2WVVB

Crystal structure of an alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
450
structure length
446
Chain Sequence
b'EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAKLYRDALT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-L-FUCOSIDASE
publication title Analysis of the Reaction Coordinate of Alpha-L-Fucosidases: A Combined Structural and Quantum Mechanical Approach
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 164
structure length 446
sequence length 450
ec nomenclature
pdb deposition date 2009-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2wvvB02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wvvB01
1UR0A 3W6MA 4PTVA 2XVKA 4WIWA 1CDGA 1W2VA 3VSUA 3DC0A 1PIFA 1UH2A 3VX1A 1Q6DA 3TTYA 4PRWA 3TTQA 3EMCA 3ZM8A 3A6OA 2NW0A 2DSUA 1BYBA 4AZGA 3RM4A 1IZKA 4GI6A 1QI5A 1W9BM 2QLYA 3AHYA 4ZXLA 3IAPA 1KB3A 3VNZA 2WMHA 3OGSA 3AMDA 3VD7A 2PF0A 1CGWA 3VIPA 4AMCA 1FP9A 4PCTA 4A3YA 1E40A 4MNMA 4HA4A 1CGYA 3ARSA 3RM9A 4D6GA 4EAMA 4W7WA 2ZXBA 1TUXA 1IT0A 1UD8A 3EDFA 4FLRA 3SURA 1Z32X 3KL3A 3AS2A 3VUPA 5DT7A 1OT1A 3WNPA 4MJ2A 3TTSA 4MNLA 2ZXQA 2CBJA 3WFLA 4M24A 4QLKA 3W25A 3LPPA 3VGBA 3GNRA 3MU7A 2CBUA 1OM0A 3WH8A 1MWOA 2WYSA 3FXYA 4BQ5A 4PMVA 5CPTA 4DWSA 1KWKA 4XZWA 2IXVA 4W8BA 4UFHA 3SCOA 4W8AA 2PWEA 1V6XA 3IGUA 1MQQA 4ATDA 3SEPA 2VO5A 2WW5A 3WY2A 1LQ0A 3GDBA 1JNEA 5HDRA 4HMCA 3PZ9A 1IZJA 1V3MA 4HOZA 4B3LA 1X1NA 2FHBA 1J01A 1R34A 5A2BA 2VRKA 3D5HA 3A22A 1ZBKA 1PEZA 5D8ZA 1KTBA 3LX9A 3CBWA 3O9NA 1HVQA 2QHAA 4UZUA 2WCSA 1E72M 3ZJ6A 3EJUA 1LWJA 5A6AA 3F5LA 1OGSA 4M29A 1V03A 3WF1A 1ZBVA 1WAWA 4UZSA 1J18A 1UKQA 1QWUA 2J7DA 4F8XA 5JBFA 3AXIA 1HKMA 4JCMA 2WC4A 1LG1A 3BLKA 2CXGA 4Q7NA 3WL0A 1XH2A 1HKIA 4QCEA 1MVYA 2W4XA 1O7DC 2PWGA 3K8MA 2WCAA 2DSZA 4XV0A 3D4YA 2JE8A 1M7XA 3WDRA 1B3XA 1B3WA 2ZX8A 2BHUA 4URIA 1VFMA 3POHA 4MDOA 5JUVA 1NP2A 5CSYA 1K9EA 2WMFA 1IV8A 3VM7A 2WMGA 4NZFA 1KGWA 1OD0A 1V6YA 2XFFA 1E6ZA 3NIYA 1EO7A 4YN5A 2EPOA 3VX0A 4UFMA 2WZIA 2X09A 3EDJA 3ARPA 4LYRA 2F1AA 1DHKA 1V02A 9CGTA 1H1NA 1HP5A 1E3XA 1HNYA 1C93A 4GQRA 3OZOA 5I79A 2DQXA 5KEZA 2JFEX 5M17A 3VMOA 1JYNA 3WUBA 2E9MA 4RL3A 4CVUA 1QX1A 2X0HA 4P7LA 5HNNA 1QI0A 3WQ8A 4U33A 2G3IA 3AS1A 1G01A 1TA3A 4LGXA 2XUCA 1MYRA 3PZTA 2DH3A 2CHOA 4DO5A 1W2PA 5A2AA 4P8WA 1LL6A 3RO8A 2YA0A 5E09A 1Y7VA 1UWTA 3MMDA 1UD5A 1GQJA 4OIFA 2WCGA 5BRQA 3D51A 3W82A 2DPEA 1PPIA 4AZ5A 3CZLA 3QHMA 3WUFA 1CECA 1UG6A 1KQYA 4KGLA 4ZXOA 1QI3A 4TVDA 4OGZA 3BUDA 1OIFA 2WSKA 3AIUA 3GH7A 5I78A 3LPOA 1F4HA 1W1TA 1JYVA 2WMJA 1JZ5A 1CXIA 4X0NA 2IXUA 3MSDA 5ABGA 3WF4A 3WUGA 3MO4A 3D4ZA 4V2XA 3CZSA 3FNDA 1US3A 1TQTA 2EQDA 1AMYA 1SFSA 2IGTA 4UQCA 1GOKA 2VVNA 2GJRA 5EFDA 1KWGA 2Y8VA 4NX0A 3ZSTA 1LJYA 1OIMA 4LYQA 4W89A 2G8ZA 1GOOA 4UFKA 4H8VA 4JFUA 3SIMA 3NDZA 3ZR5A 4LPCA 1U30A 2ZUMA 1B3YA 2YDSA 1BGAA 3SCTA 3EMZA 3AQUA 3M07A 2EJ1A 3I3DA 4P8VA 4W87A 2J74A 2WVVB 2F8QA 5GPRA 3N13A 1W32A 4E4PA 4FNPA 2D22A 4JL1A 1JZ6A 3W38A 1J0KA 1NOFA 1FH9A 3VDCA 3UCQA 4ZFMA 4OOUA 2PWFA 1ITCA 2VL4A 3PTMA 3TONA 2OWWA 1X6NA 1LL4A 1QBAA 2D1ZA 1BG4A 3SCNA 1H4PA 3BVXA 4MPKA 5A8OA 1UD4A 4HP5A 4W93A 1B0IA 4TX8A 3DECA 4P7RA 3CZNA 4YHEA 3RMEA 3WF3A 1D2KA 1E0VA 1BSIA 4W5UA 5E0CA 1CXHA 2QMJA 3WFZA 4DUWA 8A3HA 4PMDA 4ACZB 2X2YA 4WK9A 2CERA 4AZCB 3W0KA 4V27A 4CCDA 1D7FA 4CU7A 4D6JA 2YL6A 2JEQA 1JXKA 3AISA 4CD8A 4J3SA 4JFVA 3WEMA 1EDGA 3TV8A 3ZR6A 4E8DA 2WWCA 4YPJA 3EJPA 3IJ9A 3A4WA 2WMIB 4ACYA 1GVIA 3VD9A 3CUHA 3OIHA 3HG2A 1UZ1A 3AMLA 4PMUA 4Z2IA 4UOJA 1OSEA 3BSGA 1C8XA 5A6LA 4GPNA 4L4PA 2YFOA 2GK1A 2XN2A 4PMOA 3T2OA 1GJUA 2F61A 3TOPA 4D71A 4KMQA 1EOMA 1AQHA 3JUGA 1EA9C 1JDDA 4DO6A 4Z2GA 3WMSA 2PWHA 1QHPA 4BQ3A 3H53A 5A69A 2JEPA 1Q6FA 2EPLX 1UYQA 3F5JA 1UKTA 2FGZA 2NT0A 3WY3A 1JNDA 4WKAA 3CUGA 5TD4A 1UD6A 3N17A 2XIBA 4BQ2A 4BF7A 1BTCA 2W66A 3WNKA 1W9DM 3CUJA 3CUIA 3T08A 4PTWA 4J3VA 2ZX9A 1NQ6A 4D6DA 3WDPP 3L4WA 1J0IA 3CMGA 3VDAA 1US2A 2J8FA 2NSXA 1TFVA 2XN0A 2WBKA 2G3JA 2DIJA 4PCSA 4OBRA 1H2JA 5BROA 2J7BA 2DSVA 1MW1A 2PWDA 1E6XM 3L4YA 3GXMA 5A94A 1C8QA 3VIHA 3BAYA 3OGRA 1XYFA 1VBRA 3WELA 2EXOA 2YA2A 4C7DA 2VVSA 1E4LA 2XN1A 1W91A 3EMQA 3HJEA 2J77A 3B8SA 3CMJA 4DWSB 4HOWA 1OWQA 1SYTA 3BCFA 2WVSA 1YQ2A 4PMZA 2FHFA 2YFNA 1FH8A 1M03A 1QNOA 4LYPA 1HTYA 2D2OA 3CZKA 4RE2A 5I0DA 4TOQA 1MW2A 4CGTA 3DYPA 3ZT5A 4FLSA 1ISWA 3GTNA 3ZOAA 1DWHM 4JHOA 1R7AA 4AIOA 3ECQA 1V3KA 2QPSA 3BVVA 1KR0A 3U5YA 4ATLA 1ZB5A 5EB8A 4HTYA 4MAVA 3WNOA 5EMYA 5I3DA 4LQ1A 2WVTA 3ZMRA 4AXNA 3BGAA 2VX4A 1K9DA 4QLJA 2VC9A 3SCPA 3MSGA 4CN1A 1G5AA 3GXFA 1XCXA 4HMEA 5BXTA 4NZCA 1J0HA 4IUGA 1ZBWA 2BHZA 3OG2A 1JFHA 4AZBA 1QPKA 3S6TA 1FHDA 1TG7A 4D6HA 1WO2A 3WDJA 2BVYA 3ARVA 1TQSA 4UQEA 4XB3A 1W1PA 3A4XA 1UQYA 3RIKA 1WPCA 2YOCA 3VTRA 3MANA 2JIWA 1QNSA 3SCVA 1L0PA 2WM0A 4N42A 3AIVA 4K68A 2ZUWA 1SZNA 2VOTA 1XGZA 2XIIA 4MTVA 4PEEA 2YLAA 1C8YA 5CSUA 2XM1A 4PTXA 1CXKA 3VIIA 1T0OA 3DX3A 3MV01 1VRXA 5D9OA 5AYBA 1H0IA 2FH6A 3MKKA 2BNJA 2AOSA 2ZICA 3WNLA 3OLIA 3GXNA 4KGJA 1VFUA 2DT3A 3KL0A 3WD2A 4IPLA 4WKHA 2E40A 2GFTA 2VQTA 3VDHA 1E43A 1GQIA 3CV5A 4NI3A 3BAKA 4UQDA 2X2IA 1FOBA 2RGMA 3ZO9A 1HWWA 1QWNA 2F7PA 3WY4A 3GNOA 3QOKA 3WQ4A 3VGDA 4OKDA 1HJQA 3WD3A 2VRJA 1FA2A 3OLGA 2F18A 5HOSA 3VOCA 1EOKA 2VCCA 3WIJA 1TR1A 3L2MA 4H8HA 3CZ8A 4OUEA 4AD1A 4Z2KA 1HP4A 5CPSA 1AVAA 2EABA 3DYMA 2HVMA 4J3XA 2E4TA 1TVNA 1WE5A 3EDDA 4W7VA 3S2CA 3CHDA 1UR9A 1V3HA 1C92A 3WUEA 1LG2A 1J0YA 4MB1A 2YL9A 4AISA 1V6UA 4A3HA 3RILA 1R86A 1HKJA 1J0JA 2QMKA 1OB0A 3GM8A 2XSAA 2W62A 3GXTA 3GXDA 3T0DA 3PZNA 4BZYA 4AEEA 1R85A 3SCWA 1V0LA 1UWSA 2V3DA 4CCCA 3L4XA 1UQZA 2D0HA 3GH5A 3WD4A 1HVXA 3VIJA 1NM9A 1R75A 3IJ8A 3ARQA 3FN9A 3WEZA 3DHPA 2VNCA 1GOIA 2ZIDA 1OINA 2CETA 4B15A 3VIKA 3BAWA 2BXYA 2WB5A 3UG5A 1EXPA 2E9LA 2ZX7A 5A8QA 1EO5A 1QI4A 5A6BD 3G6MA 4FK9A 1VFFA 4JIEA 3MUY1 3GZAA 3T09A 1M53A 2BXZA 1R46A 1KFWA 1GHSA 1B3VA 2QV4A 2E8ZA 1MFUA 7A3HA 2WAGA 1VIWA 3FY1A 2GJXB 3LRMA 3AZRA 3AXXA 3CH9A 2GSJA 1CLXA 4N0RA 4XZBA 1UR2A 1B9ZA 2J7EA 2OW7A 5FCZA 2OLHA 1XCWA 2FDMA 5ABEA 4L4OA 2WC7A 3BVUA 3VNYA 3ZQ9A 4AIEA 1J0ZA 1O7AA 3WF2A 4ML4A 4PMQA 4CD6A 2BY2A 1I1XA 2X2HA 3NDYA 3PZIA 2DH2A 4U5IA 4CKQA 2XG9A 1ECEA 3CHFA 3CHEA 3GBEA 1JZ4A 1KXQA 1JI1A 4NRSA 1CGXA 4UOZA 2XVLA 2J78A 3W81A 3DHUA 4NXKA 1KCKA 5DO8A 1W3KA 3F4VA 4UFIA 2XSBA 2XVGA 2J7GA 3F5KA 2YL8A 3KE0A 3AYRA 3DDGA 3ZIZA 5FL1A 2Q8XA 5GQBA 2C8NA 4GINA 2VR4A 2V3FA 2FH8A 1JYXA 2BV9A 4PMRA 3VGGA 3BH4A 3L4VA 3VGEA 1UWQA 2J75A 3WH6A 4TVCA 2WKLA 4DO4A 1E6QM 2J7HA 1PBGA 3SCSA 1W3HA 1R7OA 5CPQA 4FF5A 1QHZA 3W29A 3D3AA 3J7HA 3VDBA 2GVYA 5FL0A 5IXEA 3LRKA 5JIPA 4F66A 1E6NA 1JI2A 2OSXA 4C7GA 1RP9A 1UA7A 1C90A 3BAJA 4IISA 4MDPA 2VURA 5D9PA 3WD0A 4CN6A 2WMKA 4U3AA 1VENA 2TAAA 3VIOA 1CGTA 2A3EA 2EEXA 3O2LA 1WCGA 3GNPA 1FH7A 3MI6A 2CKRA 3MUIA 3AS0A 3NSNA 4W86A 5M3WA 3PZQA 1XH0A 1V6WA 3IJ7A 1G0CA 1PZ2A 5A6KA 4HPHA 3WDQA 5CLWA 3BUBA 4AMWA 4ZENA 1H3GA 4ZE5A 5HPOA 4FNUA 4U31A 2V5CA 1E1FA 5I5RA 5LA1A 3SCQA 1G94A 4P8UA 1E4MM 4S3JA 4AZHA 3LRLA 4R5EA 3HG4A 1UKOA 2UY4A 1QW8A 3VSTA 3WSUA 3ZJ8A 4H04A 5JBEA 1EQPA 3BMVA 3UR7A 2J4GA 1H41A 1ZBCA 1E55A 4DWSD 2O9PA 3OB8A 2DT0A 1E9LA 4FNSA 3CZJA 1JG9A 1PAMA 1W3JA 3CZGA 1NARA 2ZX5A 2C7FA 4B9YA 2YDQA 2D3LA 3HU7A 3AIWA 3WBEA 3ALGA 1W3LA 3PZGA 3U7VA 1V0NA 1J12A 1EGZA 1QNRA 3HMCA 3T2QA 7TAAA 4AMXA 1C7SA 3FAWA 3EYPA 4J27A 2X0YA 4PSRA 3ZT6A 2EACA 3AIBA 3APGA 1DTUA 1HL9A 4JFWA 3BCDA 5BXRA 1CENA 1UR4A 2CESA 3DX1A 4MB3A 3SUTA 1JF6A 1R47A 2CHNA 1V0MA 3UETA 4M82A 3ZT7A 4GXPA 3PBGA 3DYOA 4OZOA 3FHAA 1NP0A 1I1WA 5ABFA 1VJSA 1AQMA 1LWHA 1KBBA 4MJ4A 3VGHA 1GOMA 1BPLB 5BYWA 4W8LA 1RD6A 4Q22A 4B16A 1RPKA 5AYIA 1NOWA 1N82A 3GXIA 3ARXA 2WHLA 2WXDM 4WLCA 4QLLA 4WSJA 3PZMA 2C0HA 4PBGA 1E15A 4PUEA 3OA5A 3S5ZA 4H41A 2CEQA 1V3IA 5C71A 1E6PA 2V5DA 1CXEA 5BRPA 4AZIA 2DT1A 4BA0A 4C7FA 4CUCA 3MMWA 4AWEA 1TMQA 4FLQA 3SUUA 1GJWA 5AY7A 3RM8A 1VEOA 1MQPA 3UEQA 4GQQA 5DEZA 2GDUA 4W84A 2VCBA 1K6AA 1SR0A 2VZUA 1QVBA 1BVZA 1BLIA 2MANA 1GUVA 2EPMX 4JZ5A 5HXMA 3W4RA 2XVNA 1HKKA 3LXBA 3VIMA 4DM2A 1UWIA 4AZ7A 2F7RA 4CD5A 4D1IA 3SCRA 4AD0A 3QHNA 1LL7A 1E0XA 4MB4A 3VVGA 4PN2A 5C8BB 3EJSA 2RGLA 3LXAA 4D6IA 3N9KA 1BQCA 3BLPX 2XHYA 3VD5A 3AYSA 4DM1A 3W37A 1BG9A 1CIUA 1NWUA 4PTMA 3A23A 1OGGA 2CITA 3II1A 1BF2A 2V3EA 3QR3A 1EDQA 2PBOA 1NOUA 4JFSA 3L4ZA 2ZWYA 3WQVA 4F9JA 2WANA 4GKLA 2J79A 4TTGA 1E56A 1QHOA 3IK2A 3W6LA 2ZUTA 2FGLA 4GO8A 1OCQA 4JKKA 5CGTA 1CEOA 1R33A 5IFPA 2E3ZA 4CN4A 1H0GA 3D52A 3BSHA 1W1VA 2A3CA 3B9AA 5A2CA 1V3LA 3RPMA 3RJXA 3AZSA 1QNPA 6A3HA 3CLWA 1JL8A 2VQUA 4AY1A 3POCA 1B2YA 1B31A 1Q6EA 3MS8A 1CXLA 2E8YA 1BYCA 2ZWZA 3SUSA 1NWRA 1C3FA 1HN1A 1FHLA 4DUXA 3SUWA 1CLVA 3UERA 1ZU8A 2XFYA 4AD5A 2WKGA 2WVVA 4QDMA 3WNMA 4FMVA 2EO7A 2DDXA 1TQVA 6TAAA 4KRUA 2YDRA 4X9YA 1TZ7A 1XHGA 1KXTA 2CKSA 4AW7A 1XV8A 1E5NA 3L2LA 4FLOA 1ZJAA 4MNKA 2BHYA 5A8MA 4M80A 4AIUA 2DEPA 4CCEA 4AEFA 2G4FA 4HU8A 1GOWA 1R8LA 3M7SA 4QFUA 3MUZ1 2G3MA 4TTUA 5E6YA 2A3BA 1XSKA 1JZ7A 4S3KA 3VSVA 1KGUA 1WDPA 4U2ZA 3A4AA 3DX2A 1GONA 1WZAA 1Q4NX 3FHQA 1HT6A 3A3HA 4P8XA 1VFOA 4UCFA 2CNCA 4ACZA 2Y8KA 4HZ7A 4AZCA 1WZKA 4JHZA 4HZ6A 1XSIA 4J3UA 2G3NA 1ESWA 2J8GA 2O9OA 1QI2A 3A21A 4IM4A 1Q6GA 1CTNA 1UD3A 2YL5A 2PC8A 3OLEA 1CGUA 2XWDA 4CD4A 1PIGA 2WMIA 2WC3A 2ZX6A 5DFAA 3BXWA 2YIHA 3AOFA 5IHSA 3BMWA 2WLYA 1O6IA 3HG3A 1DWFM 1FFRA 1UA3A 4AC1X 2AMGA 1E70M 4DWSC 1TA3B 1MW3A 1CZ1A 1A3HA 3B9EA 5HPCA 4AD4A 1XSJA 4U3CA 3VMPA 2CBIA 2Z1KA 3THCA 4CU6A 4M81A 2WPGA 1L8NA 4D1JA 1JD7A 1TVPA 3ALFA 8CGTA 1EQCA 4AZ6A 1XD0A 5CQ1A 1UR1A 1KQZA 1TE1A 3VMNA 4GZJA 1K9FA 3GH4A 2YA1A 3AIRA 5BWFA 3WDHA 4EK7A 1GORA 1V08A 4Z2HA 5ABHA 5CGMA 4BCEA 3D50A 4OBSA 5CLTA 4HA3A 1OT2A 2WHKA 1UR8A 3THDA 2OYKA 2Y4SA 3VIGA 2ZUSA 3AMCA 1KXHA 3WN6A 1V02E 4XUYA 1UH3A 1M04A 1E1EA 4UTFA 1V3JA 2OSYA 3WENA 2BY0A 2F1BA 5E9AA 3WNNA 1WZLA 1U2YA 2UWFA 3VKKA 3KL5A 1V0KA 4ATWA 2J62A 4JKLA 1E5JA 2XPKA 2OW6A 2B31A 1J11A 3VD3A 2UY2A 4GI8A 3WBAA 3N1AA 3MUAA 2ALWA 4J3TA 4JFTA 4B3KA 4D72A 2J7FA 2ZOXA 3HZ3A 4RE3A 4QAWA 2ZUVA 2EPNA 3AHXA 4UFJA 3WH7A 3NUKA 3B9DA 2DSWA 4UFLA 1HJUA 1VEPA 3QGVA 2A3HA 3U7BA 1SMAA 1PS3A 1V6VA 1JYWA 1OD8A 2UY5A 3M46A 4YHGA 4JCLA 4F79A 1VEMA 1RP8A 4HPGA 1GQKA 5A8NA 2FYVA 2EAEA 2AAAA 1GZJA 2YKKA 1DP0A 2Y2WA 3EJTA 1AQ0A 4HA1A 3NCOA 4H7VA 4CVWA 5A6MA 1E4IA 4QCFA 3TP4A 3TTOA 2E0PA 5A8PA 4D6EA 3ZJKA 3H55A 4TUFA 1DWAM 3ARTA 4NRRA 5M03A 2D0GA 1MQRA 2GUYA 3VU2A 2BY3A 1NH6A 2A3AA 6CGTA 1JAEA 5C70A 4TVUA 3GBDA 1CNVA 3N18A 3L4UA 1A47A 4M8UA 4UQBA 1CPUA 4GZEA 1GW1A 2CYGA 3ARUA 3PTQA 1ISYA 1KCLA 1BFNA 1GNXA 4GO9A 3VILA 3M6DA 1VJZA 3AXHA 1PJ9A 5FD0A 5ABFB 3K1DA 5GNYA 1XD1A 2BS9A 5ECUA 1GVYA 5F7UA 2W91A 1DWGM 1F4AA 4NXSA 3AIQA 3LXCA 1P6WA 1UH4A 4W7UA 5LA0A 3UR8A 3L4TA 3N12A 3DDFA 3CGTA 2F7QA 1J10A 3CPUA 2CIPA 1R87A 2X05A 1EH9A 3U57A 3RDKA 2BVTA 2GK1B 3W27A 5E1QA 4D6FA 3NJ3A 1H09A 3CO4A 2D73A 2V38A 1ITXA 1PX8A 4J28A 1H49A 2DIEA 1ODZA 4JL2A 1GQLA 4WF7A 3OBAA 2XWEA 4E2OA 3WEOA 3DX0A 1UHVA 3O6AA 1M01A 1B1YA 2XFRA 3NSXA 2WBGA 1KBKA 3ARWA 3WD1A 3WQWA 1XH1A 4LXFA 3AICA 4A4AA 1CGVA 1E6RA 1XYZA 2VT0A 2IUZA 2VZSA 4ZEPA 1DWJM 1XC6A 2VUYA 1UASA 1GPFA 3QOMA 1UUQA 5CXPA 4P7QA 2CPUA 1MW0A 3BAXA 3AIEA 2VX5A 3H54A 1JIBA 4P7NA 5D4YA 2VX6A 1VAHA 3MV11 2EBNA 2PBGA 3W28A 3SCUA 4MAZA 2XTKA 3WDIA 5CZKA 1EHNA 3CIVA 2X8RA 4PMXA 3VO0A 1JZ8A 2FE0A 1W9VA 1G9HA 1NWSA 2JIEA 1OGBA 5CJ5A 1D3CA 2WNWA 1H11A 2WVUA 1EHAA 4TXEA 3VPLA 4Y7EA 3KEHA 4J3WA 1CBGA 3AI0A 3K8KA 4AYSA 2OWCA 1VBUA 2YJQA 1K9TA 2QF8A 3WQ5A 4KRTA 1I75A 4WSKA 1UD2A 1UWRA 4Z2JA 3SUVA 1HJSA 2WK2A 1NWTA 1ZJBA 3PZVA 3VD4A 1HJXA 3NYDA 3OLDA 1H5VA 2CBVA 2WWDA 4W85A 2O9TA 2D0FA 4UOQA 1C7TA 3AHTA 1EIBA 2O92A 5BXPA 5IFTA 1OBAA 1WDQA 3U5UA 2OSWA 3WMBA 2F7OA 1WB0A 4CU8A 2Z1SA 1XRVA 2BVDA 1YHTA 2ZXDA 1BYAA 4QP0A 5I6SA 1HXJA 1ZS2A 5BCAA 4KH2A 1GHRA 1UZ4A 2VCAA 1FP8A 3OGVA 3PZOA 3BUPA 1BHGA 3MMUA 3K8LA 1GOQA 1B90A 1BAGA 2VRQA 1KGXA 5FIPA 1DEDA 5D8WA 3VGFA 2ZUNA 4B9ZA 4DUVA 1KTCA 3BUIA 3ZJ7A 3CUFA 5I24A 3G6LA 3A5VA 2D3NA 3EDKA 2GJXA 3CHCA 2J7CA 5LA2A 4UQAA 3EBVA 3DX4A 3WH5A 2GDVA 1HL8A 2DT2A 2DSKA 2VZVA 2Y24A 5A1AA 1FFQA 3UG3A 2W5FA 3NSMA 2W92A 1JAKA 2XGBA 1WKYA 1KR1A 1E6SM 3WL1A 1JDAA 3RCNA 1QW9A 1J9YA 4HZ8A 4MB5A 4NZJA 1BYDA 3LPFA 5DMYA 1MFVA 4P7OA 2WHMA 3AHVA 1LF1A 1CWYA 3KLLA 4NF7A 1W9XA 2OYMA 2BFGA 5E70A 2PB1A 4XX6A 5D9MA 1VF8A 1CXFA 1ISXA 2VMFA 2OWXA 1B3ZA 5GNXA 5FKYA 4M56A 3WF0A 4AYGA 3WY1A 2ZE0A 1JF5A 4X0VA 3ARYA 1TQWA 3OZPA 4D6CA 3AS3A 1JDCA 5EFFA 2V3GA 1S46A 2QPUA 1HX0A 1UOKA 1ZL1A 1WNOA 5AC4A 5I77A 2DGAA 1ISZA 3W26A 4W88A 2VTFA 3K46A 3T2PA 5A6SA 3CC1A 3N04A 3VM5A 1W9PA 1PX3A 5CG0A 4U2YA 1JZ2A 2YBTA 3AFBA 4ZE4A 2JF7A 5M5DA 1B30A 2BY1A 3ARZA 1ODUA 3I3EA 2X1IA 3EDEA 3T0AA 3PHAA 2ZUUA 4EANA 1E73M 1BGGA 3CTTA 4HOXA 5DF0A 5DT5A 5I23A 4AD2A 2WSPA 3HG5A 3VINA 4UR9A 3BVTA 3AROA 3EJQA 1QNQA 4UQ9A 2WLZA 1GCYA 2VR5A 2D20A 1UWUA 1LLOA 1HJVA 1TCMA 2UY3A 2FHCA 3AJ7A 4CD7A 3N15A 4OJYA 2VZTA 3K4AA 1E4NA 3BVWA 4KWUA 1E3ZA 1HIZA 3RJYA 1E0WA 4PMYA 5A6JA 1QBBA 3BLBA 4EKJA 1BVNP 3IANA 4FNRA 4E8CA 4U5KA 5AC5A 1WP6A 3EJRA 4M1RA 2Y5EA 2W61A 5LYRA 3HN3A 5BXSA 2JF6A 2XM2A 1TQUA 3BUQA 2O9RA 3AHZA 3GXPA 4H2CA 1JFXA 1W9UA 4FNTA 4JAWA 3KLKA 4GI9A 3W53A 1CYGA 2XVPA 2D24A 5JIWA 1JZ3A 4PSPA 4J7RA 3AMKA 2YBUA 5IHRA 4PYSA 1WZMA 4IPNB 2HISA 4W5ZA 4LX4A 5HBFA 3KWXA 1E71M 2WHJA 4PUDA 2EPKX 5A95A 1EDTA 4WKFA 4GIAA 1HJWA 2J47A 5D9NA 3WQ6A 3IAQA 2E9BA 3E1F1 2XGIA 3WH9A 1ISVA 1MXGA 4R27A 1PZ3A 7CGTA 2XJ7A 2NT1A 3UG4A 5A6BA 2W67A 3N11A 4FNQA 3T0BA 3WMCA 5I2UA 4RE4A 1C91A 3UESA 1G1YA 2D23A 3ZSSA 1MXDA 3AMGA 1Q6CA 2WZEA 3PN8A 4WJXA 1X6LA 4GZIA 2J25A 4MNJA 1SMDA 1VB9A 4H8UA 2YLLA 2XYLA 4F9DA 2ZXAA 3FAXA 3PTKA 1HF6A 2CCRA 3K4DA 3TA9A 4V28A 1W1YA 4JKMA 3I3BA 3CZEA 3FW6A 2VX7A 1HXKA 3BAIA 4OOZA 2VJXA 3S5YA 1PX4A 4HU0A 4HMDA 1RH9A 3BC9A 1WDSA 1DWIM 4UNIA 3LMYA 2JALA 2F2HA 5A3HA 4NSBA 3ARRA 4TX6A 4BS0A 3PZUA 3VIFA 1KXVA 4Z2LA 4EE9A 1QOXA 5KZ6A 3A47A 5JBDA 2WZHA 5FOOA 3QHOA 2GJPA 3GYCA 5IDIA 3W24A 2W63A 2VZOA 1JD9A 1JGIA 3A24A 3WKZA 5E0FA 2OYLA 2X2JA 4AD3A 1WDRA 2PI6A 1UKSA 5E6ZA 3KZSA 2EADA 4MADA 4BQ4A 1JXJA 3AZTA 3LPGA 1UKPA 5EBAA 5GNZA 2ESCA 4PMNA 2G41A 1U33A 2VI0A
chains in the Genus database with same CATH superfamily
2YCLA 3IUDA 4WD0A 1ZT7A 1W2VA 3VSUA 2HRGA 1LILA 1L6WA 2R1PA 5FJJA 1G7VA 5AECA 2QLYA 2WWNA 2BRRL 2QVFB 3SYCA 3H26A 3PWIA 3UZQB 3QV8A 4PJ5E 1UD8A 3STGA 2CZ5A 2JCCE 5HHMB 4KK5C 1MF2H 4MJ2A 4UQIM 4S1RL 3WFLA 4HCHA 4ICNA 3QG7H 5L8LB 1S8DB 1FXPA 4EN3C 5CPTA 4LEOB 4DWSA 3Q05A 4LVHB 4W8BA 5DJYA 1LOLA 4W70A 3FCTB 1TSHA 2OZ3A 3V5FA 1ZV9A 4HOZA 4B3LA 1KV8A 2VLME 1R34A 3NP4A 1TJGL 4RZ5A 5E0QA 5GGSY 1AY1L 1JXGA 2ICWI 5BV7B 4TSBL 5KJRH 4JTUA 4KKAC 1ZBVA 3BG3A 2RJHA 1N59B 1FHVA 1YX1A 2OLDA 5HHNB 3BUYB 4AGOA 3Q1SL 1I4FB 4TVPD 4J2MA 1EBAA 4XN7A 2XWCA 1X3DA 1DBBL 2BZCA 4JNZA 3W7EA 3GBNH 1GY1A 3D4YA 3EYQC 2ZPKL 4LEFA 5FEZA 3O6CA 5JORB 5FO9A 3SKNB 2P5EE 4O0ZA 2BK8A 1E6ZA 3QUXD 4ZTEA 5DJ6B 3D1MC 3V0IA 3X1GA 5SWSB 1JCLA 4PTTA 5FA4B 4JJHA 4V11A 3CUPB 4Z77B 2DQXA 5I79A 3P3UA 3HR5B 1SLXA 1AR2A 2X0HA 5KVMC 1AZVA 4PCYA 1G01A 1EYWA 3NR0A 4TSCL 3EFOA 1IC5H 3CLFL 2R9HD 3ZDYE 4OIFA 1FJ1B 3BXNB 1COBA 1OIFA 1Q7ZA 2YX0A 1C8VA 5LBGA 1N64H 4S0SD 5JOFA 1LWRA 1DVFB 3UT0A 1U8PA 4UT6A 2VGIA 5FO2A 3OHIA 5J6GA 2JKNA 3PFRA 2V68A 4WEBH 1H7PA 1M3IA 1A3RH 3M1BA 3WFHA 1BWLA 1QLEB 2I5YH 3WTTA 1KM2A 3K6IA 1MFBH 2Y07H 3QUYB 3L0KA 3VDCA 2C4FU 2R1NA 4XVSH 1QBAA 1BG4A 1S5IH 2XXGA 1XGTA 1WK0A 1B0IA 4QXGL 1NDYA 3EWYA 2ICCA 2Q8AH 5EGRA 1OP3H 2MNWA 5G4EA 2NSOA 5DD6A 4MZIA 1YQVH 3PP4H 5EDXA 2H0PA 2OI9B 2OK0L 3VVWA 4LLVA 1H7OA 3AISA 4Y4HB 4G7RB 1KIRA 5IHUL 4CNPA 4JO4L 1NCCH 3PAVA 3ZE1F 3UCDA 4PY7B 1EFXA 5ADPH 1CFTB 1EV2E 3JV4A 5ISZA 2XV0A 3G6JA 4LBEA 3E96A 1MHEB 4UCGA 3BJFA 2HZGA 1IAMA 2DUAA 1BF6A 1ICTA 2QJDA 4N25A 4HK6A 2F53A 4G56A 1FCUA 3LSCA 1YRRA 3LBCA 1CG9A 3MRGA 5B3JF 3TF4A 3QYSA 4DBDA 3ZDZE 1QUNA 3MLSL 2Z00A 1OSPH 2X4SA 1EC9A 2VLKE 1TFVA 1MAKA 3TQPA 2WBKA 3K0YA 2VN3A 5E8EB 1GR7A 2BJML 4NZRL 5JW3H 4ZOAA 2OMUA 4GXUM 2GQ9A 2NXYB 1DFXA 2BIIA 1S9WA 3IJ6A 4Q52A 5CILH 1XDMA 4IDJL 2YZ5A 3HQPA 4AE1A 2HE5A 3DIPA 2YFNA 1ZIAA 3ZHFA 1QSVA 3WZ0E 3LKNB 4Z0XB 4P23A 1W2KT 4JUSA 1VIZA 4YC2B 3DMMA 4XNYL 1ZB5A 3WNOA 2VH5L 2YC1A 5C0CB 3MSGA 2JLLA 4IUGA 1OTUD 4NQXA 3OG2A 1FWTA 1M5WA 3WNIA 2AEQH 3RIKA 4EVNB 1B0RB 2BH0A 4JHVA 5K9DA 3ABLB 4P2QD 2WLLA 2R9HC 4YK4B 5HMSA 1RUMH 3N4AA 5D9OA 1RSFA 3ZRFC 1J5OH 1HHIA 1HFBA 2DAVA 4ZFGH 5DMIL 1Q9OB 5BV7L 1QU4A 4HNNA 5J06A 2BSEA 1L9SA 5IB1B 3G18A 3H9SE 1OFQA 3SYOA 3S83A 2OT1A 1DZBA 4RISL 1HJQA 1HILA 5T3XD 1BECA 3TPKA 5C0EB 4OD2B 5K9XA 3GRWL 5AHIA 1T3FA 3PPCA 1LROA 1GVSA 3HS9A 4ZAKB 4W7VA 4YZFF 1WYIA 2EKCA 1FCGA 1FDJA 1IEVA 4JB9L 1JV2A 5G5IA 4JPWL 4DF0A 5DC2A 3BZFA 4HWBA 2ASHA 1V10A 3VSQA 2CRMA 4YSUA 1AHWA 2ZQKA 5J13C 3O3EA 1NCWH 4MJIB 2Z91B 2GJ6A 3MX0B 1AGEB 4NNPH 1S4IA 1QUPA 2E8ZA 2J6VA 2IAND 5JMUA 3CH9A 3WFEL 1MG3C 4XZBA 2H6UA 4HIHA 4PAZA 2I26N 2OLHA 1RY8A 1ZSHA 4HXAL 5I66A 2WC7A 4YE4H 4ML4A 4PMQA 5D1ZB 3GHPA 1W16A 3GSRB 1LDSA 1ZALA 4YVXA 3CHEA 1JZ4A 3B2PA 4K1WA 2XVLA 4MA8L 5L4MA 3DHUA 3Q48A 3K6SA 1NIUA 3F4VA 3SDXA 3TR9A 4BH8B 4OZGA 1BQLL 4EN3A 2YGVA 4RGOH 1QRQA 2X7LA 4GINA 4XZLX 3OP2A 3JRKA 1XH3A 2AJYL 5DHYA 3INUL 4ZUTB 1NLBH 4I9XA 3BKMH 1QZNA 4MLSA 1EXBA 1E4KC 2QEJA 1E6NA 2QFRA 5CZXD 3WJWA 1UA7A 3U2SA 5D9PA 1NC2A 1YMMD 2XG4B 3N40P 1EF3A 5IKCB 3GNPA 5CD3A 3ONBA 4ZI8A 3N2OA 4CW1A 3DBSA 1KYUA 2D7OA 4QXVA 1WUZA 5FK9B 2TSBA 3FCUB 1YTEA 3DUSA 4K5OA 4YWGL 4PJ7B 3V4PB 3LH8A 2POTA 3KVDD 4FQLH 4AJVA 3IGAA 1OTUC 4L3EE 3UR7A 2J4GA 4ORMA 1ZBCA 1HINH 5IEHA 4DQAA 4QWWD 4KHXL 3LHYA 4B5TA 3MNDA 5LGZA 3ROLA 1ZFJA 3M0KA 3F12A 2XIJA 4BH7B 1W3LA 3LKOB 2XC8A 1FH5L 1C8PA 3VFPA 2PDIA 5MEQB 3SKUD 1C7SA 4G8FA 1E67A 2PU1A 4QRSB 4U0QB 1EBPA 3TJHC 3GIYA 2DM2A 4US5A 3PBGA 5GZOD 3S3GA 3ULUD 3S34L 1Q1PA 3N0AA 3ZMEA 5FGCE 3TZNA 4YDKH 2W88A 1MHPL 1U92A 4NQEA 3W75A 1LD9A 2AKZA 5IM51 3L2IA 4GP5B 2CE6A 3U0TA 5C71A 3EPMA 1CXEA 3MMWA 3URAA 3UEQA 5DEZA 1HSAB 3CASA 1GC1C 1UATA 1Q1JH 4ANUA 4R4FH 1GKPA 3VFNA 3S96A 5KS9E 1AYOA 1AS8A 2C1OA 1EWEA 3RHGA 1Y8BA 3LZFL 3OMNB 2ZOLA 5J8OA 3LQGA 4AZ7A 1F05A 3QXVA 4AD0A 3GK8L 4MBRA 4MB4A 1DYSA 3NQKA 1LK2A 1RFDL 1NWUA 2ZKYA 1XB8A 2V3EA 1A8JH 3ULVC 1SOXA 1J93A 1BGXL 4G42A 2WANA 5HHQA 1ZGLP 4KKCC 3FTZA 4ZPVB 1E56A 5L88L 5E5LA 1BD2B 2C9AA 3QC6X 2B7OA 4Y7MA 2E3ZA 1XGDA 2ZUYA 3EKGA 4XAWH 3B9AA 1ORQA 3RJXA 3FFDA 1KXVC 1UVQB 2A1WH 4U1LA 1GYUA 4Z7VE 3TLQA 4H44C 4DUXA 1P0NA 2YAMA 1JNLH 5AZEH 4HUCA 4JFPB 1HL5A 1TQVA 3ZXAC 3BE1H 2YDRA 2CKSA 4LHJB 4GQZA 4MVAA 5PAZA 5BJTB 4A35A 2REQA 3CBJB 4BY3A 4HS8L 4XUGA 3CVIH 5F44A 4IGBC 1JOIA 1OW0C 1IIGA 3SKMA 2CNCA 4K38A 1B2WH 3HURA 3QQNA 4LSUL 1PSKL 3V3WA 3G5VB 4AIZB 2ADAA 4RFNC 3HPLB 2NZIA 1SZFA 3GDCA 1PTGA 3QUXA 3LEVL 4NKIH 1O6IA 3EOLA 2A9CA 1IFHL 3LIZA 2XUWA 1UWAA 1XSJA 4QWWC 5EBLB 4F7PA 5DMKB 4OB5H 2DQTH 2HX8A 5CQ1A 2FYMA 2VN7A 2BC4A 1DQQB 3ZWTA 3P3TA 1I8MB 2PDXA 2JLPA 5FEPA 1RZKL 4Y2OB 1BRLB 1FL3B 1OT2A 4GUPB 4IT1A 1ROWA 4L3AA 1URLA 1V02E 1EDYA 4JFED 3GDMA 1T1WB 1KCRH 1KOAA 4CKVX 3WENA 3FCPA 4M5PA 3P11H 5E9AA 2Z6JA 4WVXA 5I19L 2OZNA 1UEMA 4DP7X 2A7RA 3CSGA 5FYKE 5AVYB 1U91A 3MBWB 4H8WL 2UY2A 3C8FA 4L8SC 2J7FA 3A3WA 2ODIA 5INDB 1R5WB 3AHXA 3B9DA 5GZOC 2O5NA 3ULUC 1NMAH 4AL8C 1T0MA 3WN5C 3ZW3A 1NGQL 2RFXB 2FYVA 4RSVA 3P60A 1AQ0A 1E4IA 3T77B 1S7RB 3UAJD 2CLZA 4XN2A 5D1XB 2XIOA 5M03A 1DANU 1A9EA 3QGAC 5CFAA 4YNYA 1GPOH 1T89C 2XXMB 5DJZA 2VGFA 3LTSA 3V4PL 4HWEL 4OFDA 3W23A 5BS0E 4NO0A 1X9LA 5DQJA 5EO1B 2GHWB 2Y6ZA 2V2XB 1RPUA 1HH9A 1IL1B 3WO8A 5ECUA 4G5AA 2QKIC 5F7UA 4X8GA 5DJAB 4R3UA 5HHVH 4L5FL 4L0PB 4XSMA 4HD9A 2CIPA 1SOQA 4XCYA 3TBYB 2FQFA 3FQXB 3R1ZA 2AKMA 1EJFA 5HGHB 1L6GA 3CO4A 3I2CH 2QUVA 4XCFL 4UI2A 2WBGA 1LM8V 1SGJA 1ZHLA 3BPCA 3Q6FB 4JVPA 1NGPH 3U46B 3DA0A 1TPXB 3VXUB 3PHQA 1GGUA 3AIEA 1FZKB 3H54A 5E00A 2GYIA 4E36A 2HSAA 3B5GA 3MGTA 3LKSA 1XCQB 1T7WA 2EINB 1X5XA 3MBXL 4NQSA 1MDAA 1EEQA 3HRPA 1ES0A 1M6JA 5F2MA 3KVJA 3LDBC 1ZS8A 1FGVL 4NRYB 2WVUA 3UZVB 5H8UA 1W0WA 4U6VH 4WSKA 1EYEA 4M43H 2PPEA 2BZNA 3OLDA 1RK5A 2NUTA 1CFNB 1KCBA 1C7TA 3L5JA 1PY9A 2BPBA 2YBRB 1E4KA 3E6HB 1E8YA 3U5UA 4NJHA 4CSPA 3QJSB 3D0LB 4F2UA 2ZXDA 4UM9B 2DZWA 1Q0YL 4DPPA 5TE7H 4CSSA 3PGFL 1J86A 3K4WA 1DEDA 1L7IH 1KTCA 1TZHB 4XOEA 3S5NA 2OTWB 3L3JA 1YEHH 1PLGL 5IQNA 3O9WD 4Y4FB 5KMYA 3P0XA 5FYKH 1VKXA 5GS0H 1VF5C 1IE7C 3SQSA 3D48R 3EPNA 4EPKA 4HIEA 3TKFA 1G7LA 1BYDA 2AABL 3X1FA 4NF7A 5HHXH 1CDYA 5LHDA 5D9MA 3S0CA 1DJZA 3RN6A 4OV4A 4Q4IA 5F96H 4AEIH 1V05A 3T0XA 5I02A 3CPGA 1MUJB 1FGNL 4FP8L 1EP1A 3MV9D 4BWTA 4NFDA 2VABB 3DRQB 4I9MA 5F7DA 4JFDD 3CC1A 1PX3A 1BIHA 1WBZA 4E9XA 1ITBB 4TQIA 5M5DA 4QMEA 4NZTL 1XF5A 3LOTA 2V9QA 5HNRA 4M3JA 1WBHA 1EC7A 4Z5RA 4PJDE 4LC8A 3UAJC 3HPSA 2IPUK 1IGIL 4PBVC 3AJ7A 4J8RA 4CD7A 4OJYA 3QE5A 4IU3B 4GKSB 4K8RD 4AITA 3RJYA 4YYFA 3OKMA 4PMYA 4KKBC 3BAEH 3EHBD 5IY5B 5KITA 5KW9H 3E3QE 4J6IA 2Q3XA 1PCWA 4EIZC 2W61A 5BXSA 1TQUA 3RKPA 1JFXA 3V79C 1DUZB 5DDHB 1UACL 4PJ9D 5DQ9A 1JZ3A 1EDHA 4BKLA 3UYCA 1WZMA 4W5ZA 1IGJB 1E71M 3FFCB 2JCCF 4F57L 2EPKX 1UBSA 5DN1A 4OFCA 3IAQA 1MXGA 3QRBA 1PZ3A 1D7BA 4KDWA 2E7MA 2HMID 3A6BH 5F7LB 4PRDB 5EBWA 4R2GC 4WFHE 2AC0A 1U8OA 2IANA 4O2EB 1X6LA 3DFNA 1JVLA 4H8UA 4JFXA 5I1IL 5EU4B 2WAQA 1L9MA 1FNEB 4QTIH 4XVTH 3T1GA 3WIFB 5I2IB 1DWIM 1XLDA 3DSNA 2PCEA 1UZHA 2NNAB 1KXVA 2NNFA 3RY4A 1PO9A 4CBZA 3BLEA 2DDQL 3C5ZD 5K1NA 4LF3B 1FNGA 3BLFA 4FHAA 2R69A 5E7BA 1GEHA 4PB3A 3WKZA 1T7LA 2PI6A 4GKZA 4CQAA 1JRHI 2M8XA 5IHBA 1A6WL 1S5HB 1AJ7H 5LGJB 5EBUA 3ABSA 4M93C 1Q6DA 4JX6A 4LLDA 3TTYA 2LT9A 1UR3M 5C2UB 1G69A 4LL4A 3QH3A 4NQCD 4NZUL 2P5WB 2C91A 5IQ7L 4IGBA 1YMMA 1A6UH 1OW0A 4S0TD 3NVDA 3PNUA 3HAEB 3HOJA 3AMDA 3DV6B 1PG7H 4JZNA 4M9OA 5TDNA 2XN9B 3VGAC 1IQWH 4PCTA 4YQXH 1BWMA 4G7YL 1L5GA 5GS2D 2CLIA 4EAMA 1NPUA 3HPJA 5CBEB 5CLXA 4IBTA 1BX2A 3AXKA 1SHSA 1KT2A 4ZS7H 3O2VL 3ZDYF 4HSCX 5FYJD 3VGBA 4IP4A 5JHDE 2Z64C 4ZQCA 3UWWA 1J8HB 4X6CE 3QULB 5CC3A 4XZWA 3P14A 2ENJA 1CFMA 3T6CA 3TO4C 3CJJA 4GS7B 4E41B 2X40A 2QVMA 3KDNA 3HGJA 4GD0A 3D5HA 4S3AA 2NUPA 3UJ2A 3LX9A 3DXAB 5E6RB 1EGJA 4UZUA 4X5XB 4Q8NA 3PWAA 1HIMH 4J3OH 3EEZA 4ZFQA 5GGQL 2ZC8A 2BDQA 4U10A 1D7CA 1HKMA 4PJHB 3PPGA 3TNMA 3U25A 4NP9A 5TE4H 5FPIA 2HXAA 4RMVA 2YK1L 3MGAA 1YEYA 4MMXB 3JWDC 1LO4L 5BU6A 4L8SA 2FTPA 4UNTA 4YX2L 1GGBL 3C8KA 5GZOA 1ITUA 2V81A 5J1TC 1CF1A 3WN5A 4DFIA 1GEQA 1QASA 3QQXA 3WMQA 4Y2DB 4YN5A 2P24B 4N86A 4F0RA 3QFJB 4AH2A 1AR1B 1XTMA 2C4FT 4H5SA 4HFWA 2WQPA 1JYNA 4Z6AT 1T89A 4GAJL 3QYMA 3NPVA 3W9DB 1ONRA 1U3JA 3KBFA 3TN6A 3U8GA 1MCJA 3IU3A 5G5DA 2YRZA 1DQTA 2Z26A 2CHOA 5IMLA 2W0PA 1F3DJ 2PLKA 4DBUA 2QKIA 1J5DA 2HJKB 1HOEA 4X4XA 4QD2E 3MMDA 2X1UA 3VCNA 4XXWC 2DQMA 5TIMA 3K71A 4G9FD 2FO4A 3OKEB 2FZ8A 1JF1A 2DLGA 3ZDZF 5I3KA 1YN7B 3TT3H 4O1AA 4D0DA 2HX7A 4GXVL 1BV8A 3ONCA 5ICZA 1H3XA 5BNXD 4V2XA 2JK5B 2V6HA 5FJTA 5LNGA 2M1KA 5DD5H 1NFDB 3VD1A 5DX7A 5FHBH 1SOSA 4DRSA 4LPCA 1XIJA 4XMZA 4WFGD 2YDSA 4PG2C 3P77B 1FCBA 3D9AL 3TZVB 3N3MA 5C7VA 4JL1A 4FNLH 2YGPA 4BGLA 4QNWA 2KZKA 3IUHA 2DBLL 3UCQA 3SB0A 3WJXA 1ITCA 3C5ZC 2A9DA 2OWWA 2GK2A 3AWFA 5EU3B 3K6NA 5EU6D 3QIUB 3QPZA 1AP2A 1A0DA 1LO2L 1CDJA 1Z9OA 5CLZA 5BXFB 4Q8TA 4YDIL 3GYRA 2W38A 2OZ4H 3PXLA 3K91A 1W56A 3VNKA 3HRZB 1DVZA 5C9UA 1TCDA 1NCDH 3QDAA 3D47A 1LE9B 4TRPH 4QS6A 1XIGA 1TKWA 2VFDA 1DBKH 4LS0A 1UZ1A 2E75C 1C8XA 3LNPA 2C0AA 2JKEA 1ZCRA 2R1WA 4QPEA 4KMQA 4MLJA 3C0QA 1KTKE 3LJ3A 1PZ5A 1YVLA 3V18A 4JFHD 1IGYB 3MU3A 4PJGE 4RZCA 4PWJA 4MMYB 2FGZA 2YD2A 3FLUA 1JPDX 3OXRA 1DXEA 2BOEX 2DLIA 2OX5A 1R38A 3N17A 5EA9A 3KNBB 2TSYA 4W4QA 2JJSC 1WJ3A 5D30A 4ZMXA 2V5YA 3RMJA 3FK4A 2NSXA 1MHCB 3MRDA 3X3GH 3G5XB 2OMNA 3RYMA 1QRNE 1CFSA 4PGCB 3N43B 1EP3A 3EOYG 4CVZA 3EWBX 2KX9A 3JTBA 3WELA 3X1NA 4WI4A 2EXOA 2DMHA 4F3FB 1AHKA 1F2XK 3CMJA 3RIFK 4HPOH 1CE6A 3V4BA 2GBVA 1FH8A 3H4HA 1UFGA 1IBBA 2ODHA 3CZKA 1RA5A 1AZCA 1PDKA 1TTCA 4HYWA 4CGTA 3JTSB 4TO8A 1DWHM 3UMNA 2GIMA 1BXVA 4LT9A 1UOVA 3U5YA 4NL1A 1E6JL 1TELA 4LQ1A 3KDPB 5FKAA 1AH4A 4AEOA 4C65A 1IAII 3UAJA 1EMTH 2GPTA 4KI5D 4NZCA 5LBVA 3O6KL 1H6FA 3S6TA 2POZA 2NV2A 4JDVB 3MLVH 1WRFA 1L6ZA 5I0ZA 3TV3H 3UTZA 1KEML 1W6WA 1ZLDA 3GW3A 1TU2A 1FRBA 3V5HB 4JBSA 3B05A 4XO9A 1H6UA 5AYBA 2H9GB 3LSOA 1MZRA 4NUWA 5LCVA 3GMRB 2E40A 2VQTA 3DO3A 5D37A 1GTEA 2G75B 2A5HA 4Q4EA 4ODUB 3S97C 4WQ6A 1A7BA 1OSZB 3VOGA 4LCCB 3OBKA 3GG0A 1RKRA 5IGXL 4O16A 3I6GB 4N6RB 5XINA 1UCTA 3TEZA 1SYSB 4Q9QL 4WFEE 1SEBB 1W3TA 3N9SA 2GTWB 1LT8A 4NHUB 1KSRA 3TASA 1FBIH 4F92B 4JQ1A 4HKZA 3ITVA 4NPJA 4C5ZA 4FZEL 5HPMA 3EOTL 3B2UD 1L3WA 2BVQA 2QMKA 5DR5L 3GM8A 3DBXB 1D6VL 4P99A 4BZYA 3NSJA 3CFEB 3CHXA 3QZMA 3SDCB 2H32A 1UQZA 3GH5A 3WD4A 2FJSA 1U3HD 3C60B 3EKCA 2O93L 2PR4H 4M5YH 2XBDA 1OGTA 3KW8A 5I76B 3TC3A 1G0XA 2HVJA 1DSFL 2EE6A 4JIEA 5I1DA 1AGBA 4FXTA 3QDJA 3NA9H 2IC2A 3L3HB 1MAMH 2YGOA 4RA0C 2PSNA 3PGDB 4NFCA 2ISWA 5AB9A 1UR2A 4K3HA 2NV1A 3H9HA 1I1XA 3VRIA 5K1JA 2YXXA 5F93C 1CT8B 4UOZA 3W2LA 3FCGA 4MJ5A 3ASWA 4JFZH 4OLYH 5IFHL 2GTZB 2VUOA 4I9WD 4WK2B 4U1KB 3GS0A 3BP4B 5EOCH 4YAQA 4AGLA 3HUJF 2V2TA 3T1FA 1FNFA 2C8NA 4KO6A 5KSBB 3TO4A 3NTCH 3CN2A 1DQMH 2RAGA 1S7VA 3W70A 1UCBL 4XZUA 2J75A 1R3KA 4OFIA 4LAMA 5HI5D 2P9RA 1BIIA 4GW5B 3WIHL 3G5EA 1XLIA 3H2NA 4WO0A 1OK4A 1ND0B 4JM2B 1SSGA 2GYSA 1MFDH 2OSXA 4J1UA 2KERA 4JFDA 5D72L 2IOOA 4CN6A 1X8CA 3RKDD 3N44B 3FB7A 4ZMQA 3TNBA 1WCGA 2CKRA 5F7WC 1T5WB 2OZ0A 3UTSD 4Q0XH 1QO5A 2XTJD 4XQ6A 3DKJA 4Z7WA 4U7MA 5KS9F 2NY2D 3Q37A 2BHFA 4PYHA 4S3JA 2Q87A 4KI5C 1DBAH 4PRHD 1ZANL 1RUAH 3WU1A 3WJJC 4Y5YC 4WIQA 4TMCA 1OCCB 4WFFD 3BZ5A 1XF4A 4TUJB 4AQ1C 4LLUB 2CLLA 5DYOA 3URNA 4LCUA 1MRCH 2NY1D 1BZ7A 4TN9A 4WUKL 4HS3B 2RHGA 5FAJA 5C0DB 3WS3A 2G3XA 5AOLA 4X3ZA 4RBPH 1OARL 4LVNB 5LXEA 2ZVRA 3QI9B 3VI4A 4HUXA 1DTUA 3B7TA 1DOSA 2WXLA 1CENA 4XXWA 4UTLA 2DQEL 3LPWA 1BBJB 1ZPLA 4MVBC 4YHPB 1V0MA 3LN4A 2NRDA 3NWRA 3V0SA 3B37A 3ZHDA 3EEGA 2F84A 2YEQA 1BPLB 1QSFD 4HNLA 4WGWB 1NELA 3CWOX 2WHLA 4AF0A 4C6QA 3I6LE 5B38G 4WLCA 4P05A 3FSZA 2J8TA 2V5DA 2B1AL 5AOJA 2PKDA 5BVJB 2JQZA 4PG2A 3B2UC 1LL1A 4JFFE 5D2VA 2E6QA 4BCZA 4HCLA 2IFFH 4AWSA 1VCAA 1OM3H 4XOCA 4PJIB 3HPXA 5FUCE 3ES7A 2ZRXA 3C5ZA 1BLIA 4MYPA 4YWIA 3A4FA 3C5SB 3RWGB 3OIXA 4HZMA 4KJQC 3RPIA 3R79A 4NS0A 3RFZC 1YAZA 5E8OA 3TE9A 5GGTA 1ZT4B 2VXTH 2XBTA 4PR5B 3HC0B 3ZO0A 4MWAD 1FN4B 5ELIA 3BRDA 3WXVH 1U8LB 4CNNA 3A0OA 5I3JA 1ZTVA 4NQCA 3B4YA 3VXRB 3DFQA 1E8ZA 1BJ1H 1NGYB 3JW7A 4PJ6A 3UMTA 5E93A 2YAPA 4KMLB 5G4OA 1UUSA 1TNNA 4ABQA 1HEZA 3DVGB 4UQ3B 1TYEB 4LVOC 1T03L 3N6QA 1QHOA 4FYRA 1WBXB 5F2LA 1YPXA 1PYMA 3M17B 1FVEB 1T1ZB 3QJXA 4YXKL 3ZKSD 2QTEA 2H4EA 4LSBA 1D9KC 1VCBC 1BMGA 3QXAB 3PWLB 2JJSA 3MREA 2B2XH 4LRIC 3V7AE 1ZU8A 5HMDA 1YDNA 2Q2LA 4Y9FA 5HI5C 5FJOA 1U3NA 3FUFA 3U83A 2AJZA 4ZYKA 3C0LA 3DGDA 4GWEA 3IRCA 4AEFA 4HU8A 4WJG3 2JELH 1KCVL 1XSKA 2X30A 1D9EA 3RKDC 3FQ4A 3A3HA 2PXYB 3D30A 4ACZA 3H12A 2F58L 2UWEE 1TUPA 3GRIA 5A2FA 2FTAA 1R3JB 1NJJA 2YL5A 4M7KH 1CGUA 2C3VB 5DHVB 3V0JA 3QRFM 2AKRB 3O4OC 3HG3A 2UX7A 4AC1X 1Z69A 2XH4A 2RJMA 5IBLD 4L1TA 3FU6A 4ODHH 1KB5A 5TFSL 4R33A 3N34A 1KQZA 1N2VA 2ZZ2A 2E59A 5FO8B 2NY1C 1PYWB 3PP3H 2X4TB 1NBZA 1R5YA 1V08A 3T4YB 1FFOA 3P0VL 1H7RA 2VSDA 5ABHA 5CFHA 2OVLA 4ANKA 1HI6A 3GO2A 1NUNB 3DX6B 3BGMA 2I9LA 1PKYA 2OW6A 1SMOA 3WKMH 4C4UA 4O1BA 2QQKL 3MUAA 2R82A 1CZ8L 4B9CA 4B5WA 1XBYA 4PB0L 5DMMA 4MYAA 3VKDA 1OD8A 4ZUSA 5JZ7D 3DZ1A 4XGZB 1R3TA 3PUEA 5J3HD 2IGFL 4FN0A 1QVOA 3NCOA 3AWOA 1G4EA 4GRMA 3B8IA 1C9WA 2GUYA 3NQAA 2BY3A 5CCKL 1FO0H 2FZMA 1BVKA 6CGTA 3F7VA 2HXUA 4PN6A 3QEHA 4M8UA 3SPCA 3UPWA 2VR6A 5B38A 4DN4L 4GUIA 1AGDA 3WI9A 5C7XL 5REQB 1EHLH 5GNYA 3T8XB 5EU6A 1GVYA 3LZ5A 3LXCA 2ARJQ 4ZQPA 1EH9A 1DXFA 3RDKA 2FKPA 3PB0A 2R4RH 2WWKO 5IT2L 4TQ8A 3G8EA 1I9IL 4UIKH 2W59A 4JN2A 3KWVA 3QEQB 1V8EA 1JUEA 3ML9A 3U0HA 4JHAH 1P1VA 4QO1A 1DTNA 1ZHAA 3ZTJG 2X0VA 4FQIL 2NSQA 1US0A 3U4EA 4JPSA 5F6IC 1B3IA 5MEND 4HKJB 4Z1BA 5FESA 1KTDB 4KEZA 2W5PA 4RR4A 1ACXA 4NQ1A 4Q6JA 1FORL 1TWIA 3AVEA 1IBZA 3O3AA 3QA3B 3VO0A 2A9BA 3QB7C 1OFPA 3GGWB 4UTJA 1TR9A 1DBMH 3RNKB 4AZ8B 4AX7A 4ENZA 4J3WA 1SU5A 4JBRA 1K9TA 4IBLT 1P4LB 2G0KA 3QN3A 3L23A 4GG6F 1UD2A 4PJDF 3NYDA 1A4CA 2VD9A 3MODH 4PB9L 3W22A 3VYLA 5MF5A 2ZCHH 4J3OF 1VYRA 3DJZA 4IBSA 1R4XA 3A4EA 4QHUB 4I85A 4QP0A 1B4KA 1Q2RA 4R0LB 5BCAA 1C08A 4ISVA 1J96A 3C2AH 4MQXC 3CUFA 3HZKA 4B91A 2D3NA 3ZLFA 3HGRA 4PGLA 5KVGL 3BT0A 4Y9BA 3M0VA 4QITA 2DT2A 4FR1A 4O28A 1I8IB 1RZMA 5DJCB 4XWGH 1PSCA 3R8RA 1O5PA 3WL1A 3B9OA 3T65B 3NCYS 3SQOL 1K8CA 3WJJA 3O11B 4Y5YA 1LF1A 1Q7QA 4GJJA 4KROD 1EVTC 5FW6A 5E9DD 4AG4H 4DW2H 4DHGA 5GNXA 4AQ1A 2X6VA 1SBSH 4MCMA 4NZ4A 2K7PA 1RY0A 3FSTA 3AS3A 3UXAA 2E6FA 4TQHA 4K5PA 2GSIB 3SY0B 2NQDA 3NJFA 1K3ZA 2JI2A 1KW1A 1XQKA 2VR2A 5TJWK 2CHWA 1XX9C 2J44A 1E73M 4AD2A 5EORL 5J3HC 4AYID 2GOUA 3GR4A 1JP5A 5IVOA 2NR6D 1SJCA 2MQ3A 4P2CG 2GIYA 4IS6A 2VEMA 3VG0L 2A6DB 4OIIH 1HJVA 3CAWA 5FUOL 3RWIB 3IGKA 4P46B 4QRNA 5A6JA 1C1EL 1AMKA 4E8CA 2Y7QB 5CJQL 4Q8WA 4CNSA 2Z93B 3RTQD 3MGOA 3AHZA 1K72A 5DC4B 3GXPA 4PHXA 3ZE0E 4HJGA 1U2CA 2G37A 4BCXA 4J7RA 4XIAA 2C3HA 4IPNB 5I3FA 1AZNA 2CUMA 3RFZA 2HZHA 3E6FB 1N2RA 3QUXC 1IEBB 2FZBA 4PRIE 5AVRB 4LB3A 5GSVB 4K3JH 4X6CF 3SPVB 2FJFB 5I2UA 2FUQA 1NDMB 5T1DH 5E2UH 2ISDA 5D2TA 1E9PB 1FL6A 4HUUA 3BDYH 3K4ZA 4FP1A 5SX4H 3CEPA 1XX1A 3Q67A 3FAXA 3V7PA 2Y70A 4PTNA 3MHFA 2QR0A 2J8HA 2VJXA 1LEKA 3L7FB 3P2BA 1AJZA 5DT1L 5ITFA 5DRCA 5CZSA 5SWUA 1H3PL 3PZUA 1D9KA 3GYCA 2OR9L 4KDVA 2YMXH 4WHCA 1MH5B 4TUOB 4LRIA 1OOWA 4J4KA 4E5XB 3FSAA 4WI0B 4RLIA 3D3VB 1OAZL 2O4MA 3ZM8A 5EFIA 4G3YL 3CM4A 1BYBA 3RM4A 4E4UA 1JPHA 2IPUG 1JN6A 1S5TA 1LHZA 3E0VA 1RZQA 2OSLB 1T6VN 4GACA 2HA1A 2K4WA 4RAVB 4D6GA 1UOZA 4HU2A 4FQCL 3GSNL 4N2FA 1JPSH 1OZMA 2GITB 3MJ9A 3KLHD 1H3UA 3RU8L 3R25A 2G5BA 3U82B 3F7YB 4JEGB 4PRHA 1RZFH 4W8AA 1HQRB 4WNQB 3MV7D 3G6AB 5HVWA 3BVNB 4JFOA 1M2VB 2Q6WA 1IZJA 1ETJA 1EZWA 1LEIB 2OMTA 3TO2B 1ZBKA 3QYQA 5GISH 5D8ZA 1R3LA 3C9NA 1WCBA 2H6OA 4Y9OA 2P8LA 1BVWA 1SJEA 3KS0J 1GC1L 4Q7NA 4M6NL 1P43A 3SY1A 3AFLA 3NDZE 1X4ZA 2QAFA 1O7DC 2PWGA 3PHOB 1NANH 2WTRB 1JVKA 3O0KA 3PPEA 4WEUD 5BOPA 4G8TA 2FEEL 4OCXH 2Y88A 4NZFA 3KVKA 2QT6A 3WLTA 2FZDA 4GKTA 4KUZL 1QSFA 1KPUA 1BXNA 4MSWA 2EDBA 3ULVL 5T1KD 2DJ4A 1SHMA 3AU2A 1HNYA 4GQRA 2OO0A 1M7DB 1VFTA 4DN3H 3HQNA 3RJOA 3QWOA 3V0HA 4QRBA 1TRDA 4FXKC 4FS0A 5EEYA 3CK5A 2HFFA 5F4SA 3CXOA 4HJTA 4MCYB 1FWGC 3IUIA 5D2LA 4YBHA 2CGRL 5EPMB 5F7BA 1KM4A 3KBNA 4PRPB 1CXIA 3SE3C 4OUOA 1OP5K 2CIIA 3HO8A 2B16A 2G9HA 4HUWB 3MP5A 2DQJL 5C0QA 4WW2C 4IXXA 2YUWA 4YDLB 1NQKA 4C6EA 1UA6H 2AFNA 4NX0A 3MRHB 3AW5A 1S5NA 4IIZA 3ZR5A 1B3YA 5IQOA 3EWUA 3GHBL 3M07A 4UYPA 43CAA 5FLUA 3UYRL 5B7MA 4M7ZB 3TU6A 4F3HA 2VKWA 4J39A 5K9OA 3E9TA 4LU0A 2F54E 5KSWA 1L9TA 4U1JB 1E5CA 1XHHA 2NOYA 5A8OA 3VDGA 3D2UD 3O05A 2G50A 2FT8A 1A1MB 1C16A 1G7PA 2DYPD 3W11D 3OR6B 3FF8A 3EOAA 2Q71A 5J12B 4UAHA 4GAGH 1UMYA 3PRZA 3FT4A 4P57B 3CQQA 2WZPD 2R94A 3IJ9A 4U1NB 1FCQA 3BP7B 1T1YA 3TWAA 4GPNA 2F5BL 1BMZA 2XN2A 5E2VL 4YO0B 1BKHA 5I17A 4D3CL 2WBJB 1DQKA 2E76C 2R4SH 4UV4H 2FYYA 3KLHC 4QRPB 1XL6A 3C09C 3BEWA 2J8UE 4FA8A 5H8DA 3BV7A 2AJUH 1XLAA 2H1PH 1I1AB 4X2RA 2ZCLL 3IE4A 4NUGH 2GG1A 2Z8VC 3Q13A 3IGXA 2W66A 3RDTB 2C18A 3NQDA 1CIDA 4JM4L 3VXMB 1NKOA 3VOIA 4N0YH 2Q3AA 4OZFB 3FPYA 2Z9TA 3UWUA 5I6OA 2DIJA 5L4IA 5DUMH 5I74B 1H2JA 2AEPH 1KJ2B 4TNWF 3DX9A 4H0IA 2V7HA 1MW1A 2XV2A 4W9KC 3XINA 2DQHL 1XCFA 4ZW8A 1JZDC 1VBRA 5IB3B 2HJFA 4G43A 2APWA 1WWWX 2YA2A 1E4LA 2XN1A 1J7VR 5F7KC 4EUPB 4GMEA 1J8KA 4JTGA 3U2IA 5CCHE 5HI4D 4L4TB 1OCJA 3SJVE 3QY8A 1JSYA 1YYLH 3UJTH 5BRBA 4UU9B 3UBGA 3OPUA 4FLSA 4JGUA 1VD6A 1F7BA 3U4KA 1RAKA 3HE7D 4Y19E 1S2VA 5CJ8A 2YKLL 4IBYA 3B8DA 2EXSA 5FM8A 3F5WA 3NIGF 3OKYA 4MNGB 2QHRH 1FE8L 3SCPA 1UB3A 1G5AA 4Z78B 1KLYA 2ZZ4A 1VP5A 3BO8A 3EYVA 4JN7A 3F65A 1MEXH 5IJDC 4MAYD 3ARVA 3G08A 4H1LG 1BVLB 1F11A 3THUA 3CZFB 1N5YL 1XINA 1S6NA 1W1PA 5CZXC 4WY0F 3NZQA 3TDFA 4N42A 5KBPA 2YPLD 3DROA 3BH8B 4ILSA 3UWYA 2YLAA 3MV01 3AU0A 2QGDA 1X5GA 2Z2BA 1TWZA 1WEJL 2DT3A 3N85L 1K8ZA 4IPLA 4P3CL 3OPZH 3HFMH 3UTTD 1MVUB 2OYPA 4KZEH 4YHZH 2X2IA 4QKXB 4GOAA 1FOBA 4Q6IC 4X6DE 5HY9A 1ME9A 2D7PA 3ZLGA 2A4AA 2FX9H 4REQB 4ONOA 3MI2A 4I9TA 4UBPC 1EIXA 1DE4A 1I7ZA 1AVAA 5D04C 3EDDA 2CK0H 3IJQA 1DQVA 3S9YA 3O2WH 1J8SA 1UR9A 3TWCH 1MCOH 1B9BA 3FU7A 1C92A 3UY7A 1S7TB 4I3SL 5HHOE 4MM1A 1K85A 3BRGC 4ZMWA 1KFAH 4Y2NA 3QDGB 1YE4A 5T5NG 5HULA 5EPDA 1R85A 5EYWA 2INZA 4YGAB 3IGFA 4N2OA 4IRJD 3TYGL 3N2JA 4MNHB 3AAZA 2OR8A 5EZLB 2UVEA 5HNUA 1B3OA 4WWKD 3MUCA 3LNGA 2ZIDA 4EBQL 1TZGL 2GW5A 3A3YB 3W11C 4K15A 5IVXB 1OINA 4XC3H 3E2SA 1XLMA 5DHDA 1E9QB 3GTIA 1A02N 4JN1H 3CFTA 5F4WA 4A3RA 1JK8A 3S9DB 3W5NA 3FUJA 4FK9A 1MJ8H 4C6PA 4QAMB 3LS4L 4ES9A 1XLHA 2PD9A 1GGTA 5CSRA 5EOQL 5TDPA 4FZ8L 3P3RA 1Y6MR 3F7LA 4OQ1A 2TRHA 4BFBD 5GRVL 6FABL 2G3ZA 1RXOB 3GC2A 3P9MB 3NDYA 1BDYA 1OG6A 4HCFA 4W9TA 1O6SA 2BP8B 4OTXH 3NABL 1I1CA 3OKKB 1YPZA 2ADGB 1XGEA 4I7VA 4NXKA 4QS5A 2XSBA 1QG3A 4JHWH 5KAQG 1FYTD 2R29A 3D39D 2VKXA 2WQXA 1U36A 1XQLA 4R4BA 5E9DA 1AFSA 4MQ7B 3TYFA 3OKLA 4MFDA 5IB2B 3RITA 2DQCL 1E6QM 1PBGA 1W3HA 4JTTA 4U28A 2VDKB 5L2JB 2PP7A 4H6KA 5FL0A 1WFJA 3QUMA 5JIPA 5AHEA 1DPMA 5HI4C 3Q01A 4X6EB 3FDGA 4WSHA 4D9QE 1ZEAL 1CGTA 1ADQA 1ZNNA 3MUIA 4D9RE 5ENWA 1KTLA 4W86A 1Z41A 2Z25A 2FMOA 1NCUA 3FCSA 3RGBA 1PLBA 3EBIA 3S6CA 1KB9J 4U7SA 4U31A 3AT8A 3TS8A 2PCFA 1W3NA 1XR9A 3HI6L 3MCLH 5BVPL 1JPIA 2KT6A 3EZ4A 3T9PA 5JLZB 3RNDA 5IVZA 4FABH 4MAYC 2VE6B 1OYAA 4X99B 2J56A 4UINH 5DD1H 2C9VA 1NAL1 3CZGA 2ORBL 4EPBC 3V1PA 4PULA 4QHMB 1MLCA 1Q0XH 3E8UH 4B7IA 3QW4B 5JTWA 4H1LA 4FXKA 3CDCA 1WUEA 4U4MA 3FL7A 5EUOB 5GRJH 4ONHB 1XCTA 3FAWA 3GSXB 3QZEA 1KJ2L 1DSWA 4H7ZA 2E1DA 1RZ7L 1I2NA 1D8WA 3GMNA 2WXQA 3APNA 2CHNA 2FDBP 4Z7QB 4O0KA 4QTHB 4QYAA 5ADOL 3DV4B 4M1DH 3B2VH 5HGAB 4L29A 4X98B 4JY5L 3SQLA 1U8HB 3SDDD 3VWJB 3SE3A 4LV4A 2A6KB 2R8SL 2GJLA 1TOXA 3FQ2A 4WW2A 1HCFX 1JNNL 4Z0BH 5B1JC 4GISA 4M00A 3V4VB 4Y1AD 1LYXA 1LBLA 2XV6B 3ILEA 4P2QA 1YEEL 2DOCA 4G6KL 3B3BA 5AY7A 2YCLB 2UWEF 4CC0A 5KVDL 1QVBA 2Y2YA 4LEQA 3C12A 3K2UH 4WWKC 3UGRA 2Y72A 5G1TA 3NOYA 2P80D 4DM2A 3D07A 1UWIA 4IBVA 2PURA 3IVKA 3STCA 1K8IA 1K4GA 3AQXA 1N3NA 1IVLA 3EO9L 4FOUA 3QK0A 3BWSA 3P61A 3QR3A 3RY5A 4ZMGA 4N68A 1DLFL 1BZ9A 4BK8A 4YUEL 1ZCCA 4PRBA 4OAWA 4NQDE 4CN4A 2PAJA 2R51A 4W9HC 3EF4A 3N06B 1E90A 4AY1A 3POCA 4HQQH 3TAKA 1B2YA 3FB8A 3QHZL 4DN1A 3CVBA 1NBQA 3RU8X 2BVEA 3SUWA 3BQ6A 1ENUA 3PABA 4KRUA 3L81A 1ASOA 3UPCA 2MPAL 1OP4A 3JTTB 4I87A 1R8LA 3VCRA 1KF9B 2EVGA 4X80L 5FO9B 4U2ZA 1OCOB 4CQBA 5FYLD 1L7TL 3QGKC 1VFOA 4HH8A 4N9GB 4OCSL 3WK3A 1DORA 2WSYA 2F1EA 4PTTB 1UD3A 2FSDA 3O0FA 5KYUA 2XWDA 5C0CE 3P0YH 3FU3A 2A73B 3IWUA 4GPVA 1ZSXA 2V5LA 4FG4A 2R6OA 3CFJA 3BPNB 1Y5VA 4HUMB 5DLCA 4NC1C 2X1QA 4QSHA 3I50L 3QNFA 5T1KA 2MJWA 4QE4A 3FO2A 4AMAA 3ALFA 3EFOB 4D0CA 4DZ8A 3Q2NA 4EE2A 3VAEA 1IT9H 1RIUH 3KH3A 3CXHK 4BCEA 1AMXA 1QLEH 1ROCA 1UR8A 4HCRH 3P0GB 4XB8A 5JOFB 1WBYA 5D7JD 1M04A 2OSYA 1U8PB 2OMYA 4B5EA 5D7IA 4WI3A 3O2DL 5EHFA 3O9WC 1TQCB 4L2YA 5J6GB 1K5WA 2VDKL 5KG9A 1TDQA 2ED7A 4M03A 4NLAA 3M1BB 3WFHB 1E9ZB 4C83B 1PS3A 4Q6IA 4LUIA 2DB8A 1ZMYA 1YPIA 2BASA 1TB3A 3GUFA 2GJNA 5E1AA 2NQJA 2D69A 2XY2A 2YDAA 4LIQE 4RAUA 1XGTB 1HKWA 3GBDA 3K2MC 4JIQA 3MLWH 3J8F7 4DCQB 3NCJL 5DD6B 4MY8A 2BZDA 4LLVB 2ZADA 4ZMZA 3MR9A 1KIRB 4WOQA 4MOZA 3TLRA 3AIQA 3LLFA 1ZVNA 4I18C 1EFXB 4AJYV 3JV4B 3SJ3A 4MJIE 5ISZB 5T3ZE 5JHLA 1DUYA 1BQUA 4LBEB 2DYPA 2BVTA 1Y6KR 4P07A 4OCNC 3S37H 4POZD 4X7CC 5C09D 2R0WL 3SGEH 4US6A 1OD7A 2ZG2A 2F53B 1KBKA 1FDLL 1CG9B 4K8RC 4A4AA 1NIBA 4JM0A 2VT0A 3UBXI 1RLCL 5KINA 3EHBC 1QUNB 2WLIB 5F1OB 2X4SB 3WFDH 2Y0SA 1MWAA 1DQJA 1S2TA 4K9EH 3W1ZA 5I7GA 5D4YA 1VH7A 2XISA 1Z48A 1ADWA 4PJ9C 4U1MA 2CM5A 1Q8AA 4Q2ZA 5C2BL 4LCYA 4HGKC 3DI1A 5D70H 1EO8L 3T3PB 3V4VL 2A2QT 4CQ8A 1S9WB 3C08H 5DLML 2ETWA 2HMIC 1ZENA 4HJJL 2ADFH 4ONGH 1V5JA 4LWWA 3RBSA 4Z2JA 4GRWB 1JQVA 2E5DA 5C0BB 4W85A 1L6PA 4IOTA 3OJVC 1II4E 3JR2A 4CU8A 4NJ9H 1R19A 2YC1B 2B9BA 1BHGA 4G8EA 1RUKL 2VRQA 5D8WA 4DTGL 4PJ7E 1N5AA 1CCZA 3ZJ7A 2BVOA 3LCFA 3G6LA 4DNMA 3P73A 3T6WA 1TFPA 3L3OB 2HKHH 3WH5A 1U8NA 3FJNA 5E6ID 1BWWA 3CHPA 1OM9A 1PV8A 2WLLB 3W0WE 3AB0C 1JDAA 4M62L 1HQ4A 4WDIA 1T6BX 4E9SA 1F07A 2A9MH 4MAYA 4MJJA 3TPUA 2DJMA 1HHIB 3GLCA 2HS6A 4ZMTA 4URKA 5AVSB 2YPLA 4MDRA 1W37A 5L8JB 4B2DD 5JXAH 4HKBA 3Q94A 5D7JC 4LIQH 1ECYA 4OGQC 3QJUB 2L0DA 1HILB 1XBVA 2I9UA 2F9BT 5FV2A 3UTTA 4NN6B 3B7RL 4HBQA 1WWAX 1NBVH 4O19A 3LBOA 1TIUA 2YW4A 4U1SA 1B4RA 3HG5A 3VINA 2XA3A 1JCVA 4TKWA 1J4EA 1XLEA 5T3ZH 3LRHA 1KBJA 2OR7A 1JV2B 5SWZD 4JAMA 2CO6A 3BZFB 1P9MC 2RIKA 4GUJA 3VKBA 4ODTL 5B1JA 1V7MH 4XNQB 1CLYH 3GHRA 4O2CA 1AHWB 4FX5A 1N8ZB 4JFEA 3O3EB 4NRXA 1W1A1 4MIMA 4AYEC 1YG9A 3ID7A 4WWKA 5B22A 4DVOA 1KELH 3G22A 4HIHB 5C5YA 3L5WA 3W39A 4EDXA 5I66B 4XBSA 5F97E 4NB7A 4NJJA 4UT6L 3VE0A 1AH3A 1WFMA 1IE5A 3MFFA 3ZKMD 3PN8A 4JR5A 1PY0A 1GAFH 1L4IA 3K6SB 4L1BA 2D2CC 1BD2E 3WG7B 3SDXB 4WQOA 3CDFA 3CNYA 4NYLA 4OZGB 4ZW5A 2R2EB 4EN3B 2CR3A 1NOLA 4QEHA 3GMMA 5DHYB 1DIOA 4RETB 2W1NA 2YPKA 5D4JA 5DURB 5EWIL 4Z7IA 4P06A 4PJCE 5E5CA 3TH3T 2W63A 1JD9A 1JGIA 3L7RA 4CDGC 4GIPD 4C47A 3U2SB 3OC5A 4MMZC 1P69B 3NYZA 4QJ5B 1ZAGA 1NQBA 4YSOA 5L0QC 5E6UB 5CD3B 4CW1B 2XVKA 3K80A 1MFEH 2WB7A 1PIFA 4KX7A 3MUHL 2FD6L 1ZV5A 1D3GA 1OX5A 2EHHA 3DUSB 1AI1L 1Q94A 3HCVA 3IGAB 2ENYA 1FP9A 2CIKA 5ESVB 4JK0D 4BUGA 3S5OA 1CGYA 4OCRH 3MSPA 3RM9A 5IEHB 1QBML 1XFBA 2PW2B 2WN2A 3FQUA 3AS2A 2WNQA 3ROLB 5JPMC 3RX9A 5DBUA 3LU2A 5E6IC 3LTYA 3F12B 1TX2A 1SFTA 3CVHA 3LHWA 3AM8C 4HSOA 3WFCH 3VFPB 1W1B1 2HT4D 2IQ9H 1FWIC 2IXVA 4CNOA 1INEH 2R2CA 3T71A 1ORSB 1V6XA 2EVHA 3BDBA 4UB9A 3SEPA 4G8FB 1JNEA 1RCYA 1HWHB 3A22A 3X12A 1AH1A 3U7YL 2EH7H 3S7GA 3O7UA 2WLKA 3FC8A 1EEXA 2G4GA 3WF1A 1ZDQA 4UOW0 2ACQA 1R3IH 3WL0A 3C0SA 1HWGB 1IC7L 2OL3H 3VYPA 4QCEA 3ESUF 1MCQA 4OT7A 1U92B 4NQEB 3W1AA 5D2NC 1LD9B 3UVAA 3O9WA 4F8LA 4DO7A 2JE8A 4JRXB 3VKJA 1MMFA 3G5WA 5AVHA 3U0TB 2P4AB 1F58H 4IQLA 2XQBL 1TSIA 4W6XB 2EO9A 5D1XE 3VX0A 5CP3H 1YEIH 3EDJA 3QEUA 1RH8A 2YZ8A 5FCUL 3VFNB 4MCZA 9CGTA 3S96B 1S2WA 1E3XA 2C1OB 4QDGA 1SUJA 2ZOLB 3T5WA 2P8PB 3JWNC 2MCG1 4JDZA 4G1MA 4UMCA 3MV9A 2JKRM 1LBMA 2Q09A 1WITA 3QEGH 1BYOA 5IOPA 1X1OA 5I75C 3EX2A 4IJBA 4IHCA 2WXJA 2P80A 4UANA 3GMOA 3EKLA 4I18A 1F3EA 1QFPA 3PWGA 4L8CB 4G42B 5GGVY 1F4XL 2FLRT 1S2CA 5A2JH 4KVCH 2A83A 5I78A 1VGEH 4I0CC 2V5RA 3AGWA 3ZKMC 5ABGA 2GQ8A 2A77L 3RCYA 3D4ZA 2P7TA 2XZZA 1ORQB 3FFDB 3VXUE 1NZRA 4WVRA 4K7VA 1GT8A 4RNFA 1KWGA 2YOAA 3ZSTA 4S1SL 2NY5H 3SCTA 2AK1H 4MUZA 5AOKA 4GUCA 4W87A 2A2IA 4XIMA 3BT2L 5F7AA 3BKCH 1NOFA 4KCTA 4PJ9A 2EDRA 2FATL 3E2VA 4HWBL 4OD3L 1H4PA 2REQB 1XGQA 4DX3A 3C5XA 4HP5A 4EXBA 4CEUC 1QEXA 4JNMA 3C56A 2XH7A 3SKMB 3LB0A 4TXVB 4BZ2H 1GJPA 4Z7VF 4NM4H 4IPIA 3V75A 1QPQA 2CLVA 4JFVA 3RL1A 1V54B 1EDGA 3GIQA 4E8DA 3DIVA 1QFUH 5ES4B 4A7GF 4H88H 2WNZA 3CUHA 3HG2A 1LLAA 3T4WA 5LIXX 1BJMA 4L4PA 5AAWC 5D33A 3FN0L 4NM8H 1Q9KB 1AQHA 4F7PB 3HVNA 1TKKA 2PWHA 3KGSA 4M0XA 2IKJA 4AGPA 5EMKA 3FKKA 1P1ZA 4XXCC 3DLQR 1RJZA 4N0FA 3V6OC 4C6IA 3U48A 3TK7A 2BC4B 1Q63A 3BOFA 1CW2A 4QHNA 3K1KC 3PPFA 1U3HC 4KNQA 4XP9L 2VLJD 3CUJA 4R7OA 4PTWA 4BFRA 4C1NA 2OJZL 2QFPA 1U1UA 3RI5F 3DSFH 4X6DF 5KBNC 2Y7OA 4EO5A 3MRNA 3MLUL 2G3JA 4R7DA 1C5BL 4O2FA 4AVFA 1XF1A 1N0XH 2DM3A 1U91B 3S3PA 3K6FA 1JGDA 1YNTF 1RPXA 1NTDA 1C8QA 4IIEA 3BAYA 5AVZB 1FIGH 1T0MB 5D7JA 5FEXA 3V95A 4ORGA 2OCZA 1H61A 3BQUD 5GXBB 1ESOA 3I7QA 3W2NA 4NAMA 5EEXA 5GS1C 1YQ2A 3ZYIA 4LYPA 1MFNA 2CLZB 4PV8A 1A9EB 2VERN 1QYGL 4YNYB 1X44A 4K7YA 3CL6A 5DJZB 1V3KA 2ZZ1A 2AI0L 4GE8A 1SUHA 2BNQE 3AXLA 4NO0B 4DGIL 1KPVA 5DQJB 2EDQA 4BEQA 1WFOA 5JUEL 2VAJA 1C12A 1UWGL 1PCKA 1P9MA 4OF6A 3E5BA 5DUPH 3JWNG 4JQAA 4XCYB 3MLYL 3P30H 1F86A 2EIDA 2XCMC 2AQ2A 2IPGA 4MF4A 4MKNA 3SCVA 1E6OH 3UBFA 5JIDA 5KYYB 3GNXA 4L1SA 3F01A 4ZMVA 1NOAA 2VOTA 4HLZH 4PRAA 4FEZA 2B9AA 2C4XA 1V7NL 4BCYA 3FFCE 2J9ZA 4TU1A 4NJKA 5BOJA 2XTJC 1ZHLB 8XIMA 3NM1A 1S7UA 3BPCB 4NAFA 4W9JC 4WKHA 2NY2C 1A7RL 2B8OT 4WU5A 3TBSA 5C09A 3GR8A 3BAKA 3PHQB 2RCSH 1PU0A 2OKTA 2VL5A 4ZSOB 3MBED 1U6AL 5E00B 3QOKA 2ADJA 5B3SB 3MPCA 5GGRY 4HBKA 2FT7A 3OLGA 5HOSA 3MGTB 3QUHA 3LKSB 1T83C 1XF3A 2FLMA 4NQSB 2DQUL 4WUIA 1ES0B 2I60H 3GI8L 3JWOC 4I2XA 4JO2H 4EZLA 5D7SH 2E4TA 1ZS8B 3I84A 5LNSA 3QPEA 3CFNA 2KH2B 2IOIA 1DQDH 2R0KL 4Y16B 4DELA 2NUTB 4LGSB 5TPWL 3X11A 4PREA 5F3HA 3L4XA 4G9FA 1KCUH 3BL3A 1T5KA 1LO5A 1R75A 3IJ8A 5C9XA 3GLEA 1ET5A 3S42A 4MMZA 2HRWA 5C0GA 2HPMA 2BXYA 2WB5A 3N3TA 1BQ5A 4WSGA 1V5XA 1TG8A 1MREH 3L3JB 3T09A 1FVCB 1B3VA 2OQHA 5IDZA 2QV4A 2XN9E 1VKXB 4M51A 1B9ZA 3A12A 4NQTA 4HIEB 1DBTA 1G7LB 4AIEA 1BFOA 3M1OA 4JDYA 2J27A 1REIA 2G5UA 2O5ZL 4XMXA 5T33L 5DS1A 4UTAA 3ISRA 1J8HE 5JPMA 5E6IA 1EJXC 1KCKA 1FVPA 3I6RA 4H20H 3GFXA 2C14A 3S4SG 1RK1A 2EZ0D 4E41E 3AM8A 3W07A 2LW3A 3SYQA 4MWAC 2P5PA 3TSBA 4KKNA 3BOXA 4AG0A 5FHAL 3DXAE 5JPNC 3D69A 3VGEA 4OLZH 4TVCA 1WBZB 2WKLA 4FQ1L 4M1GL 2O72A 4TLUA 3GSNB 4ENLA 4LOFA 5ACZA 3SRKA 3NO5A 4PJHE 1IQ8A 5JW4N 1XF5B 1G5GA 3BQUC 3JV6A 3BAJA 4TVPL 3CFCH 3UO1L 2FGWH 2X16A