1EQCA

Exo-b-(1,3)-glucanase from candida albicans in complex with castanospermine at 1.85 a
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
394
structure length
394
Chain Sequence
AWDYDNNVIRGVNLGGWFVLEPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAALRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAFQLLDNDPYVQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGFDNSGLRDSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAFQVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGWDAKKESHWNVAGEWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFWSWKTENAPEWSFQTLTYNGLFPQPVTDRQFPNQCGFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords EXO-(B)-(1,3)-GLUCANASE
publication title The structure of the exo-beta-(1,3)-glucanase from Candida albicans in native and bound forms: relationship between a pocket and groove in family 5 glycosyl hydrolases.
pubmed doi rcsb
source organism Candida albicans
total genus 151
structure length 394
sequence length 394
ec nomenclature ec 3.2.1.58: Glucan 1,3-beta-glucosidase.
pdb deposition date 2000-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1eqcA00
4YPJA 2BHYA 1E1FA 2CERA 2J62A 4UFKA 3O9NA 3VOCA 2ZUTA 1C92A 3AMKA 1JZ6A 1WDQA 3PTMA 3CZLA 3AXHA 3WNMA 4WF7A 4X0VA 4HTYA 5A6JA 4NRRA 2D24A 1K9DA 2EPOA 3L4TA 1EOMA 1M04A 1XV8A 2BS9A 4UFJA 4W5UA 1IZJA 5A95A 4BQ5A 1UR4A 1OT1A 1PEZA 4UFMA 2VZOA 3E1F1 3AS0A 3KWXA 1J0JA 3RILA 4N0RA 3WQ8A 1B2YA 4JHZA 1BPLB 1GOMA 5LA1A 1KXTA 1XH2A 1YHTA 3DYOA 1VBRA 3AZTA 1EDTA 1D7FA 5A8QA 3D5HA 2JIEA 3T0AA 2VVNA 4HPHA 4CD6A 4QDMA 1DWFM 3WQVA 3L4WA 3BGAA 1MFVA 1K9FA 5CJ5A 4PTVA 1M01A 1JL8A 5FD0A 2WWCA 1KXQA 3WNOA 2XFRA 1C8QA 1E72M 1GOKA 1W9BM 2J75A 2WZHA 3AMCA 1NWSA 1FH7A 2E0PA 3NUKA 1UR2A 4DUWA 2E9BA 1UA7A 2FHBA 4PMDA 1EIBA 4CD8A 9CGTA 4B9YA 1GCYA 2PWGA 2F2HA 4QAWA 2Y5EA 3VD3A 1BYAA 1V0LA 3VINA 1R7AA 1M53A 4QCEA 4HZ6A 1XRVA 1B3WA 2J7EA 2VMFA 3MU7A 1NWTA 1A47A 1W2VA 5E70A 2XUCA 2TAAA 2YDQA 1QI5A 2CIPA 2QPSA 1OGBA 4M80A 1CPUA 1DWHM 3ZSTA 1TVNA 1M7XA 2FH8A 4MB1A 1VFUA 3NSNA 1GVIA 1LF1A 3K46A 4ACZB 3G6LA 1XSJA 3ZT6A 2IXUA 3GYCA 1L0PA 3AIWA 3WUFA 4TVDA 1BG4A 1K9EA 2WK2A 2WSPA 4WSKA 1EA9C 3CLWA 1JF6A 3OLEA 2OWXA 3BAXA 3EBVA 1WZMA 1KWKA 1JZ8A 4EK7A 1UZ1A 1E43A 3N9KA 4FLOA 3TOPA 4E8DA 5DFAA 1PAMA 2WMFA 1X1NA 1KCLA 1CGYA 3SURA 3VIOA 1TE1A 4HOZA 3HJEA 2WVUA 3MANA 3CHDA 3NCOA 4UZSA 1XD0A 2C0HA 5F7UA 3N11A 4Q22A 3WL1A 4WKFA 1WE5A 2NW0A 4D72A 1GOWA 4W84A 1GZJA 5TD4A 2VZSA 1NARA 3VIFA 2E4TA 1J18A 1GVYA 4LGXA 3CHEA 1WCGA 3ZSSA 1HL9A 3QR3A 4C7GA 2WM0A 1HJVA 1LL4A 1W3KA 1FOBA 1JFXA 1E9LA 3PZTA 4AD4A 3CH9A 3WQ4A 3VDBA 4P7QA 4OKDA 1B1YA 2VCBA 2CXGA 3PTKA 1CGXA 4ACYA 1VEOA 1MXDA 1ITXA 3GNPA 3MMUA 2E3ZA 2CHOA 2DQXA 2AAAA 2V3GA 5LYRA 1QNQA 4S3JA 5E09A 2PWEA 3PTQA 2JEPA 3SCOA 1PX8A 1QBAA 4U2ZA 4A3HA 2W63A 5DT5A 3ARWA 3BLKA 5JIPA 3KEHA 1WKYA 4PTXA 2A3BA 4B9ZA 3CGTA 2X05A 1OD8A 2XWDA 5A6SA 5A8NA 1BSIA 3VGBA 4GXPA 2J79A 3GNOA 4D6CA 4FLQA 1HJXA 1BYBA 2ZUWA 1BGAA 2VZVA 5CSUA 4P8UA 3BH4A 2PWFA 1YQ2A 4V2XA 3WH6A 2CKSA 3LPOA 2ZX5A 3CIVA 1XYFA 3VIKA 2D20A 3SUVA 3T2PA 3WMBA 3EDJA 3QHOA 5EFFA 1M03A 1VIWA 4U5KA 1SMDA 4J3WA 3MMDA 1J0HA 2VI0A 4CN6A 2BNJA 1J0YA 4AZHA 1WPCA 3MV11 1X6LA 5AY7A 4BZYA 2YDRA 4PTMA 3WH9A 1BF2A 3WFLA 4P8WA 2BXZA 4B3KA 5KZ6A 4J3XA 3U5UA 1E5NA 1V3LA 1J01A 1V03A 2WW5A 3CZKA 3EMQA 4LXFA 5HXMA 4U3CA 3VIJA 4OUEA 7A3HA 2OSWA 1V3MA 1E6NA 1R8LA 2VZUA 4MDOA 4PYSA 2Q8XA 4J3UA 2Z1KA 2A3AA 2WBGA 1VBUA 2YA1A 2ZX6A 5GNZA 3HU7A 1WB0A 4MAVA 1UH3A 4XX6A 4CCCA 1UWIA 2WMHA 5CPQA 5CQ1A 1AMYA 8CGTA 5ABFA 1UQZA 4PCSA 1XSKA 2BVTA 2WC4A 2FDMA 1VENA 4KRUA 4AZIA 3AHTA 4HMDA 2CCRA 2YA0A 3IAPA 3FHAA 2WBKA 2E8YA 1UD4A 1WDSA 1EOKA 2Y24A 2J8FA 3CUJA 1GHRA 5CLWA 4DWSA 5A2BA 1MW0A 3I3BA 4UOJA 1OB0A 3VM7A 1NOWA 5FOOA 3VD4A 4PRWA 2XVLA 4M24A 1E6PA 1JYNA 2VCAA 2W62A 3T0BA 5JBFA 1OGGA 2VZTA 1WDRA 3W0KA 3ALGA 3WIJA 5I6SA 1GQJA 4FK9A 5A6LA 3M6DA 2DSUA 4UOZA 2DIEA 1B3YA 2WMIB 1QOXA 2VQUA 3BMWA 3L2MA 4AZ6A 1V08A 3WD2A 3WEZA 5CXPA 1V3IA 3PBGA 4PMOA 2XTKA 4LYRA 3K4DA 4MJ2A 3T08A 5E9AA 3AZRA 3MUZ1 2W5FA 4D1IA 3WDQA 3ARXA 4JFUA 3FAWA 4DUXA 4FLRA 2OWWA 5HPOA 1NWUA 1O7AA 2Y2WA 3DHUA 2X1IA 2OLHA 1KR0A 1Y7VA 4HPGA 3WQWA 4MAZA 2JFEX 5A2AA 3RIKA 3N12A 1CECA 2BY1A 1OGSA 4ZFMA 3L4ZA 4GKLA 1UA3A 2DSKA 4RE4A 1CXIA 2JEQA 2CETA 1JD9A 3WD4A 1DP0A 2DDXA 1D3CA 2OSYA 1NP0A 2J7HA 3SCTA 4UFHA 1C7SA 4P7LA 1W3HA 1UKOA 2VL4A 3CUGA 4HA1A 4ZXLA 5HPCA 1JNEA 1RD6A 5DT7A 2DH2A 4MNMA 4LYQA 3HN3A 1MVYA 3EDDA 4GO8A 3B8SA 3L2LA 2BHZA 4Z2JA 1GNXA 4A4AA 3GBDA 4AIEA 1CGVA 2VX4A 2YJQA 2V38A 1W1VA 1HXJA 3VX1A 3WUGA 1GONA 4PSRA 1BVNP 3ZM8A 1TFVA 2VVSA 3ARSA 5A8OA 2W91A 1Q6EA 2J7BA 3ZJ8A 5D8ZA 1ZBKA 4HMCA 1PBGA 1JZ7A 1NM9A 4U3AA 4QLKA 5D9PA 2CBUA 4A3YA 1BGGA 3B9EA 1W32A 2WLZA 3WBAA 1LJYA 1GOOA 4ML4A 1G01A 2ZWYA 1C3FA 1JI1A 4FLSA 1XCXA 3WUBA 1FP8A 4L4PA 3MV01 1C8YA 3VGFA 2D23A 3MKKA 1JDDA 4JL1A 3W29A 1QNPA 3M7SA 4C7DA 1UD8A 1EH9A 4P7OA 1AQMA 1LLOA 2EPMX 1PZ2A 3A6OA 1J10A 2C7FA 2YDSA 3N1AA 3ZR5A 1MYRA 4AD5A 3JUGA 3PZOA 5JBEA 1V02E 5M17A 1B90A 2D1ZA 3OA5A 4UFIA 4E8CA 4UQEA 3LPFA 3PZNA 4PEEA 3UETA 5BCAA 1W3LA 3CTTA 1UKPA 4QFUA 3MSDA 2AOSA 1JZ4A 2J25A 3T2QA 2YA2A 4NRSA 1JAEA 4GQRA 4D6JA 2X2YA 2XVKA 4MTVA 1BYDA 4F8XA 1KWGA 1BLIA 2G3NA 4ZEPA 4CVWA 4OBRA 1OWQA 1E3XA 1CGUA 3N17A 2OYMA 4AD2A 2ESCA 3ZIZA 4PMYA 3MS8A 4HU0A 4W7VA 3ARZA 2WCGA 1ISWA 3CUFA 4NF7A 5I77A 3B9DA 3OBAA 2VNCA 1GPFA 1W9PA 3FN9A 3ZJ6A 4J3VA 4UZUA 3AIUA 1CGWA 2QHAA 3NDYA 1H4PA 1QHPA 4D6HA 2ZIDA 1HNYA 5A6KA 5AYBA 5AC5A 2HISA 1GOIA 3D3AA 1E55A 3KL5A 1IZKA 3KE0A 1C90A 4XV0A 1I1WA 3O2LA 1JF5A 1Q6CA 3AIVA 5M5DA 3RM9A 5M3WA 1TA3B 3G6MA 3EYPA 1FH8A 4HA3A 1GHSA 1KGWA 2WPGA 1V6VA 1VFFA 1E1EA 3GM8A 1KXHA 4M8UA 2YBUA 4C7FA 1KBKA 4J7RA 1B9ZA 4CUCA 1LL6A 3M07A 3VIMA 2XVGA 4PN2A 5EMYA 2ZUVA 3N15A 1ZU8A 1LG2A 2CPUA 5I78A 2GJRA 3VDAA 2NT1A 2CBIA 2BXYA 1OD0A 2W67A 1TVPA 2GFTA 3AYSA 5E6YA 4F66A 3IJ7A 1QI3A 1RP8A 3AI0A 1GORA 1KCKA 4M81A 3EDEA 2Y8VA 3QGVA 4PMNA 5D9OA 3K8MA 3N04A 1JGIA 3SUUA 1KFWA 3RDKA 3UR8A 3DECA 3UR7A 3T2OA 1UZ4A 3GDBA 4H41A 4R27A 1TZ7A 3RJYA 4QCFA 1HX0A 2WVTA 1W2PA 3W38A 1A3HA 2EPNA 1OBAA 3GTNA 2XVPA 4DWSC 3AOFA 5CGTA 5CZKA 4PMVA 4GI8A 4Z2KA 4RE2A 1VFOA 3IAQA 2AMGA 2WAGA 2DSZA 1V02A 1EHNA 5M03A 1E4NA 1U2YA 2D22A 5BROA 3K4AA 3W24A 2FGLA 3A3HA 4U2YA 4BF7A 1H1NA 2O9OA 3FXYA 4MDPA 2E8ZA 2CBVA 4YN5A 1HF6A 1G94A 1R7OA 1V0KA 1VJZA 1E0XA 3OGRA 1TR1A 2BFGA 3EDKA 1HL8A 3CBWA 3BAYA 4AC1X 4TVCA 1JZ5A 2HVMA 2UWFA 3KL0A 2QV4A 1UD3A 4OIFA 1MW2A 1HP4A 2W66A 1EO7A 1O6IA 4D1JA 5BXTA 3ZO9A 3AXXA 5CPSA 3K8LA 5ABHA 1J9YA 2DEPA 2VR4A 1HJUA 5FL1A 3BSHA 2WCAA 5A6BA 2VX5A 1W1TA 1J0IA 2ZXDA 4U31A 3RJXA 4QLJA 2WHJA 1SR0A 3PZMA 1UH2A 2ZX9A 2YLLA 1B3ZA 1E6RA 2J78A 4K68A 1QI4A 4AEEA 1BVZA 1C93A 3AZSA 4AWEA 4AZCB 2A3EA 3HMCA 1XD1A 1PZ3A 4GINA 3UG3A 4R5EA 1JXJA 2PC8A 3VMOA 1HN1A 4AXNA 3B9AA 2XGBA 3TTOA 2QMJA 3F5KA 5JBDA 1E0WA 2QPUA 5CG0A 1CXLA 2PI6A 3TTQA 4ACZA 1K9TA 3GXIA 2GJXA 3EDFA 1I1XA 3O6AA 4H7VA 4F9JA 1ZL1A 4HOXA 3UCQA 3W6LA 2DT1A 2XFYA 2ZUNA 3FAXA 2ZX8A 3LPGA 4WSJA 5IFTA 1ISXA 3ZQ9A 3APGA 3FNDA 4PTWA 1J12A 1HP5A 2WMJA 1NWRA 1CENA 1UWTA 2Y4SA 3PZVA 1H5VA 5GPRA 2EEXA 2VUYA 1PX3A 3AROA 5E6ZA 2WVSA 3GXDA 1E3ZA 1ISZA 1BG9A 2WZEA 1XH0A 4X9YA 2JIWA 4CU6A 7CGTA 2ZUSA 1QVBA 5GNXA 3AIEA 5I5RA 3AIRA 1KB3A 2NSXA 3T0DA 8A3HA 2WYSA 3W53A 1FA2A 3AISA 1UKTA 5IXEA 3ARVA 3WF0A 3WNNA 1KXVA 2ZUMA 3WH7A 1AVAA 1HKKA 3VO0A 4W8LA 2D0HA 2OSXA 2J74A 4ZENA 2IXVA 5ABFB 5C8BB 2J47A 2EJ1A 1E0VA 1SFSA 1H3GA 2DT3A 1NH6A 4HU8A 3UG4A 4OZOA 3BAJA 2G4FA 1QPKA 5HBFA 2YIHA 4H8UA 1WZLA 1ISVA 1H41A 1QBBA 1GQIA 3IJ9A 1E6QM 4Z2LA 1HJQA 2NT0A 2BVYA 3ARQA 5CSYA 3WL0A 3F4VA 1OM0A 2GJPA 3I3DA 1CLVA 3WENA 1QNRA 5EFDA 3OLDA 3SCUA 2GUYA 4JIEA 5ECUA 1OCQA 1CTNA 3WMCA 3L4VA 2O9PA 3W27A 3VNYA 3L4UA 3A47A 1LQ0A 4LPCA 2VX6A 2WVVB 4JFTA 1V3KA 4ATLA 2VQTA 4WIWA 4CU8A 4E2OA 4ZE4A 1H49A 3WNLA 1E5JA 4AISA 3ZJ7A 3U57A 2EQDA 1WP6A 4EKJA 3PZ9A 4D6EA 1ZBCA 3POHA 4PCTA 1G5AA 4QLLA 1F4HA 2YL9A 4UTFA 3OG2A 1E6XM 1Q6GA 3K8KA 2VURA 4D6FA 2CYGA 4WJXA 3TONA 2V3EA 3PN8A 4OOUA 4B16A 1UKQA 2PBGA 1V3JA 2GK1A 1F4AA 3KZSA 2V5CA 2C8NA 1BQCA 2XGIA 4UQ9A 1FFRA 1WZAA 3DYMA 4W8BA 1HVXA 3BAKA 2RGLA 5FKYA 3RO8A 4AMCA 2FHFA 3ZR6A 3N18A 4ZXOA 4EANA 5A1AA 4JKKA 2XJ7A 4AZGA 4PUDA 2JALA 2EXOA 2XSAA 2G3IA 4KRTA 2XM2A 3CUHA 2DT0A 2WHKA 4JKLA 3VDHA 4W88A 2EPLX 2WZIA 3NJ3A 3QOMA 2XIIA 1VF8A 1PPIA 1KQYA 2DGAA 1B3XA 4D6IA 4BA0A 1CXEA 2E9LA 4JFSA 4XZBA 4MPKA 3II1A 4MB5A 4CKQA 3BCFA 1QI0A 3W26A 3AYRA 4UNIA 1LL7A 3VIGA 1NP2A 4FMVA 3PHAA 1AQ0A 5I3DA 4ATWA 2W61A 1K6AA 2FH6A 4CD7A 3N13A 1MQPA 3SCQA 4CCDA 5LA0A 3SCPA 3VGHA 4AEFA 2E40A 4P7NA 1BHGA 1EGZA 1VFMA 5BYWA 3WKZA 5CGMA 1FFQA 1US2A 4W7WA 3TTSA 2PWHA 3MUY1 3ZT7A 2MANA 4UR9A 3CZGA 3BLPX 3IJ8A 1VEMA 1N82A 1V3HA 1XGZA 1OT2A 5A2CA 3AQUA 3ECQA 3QHNA 2CNCA 2BV9A 4U33A 4B3LA 1UQYA 5I23A 5A6AA 3AIQA 1ODUA 2VRKA 3VKKA 4CCEA 1C8XA 1UR0A 4HP5A 2O9RA 3TA9A 1JIBA 3AS3A 5DO8A 1VB9A 1IV8A 3OLGA 4M56A 1CNVA 1CXHA 5IDIA 1UKSA 2VOTA 5DEZA 1PIFA 5A8MA 1KQZA 2XG9A 2PB1A 3THDA 5D9NA 1KGUA 2EBNA 4TVUA 4W5ZA 3L4YA 6A3HA 1Z32X 4GIAA 3PZUA 1LWHA 4F79A 3OLIA 3FW6A 1UD6A 1MW1A 1L8NA 1C7TA 4PMXA 1EDGA 2V5DA 1NOFA 4JL2A 1V0NA 6CGTA 1FHLA 4H8VA 1EDQA 3NSXA 4TX8A 3CHFA 1VAHA 1UOKA 3A4XA 5E0CA 4HZ8A 1C91A 4TUFA 3QHMA 3CZJA 1UUQA 3AHZA 4UQBA 3U7BA 4CU7A 2UY5A 4GI6A 3UEQA 3CHCA 4PUEA 1BYCA 2WXDM 5A6MA 5ABEA 4AW7A 3MMWA 4KWUA 5JUVA 3AMGA 1UH4A 2PBOA 1W1PA 4CD4A 3BMVA 1J0ZA 2XVNA 2WHMA 1E71M 2ZOXA 3OGVA 1CZ1A 4H04A 4J27A 3SUWA 4CGTA 3QOKA 3OZOA 1NQ6A 2Y8KA 1EHAA 2WKGA 3ARYA 1MWOA 1WNOA 3CZEA 1GW1A 1ODZA 1S46A 5AYIA 3VIIA 4IPLA 3W25A 5BRPA 2A3CA 2CBJA 4W87A 4XB3A 2UY2A 1J0KA 4NSBA 4QP0A 1LWJA 3CMJA 5BRQA 1VRXA 3GXMA 3OB8A 1JAKA 3BXWA 2WANA 4UQCA 3VIPA 1MW3A 1W9UA 1V6WA 3AICA 4AD3A 3OZPA 3UG5A 3AHVA 4MADA 1W9DM 2WSKA 2WB5A 1ESWA 2G3JA 1CWYA 3WMSA 4LQ1A 1JDAA 3K1DA 2XHYA 4IPNB 2UY3A 1BFNA 2J7GA 3WNKA 3OIHA 4FF5A 5BXRA 4KH2A 4CD5A 3AS2A 3UERA 3ARTA 4N42A 4M29A 2GVYA 2X09A 1WO2A 1LG1A 1ZB5A 2O9TA 3GNRA 4UOQA 3VMNA 4IM4A 5IHSA 3WDPP 3IANA 2CHNA 1OINA 1DEDA 1HKMA 2FGZA 4J3SA 1XYZA 2QLYA 1E15A 4AIUA 1DWAM 4OBSA 3CO4A 4YHEA 5D9MA 2OYLA 1W9VA 4GQQA 3VIHA 1CXKA 1GQLA 2YL5A 3VMPA 1CXFA 3WNPA 3J7HA 1CDGA 1E6SM 1B31A 4B15A 1H2JA 1PJ9A 2IUZA 4AZ7A 1ZJAA 4Z2IA 1ECEA 2XM1A 2WMGA 3DHPA 2B31A 3VNZA 5ABGA 3VILA 3VUPA 1JZ3A 1WDPA 1WZKA 2D2OA 3ZJKA 1U30A 4W93A 1GJUA 1H11A 1W9XA 3SCWA 1GQKA 1TA3A 1E70M 5BXPA 5I79A 1HKJA 1UWUA 3VDCA 4AD1A 3WDJA 1MQQA 4EE9A 3WBEA 3NSMA 3WN6A 4WKAA 3MUAA 4GPNA 4RL3A 1GUVA 3GXFA 3W37A 3I3EA 3SEPA 7TAAA 2GJXB 3NDZA 2YOCA 5FL0A 1XH1A 4X0NA 1G9HA 2VTFA 4YHGA 5DMYA 1EQCA 1SYTA 3VVGA 4GZIA 3GH7A 3ALFA 1IT0A 3A4WA 1R85A 4HZ7A 3BC9A 4H2CA 1E56A 1UR8A 3NIYA 3ZMRA 4DWSD 2V3DA 3IK2A 1DHKA 1QHOA 2XIBA 3ARPA 1H0GA 4GO9A 3VD5A 4D6GA 5A69A 2XWEA 4W85A 4UQAA 3AMLA 4MJ4A 2VRQA 1TCMA 1VJSA 2BVDA 4BQ2A 2PF0A 1KR1A 3M46A 3WF4A 1ZBWA 1CEOA 4BCEA 4P7RA 4V27A 1JYVA 3CUIA 3A4AA 2X0HA 3WH8A 3FY1A 3FHQA 1OSEA 2CESA 4AYSA 1UD2A 2G41A 4J28A 1PIGA 2FHCA 3WDRA 2WKLA 4Z2HA 1R87A 2BY2A 1Q6DA 3AXIA 2J7CA 2WNWA 3WF2A 3WEMA 3WDHA 2VRJA 3WD0A 4LYPA 2DSWA 1UG6A 3NYDA 4KGJA 4CVUA 1JNDA 2JE8A 4JZ5A 4GZEA 2G8ZA 2VCCA 2CEQA 3WF1A 4AIOA 3GBEA 1E4MM 3SCSA 2DIJA 1CLXA 3ARRA 2OYKA 4DM1A 5D8WA 2JF7A 3U7VA 4TTGA 1R86A 2WLYA 3GH5A 4IUGA 2ZWZA 2DH3A 4JFWA 5JIWA 2QF8A 4BQ3A 2W92A 1CYGA 1WAWA 3AFBA 1HJSA 5A3HA 1H09A 5E0FA 3SUSA 1G0CA 2A3HA 1W91A 1E4LA 4Z2GA 4URIA 1B0IA 5KEZA 2VJXA 4JKMA 2VO5A 1HIZA 4AZCA 3LMYA 1ZS2A 3WSUA 1DTUA 4HOWA 5I2UA 4PMUA 3SCNA 3VD7A 1DWJM 4PMRA 1JI2A 3F5JA 1QNOA 1FP9A 3WF3A 1I75A 3VGDA 1DWGM 2XPKA 1E73M 3ZT5A 2GSJA 3VTRA 2YL6A 4MNJA 3MO4A 1JDCA 2EO7A 4W86A 3CMGA 1QW8A 4DWSB 1RPKA 4M1RA 5GQBA 3S6TA 4PSPA 2GK1B 4WKHA 1G1YA 5IHRA 1XSIA 5EBAA 1W3JA 3VM5A 1CIUA 3CZ8A 2VR5A 4D6DA 2D3NA 4CN1A 3KL3A 4GZJA 5EB8A 1QW9A 1AQHA 3AJ7A 4UFLA 6TAAA 2CKRA 3CPUA 2YLAA 3W4RA 2WWDA 4NI3A 4TOQA 2W4XA 3MUIA 4LX4A 5A8PA 2GDUA 2J7FA 2VT0A 1NOUA 4GI9A 1QNSA 1V6UA 3WFZA 2WC3A 4F9DA 2D3LA 2RGMA 4H8HA 4IISA 5CPTA 1XHGA 3RM4A 1GOQA 1Q6FA 3DC0A 4NZCA 1BTCA 3VU2A 4RE3A 3EMZA 1JD7A 3OGSA 1QI2A 2XYLA 2ZXAA 3VX0A 1B30A 3AMDA 1JFHA 2G3MA 1HKIA 3F5LA 1EO5A 3SIMA 2J77A 3RMEA 2PWDA 2DT2A 2XFFA 1RP9A 4EAMA 1SMAA 4Y7EA 1FH9A 2ZXQA 4CN4A 4KGLA 3W6MA 5CLTA 1UYQA 4DUVA 3VD9A 4UCFA 5FCZA 2X0YA 1EXPA 1CGTA 5C71A 5A94A 4L4OA 4AD0A 3WELA 3THCA 1OIFA 1JYXA 5HOSA 4KMQA 1ZJBA 2XSBA 3WDIA 4M82A 1U33A 4MNLA 4P8XA 3VGEA 4HA4A 4WLCA 2ZE0A 4JCLA 1JZ2A 1US3A 1PX4A 1E40A 2VX7A 1Q4NX 2WHLA 3WQ6A 4PBGA 1QHZA 5BXSA 2WVVA 1UWRA 2YBTA 4MB4A 1B3VA 2BY0A 3TTYA 3RM8A 5C70A 2YKKA 4JHOA 4AZ5A 2VC9A 2ZX7A 1RH9A 3SCRA 1KGXA 3GZAA 1JG9A 1XCWA 4P8VA 4XZWA 4JFVA 3RPMA 2D0GA 3POCA 3W82A 4TTUA 1DWIM 4UQDA 2J7DA 3ZOAA 3EMCA 3UESA 1UR1A 1MXGA 4V28A 4ATDA 3WH5A 1V6YA 3SCVA 1XC6A 2V3FA 3BCDA 2X8RA 2WMKA 2DSVA 4U5IA 1EQPA 4TX6A 4W7UA 1UWSA 5I0DA 5IFPA 2Z1SA 3PZIA 3AHXA 2F61A 4WK9A 5GNYA 1CBGA 1TUXA 4DM2A 1KBBA 3VGGA 3BSGA 5AC4A 1VEPA 4BS0A 3S2CA 3W81A 4S3KA 1FHDA 4MNKA 2BHUA 1GJWA 4JAWA 2D0FA 5I24A 1UD5A 1X6NA 5D4YA 4BQ4A 2YL8A 5FIPA 2WMIA 1TG7A 2EPKX 1W1YA 3TP4A 1UWQA 4XUYA 1ZBVA 4PMZA 2WC7A 1HT6A 2JF6A 2OWCA 4HMEA 3BAIA 3BAWA 3LPPA 4JCMA 4AZBA 3AHYA 3U5YA 4MB3A 4Q7NA 2F8QA 4W89A 3WUEA 1J11A 1V0MA 3WD3A 4OJYA 4ZE5A 1HJWA 2ZUUA 3L4XA 1ISYA 2J8GA 2J4GA 2E9MA 5HNNA 1JXKA 1BAGA 1UHVA 2GDVA 4TXEA 4W8AA 1UR9A 4PMQA 3GH4A 3AIBA 1JYWA 3SUTA 3MSGA 1MFUA 1D2KA 4D71A 3PZQA 3PZGA 3DYPA 5LA2A 2ZICA 3RCNA 3ARUA 2QMKA 1MQRA 3WEOA 4J3TA 1E6ZA 2O92A 2BY3A 5A6BD 1H0IA 1OIMA 5DF0A 1E4IA 3VPLA 2WCSA 2ZXBA 1TMQA 4E4PA 3W28A 2CITA 2UY4A 3WQ5A 1HVQA 3WD1A 4AY1A 5HDRA 1P6WA 3AS1A 1ITCA 5BWFA 4OOZA 1V6XA 3WY1A 2DPEA 3T09A
chains in the Genus database with same CATH superfamily
4DZIA 4GFSA 2BHYA 4Y2WA 1EJSC 4X2RA 3E0FA 2YGYA 3VOCA 2ZUTA 4HHPA 1PWLA 3MO7A 3HGJA 1JZ6A 1WKFA 4M6PA 3HM7A 3CZLA 3AXHA 3T44A 4DPQA 2JKAA 1FWDC 4HTYA 5CPMA 1A5LC 2A3LA 1EOMA 1XV8A 1XF0A 3SADA 2BS9A 1U1UA 2RDWA 4MJZA 4LUIA 2CLFA 3B4UA 1OT1A 1NTHA 4YIWA 3AS0A 1JCNA 1MI3A 4JN6A 5HWMA 3VFLA 3OHIA 4I7WA 3VNMA 1YHTA 3FVMA 4LB4A 3MUCA 6REQB 2H9AB 3MP5A 2JIEA 4WRHA 5GVJA 3UJSA 4QROA 2PTWA 2NZLA 2YXGA 1HZYA 5CJ5A 4PTVA 1JL8A 4XISA 1SM9A 4JYDA 2HCVA 1SW3A 1C8QA 1FWTA 1UP0A 1E72M 2HE5A 2WZHA 4G7EB 1OX4A 1F05A 3NUKA 4ZR8A 4DUWA 5I3FA 2A6LA 1Q7MA 4PMDA 5L9FA 9CGTA 2PWGA 3LN3A 3GY1A 4NZ4A 4PE8A 3QGKC 1V0LA 3AALA 4XG1A 3VINA 1ZP3A 1M53A 4HZ6A 3P3BA 1DHPA 4OBTA 1NWTA 1W2VA 2VFIA 2XUCA 2TAAA 2YDQA 3MYPA 5E9XA 1EUAA 1L2UA 5DMMA 4ONVA 3OIXA 4WOZA 1OGBA 3FJ6A 1TVNA 3ZSTA 1M7XA 3NO5A 4LU0A 4MB1A 3LGEA 3B05A 2V6AA 1VFUA 1JGMA 1PCWA 3NSNA 3K46A 3DBNA 3HURA 2QAFA 2Q01A 8XIMA 5I09A 1W8SA 4TVDA 1TPUA 3VI2A 1R38A 4HBKA 3W7RA 4AVOA 4JOMA 1RVGA 3EBVA 2O55A 1JZ8A 3GU1A 4DIAA 2NSOA 2YCEA 3N9KA 4ZTYA 3CUXA 4C1NB 2FMOA 5EMJA 4E2VA 1DE6A 3VIOA 1TE1A 1A3WA 3A9BA 3MVIA 3A64A 3T81A 3MANA 3CHDA 2C0HA 3BO9A 1N8FA 4Q22A 3WL1A 1OG6A 4D72A 3U2ZA 3HPAA 5TD4A 3LCXA 4LAMA 1VCGA 2ACUA 1FX6A 2QCNA 5FI8A 1HUVA 1OF6A 3WX7A 4LAUA 4C7GA 2Y70A 1OYAA 1FWRA 1LZOA 3NQCA 2WSQA 3FJNA 4PTNA 2FPYA 4YLWA 4NL1A 4AD4A 3PZTA 5BZAA 3BUVA 4O1AA 5C9ZA 3ABOA 3DFQA 3CH9A 5HMSA 3N14A 3MDWA 3A22A 3EXTA 4ACYA 1CGXA 2PLMA 3S5NA 3G1SA 4NAFA 1QDSA 5LYRA 2CC0A 2INZA 3W83A 3UXKA 2WJFA 4LS1A 4GD0A 3SCOA 1XQLA 3EB4A 3R94A 1W56A 4PTXA 5I7GA 1OFAA 3NQVA 3REQB 1SW0A 4B9ZA 1LOLA 2HDJA 4KEMA 4LRTA 1ZP4A 1R3RA 3KRUA 1PCKA 3C3UA 1S5NA 3GNOA 4DF1A 2OLAA 3HZ3A 4QHRA 4RNFA 3LCGA 7REQB 2PCQA 3G77A 5K2ZA 3BH4A 2PWFA 2MNRA 3TR2A 4V2XA 3WH6A 2D73A 3G0UA 3B0XA 1XYFA 4L1GA 3W00A 3WMBA 4F0LA 1WKDA 4QSHA 1M03A 4QE5A 2NVCA 3O6DA 2PDFA 3VXGA 3NYZA 4DNHA 5BOEA 2YDAA 2FZ8A 2P10A 1V77A 3WO8A 1KRAC 4X63A 1WPCA 3M5ZA 3ZVIA 5AY7A 3CU2A 3WMLA 4P8WA 2BXZA 5KZ6A 1J01A 1NFBA 3EMQA 5MF5A 7A3HA 3TC7A 4GVIA 4IUOA 5D2WA 1R8LA 4MDOA 3LHWA 4I6VA 2Z1KA 2A3AA 2QUMA 2VEPA 5PTDA 3HU7A 1IGSA 2ZTKA 3VZZA 3RLUA 4MKSA 3USBA 2NLIA 4LBUA 5CQ1A 4IMCA 5HWJA 4PB3A 4C60A 4LUTA 1UQZA 5LHEA 4IG2B 3NZGA 2XU2A 5AHLA 4GYFA 2WO5A 3IAPA 3OVPA 2J6VA 2V8ZA 2FTWA 2WBKA 3BLOA 4DI8A 3WJWA 1XI3A 1UD4A 1WDSA 3ZLHA 3SI9A 2J8FA 1TRIA 2PSNA 5K9CA 4KRZA 4UOJA 1FHUA 4Q4KA 3ONBA 3P5ZA 5FOOA 3VD4A 3F4CA 1RCOB 1YTEA 4ZQMA 2NQZA 1IEVA 1P0EA 4A21A 3HFTA 3T0BA 5JBFA 5GJPA 5CJMA 3M0XA 5F2GA 4MKNA 1GQJA 2OEKA 4FK9A 4CQDA 1XKYA 1MDLA 5JMUA 3S2NA 4UOZA 4ADTA 2WMIB 1R46A 3QQ0A 3L2MA 4AZ6A 4FS9A 4Z42C 1YKWA 1RALA 4FHAA 4RZBA 3GAKA 1V3IA 3PBGA 2XTKA 3R10A 4XIAA 4MJ2A 1CT5A 4J1OA 1S5MA 1EYEA 3R0UA 4H6EA 1F3EA 1BWVA 4IJBA 4L4MA 4Z1BA 1O7AA 2NXHA 1XGDA 2E6AA 4AHQA 2V2HA 4HPGA 3M0YA 4UUIA 2BSLA 3L4ZA 4GKLA 4IJRA 5GJNA 5FJUA 3BJFA 1CXIA 1WYIA 5CBJA 5G4WA 4BWLC 1XIBA 4ZSUA 2AL2B 1UUOA 1DP0A 1TPEA 2TMDA 2V81A 4PRTA 2J7HA 3KBJA 2HZGA 5EMLA 3BJSA 3UWUA 1H7OA 2VL4A 3CUGA 1RD6A 3PM6A 5DT7A 3SW6A 3UGRA 3WCZA 4O4WA 1AW1A 4IH3A 8TIMA 1MVYA 4GX9A 3ABQA 3DX5A 1I2OA 4Y8EA 4Z2JA 4A4AA 8XIAA 4K37A 4K6AA 1EIXA 4ZO7A 3VX1A 3ZM8A 3U4FA 1KM4A 2DZAA 4ILSA 3BANA 1IIGA 2HE8A 2J24A 4O8RA 5BWAA 3EKZA 3BDKA 1NM9A 4U3AA 3FKRA 3MBFA 1W3IA 1XIJA 2C1IA 1L6GA 4ML4A 1JPKA 2YX0A 3LSCA 4JNZA 4CNSA 3P0XA 3MKKA 4AMAA 1JDDA 1K7FA 4JL1A 4UXDA 4UC5A 4H7ZA 1U22A 4P7OA 1AQMA 1RA0A 1LLOA 2EPMX 3ZR5A 4PA8A 1MYRA 3JUGA 5JBEA 1V02E 5M17A 2D1ZA 2VC7A 3EWYA 3FA4A 5FEZA 2PDWA 3PJUA 3MSDA 3LLFA 1SZNA 3U6WA 2YA2A 4NRSA 4UTKA 2P1FA 4D6JA 3THUA 4F8XA 4ZEPA 3SDOA 3Q45A 1P6CA 2EHHA 1E3XA 2QVNA 1CGUA 3ZIZA 4PMYA 5J5DA 4W7VA 1UIOA 1DJGA 3TN4A 2WCGA 2C14A 4NF7A 3B9DA 3L7RA 2VNCA 1MDRA 4ECLA 3QMTA 1KLYA 3DN5A 1A50A 2QHAA 4GUHA 1H4PA 1C9DA 3H23A 3TH6A 2QGHA 3QTGA 2HISA 4R34A 1GOIA 3IIPA 4XV0A 5HQMA 5M5DA 4DXXA 1TREA 3TJ4A 3N34A 1ZAJA 3A24A 1LBFA 3GG1A 4XAFA 3XINA 3U2CA 1V6VA 1VFFA 2AQWA 1MZHA 2YBUA 1EEXA 4O15A 1KBKA 3M07A 1Q7ZA 1I2NA 1ZU8A 2Z7KA 3UXDA 2CPUA 4Q6XA 2GJNA 1UC4A 2Q71A 5EYWA 4AU0A 2BXYA 1S38A 4K38A 5IBXA 2W67A 1AD4A 3AYSA 1RP8A 1JUBA 4RV3A 3QGVA 3NQEA 4PMNA 4OE7A 2PDKA 4MPQA 3K8MA 3N04A 1XINA 1F7BA 1KFWA 2R1KA 3DECA 4I9TA 3T2OA 3NL3A 2GQAA 4R27A 4YJ5A 1GG0A 4QCFA 3RJYA 2ZZ3A 1UBSA 4UMAA 2X41A 4DWSC 1XLKA 1VFOA 2VFDA 3IAQA 5LXXA 3KVLA 4IGNA 4AH7A 4QG8A 4WXYA 3TA6A 1S2UA 2O9OA 2V63A 1TWDA 5I3IA 2CBVA 1G7UA 1R7OA 1R3TA 1V0KA 3GAYA 4S39A 1F73A 1VJZA 1E0XA 1OY0A 1U83A 1W1A1 4GLEA 4TVCA 4YXGA 2HVMA 1XM3A 4NXKA 3KL0A 5FJTA 3I10A 2Z29A 1OX5A 3O16A 3AXXA 3K8LA 1J9YA 3NDOA 3WK1A 1HJUA 3DFHA 4YU1A 1I4NA 2NWRA 1GKRA 4U31A 4NYUA 1KFCA 1ZQ5A 2PDXA 4AEEA 4E2BA 4AZCB 4Q4RA 1PZ3A 3ZWTA 1ADSA 3UG3A 4R5EA 2PC8A 3GW3A 1XG3A 2XGBA 2QPUA 1FWCC 3LBOA 4ACZA 3BOXA 3EDFA 3NPXA 3K13A 4F9JA 1OFDA 1O95A 1YPIA 2AL1A 2EAWA 4DO4A 1R9YA 2V69A 2XFYA 3LPGA 2ZX8A 1RK6A 2HTMA 3GR7A 3PANA 4PTWA 1EP2A 1SVDA 4R9OA 2Y4SA 3AROA 5LSMA 1POJA 4XVDA 3DERA 1JDFA 2OTDA 4YCOA 3LSBA 2NVDA 1ADDA 4X9YA 1QVBA 3QRHA 4GQGA 1PYMA 1QOQA 3IJQA 4HK7A 2VM8A 3MB9A 5CZSA 3DH7A 3MMTA 3VC6A 3WF0A 3WNNA 1KXVA 4E2DA 4DX3A 4HYWA 3PSVA 4LJ3A 4TV5A 3KW3A 1HKKA 4GXWA 4IMDA 4E6MA 1OABA 2OZ8A 3TNBA 5ABFB 3IJ6A 1V4YA 4QS6A 3RPTA 5SWUA 2WNZA 4UTIA 2Q6ZA 2EJ1A 4H83A 4CQ9A 4QQUA 4DZHA 1FCBA 4C6FA 4H8UA 3BV4A 3OYZA 1ISVA 1GQIA 1E6QM 3O06A 3T07A 3U0HA 1ZUAX 2GJPA 1POKA 1TPFA 3SQMA 3BK0A 1H7RA 4QIUA 3TCSA 3SAZA 4H9XA 4HSOA 1OCQA 3UJRA 4QQ3A 2WNNA 4YS1A 3VNYA 2YR1A 4LPCA 3A47A 3SRHA 2VX6A 5BOFA 2A7NA 3LS9A 4JFTA 2VQTA 1TV5A 2IQTA 2YW3A 3E0WA 1EJRC 4RLIA 1TZ9A 3OQ8A 2YBVA 2EQDA 4S1FA 3W7IA 4D6EA 1PWMA 4DZAA 1G5AA 4QLLA 1Q2RA 4UTFA 3L5AA 1GVSA 4NJJA 3W1PA 3IACA 5REQA 2GYIA 2CYGA 3TONA 1VYPX 3PN8A 4KEUA 2YCKX 2RUSA 1V3JA 2XIQA 3H4GA 2C8NA 3CS2A 2XGIA 4NZFA 3QV8A 1LWIA 4RR4A 4W8BA 1NIUA 3BAKA 1QPNA 4AMCA 2F7FA 1TR9A 4JKKA 4AZGA 2UBPC 2G3IA 4PH6A 2XM2A 3HQNA 2GSHA 2PDNA 3SSZA 3CXOA 2Z1XA 2VWTA 3ITVA 1UW9A 2WZIA 4UTHA 1VF8A 3GC5A 1B3XA 1GVFA 4E8GA 3L66A 3IJIA 4LSBA 2QDEA 2P8CA 3R8RA 3QLDA 5KZEA 4MPKA 3II1A 5FAGA 4CKQA 3VIGA 1NP2A 1JQVA 3MQTA 1AQ0A 5AYZA 3KTCA 2FH6A 1DQUA 2WZMA 2B0MA 3TDFA 3SCQA 4NNAA 3BGGA 1DBTA 1M7OA 1RAKA 1X8FA 2GVGA 3BVJA 1FFQA 3MUY1 4L9XA 2E67A 3ZT7A 4DVOA 2MANA 3OBEA 1TWIA 4UR9A 1M6JA 1OADA 1XDJA 5FACA 1XGZA 1OT2A 4OUIA 3ECQA 3QHNA 2PRHA 4R33A 2NXGA 1EX5A 3WYZA 3ZFHA 1JPIA 3WLSA 4QRNA 4CQCA 4UTWA 1ODUA 2VFFA 3VKKA 1BEUA 3M7WA 2CWXA 3I7RA 3TA9A 4Y9MA 1NAL1 3WQEA 4M56A 4GGBA 3W7QA 1TMLA 4OFCA 1L9WA 3LEPA 2W6RA 3COTA 2PB1A 3TSMA 3THDA 5D9NA 4AHOA 3FGCA 1TELA 4QS5A 3M4HA 2HMCA 3PZUA 1UD6A 1MW1A 1L8NA 1C7TA 2V5DA 3P5YA 6CGTA 4TX8A 4GJIA 4JTIA 2Q3RA 1VAHA 3A4XA 5E0CA 4OU1A 4TUFA 3CZJA 1UUQA 3TYUA 4PRRA 2D2GA 3TAOA 3GG0A 5FAJA 4EXBA 5D2XA 3TR9A 2DU2A 3QVQA 5FJRA 4KWUA 5JUVA 3C56A 3AMGA 3WG6A 4L7ZA 1E9ZB 2PBOA 3GTXA 3W7HA 1DJXA 2HBVA 4KWVA 2WHMA 3GX9A 1CZ1A 3UJFA 4DJFA 3CV6A 2H90A 4XTDA 2VP8A 3CZEA 1S46A 4ZQCA 4ADSA 3P62A 4NQ1A 1KCZA 4DZ5A 1HO4A 4WDWA 1DORA 4NSBA 4BEUA 3GK0A 3CMJA 3LYEA 3F2BA 3NO1A 1UPPA 3GXMA 3OB8A 2IPWA 3KBMA 3WLMA 1K03A 2ZQ0A 4K8EA 1L6YA 3S9IA 4NZ5A 3W2KA 1IIHA 4JYFA 1AH0A 4UTTC 4H2HA 1OHLA 2PP0A 2EPHA 2FVKA 3TW7A 2G3JA 5D33A 3DI0A 1NFPA 3HJZA 4JX4A 1FWHC 1BFNA 5DY2A 3EX4A 1H60A 1F76A 1AJ0A 4FF5A 3FV9A 1CW2A 2X09A 5EMKA 3M47A 3UZXA 3ZXWA 4UOQA 2GGEA 2XZ7A 4LVDA 1XIHA 3W7GA 2D2HA 3RU8X 1EX1A 4FNRA 1W3NA 2PUZA 5KITA 1E15A 3EX6A 1F5ZA 2QULA 4IX0A 1W9VA 2ZVIA 1YE4A 3H22A 5I02A 4A2RA 3RX3A 5FEPA 4NX0A 3CJPA 1H7WA 1CDGA 4N6EA 4D8AA 2C0AA 1PDYA 1PL9A 1H2JA 4JPGA 3QMRA 4Z2IA 2XM1A 2OXNA 1O1ZA 1WKEA 2FQIA 2C15A 1JZ3A 3WJSA 3W7PA 1TVLA 1WXZA 3TWBA 4GGHA 4JX5A 3QXBA 2R9RA 4XZIA 1GQKA 3QR1A 2A7PA 4XBJA 2KX9A 4I9MA 5BOOA 1UR3M 1JCXA 5BXPA 3TC6A 4H6KA 1AJZA 5C5YA 1UWUA 3VDCA 2KAUC 3ISIX 4Q6JA 4EE9A 4GYPC 3WBEA 1A5AA 3WN6A 1KBJA 1GUVA 4ZGYA 3V35A 4S3FA 3W37A 4DN1A 2YOCA 3W6YA 2BODX 4X0NA 3MWCA 2VTFA 4YHGA 1WBJA 4ZL1A 1XPGA 1FWNA 1EQCA 3VVGA 4G1NA 4DAIA 4NAFB 3GH7A 4EPBC 3DIPA 3A4WA 1R85A 4HZ7A 4H2CA 2V3DA 4GYKA 1ELSA 3ES7A 1DHKA 3H2CA 3T8LA 2QCHA 2XWEA 3IRDA 4W85A 5J5RA 3VZYA 4MJ4A 4GUIA 3V1PA 4L4LA 4E3TA 1DJQA 4H01A 2OB3A 4BCEA 1ME8A 2R1LA 4V27A 3CEPA 3RAOA 3MVTA 3SZ8A 1GVEA 4QGCA 2G41A 4WX2A 1NY1A 1TV8A 2Y61A 2FHCA 4CNTA 4PL1A 4CNUA 2XN1A 5F2IA 5H2ZA 4QDPA 4LYPA 2DSWA 4K39A 4KGJA 1YMYA 2JE8A 4KWWA 2C1HA 2CEQA 1QO5A 3WF1A 4HNTA 4Y9NA 3NGFA 3BW2A 2DIJA 4O18A 1CLXA 2JF7A 3U7VA 3E49A 1R86A 2WLYA 2GOUA 5JIWA 2OVLA 3N2MA 3MYOA 3CEUA 4ICCX 1QCWA 2W92A 3M0VA 4FR1A 3GUWA 3AFBA 1H09A 2PDGA 1LBLA 2A3HA 2G50A 1Q6QA 2QUNA 4NASA 2VO5A 1HIZA 3LMYA 3G1VA 5I2UA 4WVXA 1DWJM 4LUTB 4ZB0A 4NHVA 3GIYA 5HATA 3F5JA 3DU0A 3WF3A 1I75A 3KRBA 4PFMA 4PR4A 4LVFA 1XIIA 3VTRA 4W86A 3FA5A 1H7NA 2DUZA 4GQBA 2GQ3A 3S6TA 2GK1B 1VPXA 4CEXC 4PUUA 4C6PA 2XFWA 4D6DA 5LIKX 3NQBA 1QW9A 3STPA 1XR2A 3LU2A 3TW6A 2J7FA 1NOUA 5C9RA 4MZYA 2FZDA 4ERAA 2HRWA 4H8HA 3DI1A 1LQ2A 1DXIA 1XHGA 5XINA 2CLEA 4E4FA 1Q6FA 4NZCA 1BTCA 2DZPA 1JD7A 2XIJA 3BGJA 4S23A 2ZZ5A 1B30A 4DJFD 2G3MA 5F1VA 2IPJA 4IP5A 2DT2A 2PLCA 2ZXQA 4LCSA 1S5TA 4GE8A 4DUVA 3H12A 2X1SA 1EXPA 2E6DA 3TNOA 4L4OA 2A5HA 3GB6A 3WELA 1JYXA 3VKBA 2RAGA 4GKTA 4O0QA 4R85A 3WDIA 2NV2A 4MNLA 3VGEA 1GZ1A 3G1RA 3DKLA 3B0UX 3UGVA 3KDOA 4LANA 2QDDA 1XUZA 3SM0A 3FSUA 3LBCA 5I3HA 3WQ6A 1Z44A 4GRSA 4HIBA 4PBGA 2GUUA 5BXSA 2WVVA 4MB4A 2Y1HA 1XGEA 3PAOA 5K3VA 5CSRA 1PV8A 3ITCA 3MJMA 3KFTA 4JHOA 4V1YA 4AZ5A 1TWSA 1DIOA 1IXPA 4UWMA 3SCRA 4BI5A 4FA3A 1JG9A 3W1TA 4XZWA 1F6PA 3QPZA 4XWUA 3DGRA 1E1CA 3GDRA 2ZRVA 3W82A 4AFYA 4JQAA 1DTNA 1DWIM 2P76A 4UQDA 4ZOCA 4V28A 2ZFAA 3MJYA 1W0MA 3I6RA 3VYLA 3SCVA 2WMKA 1EF2A 1EQPA 4M6UA 4X60A 4W7UA 4XUGA 2FPVA 3PZIA 2ZRXA 5CKSA 2TRSA 4Q8NA 3VGGA 5AC4A 4IMAA 4NZ3A 1VEPA 3JS3A 3NOEA 1TJ1A 1FHDA 1J5TA 1UD5A 1S39A 3N9SA 3NZQA 3WJXA 1TWZA 2YL8A 2QR6A 1VKFA 3W7DA 4MUPA 3TP4A 3M6YA 1UWQA 5E0KA 1GEHA 1HT6A 1EP3A 3SO7A 4HMEA 4GYJA 2VEIA 4K2SA 2OPJA 3LPPA 3U5YA 1T96A 4W89A 4D8ZA 3WD3A 4XO7A 3FFSA 3PG8A 3Q37A 2VDHA 1RJRA 1BSLA 3S5ZA 1JXKA 4HB7A 2GDVA 1M9HA 3U3HA 1EJXC 1MUWA 1XIEA 4WJ8A 3K1GA 4FNUA 2P3EA 4M7SA 1JVNA 1OJXA 1Y5XA 4DJDC 3N2TA 4ZSTA 2OOGA 4NJKA 3PZQA 1Q8AA 1T7LA 3P7YA 2ISFA 5HK4A 5HULA 2J8TA 2C71A 1AMKA 3TKFA 1OCJA 3PVFA 3WEOA 2R1MA 2BY3A 4M19A 1OIMA 1E4IA 3P67A 1CLKA 4QE4A 4W9TA 2BWGA 2CITA 1HFBA 1YXCA 3ATZA 4OOZA 3KBNA 1V6XA 3O63A 2DPEA 2ON3A 4NY2A 4N9DA 2NUXA 3G8EA 3R12A 1A4LA 4A8RA 1E1FA 4HA0A 1Y65A 3O9NA 2QCCA 4RZ4A 1C92A 1VCVA 3AMKA 4HYVA 4L64A 2X7VA 1WDQA 3NFUA 4ZZ9A 1PKLA 1ADOA 4ICNA 5K4XA 3L4TA 1IZJA 4BQ5A 3N6QA 3BV7A 5D38A 4IXHA 2PDJA 2PZ0A 5LGXA 1EZ2A 5M2FX 2NX1A 2VZOA 3GG8A 1B57A 3KBVA 1TWWA 4N0RA 3W74A 4RXGA 3WQ8A 4JHZA 3UG8A 5LA1A 4B91A 2O7SA 4O12A 3DYOA 1VBRA 3AZTA 1EDTA 1D7FA 3S1VA 1VD6A 2UZ9A 5HQEA 1X97A 3NGJA 3GQYA 4D2JA 1WOAA 4US5D 1NDWA 4QDMA 3M5XA 3L4WA 2FB3A 1RVKA 3CL6A 3ITGA 2WWCA 2J9YA 2VGGA 4B2DA 1JULA 5LNWA 3LRKA 1R5YA 1TPB1 3PFMA 4GWEA 2V9DA 4KFOA 3EWWA 3V1HA 1P1XA 2R6OA 2XZ9A 1GCYA 2C79A 3HG5A 5FF2A 1XBXA 3MTWA 3PBUA 1B3WA 2VMFA 1KM6A 3PTDA 1U1JA 3KHJA 1I9CB 1KD0A 4LAOA 1PO9A 4HHLA 3WLJA 2FH8A 1P1MA 3ES8A 3N9RA 4OV9A 1FWAC 1XRTA 4O4VA 1LF1A 3S1GA 3GUGA 4ACZB 3G6LA 1XSJA 2FJUB 3CO8A 2PRLA 4FNSA 1L0PA 4R53A 2O7QA 3H2AA 1BG4A 3MBDA 1H7XA 1UPMB 2HK0A 2BG5A 1JF6A 4TMBA 2PURA 5DCDA 2QJGA 2ISSA 3N2OA 5E5CA 1R9ZA 4LUYA 1T40A 3GDLA 4EK7A 1UZ1A 1OVDA 4QEHA 2WMFA 2GUBA 2DZSA 1XWYA 3VDGA 3MZ2A 3SURA 4HOZA 3HJEA 2WVUA 4WQ6A 2WQDA 3NCOA 4UZSA 4HMNA 3GVQA 4WKFA 3WFAA 1MEWA 2Y0FA 1PYFA 3HMJG 3CQJA 4X9SA 4NNBA 4LGXA 2ODOA 1WCGA 2FGBA 2WM0A 3LK6A 1HJVA 4I5RA 4LNCA 1HQTA 4L6DA 1XLLA 2QJNA 3KWSA 4MWAD 4LYKA 1G4PA 3IGHX 1LT7A 2X2GA 4GACA 3VDBA 4P7QA 4OKDA 4F0KA 4KEVA 1VEOA 3GNPA 4YTUA 2DQXA 2AAAA 2V3GA 3D47A 4FIRA 5E09A 3PTQA 2JEPA 3FX4A 5JIPA 1QBAA 4NYYA 3BLKA 1O12A 4HGXA 4JHMA 4GNKB 3CGTA 3L9CA 3C52A 1OD8A 3IIVA 1RLDA 3KTXA 1BQGA 2J79A 3SQLA 3G1HA 3CAWA 4L6HA 1HJXA 1BYBA 2ZUWA 1BGAA 4Z17A 1H7PA 3SN1A 2HVNA 1LBMA 2Z25A 1YQ2A 3UR2A 1AFSA 3ZVHA 3VIKA 3IK4A 2DJLA 4HNLA 1KV8A 3SGZA 4Y6GA 5REQB 1XLAA 3EDJA 3QHOA 3UPBA 3BSMA 2VC5A 4U5KA 3SB0A 5DBTA 5LNVA 4WD0A 4CN6A 2ZZ2A 4LUJA 2BNJA 1DJHA 1R2RA 1B4KA 3MV11 1KFBA 4IQLA 5BMXA 1YDNA 3OW1A 4S3BA 5JVLA 1OC5A 4HNCA 3BLDA 1BF2A 3WFLA 2YSWA 4J3XA 5U4NA 2QW5A 3U5UA 1FXPA 1V3LA 2QT3A 4ZVJA 2WW5A 3DHFA 3CZKA 4LXFA 5FSEC 5HXMA 1XRFA 3SGGA 3W7KA 2OSWA 3QGAC 3QZ6A 1E6NA 4PYSA 2VZUA 3ZR4A 2VELA 1D3GA 1UUMA 2WBGA 1VBUA 2YA1A 3UJ2A 2I57A 3KDNA 4XX6A 4CCCA 1UWIA 4JXCA 4F2UA 2ADAA 5G1YA 3PUGA 4C6CA 4PUNA 3OJGA 3I6EA 4YVVA 4PCSA 4CEUC 2PP1A 2WC4A 2FDMA 2J9ZA 3AHTA 4HMDA 2YA0A 5FJOA 1RD5A 3GC4A 4DWSA 3GWQA 1MW0A 4JTQA 1OB0A 1R47A 4LRSA 3VM7A 1JRCA 2REQA 1GZGA 4DO5A 3QQ1A 3UWWA 1YADA 3PULA 5T9BG 2VCAA 7XIMA 2VDGA 1KM2A 4AHPA 4ZFCA 3QV6A 1H51A 3ALGA 3WIJA 4DLMA 4NIRA 5I6SA 4HCHA 1T8QA 2JK2A 2DSUA 5C2XA 2ZC8A 2DIEA 1B3YA 1QOXA 3DG3A 2VEKA 2C16A 4M1BA 2OLSA 2OZ0A 5CXPA 2PDIA 4PMOA 4D1IA 3WDQA 3W22A 1FWIC 4DUXA 4FLRA 2Y7GA 2OWWA 1B4EA 1NWUA 1OC7A 2Y2WA 3S8HA 4LEFA 4L6OA 4A3QA 4MAZA 4XD3A 1P43A 4DLFA 3MCOA 1YRRA 3RIKA 3N12A 1CECA 4NAEA 1TIMA 4LW7A 1O5XA 1JD9A 2B81A 3WD4A 1RR2A 2BP1A 2OSYA 3A3XA 4UFHA 2EGZA 3GVVA 3PSWA 1C7SA 4P7LA 1W3HA 4HA1A 4ZXLA 5HPCA 3PNUA 4MNMA 4J9JA 3Q94A 4LYQA 3EWXA 4F3HA 2Y8UA 3EDDA 1OQFA 2BHZA 1NSJA 4AIEA 1N8IA 2HVOA 2VX4A 3C86A 1W1VA 3TCEA 2WKJA 1UC5A 1BVNP 9RUBA 1TFVA 3QW3A 2VVSA 4AUBA 2DZTA 5C7HA 3HQPA 2Q02A 1ZBKA 4HMCA 1PBGA 3M64A 1N55A 3GRIA 3U8GA 4AAJA 5AYXA 4Q32A 3MKVA 4A3YA 4NJIA 5HINA 3B9EA 2E28A 1W32A 1QAPA 3FYPA 3VZXA 4GG9A 1OFQA 1A5UA 4FLSA 1T0OA 3RYSA 5D2VA 3S9ZA 1KKRA 4L4PA 5CCZA 4XKYA 4PEKA 4C6KA 2RJHA 4C6DA 4JTRA 3M7SA 4C7DA 1XRSA 1B9BA 3QR0A 3PZOA 5D05A 1B90A 3GE7A 1ONRA 2RDXA 3LPFA 4PEEA 4PUWA 3STCA 1A5MC 3G1FA 4D8LA 2AQVA 2J25A 3LOTA 4BJHA 3E3HA 4Z0SA 2PGFA 4IGSA 5EBUA 2XVKA 4AIBA 3GU9A 3HB9A 1G4SA 2IPFA 1BYDA 3VE9A 1KWGA 1JCTA 2G3NA 3NNTA 2H8XA 1OWQA 4FEZA 4OBRA 1XYBA 2GLKA 5BRBA 2ESCA 4ORIA 1BWKA 3MS8A 3IS4A 4HU0A 3EOOA 1O5QA 3ARZA 3ATYA 3R0DA 3CUFA 3IEBA 1G6CA 1IEWA 5I77A 1WAUA 1FWGC 1GPFA 2YPIA 5CC6A 1W9PA 3FN9A 3ZJ6A 1MUMA 3AIUA 4B5NA 1DIKA 2EJAA 3L12A 1FHVA 1QHPA 3D3AA 3MSYA 1IZKA 4GXMA 1P0NA 1I1WA 3O2LA 3V0TA 4C6IA 4K8HA 1LROA 5JU6A 4IL0A 2G5WA 3PWGA 3EYPA 1GK8A 1Q7QA 1KGWA 2WPGA 5T9CE 4PL2A 1E1EA 1TJPA 3GM8A 3TAKA 4HTBA 4C7FA 4JNMA 1LL6A 3LI0A 1P0BA 1JQXA 2E68A 1PDZA 2ZUVA 4GJ1A 2NX3A 3O8AA 2GJRA 1X6UA 5AHNA 2NT1A 1XFBA 5AC8A 4XAYA 5HA7A 2QIWA 5E6YA 1N7KA 1KCKA 1RY8A 2Y8VA 4QITA 3H21A 1EJWC 3BZJA 4H41A 3B8IA 2NQ5A 1J79A 5CC3A 3S2LA 4ERGA 1TZ7A 3P82A 4KBXA 1W2PA 3BURA 4I6KA 1A3HA 3SGUA 4XTIA 1M1BA 1FQ0A 3GU2A 5HMEA 4K1GA 5CGTA 4GI8A 1J93A 4RE2A 1AJ2A 3MUXA 1XLMA 2AMGA 3OTRA 2DSZA 1EHNA 2GVJA 4HJWA 5M03A 4F4RA 1AODA 4XSMA 3UBPC 3N2BA 2FGLA 4U2YA 1H1NA 3NEHA 1SO6A 4A3UA 3GNNA 1HF6A 1YBQA 4WJEA 2CZEA 2Q8LA 3QPEA 4DBSA 3LENA 3PF3A 2F6KA 2R1PA 3AXKA 2A1YA 5HJYA 1TR1A 1R3SA 2DJXA 3CBWA 3KLLA 9XIMA 3B8TA 1KFLA 3FXGA 2QV4A 3B8DA 1HP4A 2W66A 4IPPA 1O6IA 2Y62A 4D1JA 1SFLA 2ZZ4A 4HJFA 5K9XA 5ABHA 4GQ0A 4EIVA 3BSHA 2WCAA 1J8VA 3KCOA 4FPSA 5A6BA 2Y88A 4QLJA 2WHJA 3EWCA 5D30A 2YLLA 1B3ZA 1E6RA 2J78A 3LHYA 1QI4A 3I6TA 2G3FA 4AWEA 3OA3A 3NVDA 5C9XA 2A3EA 4IGHA 4R88A 2IQ0A 1JXJA 2PE4A 3VMOA 1HN1A 4AXNA 2VGBA 4GVFA 3B9AA 3F5KA 5CG0A 1VLIA 3CLMA 4ZCWA 3E12A 1F6YA 1I1XA 4H7VA 2ZDSA 4HOXA 3UCQA 3W6LA 1GOXA 1GTEA 4HK5A 2ZUNA 4WSJA 5DY3A 1ISXA 4E5TA 2WMJA 4DO7A 3MHFA 2F9RA 3ITYA 4WUIA 3PZVA 4LBSA 3STFA 5GPRA 4JTJA 1LYXA 5FEWA 3XISA 2IW0A 3UYCA 1V7AA 4C6JA 3GXDA 1E3ZA 3QTPA 2WZEA 3SN4A 2JIWA 3AIEA 4L9YA 5I5RA 3MP4A 3AIRA 1KB3A 1S2TA 3CK5A 3IV8A 4PUJA 1R3YA 8A3HA 1S1PA 2WYSA 2Z2BA 3VNLA 4A29A 1QO2A 5BNKA 3U2OA 3DZ1A 4JDYA 5G5IA 4WY0A 3URBA 1OFOA 5FSDC 4W8LA 1RSCA 5BW6A 2W3ZA 3LUTA 2IXVA 3H55A 1XBVA 2FFIA 4UTTA 5FJJA 1SFSA 5L6UA 4M6QA 5LIYX 4O54A 3UG4A 4OZOA 3BAJA 4ORMA 2G4FA 1QPKA 2YIHA 2ZADA 5KSWA 4IIHA 1QBBA 3IJ9A 4A35A 4Y90A 3WL0A 1UMYA 3LV6A 1OM0A 1CLVA 3WENA 2GUYA 1OFRA 3KCJA 4AXKA 1W8GA 5ECUA 3WMCA 4EVZA 4OVXA 3W27A 1MZRA 3L4UA 2WVVB 1ONEA 5A8GA 4KPLA 1YDYA 1N2VA 4E2OA 4S2BA 4CLMA 2V68A 4S3GA 3WNLA 1E5JA 3HPSA 2DZVA 3ZJ7A 3K30A 3ABRA 3CQKA 4DWDA 1UJQA 1DKWA 5CPOA 4XZNX 4E3VA 1W5NA 2FZBA 5H6HA 5KMYA 3OQEA 3WLPA 4FNQA 3PZ9A 1XP3A 3GDMA 2YL9A 2VWSA 5LHFA 1E1CB 2VYOA 2VURA 4IT1A 4V1XA 2PBGA 3KXQA 1HO1A 3CQ0A 1QWGA 3GTHA 1BQCA 2E5BA 1XYLA 3UWEA 1WZAA 3E6EA 3MI2A 5E1QA 2RGLA 4UB9A 5FKYA 1AD1A 4H00A 2FHFA 3N18A 4HZMA 1XXXA 2EXOA 4GYPA 4UR7A 2DT0A 4YCPA 4JKLA 3KS5A 4FO4A 3VDHA 1PZ0A 4W88A 4GMEA 3QOMA 3QBUA 1PPIA 2PD5A 4D6IA 1XIGA 3VOJA 3JZUA 1CXEA 4WR3A 1VJIA 1R3QA 3PB2A 1RY0A 1QI0A 3W26A 4UNIA 3TLQA 4O1FA 2PTDA 2G97A 2DORA 4RKAA 2XISA 2JGQA 5I3DA 3LCHA 3NQGA 4H9UA 2O4MA 3VUSA 5IM51 3CASA 2F38A 1TV4A 1MQPA 2PDLA 2H3BA 1JEZA 4IMGA 2VUNA 3LGGA 1D9EA 5DRCA 2E40A 3PBMA 4P7NA 5BYWA 3WKZA 4Q4PA 1HKWA 1US2A 2OX4A 4W7WA 3OZMA 1P5BA 4KEZA 2JKPA 2YCIX 4UTLA 3UQNA 1V3HA 5A2CA 4GCXA 3AQUA 4RZ6A 3IARA 1PUDA 4F2TA 2HXUA 2IMRA 2YXXA 5I23A 3AIQA 3O1NA 3BARA 4BI7A 2AGKA 1WUFA 2O9RA 1ZJIA 1JIBA 1M7JA 4XKMA 4HYRA 1VB9A 1CNVA 2FB2A 4JBRA 2VOTA 1YXDA 4IP7A 3KLKA 1DXEA 4NJGA 3G2GA 1KRMA 3NPWA 2AKZA 1KQZA 3L5LA 1GW9A 3AWOA 3RU6A 4TVUA 1BWLA 3O6CA 2ZBTA 1LWHA 1Z41A 2I14A 3OPSA 3W1XA 2GGHA 1PKYA 3JRKA 3IGSA 4PMXA 3OOQA 1NOFA 4JL2A 3CV7A 1V0NA 3RHGA 3NSXA 4O0KA 3T40A 1X98A 2E5DA 1UOKA 4HZ8A 3QHMA 3AHZA 4UQBA 4CU7A 2PDMA 1RQBA 2PLKA 1KM5A 3MMWA 1UH4A 4CCZA 3U48A 3ID7A 3OGVA 3EWUA 3Q67A 3B0PA 2PTZA 1EHAA 2WKGA 1A5KC 3OU8A 1WNOA 1GW1A 1ODZA 1IWPA 3SRKA 5AYIA 4IPLA 4N4QA 3W7MA 2A3CA 2CBJA 4O17A 2B7OA 3CYVA 4W87A 3W75A 2X1RA 5BRQA 1O1HA 1X7IA 4C5YA 3NPVA 1QATA 3V5OA 3ONCA 1JAKA 4AQLA 2A2IA 3VIPA 1W9UA 1TUFA 1V6WA 2YCLA 3AICA 3AHVA 3K4WA 3G0SA 4MADA 2X1TA 1FWFC 3KTSA 2FVMA 2WB5A 1ESWA 3W2LA 3MCMA 4EXQA 1AH3A 1CWYA 3WMSA 3LV5A 2ACSA 4LQ1A 4UMCA 1Q6RA 3FK4A 1ZPTA 2XHYA 3NXLA 1OK4A 4I7VA 1F9CA 3OIHA 3QW4B 3M0JA 4N42A 4M29A 1EBGA 2GVYA 4S2CA 5G2HA 1LG1A 3GNRA 4WSHA 4XK2A 4GHRA 3Q2DA 3UXAA 4DB7A 3W73A 1KCXA 4QX4A 1FWJC 1DWAM 4OBSA 3UNDA 4NZ1A 2AQOA 3M0LA 3VNJA 1FDJA 2PEVA 1NELA 3QN3A 4YHEA 5D9MA 1VLWA 4ZODA 4MKVA 4EOUA 4OWGA 1WBHA 1W31A 2VC6A 1IT7A 1PXGA 2WOQA 3LHTA 1CXFA 1I2QA 2C3ZA 2I16A 4PGLA 4Y8FA 3WNPA 5XIMA 3UY8A 3DG6A 4UIOA 4MZ8A 1E6SM 3PJXA 4NILA 1B31A 2INFA 6PTDA 7ODCA 2IUZA 3RXZA 3B8UA 2Y7DA 1RCXB 3DHPA 3VNZA 2C1GA 1WDPA 1WZKA 3DFPA 3ZJKA 1W37A 1IXNA 3N4EA 1H11A 3A13A 3FJ4A 1LOQA 3H7UA 1TA3A 2XH7A 4GABA 3UCDA 1S3TC 3W1AA 1T8XA 1XDMA 3URNA 2DZBA 1HKJA 3WDJA 4PBFA 3TV8A 3UVAA 3R89A 4PC8A 3MUAA 4WZHA 2BXVA 4RL3A 2BDQA 5K9DA 2GJXB 2OODA 3NDZA 5FL0A 1K8YA 1GYMA 4LOCA 4MJMA 3ABZA 4M3PA 1G9HA 4S3CA 3F03K 2E1DA 3CNYA 4MWAC 2Q3OA 2HWGA 3IJLA 2FVLA 4GZIA 3LLDA 4XBSA 1GGOA 5B80A 3JW7A 3GZ3A 1E56A 1PZ1A 1UR8A 2PODA 1QHOA 2XIBA 3CYJA 4GO9A 4F2BA 3W84A 1I0BA 3H7VA 4GA8A 3LA4A 3AMLA 1IF2A 2VRQA 3SFWA 1TCMA 2ATSA 3A5FA 4WEVX 1V6TA 4BQ2A 2ZRYA 4S38A 2PF0A 1A0EA 4L61A 1M68A 5AC7A 2XN2A 1P4CA 1ZBWA 1KFJA 3FEQA 2JBMA 2CHRA 1DQXA 1JYVA 2F6XA 3A4AA 4MY9A 1ENUA 4PB5A 3E0LA 1UD2A 3ZVHB 4J28A 1F74A 2GGGA 4ZBCA 3W72A 4Z2HA 3FOKA 4TU1A 3AXIA 3M16A 1A5BA 2WNWA 3TYEA 3WEMA 3WDHA 2A85A 3PBVA 4DJDA 2G8ZA 2VCCA 3WZ0E 2YW4A 2ZC1A 1S5VA 3SCSA 3O7UA 3NA8A 2ZDRA 2OYKA 5HJXA 4Z0JA 1PTDA 1BXNA 4YVPA 4IUGA 3R8HA 4JFWA 4Q4SA 1JJKA 3NQ2A 4B5UA 4ES4A 3GTFA 4MG4A 4B5TA 5D2YA 2YZRA 1VFLA 1QPQA 3LM7A 2NVAA 4GBUA 4K3ZA 5E0FA 3SUSA 4Q7IA 1W91A 1E4LA 3KRZA 4IXXA 2VJXA 4JKMA 4V33A 4DPPA 4GISA 4L65A 1PHWA 3XIMA 4O19A 3WSUA 4H9TA 4O10A 3SCNA 4R7WA 3P84A 3VD7A 3OZYA 3LI1A 1VFTA 2ZKMX 3C0SA 2R82A 1JI2A 2Y5JA 4A8NA 4LC8A 3WQPA 1ICPA 1QNOA 1FP9A 5FA5A 3ORWA 4DQWA 4EXAA 3VGDA 4NX5A 3WQFA 1SFTA 3ZT5A 4GNVA 1E9IA 4Q8QA 3MO4A 1PKMA 5AVHA 4JY8A 2EO7A 4DJEC 3DFTA 4DWSB 1RPKA 5H8UA 1SZRA 1IE7C 4PB4A 1RJPA 4XVEA 4XZMX 2VR5A 2REQB 5KINA 3UF9A 3KL3A 1J2WA 3G8RA 1FXQA 6TAAA 2XSXA 3PWAA 3QC3A 3W4RA 4NI3A 4TOQA 2DZUA 1FWSA 1TV3A 1SZFA 3P6LA 1MO0A 1QNSA 3HGRA 3O6YX 4MHBA 1VHNA 2WC3A 5I06A 4IISA 5CPTA 3RM4A 1OEPA 3UU0A 1U5HA 3ENLA 3B0VC 4F0HA 5TQLA 1DJYA 4RE3A 1IEIA 3F1QA 3EMZA 3OGSA 1QI2A 2NXIA 1HKIA 3F5LA 1EO5A 3LGDA 4RW3A 2QVHA 2PWDA 1RP9A 1SMAA 1VH7A 4N4PA 1EJVC 3W6MA 5CLTA 1B54A 1UYQA 4Y96A 3VD9A 4NZJA 3B97A 4ZQOA 1CGTA 2H3DA 1TKKA 4KKXA 3OVGA 5A94A 4IIEA 4S3AA 2D2JA 5CAHA 1OIFA 4LUSA 3BW3A 2XSBA 4M82A 4Z08A 1OZMA 1U33A 4MGGA 5IBXC 3GSMA 3V5CA 4Q4MA 4M6VA 4HA4A 3GDKA 3N2CA 3C0QA 4JCLA 1TQXA 5C9UA 1QUMA 4O53A 1PX4A 3TYBA 4K7YA 1E40A 1TIWA 2PDBA 1Q4NX 2VX7A 2WHLA 3SN0A 3RRAA 1QHZA 1UWRA 1BRLA 1KV5A 4MFDA 4ZTXA 3LCFA 4D9PA 4X61A 2VD9A 3C2FA 2DVTA 4OECA 1W54A 2BY0A 3RM8A 2XH2A 2YKKA 2CFFA 4GI4A 1IWAA 4IG2A 2CZFA 4MIMA 4ZQPA 4ZOAA 1Q8JA 1KGXA 3GZAA 1XCWA 2HK1A 1VRDA 1ZENA 3APYA 3MWAA 5F1UA 5IOBA 3LQLA 3P93A 3RPMA 1NQKA 4O52A 2D0GA 4KCUA 4DXVA 5EMUA 5AYYA 1NDVA 2R1NA 4UBPC 3ZOAA 3EMCA 3UESA 3C2VA 4A3RA 3N4FA 5DMNA 4C6NA 4GCAA 1XC6A 4RDVA 3BCDA 3V4BA 1K7EA 3QJAA 1BTMA 1MEHA 5IFPA 2Z1SA 1TZZA 1T6MA 1AA1B 3AHXA 1CBGA 3NXFA 2A79A 4XKYB 1E0UA 4JICA 4S3KA 2NUYA 4Q8TA 2C19A 1R2SA 5I24A 1ML1A 1X6NA 2ABBA 3QZAA 3W1MA 3QFWA 4OQVA 2WMIA 4RUBA 2WJEA 2AAMA 5T8GA 1W1YA 4C1KA 1W5QA 1BXCA 2HV5A 2DQWA 4PMZA 4FX6M 2OJPA 1RBAA 1K77A 3BAWA 1XS2A 1ZTVA 2F8QA 3RR1A 3WUEA 2F6UA 4FIQA 1FBAA 6ALDA 4ZE5A 3H8AA 3KVJA 5HMFA 4MSSA 5H8MA 2J8GA 2J4GA 1W5OA 1KFKA 1ONWA 3EOEA 1Q66A 1BAGA 1MUCA 4W8AA 1US0A 1UP2A 1A49A 4FX7A 1SUXA 1UR9A 1V93A 2AL2A 4KCVA 3S9YA 4LT9A 3VOFA 4PMQA 4FX8A 3AIBA 2INEA 3LZ3A 4PTDA 3PC0A 4K7VA 3SUTA 3MSGA 3R4IA 1ICQA 1ICSA 2QMKA 4B92A 2Z2AA 2FTYA 3G1AA 4B3ZA 2ZVRA 4J3TA 1E6ZA 3L0KA 2BOEX 3AU2A 2Z1VA 2ANUA 3NQAA 3SSJA 1RA5A 5EMMA 5DF0A 3VPLA 1IHIA 2QJJA 2ZXBA 4JNYA 3TIMA 5CC7A 4B90A 3WQ5A 1ITQA 3AUJA 5HDRA 3NR0A 5BWFA 5HNTA 2WM1A 3WY1A 1K6WA 4H1ZA 3S1WA 2EKGA 3DFYA 4YPJA 1EA0A 4IFOA 1A80A 4JGDA 1OYCA 2OKTA 2CERA 2O0TA 4UFKA 3HBLA 3KOFA 4G56A 2VEGA 3LD5A 3ANVA 3BCJA 3CMFA 4YWIA 1BVWA 3C2RA 3B06A 3UZYA 5A6JA 4DJDD 2NQLA 3YPIA 2OKOA 4UFJA 4NT0A 2NQJA 1UR4A 1PEZA 4MY8A 3MA8A 4UFMA 1KLZA 4LTSA 3E1F1 4N02A 3VNIA 3DG7A 5A6TC 1B2YA 1GOMA 3A23A 3TFCA 1KXTA 1ZJHA 2CZ5A 1KM3A 4ZO9A 1XH2A 2YXOA 2HROA 1M41A 3EWDA 1PS9A 2V5JA 4BF5A 1K9FA 1YBQB 5FD0A 5DMLA 2XFRA 1J4EA 3DXIA 3AMCA 2CLOA 1NWSA 1FH7A 2QYGA 1WDWA 1EWEA 4DHGA 2E9BA 2FHBA 3L65A 3FJLA 2R8WA 3WLQA 1LP6A 2FMNA 4B9YA 4FZIA 1SGJA 4X2PA 2F2HA 4QAWA 3FIGA 2Y5EA 3TOYA 1EZWA 3VKJA 3VD3A 3TZFA 3W2JA 3KP0A 4QCEA 2GZXA 3LNMA 5B7ZA 4C6MA 1XRVA 4J40A 1F3XA 5TF0A 1FCQA 1A47A 5F2LA 5E70A 2OEMA 4DBDA 3UT0A 2CIPA 2QPSA 4FOJA 3HFYA 3N19B 4GFIA 3PFRA 1EB3A 3A21A 1U1HA 4WDXA 4CQ8A 4FXFA 3M9YA 1GVIA 3E9AA 3GYCA 1EPXA 3WUFA 2DW7A 3VAVA 1RQEA 1K9EA 3Q4DA 4WSKA 1EA9C 3CLWA 3OLEA 3CAQA 1TB3A 4JIIX 1OCNA 2UV8G 1KWKA 4O0ZA 3DDMA 3SR7A 3RCYA 3N2XA 4FLOA 3TOPA 1TCDA 3NQ6A 3IVTA 4GIRA 3PPFA 1X1NA 2A6NA 3V18A 2A7RA 1CGYA 4RK8A 4LV9A 1XD0A 1Z42A 5F7UA 3N11A 1WE5A 3PBYA 1GOWA 1H1ZA 2VZSA 1NARA 3VIFA 3E2SA 4GUGA 1J18A 4WY0B 4QEEA 4GY1A 3SQSA 3TMQA 3ZSSA 3QR3A 2QIIA 4Y9PA 1LL4A 1KA9F 1E9LA 3LMZA 1CB7B 3LTSA 5DRIA 3WQ4A 2QKFA 1MSSA 1EC7A 3LX9A 2QF7A 1MXDA 3LXAA 1VIZA 2E3ZA 2CHOA 2WJDA 3IPWA 2J27A 2XN0A 2IKIA 4PODA 2P0IA 2PWEA 5DXYA 3T78A 1WDDA 2W63A 3ARWA 3RNDA 1WKYA 1M65A 3PUOA 2X05A 4DELA 3W3OA 3OEXA 5A6SA 2IKGA 1VYRA 3VGBA 4AX7A 4FLQA 2CLHA 4WDTA 2VZVA 4P8UA 1K3UA 3ICJA 5TNVA 3TVAA 2CKSA 4HPNA 2FKPA 2YCJA 3WK2A 4AF0A 5HR7A 2ZX5A 3H26A 5C2GA 1PB0A 3T4WA 1OK6A 1TTJA 3WK0A 1TPC1 3UWVA 1VIWA 3NVTA 3T0CA 1LORA 1A5OC 1IGWA 3EGJA 3MMDA 1J0HA 4JTUA 4QNWA 4XD5A 2GQ8A 5AKQA 1P7TA 4BZYA 2YDRA 2HS6A 4PTMA 4QJ4B 3S1UA 3USZA 4B3KA 5CEWA 4OV4A 1V03A 3GIPA 3S46A 1NVMA 1JUEA 2B7PA 3VIJA 4OUEA 4MF4A 2ICSA 1F2JA 3WJZA 1V3MA 4XSLA 4LNYA 2BVWA 2I5IA 2ZX6A 5GNZA 1WB0A 2OR2A 5CPQA 3RF9A 1AMYA 2XDFA 8CGTA 1ZALA 3UFYA 5ABFA 2OT0A 3EKLA 5LNSA 2FPTA 4GVHA 1XSKA 1F8IA 3S5YA 1ONXA 4KRUA 3QKZA 2CCRA 3ITLA 1F07A 2DY3A 3RLVA 3RPDA 1XCFA 1RBOB 3E38A 1OC6A 2E8YA 3S42A 1EOKA 3L0GA 3TZNA 3CUJA 4GH1A 4ADUA 5A2BA 4I3GA 1K7XA 1YX1A 3QY7A 4CQAA 3QZEA 1NOWA 4Z1AA 5BU6A 1CCWB 1LRTA 2PP3A 1RXOB 2B7NA 1X7FA 1OGGA 2VZTA 4HN8A 3W0KA 1T99A 3WK3A 2GWGA 4IJCA 1ZNNA 3M6DA 1NU5A 5CH9A 3W1UA 4ZQNA 2VQUA 4IFKB 3BMWA 1V08A 5CBIA 4JTCA 3WD2A 3WEZA 3NZPA 1REQB 4LYRA 3OO2A 3T08A 2W0UA 5E9AA 3AZRA 2W5FA 1JRBA 4YTSA 4C90A 1O5RA 4LALA 4JFUA 4DXKA 3FAWA 1PTGA 1SSDA 4NP7A 4ICMA 5CPLA 2OLHA 2G0WA 3WQWA 2JFEX 3KHDA 2DW6A 2BY1A 4ZFMA 1UA3A 2DSKA 3B0YA 2CETA 2QNEA 2PAJA 5TBOA 1NP0A 3HPXA 3MT1A 1FWBC 3WJYA 1JNEA 3A4JA 3EXRA 1Q3NA 4P61A 4KFPA 3C5QA 3TYAA 2VEMA 4GO8A 3T4CA 2BGNE 3GIQA 1CGVA 1KFEA 4IQJA 1HXJA 3P8IA 2Z4GA 3WUGA 1GONA 4PSRA 4JTLA 2W91A 3WLHA 4I90A 1ZZMA 4EF9A 2J7BA 3ZJ8A 3BICA 2I1OA 3W76A 3M0IA 4JTKA 5HR6A 4QLKA 3AWNA 3R58A 3VA8A 5D9PA 3OHMB 1BGGA 2I7GA 3HV8A 3EA3A 5CZJA 4AWSA 3W1LA 1GOOA 2F2KA 2Y7FA 1R6WA 4FOKA 1XCXA 1LUCA 4I8DA 3TROA 3WUBA 4B5SA 4LCQA 3F4NA 1C8YA 3M0ZA 2HBXA 2D23A 3SFKA 2POTA 1ZAIA 1QNPA 1EH9A 1XDLA 2YDSA 4AD5A 3LCIA 3OA5A 4UFIA 4E8CA 4UQEA 3PZNA 1W3LA 2CLMA 4IGMA 1UKPA 1AW5A 2FZNA 4IWWA 1EBHA 2AOSA 2PDQA 3LM3A 1LRQA 3T2QA 4GQRA 3BLFA 2X2YA 4HNUA 4LY4A 4QAIA 4M0XA 1Y5VA 4IOTA 2GWNA 2ONEA 2HXTA 4U10A 1OX4B 4AD2A 2P5NA 4ZA0A 1NFGA 3V0SA 3TFXA 2HJPA 3V7PA 1C8VA 2X1UA 3OBAA 4EACA 4MYAA 4N6FA 4J3VA 4UZUA 1SQ7A 5DLCA 5A6KA 2CLIA 4JQ2A 5AYBA 1E55A 3KL5A 3EX1A 3KE0A 1C90A 3LERA 5CPNA 1Q6CA 3AIVA 2XIOA 3RM9A 3S6DA 1TA3B 3AO0A 3TJLA 4PCNA 1D3HA 4YWSA 1GHSA 1J6PA 3GVWA 3I65A 3R43A 3QH2A 4M8UA 3I7SA 4EPKA 2VENA 3NL5A 1LG2A 4JN8A 2EF9A 5I78A 1GVRA 3S2MA 3UJEA 3VDAA 3TW9A 2CBIA 3TJXA 1OD0A 1TVPA 3EEGA 4F66A 3IJ7A 1QI3A 3KCLA 3O0KA 3AI0A 3GS6A 1GORA 4M81A 3NQMA 1A5SA 3EDEA 1WX0A 1JGIA 3SUUA 3RDKA 3R8GA 3UR8A 1H1YA 4RX0A 4WDUA 1T41A 3TQ0A 3TQVA 1TMHA 1LDCA 4RDYA 5DELA 1E0TA 3IVSA 4WHBA 1HX0A 4JD4A 4LY8A 1TRDA 2EPNA 5KZDA 5HNUA 1VPYA 3AOFA 5CZKA 3UYIA 4PCPA 4R9XA 1A3XA 2WAGA 5MKGA 1QWKA 1E4NA 3NOYA 4LV4A 2GSEA 4TMCA 4F0RA 3KBWA 4F40A 3K4AA 3W24A 2ISWA 3FXYA 1MNZA 2E8ZA 4H9MA 1G94A 2P0OA 4ZOBA 3A3WA 2VDIA 3H4WA 2Z0IA 1B3OA 3UNTA 3G1XA 2BFGA 3EDKA 1HL8A 3BAYA 4AC1X 1W1ZA 4LC6A 1VFHA 2JQXA 5I00A 3C2YA 1MW2A 3BL3A 4L56A 1EO7A 1X1ZA 3UD6A 5RUBA 1P0KA 4B5WA 5BXTA 3HV9A 3WLNA 3CWOX 2DEPA 3ITTA 4LB3A 5LIWX 4IQEA 3BZGA 2VX5A 1J0IA 2ZXDA 3MC5A 1YW1A 4XQ6A 2C91A 5J04A 3PZMA 1PHQA 2ZX9A 1K4GA 1A53A 4IPJA 1BVZA 3AZSA 2PD9A 3MP3A 3HMCA 5CAKA 2QMJA 5JBDA 3N29A 5LZLA 1CXLA 2PI6A 5ABTA 3TTQA 1K9TA 3GXIA 3O6AA 3UP8A 2GDQA 4JTHA 3W7CA 1TO3A 3APTA 5IFTA 1R0MA 5CJNA 2WV8A 3FNDA 1J12A 1XUUA 5BMWA 1HP5A 3NO3A 1X8CA 1NWRA 1CENA 3M0MA 1UWTA 4QXIA 3B9OA 4WGHA 2EEXA 2VUYA 1YE6A 1F6KA 2WVSA 4J4KA 1ISZA 3WLLA 4BK9A 1Q45A 1VC4A 4CU6A 7CGTA 1X96A 2ZUSA 5GNXA 3SRDA 2FJKA 1OZQA 3T0DA 4ERIA 1IEQA 1QW7A 2ZA3A 3S3GA 3W53A 1FA2A 1S2VA 5IXEA 3ARVA 4US5A 3GG7A 2ACRA 2XH0A 2Y89A 3M1ZA 4AB4A 3WH7A 3C61A 3W7OA 3VO0A 1K8CA 4S3DA 4ZENA 5LNUA 2P3ZA 2J47A 2PFHA 1E0VA 4UNKA 1NH6A 3B8WA 3UZZA 4HU8A 4IICA 3TLLA 4DF2A 1VBJA 4UTMA 2OOFA 3NZRA 2QDGA 2NT0A 2GL5A 2QQ6A 2BVYA 3ARQA 1JCJA 4H4IA 5JH1A 4LUSB 3KS6A 3F4VA 2DV0A 5EKYA 1XC4A 3I3DA 3TEVA 4YL2A 4G8TA 1QNRA 3OLDA 3SCUA 2NQ9A 1XIMA 3TN5A 5F2MA 1CTNA 3TE9A 3FA3A 2BTMA 3L4VA 1HTIA 1LQ0A 1V3KA 4ATLA 4CU8A 1BRLB 1GTHA 3IVUA 3HG3A 3LZ5A 4ZE4A 1H49A 1AL8A 4AISA 2FYMA 1YDOA 3CB3A 3DEQA 3EA2A 3TMLA 4K8GA 4GVGA 4DBEA 2Z28A 3POHA 1UZDA 1JCMP 1F4HA 3WBXA 2DVXA 3LCWA 1W3TA 1VGAA 3K8KA 2ZCGA 4WJXA 1IYXA 4B16A 1UKQA 4AWTA 2GK1A 2V5CA 2VGFA 2MUCA 2I17A 5HJLA 1FFRA 3GNXA 1HVXA 3T1GA 3RO8A 1UJPA 3ZR6A 4PUDA 2XSAA 4I9JA 1IT8A 3FKKA 5CSSA 3V3WA 3EA1A 2EPLX 3NJ3A 2XIIA 1KQYA 1LRNA 2DGAA 3FDKA 5DXXA 4DBUA 1TSIA 1EWDA 4BA0A