2WVVB

Crystal structure of an alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
450
structure length
446
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAKLYRDALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-L-FUCOSIDASE
publication title Analysis of the Reaction Coordinate of Alpha-L-Fucosidases: A Combined Structural and Quantum Mechanical Approach
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 164
structure length 446
sequence length 450
ec nomenclature
pdb deposition date 2009-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2wvvB02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wvvB01
4PCTA 1E1FA 4PUDA 3ALFA 3FW6A 4WK9A 2WK2A 4PMOA 3K4DA 3LRKA 1OIFA 3W38A 5JIPA 1XGZA 1SR0A 1TZ7A 3A6OA 1WZLA 3L4XA 1WCGA 3RJXA 1BLIA 1IZKA 3AZRA 3NSMA 4PSRA 4L4OA 5M3WA 2CESA 4MB5A 9CGTA 1TQTA 1E55A 1PAMA 3D4ZA 4P7OA 4B9YA 4P8WA 3NSNA 4TXEA 3DX4A 3NDYA 3A23A 1QNSA 4MB4A 2GVYA 4W7UA 2O9TA 3BLKA 1K9TA 4CU7A 2GK1B 1GQJA 3IAQA 2JF6A 3A21A 1VEMA 2F18A 4OIFA 1CLXA 1B3YA 1HWWA 2AOSA 5F7UA 3W28A 3FNDA 3EJRA 4QFUA 3HZ3A 4UOQA 1G0CA 2E8ZA 1VFOA 3LRMA 2XM2A 4YHEA 1TVNA 2J75A 3HG4A 1TVPA 2HISA 4PMUA 2FH8A 5HXMA 1PJ9A 3SCSA 4H8VA 2A3AA 3BVWA 3JUGA 2QV4A 2VURA 1WDPA 2CBUA 1QNQA 3WEZA 1E4LA 3VIHA 4F8XA 1YQ2A 4HA3A 1UZ4A 1VBRA 3NSXA 1NQ6A 4P7NA 5A1AA 3VX0A 4UOZA 1VBUA 2WLZA 4V2XA 2G3JA 4HPGA 2ALWA 4NRRA 4KRTA 5I5RA 2XVNA 2GUYA 1E4IA 4FNQA 3EDEA 2OSYA 2F7RA 1JXJA 3KZSA 3GXPA 5D8ZA 3BLBA 4HU8A 1UWTA 4ACYA 1AQHA 4ZE4A 1DWJM 2RGMA 4M56A 4PMZA 1BG4A 1HTYA 1J0JA 1JL8A 1SFSA 1SMDA 1DWHM 2XN0A 4U33A 1TA3A 2YA0A 5DFAA 1ISZA 3QR3A 1R85A 4MNLA 1B3XA 4A3HA 3SCRA 3VDHA 5E6ZA 1UD3A 1VIWA 3POHA 4UQDA 1D2KA 2Z1SA 4U3AA 4MNJA 1UR1A 1V3KA 1I1WA 3VD7A 4HZ6A 2J7FA 1V0LA 1CTNA 4D1JA 4M8UA 4DM2A 1ITXA 5A2AA 3ARRA 3WUFA 2G4FA 1KXQA 4W5ZA 1BQCA 3WH5A 1V3JA 3TP4A 2ZOXA 3SIMA 1B31A 2QMJA 1GHRA 4UQBA 3WL0A 4X9YA 4M81A 2CETA 4LGXA 5EFFA 4B3KA 5BROA 4Z2JA 2CBJA 2EAEA 1H2JA 2XPKA 4A3YA 3L4UA 1W1TA 5I77A 2W92A 1KQZA 2YDRA 1U2YA 3SEPA 5IFPA 3K8KA 3QHMA 4CD6A 1MW0A 3SCWA 2J8GA 5LA2A 2WVSA 1C92A 1F4HA 1K9FA 1MW2A 1KR1A 3VILA 1HXJA 1FH8A 2XJ7A 3TTQA 4GINA 3AQUA 2FH6A 1VEPA 4FF5A 4ZXOA 1WDQA 1FH7A 2WCSA 4EANA 3VDAA 1C8YA 1CWYA 2E0PA 2ZXAA 3AISA 1C7TA 2Y4SA 4JKMA 3M6DA 3WENA 3VOCA 2ZIDA 4XB3A 1G9HA 4UZSA 3WMSA 3AZTA 1MYRA 3VM7A 1QBBA 1PIFA 1UUQA 2NT1A 3BVVA 3AXHA 1WP6A 4YN5A 4FLSA 1ITCA 3DX2A 2D73A 1OGSA 1DWGM 4AEFA 1J0YA 3BXWA 2VRKA 5D9NA 1W3KA 3BVTA 2IXVA 1CGXA 1CGWA 4LXFA 3D5HA 3ARZA 1XYFA 2XGBA 1H4PA 4TVUA 2PWHA 1DTUA 4J3VA 3D50A 4UQEA 2X1IA 2ZXQA 3IGUA 4H8HA 1EO5A 2BY1A 2DH3A 4D6EA 3AXXA 2WHLA 3WDRA 3AIBA 3AHYA 4UR9A 3TOPA 1WZAA 2EADA 1NP0A 4GQRA 3CO4A 1OGBA 3UESA 1MWOA 3WMBA 2V3DA 1JDCA 3WY4A 4CD5A 3W25A 1V3LA 1MVYA 5D9MA 1IV8A 4J27A 3UETA 5AC5A 3DHPA 1KGWA 3B9DA 1QI4A 2EJ1A 3VGHA 1QHOA 1H41A 4CGTA 2ZUNA 1A3HA 3VX1A 3WF4A 5DMYA 3WEMA 2J74A 4PUEA 4QDMA 3BUDA 1R7AA 2VZOA 1H0GA 5HPOA 5BCAA 1B90A 1W1VA 3WUEA 1JFXA 2WSKA 2DQXA 2VQUA 4PMVA 2VL4A 4U5IA 1FP9A 1Q6FA 2YFNA 1JGIA 1H49A 2ZX9A 1W2VA 4Z2HA 1H1NA 5CQ1A 1J0IA 1GZJA 1TFVA 3A5VA 4AEEA 5FD0A 3TTSA 1Q6CA 4R5EA 2VVSA 1ISXA 3THDA 1KGUA 1GVYA 2NSXA 3BH4A 4ZEPA 4P8XA 2GDUA 3HN3A 4PMDA 1JYNA 1Q6DA 5BRPA 3M46A 5A8NA 5A6JA 2IXUA 4NXSA 4JKKA 1JAKA 2VR4A 1OIMA 3W24A 2PBGA 4TX8A 4HMEA 3VGEA 1PBGA 4CN1A 5E09A 4HA4A 1ZJAA 3CLWA 5A6SA 3BAXA 4LYPA 3ZIZA 3SUTA 3WNKA 2UY5A 3TV8A 3IAPA 3MUY1 3ZM8A 1UR9A 2XYLA 4W85A 1LG1A 3VDCA 3ZSTA 5EFDA 3WD0A 3AHTA 5IDIA 4WKFA 4MAZA 4JFWA 5E6YA 1W32A 2X2YA 4AMXA 3OB8A 4W7WA 3EMZA 3WDPP 1MFUA 5A8PA 4HMDA 1V0KA 3N15A 1E4MM 3WDJA 1EOKA 1UWIA 3VIFA 4LYRA 1HJXA 2VOTA 4W88A 3ZT6A 4CCCA 5BXRA 4PEEA 2WBGA 5IFTA 3AI0A 4OUEA 3N13A 1EGZA 2ZXDA 3ZT5A 4LYQA 4GQQA 2CIPA 5CPTA 4UZUA 3VIIA 2XFRA 1XSKA 1LJYA 5DT5A 5IXEA 4B3LA 3K4AA 1NWRA 4AZ7A 3VPLA 3WN6A 7TAAA 1CXHA 3BUQA 1D3CA 1R34A 3ZR5A 5DT7A 1ISVA 5C8BB 1V0NA 4LX4A 1E6QM 2MANA 3WH6A 4IUGA 2OYKA 3T0BA 1WZKA 4WF7A 3WUBA 1VEOA 4TUFA 1EDTA 1DWIM 2Y24A 1GW1A 1AMYA 2VZUA 4LPCA 3PTMA 4ZFMA 4U31A 2JFEX 4AZGA 1TQSA 1G1YA 3AS0A 3HJEA 3AROA 3A47A 3MU7A 2EXOA 1HKJA 2WNWA 1OWQA 3CUFA 1P6WA 2GK1A 4PSPA 2A3HA 4QLJA 2OLHA 2XSBA 4BF7A 2BV9A 2ZX5A 2BY0A 4CN6A 1OINA 3SCUA 5BXPA 3CHEA 5I3DA 4FNTA 1EDGA 2VMFA 1OSEA 5A8QA 2EACA 1NM9A 4CCEA 4OBSA 4GXPA 3U7BA 2G3MA 2B31A 1FP8A 3AYSA 3VMOA 4IISA 2WMFA 3H53A 3CZ8A 1GHSA 1V6YA 1C3FA 1JZ8A 4QP0A 3AYRA 3GH7A 3HG3A 3N1AA 3PZIA 4FK9A 3WD3A 3CBWA 4Z2IA 3TTYA 1X6LA 1E5NA 7CGTA 3GH4A 3LPGA 2YL9A 1WE5A 4H41A 1VAHA 4ZE5A 2W63A 4DWSC 1EQCA 1R87A 3EJUA 3WH9A 1JD9A 2XN2A 1GORA 3VNYA 3WQWA 5A6BA 1UKOA 2WVVA 2DT0A 3PZOA 2TAAA 2WW5A 3NIYA 1CXEA 2XFYA 4UNIA 2XWEA 4GKLA 2EO7A 3RDKA 1R75A 4PN2A 6A3HA 1UR8A 5ABHA 2OSXA 2CCRA 3WDQA 1QW9A 1PEZA 1W3JA 2DT3A 4CVUA 1HJVA 3ZSSA 1FOBA 1HT6A 2ZX8A 1M03A 3GZAA 4JL1A 2J4GA 3EMCA 1GJUA 2OWXA 4CCDA 3HMCA 3L4ZA 1V6WA 1VRXA 3MO4A 2X0HA 4OGZA 5KEZA 3CUGA 4MDOA 2ZICA 1O6IA 1CGTA 2DSZA 2J77A 4GI8A 2XFFA 3ARPA 5E0FA 2YLLA 3IJ7A 1W9XA 1VFUA 4EE9A 2ZWYA 2JEQA 3FHQA 2DSKA 1O7AA 3OLDA 1E6ZA 1US3A 2OSWA 3CUJA 5CSYA 5ABEA 3K8LA 2EPMX 2GJXB 2DSWA 1UOKA 2VX4A 3PHAA 1BYDA 3THCA 2F1AA 4AZCA 2PWDA 5M17A 3VD9A 1T0OA 4WSJA 1V08A 1BFNA 1SYTA 4U3CA 3VSUA 3D52A 2DSVA 4ACZB 1GUVA 2NT0A 2YBTA 1JXKA 1HJUA 4UFJA 1AVAA 1E70M 3AIVA 1QNOA 1QNRA 2VRJA 3IJ8A 1GOKA 2JALA 4MNKA 2WM0A 2QLYA 2YA1A 3UG5A 1C8XA 3BUBA 3RO8A 1QNPA 3GNOA 3A4AA 1HIZA 4D6DA 4J28A 4UFIA 3WF2A 3ZJ7A 2CPUA 1BHGA 2C8NA 2OYLA 6CGTA 2VI0A 1JZ5A 4NX0A 1TCMA 5GNXA 5CPQA 1XYZA 1Q6GA 2XIIA 3A24A 1PX3A 4MJ4A 3W6MA 3WFZA 1FHDA 3WD4A 2DT2A 3LXCA 1HP4A 1NWUA 4OOZA 4OZOA 3RIKA 4M80A 3VM5A 5LA1A 3AIQA 1CGVA 1XH2A 4HU0A 2Y5EA 2V3FA 3SCOA 2WC3A 1QHZA 4BQ3A 5FCZA 1MQRA 3T2PA 4HP5A 1OCQA 3T2QA 1UR0A 2XVPA 5DO8A 3WF3A 2XGIA 2EPNA 1E3ZA 3LXBA 2AAAA 1ODZA 3AIEA 1EDQA 1UD6A 2D20A 3MMWA 1FH9A 2VCAA 4P7QA 1OB0A 4W8AA 4W7VA 4DWSB 3MANA 3B9AA 1UD4A 2XTKA 1B0IA 1CECA 4BCEA 1W3HA 4W84A 2WVVB 3NDZA 3U5YA 5AC4A 1D7FA 1HJSA 2XUCA 3CIVA 4D6GA 4N42A 3DDFA 2YL5A 3VMPA 3AS3A 4IPLA 4M82A 2PBOA 5FIPA 3PZMA 2CBVA 3F4VA 1WNOA 3WF1A 3OA5A 3H54A 4UQAA 2FDMA 3VGBA 3VIOA 3LPOA 5GNYA 4W8LA 5LA0A 1H3GA 3GNPA 1J12A 2PC8A 4PCSA 5C71A 3I3BA 3CHFA 2XSAA 5EB8A 1GNXA 2OWCA 1JNEA 5D4YA 3W26A 2WAGA 3QOMA 3LX9A 3LXAA 3WNNA 1NARA 3ZT7A 3MMDA 3A22A 5ABGA 1JZ3A 3AS2A 4K68A 4WKHA 4Q7NA 1HF6A 3SUUA 3QHNA 2VX6A 2YL8A 1EOMA 1WO2A 1J10A 2D1ZA 3MMUA 1Z32X 3O6AA 5HNNA 3EJSA 5CPSA 4DUWA 2J62A 3VD5A 4H2CA 2BFGA 3W27A 1JF5A 5HBFA 1VB9A 1WZMA 2OWWA 2A3EA 4JFSA 3WNLA 5CXPA 4AZCB 2Y8VA 1DWFM 3EBVA 1WDRA 3MS8A 2F7OA 3OGSA 1J9YA 3M7SA 4PTWA 4BQ2A 1HJWA 3LMYA 4BA0A 3ARYA 1U33A 1HKMA 1CIUA 1B9ZA 3U7VA 4P7LA 1HL8A 4U2YA 2IUZA 1W9UA 3GYCA 3CV5A 1WAWA 1XC6A 4PMXA 4AD4A 2DH2A 2WHJA 3O9NA 2A3BA 3A4XA 3WFLA 5I2UA 2WMKA 3W53A 5A94A 1HVQA 2VX7A 1XSIA 2VQTA 4UTFA 4KRUA 1FFRA 3ECQA 1JYVA 2YIHA 2VZTA 3SCNA 1HKIA 4UQCA 5I78A 1QWNA 5CLTA 1B3VA 1JZ4A 4AMWA 3D3AA 1E3XA 1GCYA 1LL4A 2BNJA 3DHUA 5E9AA 4Q22A 7A3HA 1HXKA 1ZS2A 2VVNA 1M7XA 1UWQA 1JDDA 2FYVA 2J78A 3DYPA 2CYGA 3D4YA 2WZEA 1BSIA 3AJ7A 1C90A 2BVYA 5JIWA 1W1PA 1QI3A 3KEHA 2J7CA 4PMYA 4DO6A 2WVUA 2QHAA 2D0GA 3OLIA 4GPNA 3SCTA 4JIEA 1QI5A 2BHYA 2G8ZA 1BVZA 2WC4A 2W67A 1SZNA 5BWFA 1J11A 3WBAA 3BGAA 3GXFA 4QAWA 1W91A 2EPKX 3BSHA 5I0DA 3BUIA 1N82A 3CC1A 2FGLA 5CGMA 2J25A 1UQYA 1RD6A 4AW7A 4D6JA 3MSGA 3SCPA 1CNVA 1EHNA 2J8FA 4JHOA 3F5LA 3BVUA 4IPNB 2W5FA 2IGTA 2PWFA 2X09A 1K6AA 4AY1A 1V3IA 3AOFA 2BY3A 2J47A 1TMQA 3WSUA 2J7DA 1ISWA 3CH9A 1BYBA 4NZCA 2DEPA 1PZ2A 2CITA 5BXSA 1B1YA 1I1XA 3AMCA 4E8CA 2WKLA 1PX8A 3PBGA 3BCDA 4MTVA 2BS9A 5LYRA 1EIBA 3WY1A 2PF0A 3L4YA 1BVNP 2E9BA 1UYQA 5I79A 3WBEA 2F8QA 2YJQA 4UFMA 2CNCA 2J79A 4OBRA 1E71M 3AHZA 3PZVA 3ZO9A 4JHZA 4S3KA 3ARTA 4PMNA 1A47A 4D6IA 2AMGA 3BSGA 1W1YA 3DX3A 5JBEA 3BAYA 3W29A 4QCEA 4TVDA 1EO7A 2BVTA 5A2BA 2X05A 4E4PA 4PMRA 3DYMA 4AD1A 4AWEA 4JAWA 3GXNA 1ZBKA 4EK7A 3WNPA 3VO0A 4WIWA 1JF6A 2F7PA 2VCCA 4X0NA 3GXIA 3KLLA 2CBIA 1HL9A 3VDBA 4UQ9A 4KGJA 3ZMRA 1VENA 5BRQA 2JIWA 1R8LA 1MW1A 1CXLA 4XX6A 5A6MA 2JF7A 1QVBA 1QWUA 3IANA 1E9LA 3BAIA 1ISYA 4P8UA 1GOOA 1J01A 1FA2A 3BC9A 2BVDA 4QCFA 3T08A 2GJXA 4CVWA 2O92A 1EA9C 3VGGA 3WD1A 3FHAA 1C7SA 4OKDA 1XD1A 4QLKA 1QW8A 1J18A 2VUYA 3WY3A 1US2A 2D24A 1OGGA 4ACZA 3G6LA 3VSTA 2UY4A 1HP5A 4W87A 3VTRA 1JFHA 2WB5A 4XUYA 3KLKA 1QOXA 4URIA 2Y2WA 4J3XA 2ZUVA 1CXKA 2VR5A 1GOWA 2BHZA 1IT0A 3I3EA 3AICA 2E9LA 2NW0A 3VNZA 3CZGA 3KE0A 1VFFA 4GO9A 4KMQA 5AYIA 4GI6A 3VUPA 1LQ0A 2XVGA 1EQPA 3UEQA 1V3HA 1V02A 1JYXA 1RP8A 1IZJA 1W3LA 1TQUA 1UH3A 4V27A 2VNCA 4NSBA 3TONA 3AXIA 3WNOA 2W61A 4FNSA 3IJ9A 3ZOAA 4CUCA 3F5KA 1HJQA 4PTXA 2PB1A 2RGLA 3A4WA 4TTUA 2EBNA 4AIUA 1W9PA 4HA1A 4L4PA 3MUAA 4N0RA 3RCNA 1C91A 4J3WA 1FHLA 2QPSA 4BZYA 5A8MA 4TTGA 4M24A 3DDGA 2YKKA 1XSJA 4AYSA 1MQPA 1BGGA 3CTTA 1CEOA 3VKKA 1UKQA 2Z1KA 3MV11 1GQLA 3GXMA 2ZX6A 4DWSA 4TOQA 1ECEA 1KWGA 1V6XA 5A95A 3FAXA 3NJ3A 4CU6A 2E8YA 1NOFA 2VTFA 4AZIA 1KGXA 1KCKA 4W89A 4AIEA 3RJYA 2D2OA 2CKRA 2WHKA 4V28A 1NH6A 1GVIA 2WXDM 3DX0A 4LQ1A 3F5JA 2WWDA 4J3SA 1KXTA 3CZSA 3ARXA 3POCA 1HN1A 5A3HA 5GPRA 1J0HA 2W91A 3VIKA 3VSVA 3CHDA 4R27A 3AFBA 3L4TA 4AZHA 3KWXA 4FNRA 2VX5A 2FHBA 2D0FA 5E0CA 4AD5A 5D9PA 2ZUUA 4NZJA 2F1BA 3WH7A 2V3EA 4AD3A 2WKGA 3RM8A 3LPPA 3EMQA 4W5UA 1XRVA 8A3HA 2G41A 4AZ6A 4JFTA 3AS1A 4UFHA 3EJPA 3ARQA 1WKYA 2XVLA 1E6NA 4NRSA 2A3CA 2JE8A 4AXNA 2ZE0A 4HMCA 3OG2A 1JYWA 1LWJA 2C0HA 1UH4A 3VIGA 1Q4NX 4TX6A 4MNMA 4MPKA 1DEDA 1ZBWA 1PIGA 4IM4A 3VVGA 1JI2A 3AZSA 3ARUA 3L2LA 4BS0A 5JBDA 2WC7A 2O9PA 2BXYA 1UQZA 2VC9A 4WJXA 1Y7VA 4EAMA 1HKKA 1JZ6A 3BLPX 4WLCA 4HOXA 1GJWA 1V02E 3WQ8A 2O9OA 3AIUA 3EYPA 3FAWA 3OGVA 1UR2A 3MKKA 4BQ5A 3N11A 4OOUA 4ATWA 1GONA 2XWDA 1FFQA 3G6MA 2VCBA 4M29A 1UH2A 3PZNA 3HG5A 3VD4A 2FGZA 4CU8A 3WDIA 3BVXA 1S46A 1E0VA 5IHRA 3OGRA 3VMNA 4D72A 5BXTA 5CG0A 4M1RA 1E15A 4FLRA 3HG2A 4CD4A 3GXTA 2X2HA 4FMVA 1OBAA 1AQMA 4X0VA 1JIBA 4U5KA 2YFOA 4UOJA 2WCGA 2OW6A 3OLGA 4D6CA 4AYGA 5FOOA 2GJRA 1L0PA 1MXGA 1UA7A 1C93A 3CZLA 3WQ6A 1KXVA 2V5DA 2OYMA 3EDFA 2JIEA 3UR8A 4ATDA 3OZOA 1CLVA 1TQWA 4FNPA 5C70A 2EPOA 4U2ZA 1KTCA 4MB1A 1DHKA 1V6VA 4J3UA 2GJPA 5I24A 1E6XM 2ZUMA 4Z2GA 3CMGA 3MUZ1 5GQBA 1LL7A 3CZEA 3L4VA 1UZ1A 3WUGA 1CENA 3CPUA 3GXDA 1RH9A 3CHCA 1NOUA 2ZUWA 1B3ZA 4PYSA 4DUVA 4GZEA 1NWSA 4DO5A 3MSDA 1B3WA 4PTVA 1XHGA 2VT0A 4DUXA 1HX0A 3RPMA 3KL5A 3SUSA 1DP0A 2VJXA 3N17A 3SUWA 2V5CA 1BAGA 2YA2A 3GBEA 1H11A 4D6FA 3VD3A 3QOKA 2WWCA 3GBDA 3NCOA 4YPJA 1HNYA 1XH1A 2F7QA 2J7BA 4RE4A 3M07A 2WSPA 3SCQA 2EABA 2UWFA 1ZBVA 1XD0A 1UD2A 3W0KA 2W4XA 3A3HA 2F2HA 1QBAA 2D0HA 5FL0A 1TUXA 2XIBA 1JZ2A 2QMKA 2X2IA 5KZ6A 1E0XA 5AYBA 1TE1A 3GH5A 4BQ4A 3PTKA 1PZ3A 1AQ0A 3N04A 1OD0A 1V3MA 3AMKA 3FN9A 3MI6A 2CXGA 2QF8A 1LWHA 3CZNA 5CZKA 3AMDA 3AMLA 2YDSA 2OW7A 3BMVA 3RMEA 3KL0A 4PTMA 4FLQA 3VINA 3WQ5A 4KGLA 1TG7A 1WDSA 3DECA 1UKTA 3PZQA 3ZJ8A 4NI3A 3PZTA 1BGAA 5CSUA 2E9MA 1CZ1A 2CHNA 4MB3A 5HDRA 1F4AA 8CGTA 2Q8XA 4CN4A 4AD0A 4JCMA 1V0MA 4J3TA 3PN8A 1QHPA 1H0IA 1KR0A 1M04A 3E1F1 1TQVA 3N12A 3MUIA 1E6PA 1R47A 2WZIA 4E2OA 5FKYA 3B8SA 2DIJA 4W8BA 1OM0A 5M03A 4CD8A 1I75A 4Z2LA 3U57A 4F66A 5CGTA 1H5VA 1BYAA 1M01A 2PWGA 3ARWA 1JDAA 3IK2A 1E4NA 1PX4A 4E8DA 1E72M 1BF2A 2DT1A 4AISA 3GNRA 3RM4A 1W2PA 3FXYA 3J7HA 2V3GA 1GQKA 2UY3A 3PZGA 3SUVA 3T2OA 1UASA 3BAJA 4D1IA 3OLEA 2BXZA 1OT2A 4W93A 4D6HA 3W82A 2X2JA 3WEOA 2WMJA 3K46A 2YDQA 1OT1A 2XM1A 1PS3A 4C7FA 2E40A 4P8VA 3LRLA 1LF1A 4Y7EA 3ZR6A 3CUIA 4GZJA 2J7HA 1H09A 3AIRA 4AIOA 4DM1A 3WDHA 1EHAA 2WANA 1E43A 2CERA 2DIEA 4HOZA 3OZPA 5D9OA 4AC1X 5EBAA 2YLAA 4AZBA 3T09A 3W4RA 1XH0A 1UD5A 3WH8A 3UG3A 3BUPA 4RE2A 1G94A 1G5AA 2PWEA 1E56A 2E4TA 1UHVA 1LLOA 3EDKA 1ODUA 4B15A 4S3JA 1E40A 3SCVA 1R33A 1CGYA 2F61A 4H8UA 3II1A 3VGFA 1BPLB 3RILA 1J0KA 1ZU8A 3CZJA 5ABFA 5DEZA 1JG9A 2XN1A 4PMQA 4UFLA 3AIWA 5A6LA 2ZUTA 3VIJA 2XG9A 4CKQA 1XCWA 4AD2A 1E73M 1ZL1A 1GOQA 5I6SA 3WELA 2CHOA 5I23A 6TAAA 1WB0A 3HU7A 4AZ5A 2VZVA 2QPUA 1E6SM 3W6LA 2GFTA 3QGVA 1CDGA 3CMJA 4P7RA 2GDVA 1JZ7A 4WKAA 3S6TA 3WY2A 2ZXBA 2WMIA 4RE3A 3BAKA 1B30A 1QPKA 4RL3A 2HVMA 1R7OA 1TA3B 3K8MA 2WMGA 1GOIA 1KFWA 3VGDA 4ZXLA 4J7RA 5A69A 1CYGA 1E6RA 3WNMA 2D23A 1E5JA 3O2LA 4F9JA 5E1QA 5E70A 2YL6A 4W86A 4ATLA 4B16A 1BTCA 4EKJA 5EMYA 4QLLA 1E1EA 2VRQA 5JBFA 2G3IA 2WHMA 3S5ZA 1M53A 2EQDA 4MAVA 2WPGA 3BAWA 4DO4A 2J7EA 1JD7A 1G01A 5ECUA 3WD2A 3T0DA 1EXPA 1PPIA 1X6NA 4MADA 4C7GA 1MXDA 1CPUA 4FLOA 3WKZA 4XZBA 4GI9A 2DDXA 3W81A 1OD8A 1UD8A 4D71A 1VFMA 1X1NA 1XCXA 1CBGA 2XHYA 3WQ4A 3WQVA 4XZWA 4UCFA 1ZJBA 3SURA 1KXHA 2WYSA 2CEQA 4H04A 2WVTA 1MW3A 5A8OA 3VIMA 1O7DC 5IHSA 3BMWA 4OJYA 2JEPA 2D3LA 1NOWA 5BYWA 4HZ8A 1JNDA 3W37A 3EDJA 3OIHA 2E3ZA 3TTOA 4GO8A 1QX1A 2J7GA 3ALGA 1K9EA 3NUKA 3QHOA 3K1DA 2ZUSA 1UWUA 1UWSA 4JZ5A 4JL2A 2DPEA 2EPLX 5HOSA 1LG2A 3WL1A 1MFVA 2XVKA 4ML4A 2G3NA 3UR7A 5CJ5A 3L2MA 1ESWA 2W66A 1MQQA 3EJQA 1CXFA 2PI6A 3ARSA 3GDBA 1EH9A 1QI2A 5A6KA 1NWTA 3BCFA 4NZFA 3LPFA 3WF0A 5HPCA 3DYOA 1U30A 5TD4A 4GZIA 3T0AA 5ABFB 2CKSA 3WMCA 3VU2A 1YHTA 2Y8KA 4AMCA 1UKSA 4JCLA 1L8NA 1VF8A 1KBBA 4JFUA 1E0WA 2FHCA 2VO5A 3GTNA 4XV0A 1XV8A 1W9DM 1VJZA 5FL1A 2C7FA 1Q6EA 2BY2A 3U5UA 4A4AA 5M5DA 1B2YA 4MJ2A 1RP9A 2DGAA 1KBKA 1V03A 1RPKA 1LL6A 2WMIB 1HVXA 3D51A 3UG4A 3B9EA 5D8WA 3ZJ6A 5JUVA 1UWRA 1UR4A 2YOCA 2WZHA 4YHGA 1CXIA 3EDDA 1R86A 4HZ7A 5AY7A 2GSJA 1ZBCA 3WIJA 4Z2KA 2EEXA 3ARVA 3TA9A 5DF0A 1QI0A 2DSUA 4F9DA 3AHVA 3H55A 3EJTA 1ZB5A 2FHFA 2V38A 3PTQA 5A2CA 1GQIA 2D3NA 3NYDA 3RM9A 1W9BM 4WSKA 2WMHA 4PBGA 1R46A 4F79A 1BYCA 4B9ZA 3GM8A 2O9RA 1WPCA 2W62A 1W9VA 1SMAA 4NXKA 2UY2A 3FY1A 1KWKA 4ZENA 1KTBA 3UCQA 3MV01 1GOMA 3N18A 2VZSA 2D22A 1J0ZA 3AMGA 4JKLA 1TR1A 3S2CA 3UERA 1UA3A 3I3DA 2BHUA 1UG6A 3N9KA 1BG9A 2X0YA 3DX1A 3PZ9A 2ZWZA 1CGUA 4CD7A 5CLWA 4KH2A 1NP2A 2WLYA 2YBUA 4C7DA 1K9DA 3CUHA 1V6UA 2ESCA 4HTYA 4KWUA 3KL3A 3DC0A 3L4WA 1VJSA 3PZUA 4HPHA 3ZQ9A 4DWSD 4PRWA 3S5YA 4FNUA 4HOWA 3ZJKA 4JFVA 1KB3A 1GPFA 3CGTA 1UKPA 4H7VA 1KCLA 1JI1A 3VIPA 5A6BD 3AHXA 3OBAA 4UFKA 4NF7A 4TVCA 1DWAM 5A6AA 2X8RA 4GIAA 3CZKA 4MDPA 3APGA 2WCAA 1C8QA 2FE0A 2ZX7A 2WBKA 1KQYA 1JAEA 5GNZA
chains in the Genus database with same CATH superfamily
4MNHA 2BZ7A 2OMVB 2PTXA 3O3AB 1NF7A 4BKNA 3EUDA 1MJ8L 2FX7H 4QRQA 4LLYB 5HYSG 2FL5B 3UZJA 2BODX 1ESOA 3OVQA 4EN3A 1J9QA 4Q8PA 3A23A 2GVYA 2O9TA 5JA8B 1QFHA 5B1BB 3FUIA 2WBJD 1KNWA 3P3YA 1OIOA 2BZNA 3W71A 4FI8A 4H3DA 3HZ3A 1RUKH 3PQYB 4PJDE 5E2VL 3N42F 3I6TA 3VTMA 5CAHA 1U93A 3VG9B 5CD5C 3PHSA 3PDDA 1OP5H 1EZLA 1ML1A 4G9FA 2G3JA 1X5XA 5FV1L 1NMAH 2GUYA 2F7RA 3KCJA 2NTFA 3TBCA 2Y7DA 1E9ZB 2PKDA 3MA7A 3L48A 2WO2B 5IGXL 3MBWA 2RGMA 1LL1A 2EDXA 1I1CA 3LNIA 4NCC2 4RPPA 3IDXH 2PD9A 1ISZA 3PWPD 5DK2B 3MRFB 1PB0A 3VDHA 2J8OA 2VDLH 4NUQA 5CKAA 1EA0A 3UT0A 3RITA 5LAXB 4RRPA 5GJTL 4I9JA 4UMCA 3NTCL 4JFFD 4PB3A 3QWOB 4JRYA 3O6LL 1T1WB 3K2UL 2CETA 5G5IA 2P47B 1RY8A 1EO8H 3P5YA 1H2JA 4JPWH 5CCHE 5I77A 4GUQA 1Y65A 5LGZA 4UNLA 5IFPA 5LA2A 1P0EA 5D2NA 4JMNA 4S3BA 1KR1A 3QK0A 2QUVA 1HXJA 4G8EB 1QO3B 2WXOA 4UANA 1FL5B 4OCXH 4ZMNA 3IFOA 3DFTA 1X8FA 2W27A 1G4EA 1MYRA 1N18A 2ISFA 3NN8A 2GFBA 3RIAK 5H8DA 3PUDA 2EEFA 4HBQA 3O9WD 3LNPA 3PHOA 1GS6X 2H32A 2EEDA 3PC0A 2J1KA 2PRHA 5K3VA 2AABL 4M5ZL 2RR3A 3NDZE 4UT6A 4G7RB 5LCVA 4Y6GA 5SWZA 3I6RA 1EQWA 2WHLA 2HJLB 3AY4A 3VI4B 4LTSA 5J9PA 3Q3GA 4UR9A 3ARGB 3HUJE 1ZHNB 43C9A 3Q06A 1PTZA 3WLSA 1R2RA 2H8PB 5F2GA 1H7OA 1R5WB 2YSWA 4JW3A 1NTHA 4AY8A 4PJEE 4TQTA 5D6DC 4FYSA 1FKWA 1BZ9A 1KT2A 1XR2A 3RWFA 2X28A 2IPTH 2ZOWA 2VZOA 3BZDA 3CZFA 1H0GA 4N9DA 4UR8A 1IM9B 1H5BC 1D3HA 4LLUA 3OMAB 4FXGA 1TZGL 5XINA 2JK2A 4JDTH 1FDJA 5H6HA 4GJIA 1NLDL 2NUXA 4KJWD 7REQB 2WZ6A 2NSXA 4M7KH 4XMZA 5BRPA 2PDJA 5A8NA 4S11A 2R1YB 5KYUB 3A3XA 3AG2B 4GIRA 1SDYA 4GNVA 5ALCH 2UY5A 4N5EC 3ZE2F 3CVHA 3ZM8A 1GL4B 4X6CF 3ZSTA 4E6MA 3VACA 2WNNA 3H3PL 3PPEA 1GY2A 5FO8A 3B03A 3GIPA 5E6YA 4QX4A 1TETH 4AMXA 1TJ2A 3ZE1F 4HMDA 4G82A 4PRIB 4HYVA 3VIFA 5IOPB 4K3ZA 1E5UI 4TRPH 4UMAA 4OUEA 3IUDA 1BVKB 2HRGA 3B56A 4WUUE 1LBMA 1ZQ5A 1IGCL 1FAIH 2EINB 3SSJA 4OFYD 2R0WL 4J2MA 4Q6YA 1GTHA 5DT5A 1I3GL 3O15A 2DLTA 5LIUX 4IIQB 1EZWA 5BOPA 1JGLH 4F92B 3ZR5A 4NO0B 3OAZH 3QORC 1T6BX 4CRPA 1WZKA 2CIKA 5ID0B 1VEOA 1NIEA 4UWQB 4YHKL 2DS4A 3BURA 1XMWA 4PJIB 1T66C 3MU7A 1MCWM 1HXMA 3NJVA 2A3HA 1IVLA 1E4WL 3VQ2C 4BSWA 3UD6A 3MLYH 1S3HA 1SVZA 1XDJA 4CCEA 2YRBA 1E8WA 3HS0B 2C79A 3EOAA 1SM9A 4UNTA 1MCQA 1C3FA 4R97B 4EF8A 1WBYB 1NDZA 3TTYA 2OMBA 3PFQA 3SW6A 3W9EA 1IEAB 2WOYA 4FFWD 3GKWL 3DBSA 4PTNA 5J6SA 4GP8B 4GRLB 4GXUM 3CX5J 4JFPA 1EFZA 1UR8A 2OX4A 2QAPA 4REQB 2CCRA 5KS9E 1PEZA 4CVUA 3E7JA 2MKWA 3V5DB 2XQYA 2O6EA 1G1KA 3SQOH 5KVGH 1F02I 2DZTA 3KVKA 4NCC1 5KYXB 2ADAA 2Z7ZA 4ADSA 4NPYA 1GR7A 1G7JB 4AKQA 1ZGLM 1PDKA 3VE0B 4BFIB 4ZXBC 3K8LA 3S3PA 1SY6A 5F1UA 3NO5A 4MOZA 1BYDA 4HVBA 2XH0A 5HGAB 4PS7A 3DUGA 2BDNL 1TPB1 3UBXI 5CEZE 3BJSA 3SO5A 5CJQH 4ZMVA 5GRVK 1K5NA 3VFWB 1CFBA 4ZFFB 1GPOL 4AZ8B 2C0AA 2CFFA 1E2WA 3DIPA 5DTFA 3QJZA 1Q0YL 4N2KA 4NX0A 4Z7UB 4J39A 4L9YA 1NDMB 2BX5A 4LASL 4XMPH 4L4MA 3CFBA 4E5TA 1S8DB 1OP3K 2R51A 3SZ6A 4NIYE 3MMWA 1FH9A 4LUJA 3JZ7A 3OHMB 3DKLA 1I9JL 3DO3A 4JQXC 2ZE3A 5F1IB 1MAJA 3WCZA 3M17B 4D6GA 3TWYA 3ISRA 2NY7L 2YL5A 5FOBA 5A8GA 3BXNA 3O1NA 4K8GA 1GZHC 1AS6A 3IUHA 2P10A 3T6WA 3OA5A 2H1PL 4XQ6A 4JY6B 1H3GA 1QNZL 2C3WA 4YJZL 5C0AB 3E0LA 4OFKA 2XSAA 3WQEA 1GYCA 4BI7A 2VB5A 2IQ9L 1KBLA 5SWSD 3DC8A 5ADOH 1G1OA 4ZTOH 4AE0A 1XGUB 6REQB 5T33L 4WKHA 2QGHA 3UNDA 4IBLT 4ZYKB 2PPAA 4B27A 2RA1A 1TKWA 4Y5YB 5FKPA 1IKNA 1M9HA 1Q7MA 3F6IA 4N6FA 1TQJA 1XIBA 3LNMA 5GSRA 5L4FA 3LMYA 5CN3A 1U33A 4DW2L 3IE4A 4IRSC 4A3QA 1WAWA 2AXGB 1PTAA 5C2GA 4DT2A 3A4XA 3WFLA 3W53A 5A94A 2VX7A 2PTZA 1WHPA 4CQBA 1D7KA 4NO5B 2NY0B 3NM3A 1QWNA 2FTYA 4DK3A 1T1XB 3RWHA 2XTSA 3I6SA 2QT6A 2OLAA 2BJML 4ADJA 2YPLE 3DYPA 2QJNA 2A3TA 3MLTA 1R6WA 3EB2A 4XO4A 4WEMB 1K7FA 4WCYH 1Q3NA 3BGJA 5CGBA 4GNJA 1XR9A 4NYUA 2WCPA 2WQAA 4XXCC 1I8IB 4ZAKD 3LD8C 2ILLA 4DJFC 3G6JB 4QRRD 4CNUA 3MOAH 4AW7A 2VN5A 5GGRA 3WE6B 4KI5F 2JJSC 4XISA 2FR4A 1ODAA 2DLFH 4XMKH 3VUAA 4R90L 2F5AL 1ZP4A 1PG7X 4KEMA 2FO4B 4AVJA 2FEDC 4R96B 4OAWB 3BCDA 4ZOAA 1SQ7A 3QCTH 1KCWA 1F56A 2Q8AL 3ZLHA 3A6CL 2X4OA 2Y7FA 4U3HA 3NQCA 4G5ZH 4L4LA 4HJIA 2DPKA 4ZUTB 5HHNB 4CSZA 3BKJL 4F7EB 3T05A 3MV8E 2B08A 3MA8A 2ZOLB 5BZDA 5D2LF 4TVDA 2ZCHL 2ZAGA 5KBNC 3GU2A 5SX4I 3TH2T 2CK0L 1Q65A 3VXSD 3IFPA 1R5VB 3PYCA 4QRPD 1K8CA 1HL9A 3SKNB 4HT3A 1RQHA 3I6GA 1TV2A 1A7OL 3PWJB 3BUVA 3QQWA 1QWUA 2E28A 1OPOA 5HYSB 4NUPA 5HHOA 1CDBA 4JG0H 2AKZA 3ULVL 3NXLA 3STLA 3EJJX 1XD1A 2AJ3B 1L6GA 2XJLA 1IIIA 1RJYA 3QLDA 1Q1JL 4XBGA 4WUKL 2P5EE 3QPXH 1RVFL 1CXKA 2VR5A 3RB5A 3CLEH 5LNWA 1QG3A 2XH2A 3L5XH 3IJSB 3DX7B 1FX6A 5HP5A 4GI6A 3V0EA 1PXGA 4C6PA 3K71B 4MAYA 1QUPA 1JYXA 3UIZA 3P4MB 1TQUA 4WKZB 4OLXH 4TNVF 4X5XB 3QULB 1VA9A 1FUNA 1TDQA 4PTXA 3PCYA 2J56A 4JE0A 1S78D 1I7UB 3TO4B 5FB8B 4NP9A 3N41F 4M24A 4WHCA 3QQ9C 3KOXA 2AEQL 4M8VA 3CTTA 1CEOA 2F2KA 3R1GL 2BW5A 4YVXA 2ZX6A 5I8CB 4TOQA 4S1SL 1E7VA 4A6YB 4IOIA 3IACA 4PJXE 3MV9A 1S5IL 3STZB 3QZBA 3E49A 3H8AA 4FFYL 1KIQA 1JRBA 2YD8A 3L5JA 4YSRA 5A3HA 1HN1A 1TCDA 2D8KA 4R27A 5JHDA 4XVJL 1IB5A 1YEHH 1WFUA 4TVPH 4CL7A 3E2HB 2V7NB 4FYQA 1CI3M 1WDAA 4O52A 3RJOA 2X4TB 4HSCX 4HQQH 5DDHB 3QFJE 4BA8A 3RTLA 3SKOA 3DKHA 5A2LH 2JE8A 4AXNA 2H2PD 4OW6A 1JYWA 5I6XB 4TX6A 4RFNB 5I15H 2ZBTA 4JHVA 4MMXA 2EDDA 1NEUA 2BRQA 5HWNA 3EBGA 2QJDA 1BKSA 2GZXA 4JFXA 3RVTD 7PCYA 2DQJH 3LK6A 1I9CB 4O58H 3KWVA 3QJTB 5MENA 4HUWB 3LJ3A 2IW0A 4LCWD 3KYKH 4DF9A 1ONQA 1E0VA 3BPNB 1X3DA 5EOCH 4Z17A 3EOTL 3CK5A 4YGVA 4JR9H 1NUDA 5C0AD 1OBAA 5AVHA 4HK3N 1CD9B 3NZHL 5BPPA 3UJJH 1VD6A 2I16A 1PG7L 2HJKA 4X7TA 5F0MB 3C75A 4CJ0A 1HC1A 4AF0B 4JM2C 3BP5B 4EACA 5FF7A 2ZOKA 3T4YB 3WO3B 2R2HA 1AGDB 3ZX1A 4WKXA 3PWAA 5I24A 1Z6KA 2ZTJA 2WXLA 4NQCA 5LO7A 5IMOA 3TA3A 4YDVB 3FB7B 1GTFA 5FA5A 2DQFB 3B4UA 2HTLD 3SQSA 3UTZA 3F7YB 3MA9H 4RZKA 3MSDA 1B3WA 4AVHA 1JUKA 2ANUA 2AS5M 1W16A 2OMYA 5I1CH 3T65B 1EB3A 1JS4A 2Q7NA 3N17A 4LUIA 3UZQB 1INDH 1BAGA 2GLKA 4LAZA 4Q7IA 3GBDA 2NY0D 1IXQA 2DY3A 4OB5H 3V4VL 3QF0A 3EO0A 3BD5A 4UM8A 1QBAA 5FL0A 5HJ3B 7XIMA 6PTDA 2PMZA 2ZUQB 4F93B 3BPCB 1X9UA 1SFLA 4CNNA 1TTCA 2PO6B 2HZHA 4K8RH 3HE7D 2NY4B 2HFGL 3EZ8A 3S0PA 5E2TH 1UP0A 5CSUA 4CKVX 1I7ZB 1XL6A 6FABH 4QRSB 3K6NA 3MJ9H 5KYWB 3RWIA 4ETYA 4PGDB 1XI3A 1K4CA 4WY0B 1AC0A 1WD9A 3EAKA 5F21B 1A2YB 4E2OA 2DIJA 3MRBB 5M03A 1Q0XL 3MRMA 1E4XH 2G75B 3ARWA 4G1NA 4E8DA 4UC5A 2XBZA 2DT1A 5KINA 5G2IA 5J1AA 1JUEA 4KFZC 5C7XH 5LQBH 5KBMA 3VXUA 3ARDC 3I85A 5DURB 4D6HA 3GMMA 3AACA 3U9PH 3S37H 3H0TA 5K59F 3V6OA 4XP1H 4AIOA 3IMVA 4J5NA 1MWAH 4HQVA 2OMZB 2DIEA 1S7TB 3UIYA 1KM0A 4ETQA 3T09A 3OGCB 1VPOH 3CNKA 2ADFH 1FN4A 1I1FB 3GRIA 2NXYB 1UHVA 4H44C 4OIIH 5IV2B 4HH8A 5CPOA 4MIMA 3RILA 2INFA 4LKCA 4AQZA 3HC0B 1E5YA 3AIWA 1TRDA 4DHLA 3D34A 4FYRA 2JKLA 5KOVC 2HVOA 1TV7A 2ESVE 2GDVA 3KS0J 3QRLA 1U42A 5TQ2H 3AU2A 4DPBX 4RL3A 2TRSA 3S2MA 3KPLB 5EPDA 5T8IA 4IGMA 3VGDA 1OTSC 2MMXA 2YXOA 4HH9B 2ADGA 4B16A 3CHRA 2ZTKA 2V2WA 4OLVH 3RBSA 3DJSA 3HC3H 2ITCB 3ZLFA 2MOQA 1MAMH 5DO2D 4X5QA 2WPGA 3UYRL 3MV7B 4OLWL 5EIQA 4N2HA 4WOQA 1AP2A 3TYFB 4MADA 4FLOA 3V4LA 5I8KL 3FQUA 1VFMA 2WZPA 2HNEA 1SJVA 1FNLA 4DIXA 2OM5A 3W70A 4OFQA 1GKOA 4H04A 5A8OA 4F33A 4APXB 4JX5A 3RG6A 1XWVA 1ZEAL 5IROA 4HYRA 2J9YA 3OIHA 2E3ZA 1LO3L 1CU4L 2J7GA 1KTNA 3NJFA 3HA1A 3RPIB 3RFAA 2EXYC 1IBBA 5FA4A 3ZQXA 1NAL1 1LOSA 3UZ5A 3CFEB 1G4RA 3DRQB 3BP7A 5IBUG 2ZPKH 4FX5A 3QHFH 1CXFA 2OLDA 2XN9D 2PI6A 4X5PA 5CMAA 3LPFA 4R0LA 4UOW1 4MSSA 4DBUA 1PCWA 2HDJA 2GIXA 1POJA 3T0ED 1XF4B 3W1NA 2VABA 3QAZB 2PA6A 4L1TA 3WLRA 2C7FA 3FT2A 4LSSH 5IQMA 1WEJH 1O5PA 3O2VL 2V5YA 1FNEB 2DWSA 3EBHA 4XP4L 2VKZG 3D51A 3UG4A 3V0IA 1FQ0A 1UWRA 1ND0A 2YOCA 4LFHG 4LLDB 4POUB 1DL3A 4J4KA 4MJIE 4ELME 1BBDH 2P9RA 4BFFA 2AXJA 3H55A 1V93A 1YN6A 1UJTA 3O3EB 3UY8A 2PNDA 1X7TA 4EIGB 3WEBA 3VA6A 3BN9C 1W9VA 4UNKA 3UBHA 3RK8A 3R2GA 2G9KA 5AW4B 5D05A 4PFEA 3MAWA 1TV3A 3S2CA 3L0KA 4Q2ZA 1FVDA 3Q94A 4PJCE 2X0YA 1OG6A 1CGUA 2WQPA 4JJOA 3OW1A 3DV6A 3RGVA 2PDYA 4BWTA 5IMLA 2RQ8A 5AVRB 2VFIA 3CB8A 5K9OB 4AK1A 1WAPA 3V55A 2R69H 1VCBC 3COOA 2DYPA 2NQ3A 3QW3A 1TCRB 3NG5A 4P4KC 3FC8A 1U0QA 4P5SA 5CSBA 4FQXB 1AGEB 2ZF9A 1SYSA 3GSWB 3B6SB 3RWJA 5EMKA 3CZKA 2MTPA 2NY5H 3WJJA 5DEFB 3RZCD 1E1FA 3DKJA 3S5SA 4GMTL 2WAHA 5EUOA 1B9KA 4XVDA 1U8KA 3MRDA 4HS8L 3W38A 2K6YA 3TFKD 3E02A 2AQTA 1GSKA 4Y1AE 2E7FA 4MXWL 4L5FH 4J3OC 1GQJA 1BEYH 3N2OA 4OIFA 1E6OH 5GS0C 2C7UA 3KXFE 4A66A 1G0CA 2CZFA 3DOHA 3M0MA 1FBIH 2VIRA 2D2CC 3KAAA 4L4VA 2VURA 4D8PB 4HUXB 3CEPA 5A1AA 1FDLH 1TKKA 3LQZA 2XV3A 1Q38A 3L5WB 3WD5L 4ZMGA 2XVNA 4P4RA 3G8EA 2DQTH 2B7PA 3TBYB 1KRBC 2EE3A 3CH8A 3TXAA 2CE6A 1ROCA 5HTSA 1EMTL 4WWNA 4OV9A 2JVUA 4EI5A 3IEBA 5D1QE 4YXHL 1KACB 5E4OA 1BV8A 1RJLA 5E2UH 2AGTA 4ZQCA 2YQ3A 3GR7A 4Z3FA 2F6AA 2QIIA 5AZEL 6XIAA 3B9VA 3POHA 4PLJC 3KAOA 4QRUB 5I76B 3QPEA 4HK7A 4KK8D 4GH1A 3QWRD 1MPAH 2KBGA 4L05A 1NBCA 4UMGA 3JWOL 2IPFA 3F7VA 3UTQB 2Q8ZA 4NT6B 3VE7A 2YAQA 4E9RA 3CSYB 1F4HA 3QSRA 4ZBCA 3MCOA 1IGJA 5AB1A 3KW3A 4GJTB 3A9BA 1Q90A 4J4PC 2QCDB 4NAJA 4FF5A 3CSFA 4WWKB 4NQ1A 1YIXA 1DJXA 5E5RB 1HH6B 3I75A 4XB3A 1AXSB 5CS7A 5CJ8A 2DZBA 4MS8C 2WQ8A 3V4VB 1E65A 1BFVH 4YN5A 3DX2A 1DQTA 3MZNA 1TFHA 1XF3A 3SRHA 2PR4L 4LOFA 1CGXA 1TVLA 4XB7A 4PH8A 3GW3A 4J2PA 3S6CA 3IWVA 1S2UA 2WQXA 2FMNA 2AJVL 1A9VA 4NIKB 1L4IA 4S1QH 3FOLA 4HX1B 4IQEA 1MF2H 1MH5A 5I3FA 1NMCB 1KGWA 1PZSA 4O51A 5J7CC 2YWYA 2WJZA 3H6AA 4DNMA 3D0VB 2B9BA 4PJ8C 2J74A 1M57B 1S7QB 3ZXAC 4AYID 3KCOA 4GX9A 1KXQE 3M7OA 2PODA 4I6VA 3BAEH 3FSUA 1LK3H 4JRLA 3SGKC 1TJIL 3CAWA 3IU3A 3WN5B 4R5EA 3BKMH 3QC0A 4Q0XL 4N2CA 4MQ7B 4MA1B 5T9CE 3C8KA 4A2RA 3QYCA 1YMMD 1TZIA 1JAKA 1OAKL 1L9RA 4ES9A 3QIUC 4O54A 2H3XC 5TQLA 4HIXH 3ZIZA 3MYJB 2P0OA 3C86A 4KX9A 1XEUA 3NZ8A 1R3IH 1R24B 5GGSA 3PABB 5KSAD 5FYKD 3FU8A 1Z3NA 1DORA 1QR4A 1W32A 3MOBL 2K45A 4LB4A 3P3BA 5HGDA 3ME3A 1YADA 4FALA 5AALA 5ISZB 3EHBB 2JKPA 3QJRB 1I8JA 4HKJB 4CCCA 4PJHE 3FN0L 5TGBA 1AY1L 2GTWB 2CUHA 4IX2A 4Z0BH 4MQSB 1DBBL 5FFGA 1WOAA 3ZS4A 1I85C 2GC4C 3FOMB 3JSSA 4M0XA 4Z7IA 1XT5A 3LEYH 5BZAA 4LLMB 5CSZA 5GRYA 3X12B 1LEGB 4RGMC 2W0KA 1VACA 3WQDA 4MMZB 4MNQB 3P60A 3ZRCC 4L3CA 3HG1B 1K3ZA 3H4XA 4HUCA 1F0LA 2VSKB 3Q1SL 3ZZQA 2TSYA 2K9UA 4FNTA 3G5EA 2OZ8A 3JWNE 1GW0A 1NM9A 3V0WH 3U4KA 2A6DA 1VLIA 2GK0A 2IKGA 3KPNA 4JFHD 2WXIA 3HV9A 4CDGC 3RIAF 1YMYA 3PHQA 1X6LA 1E5NA 7CGTA 4LC6A 4IK7A 3G5YB 3P2VA 5GZNA 1GORA 4H7ZA 4FQXD 3OX8A 4FF9A 1WUFA 4HBCL 3MUXA 5DUPH 4HISA 4J8RA 2AKMA 3CDCA 4GKLA 2GJ6A 2QQ6A 3RAJL 1ECYA 3W1QA 5JW5A 5JPNB 2X41A 1HJVA 1U8HA 2RTTA 2GQ8A 3DMMC 3ZE0E 3HMCA 3O3DA 4XI5C 1K4DA 1EANA 4XGZA 1MIMH 2OX1A 3CSTA 4MSWA 3LEXB 5BNXD 1PKYA 2J88A 5LNRA 2ZWYA 3QJOA 8XIMA 5MHSE 5EWIH 2WKOF 1NBYB 3NL6A 3WGVB 4L8SA 1WA1X 2XIQA 2YB4A 2A85A 3BOFA 1NIAA 3QLLA 4ZQKA 5JXAH 4OF0A 5IMMA 1DUZB 5IBXA 2FBJH 1T0OA 3NCJH 3VFRB 4LCIH 5J0BA 5ITFA 3TT1H 3V5HB 3ZRFC 4I3RH 1P7HL 1D5XA 3PPFA 3IDYB 1QK2A 4DP7X 3KFTA 1NVMA 3WTUA 5G4NA 1F11B 3RU8L 3R06A 1FL3A 1FGNH 1XRFA 1LO5B 2IDUA 3V0JA 1ZCCA 3WF2A 3LEPA 4S1DC 3WEAA 5GNXA 5HI4D 5IFJA 5AD0B 1XYZA 1O1HA 2PD5A 1FUYA 2Z31D 4DRSA 4OZOA 4M80A 3RNKA 2ZRXA 1Z9SA 3ARBB 2Y5EA 5GHWH 5D7LB 2P8PB 1A0DA 2HV5A 1YNLL 3WS3B 4ODSL 3CQQA 3KPPA 3A0OA 1IO4C 3G1DA 2VCAA 4L3FA 1MJ7L 1ZSXA 2EIZA 4L29A 2P8MA 4FQCL 2XDFA 3ZKMD 1D7FA 4QXVA 1LQSR 1UXWB 3DDFA 3MBDA 3AS3A 4ZD3H 1P84K 2OCJA 4TN9A 4NP7A 5AENA 2CBVA 1VFLA 2C5DC 3VGBA 3FZUC 3KPRE 4LSRH 5KN5A 3TXZA 4GRWE 2VDKH 4PV8A 5FKAA 3H7VA 4WJEA 4D9RE 3MZTA 3TYUA 1RZPA 4K68A 3M44A 2WBJB 3VB8A 4Z76B 3MLWH 3GS0A 3CMOL 1EZVX 1TPXB 1FVEB 4WEEA 3V0VA 4O17A 4JIPA 1LRNA 2Z93A 3GKZA 4L8DB 1J9YA 4HWEL 3SGJC 2ALAA 4KVNL 2GAZA 4HZMA 5IBUB 2QR0B 4Z7WB 4BCZA 2IDQA 3L5AA 3DVNB 1GYVA 1GY1A 2B9AA 4OTXL 4K3JL 4UTFA 5D9SB 1KPUB 2HRWA 4LDLB 2WLIB 4XN2A 4X9GA 5C9UA 2AMXA 4MD5A 4HS3B 2CGRL 3PWPB 4A7SA 4PY8I 3W7LA 3FU9A 1S9WB 1W1PA 4NYYA 2BC4A 3BW2A 1AH4A 3EEGA 3ULUD 3OLIA 2W67A 4IM8A 1DVJA 1JPIA 3A64A 1WBHA 3HBQA 4K3EH 1GYUA 4QAWA 4YHLL 4OCSH 2FGLA 2J25A 3ZHFA 1U3JA 1I45A 4JQ4A 1CNVA 1D2PA 2CO7B 4NQDE 1DQDH 2NSOA 1YYCA 5D6DA 1NAMA 2DEPA 5DXXA 2XWBA 2FKPA 4LUTA 3HA0A 3VI3E 2HFFA 3DIDA 1H5BA 1YJDL 3WY1A 4DGVH 4QNPE 1SSDA 2NQHA 2O6DA 4X42A 1OJXA 4JPKL 1YY9C 2UZXB 1U3HA 4N9BA 4F7CB 1MCNA 2EYTA 4MTMA 5HI5D 1O94A 5BVJA 1E1CA 2X1PA 3IMRA 2BVOA 4E5XA 4AJWA 1U8NB 4WCJA 2VDNL 3LZ3A 4QCEA 3BL3A 1RUAL 2B0SL 3MRQA 1R5IA 1BX2B 5DJXA 5BS0E 4UUIA 4AUUA 5AZ2H 5F9OL 4IDLA 2G2NA 2J8TA 5GS0H 1JF6A 4X0NA 4QF1A 3CMFA 4PREB 4F8NA 2ZRVA 3VXRD 3EYOA 1W37A 4JCWA 3FCTB 4YCPA 1EBPA 2Y0FA 1ISYA 4ZSTA 4QCFA 5IG7B 1KCVL 4PJBE 2O92A 2QJMA 4XPHH 4G6AC 2DYSB 2HT2C 4QLKA 2VN3A 3MVSA 3WY3A 1EJWC 1UB5B 3N2XA 4F57L 3BWZA 4LNYA 3RR1A 4Q4RA 1ADDA 1TT6A 2VDRL 2CU9A 1E0OB 3CVBA 2WB5A 3BICA 5I1AB 1X1OA 4QTIL 3SPVA 1IT0A 5IB4B 5JOFB 2BCKB 3MTWA 3HOJA 4AC7C 2G9HA 3QORA 4MGGA 2VXNA 4OJFH 2Z0IA 2R7EB 2ZG3A 3TJLA 2AK1H 4FABH 3CN0A 2CIIB 3GSNL 5KZMA 1CUOA 4HA1A 3N4EA 2DWDB 4PHXA 3RCNA 4XMLL 1AW5A 4M51A 3GLDA 3KPMB 1GZPA 5D02A 1QLEL 3RNQB 4BZYA 2ZZ4A 1J8RA 2B1HL 2NQLA 1BGGA 3OM3B 3MJ9A 1EX5A 1IU1A 2VXSL 3VH8G 3FAXA 1VERA 3W7RA 2D7TL 3I6LE 5EORH 2ODHA 4OFVA 2X10A 3FCSA 3SRFA 1Z7JA 3PG2A 2LU5A 1RUPL 2I5YH 1CT8B 4JVUA 3RGTA 3AFBA 3G9AB 4FTVA 1FLRL 2IS7A 5C3LD 2Y7QA 3AB0B 4A04A 5F4SA 2ZCZA 5IQ9B 4Z5RA 1XIGA 1MCPH 3HGJA 3LPPA 3T3PE 3MP5A 2AW2A 4AL8H 3LBCA 1JVOA 1AXTH 1DJYA 4ODVL 2XY2A 3V9EA 4X6EA 3NFPA 4ZXBA 5F88A 1PTGA 4FERA 5FCUL 3WFAA 5D7LD 1ZBWA 3ARUA 2Z1VA 1EPFA 3MRRA 2XNAB 2Z8WC 4EUPH 4WGKA 2JJTC 2VR7A 1EJFA 3JVFC 5DT1H 2B7QA 2VEGA 4KQ4H 3AIUA 5K2ZA 2PCXA 4MZIA 1F18A 3PZNA 2N7BA 1HH9A 5I1IL 2AP2A 3EFDL 5IHZA 4EOUA 4JTGA 4X6BB 4ALAC 5K7JA 4G7VL 4XHQA 3TN0B 3GVRA 1ZD6A 3LV5A 1MRCL 3KX6A 1HSAB 4R9XA 2CO2A 1QFWH 4HIJA 3O63A 4DJDD 3GNMH 3G1AA 2ACRA 5INCA 4AEIH 3SECA 1YMHB 4J3UA 3ZDYF 5AC8A 4KC3B 5T3XH 5ID1B 2ZJSH 4LSVH 5FAAA 1KGCD 1OHZA 4JQXA 4UTAH 3EXRA 3G1SA 2NY2C 2YK1H 3NWRA 1UZ1A 2GVJA 3DXAB 4DK6A 1JFQH 2BFVL 1B3ZA 2CO6B 1GZHA 1IX2A 3DBPA 1RUSA 3KWUA 2VDPH 2R2EA 3H70A 5PAZA 1DP0A 3U4BL 2ICWJ 3RFZC 2XTJE 4D6FA 1SHSA 2KMWA 1MNUH 1QWGA 1ZBVA 3V52L 2K9FB 2ED7A 4HGWB 5I18L 3D2TA 1M1BA 2X2IA 1LP9A 3MNMA 1E0XA 3VDGA 4FG6C 4M7LL 5DHYB 4JHAL 4YSCA 3SDAB 2VYRE 4LFHD 4B9KC 3F01A 3QUYB 4K15A 2CKBL 1LMIA 4FLQA 4KGLA 5C54A 3O11B 3V0AC 3SDCC 2CHNA 1YEYA 3GSMA 3T4AC 3RURA 1L8PA 3WLBB 1BQSA 5IQOA 5JHBA 3N06B 3VVWA 4NQEE 2H1LM 3QM3A 3CUPA 1EXHA 4MMYA 4WFHD 2NNFA 4P46C 5KVDL 3WXVH 5EZIH 3IK2A 4XNBA 5IHWA 4R33A 1UB6A 4F20A 1IMHC 5SWSB 1P1XA 3IJ6A 1QSZA 2ZTBA 2ZZUT 1OT1A 5F9WC 4N87A 3OO2A 4PWFA 2FSEB 4AIXA 3WJLC 1DVZA 4O1CA 3U6RB 1H09A 5FK9A 4MDJB 4WSGA 1F6AA 4XXCA 3BWAA 4WEUD 4D0CA 2HK0A 7FABH 3GMOB 2F54E 4PJAE 4I9TA 3UG3A 3BUPA 2JJSA 2PC4A 1FI8C 4HJGB 3SKJH 4CMMB 5E2WL 2BTMA 2PWEA 2A9NH 3HMXA 4X4ME 2WJDA 4PE8A 3BH9B 3M1CA 4QYOA 3D0AA 1IEXA 2CBTA 4TOYL 5CAYB 5CJXC 2DRUA 4MD4B 4HVXA 4Z8FL 3KLAB 1A3LL 5HHXL 1QR7A 3HU7A 5XIMA 2BP8A 1E6SM 3S3SA 3T9PA 3EWUA 3OXRA 2L8AA 4X98B 1W80A 1M6OA 4LAKA 1S2CA 2XA3A 3IMTA 4PVNA 2Z4QB 3K8MA 4DGIL 3IFLL 1JPGA 3UXLA 1E6RA 3WNMA 1QA9B 4ZNEE 5C0NC 4JNMA 5E1QA 3IN2A 3F04A 3JT2A 5EH1A 3MSYA 2J27A 3OBKA 3QZEA 3M0HA 5KVEE 4ZAKB 2X4UB 5E99H 5B4MD 4F5CE 3FL7A 1UYWL 3HURA 1P5UB 3BAWA 4QRRB 5JMOC 4P3DB 3UZYA 3M0KA 1PLBA 3D0CA 4X83A 3V0FA 4NKIL 3TT3L 3KHDA 5AAMC 4TXVB 1RCXB 2GGGA 4DYKA 5D7IE 3WQVA 2FYYB 3D25A 1EP2A 4UCFA 1YPXA 4YMPA 2IQ0A 5GS2D 1ZHAA 1MRDH 5J6GA 1PO9A 2F8VA 4GY0A 2E67A 3RWGA 3NTYA 4WO0A 3EDJA 2VERN 3FUDA 5KSBF 2XQYK 8XIAA 3HKZA 3K1DA 3DI2B 2VDNB 4JZ5A 3H9HA 3NIFB 2EPLX 3TVMD 5HOSA 4NC2B 2LLGA 1UPPA 2XVKA 3R8QA 4MYAA 4RVBA 3VXSB 1PAZA 4QHMA 2DQGH 5C7VA 1X6UA 1T6VN 1EH9A 3S5NA 4QRPB 3QXVA 1AZ1A 4KV5F 2Z2AA 1GG1A 3MPGA 1AGCB 4ZQRA 3OPZH 1DO5A 3TEUA 1PNDA 1MRQA 4AMCA 5F89A 4JFEB 2AQVA 5FC9A 4X5WA 4K8RC 4M43H 4XC3L 1YYLH 4A21A 4XV0A 1OVZA 1XFBA 1Q6EA 1S2AA 1SHMA 4TS6A 2DGAA 1S7VA 1NWOA 2ISSA 4JEGB 2A9BA 1OZMA 1NUFA 3MBFA 2BVPB 2VDRB 3LMJL 3RY5A 1JRHL 1A53A 1WBJA 1OZUA 3M1OA 2VDML 5DF0A 1QI0A 2I25N 1CFNA 4MAUH 4AQEB 5LXGH 1PE1A 4TSCL 1W9BM 1CG9B 1HHGA 1L5GA 2Y85A 3RG1C 1YCSA 3I7SA 3WJMB 1DQMH 4ZENA 4IIEA 1FYHB 1AZCA 3RLSA 3GHBH 3TN0D 4XPGH 1MCCA 3GSNB 3UWYA 1XX9C 3UERA 3ZTNL 4BKLA 2BHUA 1RCYA 3CM4A 1YDVA 1IEBA 3OJ2C 5IB5A 4XNZB 3DX1A 5GGQH 1L9PA 4DEUA 1QLEB 4AW4A 1GCFA 4FKKA 2V5BA 4A2DA 2Y36H 1JK9B 2DU2A 5C7HA 2MTAA 3EGJA 1N6QH 3EOLA 3WHE0 4UILH 4HOWA 4MHHG 5F1SA 3B43A 4BFKA 3EZJB 1XISA 4HV8A 3CFQA 3W02A 1S7UA 4KWSA 2YD1A 4TVCA 3JWDH 3C5ZC 2PW1A 2ZDSA 3DXAD 4LCSA 3QIBC 4OLYH 3D9AL 4LLAA 4PCTA 5IVZA 1M1SA 4DKEH 4XBKA 4WEBH 4RIRA 2DIBA 3RJXA 5I8OL 3OVPA 2CESA 5DWUH 4KU1A 1UWFA 1Q7QA 3D4ZA 2MCAA 4Z23A 4RDQF 1AI1L 4JM2A 4CU7A 3NIGE 3UJEA 3P0GB 3N6HA 1B3YA 2QZRA 3W28A 1R3YA 3FNDA 3S3CB 3NOYA 5I17B 3SDAD 2FH8A 3LLFA 5JMRA 3CB3A 1VF5C 3QUYD 2HSAA 4KEUA 4LB8A 4XWOD 2VO8A 3T8VA 4MMWA 2CQVA 2XINA 5ANMA 4F7PB 1FZJB 4LCWB 3MXVL 4LVOB 2PW2B 4YDKH 3G6DH 4KCTA 3U9UA 1HWHB 2PP7A 4Y4KB 4RGOL 4ACYA 3PTDA 5AHLA 3C87A 1JL8A 4JFOA 2AQOA 3DSNB 4CVXA 2VGBA 3F85A 5IEHB 1TA3A 1YNTF 1R3SA 1B4JH 4KTDH 5AVZB 2QKIB 3QUZC 4IQHA 4A2EA 3PUOA 3FN3A 3B3BA 1AFVH 2GSEA 2G4FA 3SZ8A 2DQHH 1GTNA 2C1PA 4RNJA 1OM9A 3ES7A 2YGOA 4QGTA 2BIIA 4F1ZA 1IAIL 1GOFA 3M4HA 5EMMA 3FQNA 2VISA 4IRZH 3RKDD 4WU7A 4MWAC 2OU4A 3NIDF 4ZNCD 4EANA 2W60A 3ETBF 3K4ZA 4TUOB 3QV9A 1DBKH 3ARDA 3O6KL 2E6YA 4JDEA 2YPVL 4A1RA 4BH7B 4FLSA 1LNUB 3MRKB 1JPTH 4U10A 2CO1A 4JDVA 2BDQA 1KENH 3VH8B 1AMXA 1W3KA 1CK0L 1QPPA 4TVUA 4NQSB 3G5ZA 3HE7B 2MPAH 2CKBB 1NLBL 3GFUA 3IJYB 5CIPH 3A6BH 5T5NG 1IIHA 2R56L 4KPHL 5I5MA 3V5FA 1PSKH 1ZIBA 1KIPA 3UETA 5F7HA 5H2BB 4AITA 4EKXA 1WZ1L 1P6BA 3DHPA 3N43F 1KEML 3CDZB 1L0XA 1CTMA 5CR1A 5FJJA 3CX2A 2ZUNA 3NACL 4IGBC 2K6ZA 4L3EA 3BUDA 4M61A 1VCFA 3UFIA 1BRLB 2UX6A 4F8OA 4PI2A 4W9CC 2WSKA 4ALAH 4IMLB 4JTAA 2NMSA 1JGIA 3T07A 5CZXC 4MD0B 3QO0A 5EC1B 4NJAH 2NY5C 1MSPA 5AC6A 1ONRA 3BH4A 2Q02A 1C1EL 3DEQA 3NVTA 2NY1C 2WNQA 1OG0A 2PBGA 4OKVA 4H01A 1TQBC 2R29A 1R9ZA 3R10A 1ZT7A 4IOFD 3WNKA 2EVGA 3L9BA 4IS6B 2VP8A 4PN6A 4LRNL 3JTSB 4NPJA 5FYKL 5D5MF 5EBGA 1WA2X 5F1NA 1UT2A 3FYYA 1MUJB 3RU6A 4WR3A 2AJSL 1OFRA 2XQBH 3ZDXE 5A8PA 5DZOA 4JFED 3WFEL 4F2BA 4HS6B 4W9HC 1ZSDA 3VWKB 1UIPA 4QTHA 1D5BA 1FPTH 2ZP9A 4NJ9L 4FFZL 2QFRA 5HHQB 2IADB 2E9IA 3L95B 3C08H 2VDQL 2Y3AA 1AA1B 2BP0B 2YOAA 4XKYA 4EIBA 1IJ9A 1U3YA 2JTYA 2F68X 3W0WE 1G7VA 1WV2A 1AQDB 4JX6A 3OZ9H 3O2WL 4IJTA 3WH6A 1HAWA 1DWIM 2Y24A 1EDTA 5ABAA 1QZ1A 1NGPH 4PP2A 1VRSA 1IL1A 3PV7A 3OMIB 2QT3A 5EZOL 4XCCL 3IXTA 1PQZB 4K73A 2VYOA 2EACA 3DURA 4GMEA 1FP8A 5I75B 3FKRA 1UA6L 4A8LA 3RX7A 1C9WA 1HYSD 5U4NA 4BSVA 3AYRA 3IV3A 3PL6C 3GH7A 3HG3A 2PRLA 4CA4A 4H2AA 1BJ1J 1BBJB 5FACA 4XO6A 1AG6A 3CQKA 2WW5A 1SLUA 1ZHKA 4ZO7A 3WYRA 3ZY7A 3BHBB 4GAGL 1VSCA 3EH5B 4LMQI 1KN2L 3BEWB 3ZDZB 2ZVIA 4A63A 2OSXA 3EYVA 1BDYA 4RMBA 1WS8A 2AL2A 5CEZL 2FJGA 2XN9B 5T26A 2OWXA 4YHYC 2O30A 2YKLL 4OUIA 2P5WD 2I5IA 1I3VA 1YEIH 3TSDA 2A6IA 1P5BA 1VFUA 1Q94B 3T0EB 4WFEE 2JEQA 3BRFA 4OCWH 5CZVH 3G5XB 3F03K 2NYYD 4P4KA 4FNLH 5D7JB 2J8UF 4R7VA 2A4CA 4OM1H 4A6YH 2LOEA 2OKTA 1SYTA 3GGWA 4U49A 4U3CA 3RRAA 1WIOA 3IU4L 1GUVA 2HVKB 2NT0A 3GEWB 3P61A 3S9ZA 2VDMB 5E8OA 2H4EA 2XWTA 3U2SB 3QI9A 1A5FH 3MHZA 2PDPA 2PDKA 5I3JA 4Y4KD 4XAGA 4AQ8C 1MLCB 3EFOA 5JW3H 4A22A 3TWCL 4YWSA 3W6MA 1IILE 1U9KA 5E2JA 3WXWL 3E6FA 4XNXH 1HP4A 1J86A 4R4NC 4B9PA 3MRCB 2C3HA 1QHZA 4HEPG 2DTML 4FA8A 3VD2A 4Z7QB 4NNYB 4OGYL 3MDUA 5CUSL 2X87A 1OK8A 3LXBA 3UDWC 1ORQB 3P67A 4HFWA 5E1IA 3GWJA 1CECA 5HHVL 4B9FA 4MBRA 1JXGA 4M7LT 1ZA3B 4N42A 3GIVA 4M82A 4ES4A 3RZCB 1BF8A 1JPDX 1P48A 1UP2A 2P46B 3FJNA 4Z1PA 3C60C 2H9GA 3LHUA 3W26A 2TYSA 3DH7A 2CDFB 2B14A 4IHBA 1F4XH 3HPFA 1BREA 2DUAA 4B50A 4YHNB 2VGIA 2VLMD 5I6MA 5DHEA 3LZ5A 3EJSA 5ETUA 1WK0A 1CFQB 4HHAB 4ENZA 2PYEE 5I66A 4GAJL 4YSEA 4C6EA 2I26N 1WDRA 1RIHH 3TNOA 5LKYA 3ANYA 3GS6A 4U2YA 1RZKH 3V3WA 3GB6A 2NRDA 1A6TB 2DJUA 4J4PA 1U91B 3UJRA 5CHNB 2WMKA 3VZZA 1U6AH 3I65A 3BT0A 3NL5A 3H2WA 2VLRE 3STGA 4WTXA 3B0XA 3CAVA 3B0VC 4AG0A 3TYGL 5E5MB 1ZZMA 3VKBA 1JV5B 2WIIB 4H6KA 2VVNA 3DUUB 1JDDA 1AHMA 2BVYA 5JIWA 4U28A 2VXUL 1H6EA 2VR6A 3ULUL 4IPJA 1T3FB 4QE5A 4NUGL 5BWFA 2C26A 1MRAA 3GMQB 5CF3A 4UUJB 4XRCB 5A2IH 1OP5K 1YUHB 3LHPH 1JE6A 3WIFB 1K6AA 1CCWB 1TMQA 3AABA 3KDPB 5DVOA 4DFIA 1K85A 4XE0A 1DVXA 4PJ8A 4W4QA 4ORZC 4GYKA 3DFQA 1DFBL 1UG9A 1IGTB 4JDZA 3LS5H 4YR6A 5IMKB 3W9DA 2UWEB 4RNHA 4F2ME 3VWKD 4XO9A 3VXMD 5DHXB 2BZCA 4S3KA 1LDPH 3O2DL 2DDQL 5DQJB 3EKLA 3WEXA 2AQ2A 5JBEA 5T91A 5C2UB 3NM1A 1NKOA 3QIUA 2QCFA 5LWYH 3ES6A 3BUYA 2W79A 4NJJA 4QY8B 1KYOK 5EOQH 1B4EA 1RZJL 4UQ9A 4DWDA 3TVAA 4MY8A 3ZKSD 3S2NA 3W07A 1AG0A 3MQIA 2GWNA 3VRJB 4PWGA 1B0GB 3BAIA 3T08A 1ZCOA 1N7ML 2X4NB 3STCA 2CUIA 4LESA 2P48B 5E4EB 1C7SA 4XZ9A 2WP3O 4FQIH 2HPOA 2VXQH 4YXGA 2VLKD 2PGWA 4Q14A 4XUYA 1AIFB 4URIA 3OYZA 1TO4A 3REWA 2ZNWA 5K39B 5GGUA 3G3DA 3GMRB 1W8SA 3SKMA 1YMMB 2G2RB 3QBTB 3RAOA 3KRSA 1EJOH 1PY9A 3HRZB 4JGMA 2VHLA 3SN4A 4G1KA 3LCFA 3A4JA 3VGAC 2HB0A 3ECBA 5KSAB 3NQBA 1KJ3L 4P0DA 5E8NA 4WI7A 4GACA 1J4EA 4FX8A 2Q86A 4HK5A 3MV11 5HYIA 5I1HH 2DD8H 1UOWA 4NKQB 4GEJA 4KVCH 4H7CA 3P2BA 5IF0B 5D7JD 1K70A 5L7XH 4NN6C 2Y5QA 5FYKU 2VDQB 3KPQB 4ZFZB 3LIUA 3MHFA 4NFDA 3N6JA 1WITA 4YSOA 2FHBA 2D0FA 3NAAH 3BWSA 4XNMA 5C0CD 5DD0H 1CVRA 2FZ9A 4JN2A 2NVCA 3STPA 1U8IA 2BNRA 1HZLA 1WOBA 2X6CA 2HMID 3HB3B 4B5NA 2IG2L 3X3GH 1DEDA 1WGOA 1PIGA 5A3IC 3F1QA 5I6OA 5EU6E 2O9PA 3LKOB 3GZ3A 3NEEA 1NMBL 4EAMA 1O68A 4R7LA 4GQBA 4A2HA 2FLRT 3FF7A 1DLHA 1FO0H 2PDXA 1IT8A 3BVXA 3OGRA 3OAZK 1YNYA 2XACC 5IIEA 3T8XB 1KGJA 1L6XA 4S1FA 3GSXA 3V6FA 3SGUA 4X0VA 1UEMA 3D69B 3TA4D 4G6JL 3OLGA 3WV0A 4ZW5A 3E80A 1P4UA 1P7TB 2VE6B 1VKFA 2P45B 4WTWA 3QDMA 4F2EA 1IKFH 4PBFA 3QJVB 5GJNA 4CCZA 1RHFA 4HPYL 5SWUA 2B39A 3FMGL 3M1BB 4NRXB 2DL2A 4P61A 1DBTA 3L65A 2OCZA 5HYJA 4PFHA 4H8QA 1I9EA 5IOBA 4AXWB 1AR1D 1H8SA 4XODA 5LNUA 3NFNA 4NKCA 1DN0B 1FZOB 3MLUH 3GBEA 4ZFGL 3QOKA 3GHTA 4IKNA 1W0VB 4O2FA 3AT0A 4J1UB 1BIHA 3O0FA 2Z31B 4Q7DA 5HDQH 1NCCL 1U2CA 4WW2A 2K8MA 1PZ3A 1OD0A 2Y7SA 4M8RA 1G7LA 2NSQA 2A7BA 2CXGA 2QF8A 4MDRA 3MCG1 2GI0A 3N2CA 4YVVA 4YIWA 4OF3A 4CDHA 4BYHA 1V5XA 3FKUS 2E9MA 3UYPA 4JCMA 5FF6B 5I0YA 3HHSA 3PN8A 3C6EA 3R8GA 3K72B 1FRGH 4ZB2A 4C83B 3I9GH 5EU5B 1A49A 1E72M 2W94A 4R9OA 4XNDA 3FB6A 1A5NC 1OL0A 4WGXA 4JTDA 4QHNA 3P74A 4R7OA 2R4SL 5IB1A 3K46A 4DERA 4EZLA 4UTBH 1IR1A 3TBVA 1WKDA 2AV1A 3WDHA 2X70B 3LRSB 1KF9B 5D9OA 2JI2A 2YLAA 3LY0A 3KCPB 3RY4A 2ZFAA 4GOAA 1N2RB 3VNIA 5DD5L 2OL3L 4AL8C 4MASA 4JO4L 1NCBL 2IKIA 5FV2A 1MHEA 1MZRA 4PRAA 2EH7L 5DEZA 3U2IA 5LNDA 1DBAL 3GBMH 2WGNB 4QXTA 3LEVL 1UWEL 3CDGA 4JRXB 4ZQNA 4Y4HA 4AZ5A 1CDGA 1CYWA 3TLLA 4YUEL 2J6EH 3O4LB 2WMIA 2DZXA 4X6DA 4XX1G 3MODH 5I1LB 3IE9A 3V9CA 2B5IC 1LJMA 2J7LA 3VFUB 3M0YA 1QO5A 3ZZSA 4IKIA 4RMVA 1G7IB 4KZEH 1JK8A 4WUUD 2AL1A 2B7DT 1PKMA 3U2CA 3L68A 3PS6A 3GMPB 1I9RL 3KOFA 4LS2A 4KVPA 4JGUA 4Y4FB 2QTEA 2CC0A 1CPUA 3P4OA 1LD9B 3UABA 4LWWA 1OD8A 1E9OB 3FTGB 2IANA 5DD3H 4JTIA 3Q5OA 4JTCA 4JREB 2XHYA 1QRNA 3NRPA 4M5PA 4BE6A 1OAJA 3EX2A 1KCRL 4Z0JA 2GBVA 1KIRB 4X6FB 3ZGIA 4HZ8A 1WQ5A 1FCQA 3H9SE 2I1OA 3L5MA 3C6SB 3HVNA 3TC3A 1G4MA 1YQVH 1KBGL 2F19H 1R5YA 3HFFA 2NX1A 3UTTA 3O41A 3WL1A 3SBQA 3CH1B 4L18A 3B5TA 4TV6A 2ICEC 2G5UA 1L6WA 2W66A 4PR4A 3X2QB 1WVZA 3U7AA 5AVUB 5FUZL 2A6KB 5T1LD 3BPOB 3QCUL 3VXRB 2EE2A 3B3IA 4YHOL 2GSGA 4QS6A 1N67A 4BZ1L 3H9YA 3FGCA 1XH3A 4BFJA 3SE3A 3ONCA 2QHRH 3DHMA 3HB3D 3FS2A 4NP4L 5B39A 4GYFA 3VG9C 1DSYA 4NI8A 1AXIB 4KNTA 4HFUH 2R0KH 3S8GB 2H47C 4DQOL 4JTRA 5CD3B 1S9YA 2XKSA 1Z5LA 2D7MA 4KK5D 1SOSA 1T5WA 3SDXA 5CEZD 1U1JA 5T5FH 1P2CA 3QY6A 3MMEA 2OX5B 3FQTA 3P40A 3LCHA 3QWQB 3BI9X 4LKXB 1X8CA 2V2TA 2YBUA 4PGJA 3VCNA 3RDTB 5CPMA 1XLDA 1E30A 4UNUA 4GCAA 4V2BA 2YD9A 3N91A 2BWGA 3V6ZA 1WCQA 4KUZL 3LZOA 5J8LA 1KB3A 1FORL 1P0DA 5A6BD 2YUXA 3AHXA 1IAKB 1KLZA 5D1ZD 3TASA 4IMCA 3M5VA 2FZMA 5EBLA 2YXMA 4YE4H 1ACYL 3ALFA 4WK9A 2OVLA 5DJCA 5HJGA 3H9ZA 1EPVA 4B5XA 3TBTA 1FIEA 3U9WA 4I9XA 5IVXB 1XR8A 1OAYL 4MDIA 4IBVA 3T0TA 5FW7A 1XGEA 1TQTA 4HJFA 3IT8D 3QQ0A 5L4JA 2HS6A 3QXDB 4I18B 1BXUA 3GM0A 1UVQA 4S23A 4YEEA 4ADTA 1HI6A 4LQFH 1EVUA 2F18A 4N9CA 3S1XA 2E7CA 2IV8A 1CFTB 3LRMA 4DAFA 3SGZA 1QSEA 2HISA 4MPQA 4ZUVA 3SOTA 3MVIA 3S1GA 2ZCLH 5DQ9A 3ARGC 4GGBA 5J5EA 3WEZA 4F8XA 2IALB 1G6RL 2IMNA 4YFEA 1JWSB 1IQDB 5I5RA 2MOVA 2Q2LA 4GQZA 3SPIA 1SJAA 5KJRL 4KAQL 5HDBB 1J8VA 2R9HD 4YWIA 2MUCA 3RFZA 1FWFC 4ZOCA 3GSUB 1OE2A 3DHJA 1MHHB 1I7RB 3IDMA 2W0FA 1PKQA 4X4XB 1A6PA 1DWHM 3DGGB 4DZBA 4J6RH 1TREA 3U2ZA 4HAKA 1Q9OA 2IBZX 1MLBB 4EXAA 3CBJB 3NH7L 2Z1SA 1T99A 4H0HB 3OWRA 4WDWA 3DPBA 2A4AA 2D7PA 3U83A 1ITXA 3ARRA 1XXXA 2SEBA 1OADA 3KJ4B 1F05A 1YN7B 3FQXA 3U1PA 4L7ZA 3ZUCA 3SDCA 4UQBA 1UZGA 2YPLD 5CEYB 2WPBA 4PVBA 3FQWA 3DX8A 3L4UA 4YZFE 1O6TA 4OCNC 4HKZB 5T3ZH 3KYMA 1KQZA 1QLRB 2X7LB 3WBDA 4ZW8A 2OT1A 4EOWH 3ZK0A 4P46A 1P4LB 4Z78B 2YN3A 1OFPA 3UGUA 4LLWA 4PJ7A 4JRXD 1SRDA 2WWMC 4HK0B 2RDUA 4LAMA 2UYLB 3HGRA 3PAJA 4FDWA 4LVNC 3V4UH 3TF7C 3O4LD 3H4GA 3B0YA 3WJLA 2HT4D 2HNHA 3BE1L 3R18A 4HYWA 1P0KA 4UTJA 3K6FA 3FB5B 1ILUA 4IIQC 2XGBA 4JYFA 5F96L 3CHSA 4J3VA 3D50A 2DQEH 1XGTB 2BY1A 2DH3A 5JOPE 1ETJA 3AIBA 1B2WH 3MV8D 4XNQA 1JGMA 2FTAA 2JFCA 2P4AB 5CJXA 5F0LB 3TV3L 4HJ1A 3EB3A 1IV8A 5C2CA 1KBVA 3MYZA 4A3RA 2P44B 4Y4FD 2PP8A 4P57B 4K7FB 2BSTB 3HS0C 4LU5H 3TSMA 4N0FB 3IVUA 3LSOB 4AGLA 1BD0A 4R97C 2DQDH 1E9IA 1J88A 1YAZA 1XFPA 3AM8C 1AKJD 4JJ5A 3GB7A 4OZHA 4EE2A 3JWDC 12E8L 3C2SA 3G77A 4GRLC 1Q6DA 4N0UA 5FDYA 3QQNA 2VMDA 1BQUA 1PBGA 2Y1YA 5J11B 2P5ED 1JV2A 1XCQA 3NCYP 1QABA 4YXKH 4HXBH 1UR9A 4KEVA 2YUVA 1CFMA 3NZGA 4HIIB 4F0KA 1Q72H 1A14H 5CINL 3WDPP 4G8GB 2BSEA 4HBKA 4C4UA 1E4MM 2FD6H 4GG6E 5KAQG 4W88A 2I9EA 3FO2A 4XCFL 3GTFA 2J3SA 3AI0A 3LKRB 3KGSA 4C56E 4E68A 1OYAA 3H3BC 5ESAB 4AENA 1L6PA 4KK6D 5F7AA 3VIIA 2BLFA 5L6YH 3K4AA 3TKFA 4ZB5A 3VPLA 1FNHA 3OR6B 5A7BA 5LGHL 1EGJH 3BUQA 3D3VE 3MROA 4YS1A 2ICES 1W3IA 2IOIA 3B1UA 2H26A 2VN7A 2UY7A 1SFJA 2GBUA 4AVKA 2GJNA 4RQQA 3OXSB 3W2DH 3BDYL 4Z7VB 5AW3B 1U3ZA 4HA0A 4M3KB 2Q3XA 4BF7A 2BV9A 5AOJA 2W07A 3TC9A 1GGIL 4QJ5B 3DHFA 4PGCB 4GAFB 4PY7B 2IBGA 4PL2A 4YHIB 3RDTD 3S2LA 3T78A 3EKCA 2OXGB 4I4WB 1EC9A 2PS2A 4X4YB 5T1DL 5I1JH 4H41A 3QFJD 4B6ZA 2HN7A 5K9KB 4ESKA 3WH9A 2XN2A 4QSHA 3IF1B 2QSCH 1QLFB 2VAAB 3RX2A 3OF6A 3MRPB 3PZOA 4LEXL 3KM1A 1IAIM 2GGEA 3TVMB 4PN2A 4F7TA 1Z42A 1M6UA 1HT6A 2AGJH 4JHUA 3CQ0A 1KPRB 2QCHA 3GNXA 1VRXA 3L1GA 2V37A 3V5KB 4YIQB 1MWAA 4LNRB 1OWWA 2YMOA 3QPYA 4CVZB 1T22B 3CVCA 3WLPA 3N1QC 3FHQA 2RCSL 1S7RB 2WQWA 4YOKA 3R43A 5GRJL 5DVMA 3SY0B 2VM3A 3NPZB 4PJ9D 5CSYA 2YJLA 1GAFH 4Y5YC 4HN8A 1S2VA 3LTVA 1ES0B 1CF8H 3EJZC 3L45A 3LS4H 2PF6A 3CFMA 3QIBA 3MUCA 3WSQL 1RUML 2DM7A 5JLZB 4A7VA 4LEEA 1LO0H 1V8HA 4B9CA 1YA5A 2ZVRA 2YEZA 4CSSA 3RX3A 2FPYA 3IYLW 1UM5H 4JX0A 4MJ4A 5FFLA 1R3QA 2AK4A 4LUYA 5FLUA 4XH2A 2DT2A 1RIVL 5LA1A 3EEZA 4HCRL 1N6VA 1RZQA 3G04A 2BXVA 3HI6H 5HWMA 3AU1A 4UQ2B