1EQCA

Exo-b-(1,3)-glucanase from candida albicans in complex with castanospermine at 1.85 a
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
394
structure length
394
Chain Sequence
b'AWDYDNNVIRGVNLGGWFVLEPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAALRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAFQLLDNDPYVQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGFDNSGLRDSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAFQVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGWDAKKESHWNVAGEWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFWSWKTENAPEWSFQTLTYNGLFPQPVTDRQFPNQCGFH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXO-(B)-(1,3)-GLUCANASE
publication title The structure of the exo-beta-(1,3)-glucanase from Candida albicans in native and bound forms: relationship between a pocket and groove in family 5 glycosyl hydrolases.
pubmed doi rcsb
source organism Candida albicans
molecule tags Hydrolase
total genus 151
structure length 394
sequence length 394
ec nomenclature ec 3.2.1.58: Glucan 1,3-beta-glucosidase.
pdb deposition date 2000-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1eqcA00
2ZXAA 1OT2A 1V3LA 4UQEA 4JZ5A 3SUSA 4WKAA 3CHDA 1EDQA 1DWJM 3AROA 1C7SA 4W87A 1EXPA 3W29A 2YDRA 3AIVA 1C92A 3CMJA 4GZJA 3L4ZA 1BVNP 2BV9A 2V3GA 4XZWA 1B3VA 2WHLA 3ARUA 2XVGA 5A3HA 1B3WA 1CXLA 2VR4A 1VENA 1FFQA 4N42A 5ABHA 4W84A 3ZMRA 2ZUTA 4PMUA 4AMCA 2J7EA 5D4YA 1BGGA 1C7TA 2X2YA 3SCOA 4AD5A 1F4AA 4U31A 2XSAA 4CN4A 1CZ1A 3AS2A 4OBRA 5A1AA 1GJUA 2GJXA 1C93A 2D20A 4M80A 1JAKA 1ESWA 2ZX5A 2VQUA 4CVUA 4AXNA 1CLXA 3QHOA 4NZCA 3EMQA 4UR9A 1CBGA 5FCZA 4PMQA 4M81A 3WF1A 4PTVA 4E4PA 3KL5A 2HVMA 1GOKA 4RL3A 2YA2A 2YOCA 4CD7A 5JIPA 2J75A 3VGEA 3N13A 3UCQA 1CYGA 2D0FA 3PZQA 4AIEA 4HU0A 1Q6EA 4J3UA 4WKFA 3AZTA 4LQ1A 3VD5A 3AI0A 4HZ6A 3OA5A 2ZOXA 1BQCA 3T2OA 2ZUVA 3BAIA 1XSIA 1BVZA 4H41A 1UA3A 2PWDA 4PMVA 5A94A 1E70M 2EO7A 2DT3A 3K8KA 3W4RA 3WUGA 3AQUA 3BGAA 1BF2A 3HU7A 2D1ZA 3VIOA 5DEZA 2V3DA 3KE0A 2JFEX 1VEPA 1VEMA 2XM2A 4ZE5A 3AZSA 2MANA 3MSGA 3VX1A 3GH7A 3OLIA 5LYRA 2CBJA 1JYXA 1G5AA 4HMDA 2WNWA 2E9MA 1WE5A 3IANA 2VRJA 3AFBA 1CTNA 5A6BA 4JKMA 1G01A 2DT2A 3ARRA 1UWRA 3AOFA 5A6LA 1JG9A 1WAWA 4YPJA 3RMEA 1GOIA 2PC8A 1PBGA 3K8MA 3EDJA 1GOMA 1JF6A 7A3HA 4HU8A 3WMSA 1GNXA 1V0KA 2RGMA 1D3CA 2W5FA 5LA2A 4J28A 2BXYA 1AQ0A 3RJXA 1CXIA 2OWWA 1OGSA 1EOMA 4J7RA 4D1IA 1AMYA 3WF3A 1CENA 3FN9A 1MYRA 2FHFA 4JAWA 1X6LA 4AZCA 2YDQA 1HJWA 4PTWA 3RM4A 3VGHA 2GJPA 3AICA 1E1FA 3L4YA 2DPEA 2VCBA 4WSKA 3CZ8A 1EQPA 1PAMA 4NF7A 4CN1A 1V3JA 1QI5A 3MANA 4JHOA 2O9OA 1E5NA 2DSKA 4P7LA 2Q8XA 1TZ7A 4AC1X 1JZ7A 2WAGA 3GNPA 1JZ5A 1XV8A 2WK2A 2ZWYA 2JIEA 5C70A 1C8QA 3OG2A 1S46A 2D0HA 1KR1A 5AYIA 2BY1A 1HNYA 1V3HA 3SCPA 3UETA 1HJVA 1PIFA 2WHJA 1B3YA 1OSEA 1W3KA 2WYSA 3DYOA 2W4XA 1F4HA 1C91A 3N1AA 3VDHA 3HJEA 2OLHA 3MO4A 3SUWA 3VPLA 3AMDA 1UR9A 4GKLA 3VD9A 4TTGA 1E6XM 3ARXA 4Z2LA 1W32A 1RH9A 3VNZA 4FK9A 2ESCA 1E1EA 4JFWA 4ATWA 1VAHA 1QNOA 2WCGA 3FHQA 1MW3A 4QP0A 2GK1A 2EPOA 2PBGA 1DP0A 3VIGA 5JUVA 1WZLA 2CCRA 2VX7A 1ZB5A 1QNSA 4D6GA 4ZXOA 4J27A 2DT0A 1IV8A 1MFVA 2QLYA 2E8ZA 1SMDA 4AZ5A 4U5IA 5I23A 3VIJA 1WZKA 2XGIA 4FLQA 1W3LA 1V02A 3L2MA 2C8NA 4ZFMA 5I6SA 3BXWA 1JI1A 1FH9A 3VM7A 2XVLA 1DWGM 3CZJA 2ZWZA 1KXQA 4B3LA 2O9RA 1HP4A 4L4PA 5CXPA 2W66A 3B8SA 2YBUA 1KWGA 5CGMA 5A8OA 2DGAA 1QBBA 3CZEA 4W5ZA 4HA1A 1HP5A 1LLOA 5A2CA 1UUQA 1GOOA 1E6RA 1Q6CA 1QHPA 1WB0A 4AZ6A 1H4PA 1W3HA 1VF8A 3OLEA 3VUPA 3W6LA 2FDMA 3A4AA 2ZUMA 4QCFA 1E43A 4HOXA 1B30A 2CEQA 3D3AA 1K9FA 5KZ6A 3NCOA 1H09A 4QAWA 3CLWA 3T08A 3SCTA 1RD6A 7TAAA 1UKQA 3WUBA 1E0VA 5AY7A 2J25A 1MVYA 3MMUA 2CERA 3BLPX 3BSGA 4TX6A 5A8NA 1N82A 4Z2KA 2XTKA 2W63A 2WVVB 4XZBA 1LJYA 3FHAA 1M03A 1ZU8A 4JCLA 3WUEA 4F9JA 5A2AA 2GVYA 5HXMA 5JIWA 3CHCA 2NSXA 2BY2A 3AISA 1BYCA 3PZIA 3WD2A 3CUIA 2NW0A 4QDMA 2BNJA 1R87A 5D8ZA 4H7VA 4WF7A 3ARWA 4IPLA 3ALFA 2J8GA 3TOPA 1MW0A 4FMVA 1NOFA 3L4UA 4J3SA 1DTUA 2VZUA 3D5HA 3HN3A 3WF2A 3IJ7A 3WL1A 3WDPP 3PZGA 4EANA 1J10A 5CPSA 4WSJA 3J7HA 1GORA 4WJXA 5ABFB 5IDIA 2JEQA 3MSDA 4CD6A 1JI2A 3U7BA 2G3MA 1UKOA 1HXJA 4KGJA 2EBNA 1OIFA 4DM1A 2Y8KA 3SCSA 1CGUA 3ZJKA 3NJ3A 1TE1A 2YA1A 1TG7A 1XSJA 2W62A 3KZSA 4D6IA 2O9TA 5AYBA 4TX8A 4PUDA 1WZAA 3UR8A 2XJ7A 1KB3A 4TVDA 1HT6A 1FOBA 3WFZA 1CIUA 4JKKA 1VRXA 3CMGA 1C8YA 2WMGA 1VEOA 2GDVA 3MV11 3WNOA 4M24A 5DF0A 3CHFA 3VGGA 3WH8A 2EEXA 2J78A 1QVBA 4CVWA 4PMZA 2CITA 2D2OA 4V27A 2WC4A 1CLVA 4UOQA 3VGDA 3VKKA 1JD9A 3VNYA 1J0KA 3ARVA 3GZAA 1QI0A 3DYPA 4M8UA 4W88A 3NDZA 3VGBA 2X0HA 3FAWA 2E8YA 2DIJA 5GNXA 1JL8A 3W26A 4LXFA 1HKMA 1HJXA 4U2YA 3G6LA 1MW2A 3UG5A 5E0FA 2EPKX 1JZ8A 5DT7A 1EDGA 5A95A 4B15A 3BAXA 3K4DA 5IXEA 3L4XA 5M17A 4W8AA 1HL9A 2VO5A 3ECQA 1UH2A 4JL1A 3LPGA 1EH9A 2W67A 1PZ3A 1QNPA 1HKJA 4UFHA 1UD6A 1WPCA 5BCAA 1H0GA 4S3JA 1ISWA 2D3NA 1E9LA 5EFFA 3II1A 1OGBA 2WZHA 3CH9A 4X9YA 2YLLA 4P8WA 2ZUNA 4B16A 4GO9A 2VNCA 2NT1A 1BYAA 5AC5A 5EFDA 4D6EA 4WK9A 5I2UA 1WO2A 4KMQA 1J11A 2DEPA 2CNCA 3ZR6A 3PTMA 1JZ6A 3QR3A 2E4TA 2VI0A 4AZCB 1LF1A 4UQDA 4W7VA 4GI9A 3N9KA 5HDRA 4GZIA 4ACZB 1GVYA 1NWSA 5BXTA 1E4LA 1ZL1A 4CU7A 2XWDA 2E0PA 1X6NA 2XPKA 1TCMA 3ARSA 3RJYA 4AZHA 2WSPA 3E1F1 1HN1A 1AQHA 2ZX9A 4GI8A 1E72M 3A47A 5HPOA 3WUFA 4U3AA 3TTOA 3WF4A 1A47A 2E3ZA 2ZUWA 3L4WA 3ZOAA 3MUAA 2WW5A 2FGZA 2JIWA 4D71A 1MQRA 2VX5A 4JIEA 2V5DA 2ZE0A 4YHGA 4ATDA 3DYMA 3OB8A 5CSYA 2DIEA 1J12A 3VTRA 5ABFA 1XYFA 5D8WA 1ODZA 4KWUA 1BSIA 1HKKA 4MB5A 1M7XA 2ZXDA 4EAMA 3WH9A 3L4VA 5CZKA 1M01A 1VFOA 3KEHA 2GK1B 4F9DA 1FH7A 4XUYA 3RM9A 3AHVA 1NOUA 3WY1A 5GQBA 4XB3A 4V2XA 2CPUA 1PPIA 4B9ZA 2AAAA 1R85A 1XHGA 3A6OA 8A3HA 1HL8A 4KGLA 3BMVA 1JZ3A 1US2A 5CGTA 3SUTA 4W7WA 3CIVA 3WQWA 3OGRA 1U33A 1NP2A 2G8ZA 1LG2A 3GXFA 2WWDA 2CKSA 2IXUA 1GPFA 2CHNA 4HTYA 1TFVA 4ZEPA 5EBAA 5GNZA 4HZ8A 2UY4A 1UR1A 5A69A 4NI3A 4ACYA 3QHNA 5GPRA 1GCYA 4AY1A 4AIUA 3LPOA 2F2HA 2XGBA 1GOWA 4NRRA 3VIFA 5A8MA 4U2ZA 3NYDA 4FLOA 1D2KA 4GI6A 1G0CA 5M03A 3BSHA 1CGWA 4Q22A 1CNVA 2OSYA 2HISA 1JYNA 2J7FA 3ZT6A 2ZICA 1VFMA 1GQJA 1ZBWA 3VOCA 1XH1A 4ZXLA 1J9YA 3W37A 1VBRA 3SCNA 3AXHA 5BRPA 3S2CA 2VTFA 3F5JA 3QOKA 3WBAA 5A6JA 1CXEA 3JUGA 2BXZA 2QV4A 4PMDA 4UFMA 2BVTA 3U5UA 4HPGA 4MNLA 3WN6A 1W9DM 3O9NA 3NSXA 2VVNA 2Y24A 1H3GA 1SMAA 2ZUUA 3U5YA 3W81A 2D23A 3AHYA 3GBDA 3DHPA 4IUGA 1JDCA 3BC9A 3SUVA 3OBAA 5CJ5A 4CUCA 2VZOA 3M07A 5D9OA 1A3HA 4PEEA 3AS0A 4AISA 2XHYA 3N18A 2XFFA 1W3JA 4CGTA 3CTTA 3AYRA 2VRQA 4ACZA 1XH2A 3MMWA 1Y7VA 2J77A 3NUKA 3MKKA 1UWTA 4H04A 1MFUA 4NSBA 5E0CA 3WDJA 3WDIA 3QHMA 2YLAA 2EXOA 2YJQA 1I1WA 4W8BA 1UZ4A 2XFRA 4AIOA 1CEOA 2AMGA 3AIBA 2WC7A 3NDYA 3OZPA 4IPNB 4DUVA 4JFUA 5C71A 3AIWA 5A6AA 1J0JA 2O92A 2Z1KA 5DFAA 1R7AA 2Y2WA 2J7DA 4UTFA 1W2PA 3PZMA 1XYZA 2QPUA 4BQ4A 2UY3A 4AEFA 5A8PA 1KBBA 1GVIA 2YBTA 1WKYA 4GIAA 3ZR5A 4F79A 1PZ2A 4KH2A 4D6DA 2VOTA 3SURA 2WMHA 2VR5A 1XGZA 1M04A 4EKJA 2VZTA 4P7QA 5I79A 4BF7A 1JNDA 2X1IA 3IAQA 5HBFA 3WQ8A 3ZJ7A 1W9VA 1UD4A 1UWIA 2CBUA 3WMBA 2J79A 2XIBA 1YHTA 1E55A 1EHAA 2F8QA 1KXHA 2XVNA 4OKDA 3AS3A 2YL8A 1HF6A 2OYKA 2GSJA 3GDBA 1W9XA 3ZQ9A 1IZJA 1TVPA 4Z2HA 1E6ZA 2VQTA 3LMYA 1PX8A 4AD0A 4XX6A 3CZGA 1SR0A 4Z2JA 2Y4SA 1NQ6A 1WNOA 4UQBA 3PZTA 3AMKA 4W5UA 4GPNA 1QI4A 5CLTA 1U2YA 2VT0A 2QHAA 4TTUA 2JEPA 6A3HA 3CZKA 3WELA 3VIHA 2IUZA 3O2LA 4MPKA 4MNMA 1DWHM 3EBVA 2CXGA 4HPHA 3IJ9A 1V6WA 3BAJA 4P8XA 2PB1A 1QPKA 2C7FA 3ARZA 3AIRA 1OBAA 1XC6A 3ZSTA 2WWCA 4E8CA 2J47A 1RP8A 1B2YA 1FHDA 3BH4A 3NSNA 1J0HA 3GH5A 3AHZA 3FAXA 4HMCA 2WBKA 4QLJA 4H8UA 1QI3A 2WMIA 4J3WA 4AW7A 4Z2IA 1E0XA 1H11A 3K4AA 2JF7A 3WF0A 1DHKA 4PTXA 1LWHA 2XYLA 4UZUA 4W89A 4D6JA 1PX4A 3AMLA 2WZEA 4DWSD 3BMWA 3M46A 3T0AA 5CG0A 1XSKA 3WEZA 4BZYA 2OWXA 2W61A 2BVDA 3PZUA 2J7BA 4AWEA 4D6HA 5BXRA 1E0WA 4FLSA 1WDPA 3VDAA 1E4MM 4CCEA 5BXSA 3AHTA 1JXJA 3AMCA 1LWJA 1B31A 4UOJA 3DHUA 1V0NA 4URIA 5A6SA 1B1YA 3WQVA 1JAEA 4UQAA 1ECEA 1TVNA 2ZX7A 5FL0A 1VFUA 3PN8A 3UESA 1UD3A 1UHVA 3ZT7A 4ZE4A 1H41A 5IFTA 2G3IA 2QF8A 3MS8A 4PSRA 2CIPA 1EGZA 1HVXA 1EA9C 4R27A 3SCUA 2YDSA 1JDDA 4P8UA 3WIJA 1KXTA 5D9PA 1BTCA 1PJ9A 1V03A 3N15A 5E09A 4RE4A 3L2LA 2G41A 2TAAA 2DDXA 2WB5A 4HA3A 1E73M 4JL2A 2XIIA 2QMKA 2PF0A 2XSBA 4J3XA 2W91A 4PCTA 5I77A 1VJZA 4MADA 2DQXA 4GQQA 2BHYA 4PCSA 3WQ4A 3ZSSA 1JZ4A 5DO8A 4HA4A 1BYBA 3OGSA 3ARQA 3VMOA 5BWFA 5A6KA 1H5VA 1KQZA 4PMNA 2DSWA 1CXFA 3K8LA 1NWRA 1ZS2A 2X09A 1I75A 1GHSA 3AJ7A 3IJ8A 5FD0A 2CYGA 3CUHA 3ZO9A 3I3EA 3N12A 1HX0A 4W93A 3EDKA 4W8LA 3RM8A 1IT0A 4PN2A 1ISYA 4H8HA 1E3XA 4A4AA 2ZXQA 1UQYA 3PBGA 3WEMA 1B90A 3EYPA 4GO8A 4A3YA 1MW1A 2ZX6A 3W82A 1ITXA 3NIYA 1CECA 5BROA 3RIKA 2W92A 1JF5A 3B9AA 2J7CA 1E3ZA 4S3KA 4Z2GA 4HOZA 1XCWA 5ABEA 1DWFM 4D1JA 1Q6DA 2D24A 4AD2A 2XUCA 1FP9A 1UYQA 1XD0A 3WQ6A 1OGGA 3KL0A 3TTSA 1JZ2A 3DECA 2OSXA 1WDSA 3TONA 5JBEA 9CGTA 1KGUA 5JBFA 1E6QM 4GXPA 3SEPA 2EJ1A 4OOUA 1OD0A 4UQ9A 3VD7A 3TTQA 3WH6A 4FF5A 1WDRA 3AXXA 2G4FA 1O6IA 3RPMA 5F7UA 2O9PA 4AZGA 5A6MA 1E6SM 2YL9A 3QOMA 3PZNA 1KWKA 4CCCA 2FH8A 2WANA 3EDFA 1HJQA 3EDDA 1ZBCA 1H2JA 1V3KA 1BLIA 1UZ1A 3WKZA 4MB1A 5A6BD 4ZENA 3VU2A 3W6MA 1E5JA 2X0YA 4FLRA 4CN6A 4BA0A 2CETA 2VX4A 3S6TA 4GQRA 4P7OA 2VVSA 4UFLA 3VIIA 1EO7A 1GQLA 1TMQA 2UY5A 2VCCA 1TA3B 3POHA 1GHRA 1EO5A 1FH8A 3PZ9A 1QW9A 4F8XA 4N0RA 1HJUA 2UY2A 3N17A 4OJYA 1HKIA 5FKYA 4J3TA 2V3EA 4ATLA 1B9ZA 3WSUA 3UR7A 2FHCA 3VO0A 5TD4A 1QBAA 2Z1SA 2WMKA 3W24A 3W53A 1KXVA 5I78A 1K9TA 1E6NA 4WKHA 1YQ2A 4YHEA 1GJWA 4MB4A 3A4WA 2D0GA 1V0MA 1W1YA 3MMDA 4GZEA 2VUYA 4PYSA 3O6AA 2WCSA 2WMFA 3BCDA 3CHEA 4PMRA 2GFTA 3AIQA 1EDTA 3T0BA 4PRWA 3VIKA 3TTYA 3UERA 2Y8VA 4JFTA 3MUIA 3WDRA 4H8VA 4HOWA 1IZKA 1UD5A 2VCAA 5CPQA 3GXIA 4DM2A 5FIPA 1BGAA 4IM4A 5D9NA 2BY0A 4AEEA 3WNMA 4CD8A 3CBWA 2A3CA 2VJXA 4AZ7A 5CLWA 5EB8A 3NSMA 1NWUA 1JFXA 1H0IA 1WCGA 2DH2A 3A4XA 3B9DA 3AZRA 2PWHA 4CU8A 2UWFA 3SIMA 1TR1A 1H49A 2YKKA 1UA7A 1J0ZA 1G9HA 3W38A 3WFLA 5CPTA 2QMJA 2EPNA 3CPUA 4JFSA 2V38A 5ECUA 4BQ3A 2DH3A 1H1NA 1QHZA 2YL5A 1B3ZA 1UKTA 3OLGA 2YA0A 3CGTA 5IHSA 4YN5A 1AVAA 1ODUA 3CUGA 4U3CA 3WD1A 1GOQA 2E9LA 1W2VA 1W1TA 4TXEA 2V3FA 3WNNA 4QLKA 4Q7NA 2WVSA 2B31A 1OD8A 1ZJAA 4U33A 4LYQA 1CGXA 1MXGA 2XVKA 4C7DA 1BHGA 5HNNA 2WMIB 1V6UA 2X8RA 1X1NA 3BAYA 4OUEA 1NOWA 4UZSA 2VMFA 5DT5A 3WMCA 5M5DA 4PSPA 3BAKA 3GXMA 5A8QA 3FY1A 1OIMA 4MB3A 3MV01 3A3HA 4LYRA 1Q6GA 2WHKA 2XG9A 3PTQA 4JCMA 4RE2A 3B9EA 2A3HA 4HMEA 1NP0A 3THCA 4QCEA 2PWGA 5CQ1A 3VGFA 3N04A 2VL4A 1KGWA 1BG9A 4LYPA 1BFNA 1LL4A 3OZOA 1BAGA 3GXDA 3VIPA 2GJRA 3LPPA 1V02E 3WENA 1ZJBA 2WVUA 1E56A 1JFHA 2WHMA 3RCNA 1ISVA 2WC3A 2WSKA 1TA3A 1QNQA 1J01A 3UG4A 1EHNA 1K9DA 1E6PA 5C8BB 1XD1A 4EK7A 3ZIZA 1ITCA 4WLCA 4DWSC 2WCAA 4BCEA 3ARYA 2FH6A 1RP9A 1AQMA 4DUXA 3U57A 1ISZA 2C0HA 3EDEA 4WIWA 4B3KA 4LPCA 1KCKA 3GM8A 2YL6A 3ARTA 3WH7A 1JD7A 3TA9A 2PBOA 2WM0A 3RO8A 2WZIA 4A3HA 2CHOA 1KFWA 4OBSA 4CU6A 2BHZA 2QPSA 1U30A 1UD8A 4PTMA 3PHAA 3WDHA 2A3BA 1QNRA 4MAZA 3AS1A 1WP6A 1KBKA 3T0DA 3CUFA 2BHUA 3CO4A 1R86A 3WDQA 4GINA 1V08A 2ZIDA 1QOXA 4P7RA 2CBVA 4X0NA 3GNRA 5IFPA 4CD4A 4L4OA 4OOZA 3FNDA 1GQKA 4MNKA 1UKPA 1PX3A 3BCFA 2JF6A 4DUWA 3MUY1 3LPFA 2A3EA 3K1DA 1CGVA 5A2BA 6CGTA 5I24A 2JALA 1XCXA 1KQYA 5BRQA 1V3IA 2OWCA 3PTKA 3AIEA 1E15A 1OB0A 3W25A 2PI6A 1CGTA 2A3AA 7CGTA 2ZUSA 1B3XA 1BG4A 1FHLA 3ALGA 1SFSA 3GNOA 1R8LA 2OYMA 4MTVA 3WD4A 4AZIA 3T2PA 1WDQA 1I1XA 3I3DA 2VRKA 3L4TA 1CXHA 1OWQA 3N11A 1J18A 2J74A 4UFKA 4TVUA 4HZ7A 4Y7EA 1UWQA 2PWFA 3VD3A 3ARPA 1HJSA 5DMYA 1V6YA 4UFIA 2WKLA 5HPCA 1DWAM 3WH5A 1C90A 1E71M 4M29A 5EMYA 3APGA 3OGVA 4QLLA 1QI2A 1B0IA 3F5KA 3RDKA 4JHZA 2Y5EA 5I3DA 2AOSA 1CPUA 4MJ2A 2WVTA 3EMCA 1E4IA 4U5KA 3GYCA 5D9MA 1EOKA 3RILA 1W91A 1JDAA 3AMGA 5FL1A 1KCLA 4IISA 5CSUA 2VX6A 1UKSA 1UR0A 1E40A 5BXPA 3AIUA 1JNEA 1UR4A 4MDOA 4DWSB 3G6MA 5E6ZA 4AYSA 1CXKA 3CZLA 3FW6A 1C3FA 3VDBA 3ZJ6A 1JYWA 1VB9A 4PMYA 4M82A 2CESA 3GH4A 4EE9A 2WPGA 1JGIA 1UOKA 2CBIA 1ZBKA 1OINA 5LA1A 1K9EA 4D6CA 1CGYA 3VD4A 3VM5A 1DEDA 1VBUA 2J8FA 1GZJA 4UOZA 1GONA 1M53A 4TUFA 3SCVA 4OZOA 2J4GA 4W86A 1KGXA 1VJSA 3W0KA 2DSVA 2XWEA 4QFUA 4W7UA 4UQCA 4NRSA 5LA0A 1SYTA 1P6WA 3W27A 4MDPA 5M3WA 1XH0A 3WNKA 1NM9A 3W28A 2BY3A 1GW1A 1UH4A 1NH6A 3ZJ8A 3GTNA 1UWUA 3VVGA 1LQ0A 1OT1A 4AZBA 4E2OA 1G94A 3QGVA 2WLYA 2J7GA 2VZSA 1JIBA 2WBGA 3SCWA 4V28A 3IK2A 4TOQA 3VINA 1Z32X 2J62A 2YIHA 4JFVA 3OLDA 1D7FA 3U7VA 1FP8A 3FXYA 3PZOA 3MU7A 4BQ2A 5E9AA 4LX4A 4KRUA 1R7OA 4X0VA 4MNJA 3WEOA 1ISXA 3BAWA 4AD1A 1KR0A 4PBGA 5I0DA 1MXDA 4M56A 3WNLA 1W1PA 1RPKA 4P7NA 2EPLX 3HMCA 4AD3A 2DSZA 3I3BA 2F61A 1UH3A 4P8VA 3DC0A 1UQZA 2GJXB 3WD0A 2BFGA 1XRVA 1W9PA 3TP4A 2OYLA 4R5EA 3SCQA 2FGLA 5KEZA 1EIBA 1UR8A 4CCDA 1LL6A 4M1RA 4C7GA 2V5CA 1V3MA 1L8NA 1OM0A 1ZBVA 5ABGA 1UG6A 4UCFA 3ZT5A 3EMZA 5JBDA 1LG1A 2EPMX 3WNPA 4CD5A 2D22A 5GNYA 1Q4NX 2JE8A 1UR2A 2XM1A 2RGLA 2D3LA 1PEZA 2CKRA 4UFJA 1J0IA 3WQ5A 2XVPA 3KWXA 1UD2A 4F66A 4UNIA 4BQ5A 2WKGA 1VIWA 1FA2A 2GDUA 4MAVA 4J3VA 4W85A 1VFFA 3VILA 1GUVA 1MWOA 2J7HA 1V0LA 3WBEA 1NARA 5HOSA 5E70A 1QW8A 1TUXA 1G1YA 5E6YA 2GUYA 2OSWA 6TAAA 1V6VA 2NT0A 4B9YA 1NWTA 1W9UA 3AYSA 3M7SA 3M6DA 2BS9A 1BYDA 4PMXA 4D72A 3VMPA 1V6XA 3VMNA 5BYWA 2EQDA 1J0YA 2ZXBA 4PUEA 4ML4A 2G3JA 1CDGA 4H2CA 4LGXA 4TVCA 2VC9A 3VDCA 1MQQA 1K6AA 1E4NA 2XFYA 3AHXA 3ZM8A 5IHRA 2FHBA 1L0PA 2BVYA 2G3NA 2X05A 2WXDM 2VURA 2VZVA 1Q6FA 3T09A 4DWSA 1HIZA 2WMJA 3F5LA 4D6FA 1US3A 2IXVA 1CWYA 3SCRA 1C8XA 1EQCA 1OCQA 3IAPA 1QHOA 4C7FA 1W9BM 2ZX8A 1UWSA 3AXIA 2PWEA 3UEQA 1LL7A 1W1VA 3SUUA 3PZVA 4JKLA 3VIMA 8CGTA 4PMOA 4MJ4A 4K68A 3OIHA 4OIFA 1DWIM 1GQIA 1JXKA 3CUJA 3UG3A 1JYVA 3BLKA 2DSUA 2E9BA 3POCA 1FFRA 3THDA 3KL3A 3WD3A 3WL0A 4XV0A 2WLZA 4HP5A 4KRTA 3VX0A 3T2QA 4CKQA 3MUZ1 4AD4A 3GBEA 1BPLB 1PIGA 5FOOA 3F4VA 2WVVA 3K46A 2DT1A 5AC4A 2E40A 1O7AA 5I5RA 1WZMA 1MQPA 4RE3A 4BS0A 1HVQA 4E8DA
chains in the Genus database with same CATH superfamily
3T6CA 3LRLA 3V5OA 2FZMA 5AN7A 2XH4A 1OG0A 1R3VA 5HK4A 1DWJM 5I3JA 3AROA 4Z1CA 1EXPA 1QPQA 1UZDA 1C92A 1GZGA 4GZJA 3TN5A 3O06A 4LANA 3GQYA 4XZWA 1BXNA 1XUZA 4AQLA 2XVGA 5A3HA 1CXLA 4N42A 4W84A 2C16A 2E1WA 1M3UA 3GS6A 3SCOA 2WNZA 2I7GA 4PR4A 2XSAA 2A85A 1NJJA 1ONEA 4LAMA 5LIUX 2GJXA 5JU6A 4LVDA 3QR0A 3KOZA 4PUMA 3GAYA 2D20A 4XAGA 4DHGA 3W75A 4CVUA 7XIMA 4V1XA 4IZGA 2IQDA 5FCZA 4PMQA 1PS9A 5DCDA 3PJUA 2HVMA 4CD7A 2YA2A 3DU0A 4ZGYA 1NIUA 1EYEA 2J75A 2DP3A 2WNNA 3VGEA 5HR7A 1Q6LA 3PZQA 3IPWA 1G4SA 1PHQA 3DAQA 4UCGA 4WKFA 3N9RA 5AHMA 4QJ1A 3AI0A 5M1TA 2ZOXA 3R4IA 4XAZA 3T2OA 5J5RA 1QFEA 3BAIA 1EC7A 3I7RA 3H55A 4HNCA 3NM3A 3JVAA 2H8ZA 1LLWA 5A94A 1KNWA 2DT3A 3AQUA 2E28A 3KBSA 2D1ZA 5DEZA 5D05A 2V3DA 3KE0A 4GBUA 2Z27A 1VEMA 4HPNA 4ZE5A 1S2CA 1TV4A 2MANA 3MSGA 1M68A 3N25A 5LYRA 3R94A 3L5LA 4ZO6A 2WQDA 1CB7B 3AFBA 3M44A 4IMEA 1KM0A 1GVRA 4DYKA 1MXSA 4JKMA 3DGBA 5BOOA 2CHRA 1JG9A 2YB1A 1GOIA 1VD6A 3M0VA 8RUCA 3GDMA 1JF6A 4HGXA 4HU8A 1V0KA 2CLIA 1EJVC 4Q7IA 3VI2A 3TSDA 1W5MA 1D3CA 3SM0A 1YIXA 4J28A 1NTHA 2VWTA 2BXYA 4DBWA 4QE4A 1JVNA 1EOMA 4D1IA 3WYZA 4BJHA 1CENA 2VD9A 1MZRA 2XN0A 3L5AA 1DOSA 3VGHA 2BGNE 4M19A 1QCWA 2I56A 2DPEA 1SO3A 1EQPA 1PAMA 3LCIA 1BKSA 4WDXA 3NURA 2O55A 3MANA 5B80A 4OE7A 1JZ7A 5D2XA 3L0KA 4AWUA 4PRTA 2I5IA 5E9XA 1F8IA 4H9TA 5C70A 3KOFA 3NYZA 2J6VA 1S39A 2D0HA 4DJEA 4HNVA 3TJXA 1GZ1A 1EL3A 2HV5A 3DBNA 3ANVA 1V7YA 2OQHA 3F4CA 2PWUA 1DQXA 4LUJA 2P5NA 1K7EA 5DCEA 3FEMA 5XINA 4S3FA 2RJHA 1F4HA 3LTPA 3LM7A 1FWRA 4QTGA 1LBFA 3HJEA 3SSZA 1B9BA 3VD9A 2TODA 4GY7A 4A8NA 1BEUA 1E1EA 4ATWA 3W76A 4IPPA 2EPOA 4KFOA 3NA8A 2C6QA 1ZALA 1ADSA 1KFKA 1TB3A 4NJHA 2R9RA 1SMDA 4MZ1A 2HTMA 2RDUA 4U5IA 3RNDA 1JPKA 3VIJA 3L0NA 1JUKA 4HYVA 3O0KA 2CLKA 3U4AA 1LRQA 2MUCA 5JMUA 1A4LA 1V02A 5HMSA 2C8NA 3BXWA 3VM7A 4DX3A 1TPFA 2XGZA 3W1PA 1KXQA 3P81A 4L4PA 5C2CA 1H63A 1FWIC 1QTWA 4NIRA 2P3ZA 1UW9A 3VKDA 2OQLA 5AYZA 5CGMA 2OGJA 2POTA 5KMYA 4QG6A 4WZHA 5A2CA 3GDLA 3UGVA 3TV8A 2J24A 4IJRA 1WB0A 2QCMA 4GYKA 4A8IA 1W3HA 4Z0JA 3BZGA 1FDYA 1E43A 1GG1A 1JR1A 1B30A 3BWWA 3OVGA 5KZ6A 1H09A 4OV9A 4QAWA 3SW6A 2RKXA 4C6FA 1WYIA 1AW5A 3TC7A 3MMTA 4H9UA 4NP7A 1E0VA 5LIWX 4I5XA 1MVYA 1YKWA 2CERA 1ENUA 2C71A 1L6WA 3GR7A 4XZBA 2C1HA 2BXVA 5CGQA 1HW6A 1M41A 1IXPA 3GIPA 5HXMA 3UYIA 4I5UA 5LSMA 1RK5A 2BY2A 5DCBA 2Z29A 5GJNA 3PZIA 4GUIA 3WD2A 3CUIA 3W7PA 1SJDA 2HK1A 3UG8A 1R87A 1TPWA 3AUJA 4H7VA 1PKLA 3E2SA 3TOPA 4FMVA 1NOFA 3DBPA 3L4UA 3BOLA 4MYXA 2REQB 4LUYA 3PBUA 3BO9A 3IJ7A 3ZWTA 3WL1A 3CHVA 3AALA 2GZXA 2VEPA 3PVFA 3FDGA 5CPSA 2OGYA 3J7HA 5ABFB 4TV5A 3WK2A 1RBLA 1F73A 4CD6A 3KRBA 1A0EA 4XKYB 4WDWA 5HQLA 1HXJA 3MSRA 4KGJA 1Q85A 1AJ0A 3CJPA 4DM1A 3NGJA 2ATSA 2PDXA 4F3HA 3TJIA 4JN7A 4I7WA 2HBVA 3SCSA 1CGUA 4JTHA 4B2DA 4GUJA 3LHUA 2Y7EA 1PUDA 3LMZA 1F5ZA 1XSJA 3GVWA 2ZRZA 4PUDA 5KETA 3HTWA 1YNPA 5LNSA 1KB3A 1FOBA 3QN3A 3WNOA 1TPC1 3IIOA 2OT1A 3XINA 1BD0A 4Y8FA 1GK8A 5C7HA 1QVBA 3RXZA 3VZZA 4NJGA 2NUWA 4JR5A 4YMZA 1MEHA 3IVUA 3KXQA 2XN1A 2ZDRA 4QJ3B 2ZC8A 2PGRA 3VKKA 4C5YA 3S6DA 3VNYA 2ZDSA 3ARVA 2DZVA 4YU1A 1YNYA 2PDJA 3UJSA 3NDZA 4LAZA 3EB2A 1N7KA 3RRXA 2ZZ5A 3NZRA 3BW4A 4U2YA 3QYQA 4WUIA 4GZ7A 6XIMA 3KFTA 3UG5A 3CWHA 3VFLA 2PDYA 3CTLA 3UQNA 2VC7A 4Q8MA 1JZ8A 1DXFA 3KBMA 4BY3A 2YCIX 2DFAA 3BAXA 3V1HA 4QE1A 3ECQA 4RNIA 1RVKA 3LPGA 1EH9A 3GUGA 1IYXA 1PZ3A 1HKJA 3PTDA 5XIMA 5BCAA 4S3JA 1EP1A 1E9LA 3CH9A 4X9YA 1ICSA 2YLLA 1BSLA 4X9SA 2VEKA 1BYAA 2VEFA 4O15A 4ZB0A 5AC5A 3MZNA 3EA1A 2OLSA 1RQHA 1J11A 2DEPA 3DI0A 4LCRA 2NX9A 4GISA 2R24A 1AODA 3FJNA 4Y90A 4GZIA 1KFCA 2HPMA 5BXTA 1E4LA 2PTXA 4I9TA 4G5DA 3ARSA 1YE4A 3RJYA 1AQHA 1E72M 3CV2A 3W07A 3N14A 3N6QA 4RZ6A 3CQ0A 2FJKA 1QPNA 4ZOAA 1LRTA 4U3AA 3WF4A 1L8PA 3FK4A 3SQMA 2VX5A 1WOAA 3MC5A 4YHGA 4DBUA 2VFHA 3QMSA 3N29A 1ODZA 2HE5A 3CWNA 4LV9A 1A3WA 3S5NA 4PULA 3UCDA 2XDFA 4F40A 1HKKA 2X42A 4L6OA 1SO6A 2J27A 3KEHA 5EU9A 5HANA 3IIZA 3N73A 3P62A 3WY1A 4QE5A 1XFCA 3CNYA 4YYFA 1XXXA 1PPIA 2C1GA 3TMQA 3G1VA 1TRIA 3A6OA 8A3HA 1HL8A 3IGHX 1GKRA 3HPAA 2QDDA 4O28A 5CGTA 3SUTA 3TDFA 4JBRA 4S2CA 1RV8A 3H22A 2WWDA 4JX4A 5MHBA 1GPFA 4HTYA 3A24A 4XZHA 4ZEPA 1FWGC 2G37A 2ZCGA 5F1UA 4HZ8A 1FWSA 3WJZA 4YTQA 5F4XA 4ACYA 1SW3A 4MUZA 5KTLA 3SJ3A 3NQDA 1MZHA 3W23A 1WUFA 3LPOA 4NRRA 1ZTVA 4FLOA 2JGYA 2CLPA 3G8EA 1G0CA 2DVTA 2CC0A 3EEZA 4Q22A 2VGBA 1JYNA 2G95A 3ZT6A 3C2YA 3DFNA 3GWQA 1GQJA 1EIXA 1ZBWA 3VOCA 4UNLA 1ZAHA 1J9YA 4FNUA 2UZ9A 4D8ZA 3W37A 4FOUA 1Z3NA 4H9YA 5EY5A 2P1FA 3RGTA 5F4WA 3EOSA 3VFCA 3Q58A 3S2CA 3UXLA 2QV4A 5AHEA 4MLRA 3W02A 2IKHA 4ONVA 3WN6A 1W9DM 2VVNA 4Q8QA 4JIIX 2PDWA 3AHYA 4E6MA 1JDCA 3OBAA 5CJ5A 4UTKA 4WJ8A 3W7NA 3EXRA 3AS0A 4CQ9A 4AISA 1OADA 2XHYA 2XFFA 1F8MA 2ZZ2A 5K9CA 3WLNA 2VRQA 3LUTA 3GIQA 1XH2A 1XKYA 3MKKA 1UWTA 3SECA 1A53A 4G9PA 3QHMA 2Z26A 4GVFA 4ROPA 1XISA 3DGRA 4JQ4A 4HCLA 2I5GA 3WJXA 1CEOA 3HA1A 3S42A 2WC7A 3NDYA 4ZODA 1XJBA 1K8ZA 3PSVA 2J7DA 4HU4A 3PZMA 2NQ9A 3ME3A 4FNQA 2QGYA 4UBPC 1KBBA 1S5TA 4O12A 4Y96A 4UTTC 3W1MA 3MA8A 4F79A 2GQAA 1AMKA 1XGZA 4P7QA 3TZFA 4GQGA 4MY1A 3WQ8A 3UBPC 1OX5A 1UD4A 1UWIA 5CPMA 2J79A 4HCDA 1E55A 1KXHA 3I4EA 2HRWA 4OKDA 3AS3A 4UNKA 2YL8A 3VAVA 3KP1A 4LW7A 1XW8A 1W9XA 2DZWA 3H12A 2HK0A 1TVPA 4Z2HA 3GTFA 2OEMA 1HFBA 1PX8A 4AD0A 2FPYA 3IUHA 3V5CA 3GRIA 4GH1A 3AO0A 4TTUA 6A3HA 1ZAIA 3O2LA 2IPGA 1DWHM 3KS6A 5HMEA 4HPHA 3IJ9A 4C6NA 1JCMP 2TMDA 3ARZA 2WWCA 2Q6ZA 4X63A 4O57A 3W7DA 4B5VA 4KCVA 1FHDA 5K3VA 3T4CA 3WQCA 3GH5A 3FAXA 3ZR4A 2V63A 5IBXC 4UTIA 3PSWA 1S38A 1H11A 3K4AA 3WF0A 5IOBA 2YCJA 2XYLA 2I5QA 3HIJA 1TV3A 4RZBA 3NWRA 2WZEA 3BMWA 4LTSA 4QGCA 4GHRA 4KETA 3B8IA 1XLDA 1T41A 3WEZA 3A64A 4BR1A 4QJ5B 4PB5A 2BVDA 4KWSA 2J7BA 3LXAA 3S5OA 3QEZA 4RV8A 1WDPA 5FACA 1M7OA 3W01A 2NZLA 4CCEA 1FBAA 3PB0A 5BXSA 3AHTA 3GXTA 1XIFA 2J6XA 2CLHA 2YB4A 5A6SA 1B1YA 3WQVA 4JDYA 1TVNA 5FL0A 4O1EA 3PC0A 1MNSA 3BCJA 5DANA 1UD3A 3W2MA 3H53A 4ZE4A 4ZZ9A 3MS8A 2Z2AA 3TW6A 1NDWA 1P0DA 1EA9C 2QUMA 1TJ1A 3CUZA 3NO3A 4CQBA 1W3NA 1JDDA 4IL0A 1PJ9A 1F05A 3W84A 3MP3A 1A5AA 1WXJA 3N34A 4HA3A 2GQ9A 2XSBA 3VUSA 3MWCA 4MADA 1KTBA 3WQ4A 5BW6A 5DO8A 1GT8A 4HA4A 1IGWA 5D2TA 5AYXA 4V33A 4QG9A 5BWFA 3TYBA 3GDTA 4PMNA 3NPXA 3QV9A 1CXFA 4GUGA 4LVFA 1GHSA 1C9WA 5FD0A 4O53A 2QCCA 2DORA 3ZO9A 4XTIA 2H8XA 3LBOA 3EDKA 1K7XA 1REQB 1T5AA 3I6TA 4H8HA 1PV8A 1E3XA 3FJLA 4K8EA 2IPWA 5K7JA 4LVAA 1B90A 2C13A 4GOAA 2YSWA 3V4BA 1MW1A 2GUBA 1DJGA 4NASA 3NM1A 1QK2A 5BROA 1OQFA 3B9AA 2J7CA 1E3ZA 4HOZA 1DWFM 4JPGA 1Q7ZA 2D24A 2XUCA 1UMYA 2QV5A 2C0AA 3CT2A 3QTPA 2BWGA 3I4KA 4JOMA 3RRAA 3MDWA 2GVEA 4KBXA 1JZ2A 1H7XA 3R2GA 1WDSA 4LALA 3REQA 5JBEA 3TIMA 2QEZA 3V3WA 2Q3OA 4GXPA 5CC5A 4O0KA 3CV7A 4OOUA 2GYIA 3VD7A 1YTKA 3MHFA 1S2UA 4FIQA 1WDRA 4IGSA 4AZGA 1EPXA 1Z44A 5A6MA 1E6SM 3BOFA 3PZNA 4CCCA 2FH8A 3L0GA 1EJSC 4RW5A 4MB1A 1OYAA 3VU2A 3USBA 2KX9A 1OFAA 1FWAC 1E5JA 4WGXA 4FLRA 3H4GA 4KEZA 2ANUA 4GBDA 3NZGA 2VX4A 3S6TA 4M0XA 4GQRA 2CLEA 2FPTA 4C6OA 3P5YA 2C15A 3DFTA 2GWGA 4IPJA 4FXJA 4UXDA 1GHRA 1FH8A 4LBRA 4N0RA 1HJUA 2UY2A 3HO8A 1X39A 1HKIA 3N17A 4HHMA 2DY3A 1LBLA 3LI0A 3DG3A 1QBAA 3WLOA 3W53A 4H7CA 1K9TA 3D46A 3S5SA 3H2FA 4EPDC 1GJWA 4DWDA 1W1B1 4Y2WA 2WSYA 2PWVA 4GQBA 2D0GA 2FZNA 4GZEA 1W1YA 3MMDA 3SN1A 1IWAA 3DENA 1XLIA 2QJIA 1PZ0A 3LDVA 4PRWA 2Y8VA 3MCNA 4H8VA 5AOUA 1YYAA 4R7WA 5G2WA 2Q71A 3A3WA 5FIPA 3WO8A 1BGAA 5FF0A 4IM4A 2E5DA 3B9OA 5D9NA 3QH2A 2DUXA 3G5EA 4CD8A 2IMRA 4DJED 2PDQA 5D30A 5C9XA 5H2ZA 2QJJA 3GG0A 3A4XA 3PJXA 4M7SA 4ERAA 1RCXB 5K9DA 2O0TA 2PWHA 4L1XA 4WOZA 1FKWA 3SY5A 7TIMA 1UA7A 1A5NC 1G9HA 3H24A 5LKYA 4Q4RA 3SFWA 1BWLA 5CPTA 2EPNA 4KIEA 3STPA 3BOXA 1S5NA 3TQKA 1EB3A 1VLWA 1ZP4A 1R38A 4WY0B 1FWBC 1UKTA 4Z1YA 1XIDA 4YN5A 4LAKA 4P61A 1J5TA 2P50A 2ZFAA 3L21A 1W2VA 2VDIA 1A5OC 3PR2A 4GGBA 2B31A 1DIKA 3UNTA 1OD8A 1CGXA 4GFSA 1BHGA 1I45A 1V6UA 4MY9A 1DJZA 1ADOA 2X8RA 3BAYA 4UZSA 1TWIA 2ISFA 4JTTA 3HGJA 4FX6M 3BAKA 3W2JA 1A50A 1ME7A 3GXMA 3FY1A 1FHUA 4MB3A 3MO7A 2XG9A 3PTQA 4RE2A 1JPMA 3UT0A 2A3HA 2IPJA 4QCEA 3KTCA 3HPZA 3ERPA 3VGFA 3PS7A 3EB4A 5EBUA 3NXLA 3GDKA 4FALA 1XX1A 3FVDA 3G0UA 3VIPA 5HUOA 4GK8A 3LG3A 2R14A 5KZEA 3BV7A 5H8PA 2VWSA 2E68A 1G4PA 5CPNA 5J04A 3RCNA 3QQWA 5LIKX 2WSKA 1YXCA 1TA3A 2VEGA 3EWZA 1J01A 3DFSA 3V0UA 3ZIZA 4WLCA 2WCAA 1TIWA 2FH6A 1RP9A 4B3KA 2C3ZA 2VEMA 1KCKA 3GM8A 2NQ5A 2YL6A 3UJFA 3ARTA 5IM51 2OODA 3WH7A 1JD7A 1Q3NA 1NF7A 4A22A 3CM4A 2CHOA 4H83A 4CU6A 2BHZA 4DEFA 3KTXA 3EWWA 1VBGA 3NPWA 2PTWA 3AS1A 3BE7A 3RLHA 3CUFA 3KBVA 1X6UA 3GNRA 4CD4A 5LHFA 5LZLA 4OOZA 1TR9A 1GQKA 4I8DA 1UP2A 4NYYA 4FOKA 4B2DD 1IEWA 4AG0A 2A3EA 4G6CA 2WJDA 1KQYA 3L7RA 5BRQA 3O63A 2KZHA 3PTKA 4IIGA 4R85A 5T9CE 3SIZA 4CNTA 1AJZA 1VFLA 1O4UA 1XIHA 3GTIA 3GD6A 2QNEA 5ECVA 2I14A 1B3XA 2E5BA 3ALGA 5IDZA 1R8LA 4MTVA 3T2PA 1WDQA 1I1XA 2VRKA 3DKJA 1TREA 3UWQA 2WKJA 3W87A 1J18A 1F61A 1DJNA 3R25A 4KWOA 2DIKA 3VD3A 5FJOA 1ONXA 2WKLA 5HPCA 1DWAM 3QPYA 3L65A 1E71M 3APGA 1GKPA 5G1MA 3RDKA 2HS8A 2Y5EA 2A5HA 4PFMA 4NZJA 1OC6A 1E9YB 1S3HA 1FCQA 4WCJA 2GL5A 5D9MA 2OCZA 4JQAA 4ADUA 3HFYA 3GC5A 4LV4A 4DWSB 3CYVA 3G6MA 1K03A 1IEVA 4CNNA 3CZLA 3D6NA 2VR2A 1Y65A 4MGGA 3ZJ6A 2EJAA 1JYWA 4G7EA 2AQVA 4S1FA 4EE9A 3N2MA 5M2FX 1K3UA 1ZBKA 2B7QA 3LOTA 5LA1A 1K9EA 1CGYA 5CAHA 2J8FA 1GZJA 3LY0A 1XLCA 4YWSA 4O0ZA 7ENLA 4O54A 5LA0A 3TAKA 1VC4A 1XH0A 4PE8A 4HYWA 2FZBA 3LGGA 2BY3A 5HJLA 1UH4A 4NZ3A 1J5SA 3VVGA 1D8WA 3E5BA 2J7GA 3S1UA 5EA9A 1LROA 3SCWA 4L56A 4XUGA 2MNRA 3LLDA 4TOQA 1ZSXA 1Z9AA 4PMJA 4MUPA 1OF8A 4JFVA 1T8QA 3WK1A 4DYJA 3N3TA 1AH0A 3U7VA 3TUUA 4BQ2A 4LX4A 3SSJA 3EA3A 3C5QA 4MNJA 3BAWA 3O3RA 1KR0A 2HPIA 2Q02A 4PBGA 4AH7A 4DN1A 1LQ2A 1JQXA 5GJMA 1LOQA 2I1OA 2JBMA 1JCXA 4P7NA 1XLMA 3HMCA 4RE0A 2DSZA 1SR9A 2PCEA 5T8GA 3KUMA 3UWEA 4Z0SA 1XRVA 3F4NA 4WVXA 3RX2A 3SFKA 1S5VA 3AC0A 1EC8A 2CLMA 3M0KA 3ATYA 1QR7A 4M5PA 4KQNA 2ZZ6A 4H00A 3K5XA 3F7JA 3URNA 4YTSA 4UCFA 2DZBA 3WJSA 1QOQA 2GJNA 1ICQA 4QXIA 3MYPA 1Q4NX 2XM1A 1FXPA 2IPFA 2CKRA 1ZZMA 3TN3A 1J0IA 3WQ5A 4PBEA 4F66A 4UNIA 4BQ5A 1WKFA 4EAYA 4FX8A 2VGGA 4LBSA 3W7OA 2OOFA 4C65A 1VFFA 3QZ6A 3HV8A 2ABAA 3G2GA 3C52A 1QW8A 1G1YA 3WLKX 5E6YA 4IFKA 1AUSL 1W9UA 1WDWA 1W3IA 2BS9A 1BYDA 4BEUA 1CI1A 3VMPA 8TIMA 4HTBA 2EG8A 4DXVA 2EQDA 2ZXBA 3VCNA 4ML4A 4LGXA 2Y70A 4TVCA 4B91A 1MQQA 3KBWA 5PTDA 4GJIA 1U83A 2XFYA 2FHBA 1L0PA 2WXDM 1Q6FA 4DRSA 3T09A 1FWJC 1HIZA 3F5LA 1US3A 1IWPA 2IXVA 1MDLA 3URAA 1C8XA 1OCQA 4QX4A 4DI9A 1UWSA 3HPSA 3UEQA 1LL7A 4FO4A 4NXSA 2FPVA 3SUUA 3FSUA 3HQ1A 4JKLA 2RDXA 4OIFA 1GQIA 1OF6A 3USZA 1JYVA 2E9BA 2Y7DA 3MPGA 3WL0A 4GYPA 3UVIA 4XV0A 1IIGA 4HP5A 3KLKA 4CKQA 3S2NA 2VC5A 1SJBA 3O05A 1SW0A 5FOOA 1P5BA 3K46A 1SM9A 3AU6A 4MWAB 2QYGA 1W54A 1EA0A 3ITTA 3LX9A 1OT2A 5MF5A 1JRBA 4LVGA 3SUSA 3UXDA 5DRCA 1H60A 2YDRA 1V51A 2VYOA 4XAFA 5CC7A 1KCZA 3L4ZA 1JDFA 2V3GA 4G56A 4C6KA 1B3VA 1K7FA 1PYMA 4WEVX 3BLIA 4LUSB 1FFQA 4C1LA 5ABHA 5C9WA 2XSXA 5I07A 5DLCA 1H7OA 4AMCA 3AXKA 3SAZA 1UBPC 1LBMA 3HQNA 4OBRA 2D2GA 4C6BA 4PL2A 4FXRA 1C93A 1RY8A 4M80A 4AXNA 3LRKA 2EG7A 3EMQA 3QSTA 1XYLA 1CBGA 5HMDA 1TZ9A 2QCNA 2YOCA 4F0SA 5JIPA 3N4FA 4IFOA 3QFEA 4N9CA 3SBFA 1ZFJA 1Q6EA 3CIXA 3E2VA 2Z00A 2RUSA 3AZTA 4LQ1A 1O5RA 3VD5A 5U4NA 3CC1A 1FWNA 1RAKA 4PEKA 1GJPA 3OOQA 5C9UA 1IWBA 1NELA 2PWDA 4PTNA 2PDCA 3WUGA 3BGAA 1BF2A 4C6DA 4GG9A 1E0UA 2R1MA 4GNKB 3BJFA 4Q8WA 1Y5WA 2QPXA 4CEXC 1VEPA 2XM2A 1IZCA 1NVMA 1OZQA 1Q66A 3W1XA 3GH7A 3OLIA 3ITOA 3KRUA 2CBJA 4BHYA 4HHLA 4PA8A 1OC5A 1WE5A 2VRJA 1I2RA 4JQ2A 4K36A 4UR7A 4TR9A 4A6GA 2P53A 4YVXA 3ARRA 3ABQA 4GGHA 2QCDB 3G18A 5FJJA 3QF0A 3PB2A 3K8MA 3EDJA 1O5QA 3KTSA 2FFIA 1GNXA 1OFDA 5CC3A 3CPRA 3DDMA 1R3TA 3S2MA 2I9UA 3WLRA 1B3OA 1H1YA 1SZNA 4ZOEA 3W1RA 4X2PA 2JK2A 4OU1A 3IEBA 4WJEA 3TE9A 1MUMA 2B0MA 4UTWA 3R12A 1TV7A 3EA2A 4XO6A 1MYRA 2Z1WA 2YDQA 4PTWA 3RM4A 2GJPA 2DZXA 3HG4A 1T8XA 1ELSA 3GZ3A 3FFSA 3T9PA 4CQDA 2ZA3A 3ZZ1A 3M5YA 3QFWA 2Q01A 4IP7A 1QI5A 1QPOA 4JHOA 4DBEA 2DSKA 1Y5VA 4P7LA 1TZ7A 4AC1X 5T91A 1JZ5A 1XV8A 1RVGA 2JIEA 3QQ1A 3OG2A 1W1ZA 4XD4A 2BY1A 1V3HA 5HMFA 4MIMA 5AHLA 1EJ7L 1HJVA 4C6MA 2PDHA 4V15A 4UTMA 2W4XA 3N1AA 4MZYA 1TIMA 3C0SA 3KCJA 3ARXA 4LJ3A 2NUXA 4Z2LA 4Y9NA 1W32A 1US0A 5BMXA 2PDUA 1VAHA 2WCGA 3FHQA 3HPFA 1OABA 1WZLA 5G2IA 3G0XA 1DKWA 1WDDA 1OYBA 3ABZA 1M6JA 2QLYA 1KRMA 4B5WA 4O13A 5I23A 4BI6A 1WZKA 4FLQA 1W3LA 1FH9A 2HWGA 2XVLA 1DWGM 1UP3A 2O9RA 4KEMA 3VC6A 1TPVA 2W66A 2Z7GA 4LUTB 2E25A 3B8SA 4OBTA 2YBUA 2E6AA 3QW3A 3CZEA 2UBPC 4HA1A 4B5SA 4WGHA 1JUEA 1HP5A 4DXXA 2Z6JA 1LLOA 2FTPA 4RDYA 3RLGA 3U6WA 5JQ9A 3GG1A 3SGZA 3SZ8A 5EPDA 4H2HA 1EEPA 1VF8A 3WCZA 5KINA 3NQVA 3OLEA 1CCWB 2FDMA 3LTYA 3IRDA 1KFBA 1RALA 2VDHA 4HOXA 3OU8A 3CLWA 4LAUA 1RD6A 4DIAA 3AWOA 4IL2A 1PDYA 1JCNA 5AY7A 1UJQA 3V5FA 2QGHA 4M1BA 1H7RA 3MMUA 1WKDA 2NUYA 3E9AA 3BLPX 3BSGA 4GYFA 1N82A 1PE1A 2XTKA 3D0CA 1ZNNA 4NILA 3FHAA 2E09A 3EX6A 1M03A 4JCLA 2VENA 4F9JA 4CNOA 3S3GA 5JIWA 5D2WA 1HGYA 2PLJA 3V18A 4OQVA 2ADAA 3W7QA 2J8GA 4MHBA 1RCQA 4RR4A 3VZYA 1F3TA 2FMNA 3DFOA 3WF2A 2E6DA 4EANA 3NQCA 4IIHA 5I09A 3E3HA 3E12A 4NNCA 2B81A 8XIAA 3UZYA 2JEQA 3U7BA 4FNPA 5CBIA 2EBNA 2XIOA 4M6PA 3NJ3A 4M51A 3BARA 1UIOA 1OFOA 1Y8BA 4A3QA 2VM8A 2W62A 5AYBA 3BLLA 4RPQA 1AL7A 3UZXA 2CXEA 4GMEA 1FCVA 4XD6A 4TVDA 1FCBA 4JHMA 1HT6A 4LRTA 1M1BA 3EPMA 4JKKA 3TEVA 4A8RA 4M24A 3E0WA 4DJEC 3DXIA 3VGGA 5G1TA 2J78A 4PMZA 3QY6A 4XAYA 3A12A 4ZQPA 5EMKA 1AW1A 3GG8A 4YVPA 2BB0A 3UA3A 4M8UA 3IVSA 1MNZA 4J2MA 3OP2A 3VGBA 2X0HA 3FAWA 2DU2A 1CT5A 2XH0A 4O1CA 4LXFA 1OZMA 4CQAA 3G6LA 3MKCA 3CASA 3R7MA 4EIVA 2C91A 3N4AA 1TPUA 2EPKX 4NAEA 3RF9A 4MY8A 3OVPA 1LUCB 4PC8A 3STCA 5A95A 1UC4A 3QV6A 4ZSUA 1E1CA 3N2OA 3NPVA 4W8AA 4Q8PA 1UR3M 1HL9A 2VO5A 2NXHA 4JL1A 4WSHA 2PFHA 1U1HA 2W67A 2V67A 4XQ6A 1QNPA 1CX9A 4UC5A 1UD6A 1H0GA 2FZ8A 1OGBA 1ZLPA 2QJGA 2WZHA 3CEUA 4GVHA 4CEUC 1A5SA 3MYOA 3TC3A 3R8GA 3H2CA 3KHDA 4XISA 2VNCA 4XD3A 3EXTA 1XLEA 2NT1A 3TVAA 5EFDA 1VBHA 1WO2A 5D38A 2BP1A 2CNCA 3PTMA 3QR3A 2VI0A 5FESA 3ORWA 3IWPA 2FVLA 4W7VA 4ACZB 3NG3A 3Q45A 4M6VA 4I90A 1JEZA 4JTCA 4FPSA 2PMQA 3KX6A 4CU7A 3MB9A 1X6NA 4RK8A 3WLMA 4AZHA 2WSPA 4DPQA 2FZDA 3O6CA 3W1AA 2OMAA 5BNKA 3QPEA 1P0BA 1GW9A 5HPOA 4XTDA 5D04C 5C7VA 3NQ6A 1KTNA 1HGWA 1A47A 2NQZA 4IP4A 1EF2A 2QCLA 2WW5A 1QK0A 2G97A 4D71A 2ZE0A 1J79A 4KFPA 4ATDA 5CSYA 4AF0A 2DIEA 3VTRA 3FJ6A 4X2RA 2WSRA 1NF0A 5D8WA 4NX5A 1IIHA 1KFLA 3BDKA 4QS5A 4ZOCA 1LM1A 3BICA 1BSIA 4MB5A 4Q3MA 1TV8A 1A5KC 3A5FA 1VFOA 3A23A 2CFFA 4GRSA 1VP5A 4F9DA 4LUIA 3RM9A 3AHVA 1Q6OA 5GQBA 2YYUA 4DXKA 3F2BA 1SO4A 2CPUA 4NJJA 2VFGA 2V69A 1T7LA 2WZTA 2AAAA 3OHIA 3PNZA 3BMVA 3DESA 1JZ3A 4JX6A 3ENLA 3CIVA 5ENLA 4C6LA 3WQWA 3OGRA 1U33A 4HK5A 1I2OA 1ZCCA 4KFNA 3TYDA 2CKSA 3P60A 4L5ZA 5TBOA 1MRQA 4HSOA 2UY4A 3WJWA 4JTLA 1GCYA 4AY1A 1FVPA 2F2HA 2XGBA 4RX0A 4B90A 1XF0A 3ITYA 3VIFA 4PZVA 3FSTA 2R6OA 1KM6A 4JTEA 2DUZA 3EWDA 4GI6A 2FFCA 1UUOA 1CGWA 1CNVA 2OSYA 2HISA 4UIOA 2ZICA 1VFMA 5DMMA 1V8EA 1XH1A 4ZXLA 3C3NA 3E02A 6XIAA 1QJWA 3AXHA 2YW4A 5BRPA 3R6IA 3ZFHA 2VTFA 1KM5A 3QOKA 3NEHA 2BXZA 3DIPA 4MNLA 5MKGB 3NSXA 3H2EA 5F4SA 4AY8A 3OZYA 2WSQA 4FI4A 3S9YA 1SZEA 2DQWA 2D23A 3B8WA 4AVOA 4E2DA 4GYJA 1WX0A 3W7CA 1IEIA 4CUCA 3GVVA 4IOTA 2B7NA 4Q8OA 1VCVA 6PTDA 4DELA 3TYEA 1JJKA 1AZ1A 2Q3RA 2DZSA 4ZOBA 3F2DA 3TLLA 1W8GA 1NDZA 3WQOA 2PTZA 2OT0A 1MFUA 3WDIA 3PFMA 3UZ5A 5TIMA 1AH4A 4MM1A 2YJQA 2ASHA 1DJXA 2Y7GA 1UZ4A 4AIOA 2Z7KA 3DCPA 1XLKA 3OZPA 2EF9A 4DUVA 4A2SA 3C2VA 3AIWA 1XQKA 4IFRA 1J0JA 4NAFA 2O92A 2Z1KA 2QDGA 1U22A 3PG9A 4YVVA 1W2PA 2GJLA 2QPUA 1D7KA 1Q5MA 3BV4A 2QF7A 4JQ1A 4AEFA 3WLIA 2YBTA 3BG3A 3SADA 1WKYA 1J2WA 3CL7A 1PZ2A 2VOTA 3SURA 2VR5A 1EEXA 1M04A 3B0UX 5I79A 1JNDA 1D3GA 1Q45A 4Z17A 3ZJ7A 1DQUA 1MEIA 4Q4QA 3LXCA 3WMBA 1GWJA 4DBSA 4RV3A 2XIBA 1LCOA 2XVNA 4S3AA 3PJTA 5CZSA 2OELA 4H6QA 4CNPA 1IZJA 2J8TA 1E6ZA 1KM1A 2WJEA 1UASA 3LMYA 3R10A 1PIIA 4Z2JA 3HQPA 2BTMA 1NQ6A 4UQBA 3EZ4A 2YXOA 3T4WA 1QI4A 5CLTA 2WV8A 2FGBA 2QHAA 3T07A 4E3VA 4NAEB 3WELA 3UXIA 2F9RA 3C3UA 4GCXA 4V1YA 4IT1A 3OQ8A 3O7UA 1VGAA 1E1CB 3AYVA 4H7ZA 3V35A 3BAJA 4G2DA 3R8HA 1QPKA 2C7FA 1M9HA 4AYGA 4JTQA 1OBAA 1R9XA 3P0XA 3ZYZA 1XC6A 3HURA 1VFHA 2CWXA 3BLFA 3GSMA 3BTNA 2J47A 4MFEA 3BH4A 4EXQA 1XLJA 3NEVA 2A2IA 4CQCA 4MPQA 2WBKA 1G4TA 1K02A 2Y8UA 1QI3A 2WMIA 4E38A 4J3WA 4AW7A 4Z2IA 1XBVA 3KVMA 1DHKA 1TWSA 3H6OA 4PTXA 1LWHA 1AFSA 3ELFA 4W89A 4UZUA 4D6JA 4HPXA 4YIWA 1W6TA 1ITQA 2HQAA 1P1XA 4YXGA 1AZ2A 5C2GA 3HGOA 4LC6A 3PZUA 1S2TA 4K3ZA 4D6HA 3EWUA 3TXZA 1WA3A 5F2GA 2FLIA 3TJ4A 5DX7A 5FEWA 1TJ0A 1Z8AA 3AMCA 1OCBA 4G7FA 1W37A 2V30A 5DMLA 4LOCA 2J9XA 1TX0A 4UQAA 1T0OA 2ZX7A 4UTUA 3B3DA 3BQ6A 3ZT7A 3MI2A 1H41A 4FF7A 5H1WA 4ZVJA 4PCFA 2FQIA 1TMLA 2PGEA 4MJMA 4JD4A 1NQKA 2YCEA 2P8BA 1V79A 3SCUA 4PH6A 3C0QA 1BTCA 3M0XA 1V03A 3N15A 3PFRA 4FXSA 3URQA 2TAAA 2DDXA 2WB5A 2QMKA 2NVCA 3Q37A 3N6HA 4DQWA 2VD8A 2PF0A 1PVNA 3QVQA 1VJZA 2DQXA 2BHYA 4PCSA 2OR2A 4EWND 1JZ4A 1SPQA 1BYBA 3FJ4A 3ARQA 2C79A 4NHVA 1QWKA 3KM8A 1P0KA 3M47A 3XIMA 5B7ZA 3OBEA 3K8LA 1NWRA 2PZ0A 3AJ7A 3IJ8A 3NZ1A 1WKEA 4KRZA 3NQ2A 1KRBC 3I3EA 4W93A 5HWNA 1VPYA 1OCNA 2ZXQA 2FZ9A 4XWUA 3WEMA 1EJUC 5CEWA 3U48A 3TKFA 3DHFA 2PURA 4JTFA 3NIYA 3SO7A 1CECA 3GB6A 3SRDA 2W92A 1JF5A 4S3KA 1Z89A 4Z2GA 1XCWA 5ABEA 5I00A 3A3XA 4OFCA 4AD2A 2YZRA 2JKPA 4S3CA 4I3GA 4NZ4A 4O1BA 1OGGA 3AXMA 4RDZA 4PUKA 1EZWA 2G5WA 3TONA 2WOQA 2ODOA 2DZAA 9CGTA 3KDOA 3QY8A 5JBFA 2EPHA 3FA3A 2ZTKA 2X1RA 1OD0A 1POJA 3TTQA 3BLDA 3WH6A 3AXXA 1KM3A 4INFA 2I57A 2O9PA 4IIBA 4QEEA 1LQAA 1R5YA 3OVQA 1V7AA 2WANA 2AQWA 5KSWA 1FCUA 1SGJA 3EDDA 4AWSA 4JDBA 1BLIA 4JEJA 3S5YA 3W6MA 3O8AA 4CN6A 1RBOB 2CETA 3N6JA 3CUXA 2A6NA 2PDPA 4F2UA 3S2LA 3IJIA 1EO5A 1A0CA 1S2AA 1QW9A 1A49A 3W72A 2V8ZA 4Q33A 1I2PA 4JIRA 1TTPA 4OTKA 3CL6A 3RCMA 1B9ZA 1FWEC 2Y1HA 3UR7A 2QUNA 3UWUA 3VO0A 4GA8A 4JTKA 2CW6A 4I7VA 2Z1SA 2WMKA 3CAWA 4L65A 3PULA 3TTEA 1KXVA 4UTTA 1YQ2A 1YPFA 2F38A 2PP0A 2R1KA 1WXZA 2VUYA 4FHAA 3B0PA 3O6AA 2WMFA 4EVZA 1JDEA 2X0SA 5LXXA 1HL2A 1R2TA 1Q7MA 4QR6A 2YCLA 5BRBA 3AIQA 1EDTA 1IEXA 2GUUA 1ZHAA 3UERA 3E38A 4JFTA 3MUIA 5CSSA 2INZA 3UXKA 1XFBA 1IZKA 1UD5A 5K4ZA 2W0UA 4MKSA 3ONCA 2A3CA 3A5VA 4AZ7A 1CW2A 5BU9A 3O6YX 3NSMA 2Z2UA 2GVJA 1NWUA 3B9DA 3DERA 1PO9A 3AZRA 3NZPA 2UWFA 1ZRQA 1H49A 1YADA 2YKKA 1OHLA 2VOMA 5LNUA 1J0ZA 3RUBL 1N8IA 1RQEA 2IS7A 2QMJA 3CPUA 4R7JA 2V38A 1A4MA 1P43A 5ECUA 2VFFA 3TR2A 2YL5A 1QHZA 1B3ZA 2ACSA 5REQA 3IARA 2YA0A 3OZMA 3KWSA 3C2FA 5CPLA 1AVAA 3VKBA 4CCZA 4U3CA 4TV6A 5T9BG 3H21A 3NDOA 3SN4A 1SUXA 3NO5A 3GTHA 2E9LA 2FJUB 4ZO8A 5CC6A 3QC0A 3W2NA 2V82A 4IXXA 3ANYA 4Q7NA 2WVSA 4ALDA 1F9CA 1ZJAA 5KITA 4L6DA 2F2KA 4ZL1A 2W79A 2XVKA 4RDVA 1TRDA 2X1TA 3BPWA 4DB7A 4C7DA 4LB4A 3VOGA 2WMIB 3NOEA 5DT5A 4E3TA 4PSPA 4F2BA 2HE8A 3MV01 2QIIA 3FGCB 5ABTA 2WHKA 4JCMA 2W3ZA 3THCA 1RR2A 3P82A 4FXFA 3UCCA 2PWGA 3KCLA 2VL4A 3TQ0A 4K1GA 3UPBA 1KGWA 4LYPA 4BI7A 3OZOA 2GJRA 3LPPA 5JH2A 2HZGA 1JFHA 2PDKA 4TIMA 3H2OA 2OQYA 1XLBA 4HNUA 1ISVA 1W0MA 3SJNA 7PTDA 9XIAA 2ZRVA 4B5TA 1KBLA 1E6PA 1P7TA 5C8BB 1PWMA 1SZGA 1XD1A 2BDQA 5FSDC 1TWZA 2O4MA 4QAIA 4PRRA 4DWSC 3JS3A 1F3XA 3C61A 3NQAA 4BCEA 3E6EA 4DUXA 3U57A 1OK6A 1VS1A 2VP8A 2PE4A 5CBBA 4YCPA 5E1QA 5LIYX 1AG1O 1UBSA 4LY8A 1XP3A 2O4QA 2NQJA 2PBOA 2WM0A 1I9CB 4E8GA 4ZMGA 3GC2A 4KPLA 4XO7A 4C5ZA 3APTA 4BFAA 1SZRA 4S3EA 3LQGA 3RPDA 3RU6A 4O52A 3PWAA 1EPVA 3DKLA 3LENA 1KBKA 3BSMA 1YDNA 3NQGA 2GSEA 3HGRA 3TNOA 2V2CA 3CO4A 1R86A 5AVHA 4K37A 1F2JA 3EAUA 1QOXA 3QR1A 2ISVA 3P93A 7REQA 3I6RA 3FNDA 3LGDA 4S23A 4OV4A 1UKPA 1PX3A 3BCFA 2QJNA 5J8LA 3EKZA 4DUWA 3MUY1 4AX7A 3DOPA 3MSYA 1CGVA 5A2BA 2JALA 3CWOX 4GFIA 4LC8A 1E15A 5C0QA 1OB0A 3WBWA 1V77A 2LLEA 3DFHA 4L9XA 7CGTA 2XU2A 2BX7A 3WX7A 1FHLA 4O17A 1OFRA 3GNOA 1NDVA 3TXVA 5CCZA 2FB2A 1O1HA 3G8RA 2V5JA 3IIXA 3FVMA 3L4TA 4LEQA 2Q09A 1G6CA 3PBMA 3E0IA 1XYMA 3ARPA 1KC7A 4H9MA 1W31A 3FYOA 2GDQA 5F2LA 3WFAA 4M29A 5EMYA 6ENLA 1FY6A 4P5UA 3F5KA 1P4CA 1SJAA 2QJMA 4QHRA 3LEPA 1XDJA 3TJLA 3RILA 3C6CA 1OJXA 3VC5A 1KCLA 4IISA 4DVOA 2VX6A 4QDWA 2H9AA 1KLYA 1R9YA 2ZRXA 1JNEA 3AIUA 1K8XA 4MDOA 1F6PA 4KS0A 4LF1A 4AYSA 4Q4KA 1IXQA 1ME8A 3U2ZA 3UZWA 4AMAA 1VB9A 2CESA 3RN6A 1JGIA 1OINA 3U2OA 3PUOA 3VM5A 3T42A 1GONA 1M53A 1BTMA 1S3TC 2HVOA 1IF2A 4M6QA 1NDYA 5K2ZA 1G67A 2OO0A 2J4GA 3KOWA 1KGXA 1VJSA 2XWEA 3DX5A 1R6WA 2DZUA 4AX6A 5M3WA 4MDPA 2GQ3A 3GTNA 3I10A 3U3HA 5EMLA 1G94A 2G50A 4LAOA 2A7NA 3FV9A 2VZSA 1DIDA 2VC6A 3LHWA 3UPWA 2WBGA 4H19A 4B5NA 2HMCA 3UZJA 1KLZA 2YCLB 3VINA 3W1UA 3NL2A 3KVLA 3OLDA 1D7FA 4XVDA 4X61A 3C8NA 3PZOA 3E0VA 3H4WA 3AWNA 5E9AA 3GHUA 1WXYA 3WEOA 3PUDA 2ACRA 4GCAA 3GW3A 1TE6A 1OG6A 5I0DA 1RHCA 3LSBA 3MI6A 4Z1BA 3WNLA 1M65A 3O1NA 3NXFA 3CAKA 2BOGX 4QITA 4Q32A 3I3BA 1XIGA 3DC0A 4JX5A 1UQZA 2XH2A 1Q2RA 2GJXB 4XZ9A 4JIQA 1W9PA 4YYCA 2OYLA 4MWAC 3SCQA 2YFNA 5C54A 3MUCA 4AHPA 1LL6A 4M1RA 5I3KA 3GHTA 1PSCA 1CB2A 4S3DA 1L8NA 1OM0A 5ABGA 1A5MC 1Q7QA 3ZT5A 4JN6A 1UIPA 4IF2A 1LG1A 4NZ5A 2D22A 2H90A 1UR2A 2OZ3A 5BU6A 2DW6A 2HEJA 4LNYA 2A7PA 3SY8A 3IGSA 1AH3A 3RAOA 1RLCL 1VLIA 2WKGA 3LK6A 1XBYA 1VPXA 2ZYFA 2GDUA 4MAVA 1GUVA 1MWOA 1V0LA 2I16A 1FHVA 3WBEA 5HOSA 2Y5JA 3NGFA 1BWKA 2OSWA 3HOJA 1V6VA 2NT0A 4S39A 1X38A 3WK3A 1AD4A 3AYSA 5CJMA 3M6DA 5H91A 3GK0A 4FIRA 3N9SA 1V6XA 3VMNA 2Y5SA 4PUEA 3LCWA 4NYUA 4R34A 1H61A 4H2CA 2PDMA 3MHUA 3LNPA 1F74A 3O07A 1OX4A 3PUGA 4Q4SA 3ZM8A 5IHRA 2VZVA 4XSMA 1YDVA 5EMJA 5B7YA 3SCRA 3IAPA 1R0MA 3CS2A 1I6NA 2PDGA 3T1GA 3U2EA 2Z0IA 3UW6A 4XKMA 1W1VA 5EGRA 3PZVA 4LNCA 3SQLA 3SN0A 1XUUA 3CXOA 3EOUA 5FJPA 3OIHA 3WBYA 2GVGA 1JXKA 3CUJA 5FEZA 3T8LA 1JCLA 2RFGA 4F0HA 3POCA 1OCJA 3THDA 3WD3A 4GNVA 1SSGA 2BLEA 3IJQA 3P6LA 1TWDA 1PIGA 1Y0EA 3SGUA 3QKEA 2DT1A 4DNMA 1F6YA 5AC4A 4RE3A 4UMBA 4E8DA 4KT2A 3Q2DA 4UQEA 3BLOA 4B92A 4WKAA 3CHDA 5JVLA 4W87A 2J13A 3AIVA 1ZGDA 1SFTA 3CMJA 2BV9A 3S8HA 3B9NA 1QXLA 3UWZA 1B3WA 1VENA 1DE6A 3V75A 1W3TA 4PMUA 2Z6IA 2J7EA 2OB3A 4MFDA 1BGGA 1C7TA 2D69A 2X2YA 4HJFA 2RDTA 4U31A 5HATA 1AK5A 2YCKX 4RNHA 1GJUA 4GC4A 1LORA 5H8MA 1JAKA 3FDKA 2VQUA 4AFYA 1WAUA 3QHOA 4BK9A 4NZCA 4UR9A 2ISDA 3UPMA 4GVGA 2V68A 4PTVA 1DHPA 3GR8A 4E4PA 3KL5A 4W4QA 9XIMA 3DFPA 2PRLA 5CZJA 1BKHA 3U0HA 2ZBTA 3SR7A 4NJKA 4J3UA 3PBYA 4Q4PA 1XL9A 1Q8JA 2JKAA 4HZ6A 3OA5A 3FYYA 3VOJA 1BQCA 2ZUVA 2F7FA 4MJZA 1LT8A 3T40A 1XSIA 2AGKA 2XZ9A 3QBUA 4H41A 3GR4A 1UA3A 1IT7A 2OU4A 3K8KA 1H1ZA 3W4RA 3BJSA 2B4GA 1K4HA 1EWDA 1EWEA 2P76A 3A9BA 3VIOA 5BOEA 1V4YA 3MP4A 4CNSA 2HDJA 2PS2A 1K8YA 2OO6A 4Q6JA 4UTHA 3E5PA 3E2RA 3VX1A 4R33A 1FWWA 1PWLA 4GH3A 1G5AA 1M5WA 3VK5A 2A79A 1RD5A 2WNWA 2E9MA 3ABXA 3IANA 1TSIA 3OVRA 4R3UA 1QRQA 1EJWC 4N9BA 3ZWSA 3AOFA 4XAPA 3RMEA 4DJFC 1KV5A 3KRSA 4WX2A 3SRKA 1IE7C 4HSNA 2PC8A 3K30A 2GWNA 3KOYA 4YLWA 3MT1A 5FF2A 7A3HA 3M64A 3WMSA 1AL8A 3TFXA 4EWJA 2W5FA 3NVTA 4PODA 3RJXA 1CXIA 2OWWA 5HWMA 1OGSA 4GX8A 2IQTA 3COTA 4J7RA 5AC8A 1YTDA 3P67A 5HAOA 4EPKA 4QEHA 4JAWA 2FHFA 4LYKA 1X6LA 5AVNA 1HJWA 3PAOA 4R9OA 4IIDA 1KKRA 3AICA 3RCYA 3RHGA 3L4YA 2VCBA 3CZ8A 4NF7A 2A4AA 1GKQA 1V3JA 2VEIA 1SO5A 4AIBA 3DFYA 2O9OA 1E5NA 3M0JA 1EX5A 1XIJA 1DJIA 1FKXA 2BASA 2BMBA 2WAGA 1DE5A 1DJYA 1QT1A 2ZWYA 4J40A 1C8QA 3MDUA 1T96A 1YEYA 4MOZA 3B0YA 1JCJA 1S46A 4TU1A 5L6UA 5AYIA 3SCPA 2WHJA 1B3YA 1W3KA 1EBGA 3DYOA 3GNNA 1QATA 2YGYA 1H51A 4ADSA 5AHFA 3MJMA 4D8LA 3PK7A 3LCFA 3O15A 3LHVA 3SUWA 1UR9A 4GKLA 1QDSA 4TTGA 3FKKA 4EACA 1RH9A 3U9IA 3GIYA 2ESCA 3UWVA 1MW3A 4WY0F 2PBGA 1DP0A 3BG9A 5JUVA 2VX7A 1ZB5A 3CH0A 4LVBA 4ZXOA 4J27A 1IV8A 4O50A 1MFVA 4HPJA 3MZ2A 4HU3A 5DMNA 2AAMA 4IICA 3K2GA 2E8ZA 4AZ5A 3GNXA 3ITLA 2XGIA 1UB3A 4ICMA 1XIBA 1VJIA 3M6YA 1JI1A 1UPPA 3CZJA 3FXGA 3RYSA 1W5PA 2ZWZA 2H3BA 4ENLA 4B3LA 1HP4A 3GXNA 4B5UA 3GKAA 5CXPA 2IKGA 4ZTXA 3RU8X 3W70A 1OX4B 4Y9OA 5A8OA 3MVTA 4ZO9A 2DGAA 1QBBA 4I9MA 2E6YA 2Y89A 1E6RA 4ZR8A 4S3GA 3PWGA 2SFPA 4AZ6A 1H4PA 3MCOA 1EP2A 3W6LA 3A4AA 1KTCA 1PTAA 3D3AA 1K9FA 3NCOA 2F6XA 4DPPA 1B5TA 3LV5A 3C2RA 4DUOA 5AYYA 2AL1A 4HN4A 3EKGA 1BRLA 3WUBA 1YNQA 3DEQA 3GU2A 4C1KA 3EWXA 4GVIA 4ICNA 2J25A 5AB3A 3URBA 3QGKC 4TX6A 2ISSA 5A8NA 2PD5A 4O10A 3VNIA 1DYSA 3B4UA 1RBAA 4E4FA 2HXTA 5A2AA 2NXIA 3CHCA 4Q8NA 1MMFA 1BYCA 3UY8A 2NW0A 4QDMA 2OFJA 1MUCA 4DO6A 4GC3A 3THAA 4WF7A 3ARWA 4NVTA 4IPLA 3HMJG 3ALFA 1QUMA 2EHHA 3WQEA 4Z1DA 2VFDA 5DXXA 4Q4MA 1DTUA 3EGJA 2YBVA 3HN3A 1V93A 1J10A 2OPJA 2P3EA 4WSJA 4XBKA 2QKFA 4O4WA 4UTWC 1GORA 1VFTA 2O7SA 4WJXA 1XICA 2J9ZA 5IDIA 2NQLA 4BWLA 3ITVA 1R2SA 3Q94A 2G3MA 5E5CA 4E2VA 1OIFA 4AUBA 3ZLFA 3LB0A 4R53A 2X16A 3P84A 3ZJKA 1TE1A 2HNEA 3O6DA 1EF3A 4LCSA 4KEUA 4GUFA 1TG7A 4WXYA 4D6IA 2W27A 1NAL1 1WZAA 3HG2A 1IR1A 2XJ7A 1J8VA 2ALDA 2WM1A 2PLKA 3WFZA 3MV11 2WMGA 1LOLA 2GDVA 3H4XA 3LCGA 3CHFA 3NVDA 2EEXA 3QSRA 4L4LA 4CVWA 4OWGA 1TV2A 2CITA 5CZ0A 4V27A 4ML9A 1I4NA 1CLVA 4UOQA 2Y7FA 1JD9A 2OXNA 3GZAA 1QI0A 3DYPA 3W73A 5C55A 4OECA 4JEQA 4L80A 3TOYA 4XBSA 3WBXA 3P80A 2CZVA 2EG6A 2E8YA 4LBUA 2DIJA 5GNXA 5D03A 4K7YA 3W26A 2PODA 5GVJA 2X30A 1NY1A 1HKMA 1UP0A 1JPIA 1O5KA 3WLLA 1MW2A 3WLSA 1BWVA 5E0FA 5DBTA 3W7HA 3S0CA 4YS1A 5DT7A 3JRKA 3KAOA 3E0LA 3T81A 4JICA 4B15A 3K4DA 5IXEA 3L4XA 5M17A 4G1KA 1AA1B 4N2YA 3GY1A 2FIQA 4OHQA 4C91A 1VHCA 2QJHA 2YYTA 3CU2A 1LLZA 2OVLA 4J5NA 2OEJA 4UFHA 4ZCWA 1WPCA 1ISWA 4XK2A 4H3DA 4GIRA 3EEGA 3P2VA 2E7FA 2P88A 8XIMA 4MYAA 4IMCA 4D6EA 4WK9A 5I2UA 1T40A 1RY0A 1JZ6A 2KAUC 4IQLA 3UGRA 3LLFA 4AY7A 2EKGA 4GI9A 3N9KA 4L4MA 1GVYA 1M7JA 1U1UA 1NWSA 1KW1A 3R5EA 5GJPA 1D9EA 1ZL1A 1TELA 2XWDA 3N2TA 3ZLHA 4GQ0A 4RUBA 2XPKA 1TCMA 1L2QA 2EGZA 4KF1A 3E1F1 1HN1A 3VKAA 3CEPA 1U5JA 4GI8A 1GG0A 3OW1A 3A47A 3EKLA 3P0WA 1N2VA 1UUMA 3U2CA 3WUFA 3CLMA 3ANUA 2ZUWA 3ZOAA 1WOBA 2REQA 2FGZA 2JIWA 1MQRA 4PB3A 3NFUA 1EJTC 4JIEA 2V5DA 2CZDA 1G7VA 3H2MA 2Y88A 5ABFA 4LY4A 1XYFA 4FB7A 3W3OA 3WLTA 3M0IA 3R0UA 2VDGA 5DBUA 4XKYA 4KWUA 3G1XA 1C29A 3DH7A 3T05A 1M7XA 4L9ZA 4XZIA 4EAMA 3L4VA 5CZKA 1M01A 4QROA 1FH7A 1FWFC 1NOUA 3VNMA 4MKNA 4XB3A 3BANA 4V2XA 2NX3A 4NZFA 3VCRA 3G1HA 2I9EA 4B9ZA 1RJQA 3H8AA 1R85A 3PBWA 4HKPA 3LGEA 4FR6A 2HCVA 3ES7A 2X41A 3Q65A 3JZEA 4NL1A 1VZWA 3GXFA 4FSAA 1OFBA 4QISA 1EP3A 3KOXA 2C19A 1UR1A 4H6KA 4F2TA 2XIQA 2QZRA 5A69A 3V0SA 3CB8A 2POZA 3QHNA 5GPRA 3S6OA 2AQOA 1EZ2A 4GXWA 4U2ZA 5DELA 2P10A 4XZMX 5EYWA 1D2KA 4KCUA 3KBNA 2P0OA 2QAPA 4PUWA 1RXOB 1ZQ5A 2ZZ4A 3VYLA 1BRLB 1VBRA 3B03A 3W74A 4DZHA 5HJYA 4N7QA 3NQFA 3F5JA 4RPPA 4YTRA 1XIEA 3WBAA 1CXEA 2YXXA 3IJLA 3JUGA 4PMDA 2PGFA 3YPIA 4US5A 3DZ1A 2ACQA 3QZEA 3STFA 2PLCA 2Y24A 2OTDA 2V2DA 3U5YA 3GBDA 3DHPA 2A21A 3SUVA 5E0KA 3M1ZA 3ZLGA 4FEZA 4WD0A 1JGMA 3F4WA 5D9OA 1A3HA 1X7FA 1FX6A 1VYPX 3B4YA 3N18A 4ILSA 1XIIA 1W3JA 4CGTA 3CTTA 5D2VA 1WQ5A 3NL5A 4JY9A 1Y7VA 4GJJA 3BW3A 1L6FA 5E0CA 3WDJA 3MBFA 3B8VA 1RJRA 3VNLA 2OEKA 2J66A 4JTRA 4EXAA 4QNEA 2XFRA 3TCSA 3B06A 3AIBA 5D37A 4IPNB 4JFUA 1XCFA 4JS3A 5A6AA 3ABSA 1TUFA 4IGNA 1E9IA 1KBJA 3ZS4A 3TQPA 4BQ4A 2UY3A 2VXNA 4I6VA 1ITUA 1XQLA 4J9JA 4NUWA 1GVIA 3QKZA 3R79A 4GIAA 4GY1A 3I7QA 5LGZA 2VZTA 4BF7A 4JGDA 3R11A 4EPEC 5HBFA 1HKWA 2X2GA 2X1UA 1OY0A 4LCQA 2XZ7A 1W9VA 4GE8A 2X7WA 1YBQA 3W9ZA 3IUIA 3TYAA 1DJWA 1GEHA 1HF6A 2GSJA 2HVNA 5FF4A 3GDBA 4NY2A 3ZQ9A 3QM3A 1EBHA 1W1A1 3THQA 2VQTA 4FZIA 1SR0A 2VUNA 5D09A 3S2JA 1WNOA 3HV9A 3BUVA 3PZTA 4W5UA 1Z42A 2PU0A 4YL2A 2FVMA 4GPNA 2Z25A 3BL3A 1U2YA 3G1FA 1MDRA 2JEPA 2QS8A 3LN3A 1I8JA 3REQB 1M7PA 3CZKA 5FF3A 5HINA 1U1JA 4AVFA 4MNMA 3MW7A 3EBVA 3SDOA 2DVXA 2CXGA 3F2CA 1V6WA 2D73A 3NAVA 2YXGA 3AIRA 4XZLX 5I03A 2PAJA 4F0MA 4RZ4A 4E8CA 5DQPA 1KRAC 5HULA 2H3DA 4RXFA 2HBXA 1A3XA 1W17A 1JUBA 1RP8A 4K7VA 4RNFA 3OBKA 3B8TA 1J0HA 1EUAA 4H8UA 4KWWA 4MMWA 1E0XA 1PCKA 1OYCA 1O5XA 3LV6A 1VFSA 5DN1A 3M46A 3T0AA 1J6PA 5CG0A 1G7UA 1XSKA 4BZYA 2W61A 5F1VA 2DZPA 2PD9A 4AWEA 3OYXA 4FLSA 5JXQA 2IKJA