DJYB 1RJZB 1I3VA 4OGZA 4QHUA 2OMVB 5D93B 4PWJA 3RJQB 3WK1A 3WH5A 2MNJB 2HCZX 4G83A 5JIIA 4XXDB 1JZIA 1DQDH 1J5OH 3G5ZA 4DAGH 1RCOB 1HJWA 3SBFA 3NIFB 1CZ1A 2Y1YA 2WAHA 3FOMB 1UA7A 2QKIC 1TFPA 4O4YH 5EMLA 3WIHL 4XC1H 1JCYA 4ZQPA 1HHHA 2Z6JA 1UPPA 5KN5A 2YPVL 4HK3N 3GG0A 5DN1A 3P0YL 4OW6A 5MEPB 3SGGA 2YD2A 2YMOA 4M61A 3KBWA 2VNCA 3PDGA 1US3A 4PJFA 3LRLA 1FH2A 1WYJA 4W85A 4MZ3A 3NR0A 3GFUA 2X41A 5G2IA 2R2BA 2OPJA 4Y1AD 5K9DA 1MCWM 1SDDB 2PCXA 3EGSB 4WI5A 3UG5A 1KG0B 3H2NA 1OG6A 2E7LC 4WSKA 4LARL 3QIBA 4WUUD 4ZFGL 4HPOH 1XR9B 3D2UB 5DMKA 2NQJA 4B9GA 1HKKA 3L7FA 5IB1A 4X6BA 3Q65A 2E9IA 1PJWA 3N6QA 4AMWA 2K9UA 4GISA 3BH4A 5GS0H 2E75C 5ID1A 2JQMA 4NNPH 3CL6A 2Y7GA 4IQHA 2GQ3A 3CG8A 3O4OB 3D18A 3U7WL 4JFPA 1J8VA 5IQ9A 4XZHA 3L5WA 3UO8B 1BJ1J 3CT2A 5AVUB 2GJXA 1ZENA 2EO9A 5FA4A 2B77A 4N8CL 4KROB 2P8PB 2R1KA 3VSQA 4M93B 1MLCB 2Q71A 1VKXB 1KN2L 5E00A 3QUZA 1OANA 2ZJSL 2V9RA 3WIFB 1HXYB 1CB2A 3FTGA 4YDMA 1E1FA 3REQA 3NESA 2X1WL 3HS9A 4F7EA 4JM2A 1VADA 3FU7B 2WKOF 1MXSA 2IQAA 1ME8A 1HXMA 4KU1A 5J3HD 1ZLVH 1VS1A 1TJIH 1SXCA 3RILA 4OKDA 5HHNA 3VOFA 1UR4A 4ZMXA 3L12A 3KHQA 2DD8H 2GK1A 4K68A 4XUYA 3QEQA 4HCRL 1HL2A 5TE6L 3W9EB 2O56A 3SCSA 3MRPA 5HI3D 5AB2A 1T41A 3PSWA 5EL1A 3K1KC 2XVLA 2D3LA 2OKMA 2VCBA 4LB3A 2EIDA 1DJIA 2ED8A 3IUHA 5GJNA 1BG4A 3QCTL 3BURA 1U9KA 2Y6SD 4UR9A 3TN0C 3DU0A 4PRBB 3VYNA 2NVAA 3GBEA 4D0CA 3NZGA 4NN6B 2UBPC 1T1YB 4PJXF 3PZNA 1CD0A 1FI8C 1RUKH 5KJRL 4K2SA 2GVGA 4IIHA 1RU9H 3TQVA 1EC7A 4IBVA 3HZMB 3ZRFC 4MA7H 4XOCA 4JRFA 2L7UA 5E99H 2OWCA 1KYOJ 4U1SB 1HL8A 4ZOAA 3WDRA 1LBLA 1NIUA 2Y63A 1J8HB 1DE6A 5FKPB 3LKSA 3RRQA 4AIZB 3FHEA 1TJHH 2IBZX 2ZCHL 2XFGB 4P5UA 4RZ5A 4M7KH 4AEIH 3N2BA 4ADTA 1GCYA 2V82A 4PFHA 4PL2A 3SPHA 4WW2C 3GU9A 1MJ8H 4L4LA 5BROA 2C9UA 1IR2A 5T26A 1BBJA 2QDHA 4R7DB 1YA5A 3B3DA 1UZ1A 2YZ8A 4YLWA 1VFMA 4DF2A 4J3BA 1V3LA 2YWYA 1Z9LA 4IPJA 3UH8A 3DOSA 3QIWD 1QWHA 3S0CA 2W66A 2EPKX 4HCIA 5LQBL 4JO4H 4R0LA 3UDWC 3CSFA 5I1KL 1GJUA 1ONEA 1EJSC 2QQKH 2NX5D 3RWFB 5JXEC 1F9CA 5IB2B 4C6JA 2QGCA 2DDQH 3F7PC 1G7PB 3UYPA 3EWYA 3NYKA 4B3ZA 1LQSR 1JGDA 1WBJA 1BQ5A 2GGIA 5FI8A 3DVGB 4AXKA 3NN8A 1QPRA 4JRYB 2QCCA 3MRQB 4QIRA 3ARFD 4L9ZA 2W8CA 2AK4A 2F54D 2IJ0C 2E6DA 1N8WA 2IOMA 1QWUA 1EFXA 1RIVH 1IE4A 2IFGA 4K9EC 3HURA 2VITA 4DWSA 3O07A 1DCEA 3FQRA 3BAEL 2REQB 1U2YA 4NPKA 1YTKA 3VOGA 3G5YB 3LN4A 1DQQB 5HHVL 5DJCB 3IDXL 1CFMA 2X4QA 5K4XA 3S2CA 2H1PH 4PB9H 3V4PA 4CEXC 3B0PA 3KPOA 2BCKA 3UT0A 5ERWB 1OL0A 5KANI 4P0DA 4AD3A 4DI8A 1NIAA 4JQIH 5DK3A 2EDMA 4GEIA 4H9XA 2BS71 3L5AA 1VFHA 3RBSA 5T3ZL 4Q9CA 1KFCA 2AJSL 3C9NB 4HYRA 4AWSA 3OODA 3RPBA 1UZ8A 4CNIA 4AYSA 4PB5A 4L65A 1J7VR 3VXMB 5DRIA 1R3JA 3X2QB 4UTWA 1A9EA 4AVNA 1PZAA 2NXIA 4CNUA 5LNUA 4JREB 4INFA 2ZSWB 4G6MH 2ZQKA 3T78A 1J1PH 1B0IA 2WV8A 1INDL 3TPUA 5D2XA 5BW6A 1I9CB 1UWSA 3FMGL 4A8LA 1IEIA 5C2GA 3HBGA 4ZFOA 5H4YA 1J1XL 4XO5A 3IWVA 4Q8WA 1KJMA 4UILH 3VINA 2PP7A 4XHJC 1KFAL 2XTSA 4PV8A 3HE6B 3IPFA 5BJTA 3S42A 4WNSA 4F0HA 3HKFA 3CXOA 3LS4H 4N1CA 2JNZA 3WL0A 3FO9B 5IMLB 3BTNA 2CNZA 3R0NA 3HUJB 4C8XA 2RJHA 3QR3A 4TLTA 1QP1A 2BVQA 4HALA 2CBTA 5J6GB 4LTSA 5A8GA 3F12B 1K4CA 2HUEA 3MMUA 2WINA 3WKNA 4N6RA 2B5IB 2QQ6A 1ACYH 3LEXB 1NBVL 1TMHA 1THAA 3N42F 2DT1A 1YPZA 1ZU8A 3COTA 1KEGL 4PJ5E 5C9XA 3WHXB 3VFCA 3THML 4FD0A 5DJXA 3HS0C 2EIMB 1FO0H 3A4XA 3GSRB 3BEVA 4LY4A 4L3EA 4N0YL 3HLAB 2JBMA 1PG7X 4OJDH 3BWAB 2WMIB 4IIDA 4ECNA 1GH7A 3NK4A 3GLDA 4U1IA 4XKMA 1JV2A 4I4WA 1W37A 3NDYA 2R4SH 3T4AB 1AYRA 1WBZA 2AERT 1UM4H 5T5NF 2G0WA 3VD9A 1N0LB 4R2GB 1XCQB 5FOBB 1EJRC 1QLRB 5XINA 4OZHB 1ANUA 4ODVL 2NV9A 5T3XD 4N2EA 1JWMB 4KDVA 4WK0B 1T1ZA 5GZND 3KEHA 1X4XA 3P4NA 1UG9A 3CVIH 5FGBA 5HPMA 3UGXA 3AXHA 1B3XA 4NQDB 3WS6C 4S3BA 1S2UA 1IGCL 4PG9A 3N41B 2QKIA 3MXWL 4PYSA 5DBTA 3BQ6A 3B7YA 4LXFA 3MLSL 4LNRA 3O15A 4LAOA 5HUOA 2F6XA 1FWWA 2HX7A 5BMWA 1KBGH 3SKMB 1R3HA 1KM0A 2X2JA 1WC7A 1F3DJ 4XOEA 4WEMB 1M1BA 1RL1A 4L9XA 2YL9A 3ULVD 1A4MA 4ZODA 4KK5D 5CIPB 2MQGA 1J10A 4L18A 2PC4A 1SU5A 4DQOL 1RJYB 5D7KD 2X12A 4LASL 3DVNB 3UZXA 4FLQA 3PG8A 2WCPA 3GR7A 1YTEA 3AQUA 4NXSA 4F57H 2B1HL 3G08A 1IGFH 5LJYH 4GS7C 4G11A 3NZ1A 1Y5VA 2BP0B 3VXUE 3U6WA 5I3FA 1WPCA 4A38A 2H26A 2KMWA 3HE7B 4HBCH 1N67A 2PCPA 1FKWA 3BLIA 3DFPA 4JO2H 1R5YA 5HHXL 2WV3A 4K3JL 2I5GA 4IBUA 5I2UA 3GXUB 5K1VA 3PWUA 1ZGDA 2Z4GA 2SEBB 3PHSA 4GRMA 2PGFA 4IU3B 1N8OE 3JT0A 3MJ9L 3NGJA 4HJJH 2P26A 3PJLA 3EOYG 4FTVA 3W7RA 3BWUC 2MCG1 3FA5A 2Q87A 3ZKQD 4KMQA 3R06A 5EU7E 4APQC 1GG1A 2BMBA 2ZZ7A 1OSPL 1NCUA 3MLRL 2E7FA 1KGIA 2DW7A 1IEAA 1CC3A 3FVDA 1GGUA 4IGMA 1NGZB 1JNNL 1TENA 3GH7A 1OCBA 1DN2A 3GSQA 3BD3A 2BRRL 3M0MA 3CQKA 4I9TA 2H8ZA 3SQOL 2X70B 1YEJH 2WBXA 3G1DA 4DKDC 3D7PA 3HVNA 4GSXA 4CVXB 2OM5A 3UMNA 1WBXB 5LA0A 4A7UA 4G7FA 4OFCA 1W72B 2ODHA 1DORA 2J6VA 3H3PH 1QNOA 3TN0A 4C6KA 2J43A 2ZUVA 3L3DB 4WJKB 4NYYA 3OM3B 4G1EB 5TQLA 3MVTA 1RHHB 4M51A 3C8KB 2BVUA 3NVQA 2CW6A 1W3NA 5AAWC 4B4FA 3N04A 2Z93B 2G5BB 4BH7B 2WB5A 4OGAD 3L4YA 1XL6A 3CAWA 2DPEA 3IDJB 2O9OA 3BVVA 1JGLL 4HCHA 3NIFF 4MJMA 4PWFA 3I6EA 3IEAA 1H63A 2AAMA 5DEJA 5BWAA 1WOBA 4Y4HD 1TVDA 4XPAL 4LL1A 1MLBA 5EBMB 1H4PA 4WTQA 5AECA 1TVBB 3TBWA 2DLIA 5KEZA 4LAQL 1S7UB 2PDUA 3TN3A 1BX2A 3MV8B 4LUSA 5T5FH 3TJXA 3M17A 1AO7A 1DDHA 4DEUA 2D2OA 3SCMB 2H9GB 3HTWA 3V5DB 4MA1C 5DJ0A 4FR1A 5K2ZA 3DROB 1KM3A 3HGSA 5LBGA 3AALA 1HTIA 4GKTA 4ADSA 2VDIA 3ECBB 4TMCA 2IV9A 2XU9A 2QPUA 4O4YL 1FE8H 1ZLPA 3W71A 4MS8D 1WAAE 2XWDA 4XC1L 1A2YA 4IMKC 3S46A 5D7JD 4QJ3B 3FJTA 2WXLA 5AENA 3OBAA 3O3RA 1T0MB 4L1TA 2PETA 3UDWA 3PFMA 1J18A 1KV3A 4F8PA 3QAZC 1W9XA 5I1EH 3K2GA 5JXEA 4URIA 5JDJA 2WZIA 2JB6B 3V8OA 5H35A 3I9IA 4NP4L 1YUHA 4Y8EA 2GTWA 3L4XA 4YDKH 1ISZA 1L2UA 2IANA 2KC0A 2VSKB 5CR8A 5AB0A 3KPLB 3VX1A 4LFHG 2H3BA 1O0VA 4XTRD 1D8CA 3P7YA 4WIQA 4GI8A 4UFJA 3RIAF 4KRPC 3MKKA 1V02A 2ADJA 2W61A 4LAKA 5DUML 1U33A 2CMRL 4HWBH 3PM6A 3EYOA 9CGTA 3VJ6A 4IIQC 2N7BA 1ISWA 2P5EB 2FJUB 5HPOA 1WZ1L 3AC0A 1SXAA 4GX9A 3QNZB 2W60A 2LT9A 3BKJH 5E9DE 1XUZA 2OTPA 4U31A 5DK2A 2V9UA 1LYXA 4AD2A 3PU7A 2O61A 5I19H 1UC4A 2FBOJ 3L1OH 4HN8A 3LKOA 4P8WA 4KGLA 3RJXA 1ZY9A 3BQUC 5LNSA 2I16A 3MRMA 4ZXLA 2FEDC 3KRUA 2X89D 4S10A 2XQ0A 1F4XL 2WZTA 5DS8B 4L8SB 3RVVC 3SQSA 4I8YA 1LP9B 2A3CA 5IR1A 5LN4A 2E68A 2D4FA 1EPFA 1TJIL 4J4PC 4JPSA 2APBA 2GITB 1SBSH 5IGXL 2WYSA 3VABA 2H6PA 1RIHL 2YO3A 4PMXA 3VI2A 3GSUA 2DD8L 5FSEC 3FSWA 2VEMA 1TETL 3QQDB 4IHBA 4HC1A 1M3JA 4PJEE 3DI2B 4LSQH 3FQUB 1WFMA 1R2TA 1EBGA 5ITFA 3MI6A 2UZ9A 2HE5A 1Q9KA 5C1MB 5DYFA 4N1HB 1XQKA 3H9YA 2GYSA 5IB4B 4KRNA 4I7WA 4JTDA 3LHTA 5ACMA 1AA1B 1QPNA 5KVDH 3XINA 5EU5A 4JIQA 5I78A 4XN9A 4NT6A 4A3RA 5F71A 3PWAA 3SBPA 2ZOKA 1BOYA 3FSUA 4ORZC 3WQ8A 4LAZA 2YD8A 4GYPC 1WFOA 1RUKL 4OLUH 1BBDH 2ATKB 2DZEA 1B2WL 1E40A 4ZTEA 4MA7L 4WI2A 1RLDA 1RXLA 2FWSA 2C4FT 1FG2A 4MS6A 4YPGA 3STLB 4QY8A 2Z8WC 1CICB 3W2LA 3ZUNC 4GAYB 5DR5H 3VNDA 4JQVC 3WKYA 2DUAA 4KK8D 4BV1A 4QOKB 2NNAA 4UTIA 5EPMB 3OBEA 4WVRA 3KHDA 3D4ZA 4XC3H 1I3UA 3STGA 4A21A 1E2ZA 3WQ4A 4JAMB 1KTDA 4M7KL 3G24A 1IYXA 5KVMC 3PPFA 1QFOA 5E8EB 3QDMB 5B4MD 1VLIA 2HFTA 1VD6A 3NCJH 5L4FA 3MA7A 4C6LA 5JTWA 3I6SA 4LGXA 3R1GH 1BD2A 1JGVH 3CHDA 1JHKH 2Y7MA 5GGQH 5DJ6B 3NO5A 5BOPA 2ZICA 4N3UA 3MP4A 1OGTA 2J6XA 3NOEA 4DO4A 3BDXA 1RI8A 1M65A 1QKZH 4ORIA 4CD6A 3PL6B 1M4KA 1J5TA 3EOBB 1F13A 3FYEB 4HOXA 2KAUC 1CL7I 3L08A 2J77A 4PSRA 3WS6A 2VKWA 4ZNEA 3N06B 4Z17A 2RHGA 5EHFA 3SGUA 2A73B 2DDQL 2E3ZA 2VW4A 3OVQA 2H32A 3LH9A 1DWFM 1GGBL 2PABA 3IU4L 1KBBA 2GK2A 1MJ7L 4ZUSA 1QQDB 1MQKH 1S9WB 3V4PL 4FX8A 5EOCL 3PWJA 4OLVL 1F11A 1DVZA 3J27A 3U0TA 4PRAB 4ZYKB 3RP1A 4A7GF 4R83A 3A6OA 4KCVA 2MNUA 2CJUH 2IWKA 4LRNL 2NX5E 3SQBB 4RE0A 4QXUH 2J75A 5B1JC 4C6CA 4IKJA 3SOBL 1TPVA 1ICPA 4MYAA 2VZ3A 1II4E 2JXMB 1LBFA 5IHRA 2QF8A 1H49A 2ED6A 4LZKA 5GS2D 5KS9B 1PZSA 3MQIA 1KCWA 3BVNB 4ZQRA 3KS5A 3TBSB 2BNRD 2R0ZL 2K6YA 1RVFH 2H1PL 4PB9L 2A4CA 3N9KA 4LAJH 4QGYA 1VHNA 4IBSA 2G75A 4JQIL 4IOFD 5T1JA 2XIQA 5I1HL 4ZFOL 5HHQA 4AF0B 1NAL1 5AW4B 4Z76B 3NH7H 3BZ4B 3NFPA 3Q48A 5IJBC 4XP9L 1M7UA 3VAVA 4ZQCA 1EZWA 5I73B 3F4CA 7TAAA 3CXDL 5LLIC 3TURA 2FZBA 3OAYK 3KPMB 4E41E 3RUGE 3BEWB 3MHFA 4G6ML 1J1PL 2ADGB 1R30A 2ZZ3A 2YJQA 4P8QA 4R9XA 1UD4A 4APQA 2WJDA 2YPVA 3HB3D 4JJ5A 2X2HA 5EEXA 1DVXA 4HPYH 3L4VA 1ZTXH 1LQ2A 1E8YA 3LOTA 3CSYB 4K73A 3QOMA 5T8GA 1ROWA 1P0DA 1TTFA 1TWDA 1VRSA 2VN5A 2Z1KA 3B2XA 4M7SA 3MNZB 3DO4A 4AHPA 5EC2B 4ZAKC 4PJIB 4ODXB 1MZYA 4JY6B 2XH4A 3EAKA 1BIHA 4AQZA 3QFGA 1HINH 1PQZA 4LCSA 3NCMA 1RURH 1W3IA 5EZIH 1XX9C 4XCNA 2AEOA 3WG7B 3ARGD 4TTUA 1CFBA 3RWDA 1JPDX 3NEOA 3MBXH 4DP9X 2Y7FA 3CDZA 1HOCB 2Z31D 5B3SB 4QEGA 1B3JA 4IX2A 4L9LA 1KIRA 3W1UA 3FYIB 5H37A 1IO4C 1XIIA 4ZW6A 4K7PL 1TEFA 3RM8A 1HC1A 3QZBA 4KKRA 1A25A 1XLKA 1EDQA 4YOKA 3N41F 5H8MA 4NKCA 3PABB 4QJ1A 4U1NB 2VMEA 3F64A 5A6IA 4S3FA 5EOQH 4JKKA 3MSRA 5TJWK 1JIBA 3W24A 2DMCA 4H9MA 4PP2A 2V9TA 3JVGC 4S1FA 3WBYA 3BO8B 1QLEB 2MCPL 43CAA 2I1OA 4ZR8A 1PX4A 5AOIA 2UZXB 1ZAGA 1AHWB 4G9FD 1R3VA 2AI0H 1WWBX 5B38B 3IEBA 4YGVB 3CK5A 2P53A 2N1KA 1R3LA 3TEVA 1SEQH 4B95C 3ZQ9A 4FOMA 4H41A 2VO5A 2OLAA 3W0WA 1K8XA 4YWIA 2BPBA 5DLML 3KVMA 3EADA 4IMKA 4JHMA 3L1FA 4MQXD 4OF0A 2L5HA 2KDYA 5AALA 4DN3H 5C92A 1PSKL 2KZHA 4MDJA 4I0CC 5AB1A 4IX0A 4WY0B 2CIIA 1MI5D 2I27N 4JQ3A 1NGXA 2VM8A 5D2VA 3SZ8A 3GZOA 1SMDA 1V0KA 1DBBH 4XVJH 2BIOA 1TTCA 3CIQA 3L5JA 1T40A 4ACZB 3FRUA 3MO1B 4HFWA 3BKCH 1A4AA 3SFWA 3E02A 2BP8B 2VDMH 4YHLH 1Q9LB 3ARPA 4P23D 2WVVA 4JQ1A 1NFDB 2P45B 1OAQL 3M7OA 2CESA 3OKDA 4PW4A 3ULVE 4AT6A 3QJXA 4NM4H 4F2ME 5KG9B 2PWDA 4G7QB 2GVEA 3I7QA 3APNA 3WV0A 3C4UA 1F6YA 3SYOA 4X4ME 1UWXH 3N6YA 2WSKA 5EIIA 3PJUA 1X5YA 3QA3B 4EO5A 1SHMA 3BLLA 3PY2A 1AZBA 4J27A 3CZJA 3WL1A 3RX4A 2WWKO 3GGWA 3FUJA 4PBEA 4NN5C 5DZPA 5C0AD 3F3HA 2WXMA 2Z3FA 4YDIH 4YZFE 1QHOA 1W8OA 8TIMA 2NR6A 3ZTCC 2DJXA 4ELKA 3RFZA 5G4MA 3MRRB 2P0IA 1QTWA 5E9NA 3CHCA 1T83A 1KCSL 1U6AH 1H3VA 2DQWA 5EO9A 3ZYOA 4H2CA 3QIBC 3O11A 3MJMA 4NHUA 2EEAA 2OP4L 2NYZA 2XNAB 3QSRA 1L9MA 2LGNA 1X5GA 4QRRD 4AC4A 1T5WB 3KNBA 4Y19A 1EX5A 4F7TB 5G2WA 1GEQA 1VBJA 2GSGA 4ZMAT 3Q2WA 1NSNH 2CWNA 3PG9A 2R4RL 3C0LA 4F8OA 5IZ7A 1XGRB 4GFXA 4E9SA 4P49A 5HD8D 1NDVA 1YEJL 4S0SD 2P80D 1BZEA 1JN6A 1F8MA 2CBJA 2KQNA 5FGCB 1K1DA 2D7TH 3B2DC 3VA2C 2I5IA 3C8HA 4B9KC 1P4LB 3B8YA 3QUZC 1RHCA 2VL4A 1ZHAA 3NBNA 3OR7A 5SWSB 3P2VA 4DH2A 1PY4A 5IMOA 4ETQB 4MGXA 4MVBC 3LCIA 3T4YA 5IW1B 4GYPA 4TSCL 1KLYA 3KBJA 2QDEA 1IV8A 4G5ZH 5E93A 3MRKA 4NO3B 3IJEB 2IPTH 2TRHA 1ZEAH 1UM5L 2ENSA 1ZT1A 4XNZC 1SZNA 1Z7AA 1HILA 2YCJA 2B9AA 4C55A 3CEPA 4ICMA 1S7SB 4D9RE 3CX5J 4X4YA 3M43A 3ID7A 1WDDA 2ADFL 3LB6D 3M07A 4RA3A 4G1MB 2YGPA 3ZW3A 5DC4B 5T5FL 1PS9A 4R3SB 3M16A 1WA3A 1AP2B 1FFNA 4P2RD 1KWGA 3IGAA 5KBDA 1O6SA 4KKCD 5BS0B 3NDZA 1OZUA 1HQRB 3KTXA 4P2OB 1HH6A 1FAKT 4AWTA 3IF1A 5CSZB 3LV5A 3DXAD 4G3YL 4AZ7A 4GMTL 4HJEA 1NLBH 1IM3B 1RBOB 4C6PA 1GJPA 1I8IA 3BPOB 4BZ1H 3LCHA 3RX8A 3NPVA 1D9KD 4TVPE 4N9BA 4LOUC 3PULA 3MHUA 5PTDA 5E9XA 2A6KB 5KUMA 2GHZA 4U1MA 4FQ1H 4DKFL 1AKPA 1L6FA 5T1DL 2R24A 4UQBA 4GKSB 1HHKA 2QHRL 2UYLA 1KULA 3HLKA 1MSSA 1LF1A 3BSZH 4WK4B 4PRTA 5D9PA 4I9XA 3LM3A 4PMZA 3WUWG 4HN4A 4EUPG 3T0CA 3ZDZE 4IHOB 4IWWA 4EN3A 4JFUA 1O68A 5LIYX 4C7GA 3NPZB 2UUDK 5DXXA 2FECI 1C1EL 2EXYC 1SDAB 3JZ7A 2H1LM 3RX7A 2GBTA 2OL3L 3DERA 4JFHE 4Z7OE 3QUYD 3N12A 4Z7WA 1LP9F 1Q94B 3I3BA 2OR9H 5B1JA 5TD4A 4K8EA 4OZOA 4HWBL 4NRXB 1JK9B 3IVTA 2YFOA 3RX9A 3N17A 4G80B 1VACA 4W4OA 2R27A 5HNTA 1O5XA 5C08A 3GK8L 4R0LC 3C12A 1E8XA 1MQQA 3FB5B 1JWSA 3IU3A 2IXQA 1ETZB 2RACA 2L3BA 3HCVA 3PZGA 4TQTA 4AGMA 3EOLA 4AISA 4XNYH 5JYLA 3VCRA 4Y4KC 3WMBA 1ICQA 3QW3A 3I6TA 4KUCD 2GL5A 3RPMA 3H9SA 3ZZ1A 5BOOA 1HWGB 3CHRA 2QHAA 2MCAA 4UIKH 2VGGA 4KI5C 3R10A 1BFSA 4LDLB 3LN3A 1ZGLA 4R5VA 4UU9A 5I16B 2X4RA 1SBSL 3WLHA 3SGEH 4RMWA 3NL2A 5M17A 4C4KO 3NJIA 4DWSC 4UV7L 1MI3A 3BKYH 2CSPA 5G5DB 2J1YA 1JJUA 4TUJB 4LSQL 3ROLB 2C9AA 4NQQA 3MROB 3W1PA 3S34L 3AWOA 4L56A 4H88L 4LHUB 4BFJA 3IMRA 2CBVA 2BHYA 3ONBA 4QI3A 5EFDA 2B59A 3SIZA 2X3CA 3T4CA 5M94B 5GJTH 2JQXA 2WQWA 4YVPA 1CXLA 3QBUA 1TZ9A 3OA3A 2DY2A 2G3XA 4BFOA 1Q7QA 4ZUVA 3TUUA 1A9BA 3A5FA 5KVDL 2CWRA 3PPGA 3MX0A 4HHAB 3GNDA 2MSPA 5C0BD 5CEZH 3EFOA 3P67A 1K03A 4M6NH 3LXUX 1IXOA 4A39A 4QEEA 3UR7A 2WQVA 4OLUL 3AADB 4ZSOE 1ZBKA 2YW3A 2R23B 4IJBA 5EF0A 4UTWC 3J7HA 3NVDA 4V15A 5CS7A 3D3AA 3QVQA 1MNNA 1G4SA 3EHBB 5GSVB 4J3VA 2B1AL 3DDMA 1Y0LA 3T8XB 2YD0A 4O5LH 1JERA 4AD1A 3IJQA 4NUQA 4W88A 1YEEH 2BSEA 4UDTB 4RAUA 1NZRA 1FC1A 5C0CE 2Y22A 1JAKA 5EA0H 2L4OA 3NCJL 2PCQA 2B9BA 1Q90A 3B7TA 4E5XG 1EXUA 4XVTL 3R1GL 2EDXA 2K4AA 1JGVL 3JVGA 4PCNA 1JHKL 3U2OA 1OP5H 3MJ9A 1D5MA 3QDAA 5GGQL 5D1QA 4PLJC 4PRHB 3H24A 4HJIA 4FXLA 5SX4H 2YL8A 3N0PB 1KIUB 3KHOA 2D7PA 4J1UB 4JFDB 4ZMQA 1TWWA 2K3TA 3LKNB 4IJCA 4OD2A 1VYSX 1KPUB 4XB8A 4UMCA 4UC5A 1KZQA 1LL7A 4ILDA 3V4BA 3F2DA 3DPBB 1I7TB 4FJYA 2X30A 5CBAA 2HJFA 4UDUB 3FUIA 4DZBB 3ALFA 2PR4H 4L8DB 4Q52A 2ADIB 5KS9F 4OZIA 3BIKB 3VU1A 1OGAB 2G0KA 2DWYA 1E28B 4XMTA 4TO8A 1E5YA 3T0VA 4NRZB 1MQKL 3FSOA 4QO1B 2Y5EA 4MQTB 4J4KA 2J66A 3PWPB 2ZOWA 1UXMA 2QGBA 5KMYA 3OAZH 2BX7A 4QXUL 2F08A 2WGNB 4YHGA 2HKAA 4HH9B 2WHVA 4FNSA 2W0UA 4XSLA 3O8XB 3ZLQC 1X8CA 4JFVA 3TH4T 1F5ZA 2RFXB 5FGBC 2RDTA 3JWOH 1RZIA 4N2IA 3P77B 4P57A 5F4WA 3TNNB 1Y1DA 4XO7A 4IGBA 4OLEA 3DRQA 3KDOA 2XTLA 1A3WA 3P3SA 1A7RL 1A5AA 5JPMC 1U8QB 4R4ND 3R0KA 1KV7A 2VX7A 5CPQA 2B08A 3SDAB 1N18A 5BNXD 3CL7A 1DJGA 3NH7L 1GAFH 4C5ZA 3DIFB 3TBTA 3EOSA 1XGPB 2CZNA 2DYPA 1T7LA 2ZPKL 5AW9B 4BKNA 3ARDC 3L5XH 4Z3TA 5BO0D 2V7NA 1KJ3H 2VR9A 1FGNL 2ZUQB 3UTOA 5EH1A 3S2LA 4PJIF 3WH9A 4HU0A 2GW5A 4YJZL 1ECZA 5A6BA 2QVIA 3NCXA 1FORH 4R4BB 5D6CB 5I8CA 4U4IA 3WIIL 1H6FA 4O28A 4PGBB 4HPYL 1KTRL 4XD5A 2FTAA 4C56B 3SYAA 2WNKA 3C0JA 3LGEA 4JDBA 5IBLD 4P4KB 3AXIA 3IUDA 4HD5A 3EWBX 4GKOA 1AGEA 1IQDA 2QTEA 1G5AA 1XGQB 4BQCA 1BFOA 3VU2A 1PUDA 4F0KA 5A8NA 1HINL 3PNWB 4PCPA 2PFHA 1M56B 1RBAA 4GINA 4PJHA 1RURL 5FFOA 4MDIA 5EZIL 3V6OE 5L9DL 4JN6A 4NIRA 2VCAA 4XPBH 1M53A 3HA0A 2X7LB 5J13C 5E8OB 1FNEB 1R5WB 1FNFA 3UZVB 1RAKA 4XX1G 3LCXA 2OSLA 4EUPH 3UBXB 4CW1B 1ORQA 2P3EA 5D8ZA 5EBWB 3V0FA 1YDNA 4TULL 4HUVA 4GRSA 3CBWA 3CHSA 2GVLA 5FA3B 2I7OA 4HP5A 4MNMA 2HDJA 4F7MB 1H6TA 1CTNA 1JF1B 3F6LA 2EZ0D 5C9UA 1F6AB 3LI0A 2P8LA 2CLRB 2EG8A 1ZJAA 3BG3A 1K3IA 3DA0A 2Z91B 4WY0F 2HISA 5CWSB 3EYQD 4I85A 4N2GA 4IW4C 4JICA 4TX9A 4FR6A 3VNIA 1V3HA 1S7RA 2R0LL 3II1A 4LDOB 4QRFA 2WBJD 3QI9B 3ITYA 2QUMA 4XE0A 1QT1A 4WJXA 2P5WD 4Q9QH 1O9VA 4KY1H 5JMUA 1K02A 5HWNA 4M7JL 5D72H 1UR1A 4DQWA 1NFDF 4GAGH 5I23A 4KKLC 4ZFZA 4ALAL 2R2EB 2P48B 3SJNA 1YMMD 3D25B 3LIZH 1ZVSB 3QE5A 1MZHA 5HDQL 3DG6A 4I88A 2DIAA 1OJXA 3PAYA 2NY0D 1D6VH 4HETA 3CL8A 4M7ZC 5GRVK 3RKDC 4V1DB 1PDYA 4OU3A 4KY2A 4M82A 1DBBL 1R5IA 4KERA 4QCIA 1D7FA 2DVXA 2HX8A 4N2HA 5IHHA 2O5NA 2JFCA 3BKCL 3FYYA 4Y5VB 1N4XH 1I3GL 4N0FB 1FJ1A 1PGRB 4D9QE 3BXNA 1TV5A 5ALCH 5ICYB 4JIRA 5J12C 1OCJA 2F1BA 1CFNA 1V77A 1UYQA 4Y9AA 2DEYX 5DJAA 1OK8A 3C3UA 3PDOB 2WAQA 4RMBA 3KW7A 4CQ9A 4JKNA 1H1NA 3BUPA 4KZDH 2DZPA 2I56A 4JFFA 1J5HA 1M03A 5CBJA 4BJLA 5HQEA 4PS8A 4MPQA 3MSGA 3PGCB 3UMTA 1INEL 3HMWL 4CU6A 4MLRA 2W95A 5EWIL 5EZOH 4A7VA 4P8UA 2HJPA 3MJ7A 2ICWA 1TZIA 3INOA 1VERA 2IUZA 4FNQA 3PRZA 4LF3B 4KQNA 4YDIL 1EERB 1OFPA 4OD3H 4Y4KA 1TLMA 3LTVA 3T8MA 5JXQA 2VURA 4Q4MA 5C9ZA 2NV1A 3IWUA 4ROPA 4H8WL 1LWIA 2GEEA 5ACZB 3UTTB 1VFAA 4YVNA 1PJ9A 2XH0A 3T0EB 5EC1A 2YD4A 3SRDA 4PB4A 3M47A 2LLGA 4KKAC 2E9BA 4UV4H 3XISA 1HQ4A 4C6EA 1XRTA 1W6LA 4YHPB 3KXQA 2FUQA 5J1TC 5B39B 4OJFH 4HNTA 2GTQA 2QFPA 1A7OH 4K0OA 5G4WA 1TQXA 4CVZA 4CUCA 5IEHB 2OG9A 4QHMB 2IC2A 1VPOH 3GSNL 3HG1A 3V6ZA 3D9AL 1PLCA 1VKFA 5JIWA 3CH1A 3VGBA 1V4YA 1QG3A 1BA9A 2BBFA 5J6HB 3MRDB 2A6DA 2R9HD 2XYLA 4B16A 4AU0A 1HP4A 1HHJB 4XMPL 1Q38A 3NCYP 3MREA 3F7YA 3EDFA 4JPIB 4JPVL 3RZCB 5C0DB 1UPMB 2KL6A 2FSEA 3CAVA 3H9HB 1VA9A 1EAOA 1FVCA 3DHDA 1T7WA 3BPNC 3HEIB 2YKLH 1ZEAL 5AUMA 4NZ8A 4B9ZA 3NXLA 2EXSA 2HKHH 3VGAC 1D5IL 1BTMA 4KWOA 4RGNC 4ODHH 1CENA 1XYZA 4M6PA 1ZJHA 2HQAA 2VFGA 6ALDA 4JQIA 4UNKA 3C2OA 2F7IA 3JTTB 3B8WA 5C07B 1TNMA 1TR1A 4OSUH 5PAZA 3MACH 4JG1H 1WKFA 2OCFD 5J1SC 3NRFA 3FUHA 2X1OA 2XN9A 5DUPH 4DAIA 1BGXH 4QJ5B 4FI4A 5CJMA 2F9RA 1BHGA 2DQ6A 3LTSA 3VUPA 1UCBH 3ULUE 4HHPA 5FKYA 3SN0A 1S3HA 3MSDA 4LIQE 4WFFE 4AY1A 4U6YB 1WCBB 3HMJG 3KAAA 2DN7A 4FGMA 2ERJC 1G9EA 1TQUA 4FG0A 1KYUA 4HUXB 1F73A 5LKNA 4IJRA 3BD5A 1GZ1A 2WUBH 3BH8A 1NLBL 3QJFA 1BFNA 1SVBA 1DBAL 1DJWA 4LESA 3SJVA 1U8PA 1BWMA 3EUDA 5CCKH 2B16A 2R1PA 3GY1A 1QSFB 4V2CB 1YO4A 4WKXA 3IJIA 4F37K 1G0XA 3RCMA 3P2TA 4OUEA 5D7SH 1EZVX 1A1NB 3FB8B 1UGKA 3FPYA 5FJOA 3MYPA 1OFQA 1XQ4A 3U0PB 5AN7A 3VWKD 3RGVC 3HMCA 5IP4A 1TPC1 3QDJA 4QLLA 5FF4A 2VR4A 3BSZL 4H1LG 2BIQA 4UCFA 3NSXA 2OMTB 1P7HL 2CWXA 3JS3A 2WHMA 1SRDA 2WXQA 5H94A 3F7JA 4HU4A 4YCPA 2O6FA 1KPVB 1O7DE 2G5WA 2OO6A 3QQ4A 3HN8A 3HZKA 1AD9B 1C8PA 4K5NA 5ADPH 5I02A 4TOQA 1TV2A 4QNWA 4Y1SA 1VGKA 1H9DA 1FO0A 4O9HH 4N0UB 3SGKA 3FFCD 4U49A 4PS7A 4C6MA 5IIEB 4PCTA 2BDNH 2E27L 3NEHA 1V8HA 3EYSH 2M1KA 4L4TA 1FFPA 4MKMA 3RCNA 2NY1D 5EN3A 4K1GA 4L61A 1S3RA 2CRZA 3N2XA 1ETA1 5JHDB 5JPMA 5F96H 1OE2A 4WY7L 4H44C 4DLFA 4ZTOH 2RJGA 2IBBA 4UIOA 3VXRB 4HKZB 5DXYA 2XFXB 2Z92A 3LRGA 4X6DE 5C6TH 1QFWH 3S35L 1FIEA 3BK0A 3GX9A 3ARDA 4FNPA 4GKZB 1H5YA 4MCYB 2HZHA 2OMUB 1Q6DA