1EQCA

Exo-b-(1,3)-glucanase from candida albicans in complex with castanospermine at 1.85 a
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
394
structure length
394
Chain Sequence
AWDYDNNVIRGVNLGGWFVLEPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAALRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAFQLLDNDPYVQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGFDNSGLRDSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAFQVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGWDAKKESHWNVAGEWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFWSWKTENAPEWSFQTLTYNGLFPQPVTDRQFPNQCGFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXO-(B)-(1,3)-GLUCANASE
publication title The structure of the exo-beta-(1,3)-glucanase from Candida albicans in native and bound forms: relationship between a pocket and groove in family 5 glycosyl hydrolases.
pubmed doi rcsb
source organism Candida albicans
molecule tags Hydrolase
total genus 151
structure length 394
sequence length 394
ec nomenclature ec 3.2.1.58: Glucan 1,3-beta-glucosidase.
pdb deposition date 2000-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1eqcA00
3CUHA 1QI2A 1NP2A 2VX4A 2X09A 1HKKA 1E3XA 1JAEA 4W93A 1C8XA 5HPCA 1BYBA 1SMDA 1UQYA 4HPHA 2W66A 1K6AA 1V3LA 2WCSA 3GZAA 3WDIA 1JXJA 1UR1A 2V3EA 3AHTA 3QOKA 4MNMA 5CGTA 1ZU8A 2BY1A 4WSKA 4PEEA 3PZQA 4W86A 1QI5A 3WDRA 3U7BA 3WQ4A 4MTVA 1KBBA 4D72A 3I3DA 1GORA 3M6DA 3SCOA 4F66A 4H2CA 5A8QA 1K9EA 1JIBA 1Q6FA 1V02A 3GXDA 1UD8A 1WB0A 2GJXB 4CN1A 1UR9A 1BYDA 2BXZA 3RM8A 1W3KA 2YLLA 1U30A 3WH7A 2DGAA 2CETA 3ZT6A 1LJYA 2VX6A 4PMDA 4AD1A 3VDBA 1CWYA 3VVGA 2PWDA 2VRKA 4B3LA 2YBTA 4IUGA 3WQ8A 2YA0A 1IZJA 5A6LA 1MW1A 1IV8A 1E9LA 3WMBA 3CZEA 4TUFA 2WSKA 3WEOA 4JKLA 3WH9A 4MDOA 3TTQA 3MS8A 4ZE5A 3THCA 3PZIA 2GJPA 3BMWA 5CPQA 1I1XA 2G3MA 2WLYA 2WMKA 1UWTA 3N13A 1TUXA 4M82A 5I77A 1PX4A 1FHLA 5A95A 3N15A 1MW0A 5A6MA 3AIVA 3UR8A 3KE0A 1OD0A 1CXFA 3SCUA 1JXKA 5A6KA 1WDRA 1JDCA 5GPRA 1HJWA 3WMSA 4CVUA 3GNRA 1GPFA 3GXFA 2YA2A 1WE5A 2ZUVA 2OWXA 2PB1A 4HTYA 3WBAA 2O9TA 2CXGA 2ZE0A 4Q22A 5A8NA 2CCRA 3WIJA 2JALA 3VMNA 1NWTA 3RPMA 1CIUA 1FH7A 2J7HA 5HXMA 1KGWA 4AZCB 4AEFA 3VGHA 2OSWA 2PBGA 1OINA 2CBUA 1V6UA 1VFMA 2D0HA 1B31A 3CHCA 3GXIA 1BPLB 3WUGA 8CGTA 1ZBVA 4HP5A 1EOKA 5A3HA 5I3DA 2EBNA 2FGLA 5E09A 3BSGA 4UZUA 3NDYA 3AXIA 1HNYA 3LPPA 2HISA 2WMHA 1JZ3A 5EFFA 1HKJA 1E6RA 3T2OA 4HU0A 1CBGA 1BLIA 3OG2A 5A6BD 1J0HA 3BXWA 3KZSA 3EDJA 1JYXA 4PMQA 4AZCA 2WB5A 2BNJA 4Y7EA 1EXPA 3PTQA 4BA0A 1QHPA 1V6XA 1DWGM 1M53A 5E0FA 5DT7A 2E9MA 2XHYA 1E71M 4GKLA 1HVXA 2NW0A 3VINA 4AXNA 4MPKA 5M17A 5I23A 2XGBA 1JDDA 5D9PA 4CCEA 3VGDA 4WKHA 2ESCA 4W89A 1L0PA 3MV11 4FLSA 1CNVA 1UR4A 2BS9A 3PBGA 3K46A 1E5NA 2J79A 1JI1A 3IK2A 4OUEA 3AXHA 3ARQA 3AMLA 3BAYA 3TOPA 2XWEA 3II1A 1UWSA 3VDCA 3VKKA 4PBGA 5IHSA 1EQPA 2A3CA 1TZ7A 1W9PA 3PZTA 4QCEA 1GQJA 1MXGA 1TR1A 4D71A 2Z1KA 1EDQA 1CGYA 3KL0A 4MNKA 2J7CA 4CKQA 2GJRA 2FHBA 1JAKA 1CXHA 1OWQA 1MW2A 3N1AA 1GQKA 6CGTA 3VMOA 1LQ0A 1UKQA 2D3LA 1GOWA 1MXDA 3SUUA 1QPKA 1C7TA 4P7LA 1G0CA 4UCFA 1PX8A 2G3NA 4UFIA 4AD2A 1AVAA 1QNQA 1GNXA 3CHFA 1W9DM 3FHAA 3W4RA 1WKYA 5AYIA 1FH9A 2XVPA 3MSGA 3LPOA 3VNZA 4J3UA 1JYVA 2YL5A 1MVYA 2X0YA 3WEZA 5E0CA 2G3IA 3WNMA 1TA3A 1E56A 4AD4A 3L4YA 2YA1A 1JL8A 3ARSA 2DSKA 3N04A 5GQBA 3AMKA 5CSYA 3NUKA 3B9AA 4ACZA 3EMQA 1JZ6A 4UNIA 3SCTA 5M3WA 1JFXA 3K4AA 4V27A 1VFFA 2XFFA 1C90A 3CLWA 3MANA 4PTVA 1XSKA 5A1AA 3SUTA 1KQZA 3WNLA 3AIUA 4GINA 1J12A 4U2YA 1R7OA 4P7RA 1E6XM 4JZ5A 3WEMA 4KRUA 1D7FA 2DT0A 1EO5A 2JIWA 1CTNA 2C7FA 3AMDA 5CZKA 2WMGA 1BGGA 1PZ2A 3ZT7A 1GVIA 5DT5A 5E70A 3WF3A 4E4PA 1ZL1A 1W32A 2PBOA 3IJ8A 1EO7A 1PIFA 3SUWA 4TX6A 2VC9A 3UCQA 2AOSA 4AD5A 2VQTA 3ZJKA 3CMGA 4W87A 5D4YA 3W81A 2WAGA 1K9DA 1FFRA 3DC0A 3WD1A 5HDRA 1UG6A 4ZFMA 1E3ZA 2J74A 2WMFA 2VX5A 1H41A 1KFWA 3CZLA 2XM2A 3QGVA 1XD0A 3BLKA 1HL9A 3AHVA 5A8PA 5IHRA 2YLAA 5BXPA 2VURA 1UZ1A 3UG3A 4UR9A 4B15A 1OGBA 3W6LA 1LL6A 1XCXA 3WF2A 4D6JA 5ABGA 2QPSA 4U5IA 1ODUA 3BAIA 3WUFA 4JCLA 1YHTA 3WL0A 2YDQA 3VX0A 1HIZA 1AQ0A 2ZUNA 4J7RA 3ARUA 2OYMA 1RD6A 1XH0A 2ZX6A 1HVQA 4MNLA 2DSWA 5A8MA 4KMQA 3WD2A 1OSEA 3AZSA 1UQZA 4TX8A 4BS0A 1NQ6A 4C7FA 3T08A 5CLWA 3U7VA 1QI3A 2EO7A 4D6IA 1B2YA 4QFUA 1G01A 4AZGA 3AQUA 4QP0A 3VIMA 4PN2A 3BAKA 4W7WA 1UH3A 3EYPA 4LYQA 4S3KA 5EB8A 5D9OA 1VFUA 2F2HA 4Z2IA 1HJQA 3LMYA 1E40A 3UETA 4CN4A 2CBJA 3PTMA 1XH2A 2VI0A 3WDPP 3CHDA 1H2JA 1GOOA 1WZMA 5BCAA 1UKSA 3KEHA 2IXVA 5CSUA 1HX0A 1V3KA 1P6WA 1KGUA 3VO0A 2BVDA 4GZEA 4JFUA 2BVYA 3VIFA 3QHOA 1CGTA 2DH2A 2WCGA 1V0NA 3WF0A 2XVGA 1JDAA 3ARYA 4RE3A 6A3HA 2J8GA 3RILA 4MJ4A 4DUWA 2JEQA 3F4VA 1XRVA 1ISZA 1QBBA 4HA4A 1H4PA 2J7FA 4CU7A 1E73M 3AJ7A 1CXEA 2RGMA 1C7SA 5BXSA 3MUAA 4GPNA 2GFTA 5AC5A 3WH5A 3UR7A 3BAWA 1BYAA 1JGIA 2BY3A 1GVYA 4GI9A 2D3NA 2V3FA 2PWEA 4PMNA 1V3HA 2ZUMA 1ZB5A 2A3HA 4LQ1A 1NP0A 1ISVA 4M56A 5DO8A 3A4AA 1CGVA 4U3AA 3ZQ9A 5D9NA 2E40A 1KQYA 3FAWA 1DTUA 1J0IA 4P7OA 5FIPA 1GHSA 4YHEA 1B3WA 3VPLA 3WY1A 3RCNA 4D1JA 3MMWA 1X6NA 5ABEA 2WBGA 1NOUA 2GDUA 4MADA 1E4LA 3VIKA 2UY4A 3LPFA 2VQUA 1H0IA 1HN1A 1BG9A 3ZOAA 2GK1A 2W92A 4DWSC 4EKJA 4E2OA 1VEMA 3K8MA 2WHKA 3VD7A 3AIEA 1DWHM 1WDSA 3W38A 2J7GA 1CGXA 4W8BA 1W2VA 1XSIA 1PX3A 1MQPA 4AD3A 2CPUA 4OZOA 4ML4A 5ABFA 4J3TA 1UR8A 1EDGA 4DM1A 5I78A 2XSBA 4DWSB 3AROA 3WNKA 5BXRA 1EQCA 4TTGA 2IXUA 1FHDA 4TTUA 2WVVA 1EHNA 1R85A 1OT1A 3B8SA 3K1DA 4HMEA 2J7EA 2DQXA 1H5VA 1ZBWA 5DEZA 1TCMA 4DUVA 1KCLA 7TAAA 1EGZA 2YDSA 7CGTA 4EAMA 1E0VA 1JFHA 1I1WA 1R7AA 3DHUA 3BGAA 3CZGA 3U5YA 4PYSA 2VRJA 3RO8A 4GO8A 3CZKA 2B31A 1M03A 2WSPA 2Y2WA 4CU8A 2Y24A 4LXFA 4UOQA 3OLIA 2X2YA 3T2QA 3UERA 1UA3A 4WIWA 3MUZ1 3VD4A 1NOFA 2ZXQA 4UQ9A 2BV9A 1Q6EA 4YN5A 5I2UA 4GIAA 1E1EA 4S3JA 1US3A 4QLJA 4U31A 4IPNB 2CIPA 8A3HA 3GTNA 4PMVA 4NZCA 2D1ZA 4M29A 2DSZA 3SEPA 3WBEA 4GO9A 4B16A 4MB5A 4AZHA 2YL8A 2UY5A 4A4AA 1E70M 5FOOA 1VENA 4YHGA 1FP8A 1KXTA 3CIVA 4JAWA 1L8NA 4EANA 2EQDA 1WO2A 1W1PA 4OKDA 4AZBA 4F9JA 1E4NA 2ZX8A 4ATDA 4BQ2A 1MW3A 3UG5A 1DHKA 4A3YA 1FFQA 3F5KA 3KL5A 2VOTA 2WHMA 2VR5A 2ZUWA 2GJXA 1BVZA 2D23A 4AY1A 2WVTA 3AIQA 4UOJA 1CLVA 3S2CA 3CUIA 4PCTA 5CJ5A 3WDJA 3AS1A 2EPLX 3BSHA 4OOUA 1UKTA 3DYOA 3WKZA 4RE4A 3QHNA 2UWFA 1GCYA 4D6HA 1JNEA 1VAHA 3SCRA 3AOFA 2WC7A 2C8NA 2WMIB 4KH2A 2A3AA 2YDRA 1JG9A 1GQIA 2D2OA 1KGXA 4TVCA 1ISYA 3EDDA 1WCGA 4TVDA 4XZWA 1AMYA 3GM8A 5CG0A 1QNOA 2WW5A 2XVLA 1OCQA 1R8LA 3U57A 2D22A 3T2PA 3ZO9A 3W82A 2OWCA 1J0ZA 2XIIA 4J27A 5ABHA 2E4TA 5JBDA 1NM9A 3RM9A 3DHPA 4PUDA 5A6AA 2XG9A 2XJ7A 4V2XA 4BQ4A 1S46A 5D8ZA 3MMUA 1H3GA 1F4HA 3AS3A 2XFYA 5M5DA 1SFSA 3L2LA 3VIOA 3BLPX 1XH1A 3ARRA 3GXMA 1BTCA 3WNOA 4W5UA 2WZHA 1E55A 2XUCA 1R87A 3WDQA 4PMUA 1FA2A 4UFHA 3AICA 1NWUA 1LL7A 1TMQA 3WQ5A 5I24A 5LYRA 1KB3A 1J0JA 1DP0A 2W5FA 3VD3A 2WMJA 2WC4A 1VBUA 4NRRA 1Z32X 1QI0A 3MMDA 2EPOA 1BFNA 3J7HA 3ALGA 1GJWA 2G41A 1B30A 3WNPA 1MQQA 2C0HA 1JZ8A 4FMVA 4Z2JA 2QV4A 1EIBA 1Q4NX 3ALFA 3WQ6A 1QI4A 4DUXA 5EBAA 1WP6A 1H11A 2J25A 1V6VA 1UH2A 1U33A 1W9XA 5KZ6A 4JKMA 1V6YA 5D9MA 1B1YA 2F8QA 2HVMA 3ZSSA 3G6LA 3CZ8A 4H7VA 3ZR6A 2ZIDA 4QCFA 2PWGA 1ISXA 2XFRA 1XSJA 2ZX5A 3ARZA 1CDGA 4P8WA 1XCWA 5IFPA 4W7VA 1G9HA 3POHA 1ODZA 1UWQA 3AYRA 3RJYA 3F5LA 4Z2LA 3SURA 5CPTA 2XYLA 1KXVA 2CEQA 5E9AA 4JFTA 1GOIA 4BCEA 4E8CA 4WKAA 7A3HA 1JYNA 3O6AA 3VNYA 1E4IA 3MUIA 3CGTA 3F5JA 2O9PA 2YKKA 3SCPA 3OIHA 5AY7A 1CXLA 2D0FA 4AMCA 1SYTA 4D6FA 1LWJA 4QLKA 2CESA 1LG2A 3RJXA 2GSJA 3ARTA 1V0KA 3AZRA 1GONA 2EPNA 3DYPA 4X0VA 4MB1A 3EDKA 4JIEA 3TTSA 1QVBA 3VGEA 4AZ5A 4W7UA 3L4ZA 1DWIM 3T0AA 3OGRA 1XHGA 5A2BA 2GUYA 1ECEA 1TG7A 1V08A 2BFGA 1U2YA 2NT0A 1UWUA 1RP8A 1MFVA 4P8XA 2XGIA 3MSDA 1Y7VA 4IISA 1JF5A 5AC4A 4AD0A 4D1IA 2G4FA 3OZOA 2J7BA 1W3JA 2WWDA 2J7DA 3MV01 1NWSA 1TVPA 1VF8A 4V28A 3FY1A 1JF6A 3PZMA 4HU8A 3AMGA 3RM4A 3SCWA 3M7SA 1CZ1A 4UFLA 3W37A 1WPCA 4PCSA 2W63A 1FP9A 4JHOA 2VT0A 4X9YA 4CN6A 4HMCA 3WF4A 3N18A 5C71A 5HPOA 1MQRA 2FH6A 3UESA 4H41A 3CO4A 5A6JA 3FAXA 1UWIA 3A47A 3UG4A 5TD4A 2OYLA 4PMOA 3QR3A 3MUY1 1V3JA 3N11A 2WWCA 3CHEA 1EOMA 4HZ8A 3RDKA 1UR0A 1IT0A 1Q6CA 4EE9A 2QMKA 3S6TA 3GYCA 1PBGA 4OIFA 1KWGA 1W3LA 1M01A 1VBRA 3FW6A 3WDHA 2EPKX 1DWAM 2XPKA 1GOQA 1ZBKA 2GVYA 2FH8A 4KWUA 1CXIA 4IM4A 4FK9A 4UZSA 2Y8VA 1OD8A 4MB4A 1HJUA 4CD4A 2QMJA 4CU6A 4KRTA 1KCKA 1J11A 1ZS2A 1HKMA 1CXKA 3KL3A 2V3DA 3CBWA 3W25A 2J77A 1WAWA 1X1NA 3W0KA 5DFAA 1TFVA 5LA0A 1DEDA 4N0RA 1WDPA 3ZSTA 1PPIA 2VUYA 3A4XA 4MAVA 4OBRA 2CKSA 2BVTA 2W62A 1M7XA 2WCAA 3CZJA 5JIPA 2NSXA 4GI6A 4PRWA 4AWEA 1GQLA 4MDPA 3L4WA 2DT2A 1ITXA 1BQCA 4YPJA 4GZJA 4D6DA 2VO5A 1ZJBA 5LA2A 3WF1A 1F4AA 3ZJ8A 4N42A 3K8KA 1Q6GA 4FLRA 2VL4A 4AZIA 2VRQA 2ZWZA 3PTKA 2XIBA 3AS0A 2CKRA 1BF2A 1ZBCA 3BAXA 3EBVA 1W9VA 4LYPA 4ATWA 1E0XA 2VZUA 1GZJA 3FN9A 4XV0A 4UFMA 5D8WA 4PMZA 3OB8A 2WANA 5GNYA 1BAGA 4HPGA 3FNDA 4RE2A 3TONA 1XD1A 3VTRA 3M46A 2VZSA 3TTYA 4W85A 3NYDA 3NDZA 1HXJA 2CYGA 4PMRA 4LGXA 4H8UA 3L4VA 4UFKA 4PTWA 4UQCA 5I6SA 1UD4A 3OGSA 2XWDA 2DH3A 1E5JA 3MU7A 1K9FA 5HOSA 4GXPA 3SUSA 5A94A 1EH9A 3WQVA 2PWFA 5E6ZA 2BHUA 3APGA 1UA7A 3DECA 3OA5A 2WVSA 3EMZA 1US2A 2FGZA 3B9EA 1GOMA 4AISA 1W1VA 2W91A 1E6NA 4UQBA 3BC9A 4C7DA 1G1YA 3T0DA 1OIFA 1E15A 3CUFA 1CGUA 4J3XA 2OSYA 3VIGA 2AMGA 1V3MA 1UZ4A 1B3YA 3SCVA 2VCCA 5A2AA 4M81A 1JNDA 4LPCA 2YBUA 5CPSA 4NSBA 1NH6A 4QDMA 4M24A 1CEOA 1C8YA 3AHXA 3BMVA 1BGAA 4M80A 3JUGA 3N17A 2X1IA 4W8LA 1QNPA 3VD9A 1X6LA 4R5EA 2O9OA 4D6EA 2OLHA 2YJQA 2JEPA 1H09A 5EMYA 4U33A 3ARVA 4CD5A 4L4PA 4CD6A 2E9LA 4PTMA 3B9DA 3WH6A 2DT1A 1VRXA 2QPUA 3O9NA 1UUQA 4U3CA 2J4GA 3QOMA 2JIEA 2WPGA 1QNRA 3AHYA 1BG4A 1J10A 1WNOA 3GNPA 1A3HA 3CPUA 4UQEA 3VOCA 4F8XA 2V5CA 2D24A 1J0YA 3AISA 3PZGA 4W8AA 3UEQA 4OJYA 2CBIA 4X0NA 3ZJ6A 2O9RA 1HJVA 1C93A 4TVUA 2YL6A 5A2CA 1H0GA 1W3HA 5CLTA 4DWSA 4HZ7A 4OOZA 4HOXA 2VZVA 1QOXA 5CQ1A 5C8BB 4ZXLA 2ZUSA 2DIJA 4J3SA 4AYSA 2WZIA 1O7AA 4GZIA 1W2PA 2F61A 4ZE4A 1HP5A 1PJ9A 3OLDA 1UKOA 2XSAA 1PEZA 1UD2A 1KR1A 1AQMA 2VX7A 2VJXA 1DWJM 4ACYA 4CD8A 3VM7A 3VILA 2J47A 3ARWA 4JCMA 4TOQA 2EJ1A 2QLYA 2IUZA 1C3FA 1CPUA 3AIRA 2PF0A 4JL2A 3GH4A 3ZT5A 2WHJA 3ZIZA 4U5KA 2D20A 1UYQA 4BF7A 2WLZA 3CMJA 1W1YA 4FF5A 2DEPA 3D3AA 2WHLA 4K68A 1PIGA 2ZXDA 3SCQA 4AZ6A 1HL8A 1OBAA 4UTFA 2BY0A 1VEPA 1XV8A 3CUGA 3AHZA 4URIA 4UFJA 3WFZA 4U2ZA 3AI0A 1CLXA 1BYCA 2G3JA 4AEEA 3HU7A 1GJUA 4C7GA 2UY2A 4UQAA 9CGTA 2WC3A 3K4DA 1UD5A 1BSIA 4P7NA 5FCZA 2WYSA 2OYKA 2EPMX 4GQQA 5BYWA 1W9UA 3T09A 1VJZA 2X8RA 4HZ6A 3I3EA 5DF0A 2WXDM 3D5HA 1B9ZA 3SUVA 5JUVA 3CH9A 5JBFA 2FDMA 5AYBA 4H04A 5JBEA 1UHVA 2OWWA 1B0IA 5F7UA 4WJXA 2VMFA 4WSJA 3BCFA 2ZOXA 2JFEX 1LL4A 2A3BA 1JI2A 2VZTA 3GBDA 3NSXA 1HT6A 4ZEPA 5ECUA 1RP9A 2WMIA 4HOWA 3CUJA 3ZM8A 4ATLA 1SMAA 1D3CA 3CTTA 4XUYA 3RMEA 3G6MA 2J78A 5BWFA 1JZ4A 4ZXOA 1I75A 4HA1A 3SIMA 3PZUA 1M04A 2CHOA 2DIEA 3OLGA 1FOBA 3I3BA 5CXPA 1Q6DA 3VGBA 4CCCA 4PSRA 1KWKA 3WL1A 3M07A 4XX6A 3W26A 3NIYA 1C92A 3L4UA 4PSPA 4W84A 4P7QA 1CGWA 3WENA 5C70A 2YIHA 1HF6A 3OBAA 1IZKA 4Q7NA 3VU2A 3VGFA 1EA9C 4KGLA 5BXTA 4WKFA 2PC8A 1OGGA 1WZLA 1J01A 2JF7A 1QBAA 4BQ3A 1HJSA 2X0HA 5HNNA 2VCBA 3O2LA 1VEOA 1CYGA 1QHOA 1JYWA 4GQRA 1CENA 4JL1A 3T0BA 1RPKA 1E0WA 1VFOA 1KXHA 1EHAA 2GDVA 5EFDA 2FHFA 5IXEA 2ZICA 2BXYA 3SCSA 2CERA 2DSVA 3BAJA 1GW1A 3IJ9A 2DSUA 2BHZA 2V5DA 2W67A 4UQDA 1QW9A 1G5AA 1HP4A 1O6IA 3WD4A 4Z2GA 3EMCA 3L4TA 2VVSA 3AIWA 1E72M 3WH8A 3IANA 2E3ZA 3FXYA 3AYSA 1ZJAA 3QHMA 3U5UA 3POCA 2ZWYA 1AQHA 4WLCA 1TA3B 1J9YA 1LLOA 5A6BA 4B3KA 3W29A 2Y8KA 3WQWA 1V03A 1DWFM 3ZR5A 1B90A 1V6WA 4ZENA 1MWOA 5I5RA 4ACZB 3VUPA 1XYZA 1VJSA 3W28A 4W88A 5I79A 4L4OA 3DYMA 1R86A 1E6PA 3NSNA 1XGZA 3L2MA 2NT1A 3AZTA 2VR4A 3W27A 1ESWA 2A3EA 4CVWA 2VCAA 5FKYA 4M1RA 2ZUTA 3VGGA 1WZAA 4QAWA 3AIBA 2E0PA 5FD0A 4W5ZA 3WN6A 3HJEA 2RGLA 4PTXA 4UOZA 3PN8A 1JD9A 2XVNA 3K8LA 2WVUA 4H8VA 4P8VA 1E43A 3AS2A 3A3HA 1VIWA 3MKKA 5BROA 5HBFA 2FHCA 1B3ZA 2CBVA 4PMXA 4A3HA 2ZX7A 3ARPA 4MNJA 1FH8A 1A47A 4J28A 1PZ3A 2WBKA 1JZ7A 1KXQA 4OBSA 1QHZA 1OGSA 3KWXA 1CECA 1GUVA 1V0LA 3WD0A 4CGTA 1K9TA 3NCOA 1UWRA 2E9BA 2PI6A 2EXOA 3THDA 4MJ2A 3SCNA 3NSMA 1B3XA 3A4WA 3HMCA 1TE1A 1NWRA 2J8FA 3VIIA 2OSXA 4AIUA 1OM0A 3BCDA 1V0MA 4B9ZA 1UR2A 2VZOA 4EK7A 3W53A 3TP4A 1UD3A 2JE8A 4BZYA 1W9BM 2J75A 2W61A 1NOWA 4JFWA 2CITA 2E8ZA 2CHNA 4CCDA 3L4XA 3ECQA 1E6SM 3AXXA 1WZKA 1QNSA 3VDHA 4PMYA 2CNCA 4NI3A 3PZ9A 3VIHA 3WUEA 1GHRA 2ZUUA 4JFSA 1QW8A 4M8UA 4MB3A 3AFBA 2DDXA 1TVNA 4GI8A 4D6CA 3WELA 1RH9A 2V38A 1V02E 2D0GA 3OLEA 1LG1A 2PWHA 3E1F1 1JD7A 3W6MA 3WMCA 5FL0A 1EDTA 3GH7A 3OZPA 1XYFA 4FLOA 1UOKA 4HA3A 2VVNA 5CGMA 4R27A 4LYRA 5GNZA 4B9YA 4QLLA 2WZEA 1OIMA 2JF6A 3PZNA 3HN3A 1E6QM 3LPGA 2QF8A 1JZ5A 2YOCA 1E6ZA 5IFTA 1OB0A 3ZJ7A 3AMCA 5FL1A 4WK9A 3GH5A 2Z1SA 2ZXBA 4CD7A 2O92A 3TA9A 3WUBA 1W91A 1KBKA 5BRQA 1SR0A 4CUCA 1J0KA 1ITCA 3MO4A 4RL3A 2W4XA 4J3WA 4WF7A 4D6GA 4P8UA 1HJXA 2G8ZA 2YL9A 1H1NA 1LWHA 3EDFA 3A6OA 1OT2A 2WNWA 4JFVA 2UY3A 4KGJA 4AZ7A 1J18A 3PZOA 2ZXAA 1MFUA 3IJ7A 2VNCA 4JHZA 4AIOA 1LF1A 1PAMA 5JIWA 6TAAA 1HKIA 2XTKA 5DMYA 1C8QA 5A69A 2AAAA 1BHGA 1C91A 3IAQA 4F79A 2BY2A 4Z2KA 4PUEA 1UH4A 4XB3A 4H8HA 3VIJA 3VMPA 2J62A 3WFLA 1G94A 1MYRA 1BVNP 3N12A 5LA1A 1N82A 4F9DA 4XZBA 4J3VA 3ARXA 4LX4A 3N9KA 1UKPA 3W24A 5IDIA 4Z2HA 1B3VA 4AIEA 3PZVA 2TAAA 3WD3A 5A6SA 2GK1B 4HOZA 1GOKA 3TTOA 4HMDA 3RIKA 3ZMRA 2Q8XA 1VB9A 4IPLA 3GNOA 3EDEA 3NJ3A 2XM1A 1ISWA 2DT3A 4BQ5A 3VX1A 1H49A 2VTFA 5ABFB 3WSUA 4TXEA 2ZX9A 3VM5A 1W1TA 4JKKA 4NRSA 2V3GA 5M03A 5A8OA 1E1FA 2Y4SA 3OGVA 3GBEA 1NARA 2Y5EA 1WDQA 2BHYA 1YQ2A 2WVVB 2EEXA 3VDAA 5I0DA 1E4MM 4NF7A 1D2KA 2E8YA 4AC1X 2WKLA 3PHAA 3FHQA 1KR0A 3VD5A 2DPEA 3GDBA 4DM2A 4DWSD 2WM0A 5BRPA 2QHAA 1XC6A 5KEZA 1UD6A 4E8DA 5GNXA 4MAZA 2WKGA 3BH4A 1V3IA 3IAPA 2MANA 1JZ2A 4AW7A 3WNNA 2XVKA 3VIPA 4FLQA 5E6YA 2WK2A 2X05A
chains in the Genus database with same CATH superfamily
1IEXA 3CUHA 4MVAA 1HKKA 2QNEA 2OO6A 4IP5A 4M6QA 4ZB0A 2DZUA 2NVAA 2ISDA 4HPHA 2YGYA 3GR8A 2W66A 1V3LA 3TJLA 5CPLA 3GZAA 4LVFA 1JXJA 1ZU8A 4WSKA 3EX2A 3WQ4A 3KBJA 1FWHC 3GG0A 3SCOA 4F66A 4H2CA 1K9EA 4LF2A 1V02A 4KWOA 2C6QA 1UD8A 1WB0A 2OZTA 2BXZA 4OV9A 2YLLA 4TX9A 1V7AA 4PTNA 4JTJA 1W8SA 5LNSA 1M65A 3EAUA 4Q7BA 3CAVA 4B3LA 7ENLA 3WQ8A 2YA0A 2HPMA 3CZEA 4TUFA 3CK5A 3GDTA 1EP3A 4C6IA 3WEOA 1QATA 4FEZA 2RDTA 4J9JA 1M7PA 4OECA 1TX0A 3BMWA 4M6UA 4YWSA 3W83A 3DI0A 5CZSA 2WV8A 5DMMA 1R2RA 2OGYA 3PK7A 5M1TA 4DVOA 3DIPA 1EKOA 4IPJA 3WLKX 3KE0A 4Z17A 1JXKA 2WKJA 4BEQA 1JDCA 3UGVA 1A4LA 3WMSA 2A2IA 3GXFA 2YA2A 4LOCA 3B8TA 3G18A 2YW4A 3WBAA 4MY1A 3KM8A 4AFYA 2CCRA 3CNYA 3NL2A 1YW1A 3ABXA 6TIMA 1L2UA 3G1RA 1RJRA 2PLMA 2H9AB 2KAUC 2RDUA 3IGXA 4AEFA 4AIBA 1XPYA 1AJ0A 2INFA 3CHCA 3GXIA 1BPLB 2ADAA 4XUGA 4HTBA 8CGTA 1M5WA 2ATMA 1VR6A 1BWLA 3UCDA 4HP5A 1R3WA 2I17A 1TTIA 3BSGA 2UBPC 3AXIA 2HNHA 1ITQA 3LPPA 2Z2UA 4KCUA 1RVGA 3MJYA 4AHPA 1Z48A 1AH3A 2Y6ZA 5H8MA 1E6RA 4RV8A 1A5KC 3DUGA 3H7UA 1BLIA 4NAEA 3W7CA 1J0HA 3BXWA 1OYAA 3KZSA 4L9XA 4AZCA 2ASHA 2WB5A 4EWND 4Q8PA 1EXPA 4BA0A 1V6XA 5EMKA 4MYXA 4UR7A 5DT7A 2XHYA 1D8WA 1YE4A 2NW0A 5I23A 3L5AA 3TN5A 2FMNA 4AG0A 4X2PA 2ESCA 4LRSA 4FLSA 3D3FA 3LQGA 1UR4A 2BS9A 3K46A 2J79A 5AYZA 3KTCA 1OZQA 4OUEA 2IPFA 3ARQA 3TOPA 3G22A 3II1A 2Z25A 3NG3A 1HFBA 5FF3A 3VKKA 3VDCA 4LUTB 1EQPA 3PZTA 4Y9MA 1EX1A 2QPXA 1TR1A 3FA5A 4IIHA 3KL0A 2AL2A 3PVFA 4MNKA 2J7CA 3WBWA 3QEZA 1F3XA 3QR0A 1JAKA 1TWIA 1IT7A 4NYUA 3VMOA 2XSXA 2D3LA 4ZGYA 1E1CA 1T0OA 4HNCA 3UWWA 4H9XA 1QPKA 2IQTA 4UCFA 1PX8A 4R7WA 3UXDA 1AVAA 4KWSA 1GNXA 4DAIA 3W4RA 1WKYA 5CAKA 3MSGA 3G0SA 1S5TA 1QUMA 2ZZ3A 3E3HA 3WEZA 4E8GA 7XIMA 2G3IA 3RCYA 3C0JA 1E56A 4OFCA 4UBPC 3GY1A 2HXTA 3N04A 3V16A 5GQBA 3KLKA 5CSYA 4B90A 1WBHA 4PTDA 4NAFA 3K4AA 1TQXA 1VFFA 3TMLA 3WBXA 2XFFA 1C90A 3DEQA 5AZ0A 1W8GA 4GINA 1E6XM 1FBAA 4G56A 4DJDC 3VCNA 1VZWA 1EFZA 1OX6A 2OQHA 3CQKA 4G1KA 3GHTA 3N2MA 1PZ2A 2E6FA 3NVTA 3GK0A 5DT5A 4C6FA 3FVDA 4FX7A 1XYCA 3IJ8A 4AD5A 2VQTA 3ZJKA 4W87A 5HQLA 3S83A 1A53A 1SJDA 1K9DA 3DC0A 1I9CB 3LLDA 5HDRA 1V51A 4D8LA 3NZQA 2J74A 4XAPA 1DIDA 3TFXA 5LXXA 1H41A 2FTWA 3AALA 3HZ3A 2QJHA 4RX0A 2X1SA 1TWSA 1XD0A 1HL9A 4DO7A 4LAOA 5BXPA 2VURA 2PRMA 4UR9A 3A13A 1KW1A 4EX4A 3W6LA 1XCXA 2AQWA 3VZYA 1X38A 4U5IA 2Q8ZA 4H6KA 4XBJA 2GSHA 4YS1A 3WUFA 1LT7A 2WNNA 4N9BA 2YDQA 4PFMA 3DU0A 5FF4A 3HGSA 3TK7A 3M5VA 2ZUNA 3KTSA 4MNLA 4KMQA 1FCUA 3PG8A 3AZSA 1UQZA 1O68A 2ZA2A 1NQ6A 3T08A 2V2CA 4AZGA 3AQUA 3FJ4A 3VIMA 4PN2A 4H83A 4LVAA 1X1OA 1KLYA 5HMEA 2VHLA 3M5XA 3NWRA 3HG4A 1FWWA 3UQNA 1KM0A 2CBJA 5C2CA 1OHLA 3PTMA 1XH2A 3QW3A 2VXNA 1H2JA 1BQGA 3QJAA 4CQCA 1WDWA 1UKSA 4ILSA 3KEHA 2PDNA 5CSUA 1V3KA 2VYOA 4O52A 3HG2A 1P6WA 3KVMA 4OU1A 3GKAA 4GVHA 5D33A 3T9PA 4JFUA 1Q2SA 4HMNA 1CGTA 1R3SA 3DG6A 2VUNA 5G4HC 4K8HA 1SPQA 1XLLA 3QTPA 1EEPA 3ARYA 2J8GA 3GWQA 3W2KA 3CJPA 3F4VA 1KRMA 3FSTA 3JU2A 1MZRA 1QBBA 4HA4A 2HVOA 4GGHA 4I9JA 4CU7A 1ICSA 2RGMA 5BXSA 4NILA 3MUAA 2V5LA 5AC5A 4GCXA 3WH5A 2W3ZA 4QJ1A 3BAWA 1BYAA 3GIQA 2BY3A 1AH4A 1ZB5A 4DWDA 4RR4A 4BWLC 5C9ZA 3NFUA 4AUBA 1Q7ZA 1QMLA 4JTRA 3CWNA 5DO8A 3QM3A 4U3AA 4JIHA 3UXLA 4PCFA 1U83A 3KOXA 2G0WA 1Q6RA 1J0IA 4P7OA 3HTWA 1B3WA 3WY1A 1X6NA 3MT1A 2WBGA 3W1UA 2BP1A 4B5UA 2GDUA 1E4LA 3VI2A 2VQUA 1BG9A 1TWDA 3E38A 4E2OA 1DXEA 1VEMA 4HCDA 1A5AA 3VD7A 1OCJA 1WDSA 3W38A 3NXLA 1PX3A 2OZ3A 1S2AA 4M7SA 4B5VA 1WDDA 3N2OA 1PCKA 3UYCA 3E0FA 2Q71A 4ZQOA 2QCMA 3OEXA 1E51A 4WGXA 3PP7A 1R85A 3QPZA 1WBJA 5LNRA 3RPDA 3L0GA 2YDSA 4I3GA 4GE8A 1KFBA 1JFHA 1SUXA 2B0MA 3DHUA 4KEMA 4PYSA 2X2GA 4QE5A 4GO8A 3N4EA 1N8WA 1ME7A 1BVWA 4MHBA 2B31A 1M03A 2Q3RA 3R25A 3TYUA 4CU8A 4UOQA 1NDWA 3OLIA 3C2VA 4ZQCA 4WIWA 3MUZ1 3VD4A 1XG3A 2ZXQA 4UQ9A 2BV9A 1Q6EA 3B05A 1PTGA 3P81A 4GIAA 1E1EA 1LOSA 5FA5A 4IPNB 4LU0A 2CIPA 4Q33A 4BK9A 1GVEA 4GFIA 2D1ZA 3WBEA 3Q65A 3TJXA 3VCRA 1E70M 4YHGA 1FP8A 1V77A 1LRTA 2RJGA 4KF1A 1F61A 3CIVA 2EQDA 2FJUB 2OB3A 2PDFA 5REQB 6XIAA 2BASA 4LF1A 4AZBA 2ZX8A 4ATDA 4BQ2A 1MW3A 4DQWA 1DHKA 2QVHA 2H8XA 3PJUA 3EOEA 4M3PA 2ZUWA 2RH9A 1IIGA 3LLXA 2D23A 4AY1A 2WVTA 4UOJA 4IOTA 1KTBA 2FJKA 3S2CA 1A49A 5CJ5A 1ZALA 4CQDA 2X1UA 2VENA 3WDJA 4CQAA 5JU6A 3BSHA 4IICA 3WKZA 4RE4A 1XYBA 4D6HA 2Z7GA 1SU5A 1OY0A 3SCRA 2YDRA 2GVEA 2D2OA 4ASTA 1HGYA 3TTEA 4A8LA 2CU0A 1W5MA 4N02A 3LYEA 3TNOA 3MCOA 2ZKMX 2D22A 3T2PA 3ZO9A 2OPJA 3AYTA 1QPOA 2OWCA 3EKLA 5ABHA 4YTRA 2B7PA 1D3GA 3P67A 1RCXB 5I3FA 3BGJA 5A6AA 2XG9A 1ZGDA 4IG2B 1A0EA 5EMJA 1H3GA 1YNYA 4QBXA 3UP8A 2XFYA 1F07A 1XH1A 3WNOA 4R7OA 1YTEA 2NXIA 2WZHA 1E55A 3WDQA 4PMUA 4UFHA 3TW7A 1NWUA 2EG8A 3GG8A 5XIAA 5BU6A 4CNSA 4MM1A 2H9AA 3RMJA 4JTTA 5HUOA 1QI0A 2PC4A 4N6EA 3IUIA 1GJWA 2Z2BA 4M0XA 2P8CA 2DZPA 2QV4A 1EIBA 3ALFA 3QV7A 3IVTA 2GJNA 1H11A 3QMSA 3UYIA 4K8EA 2EF9A 4N9CA 3S9ZA 3O0FA 3M44A 4DBUA 3FEQA 4K36A 4JKMA 5D9MA 5AYYA 3I68A 1NFBA 3C52A 3N73A 4WRHA 2ZIDA 4JTKA 2PWGA 4OV4A 4XO6A 1ISXA 4DF2A 2XFRA 4CCZA 5KTLA 1CDGA 3WLOA 1XFCA 1Q13A 2X16A 3SSZA 3KBSA 4LY8A 2V2DA 4L1GA 1SO3A 3TQ0A 1TZZA 1YRRA 1RUSA 4H9MA 3DERA 5G1YA 3AYRA 3RJYA 3WK2A 1X7FA 3E0WA 4E8CA 4GQ0A 7A3HA 3NPXA 1PZ0A 3BLOA 3MUIA 3CGTA 1F3WA 3DFNA 3SCPA 4ZOBA 5AY7A 4L9ZA 3N6QA 4QLKA 1ZJHA 3OQ8A 4LUTA 1LG2A 3RJXA 3B4YA 2GSJA 5FEXA 5KMYA 4LNYA 1V0KA 3ANUA 1ZAHA 5EL1A 3N29A 4MB1A 1GGOA 3EDKA 3TTSA 3VGEA 4AZ5A 2OFJA 2Y1HA 3BOLA 3C0QA 3THAA 3L4ZA 4Y8FA 4BF9A 1XIFA 3A9BA 5JMUA 3KBVA 3OGRA 5A2BA 1C29A 1FDJA 4XIMA 2BFGA 4Y9AA 3EZ4A 2NT0A 2ACQA 1M7JA 3C8NA 3W73A 1U5HA 2X1TA 1N55A 3ABSA 3PBUA 3V5OA 4L9YA 4AXKA 5FSDC 4AF0B 2B81A 1W3JA 2J7DA 1R6WA 1EJWC 4DHGA 3PZMA 4R3UA 2P0IA 2XIOA 2PDYA 2OT1A 3M7SA 2V30A 1TCDA 3GC5A 1WPCA 4PCSA 3V5CA 2W63A 1QCWA 1FP9A 3MP4A 2V5BA 1XR2A 3WF4A 4TR9A 1MQRA 3HO8A 3V1PA 1EZ2A 3UESA 4PRTA 4H41A 1XIGA 3NYZA 4OBTA 4ZQRA 4IPIA 2JGQA 5CPOA 5TD4A 2HPIA 3N11A 3CHEA 2XH2A 4IIGA 2ZADA 3S6TA 4A8IA 3W7KA 1KWGA 4R34A 1R3VA 3FW6A 3WDHA 5IOBA 1GOQA 3P3BA 2FH8A 3NQVA 4FK9A 1GVRA 2VGBA 5GJNA 4I8YA 1OD8A 4MB4A 3SADA 1HJUA 1KCKA 1J11A 1ZS2A 4RDYA 1HKMA 1CXKA 2J13A 1Q45A 2V3DA 3CBWA 1WAWA 1T6MA 1X1NA 3GTHA 3W0KA 1AL8A 5DFAA 2PFHA 3KRSA 4GYPA 4H7ZA 4N0RA 4F2BA 1HW6A 1XCFA 5D05A 1EJSC 2BVTA 3KRBA 3PANA 1AFSA 3CZJA 1REQB 3KDNA 3NVDA 7REQB 5HMFA 4GI6A 4PRWA 4MDPA 3L4WA 1MDRA 2OKTA 4YPJA 1DE5A 4GKTA 4C6BA 4Z1AA 1F4AA 3LHVA 3ZJ8A 1XRSA 1O95A 1Q6GA 2VL4A 2VRQA 5DMLA 4AX6A 4H9YA 1B54A 3AS0A 5K3VA 3HQ1A 4C5YA 1ZBCA 3EBVA 3WFAA 4JTGA 5T9CE 1E0XA 1PSCA 2HEJA 4K6AA 2OODA 1XQLA 4NZ4A 1DJXA 3OB8A 1I2RA 4O1EA 2CLPA 3IGUA 4UNLA 3M46A 2VZSA 3WJYA 5LNVA 3NPUA 3MUCA 3NDZA 4PMRA 2DVXA 4LGXA 4NZ5A 4H8UA 1J8VA 2PURA 3BURA 2HTMA 4PTWA 1MDLA 3UPBA 5I6SA 3UWZA 2XWDA 2DW6A 2DH3A 1GYMA 3MU7A 3N4AA 3LTSA 4MPQA 1RJPA 5A94A 1EH9A 2PWFA 1TRIA 2O7SA 2FVLA 1EC9A 2NQ5A 4JS3A 1I0DA 1XI3A 2AQOA 4G7FA 3OA5A 3BWWA 4KWWA 1US2A 5LHFA 3O3RA 1GOMA 1W1VA 4UQBA 1T5AA 2OOGA 3LD5A 1P1XA 3I4KA 3W85A 1HO4A 5AHLA 1E15A 3TC6A 2OSYA 1KFEA 3VIGA 1H61A 1SO4A 2C79A 2EG7A 4JX6A 3IJLA 3UCCA 3O6DA 1H1ZA 5A2AA 4M81A 1JNDA 3LBOA 4F4RA 3JVAA 3SZ8A 4NSBA 2A4AA 3W84A 4ZMGA 3S1WA 3LV6A 3MZ2A 2ZZ2A 1HGWA 1YDOA 1DV7A 4JN7A 2V5KA 1X6LA 2CXEA 4R5EA 4ICCX 2OLHA 4LUIA 2QDGA 2CW6A 4U33A 3LN3A 4LS1A 3H26A 3LOTA 4CD5A 3IRDA 2OLSA 4PTMA 2WJZA 4WQ6A 3L2IA 4KRZA 3W7IA 2GLKA 3QOMA 1L6SA 2QULA 4OGZA 3EA3A 5TF0A 4FR1A 3N19B 3CPUA 3TSBA 1H5YA 4P5UA 5LGZA 5AB3A 2CBIA 4X0NA 2O9RA 3LY0A 5A2CA 2YL6A 1H0GA 1AD1A 3Q45A 1F6YA 1FWRA 4NHVA 4HZ7A 4OOZA 1OC5A 2Y89A 3SQMA 5C8BB 4IX2A 2WZIA 4JD4A 3TWAA 1VKFA 5LNUA 3OLDA 3AO0A 3M6YA 1W5QA 3JW7A 2XSAA 1KR1A 3F4NA 4ACYA 3MP3A 3A4JA 3VILA 2J47A 4QSHA 4IF2A 2VWSA 3HPSA 1UASA 3D46A 1CPUA 3AIRA 5FAJA 2YB4A 4FHAA 3T05A 2PF0A 1YXCA 3GXNA 3C2RA 3M9YA 5DN1A 4U5KA 1UYQA 3PBMA 4H6RA 4BF7A 4QRNA 4DO6A 1W1YA 4Q8VA 1W3IA 4FF5A 3EWYA 4NJKA 4DBEA 3A23A 4K68A 4DN1A 3VE7A 1OJXA 2WSYA 4O53A 3IV3A 1A4MA 3E02A 1HL8A 4UTFA 3LBCA 5CCZA 3ZLGA 1MEIA 4F48A 3TU9A 4DZHA 4HHMA 5REQA 2UY2A 3G8RA 3K4DA 4J4KA 1UD5A 1BSIA 5FCZA 2Y8UA 3BZGA 4CEUC 4E0CA 1YXDA 4GQQA 1TJ2A 5LNWA 3OQEA 1AH0A 2J6XA 3VNJA 3WLIA 3WLQA 4W4QA 2GL5A 2IW0A 1C9DA 3ICJA 3WLSA 2F84A 1XQKA 3SRDA 3LZ5A 1GW9A 3MI3A 5JBEA 1UHVA 3R5EA 3NAVA 1W1B1 5JVLA 2VZTA 3BUVA 3GBDA 3NQ6A 1HT6A 5CEWA 1NFGA 2ANUA 3TJ4A 1TTJA 4KCVA 3E2RA 4RZ5A 3K13A 1TRDA 2QYGA 4XUYA 3RMEA 3G6MA 4LJ3A 5BWFA 2C19A 3EWBX 2YFOA 3SIMA 4HA1A 3PZUA 1OYCA 2CHOA 4EPKA 1FOBA 1Q6DA 3BW4A 4PSRA 4A35A 3ZWTA 5M2FX 3W26A 4C6NA 4PSPA 4W84A 3M0LA 3VXGA 4F2TA 5C70A 1UPPA 3P14A 1RVKA 2E25A 2YIHA 5IM51 1RJQA 3OBAA 4Q7NA 4IG2A 3OVPA 3LCWA 1EA9C 1SFLA 5BXTA 2PPGA 2PC8A 3HQNA 8RUCA 4L61A 4HNLA 3ONBA 1HJSA 1KV5A 3V3WA 3O2LA 2NQLA 3LI0A 1VEOA 1CYGA 1JYWA 1EA0A 1CENA 3ZS4A 3S4TA 1E0WA 1EHAA 3OHMB 1AJZA 2ZICA 2BXYA 4MYAA 3VNLA 2BVWA 4R85A 1WUEA 3BAJA 4DJED 5LKYA 3TJIA 2V5DA 2DFAA 1G5AA 1HP4A 2ONEA 2GQ8A 3WD4A 1WOBA 4HCLA 1NIUA 3AIWA 1E72M 4I7VA 4XAFA 1HZYA 3FXYA 3XISA 1AQHA 4WLCA 2DIKA 4YVVA 2YCIX 2R14A 2C18A 2Y8KA 3W72A 3ES8A 3WQWA 1V03A 3ZR5A 1B90A 3GDRA 3PPHA 3DXIA 5I5RA 1XYZA 1VJSA 3L7RA 3TYEA 2FFIA 4GI4A 3DYMA 4ZFCA 1MO0A 1R86A 3OVRA 3NSNA 1XGZA 3L2MA 3AZTA 2VR4A 4V1YA 1ESWA 4C6CA 4F0HA 5FKYA 4LC8A 4M1RA 3GU2A 3MDWA 4FXJA 3AIBA 2E0PA 1OFQA 3I65A 3DHFA 1JD9A 2WVUA 4UTTC 1DVJA 3AS2A 3MKKA 2C0AA 4PR4A 1YE6A 2E7FA 3IWPA 1FH8A 6ENLA 3VKCA 4BJHA 3N3TA 1PZ3A 1YLVA 4A3QA 2TPSA 3USBA 1GUVA 3CMFA 3MJMA 4CGTA 3UU0A 1K9TA 1KKOA 3FA4A 5BOFA 2E9BA 3ABOA 1HUVA 5HMSA 1TPH1 1SFJA 3HMCA 1TE1A 4Q8UA 5AHFA 2OSXA 4FOKA 3SN0A 2LLEA 4AIUA 3BCDA 3BL3A 1V0MA 1UR2A 3QFWA 2VZOA 3GXTA 4IIBA 2KX9A 4F0KA 3B9NA 4CCDA 3L4XA 3KP1A 1UP0A 3E5BA 1PXGA 1CI1A 3AXXA 1WZKA 3UJEA 1GZ1A 1VRDA 2PTZA 3VDHA 1KM5A 3S8HA 4NI3A 4AF0A 3OZYA 1XIIA 4MB3A 3WQGA 3DOPA 5LIWX 1A5MC 3LSBA 4DJFA 4EWJA 3LCXA 3G77A 2FQIA 1ZP4A 4HJWA 2YXOA 1RA5A 5AHNA 3OLEA 3MYOA 2PP3A 4LS2A 3PFMA 3ME3A 2NLYA 2V67A 2VGGA 1XLMA 4JX5A 4ZL1A 2XIQA 3WMCA 4DF1A 1EDTA 3KBWA 5EMUA 2VEGA 1XYFA 3MC5A 2YBVA 3CAQA 1U22A 1A5BA 1K8CA 3LCIA 3RF9A 2H90A 2W0UA 3ITYA 1E6ZA 5CAHA 3H53A 3ZJ7A 3S9IA 3AMCA 5BRQA 4CNOA 4RLIA 3T81A 1Q63A 5E0KA 3S5SA 2W4XA 4P8UA 1IXNA 4RW3A 2GUBA 4QG8A 4YTTA 3EPNA 2GSEA 2WNWA 4JFVA 5U4NA 1J18A 1MFUA 1XYMA 4QE4A 3IPWA 1LF1A 4G5DA 2I57A 4MWAB 2TYSA 3W1RA 4ROQA 3RAOA 1TKKA 2EGZA 3R11A 1VFSA 4ML9A 4F79A 3PPGA 7REQA 4Z2KA 1REQA 3GR7A 1WXYA 3SY8A 3KAOA 3JZEA 4BEUA 1A5LC 3N12A 1TWZA 3AU2A 3SJ3A 1VP5A 1KA9F 3OVGA 5D2VA 2QCLA 4E6MA 2WJFA 3N9KA 1NSJA 3CU2A 4LWWA 1UKPA 3W87A 4Z2HA 2TAAA 1SZFA 4JTUA 2GK1B 3GUWA 1XBYA 1FWSA 3RIKA 3ZVHB 4IPLA 1US0A 3GNOA 1Z8AA 3ATZA 1K77A 2DT3A 4BQ5A 2FIQA 2VTFA 1K7FA 1V93A 4ORIA 2ZX9A 1VPXA 3C61A 4MF4A 3C3UA 3OGVA 3U2OA 1YQ2A 2WVVB 3B4UA 3HGOA 4HYVA 4HPNA 4HU4A 2J9ZA 1D2KA 1H51A 4HNNA 2PAJA 1MI3A 3D47A 2ZZ4A 3W7LA 2WM0A 1PB0A 4GH3A 4B5TA 3R0KA 2J27A 3G0UA 5EA9A 4MAZA 1O5RA 4MZYA 1V3IA 4LAZA 2MANA 1BXNA 1G7VA 3OOQA 1PZ1A 2REQB 1JCJA 2ZQ0A 3TSMA 4FLQA 2X05A 4H9TA 1FQ0A 1E3XA 1XGDA 1C8XA 3T44A 3N2BA 5HPCA 1UQYA 1RY8A 3OODA 3P8IA 3RYSA 3O06A 4Q4KA 4Q4PA 3FDGA 4IIFA 3TROA 3LMZA 1B57A 1B3OA 2DP3A 2BY1A 3PZQA 4W86A 1GVOA 2ODOA 2QDEA 3T07A 4NZFA 3P62A 3U7BA 1FDYA 3MBFA 2XZ9A 1FWEC 3DBNA 4ES4A 1JIBA 4XZLX 1PV8A 3OG3A 2GJXB 4CN1A 1S2CA 1KLZA 2OCZA 4GVIA 1P43A 3B8DA 3LHZA 4PMDA 1QFEA 1A5CA 1CWYA 3VVGA 2PWDA 2VR2A 1S2WA 1UOZA 2YBTA 4M1BA 1SVDA 1IZJA 5A6LA 2H8ZA 4GA8A 1DTNA 2WSKA 5F4SA 4JKLA 4MDOA 1YADA 3P8JA 3TTQA 4ZE5A 4ZCWA 4V1XA 4DRSA 1DHPA 5AC8A 4DX3A 1UWTA 2NX1A 4IMGA 2PD5A 5A95A 3BQ6A 1MW0A 5C7HA 5A6MA 4EOUA 3UR8A 4JR5A 5A5WA 1ZTVA 1WDRA 4PUJA 3I7QA 1HJWA 4GY1A 2QS8A 2CLMA 1GPFA 3V75A 1J2BA 2OWXA 2DZAA 4IQLA 2CXGA 4Q22A 1P0KA 2SFPA 3A64A 2JKEA 1SZEA 4UMAA 3LCFA 4XZMX 1RK5A 3RGTA 2RAGA 5KITA 2C71A 2PBGA 1L9WA 1QK0A 3VK5A 3ZYZA 1TPFA 3HFTA 3WQFA 4FPSA 4IMFA 1RQEA 1EUAA 4A21A 1ZBVA 2R9RA 4N2YA 1WUFA 1EOKA 1AODA 5A3HA 5I3DA 2EBNA 1HNYA 4KEVA 1EPVA 3FYPA 1SW7A 1HKJA 2AMXA 3BG3A 1CBGA 5MHBA 3NQFA 3OG2A 5A6BD 3AYVA 3EDJA 4PMQA 3CQHA 3W7JA 4O4WA 3GHUA 1AMKA 4JBRA 2BNJA 3W7NA 3B0YA 1M53A 2E9MA 1UMLA 2NV2A 1JRBA 1HVXA 3VINA 4I90A 3IJ6A 5D9PA 4NX0A 4X63A 3SR7A 1DYSA 3WK0A 3PUDA 3LGDA 3PBGA 4XBSA 4ZO9A 4ZTYA 1WKEA 3IK2A 4GH1A 1T7LA 5CJNA 3FSUA 1QTWA 1V6TA 1NVMA 1UWSA 4B5WA 1W9PA 4QCEA 3W86A 2DU2A 5K9CA 1A0CA 5J04A 3MUXA 1GQNA 4GYFA 1KV8A 3L5LA 2OEKA 1CXHA 4B2DD 2NXHA 1MW2A 4XQ6A 3N1AA 1GQKA 1LROA 4F40A 1UKQA 4HSHA 5TIMA 3KRUA 2G50A 1G0CA 3EEGA 4J2MA 1TVLA 4JNZA 2V8ZA 3CHFA 2UV8G 4MGGA 1QOQA 4BR1A 1DIOA 2XVPA 4KERA 4WJEA 2YL5A 1XKYA 4S3AA 3B8WA 4HA0A 1RXOB 2Y85A 3WNMA 1ONEA 5FF2A 1BRLB 1W0MA 3CPGA 1I6NA 3NUKA 5FJTA 1K4GA 3IIXA 4M6VA 1GTHA 1YBQB 3SCTA 2PDHA 3V0SA 1NAL1 2VWTA 2G97A 5AKQA 4PTVA 1XSKA 5A1AA 3SUTA 2FB3A 1BWVA 3WNLA 1OFPA 3Q58A 4YXGA 4EACA 3LHTA 4IJCA 4S1FA 2RHGA 4WOQA 1D7FA 1EO5A 3BJFA 1AZ2A 1CTNA 2OU4A 4S3DA 3F1QA 1XUZA 3G8EA 3KUMA 4JEJA 3AMDA 3NQ7A 3MYPA 2WMGA 3ZT7A 4IGMA 4FNPA 5E70A 2NV1A 3WF3A 4Z42C 1I2NA 2I16A 1S5MA 1PIFA 2VC9A 3UCQA 1Q5MA 1B5TA 5D4YA 1LCOA 1EGMA 2ZC8A 3WD1A 5HATA 1P48A 3H54A 1EZWA 1JDEA 3CZLA 5I3KA 2XM2A 3W2MA 4CLMA 4F0RA 3BLKA 5A8PA 3ABQA 2YLAA 4Y9PA 1UZ1A 3UG3A 2DZBA 3QZ6A 1LL6A 4D6JA 5ABGA 1NQKA 3N6JA 3V0UA 3CM4A 2OVLA 2ZRXA 1DJNA 3VX0A 1HIZA 4J7RA 3DZ1A 3HF3A 2OYMA 4XSLA 1VQTA 2ZDSA 4A3UA 1RD6A 2ZX6A 1HVQA 5A8MA 2DSWA 3L0KA 3B97A 3WD2A 5DMNA 1KM2A 3EB3A 3RO6A 3L23A 1FKXA 4GIRA 1OSEA 4C7FA 1QI3A 2EO7A 1B2YA 4QFUA 4O18A 2NLIA 3BAKA 4W7WA 3L67A 4RZ6A 5D9OA 4Z08A 4Z2IA 3LMYA 3LRLA 1DJIA 1VYRA 3CHDA 2ZDRA 1WZMA 4HB7A 1SQ7A 2QCCA 3EOLA 4KFOA 3BK0A 2PP0A 3C2EA 1SFTA 5ENLA 3STCA 2IXVA 4E5TA 1HX0A 3IJIA 2OGJA 3TCSA 2BVDA 3PJXA 3V4BA 3B04A 4QIUA 2HBXA 4XD4A 2PP1A 3MMTA 3UWQA 3RILA 4MJ4A 3MW7A 2JEQA 1XRVA 1GG1A 3M0VA 7PTDA 2WNZA 3S1UA 4R53A 1H4PA 2IPGA 3AXMA 4QS6A 1CXEA 3NQEA 1ZAIA 4A8RA 4GPNA 2GFTA 2ZTJA 3HPXA 3MSRA 4MWAA 3UR7A 3VOGA 4GGBA 1TO3A 2D3NA 5I03A 3U2CA 2A3HA 3ITXA 1NP0A 4DPQA 1ISVA 4DBDA 4HZMA 2PEVA 2I7GA 2ALRA 1XRFA 2YFNA 2E40A 3S2NA 3M5YA 4K2SA 1U1HA 3CL8A 4YHEA 1ZENA 5KZDA 1R2TA 5FSEC 3BW2A 4L65A 3GC2A 3RCNA 1Y5WA 5ABEA 2ZZ7A 4ZQPA 3DFPA 3AC0A 3REQB 3VIKA 2UY4A 1HN1A 2GK1A 4DWSC 4EKJA 3K8MA 4YTSA 1XICA 2CLHA 3QC0A 3ZVHA 3AIEA 2YX0A 4UR8A 1DWHM 2YXGA 3V5FA 1G69A 4W8BA 4JTSA 1W2VA 4MY8A 2CPUA 4IMDA 4PEKA 1EDGA 4HVXA 3R43A 4GJIA 4DM1A 5I78A 2FZDA 2XSBA 2VFIA 6XIMA 1EUNA 3RG6A 2Z29A 3E74A 4NJHA 3L12A 2WVVA 4TTUA 2HK1A 1TV2A 3K1DA 3IGHX 2D69A 7TAAA 1V79A 3QPYA 4IFOA 3RX3A 3W7EA 4JTDA 2FYMA 4JIRA 3B8IA 1R7AA 3KS6A 4O1CA 3WJXA 5EGRA 2VRJA 1XYLA 3RO8A 4O1FA 3CZKA 4IQEA 4A3RA 2Y2WA 4LXFA 4NP7A 2D73A 4R9XA 2X2YA 3FKKA 4D8AA 1UA3A 2QCNA 3C2YA 2REQA 3BSMA 3NM3A 1V8EA 3W70A 3WLMA 5I2UA 4GY0A 4S3JA 3TZNA 8A3HA 4QM1A 1VBJA 3ZLHA 2PTYA 4MMWA 4XZNX 5CC7A 2BGNE 4IX0A 2OEMA 5C6MA 4B16A 2VFGA 3W2LA 2YL8A 4ENLA 3A22A 1ZCCA 4MKSA 1TPVA 1H7OA 2PS2A 4IMCA 4EANA 1WO2A 1LQAA 4KEZA 4F9JA 3L65A 5H8PA 2CZFA 2V0TA 3W1PA 1FFQA 3F5KA 3NZPA 1SO6A 2VR5A 5DXYA 2GJXA 4ERAA 3AIQA 2X41A 3S42A 1UIPA 1ITUA 2E77A 1TWWA 3AS1A 1Z6KA 1UKTA 3DYOA 4FNRA 3UJFA 2PLCA 4IFKA 4FXRA 3OP2A 4L64A 2Y7DA 1KM1A 4H19A 1NJJA 2WC7A 3NEVA 2GPTA 3IIOA 2C8NA 4XWUA 2A3AA 3GG7A 5J5DA 3EGJA 3AUOA 3GVGA 4MFEA 3EDDA 3VNIA 1B4EA 3WQOA 2GVGA 3L9CA 2R82A 1AMYA 4JGDA 3M41A 3GM8A 2ISWA 4NT0A 4PCNA 5GJMA 1KRAC 1GKRA 3W82A 1IXOA 1XIHA 2XIIA 2E4TA 3LDVA 3STGA 5JBDA 3RCMA 2XJ7A 5AYXA 4BQ4A 4NVTA 1S39A 5D8ZA 3LCGA 3AS3A 3GNXA 1SFSA 3EWZA 1XP3A 3W7GA 3VE9A 1BTCA 2DW7A 4W5UA 1P0EA 2XUCA 1R87A 1A3WA 3AICA 3R8RA 4KPLA 5LIYX 4WOZA 2CLKA 3WQ5A 3VZXA 5LYRA 2Y5SA 1KB3A 3KHJA 2YXXA 1J0JA 1CLKA 3UJRA 3VD3A 1MUCA 2WC4A 1VBUA 1Z32X 3W00A 3PY2A 3UJ2A 1U5JA 1OADA 4J3ZA 1Q65A 3G1YA 8XIMA 1J6PA 2C0HA 3ABZA 1JPIA 4FMVA 3D0CA 3MKCA 4Z2JA 1Q4NX 1QWKA 3WQ6A 4DUXA 1WP6A 2J25A 4AYGA 4FXSA 5KZ6A 4LEQA 2YCJA 2ZZ1A 1V6YA 3ZSSA 1U1UA 3R10A 3RUBL 3H12A 1CB2A 2VP8A 3QFEA 2B7OA 4Q32A 2ZX5A 3ARZA 2NQZA 5FEZA 1XCWA 3TV8A 1JGMA 5IFPA 3UY8A 1WXZA 4Z1YA 4GBUA 1ODZA 1YIXA 1JCLA 3F5LA 3SURA 3P93A 5I07A 3WLJA 2P50A 4ECLA 3Q4DA 4WKAA 1O1HA 1EX5A 3O6AA 3NZ1A 1E4IA 3IIPA 4AX7A 3U4FA 1CT5A 4NZJA 4EIVA 3B0PA 1EJ7L 3NPVA 2QUMA 1CXLA 1JCYA 1RQHA 3MVTA 1VS1A 4AMCA 4QJ5B 2HS8A 3V35A 2ZYFA 3G24A 4HNTA 1GONA 3NXFA 5D37A 4TMBA 1F7BA 4X0VA 5DY3A 2OX1A 1TPDA 3H2CA 3OBKA 4GISA 2NQHA 3T0AA 4JX4A 1XHGA 4K7YA 3GVVA 1V08A 5CPMA 1EYEA 4ZR8A 3S5ZA 4XZHA 4LAKA 3LTPA 2R6OA 3GFXA 3GQYA 3MSDA 2YPIA 5MKGA 3C56A 4AD0A 3HOJA 2ON3A 3OZOA 2J7BA 4Q8NA 1NWSA 1TVPA 1VF8A 2AAMA 4HU8A 4RDVA 4GNJA 3SCWA 5HJYA 1BRLA 1EWEA 3RU6A 4UFLA 4WDXA 3WQCA 2VT0A 4HMCA 3CV2A 3O63A 1YBQA 1G4PA 1JUBA 5LZLA 4WY0B 1NDVA 3U3HA 2NQ9A 1VPYA 4PMOA 3O1NA 1L6FA 1EOMA 4YVXA 4NJJA 4Z0JA 4I8DA 3RDKA 3BJSA 1IT0A 4JN8A 1Q6CA 5L6UA 4EE9A 3GYCA 4NX5A 4KKXA 1W3LA 1M01A 1LM1A 1W5NA 4S3BA 3WLNA 1ZBKA 3M7WA 1XF0A 2GVYA 3G1SA 1CXIA 2E1DA 1EBHA 5DXXA 3BLFA 3N2XA 4DJDA 1KKRA 2Y8VA 4OE7A 4R33A 4MIMA 3EWXA 4CD4A 3HV8A 4PMJA 3GAYA 3M0XA 4GOAA 3KL3A 3TN4A 5E1QA 5FJOA 3OIXA 3T40A 4HSOA 3TH6A 5LA0A 3LNMA 4QHRA 5PTDA 3HG3A 1SR9A 1A50A 3O07A 1PPIA 2VUYA 3A4XA 4OBRA 2CKSA 2R1LA 1R2SA 5H1WA 5CGQA 1R9XA 3VYLA 4LUYA 1VFHA 5JIPA 5K9DA 2J9XA 2QCEA 4H01A 1KTNA 3CS2A 3NQ8A 1BQCA 4GZJA 3W23A 1GYLA 4V15A 2VO5A 4Q8TA 5LA2A 3VDGA 3WF1A 3H2EA 4XZIA 3PF3A 1XWYA 1X98A 3TNBA 2YSWA 1XLEA 2ZWZA 1FXQA 1BF2A 2V68A 4LYPA 4XV0A 4UFMA 1TUFA 1ELSA 4O11A 2VEPA 2WANA 1BAGA 4HPGA 1H7WA 3FNDA 1XD1A 4GUIA 4G6CA 3RNDA 4GXMA 2VFFA 1IEWA 4K1WA 1RCQA 1DXIA 2ZRUA 4XK2A 1XDMA 3P84A 3UNTA 3Q37A 3OGSA 3AWNA 4BY3A 4IH3A 2XIMA 3LGGA 5B7ZA 5HOSA 4GXPA 5EYWA 2BHUA 1OF6A 3FFSA 3U4AA 3PWGA 1SSDA 2BZNA 1EJUC 1T8XA 3EMZA 4FP1A 3WBYA 1EXBA 3PG9A 3ZXWA 3TA6A 4NI8A 1LT8A 1UCWA 1G1YA 1OIFA 3TN6A 1AL7A 3IK4A 3CUFA 1CGUA 4AAJA 3UZ5A 4QTGA 4UTUA 1QJWA 1V3MA 3UXAA 4MSSA 4WZHA 1TJ0A 3SCVA 2VCCA 4IZGA 2YBUA 5CPSA 2Y7GA 1NH6A 4QDMA 4O0KA 4M24A 1DJZA 2PZ0A 1CEOA 1C8YA 4Q8MA 5C9UA 1BGAA 3NTYA 4M80A 3HURA 5FI8A 1RBLA 1QNPA 3VD9A 5C55A 3RPTA 2YJQA 1OX5A 4QAIA 2YB1A 2JEPA 4HQVA 1TMHA 3GIYA 3AAMA 4LANA 1WXJA 3ARVA 5BMXA 3LLFA 4CD6A 2E9LA 3B9DA 2PTDA 5AOUA 5D03A 3QH2A 4PB3A 4U3CA 3REQA 3WYZA 4BWLA 3P5YA 2WPGA 3E2SA 3LUTA 3KVJA 4HK6A 4KESA 5DLCA 2QR6A 1BG4A 4RW5A 1GKQA 3PUOA 3VOCA 4CNPA 2OTDA 2D24A 1J0YA 3PZGA 2Y62A 1WKDA 3TOYA 1HJVA 5CC3A 3DAQA 6ALDA 4XAZA 5CLTA 2Y7FA 3W22A 3A9IA 4PBEA 5CQ1A 3HPZA 5D09A 4ZXLA 4J3SA 2FGBA 1YNPA 4UTHA 3EX6A 3CUXA 1O7AA 1D8CA 4E2VA 4I6VA 4ZE4A 4W9TA 3T42A 3WK1A 2Q3OA 3TXVA 1N7KA 4MG4A 4AMAA 3SSJA 2BGQA 4S23A 3ABRA 3GDMA 2VX7A 1VHNA 9RUBA 3UZJA 3P60A 3V1HA 3ARWA 2DVTA 4JCMA 2IUZA 5EY5A 5HA7A 1A5OC 2OMAA 4M5PA 4X9SA 4B5NA 3BCJA 4LVDA 2HRWA 3NL5A 2NVCA 2MUCA 1POKA 3F2BA 3ZT5A 3ZIZA 5BNKA 4HN8A 3MWCA 3NZRA 3CMJA 1MEHA 1IEVA 4A2RA 3D3AA 1D3HA 2WHLA 4WGHA 3BG5A 2ZXDA 1O5KA 4AZ6A 2CLFA 1EGVA 1DE6A 3RFAA 4QE1A 3AHZA 4U2ZA 2P0OA 3IVUA 3OO2A 4AVOA 3UFYA 2G3JA 3GG1A 1TIWA 4C7GA 3UVAA 4P7NA 3EOSA 2WYSA 2OYKA 3ITCA 2GGEA 2GWNA 1VJZA 4ZZ9A 1T96A 2HSAA 3D5HA 1B9ZA 3SUVA 1W3NA 4HN4A 2FDMA 4RJEA 4H1ZA 2VOMA 3AXKA 4PZVA 3EEZA 1GKPA 3IIZA 3IS4A 2OWWA 3UWEA 2Z2AA 3DESA 3O8AA 4WJXA 5CG7A 2JBMA 3CB8A 5ECUA 1RP9A 3DG7A 3VNDA 4C1KA 2VM8A 5T91A 1IGWA 4L80A 4ATLA 1YX1A 1DPMA 3KOZA 4EP8C 1AK5A 1M04A 3OLGA 5FJPA 3VGBA 3CXOA 4CCCA 3TC3A 1KWKA 3NM1A 3NIYA 1LUCB 5DBTA 3VU2A 4DXXA 4RUBA 3VGFA 3PJWA 2DUZA 4H8NA 2TRSA 3FLUA 4WKFA 5CH9A 3TN3A 1WZLA 2JF7A 3VAVA 1WA3A 4L5ZA 3V0TA 1Q2RA 3BV7A 3NOEA 4ZB2A 4GQRA 4JL1A 3T0BA 3MP5A 1VFOA 1X39A 2V81A 3SCSA 1JR1A 1VYPX 2I5IA 5EKYA 5E93A 2D2JA 2DSUA 3QGKC 5BWAA 1QW9A 4YCOA 4GFSA 3EMCA 3AJXA 3L4TA 5T26A 3UD6A 3IANA 3W76A 4LV9A 1PKNA 3QHMA 3POCA 2ZWYA 2QCHA 3TIMA 3M64A 3QYQA 3O6YX 1TA3B 1RK6A 2DZXA 4S38A 3TUUA 3STFA 1MWOA 4ACZB 4NIRA 1ZPTA 1OC6A 2A1YA 1YPXA 1BXCA 2A3EA 4CVWA 2VCAA 3OYXA 4GC4A 2A85A 3M0KA 4QAWA 5CBIA 3WN6A 4PTXA 4UOZA 1PL9A 2VEKA 3K8LA 2QUTA 2IKJA 4NXKA 2PDCA 1VIWA 5BROA 2CBVA 4A3HA 4BI5A 3CL6A 1KM6A 4RPQA 1HKWA 4H6QA 4MNJA 4G9PA 4J28A 4Q4QA 1JZ7A 1QHZA 1LQ2A 1CECA 3KWXA 2AGTA 1S5WA 4B5SA 5XINA 1TMLA 5DCBA 3SCNA 4UMCA 3A4WA 4JHMA 1RPXA 2J8FA 4JPGA 5KINA 4LY4A 4WHBA 1A80A 1SO5A 2DORA 3T4WA 2DJLA 3W53A 4KCWA 1W9BM 2J75A 1OFOA 1ZLPA 3MY9A 2E8ZA 3ECQA 2O4QA 4LNCA 2A7RA 1PDZA 2JKAA 1GJPA 4PMYA 3QY7A 3P80A 1P1MA 3VIHA 1GHRA 1IWAA 3NQAA 3M5ZA 2FB2A 4BI6A 1RH9A 4YLWA 4JTFA 1V02E 3U9IA 1MNZA 4GX9A 1JD7A 3W6MA 3G2GA 4RZ4A 3E9AA 3UXIA 4FLOA 1UOKA 4YYFA 1JEZA 2VVNA 2DUXA 4FX6M 4LVGA 4N4PA 1DORA 4LYRA 3RLUA 3GZ3A 1OIMA 2JF6A 2DUAA 2J6VA 1IXPA 1TV8A 3CQIA 5D04C 3KP0A 1DQXA 1P7TB 5FL1A 4WK9A 4UWMA 2Z1SA 2O92A 1W91A 1KBKA 3QZEA 1XGEA 4CUCA 1J0KA 1W1ZA 3MO4A 4RL3A 4WF7A 1RV8A 1XYAA 5HUPA 1HJXA 2QW5A 2G8ZA 3A6OA 3QV9A 4PUKA 2C15A 2ZXAA 3IJ7A 2VNCA 3SW6A 4AIOA 4K39A 4NL1A 5JIWA 3UF9A 3RN6A 2Z1VA 1BHGA 1T40A 2BY2A 2Q02A 4PUEA 4WR3A 4XB3A 2A79A 2OQYA 1PTDA 1BWKA 3WFLA 1G94A 1UBPC 1S2UA 1E9ZB 3TYCA 1MYRA 1BVNP 3WLTA 5LA1A 4NG3A 4J3VA 1GT8A 3NQCA 3QY8A 4AIEA 1TYGA 5A6SA 4HMDA 4GUJA 4ICNA 4HGXA 2QGYA 1VB9A 1XIJA 4Q4MA 1KM3A 3MB9A 4H9ZA 3G1FA 3T0CA 5AZ1A 2XM1A 3IEBA 2QJJA 5ABFB 3IRSA 3WSUA 4IQDA 4HBKA 1Z9AA 1W1TA 1XLBA 5HNUA 5A8OA 1XDLA 3GBEA 1NARA 2C1IA 3LXAA 2YDAA 5TAOA 2Z1WA 1SZNA 3R1ZA 2CHRA 4LAMA 4JNMA 2OQLA 1I2PA 1E4MM 4U4MA 4DNMA 2E8YA 4AC1X 3PHAA 3H2NA 3LRKA 4N7QA 2AKMA 3VD5A 4DM2A 4HYWA 4ONVA 4O0ZA 3S3GA 4LAUA 3LRMA 1XC6A 3PBWA 3FEMA 5GNXA 1HKVA 3BH4A 1N2VA 4HJFA 4N9EA 1F74A 3KVLA 3NO5A 3SO7A 4LW7A 4O13A 2HDJA 4WDWA 2XVKA 3WNNA 4LTSA 2QV5A 5E6YA 2AQVA 2PODA 5JH1A 3I4EA 1QI2A 1E9IA 2VX4A 2X09A 1JAEA 1GTEA 1EEXA 4JQAA 3I10A 1EP1A 1G7UA 2ZBTA 4UTIA 3CIWA 3V18A 1K6AA 4LS0A 5C54A 4CQ8A 1XISA 2V3EA 3QOKA 4MNMA 5CGTA 4IIDA 5I00A 2BG5A 1UR3M 3H23A 4PEEA 2F38A 2TSYA 3WLLA 4MTVA 1KBBA 3I3DA 4B4HA 1T8QA 3H22A 3M6DA 1M9HA 3RU8X 5A8QA 2HVNA 2XISA 1OC7A 1Q6FA 2FPVA 2X7WA 3VABA 3HQOA 2Q01A 1F3TA 4M7TA 3RM8A 1Q4WA 4WY0F 2DGAA 2CETA 2V82A 1PE1A 3ZT6A 1LJYA 4AD1A 3ERPA 2VRKA 2XU2A 1POJA 3GKFA 4IUGA 2FZ9A 3DFTA 2QIIA 3L0NA 1MW1A 3WMBA 3DKLA 4GQGA 3MS8A 3CAKA 4JY9A 3UY7A 5JXQA 3PZIA 4QJ3B 2GJPA 2VEFA 5CPQA 1M1BA 1I1XA 3CYJA 2G3MA 3MHGA 2WLYA 5C7VA 4KCTA 1FWIC 4LUJA 3N13A 4JDYA 2XN2A 1KFJA 1TUXA 4E3TA 4M82A 3EA2A 5I77A 1FHLA 1X1ZA 1XLHA 4DZIA 4H9UA 3VZZA 3N15A 4ZO6A 4XG1A 3AIVA 2CFFA 3HA1A 1CXFA 3SCUA 3T7VA 3W07A 1FWJC 3ANVA 2P10A 5K4XA 1YTKA 2YCEA 4US6A 5FJIA 4NJIA 3HPAA 4OUIA 3C86A 1WE5A 3FKRA 2PB1A 4HTYA 1Q6LA 2O9TA 2FZMA 5C5YA 4LBSA 2E28A 1W1IE 5A8NA 1A5NC 1W5OA 4FR6A 3UJSA 1FXPA 2PE4A 2R1NA 1NWTA 3F4CA 4O8AA 3URQA 3RPMA 3FYOA 2A3LA 3VC5A 1CIUA 2E5BA 4NAEB 1FH7A 2J7HA 2VC5A 5HXMA 1MSSA 4AZCB 2PDBA 2XFWA 1K8ZA 1K6WA 3E6EA 1OINA 2FLIA 2PZNA 4EF9A 1V6UA 1VFMA 2CLEA 1SSGA 4RDWA 1B31A 3R0DA 4TO8A 3M0JA 4V33A 3URNA 4OT7A 3KCLA 1DL3A 1V4YA 2FGLA 3NGJA 3NDYA 1IWPA 1VBGA 1VGAA 1DJQA 5KZEA 2X42A 5CC5A 4GUHA 2BBFA 1JZ3A 5EFFA 2ISFA 5D02A 3T2OA 2ZCGA 1R3YA 5FJJA 1ZSXA 3RITA 3GVWA 1JYXA 3B3DA 1PKYA 4Y7EA 3VOFA 1H7RA 3L68A 5F1VA 5E0FA 3R2GA 4GKLA 4H2HA 5FEPA 4MY9A 4RNFA 2XGBA 4O28A 1JDDA 4CCEA 3VGDA 4W89A 1SZGA 3MV11 1GEHA 3UPMA 3KOWA 2IS7A 4GZ7A 1TB3A 4EPBC 4DJEC 3AXHA 3RR4A 4WX2A 1LUCA 3AMLA 3R89A 2GGGA 2FZNA 4RDZA 2J8TA 1LDCA 1LOQA 4PBGA 5IBXC 2OOFA 3FV9A 1GQJA 4D71A 3BG9A 1CGYA 1OK4A 3W7HA 3LA4A 4CKQA 2GGJA 4O57A 2FHBA 1PHQA 3UA3A 3LCHA 6CGTA 2YCKX 1WKFA 3A21A 1LQ0A 3UPWA 1YPFA 1VBHA 1MXDA 5LGXA 3CV6A 3SUUA 1C7TA 4P7LA 4IHCA 1V5XA 3LXBA 1O4UA 2G3NA 3R0UA 1RQBA 3K2GA 3PWAA 4UFIA 4AD2A 5HAOA 1NF0A 1O1ZA 2Z7KA 4O16A 3FHAA 4AC7C 1JCMP 3EX1A 1VFTA 3MI2A 4ZOAA 3MA8A 4RPPA 3LPOA 3VNZA 1IIHA 3M0ZA 4J3UA 1JYVA 2X0YA 5E0CA 1ZP3A 1XFBA 1TA3A 3HJZA 3CV7A 2NWRA 3SRFA 2YA1A 4C6JA 4JIPA 2FPYA 4ACZA 2R91A 2VDGA 3CYVA 3KBMA 1JZ6A 4UNIA 4V27A 1MEWA 1X8CA 4DJFD 3GRIA 4JIQA 5I3GA 3CLWA 3MANA 4O1DA 3S46A 1XBZA 3AIUA 1DJWA 4YJ5A 4U2YA 1L8PA 3T4CA 4JZ5A 1H50A 8TIMA 2JIWA 2NWSA 1ZAJA 1GVQA 3P7YA 1DIKA 4R7JA 3BLIA 1F8IA 3M0YA 1GVIA 1K1DA 1W1A1 4E4PA 1W32A 2PBOA 2X0SA 3DENA 3CMGA 3LXCA 3HBLA 3W81A 3W2JA 3DH7A 3W7QA 2WAGA 5KSWA 1FFRA 4QGCA 1UG6A 4UTTA 1KC7A 2VX5A 4HCHA 3RX2A 3LQLA 3HG5A 3QGVA 3AHVA 2IKIA 5F2IA 4OVXA 4ZA0A 2C13A 1H63A 1Q7MA 2JK2A 2QCDB 2QPSA 3ANYA 1ODUA 3LZ3A 3WL0A 2FVKA 1BXBA 3NO1A 1AQ0A 3SFKA 3KX6A 1H7XA 4G7EB 1K02A 1N8FA 4JN6A 5CLWA 1UPMB 3H2FA 2ICSA 4D6IA 3EWCA 1IYXA 4QP0A 3OBEA 1P6BA 1RHCA 2POTA 1ZCOA 1VYSX 1UH3A 3EYPA 3M47A 4C1LA 2F2HA 2PCEA 2WSRA 4MZ1A 1HJQA 5EMLA 3C2OA 2QJIA 4AY7A 3TC7A 1Q8AA 1E40A 3UETA 5AN7A 2VI0A 1FUYA 1GOOA 2Q8LA 5BCAA 4O14A 4NQ1A 3CTLA 4HPJA 4NXSA 1OG0A 2Y70A 3SAZA 1KGUA 3M0IA 3PUEA 2BVYA 3EB2A 1P7TA 3QHOA 4C90A 4K3ZA 2DH2A 2WCGA 4B4FA 1JDAA 3N2TA 3RHGA 2NVDA 4DO4A 6A3HA 1S3HA 3TW6A 4JNYA 3BLEA 4DUWA 5AVHA 3BOFA 4HIBA 4I9TA 2NX3A 3QTGA 1ISZA 2Z26A 4E2BA 5BOOA 2X40A 3PFRA 2J7FA 3CPRA 1E73M 1TE6A 3MKVA 1FWBC 2PDPA 2GUUA 1GVYA 3T8LA 4AVFA 4GI9A 2V3FA 1TV3A 2OELA 1TSIA 3CT2A 2O4MA 1FWNA 1W56A 3KRZA 3EWWA 3A4AA 4DYJA 1UJQA 3THUA 4Z1CA 1Z7AA 1RSCA 1X7IA 4B92A 3ZQ9A 5D9NA 1YMYA 1DTUA 5FIPA 1GHSA 3VPLA 3R6IA 3URBA 3MDUA 3MMWA 1OVDA 1NOUA 4MADA 1Y5XA 3LPFA 1H0IA 2WHKA 4I6KA 3KBNA 1FWTA 4LUSB 1CGXA 3G1AA 4AD3A 3KS5A 4OZOA 4ML4A 3RRXA 4GWEA 3HQPA 5ABFA 4J3TA 2NUYA 1NFPA 4FAMA 4JQ3A 3W1MA 3AROA 4DWSB 3QMTA 3WNKA 5BXRA 2IXUA 4ZSTA 1FHDA 3N4FA 1EHNA 2C1GA 1BTMA 2V5JA 3E0LA 3GX9A 4HMEA 2J7EA 2DQXA 4O50A 3IJQA 1TCMA 1KCLA 4Z1BA 1EGZA 7CGTA 1J5SA 4NJGA 4EAMA 2F6XA 1P0DA 3MVIA 4ZO7A 1I1WA 3U5YA 3GE7A 3QV8A 2TODA 4AQLA 4E3VA 3B0XA 1I45A 3DFSA 2Y24A 5LSMA 3UXKA 3T2QA 3TYAA 4JQ1A 3UERA 4XTDA 1NOFA 4YN5A 1PCWA 2RDWA 4HNOA 4QLJA 1R3RA 4U31A 2C14A 4PB4A 1XJBA 3GTNA 3V36A 2F6KA 3UT0A 1PKMA 4RNJA 3BLLA 3NOYA 2BWGA 4M29A 2DSZA 2QF7A 4D2JA 4AY8A 4AZHA 5I7GA 2UY5A 5FOOA 1VENA 4US5A 1YYAA 1L8NA 4LFYA 1W1PA 4OKDA 1QXLA 2QCFA 3IGSA 5FJRA 5LXEA 1R3TA 4A3YA 2VOTA 2GGHA 3TVAA 1ME9A 3VNMA 4PCTA 5C9XA 2F2KA 3CAWA 2EPLX 1Q8JA 4BFAA 4RV3A 4RNIA 2PRLA 1LWIA 2UWFA 1GCYA 4NU7A 1JNEA 1QPNA 4KH2A 1JG9A 1GQIA 3KOFA 1KGXA 4KFPA 3Q94A 1GWJA 1WCGA 4TVDA 1KFKA 4HHLA 4GXWA 4XZWA 5CSRA 4C6MA 5CG0A 1QNOA 2XVLA 3MWAA 3GAKA 2Z4GA 1W5PA 5BW6A 1J0ZA 1OX4B 1IZCA 1KRBC 3B06A 3TAKA 1QK2A 1NM9A 3U6WA 3SQLA 1NF7A 1Y65A 2Y5JA 1F4HA 4JTQA 2XDFA 5M5DA 3L2LA 3QKZA 4A2SA 3VIOA 3IACA 3ARRA 3UWUA 2Z6IA 1Y8BA 1I8JA 1K8XA 1PDYA 1LL7A 4XO7A 3SGGA 1EC8A 5HK4A 5I24A 2BB0A 1BEUA 3N6HA 1XDJA 2WMJA 2R1MA 3WJWA 4NRRA 4R88A 3MMDA 3J7HA 5DX7A 2G41A 3T78A 2OXNA 1JQXA 3WNPA 2O0TA 3ITTA 1JZ8A 5HMDA 2DJXA 3GTXA 4QQ3A 1FVPA 3VKAA 1FY6A 3GHRA 5EBAA 1V6VA 1F05A 1W37A 4N4QA 1U33A 1W9XA 2A21A 1B1YA 3G6LA 3CZ8A 3ZR6A 4QDPA 3PJTA 1K8YA 4PUMA 2BLEA 2E1WA 4QCFA 2R1KA 1AW2A 1HQTA 2ISVA 1XSJA 4FS9A 2V9DA 1W31A 3B8UA 5DELA 1EIXA 2YYTA 4HK7A 4Y9OA 3TKFA 5CJMA 2ZTKA 1GZGA 1KXVA 2CEQA 4JFTA 4PUWA 4KETA 4AH7A 1JYNA 2HBVA 4I5RA 1IR1A 3JR2A 4XAGA 3F5JA 2YKKA 3SM0A 5HJLA 5ECVA 3PULA 2RKXA 2GZXA 2D0FA 3T0TA 5EU9A 1SYTA 4JQ2A 4HD5A 2CESA 1IQ8A 1Z42A 3ARTA 3LS9A 3AZRA 3MO7A 2QUUA 3N25A 4X3ZA 3DYPA 3LBMA 1XPGA 2VC6A 4W7UA 3B0VC 3S1VA 4IIEA 4HPXA 1N8IA 2PGFA 3PBYA 2GUYA 4IL0A 1TG7A 3VNKA 1UWUA 1X97A 3P0WA 3VOHA 3O05A 1MFVA 4P8XA 4GABA 1Y7VA 4IISA 1JF5A 1TR9A 2Z27A 4TU1A 1LRNA 5AC4A 2G4FA 4L6DA 2YW3A 2GYIA 4GNKB 2WWDA 4C6LA 3FY1A 4LVBA 3E49A 5IRPA 4PH6A 1CZ1A 1EBGA 3GLCA 5G1MA 3RX4A 1X8FA 1E0TA 4X9YA 3P5ZA 3N18A 5C71A 1RY0A 2FH6A 4UTWC 1KNWA 3QF0A 1VCGA 1UWIA 3GTIA 2FZBA 3QR3A 3MUY1 1V3JA 5DBUA 2GDQA 1PTAA 2PA6A 2J66A 4IT1A 2Q09A 2QMKA 1RAKA 4JQ4A 2V69A 1S3TC 2P1FA 1VBRA 2INEA 2EPKX 5FEWA 1ZRQA 4KFNA 4KWUA 2QZRA 1TJPA 4IM4A 4BKNA 1ZJIA 4UZSA 3NDOA 4IP4A 4IXHA 1KBLA 3GU1A 1OQFA 4KRTA 1XRTA 1KM4A 3HV9A 1O60A 3E12A 1TFVA 1WDPA 3ZSTA 3S5NA 2W62A 2Z1BA 1M7XA 2WCAA 4U10A 3FA3A 3PBVA 4UTLA 3GO2A 3UGRA 2QCDA 4AWEA 3MHFA 4O10A