1C9DA

Crystal structure of the complex of bacterial tryptophan synthase with the transition state analogue inhibitor 4-(2-hydroxy-4-fluorophenylthio)-butylphosphonic acid
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
266
structure length
264
Chain Sequence
ERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords TRYPTOPHAN SYNTHASE (ALPHA CHAIN)
publication title Crystallographic studies of phosphonate-based alpha-reaction transition-state analogues complexed to tryptophan synthase.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 95
structure length 264
sequence length 266
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 1999-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1c9dA00
4N9CA 4ADSA 3SSJA 3FIGA 1RVGA 2HSAA 3L5LA 1YPIA 1H1YA 5BOOA 2Z1BA 1GQNA 2A6LA 1Z42A 1KFCA 1FWSA 3KOFA 3NEVA 1GPWA 1L2UA 1YTKA 5AN7A 1ZAJA 7TIMA 5AYYA 1J4EA 2X1TA 4K39A 2Y6ZA 1CI1A 1MXSA 4HNNA 4HSOA 2WNQA 1XCFA 2QR6A 2CLIA 5BW6A 4MYXA 3KVMA 1TV7A 1WXJA 4I7WA 1IXNA 1QNVA 5LNWA 3PG9A 3TFXA 1TPDA 3DFNA 2CLEA 2YFNA 5J5DA 2PRMA 3GIYA 5HULA 2ATSA 5DCDA 3G1DA 1SW0A 2C13A 3PF3A 1KFEA 1OFPA 5MHBA 4XQ6A 4O8RA 1KM2A 4ZQNA 1R46A 2JK2A 3TDFA 1QOQA 4PTNA 3OVQA 1W5NA 2R91A 2D73A 1SZGA 2QJHA 4JNMA 4PFMA 1RPXA 1RR2A 2YX0A 1JCJA 4JTTA 3MI3A 1TIMA 5HINA 1LCOA 4K37A 3CT7A 4JTFA 1LP6A 4Z0SA 2H8ZA 5EL1A 2GQAA 4O13A 2J9ZA 2OX1A 3QQ1A 3LM7A 3W2JA 1AW1A 4XTDA 4A22A 5BMXA 4MFEA 4R33A 2C1HA 3PY2A 1EX5A 2FDSA 3TJXA 3RK8A 4NT0A 5HR6A 1I8JA 2ZQ0A 3BW2A 1I4NA 4DPQA 1EWEA 1L6YA 2QCNA 1RQEA 3HB9A 2YXGA 2OCZA 1FWRA 2VEMA 2A5HA 2CLOA 4I7UA 4AHQA 4MZ8A 5G5IA 3NR0A 5H91A 5BRBA 1FUYA 1ZAHA 3BW4A 3WK2A 5D2TA 3W86A 1THFD 3V75A 3KHJA 3PBUA 1TTIA 2QCDB 3OIXA 2A85A 4PC8A 4LOCA 3WJSA 3WK0A 2ZYFA 3W73A 5L6UA 2RDUA 5DCEA 2V2CA 5DBUA 5AHNA 1TYGA 1H51A 1OX6A 2ZA1A 4TX9A 3RLVA 3QRHA 4E38A 2B7QA 1MO0A 1TTPA 3NQAA 4WQ6A 5CPOA 2VFGA 3W1AA 3OEXA 2ZA3A 1QMLA 1OFBA 3QF0A 3CEUA 2ALDA 4RK8A 5A5WA 4HT3A 1W5QA 5GVJA 1HL2A 1FWTA 4N9BA 5DLCA 3GDKA 1OYCA 4S2CA 2YDAA 1O95A 4LUJA 3S5YA 4GWEA 5CZJA 1LRQA 4O16A 2VENA 4PEKA 3IIZA 4AWSA 1DOSA 1TV5A 3LCGA 4I7VA 4N4PA 5HWMA 1PHWA 1H60A 2EGZA 1C9DA 3UWYA 3F4NA 5K9XA 1IIGA 1WOAA 3C2VA 1SZFA 3IIXA 3W75A 4G1KA 1UJPA 3O63A 5KZDA 2QCHA 2DZVA 4Z1BA 1TCDA 2A6NA 3W71A 4O0ZA 4FEZA 4K6AA 3LCIA 4WY0A 2XN0A 4ZQMA 4LTSA 4KFPA 1DVJA 3S5NA 3LGEA 3TW7A 5LNSA 3L0GA 4YCPA 4GUIA 3W7NA 4N6EA 3P80A 3S0CA 3IV3A 2WSYA 1NEYA 3DU0A 4N6FA 1TTQA 3KFTA 3A22A 1DBTA 4GE8A 2V0TA 1F7BA 4GRSA 1SR9A 4LVFA 2YW4A 3P67A 3I7SA 2AAMA 2ZRVA 3NXFA 4BWLC 3S1UA 2HS6A 1KM6A 1JQVA 4R53A 5I3KA 3IGXA 4WXYA 2OT0A 2VELA 2A4AA 1KM0A 3C0JA 4RZ5A 2QUTA 1KBJA 2ABBA 4AVFA 4JTSA 1DHPA 4ML9A 1N55A 1YYAA 5CPNA 4RV8A 1VHCA 1F74A 4GJ1A 2V8ZA 3HF3A 2E5BA 3W83A 4XKYB 2CZDA 4NJKA 2E6AA 3RNDA 3FFSA 4K8EA 4AF0B 1VJIA 3C52A 3G3MA 4OE7A 3MJYA 3U6WA 1HO1A 3DGRA 2G5WA 3E12A 5F2LA 3HG5A 2B7NA 3TQKA 3HGSA 1JJKA 3G1HA 1G4TA 1E51A 4ADUA 1X8FA 3M0ZA 4QISA 2I1OA 2Y70A 4DF0A 5K2ZA 1ADOA 4MY8A 2J6XA 3TMLA 1KFBA 3LX9A 3LCWA 4TMBA 4BK9A 1AW2A 4HSNA 2RHGA 1W5PA 4RXGA 2J27A 1J2WA 3W07A 5HMSA 1M7OA 1DQWA 2W6RA 2X1SA 2ZZ2A 3C2OA 3FS2A 3W7PA 3T78A 3NL3A 4LC8A 5G4WA 2R8WA 3G3DA 2EKCA 1FCBA 4UMBA 2H6RA 4JD4A 4CNPA 3SJ3A 2DJXA 2ATMA 4JIPA 3T40A 1OVDA 1QCWA 1JCYA 1EEPA 1DJQA 3S9YA 5U4NA 4JX6A 3GDMA 1R2SA 3M5YA 1EP2A 2Y7FA 4UTTC 4QNEA 2Y88A 4OHQA 1H5YA 3TC6A 1KV8A 4MZ1A 3UNDA 1LBMA 3PSWA 5CSSA 3NPVA 1NVMA 3DFQA 1KA9F 1TPB1 3RLUA 3BGGA 1PS9A 3R13A 4KWVA 1TPUA 4QJ1A 3BG3A 2Z2UA 1B3OA 4NJHA 4CQ9A 4EIVA 4O1BA 1T0OA 4HPXA 3WK1A 1XBZA 2NUXA 3LHWA 3M41A 3GXTA 5HWJA 3AO0A 4MKNA 3M43A 2FLIA 1D3GA 2B7OA 2RDWA 1F2JA 1W54A 3L2IA 4O57A 3KAOA 3NDOA 1KV5A 1LYXA 4JIQA 3GX9A 1ICQA 3JS3A 1ZCOA 2E09A 3B0PA 4WX2A 5DBTA 4CQAA 4O11A 4AH7A 5K4ZA 1JCXA 4DBEA 3PAJA 3LI1A 2P10A 4BI5A 4Z1AA 3C56A 5D05A 1D9EA 3FJ6A 5F1VA 1N8FA 4MZYA 1MSSA 4HN4A 1S5VA 2NX1A 2DZUA 3BPWA 4J9JA 4DELA 3WFAA 1WBHA 5AYXA 3E96A 4E2BA 4HIBA 4IMDA 4LVAA 1D3HA 2CWNA 3HQ1A 5D2WA 3G1YA 3DFTA 3TAOA 4ICNA 1FY6A 3W1QA 3USBA 4CCEA 1LZOA 3MWAA 4FNSA 4O50A 3A24A 3KVKA 5DCBA 4JYEA 4LVDA 2BZNA 4AB4A 5D30A 3LHTA 5G2IA 1YDVA 1YTEA 3EWWA 4A2SA 3P74A 1G69A 1ONRA 3SGUA 1FXQA 6ALDA 4UTUA 1VRDA 3TX9A 2VFDA 4QSHA 3A21A 3G0UA 3MI2A 2UV8G 1VCFA 1OF8A 3LDVA 3W7EA 1KFJA 4MY9A 3NQ6A 2JKEA 1HFBA 4OQVA 5T26A 1TPVA 3BARA 2RH9A 3NQFA 1HUVA 1RQHA 2RFGA 2RDTA 2YW3A 4RXFA 3VFLA 3N14A 1AG1O 2CLMA 3W88A 4I9AA 3VCRA 3VKJA 4ALDA 3IVSA 3C2RA 4JY8A 5F2GA 1UASA 1GOXA 3BLIA 3DKLA 1X6UA 2V2HA 4TR9A 4HPJA 3P82A 4TO8A 4JTHA 1LLWA 3ELFA 3UWWA 1SW3A 4JTLA 2DP3A 3G18A 4DF2A 2B7PA 2QDHA 2YSWA 4QAIA 3W1LA 4H6KA 3FOKA 3MHGA 5ABTA 1GYLA 5G4EA 1VCVA 1FCQA 4M6QA 4FIRA 2VEIA 3TIMA 4O10A 1H50A 3S6DA 1WAUA 3IGSA 2ZA2A 3PBVA 5D2YA 4TMCA 2V82A 5CGQA 5FESA 1SW7A 1XC4A 1Q6OA 4AEOA 2ZZ4A 3TW6A 2ZZ1A 3GK0A 1VYRA 1JRBA 1LBLA 1W1ZA 3BG9A 3P81A 3GKAA 1OF6A 4PL1A 4PODA 2ZZ6A 3IEBA 1ZALA 5G2WA 3MBFA 3LXCA 5K3VA 2Q8LA 4CNNA 3TU9A 5F4WA 1BWLA 1QO5A 3GZ3A 1ZAIA 2PC4A 3NM3A 4NVTA 3STGA 2GVJA 3HG4A 1W8SA 3NPWA 4KFNA 3C2EA 3P61A 3HBLA 5D02A 4JS3A 5I3HA 2J88A 1WYIA 1O5KA 2FB2A 2R14A 1OHLA 3L66A 3EWUA 3W3OA 4O19A 1OX4A 3I6RA 5F1UA 4O12A 4WOQA 4JICA 1YDOA 3NAVA 2C3ZA 3N9RA 3N73A 3AJXA 2QCMA 2V81A 3Q2DA 4HNTA 1G4EA 2F84A 5CG7A 4KWWA 1K7XA 1OFOA 1CX9A 5H2ZA 3TK7A 2OT1A 1AL7A 4XTIA 4Y8FA 3I7RA 4O52A 4E0CA 1A53A 4JYFA 4A29A 1GVFA 4JDBA 3KRZA 4MPQA 1FXPA 4MFDA 4IX2A 1PCKA 3GAKA 4YWIA 3UPWA 4LVGA 3NL2A 2TPSA 4O0KA 1QPOA 3GDTA 3S1VA 4WOZA 3JR2A 5C5YA 5HQEA 4FXSA 4JY9A 4CCCA 3NNTA 2A7PA 2FQIA 1OG0A 4LC6A 1P4CA 4QITA 5D32A 2GUUA 3PWAA 4JTGA 2B4GA 1JVNA 3G22A 1KM3A 2HS8A 3LHVA 3PULA 2GOUA 3N2XA 1QR7A 4NXKA 2NXGA 1O4UA 1G6CA 2PURA 3MP3A 5DY3A 2Y63A 4BFAA 3LTPA 4E2DA 3P84A 3EXSA 1S3HA 4AWUA 3HGRA 5TBOA 1W56A 5DXYA 2NX3A 1QPQA 1LOSA 2YR1A 3QW4B 2YPIA 1TPWA 2QJIA 1OFRA 3PR2A 1LBFA 3G1AA 4EF8A 2V5BA 4JTIA 4ZQRA 1F5ZA 1O5XA 4L4MA 2CZFA 3EXTA 2I9EA 1Z41A 4GFSA 3MYOA 4O14A 2P0OA 4P2VA 1TMHA 5FF2A 1PVNA 1B57A 5C2XA 3TR2A 2ZRYA 4TU1A 3NG3A 2NZLA 4N9EA 1YPFA 3BGJA 1OFEA 2BTMA 3VI2A 1C29A 1SPQA 4BI7A 5CPLA 3ATZA 4UTMA 1ALDA 1QO2A 2FTPA 4IX0A 2DZSA 1X1ZA 1IXQA 3TJLA 3VNDA 4MIMA 4QQ3A 3U2OA 2EHHA 5EBUA 1OFQA 4YL2A 1ICSA 4OGZA 1I45A 3C8FA 4FXRA 3DI1A 5FF3A 3M1ZA 2CLKA 3HPSA 1TPFA 1OFDA 5K4XA 1XDMA 3LTSA 1UCWA 1GZGA 1T8XA 3LXAA 1ME9A 2NXHA 3QYQA 1KTBA 3BLEA 4NZFA 3A23A 4IPIA 1CW2A 2JBMA 5AHEA 2E5DA 3NPXA 3B04A 3FLUA 3HJZA 4YMZA 3C3NA 5EKYA 3W84A 5KTLA 2E6DA 5D2XA 4GBUA 2CU0A 3ABSA 2PE4A 3LXBA 2ZZ5A 4MLRA 4MOZA 4FX8A 8TIMA 1FX6A 1QPNA 2QCEA 3D0CA 1HG3A 5FEXA 2WQPA 2CLFA 4NJGA 4MJZA 3W7GA 3CQ0A 3DI0A 1VS1A 5KZEA 1QFEA 4O54A 2VEPA 2WO5A 4LRTA 2FJKA 3I7QA 1VGAA 2Y89A 1H7RA 1A5CA 3G0SA 3TXVA 2OZ0A 1KTNA 1FCVA 5I3JA 1V7YA 3TV8A 3UY7A 3KRSA 1K7FA 3TA6A 2OJPA 5I3FA 1Q6LA 3FEMA 4U28A 5KITA 3UZ5A 3RU6A 4NJJA 4PA8A 2GQ8A 4N02A 4DBDA 5IBXC 3QPZA 4Z1CA 2BSLA 3L21A 3Q37A 3LERA 4ZVJA 1XBYA 2DZXA 4IMFA 2YFOA 5AFDA 2QDGA 3ZWTA 3NOEA 2A21A 1SZEA 2CFFA 3EX6A 4NQ1A 2VFHA 1A50A 4KFOA 4YCOA 1G7UA 1VHNA 3O05A 3GKFA 3KVJA 5FEZA 2HMCA 1VR6A 2ZRXA 4RZ4A 3UXDA 1A5SA 4JX4A 3O15A 4PH6A 1I2QA 3NL5A 4LU0A 1MEIA 3O07A 4U4MA 3W1PA 3EWZA 3GLCA 4LS2A 3UYCA 2BWGA 2J9XA 3DKJA 3VE9A 1L9WA 2G96A 4YLWA 4JTEA 3UWUA 1W3TA 3MI6A 3W7HA 5EPDA 3W87A 3R2GA 4FB7A 3GB6A 4K36A 3DAQA 3A9IA 3LLDA 2W79A 3EB2A 3RFAA 3L5AA 1TPH1 3GR7A 2QCLA 3ZS4A 3NQ8A 3TCEA 1I2PA 2XN1A 1LM1A 2ZTKA 4EVZA 1WX0A 1EP3A 5C6MA 3FJLA 4WUIA 1ME8A 1F73A 3PC0A 3MHUA 2FFCA 2H90A 3DENA 1FDYA 5SWUA 2C14A 1W3IA 3GNDA 3QMSA 1W37A 3BW3A 1GVRA 5FEWA 4EWND 4XBSA 3CWOX 4MYAA 3TKFA 3U8GA 3F03K 2VFFA 1Q3NA 2X2GA 3F4WA 1P0NA 1GVSA 3PG8A 1JCMP 1MEHA 4NNCA 2C6QA 3PUDA 3R8RA 3L5MA 3CC1A 4K38A 2TRSA 4UFMA 3PUEA 2CLHA 1ZENA 1X7FA 5EY5A 4GUHA 3W2LA 4LW7A 3MP4A 1GYNA 4NXSA 5C55A 5HNRA 3HGJA 3QJAA 2C18A 4IJBA 3LCXA 3MW7A 3N34A 2DZTA 1MEWA 4NZJA 5K9DA 4AHOA 4AXKA 4C1KA 1KW1A 3FKKA 3LRMA 5U7SA 4AAJA 1TREA 3LRKA 4JTJA 1FDZA 1RZMA 2CLLA 3EX4A 4O17A 3IRDA 3W1MA 4IGHA 2ZCGA 1H62A 1TPC1 3TQ0A 1C8VA 3O6CA 4WJEA 1RV8A 1XFBA 2VEKA 4IQLA 1FBAA 3W74A 4OV4A 1VH7A 4WXZA 5F2MA 4FIQA 4XWUA 3RMJA 3EWXA 3C2FA 2QCDA 4UTJA 1H7PA 1GVQA 1XM3A 3GDLA 4B5NA 5G2HA 5BNKA 4YXGA 3Q94A 3QSTA 5AC6A 3A5FA 3IGUA 1Q6QA 3G8RA 3E0IA 1FDJA 1OABA 2QJGA 1GT8A 4ORIA 3BG5A 3LCHA 2DZPA 2VC6A 4K7VA 4RR4A 1TV8A 1XUZA 2VXNA 4C1LA 3LBCA 3F1QA 1GTHA 5AHLA 2G97A 3ZR4A 1IXPA 3IIPA 5LKYA 2QCFA 4O4VA 1AMKA 4XZ9A 2ZRZA 4NX0A 3EWBX 3TXZA 1KLYA 4LUIA 3P62A 3V1PA 1IF2A 3BV4A 1VZWA 4ADTA 3MMTA 4X2RA 5D38A 1TTJA 4UR8A 4DXVA 3B06A 1ZHAA 2CZ5A 3LB0A 5F2IA 2A7RA 4A3UA 1BWKA 3NGJA 5LGXA 5IM51 2NWRA 4R34A 2Y7GA 3NM1A 6TIMA 3PBYA 3W7OA 2E77A 1GG1A 3S5OA 1N7KA 1TB3A 2X30A 4X9SA 1WOBA 1YADA 3TSMA 3CEPA 3LRLA 5IBXA 1K8YA 5TIMA 3WJZA 3NVTA 3DZ1A 5EA9A 3STEA 2H3BA 5CPMA 3UD6A 2DORA 4NNBA 5K7JA 1G67A 2V30A 3DBPA 1HTIA 1DJNA 4LS0A 1BEUA 2WKJA 4XUGA 1G4SA 4UUIA 1PL9A 4IXHA 5CKSA 3HPZA 1WQ5A 4JYDA 1W3NA 1JR1A 3HIJA 3OVPA 4N4QA 4CCDA 4BWLA 3EX2A 1WDWA 3OG3A 4UFKA 3O1NA 2I14A 2KZHA 4O4WA 1LORA 1LDCA 4O18A 1PE1A 1KM1A 5HUPA 3B03A 1AW5A 5LHFA 4GC4A 4R7JA 4DPPA 3TROA 3LHUA 3MYPA 3TAKA 2ABAA 4UTKA 3GDRA 5A8GA 4WZHA 3MUXA 3DHFA 4ZQCA 2WPBA 5AYZA 2FPTA 4FNQA 3Q58A 3FYOA 3KVLA 1SZNA 1YTDA 3P8IA 4AWTA 3EEGA 4LV9A 1NAL1 3SZ8A 3E49A 2CZEA 1DORA 1P1XA 5C54A 1QDSA 4QIUA 2ISVA 3DFSA 1VLWA 1EUNA 3NYZA 1VLIA 4IPJA 4MLJA 3M5VA 4XKYA 1JULA 1M6JA 3CIWA 4AF0A 4DEFA 1QWGA 3NQDA 2NUWA 1M7PA 5FEPA 3L68A 4OWGA 1AK5A 3INPA 2JGYA 4TIMA 3QFEA 4Y96A 5CZTA 1Q45A 4JTKA 5BMWA 2DU2A 2ZTJA 2X16A 1Y0EA 3SI9A 1R2RA 1K02A 3BVJA 1K7EA 3THQA 2Y7EA 2ZBTA 5I3GA 3R5EA 5KMYA 3I65A 1SFLA 2C0AA 4UIOA 3VE7A 4RJEA 3W7CA 1L6SA 3O16A 3H53A 1VQTA 3QZEA 1P0KA 3PB0A 1LRTA 4UTHA 3MHFA 3UWZA 4WY0B 3IVTA 4FX7A 1VYPX 3B4UA 2P1FA 5D09A 1LRNA 3OA3A 3LHYA 2XFWA 2YCEA 1NF7A 2QCCA 3W7DA 2VFIA 4CQ8A 1T99A 1J5TA 3QQ0A 5K9CA 4UTTA 3C61A 4HNUA 3T4CA 4Z0JA 1QPRA 2QKFA 3SR7A 4A21A 1SO5A 4O1AA 4GUFA 3EXRA 1XKYA 3E02A 4O15A 4O1DA 4Y90A 3DXIA 3S8HA 4WY0F 2X1RA 3GR8A 3UWVA 1H7WA 1UUMA 1XL9A 4FF7A 3EX1A 4LT9A 2ISSA 1H61A 2EF9A 1GJPA 3TMQA 1R47A 4X3ZA 3C4UA 3H54A 5DELA 3M16A 4S1FA 3W1XA 1JUEA 2Y85A 4Y6GA 2FIQA 3CIXA 4IWWA 4M6PA 3ABQA 3PB2A 1KM5A 3O6DA 2C19A 2QUVA 3EX3A 1ZNNA 4GNJA 3PS7A 5D04C 3NQMA 1H7NA 3P60A 2WJZA 3PM6A 1IGSA 3CM4A 4M7SA 3WJXA 2EPHA 4POCA 3NQCA 4IMCA 5D03A 2ISWA 3L65A 3BK0A 1W0MA 3HPXA 4RZ6A 4Q4KA 3B8DA 4FNRA 4GUJA 1NFBA 5FF4A 1UBSA 4BR1A 3W9ZA 3CLMA 3CU2A 1JRCA 1XBVA 3TSBA 2VOMA 3SECA 4ZMGA 3DFOA 1KLZA 1WV2A 5FF0A 2VFEA 3NQ2A 4DO5A 2JKAA 5FF7A 2EAWA 2WOQA 1VPXA 2JGQA 2A7NA 3N19B 1NSJA 3W23A 1OFAA 4PCFA 1SO4A 4L4LA 4FX6M 4PL2A 5DY2A 2W0UA 1LROA 1FWWA 5D37A 4IUOA 5CSRA 4WD0A 1GTEA 5E0KA 2ZRUA 1B4EA 4UTWC 3HGOA 4P61A 4AHPA 3FKRA 3BO9A 4K8HA 4A2RA 3QMRA 1S5TA 1PV8A 5D2VA 4GUGA 3BLFA 1DKWA 1QOPA 4JEQA 3UPBA 1KM4A 1O94A 3PUOA 4LY8A 3M5ZA 5LHEA 4ZQOA 1R30A 2CW6A 3FA5A 3R12A 1KBIA 1NF0A 4W9TA 5I3IA 3W76A 5LZLA 3SY5A 4JTUA 5EMUA 4S2BA 3W7JA 1JUKA 3WJYA 4EF9A 4DF1A 5E93A 2V2DA 2A1YA 1H1ZA 5F4SA 3UXAA 4JXCA 5G1TA 2ZDRA 4ZL1A 2O7SA 2ZRWA 4MUZA 1SO6A 2PCQA 2ZZ7A 2V5LA 3NQEA 1JCNA 5LNVA 3ZFHA 1Z48A 2YYUA 3GVGA 4O1CA 1W31A 4M5PA 4D2JA 2NV2A 4RLIA 4KKXA 4OT7A 1ZFJA 3NO5A 2GJNA 5KINA 4X22A 3W1NA 3PBWA 1K8ZA 2FPYA 5CZ0A 4ZQPA 1F6PA 1XI3A 1SO3A 4HHPA 2Q3OA 1GVOA 3UZJA 1BKSA 2WNZA 3W85A 3L0NA 4RKAA 3ABRA 2OMAA 2Q8ZA 2AGKA 1GG0A 4GXMA 3HO8A 1OYBA 2ZZ3A 3HG3A 3DH7A 3ZWSA 3SW6A 3DHDA 3R89A 3NZRA 3W22A 3ANYA 3L9CA 3G0XA 2O7QA 1EP1A 4NU7A 1L6WA 1LOQA 1EPXA 1FQ0A 2GJLA 5AHMA 5AB3A 2PRLA 1TJPA 3W7LA 3B05A 1UB3A 3P5YA 1A5AA 1R2TA 1B9BA 1FCUA 1OX5A 1XDLA 1MZHA 4NX5A 1KFKA 1TRIA 1GWJA 3G1XA 4MJMA 3L67A 5AHFA 2NXIA 4UCGA 3TC7A 1U5JA 3W7MA 3W2KA 4CNOA 4UFLA 1F76A 5E1QA 4ZZ9A 1PIIA 3GNNA 4HKPA 4QM1A 4M6VA 3S1WA 4FNUA 1YXYA 1TPEA 4JDYA 1EIXA 1SSGA 4UTLA 1VC4A 1FWNA 1WBJA 2G95A 3M9YA 4LNYA 5LNRA 4NNAA 3W1TA 3YPIA 2QEZA 1KTCA 3LOTA 3RF9A 4UMCA 2GVGA 5AOUA 1EB3A 1G7VA 2NX9A 3OBKA 3QMTA 1G4PA 4Z08A 4JR5A 3THAA 2X1UA 4JX5A 1SSDA 4HNVA 2TYSA 4UFHA 1PHQA 3W6YA 3G1SA 2PRHA 2H3DA 1U83A 1OYAA 1TSIA 2R94A 5F4XA 3M5XA 3W2MA 3EKLA 4IXXA 3W7KA 1IIHA 1F05A 3W7IA 1ZJIA 2E1DA 3G8EA 1KFLA 2C16A 2BXVA 4H3DA 3P5ZA 2GVLA 1OK6A 1I2NA 1YDNA 3TUUA 1TRDA 4FO4A 3LHZA 3NPUA 5CZSA 1SUXA 3S42A 2WV8A 3IIVA 4DQWA 1EWDA 3T44A 1LLZA 3H55A 1H7XA 3HMJG 3G1VA 3LBMA 1UUOA 4MY1A 3PSVA 3CHVA 3W7QA 2Z6IA 1EUAA 2Y7DA 3M47A 4JN6A 3P8JA 5AC8A 2QAFA 4M19A 1W5OA 5FI8A 1T96A 2H8XA 5J5RA 2C15A 2E68A 3S5ZA 4UTWA 3N3MA 3EWYA 1GEQA 3GAYA 1O60A 1H7OA 2DJLA 4UC5A 2Y62A 3SGZA 1YXCA 3W1UA 2NWSA 1OX4B 5LGZA 2TMDA 5G1YA 4JGDA 1X1OA 2HTMA 1XXXA 1ICPA 5HWNA 1TO3A 2E6FA 5AHIA 3P7YA 3GYEA 5HUOA 4UNLA 3UQNA 4NUWA 4UFJA 1Z44A 2E6YA 3LV6A 4LV4A 3IVUA 4O53A 3MO7A 3KX6A 2F7FA 2QCGA 2WNNA 3W1RA 3M44A 1LTDA 5D33A 3SIZA 2Q3RA 4BF9A 4O28A 2NUYA 3L0KA 3GXNA 2QAPA 3TQVA 3TFCA 3TH6A 2A0NA 3O06A 3NL6A 1RQBA 2WSRA 1ME7A 1SU5A 3G1FA 4BI6A 2B0MA 2YGYA 3SFKA 1A5BA 5AC7A 4FNTA 3QSRA 3NQGA 2GPTA 5DXXA 1WA3A 1BTMA 1VYSX 5KSWA 5TQLA 4Q32A 3QPYA 3DFPA 3LLFA 4XBKA 3HOJA 1H63A 2ZFAA 3HG2A 2YYTA 5KZMA 3JRKA 3TSDA 3C6CA 4IOTA 4EOUA 3UWQA 2IQTA 1V5XA 4DO4A 2V9DA 1K3UA 1M5WA 4RX0A 2RKXA 4QNWA 4Z1DA 3STFA 2NV1A 4FNPA 3OVRA 1XUUA 4Y9AA 3TE9A 3LCFA 3TNOA 3A5VA 4UFIA 4Q33A 3CPRA 2QUUA 1DL3A 3LV5A 3QM3A 3STCA 2Z6JA 4AMAA 2YZRA 1AL8A 4UNKA 4DO6A 1TJRA 1YXDA 1ZY9A 1YLVA 3QC3A 3FYPA 3O6YX 2E5CA 1ML1A 3E9AA 2NLIA 3K30A 1K8XA 1SFJA 1W5MA 4H4IA 1TQJA 3LI0A 3N9SA 4IMEA 2A2IA 1K03A 3W70A 4NJIA 2AQWA 4UMAA 4LRSA 1PCWA 3CWNA 4UR7A 3N2MA 3ABOA 3W2NA 3S1XA 3M6YA 1QAPA 4UXDA 3T55A 1DV7A 4N2YA 4ORMA 4MVAA 1RD5A 5HR7A 3NQVA 4RCXA 5DN1A 4M7TA 1XBXA 1OJXA 3NQ7A 1EA0A 3PVFA 2XN2A 2GQ9A 4OBTA 1I2OA 3B0VC 2Y61A 4LS1A 1TQXA 4OV9A 2WSQA 3IIOA 2JKPA 1OK4A 1HO4A 5LSMA 3GXPA 2BX7A 3WJWA 3M7WA 3T7VA 1B4KA 3NZ1A 1JCLA 1JQXA 2Z0IA 1LOLA 1DQXA 3UY8A 4N9DA 1IXOA 4ONVA 3QEZA 5LNUA 1I2RA 3KXQA 2FPVA 3W72A 3CTLA 2VKZG 2QF7A 2FB3A 5L9FA 1S5WA 3B0UX 4LVBA 3LCLA 3NA8A 1P5BA 5HJLA 3W7RA 4OU1A 4IMGA 2J24A 3QW3A 5EYWA 3KRUA 2TSYA 4K7YA 3MP5A 4UTIA 2DZWA 1VCGA 3ATYA 4LWWA 3WK3A 4FHAA 2BLEA 1Q6RA 2J9YA 3CB8A 3I68A 2LLEA 3O8AA 3OHIA 1F6KA 1JUBA 3EKZA 1SQ7A 3G24A 3MBDA 3LTYA 3QH2A 4CLMA 3W2UA
chains in the Genus database with same CATH superfamily
4JN8A 3SSJA 3FIGA 1RVGA 3MV01 3GVQA 1GQNA 3E2VA 3BOLA 3NEVA 2PUZA 1ZAJA 4PUJA 2Y6ZA 1CI1A 3ITGA 1MXSA 4HNNA 4HSOA 4HSHA 4NASA 1ZPTA 3KEHA 3WH6A 1WXJA 4M3PA 1QNVA 4GIAA 1Y65A 5BU6A 5LNWA 4HPGA 2HE8A 3DN5A 3H2EA 2YFNA 3EDDA 2PRMA 3OQEA 3G1DA 3OBAA 4W86A 4FOKA 5MHBA 3M07A 5AVHA 1V6UA 3TJ4A 4ILSA 1UOZA 1W32A 1J01A 3BXWA 4Q8UA 3S2CA 4PTNA 3OVQA 3VZZA 1M53A 1ZGDA 4PFMA 3APYA 4JTTA 4GVIA 1ECQA 2A3AA 4TX8A 4K37A 3AHVA 4JTFA 1LP6A 3B9AA 4YU1A 3NYDA 5HQMA 4D1JA 1E70M 2J9ZA 3C5QA 5HNUA 3QQ1A 3OBEA 4A22A 1VFSA 3WO8A 4NIRA 4NT0A 1RSCA 4L1WA 1TX0A 3ZVIA 1RCQA 1EHNA 3JUGA 4DWSA 3BLKA 4REQA 3U3HA 2A5HA 2HK1A 3H2OA 4AHQA 3TYUA 4MZ8A 5H91A 4QJ3B 5D2TA 3QVQA 4J3VA 2ACSA 4LBUA 4D6GA 4GO8A 2A85A 3GQYA 5ECVA 4H41A 4LOCA 2RDUA 1A5OC 3WNMA 4UB9A 1OX6A 4TX9A 3QRHA 1U5HA 2B7QA 4C65A 4UZSA 1JDFA 4P7NA 4QEHA 1D2KA 2VFGA 3W1AA 2V63A 1XD0A 3OEXA 4M51A 4V33A 2QVHA 1QMLA 4IP4A 1MVYA 2YCLA 1XYMA 3A3XA 1AJZA 5FOOA 5GVJA 1EH9A 1HL2A 1IEQA 1FWTA 5DLCA 3WMLA 1X6LA 3URQA 2XUCA 4WGXA 5TAOA 2PLKA 2CZVA 4GK8A 5LIWX 2GJXB 5EGRA 5IHRA 3LCGA 5HWMA 4CD6A 5DQPA 4IM4A 3TVAA 1C9DA 3LU2A 3UWYA 1IIGA 5CBBA 3T6CA 4G1KA 4B5VA 3VKBA 1WKEA 3UR7A 3O63A 2QCHA 4Z1BA 2A6NA 2F6KA 3ITLA 4O0ZA 1UKOA 2R24A 4WY0A 4AIEA 1DVJA 3S5NA 5A6TC 1Z69A 5E70A 4YCPA 4GUIA 4N6EA 1MUMA 3SFWA 1WB0A 4URIA 1WDPA 1UWUA 4HU4A 1DBTA 2QGHA 2CCRA 3AMDA 2AAMA 2ZRVA 3I7SA 3IACA 4JTDA 4BWLC 3S1UA 1KM6A 1JQVA 4R53A 1GOIA 1XLLA 1RP8A 4WXYA 1JZ2A 5C9WA 1XIMA 4W4QA 5BXSA 3ANUA 3Q4DA 4AVFA 3WQFA 1DHPA 4C6EA 3QQWA 4ML9A 4XUYA 2I17A 5CPNA 4D6JA 1J0IA 4YJ5A 2ZADA 2V8ZA 5BXPA 3HF3A 4W93A 2PLCA 3EMZA 3FFSA 4K8EA 4B9YA 1VJIA 4OE7A 1HO1A 3N15A 3TQKA 4JNYA 4QS5A 4CEUC 4NZ5A 1UYQA 3VGGA 1MW0A 5FAGA 1G4TA 4JIIX 1X8FA 3XIMA 3TYAA 4QISA 4O1FA 4DF0A 4H83A 1OGSA 3SN1A 1ADOA 2RUSA 3LX9A 2GDUA 2J7BA 1CB7B 2XWEA 1M7OA 2W6RA 3I3DA 1NTHA 3FS2A 5HDRA 2B31A 2V5DA 2R8WA 3B97A 3BUVA 4JD4A 4CNPA 3P6LA 3PZOA 5ABFA 2BY2A 4C6IA 5HBFA 3WD2A 5GJMA 5HPOA 5LIYX 1P0EA 1E55A 5U4NA 1RY8A 3N04A 2Y1HA 5EFDA 4S3CA 3HQPA 2WZEA 4UTTC 2Y88A 1CXLA 3IK4A 4S3GA 3WLRA 3NCOA 3UNDA 3PSWA 5CSSA 1NVMA 3LNPA 3WH9A 1KA9F 1Z3NA 3RLUA 4QE4A 1JYWA 3POHA 4ZXLA 3TCSA 4AIOA 4EIVA 2WPGA 4O1BA 1T0OA 3M41A 5HWJA 1T41A 2ZXAA 4MKNA 1HVQA 3ZT7A 1TWSA 3MKCA 5XIAA 1EO5A 4HA4A 4GD0A 2PDCA 3IWPA 4EACA 1B30A 3GX9A 2PGRA 3B0PA 5DBTA 1CZ1A 4HK6A 1W3KA 4AXNA 4AH7A 4FAMA 4DBEA 3LI1A 1QRQA 1LT8A 2VP8A 4Z1AA 5I5RA 3QR1A 1N8FA 4XZNX 1S5VA 4HIBA 3WD3A 1D3HA 2CWNA 4NILA 3HQ1A 4GG9A 5D2WA 4R27A 3OW1A 1FY6A 3USBA 1R7OA 4CCEA 1LZOA 1KGUA 2ICSA 4LVDA 3WH5A 2QQ6A 3GNPA 4AB4A 3AALA 5FL1A 2PWEA 3EWWA 1FRBA 3LQLA 3P74A 1G69A 3WQOA 6ALDA 1R9ZA 1HL9A 1XS2A 3G0UA 3MI2A 2UV8G 4KT2A 3L4XA 2AL2B 4BEQA 1XD1A 1HFBA 2PF8A 1HUVA 1RQHA 3N18A 2RDTA 3TONA 1EC9A 2CLMA 3REQA 3W88A 1W3JA 5HQLA 4M6UA 3C2RA 5CXPA 1UASA 3D6NA 2CPUA 2BVYA 3LQGA 3GIPA 2PDYA 4HPJA 3LG3A 3SUTA 3CV7A 3ELFA 2WSKA 4QRNA 5EMJA 2X7WA 1SW3A 4H6KA 4C5YA 5ABTA 1GYLA 2QF8A 3FXGA 5G4EA 2Z1SA 2VEIA 3TIMA 4O10A 4Q4QA 5HANA 2EPLX 1UP3A 2ZA2A 5D2YA 5CGQA 5IXEA 1Q6OA 4S3EA 3TW6A 3GK0A 1VYRA 2WVVB 1TWWA 4DLFA 1OF6A 2ZZ6A 4PCNA 1YX1A 4D6FA 4CNNA 4IIFA 3TU9A 3EDEA 1K1DA 3BCDA 1QO5A 4YVVA 1H49A 2WC4A 3NPWA 4KFNA 3C2EA 4JS3A 1OWQA 2VZSA 1O5KA 4RDZA 3I6RA 1LT7A 1Y5XA 4O12A 4WOQA 3SY8A 3NAVA 3WEMA 1UR1A 2EO7A 3Q2DA 3WD4A 3ITTA 3ES7A 1K7XA 3UR5A 3DYOA 2Y2WA 4GA8A 4F4RA 1F3XA 4O52A 3Q65A 2PA6A 3DEQA 1GVFA 4JDBA 2GL5A 3O9NA 1ISXA 4IX2A 1PCKA 3UPWA 1CGTA 1A5LC 3NL2A 4AZGA 1FWAC 4O0KA 1QPOA 4C90A 4FA3A 2G50A 3WF1A 4ZEPA 4RE3A 3MUCA 5CBIA 1VEMA 1V02A 4MM1A 2WZMA 5A8MA 1OINA 3KOYA 2QMJA 1JVNA 1E71M 3LHVA 2NXGA 1O4UA 3MP3A 3UXLA 3MUY1 3F7JA 1PAMA 6A3HA 4BQ5A 5AYIA 3HGRA 3VNYA 1QPQA 3QW4B 4F0SA 1OC5A 4EF8A 4ZQRA 3NZGA 4L4MA 1F5ZA 1WCGA 2CZFA 4H7CA 2I9EA 4GFSA 4O14A 3MYOA 1IR2A 1XINA 2INEA 5H1WA 1PVNA 2ZRYA 4WSJA 1ZU8A 3CNYA 3TTOA 4N9EA 3CUFA 2BTMA 1SPQA 4DJFD 2RAGA 4BI7A 4U10A 2FTPA 2QHAA 4F0KA 3EWCA 4IX0A 1EIBA 4V1XA 2ZVRA 1X1ZA 4QQ3A 2EHHA 4GOAA 2YA1A 4OGZA 3FJ4A 2ZX5A 1JGIA 1OFDA 3WY1A 4L9ZA 1E0VA 4FS9A 1GZGA 3LXAA 4NZFA 3T81A 4IPIA 3ARVA 2JBMA 5AHEA 3NPXA 3FLUA 1NWTA 4GBUA 4WRHA 2J4GA 3WCZA 2PE4A 3LXBA 4CNSA 3W27A 4KCTA 5ABHA 1LF1A 4MLRA 5IDZA 4FX8A 1RD6A 4HZ8A 8TIMA 2E4TA 4HP5A 3GSMA 2DQXA 3WQDA 2CLFA 1J0ZA 3QHOA 4XV0A 3WLKX 1F3WA 4UNIA 1E5NA 2WHJA 4RZBA 1PDYA 4O54A 2PGWA 4HCLA 3BE7A 1QI4A 3USZA 1A5NC 2QUNA 2OZ0A 4HTBA 1W3HA 4TUFA 1JAEA 5I3JA 1K4HA 1UG6A 1ZQ5A 3FEQA 4TX6A 2IPGA 3A47A 2WVVA 3UZ5A 1JZ8A 3F2CA 2HV5A 3AMGA 2F2KA 2TODA 4N02A 2DW6A 3QBUA 2X1IA 4DBDA 3FVMA 5IBXC 3Q37A 4EX4A 3LERA 1B5TA 4F8XA 1EC7A 2A21A 1SZEA 1S1RA 1L8PA 3BSHA 4U3CA 4YCOA 3W82A 1G7UA 3BC9A 1BAGA 2XGIA 4ECLA 5FEZA 3RO8A 1F3TA 1OSEA 4RZ4A 3VIOA 1A5SA 4I5RA 4H6QA 3O15A 4RE0A 1XYBA 1RLCL 3HJEA 1GKQA 2C91A 1JYNA 4LS2A 4MNJA 1J2BA 1UPMB 1RP9A 2WCGA 2PP0A 4IZGA 2J9XA 4JFWA 1JAKA 1L9WA 4CN1A 4V15A 1HL8A 3MI6A 3NXLA 1NWUA 3R2GA 4WDWA 1Q7ZA 4C6QA 3R0DA 3EB2A 1YDYA 1TPH1 3GR7A 3S2JA 3TCEA 2XN1A 1LM1A 2ZTKA 3MUAA 1WX0A 3LSBA 4YYCA 3O2LA 1F73A 3PC0A 3PZTA 3MHUA 1XQKA 2H90A 1E5JA 4MF4A 1GVRA 1UR9A 4DNHA 5FEWA 1SR0A 3DC8A 1DQUA 2W62A 5JXQA 1P0NA 1E1CA 3PG8A 2C6QA 1BYBA 3D3AA 3S1GA 2CLHA 1X7FA 2G3FA 3MP4A 1BXBA 3BMWA 2C18A 4DYEA 1OZQA 1UR2A 3N34A 5K9DA 4C7FA 3N2BA 1KW1A 4AAJA 2GGEA 4Z2JA 2Y5EA 1FDZA 2XSBA 3SQMA 4PFHA 2FGLA 1H62A 2PLMA 2VEGA 3GFYA 2DSUA 1H3GA 1TPC1 2QDDA 2XZ9A 3V7PA 2VEKA 1BTCA 5A8NA 4IPPA 4UOZA 2PDWA 3URBA 3K4DA 1XW8A 1F3EA 1E72M 5CC5A 1GVQA 3GDLA 1Q13A 5G2HA 1ZRQA 5BNKA 2CETA 3A5FA 4I5XA 1FDJA 4LSBA 3V1HA 4ERIA 1OABA 2QJGA 1BRLB 3UG3A 2Y5SA 3LCHA 2VC6A 4RR4A 3UA4A 4WSKA 2POTA 1IXPA 2PDUA 3IIPA 1K9TA 2IXUA 4A4AA 2QCFA 3B9DA 1AMKA 4EKJA 2VC9A 1BQCA 5M17A 2VI0A 4AZ7A 4IICA 1MMFA 3TXZA 1KLYA 1B54A 3VNKA 3P62A 3UJEA 3V1PA 1IF2A 1QNRA 4LFYA 3HPFA 1E40A 3IUIA 4XD6A 4ADTA 1OADA 3HN3A 5D38A 2EJAA 3SCNA 4LY4A 1D8CA 4DXVA 4AD0A 3SUWA 2CZ5A 3RRAA 5F2IA 3S9ZA 1F8IA 1BWKA 2UZ9A 2Z25A 2OGYA 2CBVA 4R34A 2R1NA 3K5XA 1V3IA 2Y7GA 1PYFA 2V3EA 2P0IA 1TB3A 4X9SA 2E0PA 2V38A 3TSMA 3LRLA 2F6XA 4LEQA 3STEA 3C0SA 4OKDA 3TYDA 2QJNA 1PKMA 3XISA 2V30A 3DBPA 2GSHA 3ENLA 4LCQA 2WKJA 4XUGA 4N42A 4UUIA 3VIHA 3AYVA 1WQ5A 4JYDA 1W3NA 2XTKA 3N11A 3WNLA 4BWLA 3EX2A 5EBAA 5LA2A 1O7AA 3AMLA 4NSBA 7ENLA 2KZHA 5DANA 3K4AA 3F5KA 5C0QA 3VGBA 3DC0A 4DPPA 2EPKX 4Q4OA 2PSNA 2ABAA 4UTKA 1W8GA 4Q8WA 3GDRA 1P6CA 3PTQA 5FCZA 1AQHA 3NDYA 5CH9A 2GJRA 4K68A 5AYZA 5E09A 2AMXA 2WMIB 4GZIA 7REQA 3WMBA 3P8IA 4UQ9A 2CZEA 5C54A 4NZCA 4W7UA 3QV8A 1E1FA 3DFSA 5HMEA 2E28A 3CV6A 4ZCWA 1I60A 3M5VA 4AVOA 4UTFA 3OLEA 1M6JA 5EMKA 5DMYA 4AF0A 3NQDA 3PK7A 4QDMA 1M7PA 3L68A 1AQ0A 3EB3A 1I1XA 3INPA 3AZRA 2JGYA 3AUOA 2W3ZA 2ZUUA 5BMWA 2DU2A 1Y0EA 3BVJA 3THQA 2Y7EA 5KMYA 4TOQA 4H01A 3I65A 4UIOA 3VE7A 1OC7A 3ZVHB 1XRFA 2D1ZA 1VFOA 3QZEA 2F9RA 2PDIA 4UTHA 3F2BA 4KW2A 3WMSA 2JEQA 4DJED 3OHMB 2VM8A 2DDXA 3QV6A 2HXTA 2XFWA 2YCEA 3QC0A 1E0UA 2XM2A 1J5TA 5M03A 4UTTA 3C61A 3T4CA 1A3XA 2VR5A 3NOYA 5A6MA 2DT3A 4A21A 1SO5A 3H4GA 4O1AA 4I9JA 1V0KA 3EXRA 4MWAE 3DXIA 5JMUA 4WLCA 2NQZA 3WBEA 1BQGA 2ZXQA 3RM9A 4ZTYA 3UWVA 5REQA 3N4AA 1AFSA 1QW8A 3VOGA 4LT9A 4OUEA 1GJPA 1UA3A 4YVXA 4X3ZA 2GWNA 4JAWA 1WNOA 1J0HA 1H5VA 3CZLA 4R88A 5J04A 4S1FA 3W1XA 1JUEA 4XBJA 4Y6GA 3CIXA 4IWWA 4M6PA 3D47A 1UD2A 3GG7A 4FLOA 4YTSA 5DF0A 4H1ZA 2C19A 2QUVA 1ZNNA 1DJGA 5EB8A 3P60A 4R3UA 2WJZA 1IGSA 3WJXA 4JIEA 3NQCA 5D03A 1JDEA 3L65A 3TYEA 3ERPA 3DIPA 1W0MA 4FK9A 1PJ9A 3HPXA 2H9AB 3SAZA 4Q4KA 2I56A 4FNRA 1NFBA 5FF4A 3ARZA 3H2NA 3L2LA 1V3HA 3MSRA 1Q2SA 1IT7A 1JDDA 4OIFA 4PSPA 2W63A 3AICA 1QBAA 1WV2A 2CITA 2XH4A 3MVTA 2EAWA 1W91A 1VPXA 2JGQA 4CD5A 2XSXA 3W23A 3RCNA 4L9YA 4L4LA 3CHCA 4PZVA 4KRTA 1LROA 1BSIA 1NQKA 1HJXA 1B3YA 1GTEA 2VRQA 2ZRUA 4AQLA 4AHPA 1KNWA 3CQJA 4S3JA 3S2MA 2J7DA 3VUPA 3BO9A 1X8CA 4QGCA 1H41A 1QVBA 1QOXA 4GUGA 4JEQA 2DFAA 1O94A 3PUOA 1BYCA 3SQSA 7A3HA 4NL1A 4H7VA 3VOFA 4BZYA 1KBIA 1NF0A 3VD4A 1Q2RA 1R85A 4HK7A 4XKMA 5LZLA 2C1IA 3SY5A 3W7JA 1JUKA 3VNJA 1FTXA 2CNCA 4AEFA 3WDPP 5F4SA 1EDQA 3UXAA 4NZ1A 3UETA 4ZL1A 2ZRWA 1R3QA 2ZZ7A 4WR3A 3HV8A 3ZLGA 5LNVA 2QNEA 5GNYA 4RDYA 2J7FA 4CQBA 8XIMA 4OT7A 1DIEA 4GI8A 1EF3A 4PBEA 1CGVA 4X9YA 2WNZA 3VO0A 3MMUA 3EZ4A 3APTA 1UC4A 3MQTA 2OMAA 2Q8ZA 2VR4A 2AGKA 1GG0A 3GM8A 1Q7QA 3HG3A 2ZXBA 3TTEA 4QJ4B 4ZGYA 1AZ2A 4JKMA 3Q45A 3IJQA 3W22A 2OVLA 1JNDA 1L6WA 3KHDA 3OGSA 5AB3A 3SN4A 1OX5A 4NX5A 2OODA 1ODZA 1TRIA 3ARTA 1I1WA 3KOXA 3G5EA 1T8QA 3TC7A 5T8GA 1OCBA 1XIIA 3VPLA 2SFPA 5E1QA 1PIIA 3N25A 4XAGA 4QM1A 4M6VA 4IQEA 4FNUA 1WZLA 3CLWA 1QHPA 2GGJA 3T0CA 4C1NA 4LJ3A 2BGSA 3AISA 1EIXA 1WXZA 4B15A 1FWNA 1AH3A 2G95A 1GVIA 1PB0A 1HNYA 1KTCA 3OZYA 4KWSA 4UMCA 4YTRA 1EB3A 1G7VA 2NX9A 3OBKA 5C9ZA 1G4PA 4NI8A 4Z08A 3SJNA 1XLHA 3N2OA 2F8QA 2X1UA 1SSDA 3K8KA 3NSXA 4UFHA 3WLIA 4QCFA 1G1YA 3WDRA 1U83A 3RHGA 1OYAA 5F7UA 4QQUA 3M5XA 1XLCA 1XWYA 3EKLA 2FHBA 1IIHA 3W7IA 2E1DA 3S4TA 5IHSA 4J4KA 3P5ZA 2GVLA 1I2NA 1YDNA 4LAZA 1EBGA 4W87A 3A64A 3VNIA 4HA1A 2DVUA 1QT1A 1BVZA 5ECUA 4M56A 1DJWA 1HP4A 1PYMA 1LLZA 2V67A 3EWDA 3VGEA 3I6EA 3G1VA 1UUOA 4E8DA 3M47A 1EJXC 3WN6A 1OC6A 2H8XA 3ZSTA 5J5RA 1SZRA 2E68A 3IJLA 3S5ZA 1S39A 3N3MA 3EWYA 4PCTA 4ERAA 3GAYA 4RW5A 2NW0A 1EDGA 3U0HA 2OZTA 2CBIA 1YXCA 2QUMA 3W1UA 4DI8A 2NWSA 1FWHC 1H11A 1UPPA 1RHCA 3B8IA 1XXXA 1ICPA 1DXEA 2OELA 4JL2A 1JFXA 3ZJKA 1OT2A 4AFYA 2W9MA 2E9BA 1Z44A 3LV6A 4LV4A 2HCVA 3KX6A 3SIZA 2WVSA 2Q3RA 4O28A 3UT0A 2X40A 2WWCA 2QAPA 3T05A 3EA3A 3TH6A 3UU0A 4EAYA 1E6XM 2JQXA 1C8QA 2WSRA 4BI6A 3E0LA 4DUVA 2YGYA 1A5BA 1GEHA 1WUEA 3R1ZA 1X38A 4MWAC 3IJ9A 1E9ZB 3L4YA 3QPYA 2OGJA 3LLFA 3HOJA 2NQ9A 2ZFAA 4WGHA 2E9LA 3QR3A 4IOTA 3ARUA 1YE4A 1IEIA 2V9DA 1K3UA 1M5WA 4DBSA 4I90A 2PGEA 3STFA 2NV1A 4FNPA 3SEPA 1XUUA 4ZFMA 1VIWA 3BJTA 4IHCA 1NU5A 2XIOA 4XAPA 4J3SA 3KDOA 3CUZA 4MB4A 1TWIA 1G94A 3SRHA 4DO6A 1TJRA 3GUWA 1ZY9A 1FWEC 2VD8A 3FYPA 3O6YX 1JYVA 1UWRA 2NLIA 4NRRA 1SFJA 1W5MA 3N9SA 4IMEA 1E6NA 4NJIA 1PCWA 3K1GA 4LF1A 3S1XA 1QAPA 4H8HA 4UXDA 1DV7A 1BGAA 4N2YA 1UQYA 1TJ1A 4ORMA 2WBGA 1NP2A 5HR7A 3UJFA 5A69A 5DN1A 3GXDA 1XBXA 5AZ0A 3B9EA 2BVDA 3NQ7A 4J7RA 3V4BA 2WYSA 3L7RA 3SUVA 1OIMA 4IQDA 5HMFA 4P7RA 3U7BA 1PZ3A 1M04A 2ZUWA 5MKGB 4LS1A 3IIOA 2JKPA 3FY1A 3E0WA 3M7WA 1B4KA 4PUUA 1JCLA 2HZGA 1MXGA 1XH1A 2IQDA 3VIPA 4FALA 3MDWA 3MO4A 2FPVA 3W72A 2QF7A 3OOQA 4HMCA 1S5WA 4G7EB 5A6JA 3B0UX 2C0HA 3AIQA 4WVXA 4J27A 3N4EA 3W7RA 4IMGA 1V51A 2O9PA 3ORWA 5TF0A 3SN0A 1NOFA 1SVDA 4UTIA 3A3WA 3WNKA 1Q6GA 3MU7A 4X63A 4LWWA 2YBUA 2BLEA 3OHIA 2P3EA 1DPMA 3QKZA 4C60A 4PEEA 3BAIA 4ROPA 1F6KA 4K1GA 4PR4A 4GACA 1C90A 4I6VA 3G24A 4KCUA 4CLMA 3SRFA 4S3DA 1T5AA 4ADSA 5CEWA 1YNQA 4N7QA 1X98A 5BOOA 2Z1BA 3IJ8A 1ZP4A 4U33A 1KFCA 3AYRA 1DYSA 1L2UA 1J4EA 3ZM8A 3KBWA 4B2DD 4GINA 4UBPC 2WNQA 5RUBA 1TV7A 4F0MA 2BDQA 1F4AA 3RILA 3VD9A 3PG9A 1TPDA 3DFNA 3CUXA 5HULA 1FWCC 1W1A1 1LQAA 1XRTA 1A5UA 4XQ6A 1J6OA 4O8RA 4QG8A 4C7GA 1YEYA 2QMKA 1EXPA 1E4LA 2I5IA 3IJIA 3HURA 3TDFA 4WSHA 3MVIA 2GDVA 3CZGA 4G8TA 4BA0A 5IFTA 1Y8BA 1RA5A 1YBQB 1QK2A 4L1XA 1UP0A 3PFRA 6ENLA 1G9HA 3MI3A 1TIMA 4K1WA 5HINA 1LCOA 4PTWA 3EAUA 2PDQA 4HB7A 4EWJA 2J75A 4Z0SA 3W6MA 2GFTA 4W8LA 2BY3A 2ZIDA 2XINA 1XV8A 4DUWA 2AKMA 5HJXA 1U33A 1Q6FA 1AW1A 3NIYA 2ZVIA 2JIEA 4R33A 3OA5A 3PY2A 2J74A 3TJXA 1RUSA 1UD8A 1AH4A 3T0BA 2IKGA 1YPXA 2ZQ0A 3BW2A 3W81A 1I4NA 2ISFA 2FZ9A 1L6YA 4L1GA 3KL5A 4PUKA 1DWJM 2OCZA 3VZYA 2VEMA 4I7UA 3IARA 5G5IA 1XYZA 3KBJA 3WK2A 1H0IA 1REQA 3WUBA 2QCDB 3OIXA 3AIWA 4FXJA 4HU8A 2ZYFA 5CZKA 2V2CA 5DBUA 5AHNA 1H51A 3DBNA 1TTPA 4Z2LA 3NQAA 3WDHA 1XP3A 3H24A 4JFVA 4GIYA 3N4FA 4J5NA 4X0VA 4ENLA 2YL6A 3QPEA 3CUGA 5D8ZA 1IT0A 5MKGA 3TN5A 4FLSA 4KERA 2QW5A 3CEUA 1H0GA 3B0XA 4AIUA 4RK8A 3FDGA 1E4IA 3ES8A 4HT3A 1W5QA 3E5BA 3OJGA 1POJA 2YDAA 3GW3A 1O95A 2WC3A 3W25A 5CZJA 3SCVA 3RUBL 2VENA 4PEKA 4HD5A 4N4PA 3R94A 5BXTA 3AXIA 1V0MA 5K9XA 1WOAA 3IIXA 3PZVA 4LXFA 3E6EA 1UJPA 3CHDA 5IOBA 2VQTA 4H9XA 2DZVA 3W71A 1UH2A 4ZQMA 2XN0A 3VTRA 4DVOA 4EPBC 3V36A 3P80A 3CPUA 4LUSB 3AZTA 2WSYA 1Z7AA 3A22A 3DGBA 4DBWA 4L6DA 1VBGA 4GE8A 2XH7A 3QOMA 2V0TA 1VFHA 1NDYA 3U7VA 2BV9A 2YW4A 4LVFA 3LN3A 3ARRA 5IRPA 5I3KA 1GQIA 3IGXA 3AIRA 2PC8A 4QCEA 1VPQA 1YKWA 1KM0A 3PHAA 2WLYA 2ABBA 5DRIA 9XIMA 3II1A 1IWPA 4QE1A 1YYAA 1XLIA 1VHCA 2CYGA 3QOKA 1WKFA 3RPMA 3W83A 4CQDA 2YL9A 2CZDA 3SSZA 5A6SA 5JBEA 3C52A 3MJYA 2WB5A 5CPQA 1S5NA 3HG5A 2XVPA 3EA1A 1HGYA 5A6LA 4TTUA 1JJKA 4UCFA 4GKTA 3G1HA 3OO2A 3JZEA 3M0ZA 2I1OA 3AFBA 2GGHA 1LL7A 3IK2A 4MY8A 5A6BD 5LXXA 3LCWA 4MNKA 4WK9A 1RXOB 2EBNA 1NY1A 3GTFA 1DIKA 2RHGA 1JD7A 2J27A 1J2WA 4ZOBA 3TTQA 1PIGA 5HMSA 4NHVA 4M81A 2X42A 2X1SA 3U57A 2ZZ2A 2VHLA 3GBEA 2EKCA 2VRKA 4UMBA 4MPKA 3MMWA 3SJ3A 3UG4A 2DJXA 3HFYA 4JIPA 3LEPA 1E6RA 2CKRA 1K6WA 1JCYA 1DJQA 3AQUA 4B5TA 1R2SA 1NOWA 1UJQA 3M5YA 1RK6A 5A1AA 4Z2IA 2Y7FA 2REQB 3TC6A 4MZ1A 1TX2A 2GK1B 1LBMA 1B0IA 4GH1A 4QHRA 3PZNA 3R13A 1TPUA 2VC7A 4QJ1A 4D1IA 4LYKA 2OSYA 3T2QA 4NJHA 2MANA 4FF5A 1B3ZA 1QUMA 4HPXA 1XBZA 1I0DA 4HU3A 3ZSSA 3M43A 1P7TB 3GTIA 3VD5A 3FGCA 1RALA 1TZ9A 2I16A 4QBXA 1LYXA 2FYMA 2JE8A 3VFCA 2E09A 2J6VA 1EA9C 1I0BA 4WX2A 2VGFA 4Q8PA 2GDQA 4UQEA 2P10A 3WF4A 3THUA 4H9ZA 3MTWA 5D05A 5AY7A 1D9EA 2OYMA 1W17A 5F1VA 4FP1A 1V6YA 1AA1B 3WFAA 4JZ5A 2XFFA 2J78A 1XIHA 5AYXA 3E96A 4LVAA 5AC4A 2E3ZA 2F61A 3TAOA 1LUCA 2BG5A 3W1QA 1AUSL 3MWAA 4FNSA 3M0JA 1EJ7L 4EE9A 3A24A 2YJQA 5C2CA 3GZAA 4JYEA 1S46A 1TMQA 2BZNA 1YDVA 1YTEA 4Z2GA 1ONRA 1FXQA 2DUXA 4LUSA 4UTUA 2HPIA 2XYLA 1GOQA 1GOMA 1VCFA 3W7EA 1KFJA 3CL8A 3AHYA 4MY9A 4OQVA 1TPVA 3B8VA 1MYRA 1A3WA 4DJEC 2UY4A 1XRVA 1KGWA 3MMDA 2RFGA 1PUDA 2ZX8A 2WJDA 2YW3A 4RXFA 1VKFA 2VGBA 1XPGA 1KWKA 3VKJA 4Y9NA 4ALDA 3IVSA 1TIWA 3JW7A 4JY8A 4NAEA 5I78A 1DP0A 3NGFA 1Z89A 1RJRA 4XD5A 1BWVA 3UWWA 2D0FA 4JTLA 2DP3A 5I7GA 2QDHA 3WQEA 4QAIA 3A4JA 3FOKA 1OZMA 1EZWA 4AX6A 1VCVA 5HNTA 3W00A 3GD6A 3D3FA 1KFWA 3S6DA 3IGSA 1Q5MA 4ZB5A 2VURA 2V82A 3MA8A 4AEOA 2BHUA 2FZ8A 2ZZ1A 2HVOA 1XYCA 4DBUA 3BG9A 3P81A 3GKAA 4PL1A 2KAUC 1JZ4A 4DX3A 1B3XA 2PS2A 2V3GA 5AVNA 3EOEA 1JFHA 3GHUA 4S38A 1VBJA 3GZ3A 4NVTA 4J2PA 3STGA 3HG4A 1W8SA 3E74A 1F07A 3CYJA 3FX4A 2QYGA 2FB2A 4L4PA 2R14A 2QLYA 3W3OA 3NTYA 3Q67A 3WLSA 1VFLA 5F1UA 4JICA 1YDOA 1SFTA 4KWOA 3DFYA 1YQ2A 3N73A 2QCMA 1D3CA 2DT2A 3CH9A 1C9WA 3GXIA 4KWWA 1OFOA 1CX9A 5H2ZA 4MNLA 2REQA 3B8WA 3GBDA 4H2CA 1RCOB 4E0CA 1BG4A 4IPNB 4JYFA 3O0KA 3AU2A 3E2SA 3LPPA 3W26A 3DESA 3KRZA 4MPQA 1FXPA 3S6OA 4A3RA 5I03A 1K8CA 3WBAA 1ZJAA 3RLHA 3GHSA 4WOZA 5CAKA 1ONXA 4JY9A 4CCCA 2VWSA 5TD4A 5M3WA 4QITA 5D32A 5A2CA 1KCKA 1US2A 2GUUA 1Q6DA 4KEMA 2GOUA 3HMCA 2PURA 2OEMA 3VNMA 4XZMX 3FW6A 4BFAA 4A3QA 3LTPA 2Z24A 4YVPA 3CT2A 4AWUA 2VEFA 1W56A 5DXYA 4A8IA 4Q8TA 3UF9A 1W9UA 1IT8A 4C6JA 4U3AA 2QJIA 5FSDC 1OFRA 4ASTA 4J28A 3M64A 5T91A 4BCEA 2I5QA 4GVHA 3ZZ1A 1W1IE 1XX1A 4LAOA 4AC7C 5A8PA 1B2YA 3EXTA 4P2VA 4TTGA 1W1YA 4OUIA 5C2XA 2WC7A 2XVKA 1FWDC 3M6DA 3ITXA 2VWTA 2V6AA 2XDFA 1Q7MA 1OEPA 4U2YA 2DZSA 5E9XA 3TJLA 3VNDA 3PWIA 5EBUA 4YL2A 2EG7A 5I07A 2CXGA 1ICSA 3C8FA 4GYPC 4HYWA 2P8BA 1CB2A 2DSWA 5FF3A 2VX7A 4F0HA 3RJXA 3UPMA 2CLKA 2WCAA 1XDMA 5XINA 3MSYA 3QYQA 4ZENA 2NXHA 1EJSC 3CH0A 5CC3A 3B04A 4MKVA 5D2XA 5CJ5A 3ABSA 4PN2A 3QV9A 2G3JA 1HW6A 4MOZA 4RV3A 1IWAA 2UY5A 5DT5A 3A3HA 2QCEA 3D0CA 2IMRA 3DOPA 1HG3A 3AHZA 2A3BA 3BAXA 2CBJA 4OBSA 2ESCA 3CQ0A 2O4MA 3WENA 2HJPA 3HV9A 4XB3A 5CCZA 2EG8A 2VEPA 3UG5A 4BF7A 3I7QA 2Y89A 1X7IA 3I4EA 1KTNA 4XG1A 1V7YA 3TV8A 1UD3A 3ARQA 1K7FA 2ZOXA 5C2GA 2DUZA 4GBDA 3ONBA 2QV4A 2UY2A 4LQ1A 1HP5A 2INFA 1VEPA 5H8MA 3QPZA 2BSLA 3L21A 4ZVJA 1A4LA 4IMFA 2QDGA 3ZWTA 1V3LA 3NOEA 4XX6A 1A50A 2YB4A 3KVJA 3H23A 2ONEA 3T4WA 4XZBA 3CJPA 1NP0A 2F2HA 2D3NA 4HNOA 3WH7A 1TE1A 4RUBA 3QN3A 1I2QA 4LU0A 4U4MA 3DERA 3UG8A 3EMQA 4W5UA 4KESA 3QFWA 4P8VA 1XSJA 3K13A 2QT3A 4IFOA 3UYCA 4RNIA 2DEPA 3DKJA 1QNPA 1NFPA 4GC3A 4OBRA 4EANA 4IGMA 4YLWA 4JTEA 3LMYA 4DLMA 1JL8A 4V27A 1W3TA 4DJFA 4NZ3A 5EPDA 4FB7A 1B3WA 3GB6A 3S3GA 2NLYA 1C3FA 2DZAA 2QCLA 3OLGA 1I2PA 2HK0A 3WLNA 7CGTA 1KKRA 2FDMA 1ME8A 2PTZA 4IFRA 4IUGA 4AMCA 4ACZA 1FDYA 2C14A 1HJVA 2YDRA 1W3IA 3GNDA 3UEQA 1W37A 3RGTA 4MAZA 1HJWA 2PBOA 4OTKA 3TKFA 4J3TA 2X2GA 3E38A 1JCMP 4PMXA 3MCOA 3PUDA 3R8RA 4K38A 4IFKB 1QI3A 2ZC8A 4QROA 1TA3A 3PUEA 2Z1WA 3WQ4A 2X05A 2ZUMA 4GUHA 3HGJA 5A8OA 2PFHA 3T09A 1O1ZA 2DZTA 4C1KA 3WUGA 3FKKA 3LRMA 1RCXB 1TREA 5TNVA 3LRKA 2FMOA 3MJMA 4JTJA 3K8MA 1AD4A 1VJSA 3EX4A 1BKHA 3W1MA 2OPJA 2PU0A 4QFUA 2P50A 3T1GA 3O6CA 1FBAA 4OV4A 2J8FA 1HVXA 4FIQA 4E8GA 4P5UA 2VCCA 3RMJA 2XH0A 4J35A 1KQZA 1XM3A 4OECA 1JXJA 4GNKB 1ZBVA 3OLIA 1ITCA 4KPLA 2ZX7A 3U2ZA 2ODOA 1Q6QA 2PDMA 3G8RA 3E0IA 2XFRA 4JHZA 4M1RA 5BYWA 4HQVA 4ORIA 3GUGA 3IV8A 4LB3A 2Z7GA 3BG5A 3N2TA 2DZPA 4PYSA 4PMYA 1SJDA 1TV8A 2VXNA 3LBCA 1TJ2A 2F38A 1GTHA 3OZOA 3ZR4A 5CBJA 3R0UA 1VRXA 3TWAA 5LKYA 1K4GA 2AQOA 3UNTA 1ESWA 5H8PA 3PBGA 3UESA 1WZAA 4LUIA 3UERA 4HOWA 1W2VA 4GQGA 2HE5A 4IIGA 3MMTA 1TTJA 1BF2A 1NQ6A 5ABGA 4KEZA 4LF2A 3B06A 1OCQA 2ZX9A 2X8RA 3NGJA 3VUSA 4FOUA 4NAFB 3DG7A 2NWRA 3IUDA 1TCMA 3GVRA 1T6MA 2E77A 2HROA 1GG1A 4QTGA 1WOBA 1YADA 4TVDA 1QI2A 1BVWA 5TIMA 1DWHM 3QXBA 3WJZA 5EA9A 1ZTVA 4BS0A 1V6XA 3GWQA 5CPMA 3UD6A 1G67A 1XLFA 1R3RA 4DWSB 1DJNA 4LS0A 4REQB 2VT0A 1BEUA 2WMJA 1EYEA 4ZO7A 1PL9A 4IXHA 2AGTA 3R8HA 3VCCA 2D20A 3RX3A 4IJRA 3GR4A 3HIJA 3OVPA 1XIJA 1VB9A 3VCNA 1A47A 3WLHA 1WDWA 4CN4A 2OXNA 2C7FA 4O4WA 1LORA 4PMQA 5I77A 4CU6A 4W85A 1AW5A 4GC4A 3FSTA 2QULA 3EPMA 3LHUA 3MYPA 1JZ6A 3AZSA 3QY7A 4JNZA 4S39A 2E67A 2CEQA 5A8GA 1K70A 2V68A 4AW7A 3Q58A 1YTDA 2YCLB 3MKKA 4ZO9A 2XGBA 4NYYA 3H2MA 1WDDA 4GX8A 4IPJA 4L7ZA 3ALGA 4MLJA 4CU8A 4JHMA 4XKYA 1VIZA 5B7YA 3SY1A 1UIOA 3PTKA 5FEPA 1GNXA 1OQFA 3BAJA 3PZMA 4TIMA 4JQ4A 3QFEA 5CZTA 4JTKA 1DHKA 4DN1A 3WIJA 3R5EA 5DFAA 2C0AA 2PDKA 2W61A 4RJEA 2Z26A 4IFKA 3W7CA 2O0TA 2XIJA 2J77A 3RMEA 3FN9A 1P0KA 1Y5WA 3PB0A 3U2CA 3MHFA 4WY0B 3PZGA 1X1NA 2QV5A 5GJPA 4A8NA 3LHYA 3W7DA 4EXQA 3F5LA 3QQ0A 4OOUA 1D8WA 4PMUA 4HNUA 4AD1A 2Z29A 4Z0JA 1QPRA 4AZHA 4K2SA 5LA1A 4MNMA 4O15A 5DEZA 1NJJA 2WLZA 3CL7A 1TR1A 4PUNA 2X1RA 2R1MA 4A6GA 1CXFA 3BSMA 3TMQA 2DIJA 1NIUA 3V35A 1HJQA 1GZJA 1K77A 1A0CA 4QLLA 2FIQA 1ADDA 3GW0A 3PB2A 4B5WA 1KM5A 4GQBA 3WQ5A 1BHGA 1ECEA 4GNJA 2ZKMX 2GYIA 1H7NA 3PM6A 1DEDA 3CM4A 4M7SA 1R7AA 2PDLA 2AOSA 1GJWA 4RZ6A 3B8DA 3W9ZA 2PTWA 1ONEA 3M0KA 1JRCA 1XLAA 3TSBA 2PDJA 1PWMA 1SMAA 2VOMA 1CGWA 3SECA 4ZMGA 4NAFA 2OWCA 1KLZA 4L4OA 5GPRA 2XISA 5FF0A 2VFEA 4D8LA 4DO5A 4KMQA 2JKAA 5FF7A 3N19B 2A7NA 4JL1A 4Q4RA 4WIWA 3VZXA 4FX6M 1YNYA 2W0UA 4IUOA 3GS6A 5E0KA 1B4EA 4UTWC 4P61A 3FKRA 4J1OA 5ABFB 3MC5A 4K8HA 4B91A 3A4AA 1CNVA 1PV8A 2X0HA 3BLFA 2EQDA 4R7WA 4BQ2A 1KM4A 1MW3A 3VX1A 3JVAA 3EDFA 3R12A 4DJEA 5I3IA 2GVEA 3PNUA 3N12A 3W76A 2J8GA 2HPMA 2X7VA 4JTUA 1EJRC 4S2BA 2VCAA 3ZJ7A 1QI0A 3SCTA 4DF1A 3PPHA 1UW9A 3BOXA 5G1TA 5AZ1A 2BOGX 4H04A 4MUZA 1E6ZA 3U4FA 2PCQA 3K46A 4AY7A 3VYLA 3VNLA 3NQEA 2Q6ZA 4XIAA 2YYUA 3GVGA 3MUZ1 3ZR5A 4O1CA 1W31A 4M5PA 2NV2A 4RLIA 1E1EA 3B9OA 2VMFA 3BLLA 3EB4A 2DVXA 3ZR6A 4HN8A 3W37A 4X22A 4PUEA 3PBWA 1K8ZA 4KRUA 3URNA 3VOJA 1XCXA 3UZJA 1BKSA 1EF2A 1HKMA 3W85A 4PGLA 3W53A 4RKAA 3ABRA 4GIRA 4LPCA 2XFYA 5E9AA 1ONWA 1TFVA 1FHUA 3ZWSA 4AVNA 5HAOA 3I3EA 4XVDA 5A6AA 2XSAA 3G0XA 4LB4A 3M0VA 1FP8A 3QZAA 1S2VA 2QVNA 1LOQA 3V0UA 3S6TA 3W7LA 2G4FA 1R2TA 1XDLA 2I57A 3QGVA 1MZHA 1GWJA 4MJMA 3BANA 4AEEA 5DMNA 4ZO8A 4PUWA 5AHFA 2QPSA 3THCA 4UCGA 3EYPA 3H2FA 3W2KA 2PZNA 4CNOA 4GY1A 3KTCA 3UBPC 2W67A 1F76A 1Y5VA 2QGYA 3S1WA 3GC5A 4WKHA 3PJTA 2PDGA 3FYYA 5DX7A 2YL8A 1R3VA 1FFQA 3CHFA 1WBJA 2G8ZA 5LNRA 4UQCA 3W1TA 2QEZA 4HYVA 2D24A 1JPKA 3LOTA 3RF9A 2DVTA 2GVGA 2FGZA 3REQB 2PDNA 1UR8A 1UIPA 1TMLA 4NRSA 4CQCA 1S5MA 2YCKX 4ZE4A 5I02A 2H3DA 3LD5A 1UWQA 1KCLA 3DG6A 3M7SA 5F4XA 4D72A 4WCJA 4IXXA 3W7KA 1E6PA 3CMJA 3KW3A 1F05A 2BB0A 5A95A 3G8EA 5HJYA 2C16A 4H3DA 3LHZA 1SUXA 4DYJA 3VGFA 2HDJA 3VIGA 3IIVA 3T44A 2ADAA 4DNMA 3WD0A 3H2AA 2QZRA 3CHVA 4PB5A 3W7QA 4MB1A 3TOPA 2Z6IA 4JN6A 3P8JA 5AC8A 1W5OA 1KB3A 1A5MC 2CXEA 4HA0A 1TVNA 4CVWA 3T08A 4CGTA 1O60A 4PB4A 4AWEA 2DH2A 4UC5A 2Y62A 1WDQA 3BCFA 2WVTA 2OO0A 3ZLFA 1JG9A 5D4YA 2A79A 1VBRA 3LNMA 3QTPA 4DUOA 1V6VA 2HTMA 1TO3A 1EDTA 2E6FA 5AHIA 1CYGA 1J8VA 1Q66A 1LWIA 3GYEA 4TQTA 1F61A 4NUWA 3BCJA 3RYSA 5CC7A 1KXHA 2GVYA 2QCGA 2WNNA 1MW1A 3GU1A 3ARSA 1KCXA 1RJQA 2E40A 2BOFX 2NUYA 2NT1A 1BXCA 3MKVA 3GXNA 2VX5A 5LIXX 3A4WA 1NARA 3O06A 1L2QA 4D8AA 1QXLA 2ZUSA 2VOTA 1ME7A 1SU5A 1BLIA 2BVWA 5HATA 4B5SA 5AC7A 5AC5A 1WZKA 4P7LA 2Z28A 4PMJA 1J5SA 1WA3A 1BTMA 1W9DM 4OJYA 5JIWA 1VYSX 5TQLA 5I23A 1QTWA 3OTRA 3TZNA 4GYJA 2INZA 1WUFA 3HG2A 4L80A 3JRKA 3TSDA 4FPSA 3THDA 3C6CA 1ZLPA 3CL6A 1V5XA 2Y8KA 2YBVA 5C70A 3PPCA 4IH3A 4AD3A 4GJIA 3VOIA 4Y9AA 3S2LA 5CGMA 3LPOA 3CPRA 2QUUA 3STCA 2GZXA 3TN6A 2Z6JA 4AMAA 2YZRA 2I7GA 2OWXA 4BY3A 2V5CA 1P48A 3QC3A 4J40A 2E5CA 2WZHA 5I09A 4DWSC 2P53A 1ZUAX 4P7OA 3RCMA 3LI0A 3WBXA 5FJRA 1K03A 4UMAA 1V3KA 3W2NA 4HYRA 4H7ZA 3T55A 2WMHA 1RD5A 4X61A 3VC5A 3R11A 2D22A 1OJXA 2PDFA 4MWAD 5EMMA 4F0RA 3PANA 3EOLA 4OBTA 4JPGA 3QR0A 3B0VC 2Y61A 1W9XA 1J93A 1TQXA 2WSQA 3EKGA 1HO4A 1N82A 1HJSA 3T7VA 1F9CA 4R5EA 1LLOA 1U1JA 4P7QA 4FR6A 1KRMA 3UA3A 3A13A 1UOKA 1XCWA 3TN3A 1KXTA 1IXOA 1XLEA 5LNUA 1I2RA 4J2MA 2CC0A 2PDXA 2FB3A 5L9FA 2PPGA 3M0IA 1UKSA 2JFEX 1HKJA 4HTYA 4E3VA 3NA8A 3UVAA 2WMFA 1J79A 2J24A 4DAIA 1J12A 3UXIA 3MP5A 4DJDA 3WNPA 2F6UA 2D2GA 1I75A 2CHNA 3NWRA 3ATYA 4M80A 4ZB2A 3WK3A 2OQLA 3TEVA 3C2YA 1V03A 5HXMA 4LX4A 1R0MA 3O8AA 1CIUA 4LYPA 4PCSA 1TG7A 1JUBA 2C8NA 1R9YA 3WNOA 4F3HA 3GH4A 3QH2A 4N9CA 3F4DA 3LZ3A 3L5LA 3OU8A 1YPIA 1AD1A 3CQHA 2A6LA 1VPYA 4F2BA 1IEWA 4LEFA 1YTKA 7TIMA 1ZB5A 1KC7A 4XZHA 3P0XA 3PZQA 1PZ2A 4G2DA 4E4PA 2CLPA 4MYXA 3RR4A 1XFCA 2RDXA 1V02E 1GKPA 2XJ7A 4DZHA 3U2EA 4AZCA 1EHAA 4CD4A 3GIYA 1E15A 4L64A 2JEPA 4P8XA 4XD3A 3EDJA 3VK5A 1KM2A 2QJJA 4ZQNA 3POCA 2PI6A 2G3NA 3QYSA 4JFUA 1FWJC 4B92A 3VA8A 2QJHA 3KWXA 1JZ7A 1DIDA 3GY1A 1JCJA 2B81A 2ZUVA 5I06A 1E1CB 3CT7A 5JQ9A 2GQAA 1IQ8A 2BY0A 4LUTA 5CPTA 2OX1A 4GI6A 3LM7A 4XTDA 4BQ3A 1EYWA 3UWEA 5BMXA 2C1HA 1EX5A 1UZ4A 2FDSA 4W5ZA 3RK8A 3CZ8A 2WKLA 2WMGA 1R3WA 2DIEA 1I6NA 2R1PA 4JTQA 4L6OA 3FV9A 1GONA 2XVLA 2IPFA 3HB9A 2YXGA 1FWRA 3WLOA 1E9LA 1ZBCA 4FR1A 2CLOA 3OPSA 1KR0A 2HISA 1FUYA 2VCBA 1THFD 1E56A 1EPVA 3OLDA 3A9BA 3V75A 3AYTA 3KHJA 1TV2A 2GOKA 3PBUA 5GNZA 4PC8A 1HN1A 3WJSA 3WK0A 4KWUA 5LXEA 2C71A 1Q85A 1HJUA 1HKKA 2PDBA 3RLVA 4E38A 1MW2A 4NKCA 3EBVA 1J18A 3FAWA 3IAQA 1CXEA 5EMYA 3N29A 1E43A 3LBOA 2ZA3A 4B2DA 5CGTA 3CHEA 3IJ7A 4UOQA 2X2YA 1NH6A 2ALDA 1HKWA 4N9BA 1OYCA 3K8LA 3UR2A 3CBWA 3W38A 3VGHA 1XLBA 1QNQA 3PP7A 3DHPA 4O16A 5M1TA 1PWLA 4Y2WA 3BL3A 4AWSA 5EMLA 1TV5A 4D71A 3W24A 3QKEA 1OD8A 3C0LA 3RO6A 4XVEA 4CD8A 1A0DA 2FTWA 1SZFA 3W75A 4H8VA 4NY2A 1E0WA 4H9TA 4GPNA 2WQDA 5KZDA 3GC2A 4Y7EA 4K6AA 5HMDA 4KFPA 2PCEA 3H21A 4GHRA 3IRSA 4IQJA 3S47A 1X97A 1A0EA 1BF6A 3S0CA 1CCWB 3VINA 4N6FA 1TTQA 4C6LA 2Y5JA 1R3YA 1F7BA 4JBRA 2YKKA 1EBHA 4Q4SA 3S83A 8RUCA 3NZPA 3GG8A 4Q8MA 3NXFA 3P0WA 2BODX 4YWSA 3R7MA 2A4AA 1J11A 2FHFA 2JIWA 3C0JA 4RZ5A 1LQ2A 3VIJA 1JDCA 2EG6A 4D6DA 1GPFA 1N55A 7REQB 4RV8A 3LUTA 3AXXA 3BLDA 2VR2A 4UWMA 2R1KA 2E5BA 3WLJA 4WDTA 1ELSA 2E6AA 3RNDA 3WQPA 1GCYA 1P43A 4QJ5B 4AF0B 2BOEX 3U6WA 1GVEA 1S38A 2G5WA 3E12A 3QLLA 5F2LA 3QZ6A 3A4XA 2B7NA 3HGSA 3V18A 3BGAA 3H26A 5FJIA 3VVGA 4M0XA 1E51A 4ADUA 2Y70A 5K2ZA 2J6XA 1KFBA 1GK8A 4TMBA 4BK9A 3UJSA 4GZ7A 1W5PA 3AOFA 3ARXA 1JD9A 1DQWA 5EFFA 4ZOEA 3VIFA 1NWSA 2G3IA 3RPTA 1DTUA 3W7PA 5FJPA 3AIUA 3G3DA 3G6MA 2H6RA 1V6WA 1YNPA 2BY1A 5G1MA 1S2WA 1EEPA 3S9YA 3L4TA 4JX6A 1JF5A 3WELA 1EP2A 1WAWA 4JQAA 3LMZA 1E9IA 4Q7NA 4QNEA 1H5YA 4GI4A 1KV8A 2J79A 3GVVA 1MXDA 1GUVA 3NPVA 5REQB 3VKDA 1TPB1 5JIPA 4KWVA 3RX2A 2WWDA 1UWTA 4ROQA 1B3OA 4YHEA 4CQ9A 3H8AA 2WM0A 3LHWA 3GXTA 3R58A 3ZIZA 4GYFA 1D3GA 3WBYA 3WEOA 1W54A 1PTDA 3L2IA 3KAOA 3NDOA 2NQLA 4BEUA 1VFUA 1FWIC 3JS3A 1ZCOA 3SBFA 1OIFA 4JFSA 4CQAA 5K4ZA 2PZ0A 3N17A 4M82A 2JALA 3GH5A 1DWGM 1BYAA 4BI5A 3GFZA 3R6IA 3GDBA 4QR6A 4QSFA 1FWFC 3FJ6A 2GGIA 5KEZA 4HN4A 2NX1A 3BPWA 4J9JA 1UP2A 1WBHA 1S2CA 4E2BA 4IMDA 5M2FX 2NQJA 1B9ZA 3G1YA 6XIMA 3K4WA 5E6YA 2DSKA 4O50A 2YXOA 3L4ZA 4I5UA 1V8EA 5D30A 3LHTA 5G2IA 2VZTA 5A6BA 3JZUA 1Q4NX 4GLEA 1XIEA 1PXGA 4IGNA 3ZOAA 3SCRA 4NYUA 3W6LA 2VFDA 4LAKA 3A21A 3ZJ8A 3LDVA 2Z1XA 2JKEA 5T26A 1EJWC 3EPNA 3BARA 4ZR8A 3RXZA 2RH9A 4GQ0A 4XD4A 1E3ZA 7ODCA 3VFLA 2D0GA 4MADA 1AG1O 2FMNA 3HPAA 1DJHA 1MRAA 1PZ1A 4I9AA 2AAAA 3BLIA 3DKLA 1KO0A 2V2HA 2QIWA 4TR9A 2HBXA 4YIWA 2OR2A 3AMCA 3P82A 2XVNA 4TO8A 4TV5A 5E0FA 4JTHA 3CV1A 3JU2A 1TJ0A 3WLQA 3W1LA 3CZKA 3MHGA 2PEVA 3K2GA 3T2PA 2OB3A 4M6QA 1W1PA 4FIRA 1H50A 4F2UA 4HHLA 3PBVA 1DIOA 5FESA 3KLKA 1SW7A 1MI3A 3TJIA 4YS1A 1NELA 2ZZ4A 1JRBA 1LBLA 1WXYA 1XIBA 4B16A 3MBFA 3LS9A 1L8NA 4WF7A 3WQ6A 4KH2A 4EPKA 5F4WA 1BWLA 2WXDM 3S46A 3M0LA 2BGNE 2IXVA 2PC4A 2TAAA 3TW9A 3ZLHA 2GVJA 4C6MA 3P61A 3HBLA 5D02A 4S3FA 2ACQA 1OHLA 4LYQA 3L66A 1JNEA 1H4PA 5JVLA 1OX4A 5A2AA 1NOUA 4C1NB 2BXZA 2XIIA 2OYLA 1GJUA 3R10A 2C3ZA 2W91A 1X96A 3AJXA 2F84A 1M9HA 5CG7A 1Q63A 4HMDA 4UR9A 1FKXA 2OT1A 4QDPA 2PWHA 1AL7A 4XTIA 3I7RA 4IG2A 1A53A 3M46A 4A29A 2FZMA 4Q7IA 1UHVA 3ITCA 4MFDA 1B1YA 4LVGA 2WK2A 1GHRA 3GDTA 5BRPA 3JR2A 5J8LA 4FXSA 5BCAA 4MTVA 3AIEA 3HZ3A 4XK2A 3RU8X 3VGDA 2FQIA 1ENUA 1OG0A 4LC6A 2PGFA 1GZ1A 3KOZA 3RM4A 4IT1A 2VUYA 3PWAA 3MY9A 1UH4A 2B4GA 3NDZA 1E6QM 1XSIA 3G22A 2HVMA 4HZMA 2HS8A 3PULA 4Z1CA 4UZUA 1KQYA 1CPUA 3SCPA 1AJ0A 4E2DA 3P84A 2PMQA 3IS4A 3EXSA 3RDKA 3FJNA 3CO4A 5TBOA 1J0JA 2FH6A 2IKIA 2NX3A 2YR1A 1JPDX 1TPWA 5CQ1A 2P5NA 3B8TA 5A3HA 4JTRA 1LBFA 4JTIA 2VD9A 3WLTA 6REQA 1O5XA 3MZNA 3SCWA 1QNSA 1ISYA 1TMHA 1L6GA 1EJTC 1B57A 3NG3A 2NZLA 1UBPC 1XSKA 1YPFA 3BGJA 3HU7A 1C29A 5B80A 4PRWA 3ATZA 1ALDA 3VX0A 1XDJA 1CT5A 4C91A 3UCQA 3U2OA 1OFQA 2QIIA 5DO8A 1I45A 4FXRA 3DI1A 1UKPA 1L0PA 1CXHA 5I00A 2PTYA 5K4XA 1UCWA 1ME9A 3KCLA 1KTBA 3WFZA 1UMLA 2ZE0A 4WJ8A 1XIGA 4WDXA 1CW2A 3I6TA 4JKLA 4LCRA 2E5DA 3HJZA 5KTLA 2D2JA 2CU0A 4ZBCA 2XPKA 4IIDA 2ZZ5A 4XAFA 3P3BA 2X0SA 4XZLX 2WQPA 4AX7A 4BKNA 4NJGA 4MJZA 3WLLA 4C6KA 3BLOA 1QFEA 4G1NA 3H6OA 4J3UA 3RR1A 1T7LA 1E9YB 4AYGA 4GO9A 1KXVA 5D9MA 1H7RA 3G0SA 2P8CA 3TXVA 4G5DA 1FCVA 1OY0A 3UY7A 4I3GA 4EXBA 3TA6A 2I9UA 5I3FA 1V77A 1Q6LA 4B4FA 4U28A 3ITVA 4NJJA 3CAVA 2WKGA 3ECQA 4G6CA 1XBYA 2DZXA 3BAWA 2YFOA 9XIAA 3F2DA 4XIMA 3EX6A 4NQ1A 3BMXA 1OM0A 1VHNA 3O05A 3GKFA 5FJOA 4QDWA 1O66A 3CZJA 5BWFA 3UXDA 3ZO9A 3SM0A 3KBMA 1KBBA 1R38A 3LGDA 4F40A 3W1PA 2GQ3A 2R1LA 2BWGA 1QJWA 1PDZA 3VE9A 3N13A 3EA2A 3BTNA 4W84A 3AUJA 4A8LA 2FZDA 3W87A 2Z2BA 3HQNA 2VQUA 3DAQA 3NFUA 2W79A 3RFAA 2G4JA 3TR9A 3ZS4A 4D8ZA 2ZDSA 7PTDA 4PTDA 7TAAA 1IZCA 4Q8QA 1QW7A 3WDQA 1B31A 1PKLA 3T2OA 4KCWA 3DENA 4QE5A 3QMSA 3BW3A 4XBSA