1C9DA

Crystal structure of the complex of bacterial tryptophan synthase with the transition state analogue inhibitor 4-(2-hydroxy-4-fluorophenylthio)-butylphosphonic acid
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
266
structure length
264
Chain Sequence
b'ERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE (ALPHA CHAIN)
publication title Crystallographic studies of phosphonate-based alpha-reaction transition-state analogues complexed to tryptophan synthase.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 95
structure length 264
sequence length 266
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 1999-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1c9dA00
5D2VA 1ZFJA 1GPWA 3NM3A 3DKJA 1G4SA 3NL5A 1H7XA 4UNLA 1P0NA 3MUXA 3RNDA 3NXFA 2HSAA 1OHLA 3H55A 2C14A 1ZY9A 3QPYA 2YFOA 2I14A 2WSQA 3C2EA 2VEIA 3BK0A 5G1YA 3L65A 1OFDA 3E9AA 3UPBA 1W3NA 1EEPA 4NNBA 1YDOA 3M0ZA 1ME7A 3OEXA 4A22A 1ONRA 3HO8A 3MP3A 4Q33A 6ALDA 3TMLA 3EX2A 3G0SA 4LV9A 4O1DA 4MUZA 5L6UA 1VCFA 3NOEA 3W07A 4OGZA 4U4MA 4PCFA 4LU0A 3VE7A 4FXRA 1TO3A 2QCMA 5HJLA 3G0XA 3IRDA 3HG2A 3PUOA 3R2GA 3NQFA 1OK4A 1KTCA 3LTSA 3STCA 3T7VA 1U83A 4RV8A 5F1UA 3LHYA 4HNNA 1ZENA 1HFBA 1OFBA 3A5VA 3HGOA 4O13A 5DXXA 1H1YA 2E68A 3P67A 1LCOA 4JIPA 3W1QA 1KBIA 4AF0A 1TJPA 2Y70A 3IIXA 3GDMA 1X7FA 3F03K 2WNNA 3W1LA 1LYXA 4M7TA 4LVAA 1R2SA 3G24A 2FPYA 4O16A 3BG9A 3C4UA 3W7JA 1TPUA 4GNJA 3L9CA 1J2WA 4M5PA 2WOQA 3SFKA 2BXVA 4FX7A 4UMCA 2HS8A 3RF9A 3RFAA 3SJ3A 1Y0EA 3W85A 5LNWA 1GJPA 1HL2A 1CW2A 3W7PA 4GC4A 5HMSA 4CNPA 2JKEA 2F84A 3DGRA 2E09A 4NT0A 1THFD 3DI1A 1H7WA 3DFQA 4XBKA 2WQPA 1QPNA 5KMYA 4IMEA 5KSWA 3G8RA 1EP3A 4EWND 1QWGA 4JNMA 3UWZA 3W2MA 3CM4A 4OWGA 3TQ0A 4OV9A 4UR8A 3S1WA 3QSTA 1MEIA 3MO7A 2YSWA 2H3DA 3BVJA 3W7DA 4TMCA 2CLMA 3M5VA 1TJRA 4HIBA 1YDVA 3B8DA 3IEBA 2ZRYA 1AL7A 3O6YX 3DHFA 1XC4A 4LVGA 3UYCA 3QRHA 1F5ZA 2X30A 3S6DA 5CPOA 2B7PA 1GWJA 4RXFA 3G22A 1ALDA 5G1TA 1RPXA 3MJYA 1QOQA 1OFPA 3HB9A 3QEZA 2KZHA 1LRNA 2YCEA 1G6CA 3GB6A 3NQCA 2J9XA 2XN1A 4N6EA 1WBJA 1B4KA 4DF2A 1XL9A 4R53A 3HPSA 3TUUA 3GXNA 3S1XA 2Q3OA 3W7LA 1LBLA 3E12A 3W1RA 1KA9F 2OMAA 1LRTA 2VENA 3DI0A 4FF7A 3NZRA 1SW3A 3W84A 1UUMA 2YYTA 4N4QA 4LC6A 4FNQA 4I7UA 2NX3A 5I3GA 4O12A 5ABTA 1G69A 3MP4A 4GUHA 3NYZA 4JR5A 4UTIA 4FXSA 4JTJA 3W7NA 3L68A 4N9EA 4AAJA 1OG0A 1H62A 3BO9A 2QAPA 3VE9A 5DXYA 1NEYA 4JX4A 1QPOA 2X1TA 3O1NA 1UBSA 4O19A 3W2NA 3JRKA 2UV8G 4IMFA 3BPWA 1T96A 4X3ZA 3MMTA 4FO4A 3P82A 1FBAA 2BX7A 1XBYA 1SZNA 2RDWA 4JYEA 2V81A 3W86A 1L6SA 1K7XA 4YWIA 4BI7A 3PS7A 1W3TA 2BSLA 3W71A 3QZEA 1A53A 5BNKA 5A8GA 3QMTA 1OFRA 3HG3A 1PCWA 4GWEA 1SPQA 1ZAIA 1EPXA 4DBEA 4FNTA 3N9SA 3HOJA 2Z1BA 2PE4A 1HTIA 2QCCA 2GUUA 4ML9A 1WX0A 4C1KA 4N02A 1Z48A 3ZFHA 2ZRZA 2XN0A 5C54A 3CPRA 3BV4A 3NPWA 3USBA 1EA0A 2WNZA 4JN6A 4AMAA 2DZWA 5F2IA 3S5OA 3TKFA 1TCDA 3KVKA 3HGSA 3B0VC 3WJSA 3OVPA 3MI6A 2Y88A 4Z1BA 1HO1A 1QNVA 1LBMA 1K8ZA 1EUNA 2YDAA 3B06A 1WDWA 4I7VA 3LI1A 4IMCA 2HS6A 1TPDA 3W7MA 3N2XA 1W8SA 2TMDA 3W87A 4EOUA 1MZHA 3R8RA 1SW7A 3TSBA 1W5PA 4JTFA 3LCLA 1T8XA 3NL2A 2CLHA 1S3HA 1RR2A 2ZRUA 1I2QA 4UTTA 1N7KA 3N73A 1X6UA 4Z08A 1MSSA 1MXSA 2E5CA 3FYOA 3OVQA 2X16A 1ICQA 3Q94A 3E02A 3WJYA 1H60A 2DZXA 4N4PA 3BGGA 3DFOA 2A7PA 3LV5A 3PY2A 3NPXA 3DHDA 3STFA 1Z41A 3CQ0A 1YDNA 3C3NA 4GRSA 5HWNA 3P84A 4O57A 1LP6A 3LBCA 4FNUA 2JGYA 5BOOA 4IGHA 3GXTA 2QCFA 4U28A 2AAMA 3S8HA 1KFCA 1YADA 1OVDA 1SO5A 4ORMA 1WXJA 4IXXA 2CLOA 1KM5A 2Y7FA 1F6KA 2Y85A 4YLWA 2VFIA 1YTKA 4KFNA 4AWUA 3CU2A 2ZTKA 4RZ6A 2Z0IA 1KM1A 2FPTA 2VFGA 4RJEA 5LZLA 3MW7A 2A1YA 1AMKA 3KVMA 4MY8A 4AVFA 2B0MA 4UR7A 3FKKA 3KAOA 3NA8A 3NO5A 4UUIA 3P81A 4A29A 1KFBA 3NDOA 1Q6OA 1IXPA 5AHIA 1NF0A 4ZQRA 3FS2A 3UWVA 4EIVA 3R89A 4FNPA 2TPSA 3HF3A 1Q6LA 2Y62A 4Q4KA 1CX9A 1P5BA 3O63A 3ATYA 4JDYA 5EL1A 4DF0A 4QITA 2NLIA 4HN4A 3ZWSA 4UTMA 2YFNA 2R14A 2GPTA 3LX9A 1XM3A 1DQWA 4PC8A 1TTIA 2J9ZA 4WUIA 3T78A 5TIMA 1QCWA 4MZ8A 3P8IA 2G95A 4MVAA 5HULA 3W74A 4E2DA 4PTNA 2BLEA 2GVGA 2A5HA 3CEUA 3VCRA 1FDZA 1KLYA 1LBFA 3GDTA 3W2UA 3TC7A 2FIQA 4QSHA 4FX6M 4ZQNA 3GX9A 3MP5A 2VEMA 2NWSA 2DP3A 2VC6A 4AHOA 1ZAHA 4MPQA 1RZMA 2YR1A 4XBSA 4CLMA 2Y7EA 4IJBA 3UWYA 4S2BA 4TX9A 1DBTA 3MYOA 5F2MA 2NX1A 3L67A 5FEZA 4A21A 5F4XA 1OFAA 3M9YA 4E0CA 1A5SA 2ZDRA 1S5TA 3W7OA 3A23A 2OT1A 4ZVJA 3W9ZA 3F4WA 3L0KA 5F2LA 4DBDA 1OFOA 3UY7A 2ZQ0A 3SZ8A 1GEQA 1ZALA 4O1AA 1PHWA 1MO0A 4RR4A 1G4EA 1TPH1 4JEQA 4AHQA 3INPA 2ZZ1A 1YPFA 3DFPA 5HWJA 3L0GA 5F1VA 3VKJA 5CZJA 2VFEA 1XDLA 4XUGA 5I3HA 1DKWA 5EKYA 2ZBTA 3E49A 4DF1A 4LVFA 5LGXA 2VFHA 3W83A 3G8EA 4CQAA 3LDVA 2DZVA 3G3MA 4IOTA 3CB8A 2E5BA 3L0NA 4WY0F 1OFEA 3STGA 3EWWA 4RX0A 1TTJA 4M7SA 1TYGA 1PIIA 2O7QA 3TR2A 1FWTA 1ZJIA 2QJIA 3BLEA 1M7OA 2CZFA 3C56A 1VH7A 3U8GA 4P2VA 1A5AA 1Q45A 4Q32A 2FLIA 1YTDA 4K38A 1J4EA 1W1ZA 4M6PA 3I6RA 3WK2A 5IBXC 1TPB1 3W7HA 3L5LA 1FDJA 1UASA 2AQWA 5HR6A 5G5IA 5LNVA 2R91A 1PV8A 1W37A 1XFBA 2ZFAA 3TQKA 4TU1A 2JGQA 2QUUA 1RQBA 2Q8ZA 4Y8FA 4TO8A 3W76A 2JK2A 3P5YA 1VCVA 2WJZA 5C2XA 3I7SA 4GUFA 3DH7A 1H50A 1OYBA 1H7OA 4ZMGA 1JQVA 3NL6A 5FF4A 4DO4A 2A7RA 3EXTA 3HPZA 3I7RA 4M6VA 4Y6GA 4CNNA 5DCEA 3AJXA 1RQEA 3IIOA 4E2BA 1IGSA 1H61A 3DAQA 2WPBA 4O17A 4O52A 3ANYA 3A24A 3A9IA 2A2IA 2J9YA 2ZYFA 1HO4A 4OU1A 5DCBA 1DHPA 1QDSA 3EX4A 3EWYA 4UCGA 2Z2UA 3QW3A 5AYYA 1KFJA 1IXNA 5D2YA 2WNQA 4O8RA 1WOAA 2E6FA 1VLWA 1WBHA 2PCQA 2B4GA 2IQTA 2RH9A 1KFEA 5D02A 1JCMP 3QMSA 2F7FA 5DBTA 2Q8LA 4FHAA 3M44A 4M19A 2G5WA 1PCKA 5K9DA 5HWMA 1W54A 1IXOA 5E93A 1Q3NA 3QF0A 1GVSA 1DJQA 3CWNA 4LV4A 5AYXA 3GAYA 1G4TA 3S9YA 1AK5A 3W3OA 1YXDA 5DCDA 3MHUA 5HR7A 3QW4B 1WV2A 5EPDA 1DJNA 1SO4A 5EYWA 4FIQA 2Q3RA 4QIUA 3PAJA 1ZNNA 3SY5A 4BWLC 4K8EA 4N2YA 2GJLA 3EWBX 3NQVA 1SSDA 1TQXA 3DFNA 4KWVA 3G1DA 1G4PA 2NXGA 1NFBA 2AGKA 4DPQA 5F2GA 1SSGA 5A5WA 5C55A 3B0PA 5CKSA 2Y89A 3SGUA 2H8XA 3G1FA 3SW6A 4N9CA 3AO0A 3W7IA 3IIVA 3M1ZA 1EUAA 2ZTJA 3W23A 2CZ5A 5D30A 1FXPA 3EWXA 2P10A 1TIMA 2QUVA 3OHIA 4ZL1A 2YZRA 3ELFA 1P1XA 3QMRA 5HINA 3R5EA 1TV8A 3LB0A 1TMHA 4LT9A 3GIYA 2QKFA 3UXAA 1BTMA 2V82A 1O94A 4QISA 2YYUA 3TIMA 5AC6A 4GUGA 3H53A 5LHEA 4ZQPA 3L21A 2ZA2A 2Y6ZA 5F4SA 4IX0A 2GOUA 4JTIA 3GZ3A 4UTWA 1JRBA 4RLIA 1M5WA 2C1HA 4JTSA 1SO6A 3THAA 3TW6A 4WD0A 1KFLA 4O4WA 1G7VA 4K6AA 2ZRVA 3ABQA 4ZZ9A 2J27A 3S1UA 3CHVA 3CWOX 5CPNA 1VJIA 3NG3A 4GUIA 4Z1DA 4MLJA 1ZCOA 3B04A 3NNTA 1SUXA 2OZ0A 3A5FA 4UFJA 1A5CA 1RV8A 1JVNA 4X22A 2EPHA 3TA6A 1TTPA 4WXZA 1VYSX 3YPIA 4IQLA 1QMLA 1VZWA 1LOQA 3W1XA 5EY5A 1SR9A 4UMBA 3EWZA 3IGXA 4LY8A 3W7QA 4JTKA 4LTSA 4P61A 1GG1A 4NXSA 5LKYA 4RCXA 4OT7A 2B7NA 4DEFA 2VEPA 1OX4B 3LCIA 1TPVA 2QCHA 3MI3A 3NPUA 1B3OA 4NVTA 1OK6A 1D3HA 3W70A 3TJLA 1UJPA 4PFMA 4UFLA 2E1DA 4JD4A 4OBTA 1Q6RA 3C8FA 3KRSA 4R33A 3LRKA 3O6DA 1X8FA 4NJGA 5D04C 3DKLA 3N3MA 3PWAA 2ALDA 1F7BA 3TV8A 1GVFA 1WYIA 3QC3A 5DBUA 3QQ1A 1IIGA 3HG5A 2NUYA 2VEKA 5AC8A 1LZOA 3HQ1A 1W5MA 3LXAA 1A5BA 5FF0A 4LOCA 2R8WA 3KRUA 3W73A 1GYLA 3TK7A 3MBDA 1LLWA 3G1XA 4IPJA 3M5YA 3W7CA 5D09A 3EWUA 3LHZA 3P8JA 4DPPA 1ME9A 4RZ4A 4LUJA 1ICSA 1ADOA 1D9EA 3SGZA 4K36A 4ZQOA 3V75A 3W2KA 3M47A 1ML1A 1QO5A 3KOFA 2ATSA 4O18A 1N55A 1FX6A 3GVGA 4O0KA 1BWLA 4NJKA 3TC6A 5MHBA 2E5DA 3W7KA 4OHQA 1AL8A 2EHHA 2BWGA 2ABAA 5BW6A 5DLCA 4A2SA 4ZQCA 4QM1A 3RU6A 3WJXA 3MWAA 3BW4A 1JR1A 1M6JA 3SECA 4JX5A 4ONVA 2VFFA 4HT3A 4UTJA 3LLFA 2PRLA 1W5QA 1R46A 1TPC1 1LTDA 3LM7A 3BLFA 5FI8A 2V5LA 2YGYA 1I4NA 4CNOA 4S1FA 3DU0A 1QPQA 3A22A 1LOLA 3MHGA 5KTLA 3NQEA 4M6QA 3KHJA 3ZR4A 3H54A 4HNVA 3KVJA 5L9FA 5D2TA 4WQ6A 4LWWA 3W7RA 4N9BA 4G1KA 3A21A 4HHPA 1JJKA 4O14A 3PBUA 2O7SA 5C6MA 2ZZ3A 1YLVA 1XCFA 1SZEA 3OVRA 1C9DA 2FDSA 1YYAA 3C2RA 2QDHA 3MI2A 5CPMA 3C61A 3TAOA 1ME8A 4HKPA 1VHCA 3LHTA 3RK8A 2QCLA 4IPIA 4WY0B 3BGJA 3VFLA 4NX5A 3TROA 1B57A 1ZAJA 1I8JA 4YCPA 4O4VA 4YCOA 2H6RA 3EX3A 1FCBA 4POCA 4EF9A 1TV5A 4FNRA 5EMUA 5BRBA 1FWNA 1O60A 4Z0JA 4MY1A 2W79A 1OABA 3B4UA 1K3UA 1JCJA 4K8HA 5FF3A 2WSYA 1QFEA 4PL2A 1L9WA 2DORA 1W31A 3PUDA 2ISVA 3OA3A 1B9BA 2ISWA 4PEKA 4DXVA 4K7VA 2OJPA 5E1QA 3S5ZA 4R34A 1XBVA 4WOQA 2G97A 3W2JA 3Q2DA 1EX5A 1WA3A 2PC4A 3NQ8A 4JTLA 4C1LA 4N9DA 1XDMA 1SW0A 1EWEA 3M43A 3KFTA 4ICNA 1O95A 5D32A 3W72A 4MFEA 5CSSA 4QNEA 2YXGA 4Y90A 3Q58A 2V2DA 3G1VA 3WK0A 1SQ7A 6TIMA 2NUXA 1FY6A 3C2VA 5FESA 3QJAA 3PVFA 3IV3A 3LCWA 3WK1A 1VLIA 3NAVA 3PB2A 2WO5A 3UY8A 3NM1A 1AW2A 1NF7A 5F4WA 2CFFA 2FJKA 4ADTA 2VKZG 4DO5A 4K37A 5T26A 3P7YA 4GFSA 1SU5A 3PF3A 2C15A 4XQ6A 1TPWA 3W88A 5K9XA 4CQ8A 1U5JA 1IF2A 3TAKA 3M41A 4NZJA 4NQ1A 3UXDA 2A0NA 2B7OA 3TW7A 3EXSA 1JULA 2YW4A 3HBLA 4I7WA 4JGDA 5HUPA 1VYPX 5G2HA 3IIPA 4RXGA 3T44A 2ISSA 1KM6A 3P62A 2C3ZA 1E51A 1LROA 1GG0A 1I2OA 5AB3A 3ABSA 4RZ5A 1O4UA 1P4CA 3S1VA 4ADUA 3N19B 4KWWA 2Y7GA 1X1ZA 2R94A 3E0IA 3TXZA 4HSOA 1XKYA 4ZQMA 3RMJA 4UTUA 4WXYA 4NUWA 2H3BA 3NQ6A 2TYSA 2W0UA 1OF8A 3TSMA 2NV2A 2E77A 4O1BA 2HTMA 4BI5A 3S5NA 1K7FA 3W1AA 3JR2A 4MJMA 3LTYA 4UFMA 3UZJA 4JY8A 2NWRA 2ZZ7A 3TQVA 2VFDA 4Z0SA 4LS0A 2A6LA 3NPVA 4PA8A 1EWDA 1L2UA 1R2TA 3NZ1A 5DN1A 1GVRA 1TQJA 1VYRA 4RK8A 2GQ9A 5CGQA 1YTEA 3TNOA 3PB0A 1VC4A 4WJEA 3I65A 1OJXA 3M5XA 3PULA 3G1HA 3O15A 4J9JA 3O06A 3SSJA 4LRSA 3UZ5A 3LCHA 1K03A 1DV7A 4UTHA 3HJZA 2CLEA 1CI1A 4NX0A 1SO3A 5D03A 4TMBA 5HUOA 5AFDA 3PBYA 4HPJA 3RLUA 2QCEA 4UTKA 4X2RA 2WV8A 1RQHA 5U7SA 4FEZA 4W9TA 1F2JA 4WX2A 1PHQA 2C13A 3N9RA 3G1YA 3JS3A 3B0UX 3S0CA 5AHFA 3PUEA 1K8YA 4H3DA 1W56A 2B7QA 4BF9A 3FKRA 4NNAA 1KM4A 4DELA 4YMZA 5D2WA 4CCCA 2CZEA 4E38A 1UUOA 4FIRA 4Y96A 4OV4A 2TRSA 2BZNA 2NXHA 4LW7A 4WZHA 4GBUA 4MKNA 1OX5A 3GDKA 3BG3A 1TB3A 2BTMA 2J24A 2RDTA 3NQ7A 1KLZA 4JTUA 3FIGA 2GVLA 3LOTA 1KBJA 3GAKA 1J5TA 4BR1A 1H63A 1L6YA 3FJ6A 1RD5A 2Y7DA 2QCNA 3NQ2A 1TV7A 4MOZA 1OX6A 5EA9A 1JUKA 1TSIA 4MYXA 4XWUA 4BK9A 4NXKA 5G4WA 5KZDA 4UIOA 4IUOA 3S5YA 1KV5A 4BI6A 1WAUA 1LOSA 1HUVA 5CZ0A 4UXDA 1EIXA 3CEPA 1V5XA 3WK3A 2VELA 4MYAA 4B5NA 3NEVA 3VI2A 1EB3A 5G2WA 2C0AA 2QF7A 2VOMA 1VQTA 2J88A 2ZZ5A 3W7GA 1YPIA 1T99A 4UFHA 3IGUA 4LS2A 3LRMA 1XXXA 5AHLA 3F4NA 1FCVA 2QCDB 1SZFA 4LVDA 5FEWA 2P0OA 3N14A 5AN7A 1FQ0A 2C6QA 2FTPA 4QAIA 3BG5A 1VGAA 2DU2A 1G67A 3KRZA 1EP2A 3C0JA 4TIMA 5J5DA 2QEZA 1PE1A 1WQ5A 4WY0A 1QOPA 5KITA 1KTNA 1PVNA 3TXVA 5I3FA 4NU7A 3UWWA 3TFXA 1IXQA 2W6RA 4NZFA 3O16A 4PH6A 2DZSA 1OF6A 1KM2A 2DZPA 2NZLA 3MYPA 3GKAA 3QM3A 1N8FA 5K3VA 1VPXA 2V8ZA 3TSDA 3U6WA 5LHFA 3FEMA 1GTHA 4K7YA 4AH7A 4QJ1A 3CIWA 3D0CA 4FX8A 4AXKA 1RVGA 4IWWA 4UTTC 3QSRA 4JTTA 5EBUA 5FF7A 5CZTA 2FB2A 1DQXA 2EKCA 1H7PA 3DENA 1PS9A 3HGJA 3P80A 5BMXA 5AC7A 3O8AA 3EKLA 3GDLA 3W1NA 2I9EA 1ZHAA 2Y63A 1GQNA 1H7NA 2FFCA 3GNDA 3LCFA 1XI3A 2A85A 2QR6A 1HG3A 4MZYA 1A50A 1SFJA 3UQNA 3MHFA 3PBWA 3NR0A 5D2XA 1H51A 1BKSA 3QFEA 2I1OA 4TR9A 3W22A 2QAFA 2E6YA 4I9AA 3W1MA 2A4AA 4Y9AA 3ZWTA 3NGJA 3NQAA 4MIMA 1YXCA 1AG1O 1TRDA 3NL3A 4AWTA 3FA5A 1NAL1 4FNSA 3CC1A 3FOKA 5LNUA 5FF2A 5CG7A 2V2CA 4QQ3A 4H6KA 5KINA 3L2IA 3F1QA 3EEGA 4NNCA 3T4CA 3LGEA 4O10A 2QJHA 4AHPA 3PBVA 3KXQA 3QYQA 5DY3A 3T40A 5J5RA 1XUUA 1H1ZA 2XFWA 4ADSA 3ZS4A 2ZZ6A 4O11A 3HG4A 3FFSA 2ATMA 5IBXA 1XUZA 1M7PA 3GKFA 4XKYB 4GXMA 3UD6A 2DZUA 2D73A 1GOXA 2NX9A 3GR8A 1VR6A 2RHGA 4Z1CA 5D33A 3TU9A 4PODA 5I3KA 4QNWA 2EGZA 3LLDA 2RFGA 3SIZA 4L4LA 1NSJA 2A7NA 2WSRA 4O50A 3U2OA 1QO2A 1F05A 5FEPA 4KKXA 4DQWA 2CLKA 1S5WA 4NJHA 5FEXA 3R12A 2GVJA 1F73A 3W75A 4DO6A 3NQMA 2ZCGA 4NJJA 2PURA 2A6NA 3CTLA 7TIMA 1R47A 1V7YA 4A3UA 3KVLA 3DZ1A 3TFCA 1TTQA 3O07A 3GR7A 4HNTA 3E96A 5U4NA 4JY9A 3OBKA 3NQDA 3HPXA 4H4IA 4JTHA 4LUIA 4JICA 1VHNA 1GVQA 1GYNA 1W3IA 5KZEA 3CIXA 5G2IA 3TDFA 2FPVA 3LCGA 2PRMA 3BW2A 5E0KA 4JXCA 3FJLA 3OG3A 3GDRA 1FWRA 3N2MA 3LV6A 3EKZA 2QCGA 2WKJA 5IM51 2FB3A 3PSWA 3LXCA 3TH6A 1KTBA 3WFAA 3MBFA 1YXYA 2EAWA 3IVTA 4LS1A 3BARA 3P61A 1KW1A 1JRCA 1O5XA 5HQEA 1GVOA 3DFSA 1G7UA 3O05A 5K7JA 3TCEA 1F74A 1LM1A 2DJLA 2YW3A 1F6PA 1KV8A 2P1FA 2GJNA 2LLEA 4HPXA 4EVZA 2OX1A 5CPLA 1MEHA 1S5VA 4O54A 4ORIA 3OIXA 1FCQA 4HNUA 4JIQA 1I45A 4OE7A 1Z44A 3PG9A 4K39A 3G18A 1K8XA 2E6AA 1JCYA 1GTEA 3DXIA 3IVUA 1UB3A 5AYZA 4MY9A 3RLVA 4BWLA 4JS3A 4GJ1A 3PG8A 2V5BA 3EB2A 1C29A 2JKPA 1VRDA 3IGSA 1UCWA 3B05A 5D38A 5DY2A 1L6WA 4N6FA 3KX6A 3QQ0A 4LVBA 5GVJA 1FWWA 3GXPA 4LC8A 2CWNA 3I7QA 3HMJG 1GT8A 4JTEA 5KZMA 1QPRA 4IMDA 1KM3A 3P60A 5AHMA 3M16A 1FUYA 4UTLA 1JCXA 3WJWA 4XZ9A 2J6XA 1VS1A 1GZGA 1R30A 4MZ1A 3C52A 2GQ8A 5LSMA 3ATZA 1OFQA 5AHEA 3GK0A 4NJIA 4UMAA 4JDBA 4O0ZA 2A21A 5LGZA 4JYFA 3C2OA 3M6YA 2ZRWA 8TIMA 4AF0B 1LRQA 4AB4A 5AHNA 1AW1A 5LNSA 4UFKA 1JQXA 2PRHA 1PL9A 4LNYA 3STEA 3BW3A 3FLUA 1H5YA 1O5KA 2QCDA 4IMGA 2Y61A 2OT0A 1TRIA 4OQVA 2Z6JA 3EX1A 2ZA1A 5LNRA 3LCXA 3TMQA 1I2PA 1I2NA 5H2ZA 2ZA3A 4O28A 2V30A 2NV1A 1LLZA 1TREA 3O6CA 3N34A 3BLIA 4MLRA 3SR7A 3G1AA 2ZRXA 4O15A 1W5NA 1I2RA 4A2RA 4XTIA 4FB7A 1K7EA 4YXGA 4RKAA 4AWSA 3WJZA 1W0MA 2TSYA 3PM6A 2C16A 2QJGA 2CLLA 4JTGA 1FWSA 1W5OA 5CSRA 1FXQA 5TBOA 1OYAA 2QUTA 3I68A 3HGRA 3DFTA 3GYEA 2RDUA 3TE9A 3G3DA 3W1PA 2X1SA 4IX2A 3M5ZA 4O1CA 3W1UA 1B4EA 3LHWA 1D3GA 2CW6A 4WOZA 4HSNA 2FQIA 3M7WA 2DZTA 2V0TA 1JCNA 3UWQA 5C5YA 3K30A 2V9DA 3Q37A 5CZSA 2RKXA 2CU0A 4L4MA 4CCEA 3NQGA 2JKAA 2CZDA 3S42A 3LXBA 3ABOA 5K2ZA 1TPEA 1JCLA 4S2CA 3VNDA 1OYCA 3LBMA 3NVTA 3PR2A 4CQ9A 3P5ZA 1DOSA 2ZZ2A 3B03A 2CLIA 2XN2A 3TJXA 1DORA 1Q6QA 3PC0A 2ABBA 2QDGA 5K4ZA 3LRLA 3W1TA 2YPIA 4D2JA 1BEUA 3GNNA 3LTPA 5K9CA 2CLFA 1JUBA 1NVMA 4XTDA 1DVJA 1JUEA 5AOUA 3W2LA 1ICPA 2YX0A 4Z1AA 3C6CA 4EF8A 1SZGA 3THQA 1C8VA 4GE8A 2C19A 4UTWC 3GLCA 2GQAA 3DBPA 2X1RA 3FYPA 4JYDA 3LHUA 1MEWA 4CCDA 1X1OA 1XBZA 3CT7A 4KFOA 3G0UA 1OX4A 4R7JA 1KM0A 1BWKA 1KFKA 3W7EA 3CLMA 3EXRA 2Z6IA 5BMWA 4MJZA 3UWUA 4UNKA 3P74A 3QPZA 2NXIA 3UNDA 3T55A 5DELA 2JBMA 1VCGA 2OCZA 4XKYA 3IIZA 4UFIA 1QAPA 5SWUA 3L66A 3R13A 1WOBA 2X2GA 2NUWA 3LERA 3L5MA 1LDCA 5G4EA 2H8ZA 3ABRA 2C18A 4PL1A 4LRTA 3L5AA 4BFAA 3C2FA 5H91A 1FDYA 2HMCA 3IVSA 2VXNA 3SI9A 2EF9A 2X1UA 1P0KA 5I3JA 1F76A 4MFDA 3QH2A 3LI0A 1Z42A 2G96A 4GUJA 1LORA 4ALDA 1FCUA 3TX9A 2DJXA 3V1PA 1EP1A 1H7RA 4X9SA 4AEOA 1K02A 5D37A 1XBXA 5D05A 1R2RA 2ZZ4A 5TQLA 4YL2A 1TPFA 5HNRA 3EX6A 3G1SA 1DL3A 1T0OA 1IIHA 2H90A 4IXHA 5I3IA 2E6DA 1AW5A 3PSVA 5K4XA 4UC5A 4JX6A 4O53A 3HIJA 1SFLA 3W6YA 4KFPA 3UPWA 3LHVA 1QR7A 2V2HA
chains in the Genus database with same CATH superfamily
4ECLA 3HFTA 4UNLA 1P0NA 5LIWX 4A05A 1TWDA 2C14A 2ZX8A 3RRAA 2I14A 4EXAA 3RM8A 2QMJA 2WJEA 5G1YA 1E6RA 1HVXA 3E9AA 4CD8A 3B8VA 1M9HA 4NNBA 4Q8TA 1ME7A 2OTDA 4A22A 1ONRA 4ERIA 4DJEA 2X42A 3MP3A 2R1KA 3VIPA 2IW0A 3EX2A 3WBEA 2R9RA 3MMUA 3E0WA 4OGZA 4U4MA 5A6JA 3VK5A 4LU0A 2PDNA 4OOUA 4FXRA 1W17A 2VGIA 3SCUA 2PDPA 1TO3A 1RXOB 1QTWA 3U2ZA 2DIKA 1XKJA 1EQCA 2FZMA 3AIRA 3HG2A 4GH3A 3VC5A 3GU1A 2XWDA 1VFHA 1F8IA 2XIMA 3GHRA 3LNMA 3KE0A 3HPAA 1CZ1A 1BLIA 3LHYA 3I3EA 2OSXA 2WW5A 3E5BA 1EIBA 1DIKA 3XINA 1TVLA 4ZR8A 5DXXA 3AS0A 4ZB5A 3UU0A 3ZJ8A 1L8NA 1WO2A 2X1IA 4WLCA 4DXKA 3TN3A 2ADAA 2OEMA 2Y70A 3IIXA 5A94A 1XCXA 2X0YA 2WNNA 3W1LA 5HQLA 2W67A 4EE9A 2MUCA 4LVAA 3G24A 3BG9A 1D8WA 1J2WA 4KRZA 4M5PA 2BXVA 4UBPC 3AUOA 2A3EA 1U33A 3MB9A 2OYMA 4C6NA 1VBUA 4ZB2A 2BY0A 3KLLA 4X60A 5FAJA 5DEZA 1LUCB 5HMSA 4NT0A 1V77A 1THFD 3DFQA 1R3RA 2J25A 4H9XA 1QPNA 4P7NA 5KMYA 4IMEA 4XAFA 3CZLA 1RY8A 2OGYA 3G8RA 1EP3A 4PFHA 3UWZA 3CM4A 3TQ0A 3PTQA 1DYSA 3MO7A 1XRFA 3QZAA 1HQTA 1TJRA 2VYOA 3B8DA 2ZUWA 4CEUC 4MNMA 3WN6A 3DGBA 1QXLA 1XC4A 1F5ZA 4C65A 3SDOA 3M0LA 4RV3A 3S6DA 1K8CA 2QJJA 2XM2A 1NDYA 4RXFA 3G22A 5G1TA 4XO7A 2X41A 1XWYA 1RPXA 1J0HA 3LYEA 3HB9A 1EF2A 3QEZA 2KZHA 1OCBA 1MNSA 3BAXA 1UQZA 1G6CA 4LEQA 3RU8X 3NQCA 4OKDA 1TWSA 2F8QA 3ZLFA 3IV8A 4CNUA 1TZZA 2GSEA 1B4KA 1XSKA 4YWSA 1TX2A 4AX7A 3HPSA 3GG1A 5I6SA 3GXNA 3FHAA 4LUTA 3UXKA 1LBLA 2OLHA 4RUBA 3OW1A 1MMFA 1QWKA 3W1RA 4AIBA 3OYZA 2OMAA 1R3YA 3OPSA 1DE5A 1VIWA 3NZRA 1IEIA 3ERPA 3NZGA 2OVLA 3A4WA 4N4QA 7XIMA 4LC6A 4I7UA 2NX3A 1V02A 1G69A 3F5JA 4JR5A 4UTIA 4FXSA 4B2DA 3L68A 1H62A 1IR2A 3AHZA 4O19A 5I07A 4BEQA 3V5FA 3GRIA 1N8IA 2PDJA 5HJYA 1UKTA 1FTXA 3QV9A 1VP5A 3KM8A 2V81A 1K7XA 4E3TA 2PDXA 3M0MA 3WD4A 1UKQA 3ITTA 1E73M 5A8GA 5T9CE 3A3HA 3OLGA 1X1NA 1SPQA 1EPXA 4FNTA 3N9SA 3QY8A 1WKYA 1WX0A 2YKKA 1Z48A 1GW9A 3NPWA 2WZTA 3USBA 1EA0A 2Y24A 2HDJA 3TKFA 1VD6A 3KVKA 3BAYA 4FOUA 3SURA 3I6EA 3PWGA 3AXIA 1C3FA 3GY1A 4DZ5A 3LPPA 3QFWA 1QNVA 2WLZA 1EUNA 3B06A 4HA1A 4QQUA 3N11A 3OU8A 3R8RA 1BFNA 2DUXA 4PBGA 4OUIA 2D3NA 1T8XA 3GWQA 3NL2A 3R58A 3TLLA 1FH9A 1FWHC 4V1YA 1I2QA 1HT6A 4M3PA 1OIFA 4HQVA 3STPA 5IDZA 2E5CA 3OVQA 3LA4A 4JIHA 3FSUA 3Q94A 3E02A 3Q65A 4AEFA 2DZXA 1LT8A 2UY4A 3H23A 3LV5A 3DHDA 2ON3A 5E0FA 3WDRA 1J12A 2ZX5A 3T08A 1LP6A 4L7ZA 4HCHA 4IGHA 1PKNA 4WGXA 3GXTA 4HOZA 4KT2A 3WLJA 2ANUA 4LFYA 1T6MA 4C1NA 1YADA 2FTYA 2VFIA 1YTKA 4FXJA 2DEPA 3N6QA 2VFGA 2A1YA 1D7FA 1AMKA 1M1BA 2B0MA 3P81A 4ZOCA 3SCPA 2DFAA 2V6AA 3K4AA 4LB4A 2DT3A 4ZQRA 3UWVA 3AXXA 4EIVA 1NFGA 5M5DA 2I5QA 3R89A 4MF4A 2G41A 4AIEA 2TPSA 1CX9A 3ISIX 3O63A 3BMWA 4V1XA 1B3YA 5EL1A 4H9MA 1L6GA 4QITA 1HW6A 3TWAA 3VILA 1FOBA 4URIA 2J9ZA 1PXGA 1E0XA 5TIMA 3UF9A 4ERAA 3LGDA 4AD1A 3S6OA 3A47A 2VR2A 4U5KA 4PTNA 3CEUA 1LBFA 4GYPA 1ZJHA 4Q3MA 1ELSA 4QSHA 1KCKA 4FX6M 2WZHA 3MP5A 4MWAD 1EJRC 2VC6A 1KBKA 1CXIA 4MPQA 1RZMA 4XBSA 1V93A 4IF2A 4IJBA 3N29A 3EA2A 1CECA 4JN8A 1RK5A 3IJDA 4A4AA 3SCWA 1XR2A 4YJ5A 1KKOA 3W9ZA 3U5UA 1MVYA 4R9XA 1GGOA 1C90A 4REQA 2VDHA 3UR2A 1B54A 1PHWA 3BJFA 1MO0A 2INFA 1G4EA 3VIKA 3VKAA 1T7LA 2AKZA 4GOAA 3L0GA 3T05A 2IKHA 2VURA 2PDYA 2ZBTA 1ODZA 1EKOA 3W83A 4IOTA 4V15A 4MB4A 4E8DA 4CU6A 3AXHA 3L0NA 3APTA 3R0UA 2FHBA 1OFEA 3IUIA 1V6VA 4RX0A 2Q8XA 4M7SA 3BSGA 3LD5A 4PMRA 1U30A 1B31A 1EJUC 1M7OA 1Q45A 1VPQA 4Q32A 3KP1A 1YTDA 1J4EA 5C8BB 2IS7A 3GTIA 2J62A 4B3KA 5IBXC 1REQB 3MTWA 1FDJA 2OO6A 1LG1A 5HR6A 1PV8A 1E9LA 1N8WA 4TU1A 1SMAA 4U3CA 3E2SA 1CXHA 1SMDA 4OJYA 5M1TA 2ZX9A 4TO8A 4B90A 1IT7A 2JK2A 3P5YA 4A6GA 2PBGA 2I57A 2WJZA 2G3IA 5C2XA 4F2BA 3I7SA 4GUFA 3DH7A 1UIOA 4H9ZA 5BXRA 5FF4A 2A7RA 4M6VA 4IIDA 1RQEA 3MSGA 2WPBA 4HMCA 2REQB 3ZXWA 5AVNA 3A24A 4ZXOA 3ZSTA 3KS5A 4EXBA 4NP7A 4DZIA 2ZYFA 4U3AA 1V3JA 1BRLA 5GNYA 1QDSA 1QBAA 1UR1A 2QF8A 4UCGA 3QW3A 5AYYA 1KFJA 4I5XA 2C8NA 3WLPA 5DMNA 4QG6A 3IWPA 3GG7A 1VLWA 5D02A 2F7FA 1DIDA 5D9NA 2DZBA 4Y9OA 2Q8LA 2EXOA 1XG3A 4WF7A 1XQLA 5HWMA 1IXOA 3GAYA 1E1EA 4UWMA 3KCJA 3REQB 1E0UA 5CBJA 3QW4B 4F0MA 2DQXA 1WV2A 1SO4A 3VCCA 1J79A 2PWUA 5EYWA 3WUBA 2Q3RA 3PAJA 1ZNNA 1JD7A 3SY5A 3UJRA 4LYPA 4K8EA 2GJLA 4LCQA 2CESA 2NXGA 5BXSA 3B8SA 2AGKA 3VINA 4GQQA 5CKSA 2JIWA 3EB4A 3SW6A 1R38A 2QNEA 2CZ5A 3VMNA 2FJUB 4LPCA 1XX1A 4AFYA 2AMXA 3OHIA 4ZL1A 5I7GA 3ELFA 1ITXA 3QMRA 1UD3A 1TV8A 1TMHA 1O5RA 4BQ4A 2HCVA 3W37A 1OSEA 3B40A 3M7SA 1E6XM 3TIMA 5E9XA 3L2LA 4GUGA 3H53A 4ZQPA 3L21A 2Y6ZA 1LL4A 3CO8A 4JTIA 4UTWA 4DVOA 1NDZA 4LBUA 5ABGA 2JF7A 3AXKA 2OOGA 4HCLA 2WLYA 1VKFA 3ARZA 3TW6A 2GGHA 1UZ4A 2YL9A 3BSHA 4O4WA 4K6AA 4HHHA 5CXPA 4Q8UA 4M6UA 5CPNA 1RA5A 4GUIA 1VFUA 4Z1DA 2J78A 1TMLA 4EAYA 3A5FA 2V68A 4GHRA 3VPLA 4K1GA 2ZICA 1VYSX 1YRRA 3YPIA 2ZUVA 4WK9A 1SR9A 4UMBA 1TUXA 4LTSA 4P61A 4B91A 4NXSA 3SCNA 3LCIA 3J7HA 3PTMA 4M0XA 3MI3A 1MDRA 4ZO9A 4NVTA 1D3HA 3VGEA 2EG8A 4AC1X 2AQOA 3WBWA 1QW8A 2QVNA 3WD2A 4PFMA 3WFLA 3C8FA 3LENA 4R33A 1MQQA 3LRKA 4PGLA 5F7UA 2QQ6A 3VOHA 1F7BA 5A6BD 1WYIA 3QC3A 4LNCA 1WNOA 2NUYA 2VEKA 4B3ZA 2NQJA 3WDQA 5FF0A 1WCGA 3MKVA 1JNDA 4RE3A 2FGLA 1LLWA 1VFTA 2J7BA 4PBEA 3QZ6A 4Z1YA 1ICSA 1MYRA 1ADOA 2G4FA 4ZQOA 2F6UA 1QO5A 2ATSA 3V4BA 4DUVA 1V6TA 5C2CA 5DX7A 4GIAA 5A2CA 1W1VA 2O0TA 3CZJA 1FX6A 2P8CA 3GVGA 4RNHA 5A6TC 4O0KA 4JPGA 4M51A 1E72M 2DSVA 4AIUA 2EHHA 2OKOA 2BWGA 3SO7A 1SZRA 5BW6A 3BLLA 1YPXA 5A6AA 3N2TA 1HVQA 1AH3A 3OQ8A 4QM1A 3Q4DA 3AHTA 4QE4A 3BW4A 5AYIA 4JX5A 3NXLA 1UW9A 4UTJA 3LLFA 4US5A 2DSKA 2V5LA 4S1FA 2VR4A 3P0XA 4NYUA 3MHGA 4M6QA 5JUVA 1UP0A 3TOYA 4GH1A 3KVJA 1BG4A 4LWWA 3W7RA 5D9MA 4N9BA 4H8HA 4PBFA 3A21A 1JJKA 2O7SA 5C6MA 5E6YA 3OVRA 5JIPA 3N25A 1YYAA 1XLEA 3O3RA 4RNJA 3LHTA 1W1YA 1ZSXA 3QHMA 4ROQA 4LF1A 2Q01A 3IUDA 1B57A 1ZAJA 4O4VA 1KCLA 5CBIA 3MCNA 4H1ZA 5BRBA 5ECUA 2GGGA 1O60A 3VZYA 3CYVA 1JF6A 1K3UA 4NY2A 4PTDA 4WEVX 1L9WA 1W31A 3W24A 2ISWA 4Q8MA 2DSUA 2FDMA 4BA0A 3S5ZA 3ZIZA 5E0CA 3AYRA 1OIMA 2J4GA 1ZL1A 1NJJA 1US2A 1ONXA 1SW0A 2PC8A 1O95A 4K3ZA 1DP0A 2OQYA 4MFEA 5CSSA 3RR4A 4QNEA 4DJEC 2CERA 2WNWA 1KRCC 2V2DA 3G1VA 6TIMA 1CDGA 3RIKA 3LCWA 3UETA 3R43A 1VLIA 4KWOA 4CQBA 1AW2A 4JTDA 5F4WA 2CFFA 1PIFA 2VKZG 4DO5A 4K37A 3KL5A 4DXXA 2OODA 1BQCA 4GFSA 4GYFA 1DJWA 3TNBA 1V51A 3DYMA 4CQ8A 1OD0A 4ZTYA 1K9EA 2XTKA 3D47A 4E4FA 4E4PA 1TV4A 2A0NA 2B7OA 3TW7A 2YW4A 3AMDA 1K70A 4HYVA 4WSKA 2FHCA 3NO3A 3FAXA 1VYPX 1Q8AA 3IIPA 3UWEA 1ODUA 1RVKA 1GQKA 1XRSA 4DM1A 3RUBL 3ABSA 4KIRA 3ARWA 4ADUA 3S1VA 1FHVA 2V5KA 3PK7A 4F48A 2Y7GA 1QK0A 2WZEA 4HK7A 2Z1WA 1OM0A 1XKYA 4IGMA 4H8UA 4WXYA 1YDYA 4D6DA 4NUWA 2D23A 4AX6A 2W0UA 5D8ZA 4DY1A 3TSMA 2E77A 4BI5A 2HTMA 3W1AA 3BCFA 3V0UA 3UA3A 4MJMA 3LTYA 1GOWA 3TQVA 3K4WA 2A6LA 3APGA 5A6LA 2OB3A 3LK6A 2VUNA 1GVRA 2HVOA 1TQJA 3LUTA 2GQ9A 3HJEA 3AIWA 2Z25A 4G56A 1OGGA 2OKTA 1VC4A 4WJEA 3Q67A 1XC6A 4GGBA 4B2DD 2E40A 3DUGA 3O15A 3EGJA 4J9JA 3SSJA 1J6PA 1XGDA 3WD1A 5H6HA 1DV7A 4UTHA 3HJZA 1XPGA 1CI1A 1EC7A 1SO3A 4NX0A 5AFDA 2PODA 4UTKA 2OU4A 4HZMA 3SIMA 1O66A 2WMFA 3BUVA 3G1YA 2BXYA 3S0CA 7TAAA 1K8YA 3QV7A 3WBYA 4QS5A 4IQJA 3U7BA 4BF9A 3FKRA 3VOJA 1KM4A 2HZGA 1QW9A 5ABFB 3C86A 4FIRA 4A3QA 2XH2A 4KEMA 1FRBA 3KTSA 4D6FA 1XIEA 2E9MA 2GUBA 3GDKA 3N4FA 2BTMA 3ZT6A 1QHOA 4IGSA 3LOTA 3GAKA 4BR1A 1H63A 3CLWA 1JPHA 3TP4A 4MOZA 3AIEA 5EA9A 1H2JA 3CBWA 4MYXA 4XWUA 3BJTA 2XFFA 3MCOA 1W3LA 1AQ0A 4NXKA 1U1JA 5EB8A 4W7UA 3S5YA 4I5UA 1WAUA 1UG6A 3UESA 4QG9A 1OINA 2CPUA 1V5XA 4B5NA 1A0EA 1EB3A 2VOMA 3WBAA 1LT7A 4WHBA 2VHLA 3M6DA 3EOOA 3F4NA 5FEWA 3N4AA 1I9CB 1EP2A 2BVYA 4U31A 1E0TA 3CGTA 3W6MA 3ES7A 1GK8A 2QEZA 1PE1A 1QOPA 4Y2WA 1GJWA 3T2OA 1RCXB 3ABZA 2X05A 3UWWA 2W6RA 1RA0A 4DLMA 4TV6A 3TJIA 1KCZA 2DZPA 4Q8PA 4IQEA 1XGEA 3GKAA 3C8NA 4I9TA 3BAIA 3VM5A 1GTHA 3UCQA 4CN4A 4AH7A 3CL7A 4P5UA 1E5NA 1EXPA 1WP6A 3ZO9A 5D9PA 1VJSA 3POCA 1EC9A 1RVGA 5EBUA 4KW2A 3MKCA 1PTDA 4HU3A 4XV0A 1DQXA 5BMXA 3HGJA 5AC7A 1XICA 3CMFA 2ZWYA 3MJMA 2O55A 2BHZA 2D2OA 2FFCA 3GNDA 3LCFA 3URQA 2WCSA 1HG3A 1S39A 3VIOA 1HGYA 2G3JA 1UBPC 3LQLA 2WANA 5BYWA 3AFBA 1R87A 3QKZA 1H51A 1BKSA 2OSYA 4Y9NA 1YHTA 1M3UA 3BOXA 3W22A 2QAFA 2E6YA 2BFGA 4AVOA 2V3FA 4WKAA 4MAZA 3APYA 2GK1A 1TRDA 2ZC8A 1NAL1 3FOKA 1J01A 1ISZA 4GCXA 5FF2A 1V0KA 4FLQA 4QQ3A 1KXVA 2GYIA 1MUCA 3EA1A 3F1QA 4S3AA 4F0HA 1U2YA 4RNFA 1GVYA 4AHPA 3PBVA 3KXQA 3GUWA 1VFLA 1CBGA 3T40A 5J5RA 1XUUA 3H2FA 3GDBA 3RILA 3AQUA 3FAWA 3FFSA 3SRHA 4S3DA 4ZSUA 4Y9MA 2RDXA 3R10A 2NX9A 5AECA 4W89A 2EGZA 3LLDA 3ZJ7A 3QGKC 2P5NA 4GYPC 2Y8KA 4TXEA 4KKXA 2WVUA 4XSLA 5FEXA 2GVJA 1J0YA 1F73A 3AYTA 1A5LC 3HPFA 3HTWA 1FFRA 1R3WA 3CQKA 2P53A 4EPDC 4NJJA 4UTFA 3CTLA 1W1TA 3GHSA 4JQ3A 3VKDA 4A3UA 4BF5A 3DZ1A 3O07A 4HNTA 4KF1A 4NZ3A 4LUIA 2IPWA 1DTUA 1GVQA 1SFTA 4IFRA 1J93A 1P7TB 3GH7A 2PWFA 2PRMA 3GDRA 2JALA 3FYYA 4R5EA 2DQWA 1AH0A 4B5WA 3USZA 3EKZA 2QCGA 2V5CA 2FB3A 2YB1A 3OHMB 1L8PA 1KTBA 4L1XA 2CLPA 1RP9A 4ILSA 3C0SA 1POKA 3IVTA 1MI3A 4LS1A 3P61A 1CTNA 4GVHA 5BCAA 4WSJA 5K7JA 1XIIA 1LM1A 2DJLA 1W1PA 2YW3A 1KQYA 4Q22A 4EVZA 2OX1A 1Z3NA 5CPLA 4O54A 3VGBA 1NWSA 5HK4A 1NFPA 2XSBA 5I77A 4K39A 1GQLA 3IVUA 2BY3A 4BWLA 1Y65A 3FA4A 4JS3A 3VNMA 2NT0A 4LSBA 2EG7A 2V5BA 2QPSA 1K4GA 3EB2A 2JKPA 4GA8A 3WLLA 1RCQA 1IR1A 1WAWA 4N6FA 2UZ9A 1T41A 1FWWA 1TELA 3QXBA 4GO9A 4LC8A 1TV3A 2CWNA 3VOGA 1QK2A 4JTEA 3QLDA 5A1AA 5EMYA 4XVDA 5I0DA 3UPMA 1JCXA 3UVAA 2J6XA 1GZGA 4TOQA 1R30A 3VOIA 2GQ8A 5LSMA 3IACA 2XH0A 5AHEA 4MUPA 1V4YA 3B0YA 2A21A 4OFCA 4UOJA 5LGZA 3M6YA 4AF0B 4AB4A 4IZGA 1AW1A 1IZJA 3H2MA 4WIWA 1A3HA 1CPUA 3TQPA 1JQXA 1JI2A 2PRHA 1PL9A 1OC5A 2Y61A 1TRIA 5LIXX 3ANVA 3EX1A 3N6JA 2ZA1A 5LNRA 4E4UA 3VA8A 6REQA 1JF5A 1UR9A 3LCXA 3MMWA 1I2NA 2ZA3A 3EMCA 4ZOAA 5I06A 4PUMA 1SYTA 3ARTA 3BLIA 3SRKA 3G1AA 1W5NA 1JYWA 1UP2A 4FB7A 1VEOA 3VMOA 1MNZA 4AWSA 3WJZA 2QJGA 1W5OA 2XYLA 3WEMA 4IIFA 1E6QM 1JXJA 2QUTA 4CN6A 3I68A 4TX6A 3CT2A 3ORWA 3GYEA 3TE9A 3G3DA 2EJAA 1XLAA 3E0FA 4JQ2A 1BVNP 2X1SA 1Q4WA 1C8QA 4MB3A 1B4EA 3OJGA 4PUWA 3E1F1 1D3GA 3M7WA 3P3BA 2OYLA 3UERA 1U1UA 2XG9A 5EMLA 3EDFA 3JUGA 4DZAA 2X7VA 3SQSA 1XW8A 4L4MA 4PCPA 3NQGA 2JKAA 3S4TA 3ABOA 1POJA 2XIBA 1R3TA 1S5NA 4DAIA 3CAKA 3NVTA 5BXPA 1YKWA 4CQ9A 2RGMA 1DOSA 2VZTA 4H7ZA 3TONA 2OO0A 2EPMX 4J3UA 4IGNA 4PSPA 3MV11 4MM1A 3HN3A 4ZCWA 3UT0A 2P3ZA 2ZE3A 3GNNA 3LTPA 1Q5MA 5K9CA 2XDFA 5DRIA 3U3HA 1O7AA 1NVMA 2WVVA 4HOWA 1TWWA 1JUEA 3UG3A 2I9UA 4IFKA 3WF2A 1ICPA 5JU6A 3SAZA 1SZGA 4UOQA 3RM4A 4EF8A 1XYCA 1C8VA 4GE8A 4UTWC 3FYPA 3LHUA 2VCAA 3SEPA 1XBZA 4KFOA 3N6HA 4R7JA 4DJFC 4MJZA 1C9WA 3BL3A 4UNKA 3KS6A 3FX4A 2GGJA 2PDGA 1A3WA 2OCZA 4NAEA 1QNSA 3IIZA 4UFIA 1QAPA 4F9DA 2NUWA 3UXIA 3QVQA 4FF5A 2A3BA 4DWSB 1XV8A 1E43A 4PL1A 3B9NA 2A3LA 3QGVA 3KEHA 1FDYA 1P0KA 5I3JA 1F76A 5HXMA 3LI0A 1EFZA 3VD3A 2G96A 3I3BA 3FVDA 7CGTA 4US5D 2DVUA 4XZMX 4LAKA 1FCUA 2DJXA 3LLXA 4YTTA 1ZZMA 1R2RA 3T07A 2WM1A 1TJ2A 1A5MC 5HNRA 1KC7A 1H1NA 2VM8A 3G1SA 1FH8A 1VIZA 1DL3A 1JPDX 1T0OA 2H90A 2E6DA 5K4XA 4JX6A 2YCLB 3GU2A 1F07A 3PJUA 1ZBWA 3W6YA 4KFPA 3UPWA 2VP8A 5IXEA 3QN3A 2GQ3A 5EGRA 1QR7A 5E6ZA 4L56A 4RW5A 1ZB5A 1ZFJA 2RJHA 3H2OA 2X2YA 3WLTA 5BZAA 5J04A 3RNDA 3NXFA 1OHLA 3ZR5A 4W86A 3V36A 3TR9A 4YYCA 3C2EA 2VEIA 3PZQA 4RPQA 3UPBA 5ABEA 1W3NA 4HYRA 3AMLA 1EEPA 4KEUA 2GGIA 3NSXA 4B5XA 4Q33A 6ALDA 4PE8A 2Z1KA 3WMCA 4LV9A 3KZPA 3NFUA 5HMFA 5CPTA 3S2NA 4WGHA 2P8BA 3BQ5A 3WDPP 3G0XA 3FW6A 3IRDA 3PUOA 3R2GA 1L0PA 1PKMA 3VZZA 1KTCA 3GVQA 3BLDA 4P8VA 4DBWA 3T7VA 4AYSA 1U83A 5G4HC 2YBUA 5HOSA 5CJMA 1SJDA 1HFBA 4PRRA 4QHRA 2XPKA 2FH6A 4O13A 3PBMA 3P67A 4QS6A 4DYEA 4F79A 4GVFA 2FVMA 3MT1A 3AIQA 3AWOA 3ZLHA 3DG3A 4M7TA 4O16A 3W7JA 3ZOAA 4LUSB 3L9CA 3E74A 1Y5VA 4MJ2A 3VABA 3SFKA 1JIBA 2ZXDA 2HS8A 3RF9A 3RFAA 3SJ3A 4AZ5A 1Y0EA 4F40A 3EMQA 4X0NA 4MDPA 1HL2A 4DBSA 2GJXA 4JFUA 1EYEA 4HK6A 1FWAC 1Q6EA 4CNPA 1NY1A 2JKEA 2F84A 3DGRA 1AH4A 3DI1A 1TZ7A 1TA3A 4YHGA 3E2QA 3PPGA 3F2DA 3IUHA 2BVTA 2FMOA 4EWND 1QWGA 2VD8A 2VZVA 1MEIA 4Z42C 3W7DA 3IK4A 1B3WA 4L1WA 1YDVA 3IEBA 1YQ2A 4I8DA 4GGHA 1CGVA 3N12A 3ID7A 5CPOA 4E3VA 3D3FA 4OVXA 8RUCA 4D6JA 3F4CA 2Y1HA 2GWNA 4AVNA 1LRNA 1OGBA 5E09A 3VYLA 2XGIA 2XN1A 4AZGA 1JDEA 1WBJA 1A3XA 1K9DA 5HPOA 2E7FA 3GTXA 3TUUA 2WK2A 5HDRA 4HB7A 3OZYA 4HA0A 1KNWA 3GVWA 4TV5A 2CXEA 3NEHA 1XLIA 1KA9F 2CHNA 1LRTA 5C2GA 3SY1A 3UYIA 3ITVA 2VX6A 3DBNA 1SW3A 3SN1A 4J4KA 4CNSA 2W27A 1OB0A 4JTQA 2VOTA 4QJ3B 5I3GA 3I3DA 4JQ1A 5ABTA 2HEJA 5CLWA 4JTJA 1OG0A 1D7KA 4B9ZA 2QAPA 2OEJA 1H0GA 1NEYA 4JX4A 2BVWA 4GJJA 4LY4A 9CGTA 4NKCA 3JRKA 4IMFA 1JEZA 3UR8A 2J7FA 3BPWA 4X3ZA 2Z28A 4DAFA 4FO4A 1FBAA 2FMNA 1L2QA 4QDWA 2PTXA 1L6SA 4R9OA 4YWIA 3WQGA 3PS7A 3UZXA 3R7MA 1NOWA 3SUTA 5BNKA 4A3HA 1OFRA 3I4EA 4MKVA 1PBGA 3B9OA 3SCQA 4P7RA 1G5AA 3D5HA 3LSCA 3HOJA 2Z1BA 2PE4A 2GUUA 3BV7A 4N02A 4XSMA 1UROA 1FWCC 3KDNA 3ZFHA 5C54A 2CBUA 3CPRA 3VKCA 3RJYA 1US3A 4UCFA 2INZA 1KO0A 1QATA 3MI6A 5KEZA 1U5VA 4ZODA 3C0LA 3S1GA 2W3ZA 3H70A 3FGCB 4HVXA 4LANA 2WB5A 1Q6CA 4I7VA 3VNKA 2HS6A 4J28A 1KGUA 1TPDA 1V3KA 1W8SA 3HURA 3W87A 3RCMA 1MZHA 1WDQA 5D4YA 3TSBA 2ZUSA 1W5PA 4NI8A 3EZ4A 3LCLA 2NVCA 3KBNA 3RMEA 3WQCA 1UIPA 1X97A 3I4KA 5AVHA 1JXKA 3N73A 1JZ5A 2VEGA 1LF1A 1MSSA 2HNHA 4JZ5A 3FYOA 4Z2KA 3WJYA 4N4PA 1ZU8A 3BGGA 5A6MA 1TWIA 3DFOA 5C9XA 2BMBA 3T0DA 4XZNX 4A3RA 1N82A 4O57A 1CXFA 4G7EA 4Q8OA 4FALA 3URBA 3RXZA 2ACQA 2YA0A 2QCFA 1TWZA 2AAMA 4U28A 1HL8A 1DXFA 3VD5A 4BKNA 1BGAA 1E4LA 3RPTA 5I23A 1F6KA 3NSMA 4G1NA 4KFNA 3W81A 2ZIDA 2FPTA 1K9FA 3MW7A 3PJXA 3KVMA 4MY8A 3NJ3A 2VWTA 1DJZA 1G0CA 3L4XA 4DX3A 3FS2A 3WUEA 2R82A 1OZQA 4WKHA 5HPCA 5EMJA 2VMFA 3WEOA 3HF3A 1KWGA 1GJUA 4JDYA 4DNHA 1VFFA 4DF0A 4HN4A 6PTDA 3MKKA 3ZWSA 3IJ7A 2DSZA 1TTIA 5HMDA 1CGWA 4WUIA 3T78A 3T0CA 3VC6A 4LF2A 4MZ8A 3P8IA 4GKLA 1MZRA 2V5JA 5HULA 3K13A 2BLEA 2WKGA 2WKLA 3TC7A 3SSZA 2FIQA 4KIEA 4YU1A 2D3LA 2NWSA 5CGTA 3TTSA 4AHOA 4BHYA 2HXTA 4HNLA 2NSXA 4IPPA 4S2BA 5I3DA 5F2MA 2NX1A 1UWIA 1S5MA 2VC7A 3PWIA 5EMKA 1OFAA 1HNYA 2HQAA 3T0TA 4E0CA 1A5SA 2F6XA 3F4WA 5AC4A 4W88A 6CGTA 3L0KA 3ZT5A 3DEQA 4KPLA 3SZ8A 2ISDA 1ZALA 3B0XA 3CV7A 4O1AA 3ZVHB 1E0WA 4O0QA 4RR4A 1R3SA 1JCTA 2HNEA 2PDCA 4C6KA 4AHQA 2ZZ1A 1ECQA 3DFPA 3T09A 3UR7A 3VDHA 2I7GA 2VX4A 4H19A 5CZJA 1XDLA 4XUGA 3E49A 3V5CA 4DF1A 3ICJA 1MWOA 3S6TA 3G8EA 4CQAA 5A8QA 2DZVA 3G3MA 3H2AA 8A3HA 3S83A 2E5BA 1DJYA 2PP3A 2PP1A 1HJVA 2J6VA 2QVHA 5E9AA 2O7QA 3DHUA 4AZCA 6XIAA 3QLLA 5IHSA 1ZJIA 3WLNA 2AKMA 3C56A 2J13A 4JQ4A 3WL1A 4UQDA 4LH8A 3L4WA 1UZDA 1RJPA 4V28A 1IEWA 4M6PA 3I6RA 3WK2A 4IMAA 3L5LA 1UASA 4ZGYA 3IK2A 2AQWA 3VFCA 5G5IA 2R91A 1W37A 7REQA 1B5TA 4LBSA 3UP8A 4PCSA 1UR8A 1RQBA 4GY0A 3MUY1 4OZOA 2Q8ZA 1UQYA 5CC7A 2C7FA 1IWBA 1VCVA 4IIGA 1EHAA 1H50A 1ADDA 3BAKA 5FSEC 4ZMGA 3NL6A 3MZNA 4DO4A 4WDXA 1AD1A 3UA4A 4CNNA 1PB0A 5DCEA 1FWDC 4C6LA 4E2BA 3E2VA 1IGSA 5KZ6A 1J8VA 4O17A 5CC5A 3ANYA 1EA9C 4Q4QA 3A9IA 2A2IA 1HO4A 2QPUA 5DCBA 2VTFA 1HKVA 3VX1A 4G5DA 3EWYA 4GQBA 4X2PA 4J27A 4U10A 1WOAA 2E6FA 2B4GA 3MU7A 1KFEA 1JCMP 3S5SA 5DBTA 4ACZB 3TZNA 4M19A 2G5WA 1PCKA 4DHGA 5JBFA 2IUZA 1TJ0A 4YIWA 5DT7A 5EMMA 3VIFA 4IHCA 3W3OA 1DJNA 3T42A 4PTMA 1WDPA 3L4ZA 1OCJA 2QGYA 4M81A 1X98A 4BWLC 1HN1A 3LMZA 4AD4A 1TX0A 2EPOA 1H0IA 3DFNA 1G4PA 5C9UA 4JTAA 2F6KA 2VZOA 4JCMA 2NQZA 5F2GA 1SSGA 3B0PA 2Y89A 2H8XA 3KOXA 3IIVA 4AEEA 3MZ2A 2FZNA 5T91A 3GXDA 4GZIA 1E56A 3W23A 2Y8UA 5IRPA 3EWXA 1TIMA 3IPWA 4Z2IA 3VXGA 2P76A 1RK6A 1XD1A 5HINA 3GH4A 3GIYA 2PTWA 1O94A 2VZSA 4QISA 2YYUA 4W5UA 5AC6A 9XIAA 5LHEA 2BB0A 4W7VA 3GZ3A 2PA6A 4HPNA 1XLLA 4XBJA 2C1GA 5FJRA 2ZUMA 1OCNA 4JKLA 3TYBA 1Q63A 3THAA 3LSBA 1RD6A 3RG6A 1KFLA 1FKXA 1UWSA 1G7VA 3VU2A 3TN6A 3OZMA 2PUZA 1ZP3A 4D1IA 3CWOX 1VJIA 4HNOA 1V0LA 3UG8A 4MLJA 4DUOA 3AC0A 4MPKA 3OODA 2OZ8A 4X22A 5CLTA 1TTPA 1WUEA 3CHCA 5C9WA 1J6OA 1V6UA 2POZA 2PWDA 4O1EA 4GI4A 3UFYA 5EBAA 4LJ3A 4LY8A 1GZJA 4W84A 4UQAA 3VGFA 5LKYA 4RCXA 4OT7A 5JIWA 4DEFA 2W66A 1OX4B 1TPVA 3PHAA 5BROA 2QCHA 3HZ3A 4FK9A 5AZ0A 3WLOA 3NPUA 1B3OA 1R5YA 4BF7A 3V0TA 1JPIA 1AA1B 1LWHA 3TCSA 4DJDD 2VR5A 4A8IA 3R25A 1GNXA 2CHRA 5FL0A 3ARSA 2E1DA 2YXXA 3CZ8A 2FFIA 3KRSA 4Y8EA 3O6DA 1X8FA 3PWAA 2ALDA 3TV8A 5HQMA 4KEVA 1MW3A 3QQ1A 1IIGA 1KRBC 2R1PA 1Q6GA 3HQ1A 3N13A 1A5BA 1VBHA 1GYMA 4LOCA 1QBBA 3KRUA 3W73A 3NCOA 3TK7A 5LA0A 2OEKA 4L9ZA 2CZVA 3M5YA 3W7CA 3B3DA 3EWUA 3VX0A 3P8JA 4RZ4A 3WH5A 1D9EA 2XFYA 3AI0A 3CV2A 4Q4PA 2QMKA 3DFYA 3SN0A 3GFYA 2FTWA 4ASTA 3M47A 1ML1A 1UPMB 5A2BA 2J7EA 4XZWA 3D46A 4H9UA 1J0JA 3SUWA 1Q7MA 1AL8A 2BGSA 3CHDA 5DLCA 4HN8A 4RDVA 1V3LA 2Y8VA 1VFMA 3UGVA 4MTVA 1BXCA 3UEQA 1W5QA 2CC0A 2YCJA 1N2VA 2YDRA 3LM7A 1XLGA 3QHNA 4AU0A 2YGYA 4CNOA 2QHAA 3AU2A 3IAPA 1T40A 5KTLA 1MW2A 3WDHA 1Q13A 3NQEA 3WNKA 2Z4GA 2E8YA 3RO8A 4HNVA 1KGXA 1DWAM 4UR9A 2PSNA 3RX2A 1B9ZA 3KBWA 5FJJA 4IP4A 2CITA 3SCSA 4HHPA 3PBUA 1YLVA 1SZEA 2PB1A 3ZQ9A 1A80A 4HZ7A 4WVXA 3C2RA 2QDHA 5CPMA 4JTRA 4HKPA 4LCRA 3GW0A 4WY0B 1XLMA 3BGJA 3OZOA 2PMQA 4QX4A 3VFLA 4NX5A 4U2YA 4YCOA 4EK7A 2H6RA 3EX3A 4US6A 2E25A 5EMUA 1A4MA 2NQHA 3ARPA 3KHDA 3DERA 2E9LA 4MY1A 1OABA 3B4UA 3TVAA 4K8HA 1PKLA 5FCZA 3W00A 3N1AA 4PUJA 4F0SA 4PEKA 3NIYA 4K7VA 5A6SA 4XZBA 1IZKA 5I2UA 4BQ3A 4PULA 3E0VA 1EX5A 3BJSA 3D6NA 2PC4A 3DCPA 1ONWA 4JTLA 2RAGA 1XDMA 1EWEA 4WDTA 3KFTA 1PWMA 3UG5A 3W72A 4A8RA 1ITCA 1PZ2A 1PTGA 1S1PA 2VVNA 2YXGA 2QIWA 3C5QA 4QE1A 1SQ7A 3C2VA 5FESA 1GOOA 3WK1A 3XIMA 2IKGA 1XIMA 3NAVA 3GS6A 2FJKA 4XAYA 5HJXA 3U7VA 5T26A 1LQAA 4J3SA 1M04A 4W5ZA 1M68A 2DDXA 4BS0A 3W88A 1OT2A 3ARYA 4LX4A 1IF2A 3TAKA 2XVLA 1WXZA 2IKIA 4GFIA 4YTSA 3M0VA 3WQFA 3P0WA 5HUPA 2PLJA 3AISA 5MF5A 3K46A 4MWAB 3SUSA 2WSKA 2PDMA 2VCCA 2QLYA 4GIRA 2WHKA 1F61A 1P4CA 5B7YA 3TXZA 3E0IA 3GIPA 1W8GA 3NQ6A 2TYSA 3BOLA 6ENLA 3BH4A 1KB3A 2X40A 2J66A 4R7OA 1R9YA 4O1BA 1K7FA 2W92A 3JR2A 4CQDA 4HGXA 5M2FX 2ZZ7A 2Y2WA 2VFDA 3PZNA 3NPVA 3HMCA 2J75A 3G6MA 4AD0A 1L2UA 1R2TA 5DN1A 2BOEX 2PLKA 2I17A 4YHEA 1TFVA 4FMVA 1QNQA 3PB0A 3I65A 1CLVA 1OJXA 4W8BA 3G1HA 1Q6DA 1QT1A 1R7AA 3O06A 1B1YA 2DV0A 4LRSA 3UZ5A 1PEZA 4YTRA 3NQBA 5HUOA 4HMDA 1Z7AA 3QR1A 2WV8A 4FEZA 1J9YA 1F2JA 1OQFA 4WX2A 3N9RA 2C13A 3B0UX 4H3DA 1NTHA 3VGDA 3V35A 3A3WA 2HWGA 1JAKA 3RO6A 5M3WA 4QDPA 5D2WA 4E38A 3OO2A 1B3XA 3HQPA 5FSDC 3AZTA 4OV4A 3MVIA 3MV01 2NXHA 1RBOB 1K6WA 4LW7A 1BXNA 3WH8A 4WZHA 1FWBC 4QP0A 3BG3A 1JI1A 2PDBA 3FSTA 3NQ7A 1KLZA 4JTUA 3VOCA 2GVLA 3WQWA 1KBJA 1QPKA 1L6YA 3FJ6A 3RCYA 4HOXA 3AIUA 1RD5A 2PU0A 5D9OA 4AC7C 4GABA 3M07A 4AWEA 3VOFA 1J18A 4YVXA 2Z7GA 1R0MA 3UJEA 2C79A 5GJNA 5G4WA 3CMJA 3BICA 3CQJA 3N2OA 1RHCA 1KV5A 4BI6A 3TYDA 1HUVA 1E15A 3N15A 1Q2RA 4UXDA 1C8YA 2NQ9A 2VELA 4S3FA 5CC3A 4BCEA 3OLEA 3PTKA 3QOKA 1WUFA 4U5IA 2ZZ5A 1YPIA 1T99A 3ENLA 3GYCA 4LS2A 3K8KA 1XXXA 1FCVA 3K1GA 4OBRA 2GL5A 2P0OA 3N14A 1PDZA 3O9NA 4HHMA 4QAIA 1VGAA 2IPJA 4FOKA 5JBEA 3DG6A 4GMEA 5J5DA 1WQ5A 5KITA 1QW7A 1KTNA 4KERA 3WY1A 2CXGA 2YCIX 4E2OA 4NU7A 4NZFA 1OF6A 5JH2A 7A3HA 2NZLA 1V02E 2DW6A 3QM3A 1N8FA 2GSHA 1VPXA 2VJXA 3TSDA 5DFAA 4K7YA 1AQMA 1CCWB 1XLKA 2D0HA 4FLOA 3QSRA 5FF7A 4TVCA 1T8QA 2FB2A 1ESWA 1QHPA 4IUGA 1PS9A 3B8UA 4IIEA 4HA3A 2AMGA 3M0XA 3GDLA 2I9EA 2Y63A 2CKRA 1H7NA 1YIXA 2QR6A 1A50A 1E3ZA 1SFJA 1JDDA 2G4JA 1FWFC 3NVDA 2BOFX 1Z8AA 3MUIA 1NOUA 3PPHA 2I1OA 3L4YA 4RE0A 1V3MA 4P8UA 1EEXA 3MSDA 4I9AA 3W1MA 2WWCA 3LPOA 3GTNA 3ZWTA 1JAEA 1NP2A 4C5YA 3NL3A 2WAGA 3FA5A 4FNSA 3CC1A 5LNUA 5JQ9A 5I09A 5C70A 5KINA 2AL2B 1HP5A 3L2IA 3CUFA 1EJVC 3EEGA 4NNCA 1EGVA 3T4CA 1R9XA 4O10A 5MKGB 3QYQA 1IZCA 5DY3A 2XFWA 4ADSA 1VAHA 3HG4A 2VX5A 5HANA 3TZFA 1XUZA 1M7PA 3GKFA 4K2SA 4PYSA 4TQTA 1W9PA 2HK1A 2C91A 4ZTXA 5BWAA 1GVEA 2ISFA 4PR4A 2RFGA 2XWEA 1KRAC 1XIFA 4O50A 1MRAA 4IL2A 3WQOA 4KRTA 4C60A 4P8XA 3WLIA 4C6EA 5FAGA 1M53A 2VC5A 3U57A 2X8RA 3R12A 3W75A 1F3TA 4DO6A 3NQMA 4L65A 4XAPA 2ZCGA 2PURA 1R47A 3KVLA 2PU1A 1DEDA 1I6NA 3GR7A 1I1XA 1HXJA 4QRNA 3HPXA 1J10A 1AD4A 1VHNA 5KZEA 4B5VA 2IMRA 3A6OA 1OBAA 3VIHA 3VNIA 4P7LA 2DPEA 5IM51 1B30A 3VIMA 1JGMA 3LXCA 3PSWA 3TH6A 3WO8A 1QVBA 1YXYA 4FS9A 4W8LA 2P50A 4NIRA 4ENLA 2CBIA 3BARA 4OBSA 1HKJA 1F4AA 3DFSA 3ZVIA 2DH2A 2LLEA 1RAKA 1GPFA 2YCKX 4UB9A 4ORIA 1BVZA 3OIXA 4GK8A 3SCRA 4JIQA 1Z44A 4Q7BA 3PG9A 4GKTA 4Q4MA 2E8ZA 2XVPA 2Z2BA 3L12A 1DIOA 4MY9A 5XINA 2UY5A 4GJ1A 1FWJC 4E8CA 3WX7A 2GZXA 4TVDA 5D38A 4Z2JA 4LVBA 5GVJA 3GXPA 4M29A 3KBSA 3I7QA 3HMJG 1Z9AA 3ONCA 4GZ7A 3R6IA 2BNJA 4H6QA 4HTYA 2C0HA 1KM3A 2O4QA 2PDUA 4MB1A 4XZ9A 4XX6A 2ACRA 3U4FA 3JZUA 4NJIA 4O0ZA 2HVNA 3W0KA 3GM8A 3C2OA 4PMYA 2FH8A 4JL1A 2P3EA 5LNSA 5AHNA 4DYKA 3KWXA 5HNNA 5GJPA 3STEA 2QCDA 3CL6A 1U1HA 3MVTA 4WDWA 2PDHA 2V30A 3R4IA 1LLZA 3N34A 4LAZA 4MLRA 2CEQA 1XIJA 3LU2A 1IHIA 4MNKA 3M4HA 1NM9A 3ALFA 3VAVA 3H4GA 1JPKA 2VQUA 2C16A 1FWSA 4DZHA 4YN5A 2BV9A 3L4TA 3PZ9A 5CSRA 1FXQA 4CEXC 1OYAA 2A3HA 4UQ9A 1EGZA 2WMKA 3LNPA 1XH2A 3W1PA 4GYKA 1PX3A 3P6LA 3M5ZA 3LHWA 5ABHA 4HSNA 2FQIA 1JCNA 4PN2A 3K30A 1PX4A 2VRQA 4MKSA 4DBUA 2CU0A 1ECEA 1HJUA 5C7HA 2PI6A 5K2ZA 3I6TA 5GNXA 1QOXA 1TPEA 4S2CA 1OYCA 2CWXA 1M41A 1E1CA 2QJNA 3EKGA 2YBVA 3NSNA 5HNTA 2VL4A 5FA5A 4LUTB 2ABBA 2E1WA 2QDGA 3W1TA 4GY1A 1UWAA 4D6EA 5FJTA 1DVJA 3FDGA 3TYAA 1RJQA 1UD2A 1VBGA 4Z1AA 3QV8A 3WQPA 3DBPA 1XIHA 1ITUA 2V3DA 4C7GA 3G0UA 3QTGA 1OX4A 5JH1A 1ZGDA 4DLFA 2DY3A 1BWKA 3W7EA 2EBNA 3UWUA 3TA9A 1U5HA 3S47A 3EPNA 1HKKA 3P74A 3QPZA 4KWUA 5DO8A 2PPGA 4XKYA 1WOBA 2YL5A 3WQEA 2E3ZA 1CB7B 3LS9A 3ABRA 4LRTA 3CTTA 1TVPA 3IVSA 1PJ9A 4XISA 2A3CA 4IG2A 4J3TA 4A8LA 1JZ6A 1QJWA 4I3GA 2FYMA 1WKEA 3FHQA 1NIUA 1BF6A 4QAWA 1XF0A 3TX9A 4X9SA 2PDIA 4AEOA 1GEHA 3VIJA 4QJ5B 1XBXA 2ZZ4A 1Y8BA 2GLKA 5TQLA 1TPFA 3EX6A 1ISVA 4L9YA 5FL1A 3H6OA 2AQVA 1AW5A 1YX1A 4N42A 1SFLA 1V0MA 2IKJA 2WMGA 3AZRA 2BODX 4W87A 2Y0FA 3HU7A 3KRBA 3WNOA 2QDEA 3KW3A 5LA1A 1A4LA 1UWTA 1GHRA 1GPWA 5LIUX 3T6CA 4AY8A 1G4SA 1H09A 4MGGA 1H7XA 3HQOA 1HJSA 3MUXA 2HSAA 2CHOA 3GNXA 1OT1A 1D8CA 3BK0A 1OFDA 1QI3A 2FVLA 5TF0A 5LXEA 3TTQA 4DWSC 1A5OC 1PSCA 2MNRA 2CCRA 4Q6JA 2VWSA 3BZGA 4Q4RA 1CLKA 3GW3A 3GC4A 1UWRA 3SRFA 5REQA 4C1NB 3BAJA 2J8FA 5L6UA 7ENLA 5IHRA 1VCFA 3NOEA 3W07A 2CBJA 4NILA 4PCFA 4TUFA 2V38A 4Z2LA 4ICCX 5E5CA 2DGAA 1OZMA 9RUBA 4AZIA 1XYBA 4D9PA 2AOSA 1V3IA 3NQFA 1OK4A 4R85A 3LTSA 4Q7NA 3STCA 4RDWA 4IL0A 4HNNA 1ZENA 1DJXA 2DVTA 3HGOA 3ITYA 1E6NA 2V67A 4HU4A 1F3EA 3V1HA 1W9DM 2E68A 2XUCA 2ZUTA 5RUBA 1LCOA 5M17A 3W1QA 1KBIA 1Q4NX 1TJPA 3OVGA 1LWIA 3GDMA 1X7FA 1J0IA 2UY3A 3F03K 3VDGA 3K5XA 3WEZA 5DRCA 2QIIA 1R2SA 3GSMA 1TPUA 3MDUA 4QG8A 1UC5A 4D71A 1PWLA 1AVAA 4FX7A 4UMCA 3HFYA 3WH9A 2V5DA 3W85A 4GX9A 5LNWA 1GJPA 1CW2A 4S3GA 4C90A 4HU8A 3W7PA 4GC4A 2WMIA 2GUYA 4PUNA 1H7WA 2H9AA 1NWTA 4QLJA 3AHXA 5KSWA 4GO8A 2WXDM 1YBQA 3DOPA 4JNMA 4OWGA 1RLCL 2POTA 2J7GA 4OV9A 2NVDA 3S1WA 3QSTA 4DJFA 2PF8A 2YSWA 3BVJA 4TMCA 2CLMA 3GFXA 3M5VA 3TOPA 1V3HA 4HIBA 1J5SA 4S3EA 4REQB 1AL7A 1B2YA 3O6YX 3UYCA 3QRHA 3AMGA 4PTVA 1BWVA 2B7PA 1I1WA 2BG5A 2WZIA 3MJYA 1QOQA 4ES4A 3RRXA 3MANA 2EPLX 4ATWA 1PZ3A 4M24A 4D8ZA 3AJ7A 3S46A 2YCEA 2PS2A 3WL0A 2J9XA 4PRWA 4AZBA 3EPOA 1TKKA 3M0IA 1XL9A 1Z89A 5BU9A 3WNMA 3KOZA 1UC4A 3QY7A 1H49A 3W7LA 3E12A 3GE7A 2VENA 2R24A 3DI0A 4A35A 1OCQA 5CSUA 1A0DA 2YB4A 4IH3A 3W84A 5CAHA 2YYTA 4NZ4A 4NI3A 1E4NA 4FNQA 1ZPTA 3GTHA 4O12A 2FZ9A 1V6WA 4GJIA 3W26A 3NYZA 4IICA 4LAMA 3W7NA 1NARA 4H2CA 4N9EA 3CUGA 3BO9A 5DXYA 3HQNA 1S2VA 2GGEA 1QPOA 2X1TA 1XD0A 3BXWA 3VIIA 4C6CA 2UV8G 3QC0A 4NAFA 1TUFA 2ZUUA 2JFEX 3AS1A 1SZNA 1UR4A 4BI7A 1W3TA 2BSLA 3W71A 3QZEA 4F8XA 4Q7IA 1W3KA 4OECA 1A53A 1WPCA 4WRHA 1V8EA 4GWEA 1ISWA 2IXVA 2O92A 1SVDA 1ZAIA 4DBEA 1XDJA 2QCCA 4ML9A 3PFRA 1BRLB 3ES8A 3R1ZA 1R7OA 1W9BM 3NOYA 2XN0A 4H8NA 2WNZA 1M7JA 1NP0A 3S5OA 3HGSA 3B0VC 2YDQA 3OVPA 4F66A 4QCFA 4AD2A 4I9JA 2R1NA 4C7DA 4GQGA 2PP0A 4Z1BA 3DC0A 1HO1A 2DT0A 3RM9A 1V08A 4JHMA 4DJED 1WDWA 4L80A 4IMCA 3TW9A 4PUUA 3W7MA 3N2XA 1UHVA 4H9VA 4GZEA 1R8LA 3S3GA 3E3HA 3PFMA 2ZRUA 1S3HA 3EEZA 1UJQA 4UTTA 3JVAA 1AQHA 2X16A 3WH7A 1K9TA 5FD0A 2A7PA 3PY2A 4L64A 1XH0A 3W01A 1UH4A 1Z41A 3CQ0A 4Y9PA 4D72A 2DSWA 1YDNA 1CEOA 3C3NA 4AXNA 3VD9A 4GRSA 5HWNA 2PTYA 3LBCA 2JGYA 4FNUA 5BOOA 2TODA 4C6QA 2WHLA 3F5KA 4HJFA 2OZTA 5AYBA 3S8HA 1KFCA 3O0KA 3RYSA 1OVDA 1BSLA 1KM5A 1LLOA 2JQXA 3WDJA 4JFSA 2NSOA 2ZTKA 3SUUA 4PB4A 1KM1A 4BQ5A 3DESA 4UQBA 4AVFA 1AUSL 3NO5A 2EG6A 4A29A 1KFBA 1IXPA 3QKEA 1NF0A 1UR3M 4PEEA 1X6LA 3A4JA 2SFPA 2B31A 4EAMA 1R6WA 4FNPA 3CUJA 2D0FA 4Q4KA 3SB0A 4NYYA 1P5BA 1VBRA 3EDDA 1E4MM 2FKPA 1CWYA 4UTMA 2YFNA 2R14A 1EC8A 1VEPA 3G1RA 1UKPA 2YL6A 4XKMA 5CGMA 4MVAA 3PZUA 4CU8A 3LMYA 2GVGA 1WDDA 3EWDA 3VCRA 1FDZA 1KLYA 3GDTA 5FJPA 1FWEC 4ZQNA 1OADA 1X7IA 2VEMA 2O9TA 2DP3A 4JAWA 1LUCA 2HJPA 1ZAHA 2YR1A 4CLMA 3NWRA 4M80A 2IPGA 3UWYA 4TX9A 1DBTA 3MYOA 1YNPA 3L67A 2VZUA 5FEZA 4L6OA 3MDWA 5F4XA 3SADA 3M9YA 1S5TA 5I02A 2OT1A 3FXGA 3KP0A 2R1MA 1BXBA 4GX8A 5F2LA 1CGUA 3CL8A 5A8MA 1JDFA 1GEQA 2WCGA 1EHNA 4BQ2A 4KBXA 1TPH1 4JEQA 3INPA 1YPFA 2D2GA 5HWJA 5F1VA 3HV9A 3AAMA 4UNIA 4Q6XA 2D22A 5I3HA 1DKWA 3W28A 3H2CA 4LVFA 5LGXA 5DMLA 1WDSA 1SJCA 3V18A 5I00A 5A6BA 1E40A 3U48A 3STGA 4GIEA 1PIIA 3R11A 3LPGA 2QJIA 2EKGA 3WZ0E 3GNRA 3AXMA 3U8GA 2PGRA 4L6DA 2W63A 3BMVA 4K38A 3WF3A 1CGTA 1V0NA 2KAUC 1TPB1 3ZLGA 5I79A 3W7HA 3W6LA 1XFBA 2ZFAA 3TQKA 2JGQA 1W9VA 2AL1A 3T81A 4JHOA 4XUYA 1U22A 1KXQA 3HV8A 3BGAA 1PZ0A 1VFOA 2WMHA 3SGGA 2OFJA 3K2GA 1VBJA 3GNOA 3FV9A 1WB0A 3LEPA 1H7OA 3R8GA 1JQVA 3BQ6A 3L4UA 1UOKA 4F0LA 3EXTA 1G94A 3I7RA 4MAVA 3AJXA 3IIOA 1SJBA 3VO0A 4ICMA 1C91A 1H61A 3DAQA 4DN1A 1O5QA 4O52A 3EOUA 4OU1A 1LWJA 3EX4A 4UQEA 3UZWA 2Z2UA 3CUHA 4F4RA 1IXNA 4MNLA 1VFSA 3MWCA 3WMSA 3IRSA 4G6CA 1WBHA 2BS9A 2RH9A 1W3JA 3QMSA 1S1RA 4AZ6A 3T4WA 2F9RA 5K9DA 3H26A 2E67A 1Q3NA 1GVSA 1EH9A 1DJQA 3CWNA 5AYXA 1G4TA 5LYRA 1AK5A 4HCDA 1YXDA 4JL2A 3MHUA 5DCDA 5HR7A 3WCZA 4GPNA 1GONA 4G2DA 4R3UA 3SUVA 5EPDA 1LQ2A 1B90A 4FIQA 6TAAA 3S9ZA 4N2YA 3EWBX 1TR9A 4KWVA 3G1DA 4JQAA 2ZVIA 1NFBA 2HISA 2NQLA 5BWFA 3CZGA 2J47A 4EPBC 1X96A 1FHUA 3AO0A 5H1WA 1DPMA 4C6OA 2WHJA 1KR0A 2V69A 3WELA 1FXPA 3AROA 3KWSA 2P10A 4X9YA 3WQVA 2QUVA 5TAOA 4GVGA 2YJQA 4DO7A 1KR1A 4B4HA 4XZLX 3R5EA 4HMNA 2GJPA 1BTMA 2V82A 2XJ7A 4XG1A 1V03A 3L2MA 1V79A 1KFWA 2ZA2A 4QDMA 3LGGA 4KCVA 4IX0A 1LQ0A 4KH2A 3MPGA 3IJ9A 5HA7A 1JRBA 4XD4A 1M5WA 2XVGA 3CNYA 3LZ5A 3MSRA 4MJ4A 4ZZ9A 2XZ7A 3S1UA 3CHVA 3MCMA 1KBBA 1J0KA 4PMNA 1ZCOA 3NNTA 2E4TA 4UFJA 1LL7A 2WM0A 3N3TA 1A5CA 3DYPA 1JVNA 4V2XA 3ZZ1A 3TA6A 4S3BA 1VPYA 4LEFA 4WXZA 4CNTA 5H8MA 2VT0A 3UNTA 2XFRA 3UVIA 3EWZA 2HV5A 3W7QA 4W7WA 4FLSA 1GG1A 3CJPA 1EO5A 2VEPA 5T9BG 3AYVA 4F2UA 2IQDA 1OK6A 1UJPA 1AFSA 4JD4A 1Q6RA 4OBTA 3GIQA 3CXOA 3SJNA 3DKLA 4GNVA 4AUBA 2OX4A 5CPSA 1GVFA 4KETA 3HG5A 3WIJA 5AC8A 1W5MA 3XISA 4EKJA 4QJ4B 3EOLA 2R8WA 4HPGA 1ZTVA 3EAUA 3MBDA 5FKYA 5D09A 2QV5A 3FJNA 4DPPA 1ME9A 4LUJA 2OWCA 4K36A 4LALA 3W2KA 3KOFA 1P6CA 4OUEA 3KDOA 2XISA 2Y5EA 4GQRA 2OQLA 4S23A 1DE6A 3IS4A 1BWLA 3V16A 3CV6A 3GHTA 4HHLA 3TC6A 5MHBA 1JZ2A 2HRWA 3W7KA 3PJWA 4OHQA 2ABAA 4A2SA