1EQCA

Exo-b-(1,3)-glucanase from candida albicans in complex with castanospermine at 1.85 a
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
394
structure length
394
Chain Sequence
AWDYDNNVIRGVNLGGWFVLEPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAALRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAFQLLDNDPYVQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGFDNSGLRDSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAFQVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGWDAKKESHWNVAGEWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFWSWKTENAPEWSFQTLTYNGLFPQPVTDRQFPNQCGFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the exo-beta-(1,3)-glucanase from Candida albicans in native and bound forms: relationship between a pocket and groove in family 5 glycosyl hydrolases.
pubmed doi rcsb
source organism Candida albicans
molecule tags Hydrolase
molecule keywords EXO-(B)-(1,3)-GLUCANASE
total genus 151
structure length 394
sequence length 394
ec nomenclature ec 3.2.1.58: Glucan 1,3-beta-glucosidase.
pdb deposition date 2000-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1eqcA00
4F9DA 1E4MM 3WQ6A 1HVQA 2WWCA 3MMUA 1MW3A 1W9DM 4M80A 3W29A 4XZWA 1C3FA 5GPRA 2VRKA 1O7AA 1GNXA 1JYNA 1HP4A 4PRWA 4YPJA 2GDVA 3AROA 1EQPA 2EPKX 1E1FA 1V6UA 3SUVA 4PBGA 1UKOA 1F4AA 3MV11 3SCPA 1ZU8A 2GSJA 4BZYA 1J10A 3MUIA 2WHJA 4B15A 5A6AA 1EOKA 3MSDA 1UWTA 5CG0A 1XYFA 1M04A 4LYPA 3MMDA 2ZUMA 1FHLA 1B3YA 3AMKA 3W6MA 1HKIA 1OGSA 1BSIA 1F4HA 1OCQA 3DHUA 4V28A 4JHZA 3K8LA 5JBDA 3BGAA 2WANA 3PTMA 4OBRA 3AICA 4PCTA 3NIYA 5CZKA 3SCVA 1GUVA 4PMVA 4HOZA 2VTFA 4KGLA 4YHEA 1XSJA 2ZXBA 3II1A 3WQVA 2WKLA 1XHGA 4DUVA 4ZEPA 1EIBA 2A3HA 3T2PA 2YL8A 4YHGA 1KXTA 4AEEA 1C93A 1UR2A 1JI1A 1WKYA 4UFIA 2VT0A 4MDOA 3BAIA 3K8KA 4PTVA 1TUXA 2YL5A 3GXMA 3NSXA 2XYLA 4CU7A 4M81A 4D6EA 4PN2A 5EMYA 5I24A 3AI0A 1JZ5A 3EDJA 4RL3A 1HJSA 2C0HA 1V6VA 4ZE4A 1E70M 3UR8A 2PWFA 3SEPA 3VDAA 2GDUA 4DWSB 5CQ1A 5DFAA 1A3HA 1C7TA 3L4XA 1I1XA 1RP9A 3F5LA 4R27A 5CXPA 1DWJM 2WYSA 1K9EA 5IDIA 2DSUA 3PZMA 3AQUA 2FHFA 4WKHA 3ZMRA 4JIEA 3VGFA 5CLTA 1VRXA 1CGUA 3VIIA 4QLJA 2RGMA 1WAWA 2AOSA 4D6IA 1MYRA 1NOFA 3WMSA 4JKMA 1E55A 2X09A 1FOBA 4JCMA 8A3HA 3S6TA 2VZTA 2CYGA 4CD6A 4J27A 4AZBA 1JFXA 1CXLA 3OLGA 4GI8A 1C8QA 1G5AA 3AIRA 4WJXA 1EDGA 1MXGA 1CEOA 5EFDA 3ZT7A 2WHLA 1E6XM 4P8VA 1JL8A 3CO4A 1UA3A 2X0YA 4PSPA 4RE3A 5D9PA 3VDCA 1NWSA 1C8YA 1ZB5A 4DM1A 5M3WA 4HOXA 4TVCA 4LYQA 4LXFA 3N17A 1JAEA 1PBGA 1MQRA 1W1VA 4MJ2A 3RIKA 2IXVA 4NRSA 1ZBKA 1E0XA 4IPNB 4CCDA 5BROA 4GQRA 3KEHA 1W2PA 3O9NA 1NQ6A 3ZJ8A 3K8MA 1X1NA 2ZUSA 1H0IA 1C8XA 1WPCA 2C8NA 1BAGA 1XCXA 1SFSA 1R8LA 1XSKA 1UWUA 1WDSA 1MXDA 3M6DA 1E56A 4JFVA 1E0VA 4IUGA 1BFNA 3ARVA 4IISA 1TCMA 2XVGA 3CHDA 2WW5A 4W8BA 2D3NA 1BYAA 5M03A 4WIWA 3L4YA 5A6BA 1LJYA 3MKKA 4CN1A 2B31A 3L4ZA 1KB3A 1H11A 4HOWA 2TAAA 1VJSA 4AZ6A 1S46A 2PC8A 1JFHA 3QHNA 5ABGA 2WCSA 3NSMA 2WB5A 1ESWA 5FIPA 2XSAA 2J7FA 4JCLA 2ZXAA 4HA1A 4Q22A 3WFLA 1UUQA 1HJXA 1WZAA 2WM0A 1W9VA 4C7FA 4MTVA 3ARUA 4WSJA 5CPQA 1JXJA 1EOMA 2EQDA 2J7HA 4A3HA 3FNDA 1FFQA 4E4PA 2W66A 1QNPA 5I23A 1LL7A 3TTQA 3IAPA 3TTSA 5I5RA 5DO8A 1GOKA 1MQPA 2WVSA 3WF0A 3WH7A 5HXMA 2QPSA 4OUEA 3WBEA 4NF7A 4GI9A 4WSKA 1QVBA 1E6SM 3W4RA 2WMGA 1JDAA 5E9AA 3IJ7A 3N13A 4W85A 4QLLA 1SYTA 1VEPA 3J7HA 2ZXDA 4GI6A 4XV0A 4GQQA 4D1IA 1EDTA 1QBAA 3WEOA 3PHAA 1H41A 1QNRA 2PWGA 2WBGA 1PX4A 5ECUA 5A6KA 3AZRA 4GINA 4M29A 1NP0A 3WH8A 1Q6EA 4DUWA 1OB0A 3GBEA 2WZHA 2O9RA 1CLVA 3GNOA 2UWFA 4XX6A 1OBAA 1OT1A 3WUFA 1UR0A 1W32A 1VF8A 4MB1A 1E6PA 5TD4A 1UD2A 4FF5A 1V08A 1H0GA 1W3KA 1V0KA 2BY2A 3PZUA 3CZ8A 4M8UA 1BVZA 3VIJA 2DH2A 4J3XA 2QMKA 3K1DA 3AJ7A 5E0FA 3W81A 2ZE0A 1GOOA 1OD0A 4W87A 3AIWA 4U5IA 2A3CA 2WZEA 1GHSA 3VIFA 1NWUA 1B31A 1H3GA 1HJVA 3WDHA 1KQZA 3ZJKA 3L4WA 3FY1A 3HJEA 3VIPA 4TOQA 4ML4A 4Z2KA 5HPOA 2CERA 1UHVA 1UR9A 4UFHA 3AIUA 3CTTA 2CBVA 2UY2A 3N04A 3VGHA 4MAVA 1CXIA 3RO8A 2CBJA 3VD5A 2BVTA 2E9BA 1PX8A 2D0HA 2J78A 3NDZA 1PIGA 4YN5A 1MW0A 3CZLA 4AWEA 2GK1B 4H04A 3RM4A 4R5EA 1ZBVA 2CEQA 2VX7A 2OLHA 3AISA 1E15A 5E0CA 1OINA 4JAWA 1KGWA 2WKGA 2ZUUA 1V0MA 1QBBA 5GQBA 2WVTA 2ZIDA 3B9EA 3BSHA 4N42A 4W7WA 1UYQA 2IUZA 3B8SA 2CETA 4X9YA 3AIQA 4JFUA 1TA3A 1AMYA 4AD2A 3SURA 3W27A 1HNYA 1CENA 1K9FA 3QHOA 3SCSA 1E6RA 3ECQA 5CPSA 2XGIA 1VIWA 1O6IA 2EXOA 1EO5A 3UR7A 5A8MA 1C92A 3AIVA 2O92A 3PTQA 2E9MA 4JL1A 2RGLA 2V5DA 3KL0A 3KZSA 4MPKA 5ABFA 1ZJBA 2X1IA 3VGBA 5FKYA 2XVPA 3WQ4A 2CKRA 4Z2HA 8CGTA 2W63A 5ABHA 5BXTA 3WD3A 4AEFA 6A3HA 2EPNA 1EA9C 7A3HA 1JI2A 3IANA 3OLDA 3EDEA 3WDPP 1W9XA 2E8YA 4P7NA 1MWOA 3ZOAA 6TAAA 2BNJA 2XPKA 3W37A 1BVNP 1CYGA 4F8XA 1HX0A 3W25A 2O9PA 4J3VA 4TX8A 3AIBA 1CGYA 3SCRA 3VPLA 3CMGA 3ZR6A 1IT0A 2WSPA 4UOZA 1UH4A 4ACZA 4WF7A 1MVYA 1W3LA 1V0LA 2CXGA 1H5VA 5GNYA 3BLKA 1B3ZA 2BHYA 3S2CA 2V38A 1QW8A 3NYDA 3IJ8A 2JEPA 3UEQA 5D8WA 2VZVA 3RMEA 3D3AA 2YLLA 3CBWA 4A3YA 4XUYA 1AVAA 3DYPA 4LX4A 3E1F1 4FMVA 2D0FA 5BYWA 4CCEA 4CU6A 4MNKA 3GM8A 1PIFA 2ZUNA 1E4NA 2FH8A 2YA1A 4TUFA 3VIGA 1WDRA 4B9ZA 3RJYA 1WP6A 5E6YA 3KL3A 3OZOA 4BQ4A 3N15A 4GO9A 4JFSA 2BY0A 3JUGA 3OLEA 1LF1A 2WC7A 3CHEA 2PBGA 4JFWA 1CWYA 5CGMA 5JBFA 2WVUA 1EDQA 5A2AA 1TG7A 4IM4A 4H7VA 5HOSA 4X0VA 2HISA 2Y8VA 3OZPA 1TVPA 4CD7A 3MSGA 1UOKA 1HXJA 3ARPA 3RILA 1HKMA 2VZUA 2G3MA 1TR1A 2CIPA 3BH4A 3WNKA 4XB3A 4HPGA 4J3TA 2JF6A 3ALFA 4PTMA 4LQ1A 5CGTA 3O6AA 4W89A 3RM9A 5A6BD 4U3CA 3AYSA 1VAHA 4DM2A 1RPKA 1WNOA 3AMLA 1VEOA 4AZCA 1UWQA 4ATWA 6CGTA 3AIEA 4M24A 5HDRA 5HPCA 1GOIA 1LWHA 2YDRA 1SMDA 1GVYA 2Y4SA 1EGZA 2QLYA 3WMBA 1WZLA 3VO0A 2OYLA 3UETA 1FA2A 1QHOA 3LPPA 5FL1A 1RH9A 1GOWA 1V3KA 2G41A 3A6OA 2YIHA 4AD3A 5C70A 2WBKA 3GTNA 2XM2A 3OGVA 1Q6FA 1FFRA 1XV8A 3ARWA 1QI5A 3HU7A 4E2OA 4CD4A 3W28A 3ZJ7A 4PMUA 1CDGA 3PZ9A 4UOQA 4D72A 4D1JA 4TVUA 4AZ7A 2V5CA 4AMCA 1UKPA 3CGTA 4PMRA 1VFMA 1KBKA 1EXPA 4ZE5A 5I0DA 3AS1A 3AS3A 1ISYA 2X8RA 4UQ9A 5DT5A 2V3EA 1HP5A 4PMYA 3W0KA 5AYIA 3VX1A 3DECA 4D6JA 2XGBA 2VI0A 3WH9A 1V03A 3WEMA 1NWRA 3ZJ6A 4PUEA 4PTWA 2VRQA 2DT0A 4HA4A 1W3HA 1V3MA 3VVGA 5C71A 5EFFA 1G1YA 3F4VA 5CJ5A 1OWQA 5A8OA 1OGBA 3THCA 3HN3A 4ATDA 4MNLA 3DYMA 1KGUA 2BY1A 5A95A 1ECEA 3FXYA 3KE0A 4HZ8A 3SCTA 1E5JA 4H41A 3MV01 3CPUA 4XZBA 4EE9A 3L4TA 1GHRA 3VGEA 3POCA 3BLPX 3BCDA 4EK7A 1B0IA 1VB9A 2OYMA 4AZ5A 1Q6DA 3WF3A 1K9TA 1J0KA 4H8HA 2FHCA 1G0CA 1UQZA 2WXDM 2YDQA 4BCEA 1D3CA 2NT0A 1SR0A 3M7SA 1YHTA 5KZ6A 4WK9A 9CGTA 3PZGA 1CPUA 3OBAA 1E4IA 5EBAA 2J7EA 3BMVA 3WDRA 1GQJA 2WWDA 3CZJA 3WQ5A 3WDJA 1GQIA 2ZOXA 4WLCA 2ZX5A 1GONA 3T0AA 1GORA 3ARXA 2YBUA 1ZL1A 3AHVA 2GJXB 3T0DA 1LG2A 1WE5A 2J7CA 3MUZ1 4QCEA 3B9DA 5DT7A 3W38A 3WDQA 3G6LA 1TFVA 2F2HA 2WHMA 1BG4A 3ALGA 1G94A 1RD6A 4JL2A 1CGWA 3HMCA 3CH9A 2PWDA 4AXNA 4JKKA 3ZT5A 2QHAA 2DGAA 1A47A 2VX5A 2F8QA 4CCCA 1GVIA 2UY3A 4PMQA 1BG9A 4C7GA 2GJXA 2XUCA 1UKTA 2YDSA 3UG4A 1WDPA 3BMWA 4MAZA 1BQCA 2J8GA 3QOKA 5DMYA 1U30A 1IZJA 5A2BA 3OIHA 2WLZA 5JIWA 3ARRA 2BXYA 2DQXA 3VNZA 4J7RA 1NWTA 1WB0A 4ZXLA 1QI0A 1JF6A 4P7LA 2OYKA 2J7DA 4AD4A 4OKDA 3UCQA 4AISA 2DPEA 4UCFA 2NSXA 3NJ3A 1JD7A 1R7OA 5A6JA 1V3LA 2NW0A 3NDYA 4GZEA 1FP8A 2WC3A 3PN8A 5CSYA 2D23A 4P7QA 1KWKA 1VFOA 1CXKA 1TMQA 5JIPA 3MMWA 5IFTA 3QHMA 1RP8A 2PWEA 2CCRA 3CUIA 4AZGA 1KCLA 3APGA 5I78A 5A6SA 2ZUVA 1HF6A 1J0IA 2YL6A 3MUY1 1ZBCA 3GXFA 4BQ3A 1CECA 1J0HA 1C7SA 3OA5A 4RE4A 3EMZA 3WUEA 3AOFA 1L8NA 1GW1A 1KFWA 2JFEX 5I77A 1JAKA 3BSGA 2AAAA 3WNLA 1XH0A 1TVNA 1BYDA 1BHGA 1I75A 3IJ9A 2ZICA 2WNWA 4S3KA 4FK9A 2X0HA 3VNYA 2EBNA 1JYWA 1H1NA 4P7OA 1CZ1A 4JHOA 3AZSA 3BAKA 1Q6GA 1CNVA 1GJWA 1CGVA 2J79A 4V27A 3GH4A 4BF7A 3AMGA 4ZFMA 1GOQA 3G6MA 4W88A 5I79A 2ZXQA 4AC1X 1XH1A 3N11A 1NP2A 3A3HA 4CVWA 2FGZA 3ZSSA 3ARYA 2IXUA 1K6AA 5A8PA 3SUUA 4EKJA 4J3SA 4NSBA 3A4WA 1ITXA 3ARQA 4HZ7A 3O2LA 2XVNA 3W26A 3VDBA 1R7AA 2XFRA 1GZJA 4F79A 1HJUA 2E40A 4ZENA 3CUFA 1OT2A 4TVDA 1PJ9A 4W8LA 1ITCA 1W2VA 3EBVA 3DC0A 3WBAA 3VD4A 4BS0A 3VIOA 4J3WA 5CLWA 4UZUA 4CD5A 1MQQA 3WNPA 5ABFB 3AMDA 2E0PA 2VOTA 3CHFA 3SCOA 2WC4A 4IPLA 2BVYA 4FLRA 3WN6A 4MNJA 1E43A 2J25A 1XSIA 1M01A 3M07A 1XD1A 5BXRA 2CKSA 2WLYA 3WL1A 2WMHA 4KRTA 4UNIA 2G3NA 3U7VA 3LPOA 2CPUA 2ZUWA 1AQHA 4PEEA 5IXEA 3SCWA 3W82A 2VZSA 4U3AA 5CSUA 3L4UA 5A94A 3T0BA 3AZTA 4LYRA 5D8ZA 2BV9A 4CKQA 1M03A 1XCWA 3VKKA 5I3DA 1CXHA 3VMPA 2VMFA 4UZSA 3VINA 3WFZA 5KEZA 1PZ2A 4H8UA 3VMNA 4HU8A 2X2YA 4OBSA 1YQ2A 2XM1A 3WH6A 2D2OA 2EPMX 4D6GA 1US3A 3M46A 1LL4A 1WZMA 4AD0A 1I1WA 1G01A 4UQEA 1B3VA 2VL4A 3AXHA 5IHSA 1E6QM 5D9NA 5BRPA 2OWWA 3EMCA 4BA0A 3N18A 1IZKA 1MW2A 3WQ8A 1QI4A 7CGTA 3B9AA 3CZEA 3RCNA 1BGAA 4NRRA 2OSWA 2AMGA 2WZIA 3NUKA 1M7XA 3WQWA 2VCCA 2Q8XA 3VM7A 1UKSA 3MANA 3T2QA 3PBGA 5C8BB 3F5JA 2WMFA 4C7DA 5A1AA 1GCYA 1OGGA 3GDBA 4UFJA 2YBTA 4OZOA 2YJQA 1NOWA 5FL0A 2WCAA 2XWEA 3BCFA 1QW9A 3VM5A 3BAWA 3CZGA 1MFUA 3AFBA 2EJ1A 3CLWA 3N1AA 5D9OA 3W24A 2Y5EA 1P6WA 1HL9A 2W91A 3IK2A 4D6DA 5A3HA 1NARA 2WMJA 4F66A 4KRUA 1ODZA 3WUBA 5LA2A 1HKKA 4HA3A 1CXFA 2VR4A 1DWHM 3MO4A 1OSEA 5IHRA 2QF8A 1ISXA 1UZ4A 2GVYA 1XRVA 3UG3A 1UZ1A 2W67A 3PZOA 4PMOA 4Z2GA 1QNSA 3WEZA 3SUSA 3CMJA 4AIUA 5E6ZA 5AC5A 1TE1A 3OB8A 3OGSA 1SMAA 1LWJA 2DSZA 3GYCA 1CLXA 5A8QA 3GXIA 2VVSA 3ZR5A 1TA3B 1U33A 2GJPA 1CGXA 1GPFA 1ODUA 5E70A 2DEPA 2PI6A 1BGGA 3MUAA 3KWXA 2D3LA 1B3WA 2D20A 4P8UA 3FW6A 1UKQA 2D0GA 3ARSA 4JKLA 1EHNA 4PUDA 5AC4A 4W5ZA 4NI3A 4MB3A 1E3ZA 4JZ5A 1JD9A 2J4GA 5ABEA 1FHDA 5BCAA 4QDMA 4PMZA 2EEXA 4WKAA 3WELA 1LG1A 2PWHA 3IAQA 2YA0A 1TZ7A 1V6WA 1KBBA 2W61A 2DSVA 4AYSA 3VU2A 1B90A 4D6FA 3FHAA 1ZBWA 4ACZB 3EMQA 1VBRA 3OG2A 4P8XA 1PX3A 2XTKA 4HPHA 5I6SA 1E71M 1XC6A 3QOMA 4DWSA 4U2YA 2ZX7A 1LQ0A 3WKZA 3AHYA 3TOPA 1HT6A 5A69A 4BQ5A 1BF2A 1ISZA 1AQ0A 2CHNA 3EDKA 4CVUA 4KH2A 4QFUA 1OM0A 4B16A 2V3GA 3PZNA 2XWDA 1W1YA 3AYRA 2DSKA 1EO7A 1DWAM 2FH6A 1E4LA 1UR8A 2OSYA 3AMCA 2ZX8A 4NZCA 3VOCA 3VX0A 3ZT6A 1ISWA 2CBIA 2XHYA 4PMNA 4UOJA 3GXDA 1UR1A 5A6MA 2DH3A 1OIMA 2OWXA 4HTYA 4MADA 3FAWA 3RM8A 1LL6A 1HN1A 1UH3A 1Q4NX 3U7BA 5HNNA 2D1ZA 3AS0A 3D5HA 1JDCA 3QGVA 4U2ZA 2DT1A 2FDMA 4FLOA 4M56A 3WL0A 1GQKA 2D24A 3GBDA 1R85A 1H09A 1Q6CA 1E73M 3UG5A 3VDHA 1UD5A 1HKJA 1JZ4A 1JF5A 1V3JA 3L2LA 1E6NA 4TXEA 5AYBA 5EB8A 2GK1A 5D9MA 5FD0A 2J8FA 1KR0A 4KMQA 2F61A 3T09A 3VIKA 1W91A 4H8VA 5M17A 1MW1A 1W9BM 2WHKA 2JF7A 1QI2A 1QI3A 4HMEA 1UWIA 3WIJA 1WCGA 1PZ3A 1J0YA 5GNXA 2W5FA 1B3XA 2EPOA 4KGJA 2VURA 1VENA 1JNEA 4AZCB 1B1YA 1V02A 4Z2IA 2VCBA 4ZXOA 3AXXA 1JZ2A 4N0RA 3WD1A 1DWFM 2A3EA 1NH6A 2OSXA 2VRJA 1HJQA 2EO7A 4GPNA 1E72M 1W3JA 1UR4A 4QCFA 5I2UA 5GNZA 1ZJAA 2XSBA 1L0PA 3VIMA 4CGTA 3I3DA 1Z32X 3AHXA 1CTNA 4CN4A 2BFGA 2QV4A 4KWUA 4GIAA 3WDIA 1UG6A 1JDDA 1CGTA 1JG9A 2V3FA 2E8ZA 2WK2A 1H2JA 3RDKA 3WD2A 2W62A 2C7FA 5F7UA 2WPGA 2G4FA 1KQYA 1UA7A 1JZ6A 4UQCA 2WMKA 1EQCA 3VMOA 2VC9A 2ZX6A 3PTKA 4UFMA 1KGXA 1E9LA 1Y7VA 2PBOA 4HMCA 2J77A 3VGDA 4AY1A 1BLIA 1M53A 1CBGA 2CITA 2WSKA 1NOUA 3BC9A 2JIWA 5JBEA 4B9YA 4ATLA 3U57A 4HP5A 7TAAA 2VCAA 1VFUA 2ZX9A 3BAJA 4MB5A 2J75A 3SIMA 3SCNA 3N12A 3ZIZA 4BQ2A 2PB1A 4OJYA 2BHZA 2DIEA 4UQDA 3GNPA 3NSNA 4X0NA 3PZTA 3EDDA 1W1TA 5FOOA 3PZVA 1HVXA 2JE8A 2MANA 4W8AA 1R87A 3PZIA 3F5KA 4UTFA 2CBUA 5LYRA 1J0JA 3WF1A 3SUWA 4AD1A 1FH8A 4DWSD 1UD6A 1J11A 1UQYA 4AZHA 3THDA 4UFKA 4FLQA 1JZ3A 4QAWA 5LA1A 4W7VA 4W5UA 4OOZA 1QNQA 2VQUA 2HVMA 2O9TA 3SCUA 5LA0A 3K4AA 1QOXA 4PMXA 3ZO9A 1BPLB 3K4DA 3MS8A 1E40A 2YA2A 5HBFA 1X6NA 4TTUA 2XVLA 4L4PA 2DSWA 1QNOA 1B2YA 1C90A 1WO2A 4J3UA 4H2CA 2X05A 3A4AA 2J47A 4GKLA 1J01A 2VX4A 1E5NA 2NT1A 1NM9A 2Y8KA 5FCZA 1H4PA 4HZ6A 1X6LA 2XFYA 3ZSTA 3L4VA 5M5DA 4Y7EA 3FAXA 2XJ7A 4EANA 4DWSC 2W4XA 2WVVA 1W1PA 1JYXA 2JEQA 2XVKA 2W92A 3N9KA 2GFTA 3ARTA 1E6ZA 4AIEA 1ISVA 3SUTA 3CUGA 1JNDA 4UQBA 1QPKA 5CPTA 1OIFA 3TTYA 4OOUA 1W9PA 1DP0A 2VX6A 3WF2A 3CUHA 3QR3A 3I3BA 2YL9A 1DHKA 1JZ7A 2ZWYA 1E0WA 3GH7A 4WKFA 3CHCA 4P7RA 2Y24A 5BXSA 2WVVB 4DUXA 3L2MA 1V0NA 5BRQA 3RJXA 2CNCA 1GQLA 4CN6A 2E3ZA 2BVDA 1HL8A 3GZAA 3VILA 3W53A 1V02E 1KXHA 2WMIA 3VTRA 2E4TA 3UESA 1JXKA 1WDQA 4A4AA 2VO5A 4F9JA 1V6YA 3ZM8A 1JZ8A 2DIJA 1QHZA 3OLIA 2WCGA 2ZUTA 4W7UA 1J9YA 4Q7NA 1KXVA 2Z1SA 3ZQ9A 1EH9A 4S3JA 4E8CA 1BTCA 3WUGA 1CXEA 2XIIA 3GH5A 3NCOA 4LGXA 5IFPA 2ESCA 4PCSA 2J74A 2GUYA 4OIFA 3T08A 2UY4A 1XD0A 2BS9A 3EYPA 1N82A 2CHOA 2JIEA 1IV8A 4EAMA 4W84A 4L4OA 3WNOA 3AHZA 1OD8A 4HU0A 1BYCA 2QMJA 4U31A 5BWFA 3AS2A 2XIBA 1HIZA 3CIVA 2VR5A 3RPMA 1UD3A 4CD8A 2O9OA 4J28A 4PSRA 2J7BA 2YOCA 5AY7A 1U2YA 3CUJA 2EPLX 1J0ZA 4GXPA 1KR1A 2QPUA 4HMDA 2BXZA 4GO8A 3WD0A 4UFLA 2E9LA 3W6LA 1FH7A 4U33A 3WNMA 2YLAA 4Z2LA 4E8DA 5BXPA 3FN9A 3U5YA 3WY1A 4D71A 3A4XA 4AW7A 1GJUA 3BAYA 4M1RA 3VD9A 4D6HA 1UD4A 4MNMA 4UQAA 4U5KA 1GOMA 4ACYA 4UR9A 3SCQA 1V3HA 3KL5A 2G3IA 4GZIA 5JUVA 2Z1KA 1HJWA 4B3KA 1JYVA 3FHQA 1PPIA 2VQTA 4W86A 4MJ4A 1UD8A 4Z2JA 2BY3A 5E09A 2PF0A 1QHPA 5DF0A 1J12A 3POHA 1UWRA 1W9UA 1J18A 2J62A 1US2A 4GZJA 1CIUA 3LPGA 3A47A 2D22A 1D2KA 3BAXA 1KWGA 2DT2A 1JIBA 2VNCA 3TONA 4P8WA 2FHBA 4B3LA 1G9HA 4W93A 3AHTA 1XH2A 5A6LA 4K68A 1B9ZA 3TP4A 4MB4A 4CU8A 3TTOA 3OGRA 3GNRA 2OWCA 1ZS2A 1XGZA 2BHUA 1UH2A 3DHPA 1DEDA 4M82A 1WZKA 3VGGA 2A3AA 2ZWZA 3BXWA 3WF4A 3VD7A 3K46A 4AZIA 1PEZA 2XG9A 4LPCA 3U5UA 2G3JA 1XYZA 4QLKA 1C91A 4FLSA 4PMDA 3WNNA 3WSUA 1FH9A 3UERA 4PYSA 3DYOA 1DWIM 4TX6A 2DT3A 1DTUA 1DWGM 1KXQA 2VZOA 3WENA 1R86A 5A2CA 2VVNA 3VIHA 1JGIA 2DDXA 1B30A 1EHAA 1UWSA 4JFTA 1VEMA 2VJXA 4AIOA 2FGLA 1LLOA 4MDPA 1AQMA 1FP9A 3VD3A 1VBUA 4URIA 2A3BA 1VJZA 4PTXA 2YKKA 2WMIB 4D6CA 1PAMA 3VUPA 3ARZA 1E3XA 2WAGA 2VUYA 2Y2WA 3MU7A 5A8NA 2GJRA 3TA9A 3WMCA 1MFVA 3WD4A 1KCKA 2CESA 4V2XA 5DEZA 3I3EA 2V3DA 3LMYA 1BYBA 2G8ZA 2J7GA 4QP0A 3AXIA 3EDFA 4AD5A 4CUCA 4RE2A 1K9DA 4TTGA 2XFFA 1E1EA 3WH5A 1H49A 1V6XA 1VFFA 2JALA 3PZQA 2UY5A 3CZKA 1D7FA 3T2OA 1V3IA 3LPFA 5D4YA
chains in the Genus database with same CATH superfamily
1E4MM 1HVQA 2WWCA 3MMUA 3W7IA 1SZGA 1F74A 2VGIA 1C3FA 1YDNA 5GPRA 3MW7A 1XINA 3G1YA 4D8AA 1SQ7A 4YPJA 2GDVA 4O19A 2EPKX 1E1FA 4GNVA 4PBGA 5FJPA 1ZU8A 4JIQA 4HN8A 3MHFA 5LNUA 1ZENA 1LUCA 2ZC8A 3MUIA 2WHJA 4H9TA 3NM3A 2B4GA 3HA1A 1PCKA 3MSDA 3RU6A 1YXDA 3T4WA 3OEXA 1EP3A 1G69A 3MMDA 3W1UA 1DE6A 1HKIA 3P62A 1WBJA 3K8LA 3DI1A 1JVNA 2YW3A 2YCKX 4DYKA 3SCVA 2CLHA 4O11A 2GWNA 1GPWA 1TO3A 1XHGA 3GC5A 3HV9A 1WKYA 3WK2A 4B4FA 3W86A 4PB3A 3H21A 3M0MA 4Y8EA 1EIXA 1W37A 1QRQA 4FOJA 3M44A 4CU7A 4M81A 3WLNA 4PN2A 4QISA 5KTLA 4W4QA 2PCQA 3VDAA 1NEYA 1XLKA 3L4XA 3LZ5A 1I1XA 3F5LA 3GK0A 2YR1A 3DX5A 5CXPA 1DWJM 2WYSA 1K9EA 4HHHA 2FHFA 4UTUA 2ZE3A 1FWNA 4JIEA 1ZLPA 1CGUA 4YWSA 2GGHA 1WAWA 4O1BA 4D6IA 3MUCA 3W7KA 1NOFA 1DJWA 4R7WA 1BRLA 1E55A 3S6TA 2QUMA 5HR7A 3TC6A 2VGBA 2CYGA 1VFTA 4CD6A 4GI8A 4WJXA 1G5AA 1EDGA 1MXGA 4DJDD 3NEHA 1FWRA 4EPDC 4LT9A 2WHLA 4ZTYA 1T41A 1R3SA 4L6HA 1MDLA 3WQDA 2ASHA 4O1FA 1UA3A 1DBTA 1ZB5A 3TXVA 2C1IA 4ZR8A 4TVCA 3UP8A 1NIUA 4JIHA 3VK5A 3Q37A 2VC6A 1MQRA 4WQ6A 1W1VA 2IXVA 3GNXA 3B8TA 1XQKA 1JDFA 5H8PA 3YPIA 3ZJ8A 4QS5A 3K8MA 1V6TA 3ATZA 4KKXA 2C13A 2C8NA 3W88A 4GISA 1KFBA 2RJGA 3OIXA 1TIMA 5LSMA 4JFVA 1MEWA 2PDLA 4S3DA 4IISA 1TCMA 2WW5A 3Q67A 4W8BA 2CLEA 3SR7A 5M03A 2JBMA 1TV4A 5A6BA 2AAMA 2QCDA 3MKKA 2PGWA 2YXXA 3EEZA 2B31A 4Q8OA 1Z9AA 1VJSA 4AZ6A 3H70A 4ZOEA 3SY1A 5ABGA 2WCSA 3NSMA 3UCDA 1TUFA 1EJRC 4UTMA 4Q7IA 4GYJA 4PB5A 1IT8A 4UTLA 4RZBA 4KIRA 4Q8WA 4LANA 1IXNA 2IQ0A 1W9VA 2WM0A 4Y90A 4YVPA 2A0NA 4UMAA 4NX5A 3FNDA 1FFQA 1X6UA 3MPGA 1KM2A 1Y5VA 4GXMA 3TTSA 1GOKA 3M0ZA 5LIWX 1MQPA 2WVSA 1ADOA 5HXMA 2QPSA 1E6SM 4LB4A 5E9AA 4W85A 3A22A 4CNSA 1DVJA 4QGCA 4AB4A 2C0AA 2HBXA 4XD3A 1RPXA 1H41A 4LCSA 1QPNA 1QNRA 3W70A 2X0SA 1PX4A 1XL9A 5A6KA 1NELA 1EBHA 2I1OA 4GINA 1X7IA 4JTGA 2ON3A 3GU9A 4KF1A 2X1UA 1XPYA 2QJMA 2UWFA 2ZRXA 3DU0A 4XX6A 1OT1A 3WUFA 1T40A 1RQHA 3E0VA 1E6PA 5HJYA 3PZUA 4X2PA 4DJEA 2QGYA 2DH2A 4J3XA 2V69A 3AJ7A 2ZE0A 1OD0A 3NEVA 1O5XA 1YPXA 1TMLA 4U5IA 3R8HA 2A3CA 3HG5A 2PZ0A 2WZEA 3B0VC 2NQZA 1GHSA 3PVFA 1OK6A 1BEUA 2VFFA 1NWUA 4LJ3A 2WJFA 1HJVA 1EGVA 1KQZA 3HIJA 1PKYA 2PSNA 3SGUA 4YS1A 1LT7A 3FY1A 3XINA 4WDWA 3RR1A 3P3BA 4C1NA 3ME3A 4IQDA 2P8BA 4KEVA 1ADSA 3FOKA 3M5ZA 3GR4A 4GX9A 2CBJA 4G7EA 3TLQA 3O7UA 4PUUA 1HGWA 3VD5A 1RCQA 2X30A 1GVFA 3DHFA 5GJPA 2E9BA 2D0HA 2J78A 3W7QA 1YLVA 5AB3A 1F9CA 4AWEA 4H04A 3RM4A 2I5IA 2OLHA 3P84A 1KV8A 8XIMA 5E0CA 1Q7MA 1CB2A 4KFPA 3N4FA 3NQ7A 3HF3A 4Y96A 2ZUUA 1V0MA 1H7XA 3B9EA 1Y5WA 2D2HA 4NZ3A 1IR2A 4QG8A 4AD2A 2I14A 3LXCA 1VKFA 1RALA 3BK0A 2W79A 1HNYA 3MCOA 1H7WA 3QHOA 4NAEB 3ECQA 5CPSA 4WZHA 1A0CA 1VIWA 3GG1A 2R1MA 1O6IA 4HKPA 5LNWA 5LZLA 4O8RA 2E6YA 2LLEA 1VBHA 4AWTA 4MPKA 4MYXA 4O1EA 2XVPA 3WQ4A 4Z2HA 3U6WA 4Q32A 8CGTA 3OA3A 2OEKA 1I6NA 1JI2A 3IANA 3OLDA 1W9XA 4P7NA 6TAAA 2I56A 2J13A 3NURA 3L66A 2NVDA 2BNJA 2W27A 3DFOA 3OZMA 1XP3A 4F8XA 2O9PA 4J3VA 1LT8A 4FB7A 5C0QA 2XSXA 4Y9NA 2WSPA 4WF7A 1W3LA 4EXBA 1NJJA 2CXGA 4PCPA 3SRKA 5I3GA 4IIFA 3W23A 2A2IA 3BLKA 5EMMA 2V8ZA 3IRDA 4NJJA 4DJFC 1SFTA 2V38A 4I5XA 1R3QA 4IMDA 3IJ8A 5D8WA 2VZVA 4FX7A 3G24A 1VGAA 3GUWA 2YLLA 3KBWA 3DYPA 3PJUA 4LX4A 3W01A 2HVNA 1EB3A 4A2RA 3LGEA 4XSLA 4HVXA 4DBSA 3CO8A 2D0FA 4IGHA 4CU6A 1PIFA 4GUFA 3SSJA 1E4NA 2PLJA 4IFKA 1WDRA 4BY3A 2C91A 2DIKA 1WP6A 1PKMA 4JN6A 1A49A 3LD5A 3EEGA 3F4CA 3F4WA 5FAJA 1QWGA 2FFCA 2PBGA 4JFWA 3OU8A 3KS6A 1K7FA 2EKCA 1T96A 4LF1A 5JBFA 4N9BA 1F6YA 5AHFA 1UOKA 4UR8A 5BU9A 1HXJA 3RILA 1HKMA 1XDMA 2C71A 1AJ2A 3W7EA 1TR1A 3BH4A 3DXIA 4C6DA 3G22A 5DBTA 3IK4A 4PTMA 2Y70A 4LQ1A 1JUBA 5K9DA 2GQ8A 3RM9A 2PDCA 5CPNA 3GNNA 2OTDA 1RPKA 3AMLA 3PC0A 5CJMA 4FR6A 4AZCA 2Q09A 3SAZA 1ZQ5A 1AD1A 5XINA 2O55A 3WMBA 3LI1A 3M0JA 3MSYA 1ONEA 3UETA 3LPPA 3BPWA 3IRSA 1GOWA 5C9RA 2G41A 3A6OA 3TSMA 1O66A 3NR0A 4NG3A 1KRBC 3ARWA 2VM8A 2E5CA 3W28A 4WDTA 4H00A 5C9UA 2X40A 3AXKA 1RBLA 1J4EA 3EPOA 4UOQA 4D1JA 4TVUA 2G95A 4LV9A 3L0GA 4AMCA 4KCUA 1KBKA 1JULA 5I0DA 3AS1A 4YVXA 1QAPA 2YFOA 3WZ0E 2X8RA 1X39A 5HUPA 4PMYA 3W0KA 4TIMA 3A24A 3DECA 2BBFA 2CZ5A 1T99A 1F5ZA 3BE7A 5KETA 3A23A 4JYEA 1KM6A 5C71A 5EFFA 1G1YA 1NFGA 5D37A 3F4VA 1OWQA 5A8OA 1OGBA 2HMCA 3N2CA 5CAHA 4J5NA 4MNLA 4PFMA 1ZNNA 3DYMA 2BY1A 3C5QA 3UR5A 3HFYA 5A95A 1ELSA 3LY0A 4HZ8A 3NO3A 3BUVA 4H41A 3L4TA 1PVNA 3H4GA 4FOUA 4DZIA 1YBQA 3E5PA 3NZPA 4GABA 4ZB0A 1VLWA 4B5VA 1J0KA 2FHCA 4UWMA 1H63A 4RV8A 4FA3A 3KXQA 3GDRA 5A5WA 4M6QA 3LGGA 4YYCA 3R2GA 3NQEA 5DRCA 3LERA 3QGKC 4IMFA 3QY8A 1NTHA 3NQ8A 3BMVA 3WDRA 1O5KA 2J9ZA 3NQBA 2IPJA 1U5JA 2Q6ZA 5XIMA 3T0AA 4GA8A 2QDHA 3D47A 3UZZA 2YBUA 2J7CA 3KHDA 4ZQNA 4QCEA 3FJLA 4ZOBA 3HM7A 4B5WA 3T81A 2R94A 1X96A 2WHMA 3HMCA 3H12A 3PTDA 3APTA 1E1CB 1A47A 2VX5A 4IICA 2F8QA 4PMQA 3HPZA 4C6PA 4QE5A 5CBJA 1K7XA 3CWNA 2YDSA 4PTNA 3UG4A 1WDPA 2OEMA 2WLZA 5JIWA 3UFYA 2VFHA 2BXYA 3VNZA 1NWTA 1C29A 1WB0A 3GW3A 3OYXA 1JF6A 2OYKA 4AD4A 3CB8A 2GJNA 3RLHA 2DPEA 4G2DA 2NSXA 3U3HA 4YU1A 2VD9A 3NJ3A 3UZJA 4ZQPA 1JR1A 1JD7A 5A6JA 1V3LA 4A05A 4GZEA 3TQPA 3PG8A 1H61A 1FP8A 3PN8A 5CSYA 2RDXA 2RDUA 1VFOA 2REQA 2O4QA 2PODA 4EPKA 3TKFA 4C6EA 3KUMA 1XS2A 3N6HA 4XIAA 1HF6A 1J0IA 1R9YA 4O0ZA 2I9EA 3GXFA 4AAJA 1CECA 3MJYA 1OYBA 2J24A 3OA5A 4RE4A 3EMZA 3S2LA 8XIAA 3WUEA 1L8NA 1KFWA 3LDVA 3S46A 3N2OA 3VNMA 9XIMA 1BYDA 2EKGA 4E2DA 3RRAA 2ZICA 3QLLA 2EBNA 3B03A 2IPFA 3QV9A 5AC7A 3DHDA 1JYWA 4ROQA 3SY8A 1CZ1A 3VC5A 4IP4A 4JHOA 4JX6A 1IR1A 1I2PA 1CGVA 3RMJA 1FKWA 2J79A 2WKJA 3EWUA 4LUIA 3MKVA 2A7PA 1IT7A 4CEUC 3LRKA 4BF7A 3AMGA 2ZXQA 4IL0A 3N11A 1IWBA 3A3HA 4G56A 1QWKA 3ANVA 2J88A 5D02A 4DXVA 4WDXA 5FEWA 4EKJA 3KFTA 4KW2A 1JUKA 3MUXA 1SFLA 3ARQA 1AH4A 4HZ7A 3O2LA 2XVNA 1X8CA 1LBMA 1FWBC 4ZENA 2YYUA 2QCCA 4TVDA 1XLCA 3ITOA 1F61A 3AO0A 3LQLA 4UNLA 3EBVA 4J3WA 3TMLA 3UF9A 1LRQA 2VEIA 3LGDA 3NVTA 1QU4A 4AEOA 4FX8A 3TN3A 3WNPA 1DYSA 2PGFA 1K8ZA 5GJNA 3M47A 3RLUA 3WK1A 1H51A 2ZZ5A 5LNRA 4GNJA 5BWAA 4GZ7A 3PWIA 2WLYA 3PPFA 5TF0A 4O0QA 4OV9A 2G3FA 2XZ9A 1AQHA 4PEEA 1WUEA 3SCWA 3KX6A 4YNGA 4YCOA 4ZQRA 1K02A 3H2AA 3WQCA 4L1XA 1TJ1A 1IEXA 3AZTA 4FXSA 3BLLA 3WJSA 2BGQA 4CKQA 5DLCA 4KETA 3VKKA 2P10A 4H6KA 2YCLA 1XLHA 3CNYA 2PURA 2CLPA 4AG0A 2GPTA 3B4YA 1IXPA 3KBJA 2NLIA 2ACQA 2Y7DA 1YQ2A 2MUCA 2XM1A 4L6OA 2J66A 1FWHC 2NUYA 2DZVA 2PTDA 3M46A 1YPIA 1WZMA 1G01A 4BFAA 5AYXA 2VL4A 5TQLA 5C55A 2OWWA 3N18A 3MP5A 4DB7A 2HNEA 2ZA1A 3RN6A 3W2JA 3FA3A 2AMGA 4RJEA 1TR9A 3LS9A 2QDGA 4B5UA 3DG7A 3DGRA 3CIXA 5E5CA 2Q8XA 3PBGA 1EBGA 1H7RA 1P0KA 4R85A 5MKGB 5U4NA 4R53A 4C7DA 1GCYA 1R6WA 2NWSA 3KAOA 5BMWA 3QSTA 1QK0A 4GMEA 4UFJA 2NX1A 1R3YA 2H3BA 2DW7A 3G8EA 1NOWA 3IEBA 4O52A 1QW9A 3VM5A 3BAWA 4FNQA 3CZGA 4HU3A 3PBWA 3AFBA 4EAYA 2C14A 3CYVA 3N1AA 5D9OA 3BQ5A 2Q71A 4LALA 2AQVA 1TPFA 4IOTA 4KRUA 4Q8QA 1ODZA 2E5BA 5KSWA 3GVRA 3WK3A 3A13A 4F0MA 5D38A 1VBGA 2VR4A 5LNSA 2YPIA 5DMMA 2P53A 1UZ4A 3LUTA 3UG3A 1UZ1A 4PMOA 4Z2GA 3TYEA 3STCA 1R30A 1YRRA 5E6ZA 1LWJA 1TA3B 3HGRA 1ZUAX 4JY8A 2DEPA 3MUAA 1B3WA 3C2EA 3VC6A 3FW6A 3CL6A 4GGHA 3ARSA 2OR2A 4WOZA 1EHNA 3QY6A 1FWIC 1YTKA 1XBZA 1R46A 4MB3A 1JD9A 4QDMA 3WELA 1P1MA 3SGZA 1XRSA 3QLDA 4LC6A 5AVNA 3C3NA 3KCLA 2W61A 1LP6A 3VU2A 1B90A 3FHAA 3C2OA 3B0UX 1Q6RA 1GVOA 2R8WA 1NFPA 2I17A 2W0UA 4HPHA 3KTCA 2P1FA 5I6SA 1E71M 4RZ5A 2V5BA 4IG2B 3H7UA 1EUAA 3ANYA 4O53A 4RDZA 2VDHA 4XZHA 5A69A 5D2YA 3PPHA 1ISZA 2P76A 1AQ0A 4Q4MA 3EDKA 1LM1A 3QPZA 3UY7A 3KHJA 1W1YA 4GJJA 3RUBL 5HATA 1UR8A 4K7YA 3IJLA 3TYAA 3TWBA 1ISWA 2CBIA 3EWBX 2CLOA 4I7WA 5A6MA 5CZSA 4PBEA 1SUXA 2FTWA 2OWXA 4MADA 3MHGA 1OEPA 2CZEA 1UH3A 3RAOA 2D1ZA 3AS0A 3BW4A 5G2IA 3MVIA 4IFKB 2FDMA 4UNKA 4FLOA 4GLEA 4WR3A 3MKCA 4E2VA 1KFKA 3GBDA 1R85A 3K2GA 3SZ8A 2ISVA 5CEWA 2FJUB 3UG5A 1MNSA 4ZQMA 3GXNA 3L2LA 4I5UA 1K6WA 5EB8A 1R2SA 1UBPC 2QIWA 1M9HA 2DZPA 3TQ0A 2F61A 3T09A 1A5SA 3VIKA 1W91A 1MW1A 6XIAA 3L21A 1QI3A 3ONBA 4EWJA 3WIJA 1HO1A 1WCGA 5HMSA 2NV2A 1R47A 3UJEA 4I9MA 1B1YA 4ZXOA 1JZ2A 3ISIX 4N0RA 1XIMA 1PTGA 3WD1A 5G2WA 1DJGA 1DWFM 2A3EA 4GNKB 2EO7A 4GPNA 5AECA 5IDZA 2FQIA 2POTA 4JNYA 4EOUA 3L0KA 4XAZA 3VIMA 8RUCA 4Q8VA 3I3DA 2OOFA 3O0FA 3R7MA 2R24A 4KWUA 1FCUA 3PG9A 4GIAA 1GEHA 1UG6A 2Y5JA 3ZVHB 1JDDA 3B0PA 1FDZA 3GC2A 3CK5A 2V82A 3E0IA 3WD2A 5LNVA 1PHQA 3V35A 2QIIA 3SFWA 3KOXA 1AJ0A 1JZ6A 1P48A 3VMOA 1F05A 5H2ZA 2PBOA 4HMCA 3H2CA 3VGDA 1GZGA 4GYKA 1RQEA 1BLIA 2Y7FA 1M53A 3XIMA 4DJDA 1RBOB 1KBJA 2CITA 1L6WA 2WSKA 1TIWA 4YTUA 4D8LA 2JKEA 2JIWA 2P5NA 5HUOA 4QJ5B 4F0HA 4ONVA 3BAJA 1CCWB 2HBVA 3TW9A 1EF3A 3ZIZA 1AA1B 3OW1A 4O1AA 2PAJA 4FF7A 5AFDA 3EDDA 2OLSA 1W1TA 4HSNA 3PZVA 4OE7A 3FYPA 3O63A 2PD9A 3PZIA 1GEQA 4Q7BA 3F5KA 2VDIA 3W7MA 2CBUA 3WF1A 4IJRA 3LTPA 3WLIA 1J11A 1I2QA 3GLCA 1YYAA 4UFKA 4EF8A 2NQJA 1KKRA 4QAWA 3DZ1A 4G9PA 3BICA 3H2NA 1QNQA 2HVMA 1QOXA 1YNQA 1J5TA 3BV4A 1V79A 4MZYA 3PUEA 1X6NA 1UW9A 2E67A 1B2YA 4Z0JA 5LIXX 1WO2A 2PFHA 4J3UA 2X05A 4YTQA 2ZRZA 3W83A 1A5CA 2VX4A 3CPRA 1PYFA 1MDRA 3W7GA 3TEVA 3L4VA 3QPEA 3FAXA 1M7PA 4C6BA 2ISFA 3UNTA 3MTWA 4EANA 3WLJA 2WVVA 3P0WA 2JEQA 2V81A 1E6ZA 4AIEA 1ISVA 3OVGA 1PZ1A 1JNDA 2H90A 3IS4A 1OIFA 4TQTA 4KPLA 3CUHA 3QR3A 4L4MA 4UTHA 1E0WA 3I6EA 3QKEA 4IMEA 4WKFA 4P7RA 4FNSA 1C8VA 5BXSA 3L2MA 1V0NA 2HS8A 4H2HA 2E25A 4B4HA 3VILA 3W53A 2WMIA 5AZ1A 1JXKA 1WQ5A 4GHRA 2A6NA 1W8SA 2DIJA 4IUOA 4LWWA 2J6VA 2ZUTA 3JS3A 2VENA 4AVNA 1EH9A 4S3JA 4FS9A 4UBPC 1QK2A 1Q6LA 2Z6JA 1D7KA 4Q4SA 3CQHA 1CXEA 2XIIA 3EWWA 3NCOA 4NL1A 2ESCA 4OIFA 1OX6A 1AW1A 1XD0A 2BS9A 1N82A 1BYCA 4TV5A 1PO9A 4NNCA 3RYSA 1J5SA 2WSQA 1WKDA 3NQVA 3RPMA 2OO0A 4PSRA 1ZP3A 1U2YA 5D09A 1ALDA 2EPLX 1PTDA 1FQ0A 3TC7A 4TU1A 3QXBA 4LUTA 3NFUA 2YW4A 4Z2LA 4E8DA 3WLQA 4MMWA 5BXPA 2DORA 3FN9A 4ZMGA 3G5EA 4INFA 1J96A 4D71A 3A4XA 4AW7A 1GJUA 2DZAA 4D6HA 4UQAA 4U5KA 4C6CA 1V3HA 1GJPA 4GZIA 2G3IA 2GQAA 3STGA 4YLWA 1SSGA 4AF0A 5A6TC 4RKAA 1PPIA 4M6VA 2QVHA 1BWVA 4IMGA 4PFHA 3POHA 4HHPA 3W71A 3AYTA 2J62A 1X7FA 1DKWA 2CHRA 4AU0A 4DXKA 4UC5A 1CLKA 3EWXA 4KWVA 1XGDA 1Z89A 1JIBA 5J04A 4LV4A 4KT2A 1G9HA 2F6XA 2V5KA 4W93A 4AHOA 1THFD 3NM1A 2Y85A 4YTSA 2YBVA 1XH2A 3N2XA 4WD0A 4K68A 4OBTA 4CU8A 3KVMA 1X8FA 1ZS2A 1UH2A 3VCCA 1EP2A 1A80A 3NXFA 2YCJA 4NNBA 2XGZA 1K03A 2JKAA 1Q8JA 4M82A 3B97A 2A3AA 1JJKA 4A35A 3K46A 1BXBA 1TX0A 2XG9A 4LPCA 1POJA 4IP5A 1A4MA 2FIQA 5FJTA 4Z42C 1TJPA 3UERA 4F48A 2RFGA 1DWIM 1US0A 3GG0A 3AUJA 1GTHA 1KXQA 3EWDA 2E5DA 4R88A 3L68A 1JGIA 2DDXA 2H9AB 3DGBA 4LUYA 2VJXA 2FGLA 3R25A 2EG7A 3CV6A 3VD3A 1VBUA 4PTXA 3OOQA 1PAMA 4JEQA 1E3XA 3ARZA 4ERAA 4QSFA 1UUOA 3GHUA 2BGNE 4K7VA 3LMZA 2BZNA 3N2BA 1EUNA 2BOFX 5DEZA 5I3IA 1V8EA 1BYBA 2J7GA 4S3CA 5BMXA 1XDLA 3EB3A 4CUCA 1K9DA 1E1EA 2QJJA 1KM1A 4NILA 4RW5A 4KFOA 5HQEA 3TR9A 5KZEA 5F4SA 1KM3A 3GTXA 3LPFA 4QXIA 4F9DA 3WQ6A 1XWYA 4W9TA 1C9DA 4C5YA 1M7OA 3LCIA 2D73A 1MW3A 4M80A 2ZZ7A 4PE8A 1UP0A 2PDMA 4EVZA 2VRKA 1JYNA 5FEZA 2XH0A 1OHLA 5E0KA 1EQPA 4JTJA 1V6UA 4M1BA 1UKOA 5FACA 3MV11 2F7FA 1VC4A 1MXSA 1N2VA 1RLCL 1EOKA 1UWAA 3NQ6A 2HJPA 3W1RA 5CG0A 2ACRA 1XYFA 1LROA 2ZUMA 1FHLA 4NAEA 3AMKA 2PTWA 1Z48A 6ENLA 3BGAA 2WANA 1TTQA 4YYFA 3PM6A 4HOZA 3LHZA 3LNMA 4IJCA 1TVLA 4YHEA 4JXCA 3II1A 1W56A 2WKLA 4DUVA 4HCLA 2GJLA 1AODA 1UR2A 3VNKA 1JI1A 1G4TA 4A29A 1OF8A 3LNPA 1P1XA 1TUXA 4H19A 2NSOA 1MZRA 2YL5A 1UMLA 4LFYA 2CZVA 3NSXA 3WBXA 3UZYA 4B5TA 3KTSA 2HK1A 2WSYA 3N4AA 2DVTA 2Z29A 1JZ5A 2VEMA 1HJSA 2G96A 3GR8A 2C0HA 2OKTA 2V5JA 1V7YA 2PWFA 3ES7A 1V51A 5CQ1A 5KZMA 2X1RA 1O5RA 2Z0IA 5HMEA 1A5BA 1ITQA 5IDIA 4GC4A 4XKYB 4IG2A 3AQUA 1JDEA 1BSLA 4WKHA 4DLMA 5XIAA 4LBRA 1VRXA 3I10A 5G5IA 2YCEA 1QTWA 5FF7A 1T5AA 2ZYFA 4HK7A 3D0CA 3EB4A 4IQJA 1PSCA 2FZ8A 2G5WA 4FSAA 1FOBA 1RK6A 8A3HA 4RNFA 2VZTA 1I0BA 5D04C 4J27A 4AZBA 2Y62A 4DJEC 2B81A 3MI3A 4PR4A 4H3DA 5FEXA 4MJZA 4FI4A 1EJ7L 4E3TA 2ZTKA 3ZT7A 1W5OA 4QG6A 1E6XM 2B7QA 4P8VA 1JL8A 4LUSA 2DZSA 3CO4A 4DELA 2BGSA 4E8GA 3TX9A 3BOXA 3MI2A 1NWSA 1S2UA 4DM1A 2IKGA 3GTHA 4U4MA 1E0UA 4HOXA 1HFBA 3GKFA 5DCEA 1TCDA 3BJSA 2AL2B 5DELA 3DN5A 1VPQA 1ZBKA 3OZYA 4IPNB 3CM4A 1W2PA 3O9NA 2XIQA 2X1TA 2OQLA 5LXEA 3UJ2A 2E77A 2Z25A 5B7ZA 2C1HA 4J1OA 1WPCA 4GD0A 1SFSA 4FHAA 5CZTA 4MLJA 1S3TC 4QDWA 3MVTA 3M16A 1REQA 3MP4A 1S5TA 1TKKA 4IUGA 2P3ZA 2QPXA 3QRHA 1BFNA 5F2MA 1ZGDA 2HCVA 1OADA 1MO0A 4I8YA 3NL6A 1S39A 4HYWA 1KFCA 5PTDA 3CH0A 3W7JA 1ZAHA 4DYJA 4MKNA 2V6AA 4M7TA 1KB3A 1S46A 4QBXA 2OX1A 4OECA 1GYLA 2A5HA 3UBPC 1ESWA 4JCLA 2ZXAA 3F4DA 2VEFA 3MB9A 1WZAA 3BCJA 3N25A 4C7FA 4US5A 4WSJA 1N8WA 2YFNA 4BEUA 1PKNA 4GBDA 4L9ZA 4YMZA 2ZVRA 2WQPA 5C5YA 3GDLA 3IAPA 3JZEA 5DO8A 1YTEA 4CQBA 4U28A 2GLKA 3G8RA 3B8VA 4GI9A 4WSKA 1HKVA 1QVBA 3LN3A 4PH6A 3W4RA 2WMGA 1A5NC 5HWJA 2Y7EA 3QVQA 1O94A 2ZXDA 4XV0A 4GQQA 3IARA 1DPMA 1EC9A 4MF4A 2PWGA 4A3RA 4OWGA 3R8GA 1BRLB 2HVOA 2QZRA 5ECVA 1YKWA 1W1A1 2WZHA 1CLVA 3GNOA 2V2HA 2GVLA 4Q8UA 5DCBA 3FA5A 4CEXC 5AHLA 1UR0A 2BB0A 5TD4A 4FF5A 4O14A 3E2SA 3CZ8A 4GKTA 5J5DA 4Y9PA 3T8LA 3W81A 5I3FA 2Z6IA 3URNA 3RLVA 4C6MA 5HANA 1M5WA 4IH3A 5CKSA 4XBSA 3FK4A 1YW1A 2CWXA 5I3JA 5IOBA 2CWNA 3S8HA 1G4EA 4RDYA 3WDHA 4OFCA 3HJEA 1N8FA 4CNNA 2GYIA 3VIPA 4TOQA 2QJNA 4IFOA 4ML4A 4V1YA 2CERA 4UFHA 3AIUA 3M64A 3N04A 4ZGYA 1CXIA 3NPVA 3DAQA 3ORWA 2A21A 3NDZA 4Q6XA 5F4WA 1YMYA 3KOFA 2HNHA 2ABBA 3PFMA 3CV1A 4R5EA 3AISA 3DOPA 2VC7A 2VEKA 3EAUA 3GAYA 1P6BA 3KDNA 2QCDB 3ABXA 1KGWA 4LAZA 1TTIA 4RLIA 2WKGA 2E1DA 1MNZA 2WVTA 1OABA 3FIGA 3BSHA 4MVAA 2PA6A 4W7WA 1FDYA 5H6HA 2V0TA 3Q45A 4LU0A 2IUZA 2VFGA 3B8SA 2HDJA 4NYYA 1XIIA 1ZJIA 2P0IA 2QXWA 4H6QA 4GC3A 4EPBC 2PP3A 1UC4A 1W54A 4XISA 2EXOA 3DENA 3ITGA 3AIVA 3R11A 3PTQA 4L56A 3S1UA 1HKWA 4NU7A 4DO5A 5ABFA 1LDCA 3H2EA 4R34A 2X1IA 2PP1A 1XRTA 5FKYA 2PDYA 3U0HA 2H8XA 1I60A 2PWUA 1I2NA 4GXWA 2QULA 3GYEA 5ABHA 3WD3A 4AEFA 1L6SA 6A3HA 1JCTA 1EA9C 7A3HA 2H3DA 3FA4A 1MWOA 3BWWA 3H2MA 1DV7A 4Q4KA 3BARA 1OFPA 1CYGA 4KBXA 1HX0A 3W25A 3AIBA 2OQHA 1CGYA 4CQCA 3W1NA 4UOZA 4ACZA 1MVYA 3ZZ1A 4GCAA 2ZDRA 3KBNA 5DQPA 1TV8A 5GNYA 3WK0A 4HTBA 1P0NA 4HZMA 1OF6A 3S2CA 3FKRA 4RXGA 2RJHA 1D3GA 3NYDA 4JTQA 4E5TA 5CBBA 3D3AA 1X1ZA 4HQVA 3CBWA 2REQB 4XUYA 1AVAA 5M2FX 2A1YA 4FMVA 2ZUNA 3A64A 3ERPA 4UXDA 3VIGA 5CC3A 2FVMA 4RZ4A 4B9ZA 1TRDA 2OG9A 3OZOA 4JFSA 3E0FA 4LSBA 3TNOA 3JUGA 3OLEA 1LF1A 1XKYA 3CHEA 2GVJA 3HQ1A 3VI2A 2QEZA 3ID7A 3SJ3A 2PDUA 3VABA 4JTDA 4XIMA 4H7VA 2HISA 1SZEA 4I3GA 3OZPA 4CD7A 2PDFA 3V0TA 3EA3A 1IF2A 3ARPA 1AJZA 2VZUA 1XI3A 2G3MA 2QUUA 2CIPA 2R91A 4F0LA 4XB3A 4HPGA 3ALFA 3S9YA 4W89A 3VKDA 4IXXA 4NAFA 1V4YA 1VAHA 1ZSXA 1XQLA 1XXXA 6CGTA 5HDRA 1GOIA 1LWHA 2YDRA 3KTXA 1SMDA 1XBXA 1GVYA 4C6LA 2P3EA 2Y4SA 3ITYA 2E7FA 3IUHA 1WZLA 3E02A 5T9BG 3VO0A 1FA2A 1QHOA 5FL1A 3TYZA 1RH9A 4A6GA 1U1JA 5T9CE 2WBKA 4Y9MA 3OGVA 1Q6FA 1FFRA 1XV8A 3GSMA 1QI5A 4CD4A 5CH9A 3ZJ7A 4PMUA 4Y9OA 1CDGA 1L9WA 1QDSA 1SJBA 4CNUA 3K30A 1J93A 2AL1A 3H26A 4AZ7A 1KNWA 4PMRA 2G37A 1E51A 1Z42A 5F1UA 3LXBA 1QT1A 3LK6A 1ICQA 3THAA 1G7VA 1NDVA 1SO3A 5AYIA 3VX1A 1WBHA 3F7JA 3GZ3A 1DQUA 2XGBA 1NDWA 2GL5A 3L0NA 1S2AA 1JCMP 2ANUA 4DZ5A 4PUEA 3T6CA 3TYDA 4HA4A 5K3VA 3W1AA 3W7LA 4S3EA 4BI6A 2JGYA 1RV8A 3FXYA 3KE0A 4GFSA 4ZO6A 1KO0A 5D2TA 2YYTA 1OFOA 3PUDA 4XZBA 1VCVA 3EX6A 1GHRA 4XWUA 2ADAA 2E09A 4ZBCA 3BCDA 1VB9A 3LI0A 3TSBA 4GFIA 2WNZA 4I6VA 3GDTA 3S0CA 1K9TA 4JTEA 5C2XA 4L6DA 2DJLA 3T05A 4XO7A 1K70A 2YDQA 2ODOA 1DOSA 2PD5A 3M7SA 4AHPA 2QCLA 2OFJA 1E4IA 4XZ9A 3BJTA 3M43A 3MC5A 5BOEA 2WWDA 3CZJA 3WQ5A 1VPXA 3OPSA 2TMDA 1GQIA 3G1VA 4WLCA 1GVRA 4B5NA 3PWGA 2JQXA 2ZX5A 3GVQA 1GONA 1XLDA 3B4UA 1T0OA 4C6JA 3FDGA 1GORA 5G1MA 3AHVA 2GJXB 4LYKA 1LG2A 3VUSA 1WE5A 3MUZ1 1OZQA 1R3RA 3W38A 2NQ5A 1TFVA 4DXXA 2TPSA 1BG4A 3WJXA 3VNDA 1FWCC 3MBFA 4Q4RA 1O4UA 3MBDA 5EMUA 3FJNA 3CH9A 3ENLA 4AWSA 4JKKA 1LBFA 3QYQA 2DGAA 1K4HA 2DUAA 4LTSA 1GVIA 1J6PA 3W7DA 4C7GA 4MHBA 2XUCA 5DX7A 1BQCA 4DBUA 2H6RA 1IZJA 5EMKA 3OIHA 1DL3A 5CPMA 5FI8A 4QNWA 4J7RA 1EPVA 4F0KA 3DFHA 1W5NA 2PU1A 4E2BA 1D8CA 2J7DA 4OKDA 1V77A 4DI8A 4UCFA 3C86A 3CAKA 1M3UA 3T4CA 4V15A 4Q4QA 1VJIA 4ICCX 1TPVA 2IQDA 1TMQA 2PWVA 1D9EA 5EYWA 6REQA 3GG7A 2OMAA 3S2JA 2R1NA 2AMXA 1TRIA 1YNYA 3APGA 5I78A 2FZDA 2GZXA 2G4JA 2ZUVA 1X97A 2YL6A 3MUY1 5HWMA 4BQ3A 4AUBA 1LOSA 2YZRA 3B8WA 5DMNA 4DJFA 3E0WA 4HNCA 3KRSA 3A3XA 4UTWA 3OVPA 1R0MA 1UR3M 4KEZA 3OO2A 1A5KC 3H4WA 1PWLA 3BG3A 4LS0A 3FVMA 2JFEX 1JAKA 2YDAA 3VKJA 3A4JA 4GBUA 3CIWA 3EXSA 1TVNA 1BHGA 1I75A 3IJ9A 3D46A 2X0HA 3MCNA 4QE1A 3M4HA 1CX9A 1RVGA 1TJRA 4HPJA 1H1NA 4P7OA 3QF0A 3BAKA 2C3ZA 1CNVA 1GJWA 4NZ5A 3DFNA 1WYIA 3IGSA 3U48A 4ZZ9A 1Z41A 1LQAA 3WLRA 4W88A 5I79A 1BWLA 1OFBA 2FGZA 3ZSSA 1IYXA 3VOIA 3CASA 1W6TA 4MG4A 1DJIA 2IXUA 4G1KA 1K6AA 5A8PA 3HFTA 4J3SA 1TTJA 1F3XA 3NL3A 4B2DA 1GZJA 4WGHA 3AU6A 3ZLFA 3TQVA 3SW6A 1PCWA 1PJ9A 3HO8A 1N8IA 3WBAA 5EMJA 3VIOA 4BS0A 4FNUA 1LQ2A 1OCJA 4DN1A 4JICA 4BKNA 3CL7A 4GVIA 7TIMA 2QCNA 2W6RA 3CHFA 3W02A 4BHYA 2WC4A 4IPLA 3P14A 4FLRA 4A22A 1G6CA 3M9YA 1DJXA 2J25A 2QYGA 1M01A 5CSRA 3QV7A 2DV0A 4UNIA 4UR7A 2G3NA 3U7VA 3LPOA 5HWNA 3S2NA 5IXEA 5J5RA 5DRIA 3UWQA 3L65A 4TR9A 4XKYA 1ZHAA 1GVEA 4JBRA 1GGOA 1UASA 4R33A 3T0BA 4LYRA 3W7NA 3P93A 2QQ6A 3SN4A 1RY0A 3ABSA 1XJBA 4NNAA 1F3TA 1PUDA 3NO5A 2UV8G 3V18A 5LHEA 4H8UA 1VCGA 2X2YA 4HU8A 1KW1A 3NQAA 3TUUA 2D2OA 2EPMX 3BSMA 3L12A 3TYCA 4Z08A 2NLYA 2OKOA 2WPBA 1V7AA 2PRHA 4UQEA 1B3VA 4EX4A 2AKZA 4GGBA 4H9VA 1Q8AA 3PBUA 5D9NA 3DH7A 4G1NA 5HAOA 1MW2A 3R10A 3WQ8A 1B5TA 1QI4A 7CGTA 3UVIA 1L2UA 4HK6A 3RCNA 1OFDA 2B7PA 1F6KA 1BGAA 1SVDA 3WJZA 1JCJA 4UB9A 4DJED 1JGMA 3FXGA 3DKJA 3WQWA 1QPOA 5C8BB 2WMFA 4NASA 4AQLA 3WLTA 3W2MA 3WQFA 1R38A 4FALA 2E6AA 4LS1A 1S1PA 5AC6A 3CQKA 4OZOA 1EFZA 5FL0A 2WCAA 2XWEA 3IJQA 5FEPA 3BCFA 2QCGA 2BDQA 5GVJA 1GYNA 1TX2A 2GDQA 5K9CA 5D2WA 3W24A 2W91A 4D6DA 1ITUA 2Z2UA 3SDOA 1NARA 2P88A 3MMTA 4K3ZA 1SFJA 4HA3A 3EPMA 3ANUA 3EZ4A 3G1FA 3QQ1A 2QF8A 1UPPA 1ISXA 4S3GA 3C2FA 3W1LA 5CPLA 1Q66A 1QNSA 3WEZA 1ME8A 4IIGA 3SUSA 4DBEA 1QJWA 1R3WA 3CMJA 1UPMB 4E0CA 3OGSA 1SMAA 1NF7A 1CLXA 5A8QA 1U33A 2GJPA 1CGXA 1I4NA 1RJQA 3EOEA 5E70A 2PI6A 4P8UA 1VHNA 3M6YA 3TAKA 4XSMA 4W5ZA 3R1ZA 4JZ5A 2J4GA 3HG4A 1FHDA 1YEYA 3DESA 1P5BA 1MRQA 3GR7A 3UPMA 4PMZA 4WKAA 4MYAA 4IGNA 3UXLA 1FWTA 1V5XA 3WJWA 1V6WA 1W31A 1Z69A 1KBBA 2PLMA 1AMKA 4AYSA 3UPWA 3WYZA 1W3TA 3GIYA 1ZBWA 4ACZB 1W3NA 3ITCA 1VP5A 3OG2A 1MI3A 3U2ZA 1W5MA 3WBYA 3GXPA 3AC0A 1SW7A 1UUMA 1XC6A 5JMUA 3LQGA 3CUXA 4FNPA 2ZX7A 5I06A 2RDWA 1X1OA 3TOPA 5DBUA 1XISA 3ABZA 1XIBA 2NX9A 3K1GA 4CVUA 1O1HA 1A0DA 4B16A 3GVGA 3PZNA 2XWDA 4OU1A 1TWDA 3TIMA 3OHMB 1XIFA 1E4LA 4DF2A 2OSYA 4H1ZA 4JPGA 2OX4A 1PHWA 1DIEA 4L5ZA 4LF2A 3GXDA 3N6JA 4JIRA 1WXJA 3BLOA 2CW6A 3SN1A 4GRSA 4H6EA 1Q4NX 4IHCA 1POKA 2IKIA 3D5HA 1JDCA 3RNDA 3TA6A 2DFAA 5FJUA 1W3IA 1XIEA 1GQKA 2D24A 1FWSA 3R58A 4PUWA 1E73M 3VDHA 4E38A 3AAMA 5D05A 2KZHA 3QMSA 4MUPA 1HKJA 1EYEA 4IX0A 1JZ4A 4Y6GA 4TXEA 4OQVA 5FD0A 1JRCA 4KMQA 1WDWA 5T91A 5M17A 1R9ZA 3P81A 1FCQA 2WHKA 1IXQA 1X98A 2WV8A 4JX4A 1UWIA 4JEJA 2W5FA 4L9YA 1B3XA 4K36A 1Z7AA 4KGJA 3TSDA 3OG3A 1VENA 3M0IA 4AZCB 4BI7A 1V02A 1DE5A 4Z2IA 3AXXA 3DC8A 3UW6A 1NH6A 1HJQA 1FXPA 3Q4DA 1E72M 2ZZ3A 1UR4A 5I2UA 2E28A 1ZJAA 2FVLA 3G1SA 2R1LA 1L0PA 1ZPTA 4CGTA 2DUXA 4IF2A 1FWEC 1Z32X 3AHXA 3LEPA 4K8GA 2WOQA 4NJIA 3PNUA 5AHMA 1JG9A 2ACSA 2E8ZA 4P5UA 1RD5A 1KLYA 2WK2A 2W62A 2C7FA 5F7UA 5DMLA 4O57A 4J4KA 4PL2A 4PZVA 4UQCA 4DAIA 3SIZA 5HJXA 2VC9A 1KGXA 1Y7VA 3P7YA 2J77A 4AY1A 1C9WA 5C9ZA 1CBGA 1NOUA 5JBEA 3TCEA 4B9YA 4ATLA 4O18A 4IFRA 5TAOA 2J75A 3SIMA 1AL7A 3SCNA 3N12A 3LENA 3NGFA 2NVAA 3G1HA 2QR6A 4WGXA 4OJYA 4LVGA 4O4WA 2HTMA 2ZRVA 4KQNA 1OFRA 4ZOAA 1L6GA 4X0NA 4E4FA 5FOOA 2JE8A 1XF0A 1R87A 5LHFA 4UTFA 2Z7KA 4ADSA 4G6CA 2Z28A 2HZGA 1GT8A 2VKZG 1FH8A 1KTNA 3I6TA 1HZYA 4AZHA 3THDA 1JZ3A 2OT0A 4XZMX 4A3QA 1DJYA 5LA1A 2G0WA 4W7VA 4W5UA 4OOZA 4ML9A 3UNDA 3K4DA 2EG8A 1E40A 1B54A 4BF9A 5HBFA 3SADA 4LB3A 4BEQA 2XVLA 4H2CA 2HE5A 4V33A 4AVFA 4JYDA 4R9XA 2PC4A 4UMCA 5FJJA 3HOJA 2NT1A 3CAWA 1X6LA 2XFYA 4Y7EA 3GIPA 3TJ4A 4RXFA 3HURA 3C0JA 1PXGA 1VZWA 2NXGA 2W92A 4XQ6A 1I45A 4L65A 3KVJA 3CUGA 4L64A 5REQB 4K1GA 3OQEA 5CPTA 4LNYA 4ZCWA 3WF2A 1DP0A 5IBXC 3S5SA 4B5XA 3JR2A 2YL9A 4N9EA 4NIRA 4EPEC 5LXXA 2WVVB 2XISA 1VYRA 3EXRA 3RJXA 3GY1A 2F9RA 1GQLA 4DO6A 2E3ZA 4DF1A 3GZAA 1VFLA 4LAKA 3G77A 6ALDA 2OZTA 3DCPA 3S2MA 4B90A 2VO5A 4IP7A 1V6YA 5F2IA 2AQWA 3FSTA 1QHZA 3OLIA 2ZQ0A 3W2KA 1J9YA 4GH3A 4Q7NA 3ZQ9A 3SO7A 3FEQA 3DFYA 3MP3A 1SW0A 2J9XA 4E8CA 3UY8A 3HZ3A 5MHBA 3JRKA 1GVSA 4ES4A 2HXUA 3HMJG 3JW7A 2ICSA 4PCSA 4AHQA 4LOCA 3T08A 4XK2A 1G4SA 1Q2RA 4EACA 2JIEA 4KS0A 4Y8FA 1F73A 4EAMA 1TPEA 3WNOA 3AHZA 5MF5A 1EA0A 1O5QA 3LSCA 4QJ4B 4S2BA 1LLZA 4NZ1A 5BWFA 1UD3A 4LW7A 5C54A 3NO1A 3PBVA 2V63A 2J7BA 4XO6A 3RRXA 3UXKA 4NY2A 1J0ZA 4GXPA 3OBKA 1KR1A 3OYZA 4GO8A 4UFLA 2E9LA 1FH7A 4U33A 2YLAA 3UZ5A 2ZVIA 3H2FA 4XUGA 1QR7A 3CWHA 1KKOA 4M1RA 1SJDA 1B4KA 4MNMA 3KRBA 3E49A 4JTRA 3TAOA 3W22A 2HPIA 4UR9A 3EPNA 3PUOA 4A8RA 1S2TA 1LUCB 2PDHA 4B3KA 3PBMA 4LAUA 3HG3A 2VQTA 2NUXA 1UD8A 1QHPA 1L8PA 3DI0A 4JTTA 4GYFA 1DJZA 1W9UA 1VPYA 4MKSA 1US2A 4GZJA 4YXGA 3LPGA 3EX4A 3A47A 2D22A 3LCXA 3W1XA 1D2KA 3VNIA 3THQA 2QAPA 5F2LA 4B3LA 3AJXA 3ABOA 2WNQA 3F1QA 1JCLA 2L5HA 4REQA 4AIBA 5A6LA 4ICMA 3LOTA 2AGTA 1WV2A 3KBMA 2OWCA 4X9SA 4HNTA 3O6CA 5I7GA 2WSRA 3C56A 3NZGA 3UGRA 2BASA 1YTDA 2DP3A 2R82A 1TELA 1WZKA 3RF9A 3O0KA 4G8TA 1KM0A 2ZWZA 3BXWA 3BG5A 3G1AA 4AZIA 1XW8A 2G3JA 1XYZA 1C91A 1B57A 2J9YA 4WHBA 5AZ0A 3FLUA 3WNNA 3NDOA 3WSUA 1FH9A 2PGRA 1TPWA 3B9OA 1D8WA 2V9DA 4NUWA 4C6OA 3LTSA 4XBKA 2DT3A 5AHNA 3N6QA 3P0XA 1DWGM 2VZOA 4JHMA 1XFBA 2VVNA 2OGYA 1B30A 4C1LA 3W73A 1LLOA 2VUNA 4QQUA 4O4VA 1I2RA 2IKHA 5F2GA 1VJZA 2Z4GA 3E3HA 2ZFAA 2WMIB 3CUZA 2Y2WA 2WAGA 3C6CA 4ZQCA 3MU7A 5A8NA 1EL3A 4JQ1A 2CU0A 1MFVA 2FB2A 2WQDA 3WD4A 3H8AA 1JEZA 2CESA 1ONXA 4RV3A 2PDXA 2Y8UA 2G8ZA 4RNHA 3TE9A 1GK8A 1A50A 4IQLA 1MUWA 2EG6A 4NI8A 4RE2A 1NDZA 4JTLA 3C61A 1RXOB 1TPDA 2PDNA 3CWOX 3ES8A 5DY3A 2UY5A 4NT0A 4RPPA 4LVAA 4L1GA 5D4YA 2ZZ2A 2TRSA 1IEIA 1O95A 1W9DM 3W29A 4XZWA 1FVPA 3IIPA 1O7AA 2HEJA 1GNXA 4PRWA 3IV8A 3H6OA 3AROA 2TYSA 3SSZA 4N6EA 3QYSA 1JCXA 1F4AA 3U4FA 4AYGA 1XBYA 2XINA 5G4HC 1W0MA 4IJBA 1UWTA 3Q58A 1M04A 3A3WA 2BOGX 4S23A 4AX6A 4B3ZA 5C7VA 1OGSA 4DJFD 1FRBA 3ZWTA 3QKZA 1OCQA 1KBIA 2I5GA 4V28A 4JHZA 4ORIA 3TV8A 5JBDA 4LEQA 1L2QA 3INPA 1DXFA 4DJDC 4IMCA 4F3HA 3NIYA 4GIRA 4PMVA 2Y6ZA 4K6AA 1GKQA 1LRTA 4KGLA 1RVKA 1XSJA 3AXMA 3QW4B 2IMRA 2A3HA 4IGMA 3T2PA 4YHGA 4AEEA 1C93A 4NJKA 4UFIA 2VT0A 4MDOA 1E9YB 1N7KA 4PTVA 2OODA 3OQ8A 3W2UA 1FDJA 2XYLA 4D6EA 3P80A 5EMYA 3RFAA 5I24A 3AI0A 4R7JA 4AMAA 5HMFA 3TJIA 2O7QA 2HSAA 3L5MA 3W72A 3SEPA 2GDUA 4DWSB 3IV3A 5DFAA 1A3HA 1C7TA 3AU2A 1G67A 1A4LA 1SGJA 2EHHA 4F2UA 4A8IA 4ZODA 3HPAA 3N3MA 3MZNA 3VGFA 2XDFA 4EXQA 4QLJA 3W7RA 2J6XA 2PRMA 1S5MA 1UC5A 4DBWA 1FWJC 4JKMA 4JCMA 2PRLA 4XAGA 3KP0A 4IX2A 2UBPC 6XIMA 1JFXA 1CXLA 3OLGA 3AIRA 1KLZA 3LHWA 3K5XA 4DVOA 1SO4A 5EFDA 3U8GA 1CI1A 4NHVA 4C6NA 2XIMA 3WFAA 3W2NA 4LCQA 2X0YA 4PSPA 4RE3A 5D9PA 4GJIA 3UPBA 3VDCA 3CPGA 4HGXA 3WLSA 3UJRA 3EGJA 4LYQA 3TCSA 4LXFA 3N17A 5LIKX 1RUSA 1EJWC 4GK8A 3W7CA 3RIKA 2QCFA 1HL2A 2V2CA 1YNPA 5BROA 3KEHA 1EX5A 4O1DA 1NQ6A 3KS5A 2Z26A 1X1NA 1H1ZA 1UZDA 1XCXA 2VEPA 4QQ3A 3S5YA 3UQNA 3BV7A 4J3ZA 1R8LA 5IM51 1UWUA 4G7EB 1WDSA 1MXDA 1E56A 1EYWA 1S5NA 5DN1A 1E0VA 4DIAA 4JOMA 4ERIA 4N9DA 5KINA 3CHDA 5M1TA 1T6MA 1EXBA 1NQKA 1XYBA 5EMLA 3ZR4A 1BYAA 4BK9A 3UZXA 3L4YA 3NQ2A 1LJYA 3EWZA 1A5AA 3V5CA 1TQXA 2GGIA 1T8QA 1H11A 1IIGA 3EKGA 2ZZ6A 4HNLA 2WB5A 5FIPA 3V1PA 2XSAA 1Q5MA 3E9AA 3IUIA 4HA1A 4Q22A 3WFLA 1UUQA 5HNTA 1HJXA 3EOUA 5TBOA 3ARUA 5CPQA 4H9UA 3VOHA 1JXJA 1EOMA 2EQDA 2QUNA 3EA2A 2J7HA 4JTSA 1RZMA 3UXDA 2Q3OA 1QNPA 5A8GA 5I23A 4WRHA 3N73A 1SO5A 5JH1A 1ZCCA 1Q63A 1ME9A 5JVLA 1VCFA 3LRMA 4PUKA 1LOLA 3OBEA 2NV9A 4OUEA 3WBEA 3T1GA 1CB7B 3VNLA 2VFDA 1JDAA 1JPIA 3N13A 3N3TA 3BTNA 4I6KA 4QLLA 1SYTA 3G1XA 3NYZA 3GX9A 3B04A 3MCMA 3K13A 1EDTA 1N55A 1QBAA 3WEOA 3EKLA 4L80A 5H8UA 3I4EA 1T8XA 3QSRA 2XU2A 3B0XA 4F0SA 1IEWA 3GTFA 3O15A 3QFEA 3R6IA 3V7PA 2R6OA 1Q6EA 3VOFA 4DF0A 4DUWA 1OB0A 3GBEA 3H55A 4HU4A 2A79A 3IGHX 2O9RA 1OBAA 1Q4WA 2Q02A 4PCFA 1XYLA 3FX4A 1DTNA 1W32A 1VF8A 3NQGA 4MB1A 5DXYA 1A5LC 1TTPA 1V08A 1W3KA 1LOQA 2BY2A 1BVZA 2W3ZA 3C2VA 4M8UA 3CMFA 3REQB 3GVVA 4AH7A 5T8GA 2BOEX 3IJ6A 1GOOA 3AWNA 3TYUA 1V93A 1L6FA 3AIWA 1Q2SA 5GJMA 4R9OA 4ZB2A 3FYYA 3ZVHA 2RKXA 3NQFA 1VYSX 1M68A 4LNCA 1B31A 3KCOA 4HD5A 3ZJKA 1UZHA 5EY5A 1OVDA 4L1WA 2JK2A 4PA8A 2CZDA 1VH7A 4DZAA 2P8CA 5HPOA 1RJRA 1UHVA 2CBVA 4DX3A 2UY2A 4MAVA 3RO8A 3MDUA 3U2OA 1SZRA 1KFEA 1PX8A 1ML1A 5HK4A 4YN5A 3TXZA 2YCLB 4NJHA 1TWWA 2CEQA 2VX7A 2OB3A 3HBLA 2A85A 4JQ3A 1F3EA 3FEMA 4QAIA 1E15A 1WXZA 1QBBA 5GQBA 1FTXA 4MFEA 3AYVA 3QW3A 2YX0A 4A8LA 2OU4A 1FCVA 1SJAA 4H7CA 3N2MA 3AIQA 4QS6A 3SURA 3W27A 1K9FA 4RZ6A 3SCSA 1TQJA 1A53A 3CLMA 1EO5A 3UR7A 3FVDA 1R3VA 1C92A 2O92A 1HTIA 4QHRA 5G1TA 4JL1A 2RGLA 4JR5A 2V5LA 3W07A 3B3DA 5ABTA 2CKRA 2FTPA 3WMLA 2W63A 2PDGA 5BXTA 1S3HA 2CXEA 1WOAA 1ZRQA 2ZA3A 3VE7A 2EPNA 4NJGA 3EDEA 3PB0A 4KWOA 4GQ0A 1PTAA 3W37A 1L6YA 1BVNP 3MT1A 2BWGA 5D03A 3NZ1A 2V30A 3LLXA 3SCRA 4K37A 3CMGA 3ZR6A 2VDGA 1IT0A 4GVGA 3KRZA 3T42A 3MYOA 1LCOA 1V0LA 2NVCA 3WLOA 5G4EA 1XG3A 1QW8A 2F84A 4S3FA 3TW7A 3UEQA 1OX4A 1XLJA 3RMEA 3CV2A 2ZA2A 4ASTA 3NGJA 3E1F1 4X61A 3HGSA 1H7NA 4DY1A 1FHUA 4MNKA 2PDBA 3GM8A 1H62A 2OQYA 4M51A 2FH8A 2YA1A 3B06A 4GJ1A 4PL1A 4TUFA 1Q3NA 1UBSA 1WDDA 1UJQA 3RJYA 5E6YA 3KL3A 4BQ4A 2E6FA 4IT1A 4GO9A 4GUJA 1H5YA 4I7UA 2ZRWA 5CPOA 1VRDA 1CWYA 3UWZA 1FHVA 4FAMA 1EDQA 3KP1A 5A2AA 1ONRA 1TG7A 4IM4A 3BG9A 3R13A 4RK8A 3LHTA 3OTRA 4ZO7A 3N14A 2B7NA 4V1XA 1HW6A 1IWPA 1OCNA 3PP7A 3WNKA 1EJTC 3NTYA 3QQ0A 1J6OA 4QM1A 4ZFCA 5A6BD 2RAGA 4U3CA 4D2JA 1WAUA 1P0EA 1WNOA 1VEOA 1UWQA 1U5HA 2AKMA 2RH9A 5K7JA 2IPWA 5HPCA 4O50A 3GRIA 2TSYA 3SECA 2QLYA 1Z44A 1DJHA 3UWEA 5CG7A 4NKCA 2Z27A 2CZFA 4US5D 1V3KA 2ABAA 4ZA0A 3QR1A 3ZWSA 5MKGA 2XM2A 5I02A 3HU7A 4E2OA 1O60A 3PZ9A 3W74A 2D69A 5HJLA 3CGTA 3LTYA 1XC4A 1VFMA 4JTFA 1EXPA 1XLAA 4DQWA 4ZE5A 1LWIA 2E6DA 3AS3A 3KRUA 6PTDA 1ICPA 2BMBA 2B7OA 2V3EA 5DT5A 3LCWA 4ZB5A 3KZPA 4I7VA 3VYLA 4D6JA 3M0VA 1K3UA 4GY1A 1F3WA 1V03A 3WEMA 2QDEA 1NWRA 3ZJ6A 4PTWA 2VRQA 3CS2A 4JN7A 2OXNA 3VVGA 1F8MA 1O1ZA 3H7RA 1DXEA 5CJ5A 3L7RA 4J2PA 3THCA 4ATDA 1QPRA 1KGUA 3WLKX 2BP1A 5CC6A 1E5JA 1PIIA 2R1KA 4A21A 4O17A 3CPUA 1GWJA 4DHGA 3TU9A 1E9ZB 1BWKA 1IXOA 5TNVA 1NU5A 1EJSC 3LB0A 4I5RA 5FJIA 1EEXA 1Q6DA 3H22A 3IGXA 4FPSA 4H8HA 4I9AA 4JTIA 3VCRA 1UP2A 2WXDM 2Z1VA 4BCEA 1D3CA 1BQGA 3MHUA 3DERA 1YHTA 2XN0A 9CGTA 3F2CA 3OBAA 2EPHA 1GQJA 5I3KA 4FIRA 1TV2A 3STFA 3WDJA 4IPPA 3QQWA 4P61A 4GQBA 4NQ1A 1ZJHA 4C6FA 3ARXA 1ZL1A 1GKRA 1XKJA 3UXAA 3B9DA 5DT7A 1H60A 1NSJA 2VFIA 3G6LA 4HSHA 5LIUX 4CNTA 1XX1A 3H4XA 1JQXA 3E2QA 4BF5A 3ALGA 1G94A 1I2OA 2IW0A 4JL2A 1GG1A 2VXNA 2VELA 3E38A 1B4EA 2PWDA 4AXNA 2QHAA 2UY3A 1BG9A 2GVGA 4LC8A 1UKTA 3CV7A 3DIPA 4MAZA 4CQ9A 5DMYA 1U30A 5H91A 3ARRA 4QDPA 4MFDA 1RQBA 3C52A 1BXNA 4ZXLA 1QI0A 1UIPA 3TZFA 4C65A 3UCQA 1JRBA 4QEEA 3W3OA 4AISA 3BDKA 2OCZA 3M7WA 2Y5SA 3NDYA 1KC7A 5AHEA 3F4NA 2Z1BA 2D23A 3T78A 4P7QA 1CXKA 3OP2A 5IFTA 3QHMA 2PWEA 3TVAA 1BKHA 2XIOA 4XD4A 3CUIA 4AZGA 5BOFA 5A6SA 2PZNA 3N29A 1AH0A 4UTKA 1W8GA 1XCFA 4BWLA 1M41A 5E9XA 3TMQA 3QV8A 2C15A 3S1VA 3UWVA 1J0HA 3RU8X 4ZQOA 1RBAA 4CNPA 3LG3A 2KX9A 4H9XA 3VFCA 1GZ1A 6REQB 3AOFA 3IVUA 1GW1A 4HN4A 1GTEA 5JU6A 2NQ9A 4Q3MA 3WNLA 2AAAA 1SPQA 1YPFA 3PY2A 2X2GA 2WNWA 3WLMA 2VHLA 1IE7C 1P6CA 4Z17A 1ZAJA 2FZNA 4HPXA 1FWGC 3EX2A 4J2MA 1Q6GA 4N7QA 1YDVA 2C19A 2INFA 3BQ6A 4RCXA 2FPTA 4JTAA 5HINA 3LCGA 4CLMA 4DZHA 5CZ0A 1GOQA 4X60A 3UA4A 4GWEA 3DBNA 4AC1X 2DZWA 1XH1A 1NP2A 4IQEA 3ARYA 3CQ0A 4Q4PA 3SUUA 3B40A 4Y9AA 3P74A 1BD0