3ZQ9A

Structure of a paenibacillus polymyxa xyloglucanase from glycoside hydrolase family 44
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
512
structure length
512
Chain Sequence
AKTITIKVDTFKDRKPISPYIYGTNQDLAGDENMAARRLGGNRMTGYNWENNMSNAGSDWQQSSDNYLCSNGGLTQAECEKPGAVTTSFHDQSLKLGTYSLVTLPMAGYVAKDGNGSVQESEAAPSARWNQVVNAKNAPFQLQPDLNDNYVYVDEFVHFLVNKYGTASTKAGVKGYALDNEPALWSHTHPRIHGEKVGAKELVDRSVSLSKAVKAIDAGAEVFGPVLYGFGAYKDLQTAPDWDSVKGNYSWFVDYYLDQMRLSSQVEGKRLLDVFDVHWYPEAMGGGIRITNEVGNDETKKARMQAPRTLWDPTYKEDSWIAQWNSEFLPILPRLKQSVDKYYPGTKLAMTEYSYGGENDISGGIAMTDVLGILGKNDVYMANYWKLKDGVNNYVSAAYKLYRNYDGKNSTFGDTSVSAQTSDIVNSSVHASVTNASDKELHLVVMNKSMDSAFDAQFDLSGAKTYISGKVWGFDKNSSQIKEAAPITQISGNRFTYTVPPLTAYHIVLTTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Activity of Paenibacillus Polymyxa Xyloglucanase from Glycoside Hydrolase Family 44.
pubmed doi rcsb
source organism Paenibacillus polymyxa
molecule tags Hydrolase
molecule keywords XYLOGLUCANASE
total genus 184
structure length 512
sequence length 512
ec nomenclature ec 3.2.1.151: Xyloglucan-specific endo-beta-1,4-glucanase.
pdb deposition date 2011-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12891 Glyco_hydro_44 Glycoside hydrolase family 44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3zq9A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3zq9A02
3SCOA 1QHPA 3BAJA 3KL0A 1OT2A 1J9YA 3WBEA 3A24A 3QR3A 2FHFA 3M7SA 4GZIA 5CPSA 2XWDA 1WDPA 3D4ZA 3WIJA 2X2IA 1JZ3A 2V5CA 3N15A 4J3VA 5A6MA 4D6CA 4J3WA 1E6PA 2CBUA 3CZNA 1GOIA 5AY7A 3EDDA 3WEOA 2J7GA 1QI0A 4D71A 3VGEA 4J3TA 2ZUUA 3WQWA 2EXOA 4PRWA 1KXHA 1VFFA 1WNOA 4AZ5A 7TAAA 3F4VA 2W67A 1H2JA 3AHXA 2EABA 2YA0A 1GZJA 3WH9A 4J28A 2J25A 1D3CA 2YJQA 2ZUWA 1CECA 5BXRA 1UD3A 4AYSA 4AZGA 5JBDA 3CUIA 4WK9A 4FLQA 1MW2A 1UWUA 2DT0A 4E2OA 4YN5A 1GVIA 4FLRA 4C7FA 1GHSA 1VF8A 4AD0A 2WC7A 1UWIA 3D4YA 3FN9A 4ACYA 4IPNB 2C7FA 3B8SA 3B9DA 4ZEPA 4TXEA 3UESA 1FA2A 1XD1A 8A3HA 4P8WA 2GVYA 1E6XM 4CUCA 1MXGA 2HVMA 2YFOA 1SMDA 1RH9A 4W88A 1XCWA 4UFIA 2WK2A 4V28A 4BS0A 5E9AA 5CLTA 2VX7A 3FW6A 3SCPA 4CCEA 5IFPA 2X2YA 5LYRA 4EAMA 3D3AA 2E40A 2D0HA 1GQLA 3HG4A 3L4ZA 3HG5A 1QOXA 1O6IA 3AFBA 3WQ6A 2YL6A 4AEEA 2ZUVA 1H49A 3RPMA 5BXTA 2YBTA 2JIEA 3W4RA 2RGMA 3GXDA 1X1NA 1W3LA 1JXJA 1J0ZA 2DH3A 4B9ZA 1CPUA 3VX1A 3N18A 4MJ4A 3MU7A 2WMHA 4UFJA 4J27A 1C90A 2J7DA 4UTFA 2V3DA 3WY3A 4J7RA 2CEQA 3T09A 3KLLA 4DWSD 2DSUA 3A23A 1PZ3A 4PCTA 1E6QM 5I6SA 2GSJA 1G94A 2W63A 3PZ9A 2XFFA 2WVVB 1C7TA 3VGDA 1UKOA 5DO8A 4FK9A 4A4AA 4UOJA 3FY1A 3OZOA 4PMUA 3AZRA 1I75A 1PIGA 2XVLA 3OA5A 3BGAA 2BY2A 4OBSA 2F1AA 2PB1A 1B3XA 3BUIA 4GZEA 1J12A 2VO5A 1W2VA 4H7VA 2X05A 4PMVA 4UOZA 1E40A 1V3KA 1KTCA 5TD4A 4NRSA 1JZ2A 1E6ZA 2ZX9A 3N12A 2NW0A 3H54A 3WUGA 1BG9A 2F8QA 1BQCA 3N11A 3VIOA 1W9UA 3BC9A 3LX9A 3EMCA 4CCDA 3UG5A 2DQXA 3WQ8A 2IGTA 5BYWA 1RP9A 3AMKA 5CZKA 3CUJA 1LWHA 4PCSA 1UR4A 4KGJA 4FMVA 3BVWA 3AS1A 2DPEA 2B31A 4HA4A 2EEXA 1V6YA 3ZT6A 3AXIA 4W84A 3VIFA 2DT1A 4AZ6A 1US2A 1BYDA 4MB4A 4GPNA 1ITXA 2A3CA 2ESCA 5A8MA 1E4MM 4MDOA 2BXYA 1GQIA 1JL8A 4JKKA 2OYKA 1BVNP 4L4PA 9CGTA 2EADA 2OWXA 5FD0A 1JFHA 4P8VA 2X2JA 1V02E 1R46A 5D9PA 3GNOA 1R87A 2EAEA 3ARVA 2WCAA 3CZKA 1MVYA 3EJSA 2G8ZA 3POCA 3GZAA 4NXKA 4UQDA 1DWJM 4MTVA 2A3BA 3CMGA 1SR0A 1KXVA 3CV5A 1E70M 3O2LA 4RL3A 1RD6A 1B1YA 1ZJAA 1HJVA 1JAKA 3EMZA 7A3HA 2F1BA 3UCQA 3T0DA 4PTMA 1ZBKA 1UZ1A 5FIPA 3DHUA 2VCCA 2ZE0A 2WANA 1HVQA 1ITCA 1UH2A 3AIVA 3CPUA 1GHRA 2DSVA 3K8KA 3WDJA 2W62A 4MNMA 3UETA 3ZSTA 4JL2A 3ZR6A 3PN8A 3WL0A 5IDIA 1H3GA 5A3HA 4H41A 3WDRA 3MV01 2CBIA 4FNQA 1E43A 1M7XA 3W25A 1QI3A 2EACA 1CIUA 1QI2A 1UQYA 3WL1A 5IFTA 5ABFA 2VZTA 3ARPA 2V3EA 3EJUA 4JFVA 1PX4A 3MANA 4AD5A 2D1ZA 4OOUA 1UYQA 1E1FA 4AXNA 2WMGA 5ECUA 4UFMA 3DDFA 1TQSA 1DWHM 4W7UA 2F7QA 2WCGA 3B9EA 4AMWA 2G41A 1BG4A 2VR4A 3AYSA 3HZ3A 4WKHA 3ZIZA 3B9AA 3K4AA 3TTSA 3CO4A 2F7OA 2J7FA 3BLKA 3M6DA 3CHEA 3FHAA 3ECQA 2VC9A 4UOQA 5CJ5A 1JYXA 1B0IA 2CPUA 2X0YA 5AYBA 1VIWA 2Q8XA 1LL6A 4MAZA 5CQ1A 4UCFA 3HMCA 2XM1A 3CZ8A 2QF8A 5IHSA 1LL4A 1W9VA 4P7NA 2XGBA 3AZTA 2VZSA 2CBVA 2Y8VA 5C70A 4QCEA 1W2PA 2EPOA 2WMIA 1EHAA 1MFUA 4M82A 1V6XA 2A3EA 3VGFA 2YFNA 4J3SA 3A3HA 4QAWA 4EKJA 1XC6A 1EDQA 4QCFA 1R8LA 2FHCA 3ZR5A 5DF0A 2VRJA 1BF2A 3EJRA 1MQPA 4MNLA 3GBEA 3VNYA 3PTQA 3VU2A 4CD8A 3QOMA 1CGYA 3FAXA 3GXFA 1OINA 1PX8A 1TR1A 3KZSA 1H1NA 3VGBA 2VX6A 5CGMA 4D6GA 2XSBA 4CVUA 4AWEA 3WELA 1O7DC 4H2CA 1Q4NX 2YA2A 1R85A 1QI5A 3VIKA 1BGGA 1CLVA 1OD8A 3WENA 1W9PA 4D6FA 1WE5A 1KR0A 4S3KA 1B31A 1OD0A 4AZBA 1CGUA 2CITA 1UH4A 3AIBA 1V6WA 3GXTA 4GI9A 3VSUA 3L4YA 5GNYA 4HZ6A 3W6LA 5A95A 2WC4A 2D73A 3UEQA 4DUVA 3VINA 2XWEA 3BH4A 3DX3A 3ZT5A 1G9HA 3GXNA 3WD2A 1KBBA 4FLOA 3CTTA 4LGXA 4D6EA 1CXIA 2PWHA 1GORA 2W61A 1EXPA 3AZSA 3DX0A 4HTYA 3TA9A 5I23A 1H5VA 2ZUTA 2VUYA 3TTQA 4AEFA 1GQKA 3VTRA 5CGTA 1HF6A 3IANA 4OZOA 4GO9A 1C8QA 3G6MA 3ZJ6A 1WKYA 3WFLA 3ARRA 3VKKA 3WKZA 2VZUA 2XVNA 2XVGA 1S46A 3WN6A 3PZMA 1GOMA 2WHLA 2VURA 2GJRA 3ARUA 3A6OA 2E8ZA 4U31A 4ACZA 2W5FA 4U2ZA 2OLHA 1EDTA 1J0HA 3AIWA 1JDDA 1CBGA 4P7LA 3ARWA 3QOKA 4IISA 3HJEA 4R5EA 1IZJA 3WQVA 3I3EA 3AHTA 4EK7A 4TVDA 1V3LA 2XVPA 3A4AA 2UY5A 3LRMA 1E55A 3W28A 1V0NA 4MB3A 3SCSA 5DMYA 1E56A 2O9PA 5GNZA 3W27A 2FDMA 2BY1A 3CLWA 3DX1A 2GK1B 4N0RA 2Y5EA 4AC1X 1L8NA 3OLDA 2AOSA 2XG9A 3AI0A 4HZ8A 2J62A 3WH8A 4CU7A 2YIHA 4U5KA 3CZEA 4KRUA 4IUGA 1CGWA 1DWFM 3WUFA 1NM9A 3THCA 4W7VA 1QHOA 5AC5A 1BFNA 4JCLA 1E5NA 2YLLA 1OIMA 3PZOA 4PTWA 3VIPA 2ZWZA 4MPKA 4C7DA 3QGVA 4EANA 1U2YA 2CNCA 1MYRA 3W81A 2FH8A 4M56A 4OUEA 2WWDA 4OJYA 3AOFA 4UFKA 4M29A 3BUDA 5I3DA 1X6NA 1VJZA 1Y7VA 1UASA 3S5ZA 2JEQA 3LRLA 1E4NA 2XFYA 5ABFB 4ML4A 3ARTA 4GXPA 3S5YA 1B3ZA 4UQAA 1KB3A 1MWOA 3MMUA 4BQ5A 2FH6A 4D6JA 2CCRA 4GINA 2QMJA 7CGTA 1OGGA 3CGTA 4GIAA 1LF1A 3AMGA 2J4GA 1KCKA 2DIEA 4TVCA 4AYGA 3HU7A 2BV9A 1HP5A 3BCDA 1JI2A 1E71M 3W37A 1UG6A 2ZXQA 4DUWA 1ZB5A 1KXTA 1US3A 2WVVA 4BCEA 4HU8A 4B9YA 3WUBA 3SURA 4HA3A 1C8YA 2BVTA 1PEZA 2F7PA 4UFHA 3WNLA 2VR5A 1EGZA 4NRRA 1ODZA 2VRKA 2C8NA 1OIFA 1OSEA 3GTNA 1NOFA 1DTUA 3IGUA 1BSIA 1TQWA 2Y24A 1D2KA 3OGSA 4MAVA 1E6SM 1B3VA 1UD4A 1LJYA 1IT0A 1E15A 5EMYA 1TFVA 1E4IA 1VEMA 2PWFA 5D9MA 6CGTA 2E3ZA 4QDMA 2Z1KA 4BA0A 5HNNA 3EYPA 3LXCA 3LPGA 1W9DM 4FNTA 2BFGA 1W91A 1HJUA 2JF7A 3DYOA 2XGIA 1KBKA 4NI3A 1FHLA 4M8UA 1UA3A 5KZ6A 4W5ZA 3VD9A 3DC0A 3KWXA 2WVTA 3RO8A 3AYRA 4L4OA 4XX6A 3ARSA 5A8PA 4PUEA 4AD3A 1BPLB 3WH5A 2F2HA 2EQDA 3CUHA 2VTFA 2WKLA 5LA1A 3D51A 3WF0A 3NSNA 4AY1A 3GH7A 3PZQA 4Z2IA 4P7RA 4WF7A 1V6VA 4XB3A 2YL9A 2FGLA 4Y7EA 2JF6A 2E4TA 3WNMA 1NWRA 1MW1A 5CPTA 1HKJA 1UA7A 1WAWA 1CNVA 3MS8A 3NSXA 4HZ7A 1UZ4A 4AD2A 1R34A 2JFEX 4BQ2A 1TVNA 1XSJA 3LPPA 3VM7A 3MUY1 3W53A 1GUVA 4D72A 1EOMA 4WKAA 2QHAA 4W8AA 3GH5A 3I3DA 5EFFA 4PSRA 1C8XA 3VIJA 3CIVA 4KGLA 2F18A 3FAWA 5IXEA 5D8ZA 2ZUMA 1HIZA 2OW6A 2PBOA 1PJ9A 3DDGA 4UZSA 3VIMA 2E9MA 1NP2A 5LA2A 4JCMA 3ZJ8A 2O9OA 4ZE5A 2BNJA 2WW5A 4QLJA 2OWWA 1KXQA 4HOZA 1OGBA 2XHYA 1FFQA 3CZGA 5DFAA 2XPKA 1DHKA 2VCAA 3AISA 5GQBA 1UKPA 3N1AA 4CU8A 2WZHA 4UFLA 1E9LA 2YDQA 3GYCA 4QLLA 1AMYA 5JIWA 3QHMA 1DWAM 1HNYA 1K9FA 3GH4A 1M04A 5EBAA 2YLAA 3VD3A 3O6AA 1ISXA 4M81A 1G1YA 3PTKA 4M80A 3VMOA 1R7OA 1R75A 2CKSA 2GDUA 4HOWA 2FHBA 1QNPA 3SCUA 1CXLA 1WO2A 2YL8A 2NT1A 3PZNA 5A6JA 3DYPA 1E0XA 1KCLA 4AMCA 2J7EA 5A1AA 1FP8A 2F61A 1UWRA 4PN2A 4TTUA 2VT0A 4EE9A 4ACZB 1CYGA 4HOXA 3VO0A 3PZGA 1KGUA 2J74A 3CZJA 2OYMA 4FNRA 1ISYA 1JIBA 2XTKA 1CTNA 5I5RA 3PZVA 4DM1A 1ZBCA 1WZAA 1CLXA 5A2CA 3W26A 4JZ5A 3GBDA 4PMOA 1CGTA 4OIFA 4JIEA 3BAKA 3EDKA 1C7SA 2D24A 3OGVA 1EOKA 2E9BA 3PBGA 1ESWA 1A47A 5AYIA 1JD7A 4ZXOA 1GOWA 4AZCB 4ZE4A 1LG2A 4UR9A 5FOOA 3RIKA 2BHZA 3VGGA 2ZXAA 2Y8KA 2ZX8A 2BY3A 1NARA 1QBAA 1W3KA 4CD7A 3ALFA 4NF7A 1JNEA 4DWSB 4U2YA 1U33A 2ZX5A 2WKGA 4PSPA 4CN6A 1W1TA 2DSZA 2DEPA 4MB5A 4LYPA 3L4XA 4PBGA 4HPHA 1UHVA 2WBGA 2VJXA 4WJXA 2YKKA 3BSHA 3LXAA 3IK2A 1CXFA 4TTGA 2WLYA 1J01A 4URIA 3BMWA 5C8BB 3K4DA 4KRTA 1RP8A 3A4XA 3ARQA 4QP0A 3VMPA 1QHZA 4HMEA 4JAWA 1UKTA 3AQUA 1Q6FA 1GOKA 1VEPA 3IAQA 2J79A 2PWGA 1H11A 2CHNA 1H41A 1HKMA 2BHYA 3VD5A 5LA0A 4W89A 3EJTA 1MW0A 4JL1A 2IXUA 1BYCA 1I1WA 2OSYA 2XM2A 1NP0A 3L4TA 1JZ5A 3IAPA 1JDAA 1JFXA 3RM4A 2DT2A 2PC8A 4PMRA 4W87A 2UWFA 2HISA 4U3AA 3N9KA 1UD2A 2O9TA 5I24A 1CXEA 4W86A 1VB9A 5I78A 3ALGA 3ZSSA 4JHOA 1W9BM 1O7AA 3RDKA 3IJ8A 2ZXDA 4MADA 4WKFA 3A22A 3NSMA 1M01A 1WZMA 1G01A 3WNNA 3OLGA 1OB0A 3ARZA 5M03A 4FNPA 1QNRA 4W8LA 3NDZA 3EJPA 3M46A 1UR2A 1HJWA 1CGVA 3K8LA 1VJSA 4RE3A 1GOQA 4XUYA 5KEZA 5E0FA 3BVVA 3MUIA 3VOCA 2XVKA 3MUZ1 2WMJA 2Y4SA 1CXKA 3LXBA 1J0IA 1CZ1A 3AS0A 1JF6A 1K6AA 3FHQA 3THDA 4BZYA 5HXMA 5I2UA 3KL3A 4W85A 1ODUA 3F5LA 1Q6GA 4UQ9A 3VVGA 2G3IA 4LYQA 3W6MA 1XHGA 4YHGA 1LQ0A 4AMXA 4DO6A 3WDHA 3BUQA 2ZWYA 3VDHA 4N42A 4WSJA 3K1DA 3VUPA 4D6IA 1UD8A 3RM9A 3TTYA 3CH9A 4AISA 2E0PA 1J18A 1DWIM 3VD4A 4MNKA 1MQRA 4LXFA 3T2PA 3WBAA 5FL1A 2CERA 1GVYA 4MJ2A 3BAWA 2WZIA 1QWUA 3ARXA 1W3JA 1FFRA 1VFUA 2WHMA 1JNDA 3L2LA 3WF4A 1H09A 2E9LA 3WEZA 3HN3A 2XN0A 2AMGA 4MB1A 2WMIB 3WMCA 1PX3A 4DWSC 1BTCA 1HT6A 1L0PA 1E5JA 1QNQA 4AW7A 1OGSA 3WMBA 3BVXA 3MKKA 3AICA 1HJXA 3CHDA 4U5IA 2WPGA 4NZCA 3TV8A 3GM8A 4WIWA 3BVTA 2XUCA 1G5AA 3DHPA 1C92A 4GZJA 2CYGA 3MV11 2GFTA 2OYLA 4D6HA 1E0VA 4NZJA 6TAAA 1E6NA 2D20A 4FNUA 1U30A 3SIMA 3U5YA 3SUUA 5M3WA 1ECEA 2BY0A 5D4YA 4LPCA 4GI8A 3FNDA 3MMDA 3UG4A 3ZJKA 4B16A 4E4PA 4YPJA 3JUGA 3HG3A 1JZ7A 1NOWA 3T2OA 5FL0A 1V3JA 2YA1A 1Q6EA 3EDJA 3IJ7A 4JKLA 4NXSA 2V3GA 3OG2A 4HMDA 1KTBA 4XZWA 5ABGA 1PIFA 5E0CA 1TA3B 1JZ6A 4NSBA 1WZKA 4CD5A 5BRPA 2WCSA 1ZBWA 1B3WA 4HU0A 2JIWA 2ZIDA 4PTXA 5E09A 1TQUA 1EO7A 1GQJA 4UQCA 1KQZA 4K68A 3O9NA 3VDCA 3EBVA 2DT3A 3UG3A 4S3JA 3VPLA 2QPUA 1KR1A 1H0IA 1V02A 2ZX7A 3OLIA 1K9TA 1K9DA 2VVSA 4B3KA 1FHDA 4Q7NA 1KFWA 2EPLX 1R86A 2WYSA 3LRKA 2D0GA 2G3MA 1CENA 5BXSA 3MI6A 3GNRA 1NWUA 3VMNA 3VX0A 3U7VA 1H0GA 2ZUNA 2VOTA 2J8FA 1JI1A 4HA1A 5C71A 2EBNA 3L2MA 5I79A 1E1EA 1WDRA 1HVXA 1VAHA 4IPLA 3AHZA 2YBUA 3W24A 1TQVA 2FE0A 3L4VA 2X1IA 1HXJA 3AXXA 4CCCA 1B90A 4ATLA 3VDBA 1PS3A 2JEPA 2VQUA 2EPMX 4IM4A 4JFTA 2CETA 2CHOA 3D52A 3VILA 1HN1A 4A3YA 1MFVA 1BGAA 3A5VA 2F7RA 1W1PA 3AIRA 4WLCA 3ZMRA 5CLWA 4X0NA 1BVZA 2W92A 3UR8A 3TOPA 1ZU8A 1UUQA 4RE2A 3BSGA 3WSUA 5JUVA 2A3AA 2FYVA 4B15A 2ZICA 1DP0A 3WH7A 3CZSA 3DECA 5D9NA 4PMDA 1JYNA 1UR8A 2YL5A 4BQ4A 2DSWA 3ZM8A 3SCWA 2PWEA 3EDFA 3BUPA 1K9EA 1R47A 4D6DA 2WC3A 1UR9A 1UR0A 2W66A 2ZXBA 4UQBA 3VNZA 1TE1A 1FH9A 1FOBA 1RPKA 1TMQA 1E73M 3PZIA 4M1RA 2IUZA 4DUXA 2WB5A 4F66A 1JZ4A 5A69A 1QW8A 3HG2A 3OGRA 2BVDA 1UR1A 3II1A 1GOOA 4UQEA 3VDAA 1ISZA 5HPCA 5BROA 1PZ2A 3GNPA 2W91A 3D5HA 4DWSA 4TUFA 5ABEA 1KGWA 1BYAA 5FCZA 1E6RA 3SCNA 2VMFA 4AIUA 4QFUA 4F9JA 1MW3A 1KGXA 3D50A 1OBAA 1AQMA 3DX2A 1XH2A 2X0HA 2W4XA 5AC4A 4KWUA 4U3CA 4GKLA 3ZO9A 1HJSA 3NDYA 1IV8A 3K8MA 2BHUA 3WQ4A 4F8XA 1V3HA 1QNOA 3J7HA 3VIIA 3APGA 3AS2A 4W7WA 1TZ7A 2VCBA 3PHAA 4UZUA 2Y2WA 4Z2GA 3T08A 3OLEA 4GQRA 1EDGA 1WZLA 5A6SA 2WHJA 1V3IA 3BLPX 3AS3A 3SCQA 1B3YA 4PTVA 5BRQA 3VGHA 1J10A 4Z2JA 4H8UA 2UY2A 3SCTA 3BCFA 3PZUA 4E8DA 4CD4A 2WM0A 1ZBVA 2AAAA 1V0KA 3RJYA 4H04A 3WNOA 1SFSA 3AIQA 1W32A 3SEPA 4CN4A 2EPNA 4LX4A 1UD5A 2D3LA 3K46A 2ZX6A 3OIHA 1QBBA 3N17A 2XN1A 3MSDA 1WDQA 1VEOA 4JFUA 2XIIA 2Z1SA 3UR7A 3T0AA 3WEMA 5A94A 2CXGA 2VNCA 4M24A 4BF7A 5GPRA 2WAGA 1W9XA 3WY1A 4OBRA 1EIBA 1QPKA 4JKMA 2J7CA 1CXHA 2DSKA 5A8NA 2VX4A 5CSYA 3BAXA 1BAGA 1UWTA 2NSXA 3RJXA 5HBFA 2G4FA 2D3NA 2PWDA 3VSTA 2VQTA 3SCRA 4ATWA 4AD1A 2J78A 4ZENA 1HXKA 1WP6A 2WVUA 3WH6A 3ZJ7A 2RGLA 3RCNA 3KE0A 1EO5A 3WNKA 1HX0A 4CKQA 1TQTA 1V0MA 2WXDM 1WCGA 4DO4A 3MO4A 4PMYA 1XYZA 2X8RA 1VENA 2XFRA 2XIBA 1NH6A 2DGAA 3GXMA 5DT5A 4J3UA 3VIHA 3CC1A 3SCVA 4D1JA 3NIYA 4BQ3A 1JYVA 3VIGA 3KL5A 4YHEA 1B9ZA 3H53A 3W29A 4W93A 4V2XA 1V6UA 1QX1A 5HDRA 1XRVA 2FGZA 3SUSA 4KMQA 1HTYA 5JBFA 3CUGA 1W3HA 3A4WA 4F79A 2XJ7A 1JXKA 1XSKA 4HMCA 1MQQA 3W82A 1WB0A 2PF0A 2NT0A 4PMQA 4AIOA 5EB8A 1GW1A 3KLKA 4CD6A 4OKDA 4GI6A 4MNJA 1E4LA 5I77A 1VBUA 3I3BA 3SUWA 2WWCA 1TA3A 2G3JA 2J47A 3L4UA 5CXPA 1NQ6A 3BAYA 1X6LA 1XH0A 1YHTA 4F9DA 1UH3A 2WZEA 3S6TA 1FH8A 3BAIA 3VSVA 2J7BA 3BXWA 2IXVA 5A8QA 8CGTA 1DEDA 1SZNA 5I0DA 5E1QA 3RILA 1XD0A 5CSUA 2XYLA 1UWQA 1OWQA 4X9YA 1SYTA 5A2BA 2YOCA 3WDIA 1AVAA 1AQHA 2ZUSA 1C93A 4PYSA 3GXPA 3E1F1 1H4PA 1QWNA 1OT1A 2WMKA 2X09A 1V08A 3WY2A 3WD3A 1QI4A 1GJUA 1KWKA 1FP9A 1D7FA 3RM8A 4Q22A 2BS9A 1MXDA 2J77A 3AMCA 2VZOA 3VM5A 2ALWA 1VFMA 2WSPA 4P7QA 1VFOA 5ABHA 4NZFA 2VRQA 2WLZA 1ISWA 3BVUA 3OZPA 2VZVA 1BLIA 1XCXA 5CPQA 1R7AA 1R33A 2EJ1A 2VVNA 5DT7A 1V3MA 3WDQA 4FF5A 3T2QA 3NUKA 1JAEA 2OSWA 4CN1A 2CBJA 1EA9C 1UOKA 1UD6A 1UKSA 3WUEA 5A6LA 1E72M 2WMFA 4DM2A 1QNSA 3CZLA 3POHA 1J11A 1WDSA 2ZOXA 5D8WA 3FXYA 4OOZA 2XSAA 1F4AA 3EJQA 4DO5A 1Q6DA 3WFZA 3PTMA 1Z32X 3TONA 3H55A 1EH9A 2GJXA 1LL7A 3VD7A 1E0WA 1ZJBA 1JGIA 1XH1A 1HL9A 5JBEA 4P7OA 1N82A 3CHFA 1TUXA 4H8HA 1TCMA 4FLSA 4PEEA 3CUFA 1UQZA 1OM0A 4CVWA 2MANA 1BHGA 4X0VA 4CGTA 1LLOA 4LYRA 2V5DA 3ARYA 2JE8A 3MUAA 2PBGA 1I1XA 4PMZA 3ZT7A 4JFWA 1E3XA 2WNWA 3LPOA 5M17A 4AIEA 1M03A 2CIPA 3GDBA 1GCYA 4PMNA 1HKKA 5A2AA 3BLBA 2X2HA 2J7HA 2PI6A 1XV8A 2G3NA 4AD4A 2DDXA 1F4HA 2O9RA 1M53A 2QV4A 1XSIA 4HP5A 3WMSA 5GNXA 3NCOA 1GNXA 4V27A 3L4WA 1QW9A 1B30A 1IZKA 1CGXA 3A47A 1HP4A 4OGZA 4B3LA 5A6BD 2QLYA 1J0YA 1Q6CA 4PUDA 1KQYA 3OBAA 2CESA 1UWSA 3WF3A 2D0FA 3QHOA 2VX5A 4FNSA 3S2CA 2J75A 3WY4A 4QLKA 5CG0A 1PAMA 3M07A 1B2YA 1WPCA 3MMWA 5BXPA 1DWGM 5D9OA 3CBWA 1JZ8A 4TOQA 3AIUA 4GO8A 3ZQ9A 2YDSA 1ZS2A 3SUVA 1JF5A 2DIJA 4ATDA 4D1IA 3N04A 4UNIA 4ZFMA 4ZXLA 1C91A 2EO7A 2YDRA 3KEHA 2VL4A 2WVSA 1JD9A 1HWWA 1HL8A 3A21A 1GPFA 4JFSA 3DYMA 3IJ9A 2BVYA 2TAAA 3SUTA 5HOSA 3CHCA 1JG9A 2GUYA 1KWGA 2O92A 4E8CA 4GQQA 4H8VA 5F7UA 3AIEA 3WDPP 2DH2A 2QMKA 1OCQA 5E6ZA 5A6KA 3EMQA 3GXIA 5E6YA 2V38A 3TTOA 1E3ZA 4J3XA 3MSGA 4R27A 1ZL1A 1QVBA 1BYBA 3EDEA 1TVPA 3WQ5A 1XYFA 1J0KA 1YQ2A 1EQPA 4PMXA 2V3FA 3BMVA 4WSKA 3AHYA 4CU6A 1G0CA 3AMLA 4TX8A 1VRXA 2OWCA 1NOUA 3WD4A 2C0HA 1C3FA 3WD0A 3ZOAA 4W8BA 2GK1A 3W0KA 5IHRA 4AZHA 2XN2A 1PBGA 1HKIA 3AJ7A 1P6WA 2OW7A 4AZ7A 4AZCA 2QPSA 3G6LA 1V0LA 4C7GA 3CMJA 3UERA 3T0BA 5A6AA 4NX0A 3WD1A 2GJXB 4JHZA 1J0JA 2BXZA 5BCAA 1W1YA 1AQ0A 2UY4A 3U57A 2D22A 1GONA 1NWTA 1SMAA 1JYWA 1FH7A 4W5UA 3N13A 2J8GA 3U7BA 1A3HA 3F5KA 2GJPA 2VI0A 5E70A 3LMYA 3WF1A 1CDGA 2WBKA 1XGZA 5A6BA 3WNPA 1LG1A 3AROA 2CKRA 4AZIA 3DX4A 4MDPA 4LQ1A 5HPOA 4XV0A 1GJWA 3OB8A 1T0OA 1NWSA 3F5JA 2D2OA 4KH2A 1UKQA 4Z2HA 2WSKA 5DEZA 5BWFA 4TX6A 4P8UA 1W1VA 3AXHA 2EPKX 1CWYA 1V03A 5EFDA 1PPIA 1CEOA 3W38A 1HJQA 2D23A 4XZBA 1ISVA 5A8OA 4Z2KA 1LWJA 3LPFA 1VBRA 3NYDA 3NJ3A 2E8YA 4P8XA 5M5DA 6A3HA 3PZTA 3AMDA 4U33A 5FKYA 4Z2LA 2JALA 3RMEA 1EHNA 2UY3A 2WHKA 4RE4A 2OSXA 3AHVA 3QHNA 4HPGA 3WF2A 4TVUA 1JDCA 1TG7A 3U5UA 4A3HA 2GDVA 3TP4A 5JIPA 1EQCA 3BUBA 2A3HA
chains in the Genus database with same CATH superfamily
1QHPA 3BAJA 1RMFL 3WBEA 2FBOJ 1Q6RA 2NV1A 1RK1A 3M7SA 3LKPB 3I6KA 2ATKB 2XWDA 3K6DA 3THMH 3D4ZA 4KKBC 5IBUB 1PD6A 4WUUB 1HZLA 3C0QA 1AGDB 4MZ8A 5CP3A 4HCIA 4WI5A 4KESA 4EI5C 4LLVA 3V4PB 3QA3A 4WVXA 5IQ9B 1JZ3A 1FVEA 2HJKB 1S2EA 2R83A 1OD9A 4MA3A 3HGRA 1H15A 4MZYA 3ALPA 1ITQA 1J8HB 4G1EB 5IFHH 5DWUH 3WHE1 2CJUH 3CQHA 3QEGH 5F1VA 4R3SB 3KEDA 2MHAA 4UTBA 4EVZA 4BSJA 3EDDA 2J7GA 1Q94B 3S2NA 1GGBL 2QVIA 1S7XB 1I1CA 1C16B 4NPKA 3KPRD 4U7MA 4UT9L 3H70A 4NKMA 2NR6C 3CNYA 5DHXB 1YYLL 3OQRA 4ONHB 3L45A 1S2TA 2EXOA 4PRWA 3LHTA 4OLVH 4XUGA 3ZHKA 3PWLA 1VFFA 3GS0A 4PP1D 2PCPB 4HHLA 3F4VA 4IMKC 3S42A 2XZCL 3DETD 2W67A 1MUWA 5C08A 1XRFA 1DBMH 2RDXA 4S3CA 2P24A 1PKLA 5GGRB 4QF1A 4FDWA 4N2NA 4R4NC 4FLHA 1GZJA 3WH9A 1YBQB 3F7PC 4P2QB 1U95B 1WUEA 1WAEA 3RUGB 5ALBH 1D3CA 3UJFA 3W00A 3HNTL 4OGYH 2BDQA 2YJQA 2ZUWA 1CECA 4QNEA 4JPKL 2ISFA 5BW7C 4YYFA 5BXRA 3BPNB 3FHEA 5DJZB 2IBBA 1J1OL 1MW2A 1Z66A 1G7MB 3DMMA 3FB7A 1UWUA 4TLUA 4E2OA 3FUKA 3LQMA 4TIMA 4FLRA 3BWWA 3MRPA 4QNPE 2ZWNA 1PY9A 2G4EA 3GSRB 2DQIH 2RGSA 3P2TA 3VC6A 3E2HB 3V6OC 2Z8VC 1OAYH 3ZS4A 3QS2A 4WKZB 5EFIA 4KTYA 4JTQA 1QVOB 4DI9A 2J88L 4BUGA 4K1GA 4LCWD 1OZTG 3VXSA 2PU0A 1I82A 1MFBH 4JY4B 2Y7MA 1HZHH 4H9VA 3QORC 1KNWA 2YWYA 2EYSA 1ZAJA 3S3BB 7ENLA 4HFUL 5ICZB 2A5HA 1A6AA 4ZEPA 2FJGA 1FA2A 8A3HA 1AGBB 5AN7A 3C8DA 3VWKA 1A21A 2PCEA 5EF1A 1G7PB 4CUCA 4NQDB 1E6XM 5LZLA 3N43F 1JVKA 1T8QA 3GZPA 2PW1B 3GTFA 2VM3A 1U8CA 1SMDA 5I75C 2REQB 4L9LC 4P2AA 3LGDA 2OZTA 1NOLA 4X6BA 5F72S 1E6JH 4M00A 2Z8RA 5SWZB 1CR9H 4P2OB 5F96L 3X1GA 3VCLA 2O0TA 4KHXH 4ZS7L 3T3PF 5CJQH 2VX7A 2ACSA 2NQDA 1GAFL 4IRZA 4MD4A 2R2HA 3BW9A 3QYNA 3Q4DA 5I3HA 4MNQD 3EOBA 2F6UA 4EAMA 2WO3B 5AD0B 2X1TA 4L5ZA 4KEUA 3EIFA 1GQLA 5FIEA 1T20A 3HG4A 5E6ID 1OZMA 3L4ZA 4F7EB 3HG5A 1BXVA 1Q9LB 3LIUA 4LMQI 4QO1A 1IFGA 3T3ME 1UB3A 1SUJA 3WQ6A 2HNHA 4WQOA 5KYYA 3GSVA 5H91A 2ZUVA 5BQ7A 1H49A 3TK7A 1UM6H 3LYRA 1V7NL 4AVHA 3GKFA 3TASA 3PXHA 1W3LA 1J0ZA 2ZAGA 4B9ZA 3LZ5A 1NMAH 2QAFA 5D7LB 5IMKA 1C5BL 4XPFH 4XWOC 4MDRA 1U8QB 4MNQE 2WMHA 3SJ3A 3KVQA 4J27A 4DEWA 1ET8A 3T42A 2D31B 1NEZA 3T8VA 2V3DA 3WUWA 4GY1A 4ZB5A 4ELMF 4J7RA 4QD2E 4Z5RA 2BERA 3LKQA 1L7TL 3T09A 5AECA 5D33A 3VJ6B 2GUUA 3C0SA 1U8HA 5AZ2L 1W72B 4GAAA 2XXGA 4HWZA 3JWDH 1Q9WB 1J1PH 2GDQA 2A6DA 4ELME 1B6UA 5HHXL 2XFFA 3D8MA 1O5PA 1A14H 4ZPVB 2WVVB 4L1DA 4AM0B 2UWEE 2FBRA 1YEKL 1C7TA 2LT9A 5DO8A 3MJ9A 5MP6H 3EBAA 5ECVA 1F3WA 4A4AA 3TCXA 1MLCB 3FY1A 1OG0A 4XO6A 4PB3A 3AZRA 2CLFA 3B6SA 1FNAA 1PIGA 2XVLA 5CCJA 2G5WA 1OB1A 2ZOOA 4OBSA 2F1AA 4NO3B 4RAUB 4UMSA 5AAPA 2PB1A 1B3XA 3S46A 3LY0A 3M1BA 5I0XA 1MZHA 3KW8A 5DJAB 4FADA 2CLEA 3K91A 3CWNA 1XF2B 3RX2A 2GTQA 4J6IA 2HKAA 4UOZA 1BQLL 1E40A 1MEXH 1OB1B 4RAUA 1KTCA 3SSGA 2AKZA 3WIIH 4A29A 1I4FA 4K55A 3N6YA 3URNA 4PV1C 3OXSA 3SFKA 3BYTA 3I9GH 3TZVA 3PP7A 4K8RC 3PWUB 1MCEA 4R26L 5CSZB 2ZX9A 2VXSL 1S78D 3PGFL 2OS7A 2NW0A 1C16A 5HMFA 4FEMA 1BG9A 5FGSA 5JPNB 4TUUA 4APQB 1HEZA 3KBNA 1U83A 1R24B 4G8IB 2R29H 3CVIH 4UB0H 2JKAA 3N11A 1RJLA 1JPIA 2OG9A 3KH3A 4P5KB 4G72B 4ELKA 4FZ8L 3BSZA 1JNLL 2DUXA 3T1GA 3FQNA 4KRPD 3WG6A 4UYQA 5AL0A 3BPLB 1H3UA 3V4PA 5INDB 5KJRH 1DQLH 4HZLB 1JXFA 4GYFA 3MSPA 4QROA 4JR9L 4WHBA 5ESQB 3I74A 2R6OA 3VTRA 2WLHA 4HCLA 3I6KB 2OXNA 1KIRA 1OT4A 1EGJH 1RP9A 3KVDD 1QBMH 4NQEE 4OF3A 1CMOA 1FF5A 3MREB 4HUXA 5IBLD 1LWHA 3R1GL 1CTOA 1ZNNA 2CMRH 1KC5L 2G60L 3Q06A 1ZS8B 4WU5A 1PZBA 2VGLM 2WLIB 5E94B 5I17B 5L7XH 1A8JH 4H1LA 4QOKE 3D46A 1ICPA 3E02A 4GG8A 3ASNB 1EEYB 3JTSA 1TJHH 1AZCA 4P9HC 4TNVK 2O5ZH 3FKUS 3ZT6A 5I76A 1JUBA 1FVCB 3QO0A 5EUOF 5K2ZA 5T1MB 3ZN6A 4N02A 5L6YH 1NGPL 4W84A 1CDJA 1ZTMA 2AJVL 1EEUA 1KW1A 4KUZL 5D37A 5AHMA 5ISZB 4MB4A 1EBGA 4XTIA 4XKYA 1TTRA 2VR9A 2IAMA 2Q3ZA 2WXQA 2IBGA 2GAZA 3HFMH 5BZWB 4S1FA 5JPMA 4TO8A 5T3ZL 1OFEA 3OGCB 1Z0MA 3NA9H 3CAWA 2BXYA 5LAXB 2OBGA 3FS9A 4XMWA 3MOBL 3QTGA 1T4KB 5CEWA 4N8VB 3AG1B 2GG1A 4ZFOB 1T7YA 5H6HA 2QJNA 2C3HA 4B3ZA 1XLBA 2HX8A 5ID1B 5L2KE 3HOJA 3TZVB 4FXKC 5JTWA 1MWAL 4XCNA 2AVGA 4Y5VC 2P52A 5MENB 1BM7A 2PD5A 5G2NA 3FTZA 3N5AA 4KDVA 3U30C 3MRQB 3S0CA 3ARVA 2GJLA 2G5BA 3TJIA 3U9UA 4B7IA 2R27A 4TULH 4U6HB 3NZPA 4XP4L 1XZ0B 3W9EA 3PUDA 4V2CB 2PPAA 5KVMC 1UWEH 2OAAA 1CI1A 1OADA 1ZP3A 1MVYA 2ZC1A 4MXQD 1X5MA 1T1YB 3QK0A 1S7VA 1IC7H 2OKOA 2X1WL 3JWOC 1YECL 2PDQA 1JPFA 3WQFA 2H6OA 3HE6C 3PRZA 4EXKA 1E8WA 4D0CB 3NTCL 2HP4A 1FL6B 2B8OT 3DROB 4M6OL 4UQDA 3LZLA 2ENQA 4CMHB 3AU1B 2BFVH 4L8SB 4X83A 3QDHA 4NKQB 3WMQA 1DXIA 1HXYA 1CFQB 3T2NL 1YC8A 5J6HA 5F88B 1YDVA 3GQYA 3KXQA 3AITA 3O2LA 3PHSA 1I7TA 1B4JL 3HF3A 1N0XL 1T21A 3G1AA 1TIWA 5D1XD 1LD9B 4XZNX 1MVFA 3M0XA 3H4HA 3O4OB 2EE3A 3RVXD 5K5YA 3HAEB 3OVUB 1ZBKA 4C54A 1QBLL 5EMJA 4DX3A 5HYJD 4JFDD 2IADB 2VRAA 3DHUA 2QKFA 1DBTA 4QQ3A 3LKNB 4A6YA 3U2SA 3G6LA 4NC1E 1UH2A 1W1A1 1R5YA 5BZZA 3K8KA 3INPA 2GL5A 4I7WA 2FZMA 2BSRB 5DQ9B 4A7GF 4MNMA 4LNCA 3KPSA 3UETA 1R3QA 4DELA 2R2HB 3BW9B 3R0NA 1LEGB 3WKYA 1M71A 1P7HL 1U5VA 5IDIA 2E56A 2PLTA 4N3TA 1UM4H 3WDRA 2VEGA 2VB5A 3A9BA 2GBAA 4C6LA 5I1DA 2C7UA 3FQWA 2EACA 1UATA 4LVOB 1F45A 1L6WA 4AKOA 1I3GL 1I3RB 1JVOA 4OLZL 4JFVA 4IRZL 1Z5LA 3O41B 4BXSV 3QPYA 2ATPA 4AD5A 3CVCA 2I1OA 4MCZA 2ABAA 4UDTA 4OOUA 2VMEA 4AXNA 2EDLA 3GRWL 1S7SA 1A1NA 2XWCA 3X1EA 5IB4A 5MEND 2CIIA 1UOZA 3N19B 1XGPA 3X14B 3WHXA 2H6PB 2IJ0C 2J21A 3RDTA 1ORQB 3MCKA 2CE6A 5LIUX 3FB5B 1U8LB 1IRAY 1KCVH 4AMWA 2VR4A 1II4E 5FXCH 1XT5A 4X99B 3ZE1F 5H37A 6PAZA 1NBZA 2W6RA 2BX7A 5AZ1A 3W1UA 3MRIA 3NH7H 2H45A 3JV4A 3K4AA 5B39G 3KWVA 3KGUA 3TTSA 1DFBH 1RULL 1GA2A 5IW3A 5ID0A 2F7OA 3VG0H 1JWMB 4PW3A 1HZKA 2WXGA 2J7FA 3IIPA 3NPZB 5JLZA 3U6WA 3LNFA 4Q97A 2PTWA 4Z1CA 2BSBA 4UOQA 3UZQA 3GEWB 4PWEA 1T7VA 1P6AB 2B9AA 2K6ZA 2CPUA 3FT1A 1XL6A 2X1XR 3HB3D 3P3RA 3MO7A 2R2CA 4K9EL 1VIWA 2ACRA 5E03A 3FULA 4MAZA 1E2ZA 1X9LA 1EVTC 4UCFA 3HMCA 2XM1A 3S5SA 4S1SL 2ZDRA 5C0BE 3CASA 3REWA 3LB0A 2QF8A 1DJNA 1QSEE 5IHSA 1U5HA 2L04A 2Z6IA 1OCWH 3OJ2C 1OCRB 4QG6A 5JXAH 3MGTA 3VW3H 2FIKA 2H1PH 3DJTA 4PPTA 4FSAA 1TJ1A 3T40A 1MLBB 4IIQA 1W9VA 3O45A 2DWTA 4RPQA 1ZVNA 1F4XH 2KZKA 3IJLA 3HIZA 3M88A 5TH2A 2DTML 5KJ4A 1JCMP 1EPXA 3QG7L 2ZZ2A 1HH9B 1F8IA 5C9XA 2I7SA 5C3LD 4NSKA 2ADIB 3JVGA 3MR9B 5FDYA 3G08B 3NCWA 1XC4A 2CBVA 3M0ZA 3PVFA 3VG9C 1L9NA 5K9KA 3KJ4C 1B0RA 1P5VB 4BKLB 4U1JA 2EZ0D 4PJXB 5CR8A 1MNUH 2AERT 1OSZB 2GSIB 4IKJA 4QJ3B 4Q4EA 1LLAA 5FX3A 5ALBL 2FVNA 2PDMA 4DJEA 3F62A 4HS8L 2V5BA 4EKJA 2Y89A 4YHMH 1RJRA 3B06A 3NAAH 5K3VA 1NFAA 1IEQA 3DOSA 4DP4X 4M9PA 2XIQA 5CJQL 2PLKA 3CAQA 3S9IA 1WAUA 2EXWD 3ZR5A 1YNTF 2MWCA 3TX4A 3ZTJG 2VRJA 4JTGA 1TX0A 5EPMA 1CFSA 4GIOA 4XR8C 2AEPH 2CXKA 3T0VA 1IM3A 4MNLA 4D8ZA 4FS9A 4MMXA 2Y5QA 3GBEA 1IWAA 1BEYH 2XX0A 3RI5K 4FD0A 3VNYA 4TOYL 1FVDA 4L4VD 3DRTB 4K5LA 4H19A 1TZGH 4OE7A 4HIQA 4AVOA 2DZPA 3NJVA 3RPBA 1CGYA 1EWHA 3FAXA 5J12C 3WJJA 4HQQL 3V5HA 1OYBA 4V1DA 3SODB 1P43A 5H8DA 5J8OA 1FRGL 1O95A 3U7WL 3KZSA 1H1NA 3LHYA 3TE9A 4YYCA 3DRQA 3DX9B 4FZEL 3WBXA 4JDEA 3ATDA 4KI5D 3U4BL 1LOLA 2VLJA 3W01A 2CJUL 5CBEB 4JS3A 3E9TA 4CVUA 1H19A 4R7NB 5KTEH 3FUFA 2FFIA 4LBEA 2P42B 3IKKA 5IBTH 3ROOA 1BGGA 5CSBA 3WENA 2WAHA 4ES8A 2H90A 4QRRB 3WJXA 4WI9A 4WWKB 4HH9B 4YTRA 4IEFB 1WE5A 2W0KA 1R2TA 2Q7NA 2X88A 4M6AA 4MDJB 3BJLA 8FABA 3U1SL 1CGUA 3TN3A 2BNUA 3LH2H 4AZBA 4OTXH 1KYOK 3WK1A 4A3RA 1KJ2A 4F2EA 2JKEA 3QEUA 3HG1E 4IMKA 4KHXL 4ZS7H 3WL9B 3BTNA 1H7PA 2VAAA 3UGEA 1T5KA 3JWOH 4GP8B 4P49A 3TCTA 1X6UA 4PUMA 5GNYA 1HAUA 4PYHA 4KI5C 2A1YA 4HZ6A 4HKPA 5IEKB 2WC4A 4Z1DA 3UEQA 4E6MA 4DUVA 1EVUA 3U46B 3CDZB 1RUML 4X8XA 1VPOH 2N56A 4JO8A 4UT6L 2D7OA 4AT6A 1GYNA 3MYOA 4NBYB 4ZTPH 4WI2A 5CPLA 2R4RL 1W0YT 4H44C 2NX9A 5J06A 5IEKA 4WDIB 4GIPD 4O16A 2VM9A 4IQEA 4HWUA 5DRWA 1KBBA 1YRKA 4D9PA 3CTTA 3V35A 4JIPA 1EXUB 3VI4F 3IU4L 1CGSH 3B8YA 1XYLA 2HCVA 3R06A 2RJHA 2QSVA 3SW6A 4LUSA 3SIKA 5FHAH 5EZIL 1B4KA 5KVFL 4TVPL 4Z7OF 4GW4B 3TA9A 4AUBA 4BHUI 5JW4R 2Q09A 4EI5B 1E27A 2X4OB 1C5DA 3A67H 4M93B 5F2FA 4AEFA 1VERA 4IYKA 3BLDA 4YTUA 3TXZA 4OM0L 2OT0A 5G1MA 2QDWA 2QGDA 3WBYA 4KH9A 5IW1B 3BGFB 4P2CG 4OZOA 4WO4B 3CV2A 1FIGL 4UTUA 3VNKA 3ZJ6A 5GS2D 3F6IA 1AS6A 2BZ7A 2QZRA 3FS2A 3IS1X 3ULVE 3STBA 3WFLA 4E0CA 4NJ9L 1OARH 1TYJA 3WZ0E 3WKZA 1EJ6A 1NPJA 2WLLB 2VZUA 3P7YA 3KS0J 3LCWA 1H7NA 4X61A 5I3IA 1S46A 4DGIH 2JWYA 3PZMA 4NUWA 5A40E 1ZGDA 3CU1A 4XTDA 2Z92B 5I1LA 2ASHA 3E6HB 3V10A 2EG7A 4IH3A 3WQGA 4YHIA 4DN4L 1XRTA 2VLKA 1UZ8A 2BOGX 3D34A 4MLRA 5F9WC 5EU5B 3ARUA 2ZSVA 4HUMB 3QIBA 1D7DA 1DJZA 3OMAB 4JR9H 4ZR8A 2EINB 1J2BA 1PDYA 1XLLA 2F19H 2OLHA 1EDTA 2YJLA 3GFUA 4C1NA 3AIWA 4F2TA 4LP5A 4NZDA 1DUZA 4F9LA 4WDIA 2ZRWA 3QWRD 1T3FB 2MNRA 1NJ9A 4LDCA 4Q8VA 2J66A 2ICEA 4K7PX 1ZHAA 4IFKB 5JH1A 4R5EA 2O5YL 3U46A 3GKWL 5I7GA 1W8EA 1WGOA 3WQVA 2BWQA 3I3EA 5EG6C 1NCOA 4H6KA 4LVEA 4AI7A 2B7DT 1ZLEA 3OR7A 4LK4A 3UT0A 4XTRD 4GVIA 2Z7ZA 4BWUA 2UY5A 3D06A 4LPWA 1E55A 1U3NA 5CCHE 1J5OL 1XBRA 1NU5A 5BUAA 2IVFC 3NZ8A 5AB3A 1LRQA 3C60D 2ZVIA 3N9RA 4N8VA 2HK1A 2VITA 1QT1A 3CLWA 1PDKB 4Y16D 2MPVA 5AG8A 3PSWA 1EP1A 4LYKA 1XG4A 5KVEL 4AL8H 2XG9A 1NSNL 3E7JA 3QULB 4TNEA 3AI0A 3B04A 3HQ1A 2J62A 3WH8A 5K9CA 2JIXB 2Q9OA 4M5ZH 5C8JB 2N1KA 3DX6B 4ZK8A 3BG9A 1P4LA 2WIIA 1AGFA 3UWUA 4MJ6B 2UZXA 3TZFA 4X80H 2Y62A 4AGQA 1DWFM 1G6VK 1GL4B 2J8HA 5E95B 2IXQB 3TGXA 5I73C 3LS4L 3OHXB 3DUGA 4W7VA 1ZT4B 4Y4KA 3SBQA 3KJ4B 2ISVA 4RAVB 2R0ZL 1OAQL 1E5NA 4GBUA 3S7GA 4U3SB 2VLLB 3I68A 5IFAH 3VI3E 5GS0C 1SXSA 5IM7B 2ZWZA 3I50H 2Z7KA 4XVDA 1TNMA 2VXVH 3QGVA 4ZPTA 2DAVA 2MQCA 3L5AA 3TA6A 1MYRA 1P5UA 3TYBA 4EANA 3PDOB 1IAOB 3PLYA 4HX1A 4DN3H 4I3SH 1BFVL 1W3IA 3DRQB 2Z1WA 4JG0H 1A4MA 4YTSA 2KH2B 1DQVA 5HDBF 3S9YA 4RMBA 2AI0H 2VABA 3IE4A 5IESL 1TETH 4Z42C 3LLXA 3CHSA 1KENL 4LARH 4N2LA 5CS7A 3N3TA 4LBRA 1X6NA 5LBVA 2HTMA 1VJZA 2RKXA 4YU1A 4ZCWA 3DK0A 5K33A 5SWZD 4MSWB 1KACB 3ZYJA 1ZP4A 4U3HA 2PU1A 5K9KB 2R59A 2A74B 2I9TA 2HDJA 1NGQH 3ARTA 1RBLA 3MNMA 2Q0ZX 3AO0A 4JGJA 4FQJH 1XIIA 2JV6A 4LVAA 1CVRA 3PG2A 4K8GA 5EO0A 4FYQA 1XYMA 3MMUA 4XIMA 1LEGA 4JKNA 2VFEA 3HFYA 5E99L 4M7TA 2Y7LA 2H2SC 5DQ9A 3SDDD 1AY1H 2CCRA 2QVNA 4O2EA 3RIAF 4NJHA 4XWOD 2BRQA 4GY0A 5F1NA 1RUPL 4NP4L 4WDTA 2AXJA 3L3OA 2EGZA 5FB8A 3GX9A 3BDXA 4GIAA 1OZUA 2Y63A 3EKGA 3G6DL 4QHNA 3G1DA 4YCOA 4AQ8A 1TZZA 4HJUA 2J4GA 3SM0A 3D85D 4ADUA 4GG6E 1AZBA 3Q43A 4ZSOE 5LNEA 3GC5A 4HQVA 3QDGD 1AP2A 1ECYA 3UFIA 1EB3A 2F5BH 4S1RL 3MROB 3B43A 3SJNA 4FHKA 4RA3A 1XX1A 1VACB 3G1SA 4A67A 1CGSL 1YYCA 1GZQA 2QJDA 4LLUB 3SB3A 3SURA 4DEPC 4Y7MA 3IMBA 1WXZA 3MRIB 1EJRC 1IARB 4JVWA 2ZZ6A 1PEZA 3WJMB 4OIIH 1G0XA 3GHPA 4OFDA 4UFHA 4YZFF 1GYMA 4GFXA 4XAGA 2NYYD 3DFYA 4P3DA 3ZFHA 4XP9L 1HGWA 1OIFA 3CFBB 1LP9A 5BXFB 1DFBL 4MRCA 1NOFA 3WJLA 2LV4A 3NJMA 2VDNL 1AFVL 2V2WA 1PQZB 4I4WA 3HLKA 4IRSB 3HKZA 3RX8A 5A2JH 1V8EA 2XQYA 4YS4A 5JLZB 4M6VA 3TWAA 4YEEA 3EWXA 1H5BB 1E6SM 2ISDA 1KFEA 1JNHB 2ZZ1A 1RUSA 1UXSA 3DK2A 4Q8BA 3MW7A 3NR0A 3PSVA 4QRRD 2X4TB 5EMYA 4UNVA 1TFVA 2OTDA 5H2BA 4OF0A 1E4IA 1H3VA 1N5YH 2MRYA 3TBWB 3BK0A 3CD4A 3EBIA 2MOVA 4TULL 3V0WL 2E3ZA 3DKLA 2ZCKL 1U3HD 2F9BT 3ITTA 2KS0A 5BUGA 1CWVA 1ETZB 1UXWA 3TBCA 1Y1UA 2LU7A 1S9XA 4U49A 1KDIA 4XNZB 4BA0A 4K38A 3EYPA 4PJ9A 5CBIA 1MAKA 1F9CA 1OAZH 4FNTA 2GAZB 4JNYA 4M1CD 2R9HC 2E77A 5KYXA 1RY0A 1IAIH 1DL7L 4OZHF 4YBQC 3N44F 1JGDA 4ABVA 3KCLA 4FQLH 4JVPA 2CKBB 4KQNA 4EI0A 5T33H 1G7IA 4N0FB 1G7QB 1UA3A 2D9QB 3HS9A 1RIVH 1L2UA 1NFGA 4UR7A 1JPGA 1JWSA 3OF6A 1AH0A 5KZ6A 4BSVA 1TCDA 1LO3H 2ICEC 4YDLB 3LCGA 1OTUD 1T1XA 3IDNA 4M8VA 3CVDA 4MLIA 3MLWH 4LZKA 5CBBA 4YHZL 4XCYB 4OFKA 4BSWA 2ESVA 1GSKA 4S11A 1XB8A 4QRPB 4L4TA 2ZVRA 7XIMA 3U30B 3DC0A 4K3JH 1O1ZA 3O15A 3UZYA 4HSQA 3KWXA 3YPIA 3URAA 5CIPB 4C56A 2DVXA 4HIXH 1FWRA 3O16A 2UWEB 3KPLA 4PUJA 3V0VB 2PSNA 4UAOB 1E7UA 3QCUL 2FWOA 3GEFA 5C7XH 1U3YA 1Y07A 3VRJB 3VXMD 4G7EA 4JQ4A 4YSAA 3RNKB 4XVUC 1S5VA 3CUHA 4O0QA 5GS2H 2NXGA 2VTFA 5KVEH 4O13A 2GQHA 1XAKA 3CN4A 2TMDA 4DGYH 5IHLB 4B92A 1RSCA 1I9JL 2B2XH 5CD5D 2A1WL 4XN8A 4J4PA 5FECA 2XHNA 4W4OC 3BO8B 4JW3A 1CLOH 2ACQA 4Q3MA 2AK4E 1O75A 3UTQB 2KZBA 3IGHX 4JGMA 2GKIA 3BZFA 4WEBH 3PV6B 4EOWH 1BIIA 4NAQA 1UENA 5D4IA 4XTRC 3V8CA 1HUVA 2PCFB 2YL9A 5TE6L 4GMSH 4M8QA 4B5EA 2FGLA 2PDJA 2XI9A 4O02H 2JF6A 1M42A 1MNUL 3VOIA 4S3FA 4JKWA 5IG7A 4PJEF 3W2LA 3MNWB 4FRWA 4HCGA 1NBQA 1Z41A 3IRPX 1HKJA 4HEPG 2R8SL 1PTAA 1XXFC 4B9GA 3CV7A 3TBTB 3FJNA 1L5GA 3H7UA 3QKZA 3TXVA 4KQ3L 3HPSA 2B4GA 4DJFC 4TNWK 1SEBA 1UZ4A 3G08A 4OCNC 4YHPA 1I8KA 4U4MA 2JJSC 2JFEX 1HFUA 3MUY1 4Y4HD 5DS8A 1IQDB 3LSOB 4ODBD 1GZPB 1GUVA 2AXFB 1KJ3L 3RZCA 4JTKA 4FKEA 4X2UA 2Y6TE 1D9KB 3RG1C 4HUVA 3LHZA 3W7DA 5IB5A 2HZHA 3CN3A 2AQQA 5ISZD 3DVFA 3O6CA 1CICC 1VF5C 2H2PC 3IF1B 2F53D 4FFVD 5FWQA 3N2MA 1R9FA 4AUJA 4M3HA 3H4WA 3T2NH 1ZJHA 4L3FA 4HLEA 3FAWA 3OODA 2NUTB 3WAKA 1B4JH 1TZIA 3BWSA 3CN0A 3QC6X 1OJXA 3BX7C 2CWNA 1JHKL 3CVHA 1QNZL 5AEAA 4MLJA 5E2VH 1NCIA 4LUTB 4DKEH 2BIPA 3PYCA 4MUZA 1PD0A 1N2RA 5BOFA 2NMSA 3DDGA 1INEL 4P5TB 2OL3B 1EEQA 1X4ZA 1WWBX 3BWUC 4S1DC 2E9MA 4LVNC 3QEZA 5FWRA 1QPRA 3EYUH 3LS5L 4ZE5A 1F5ZA 1MSSA 3UTQA 5DUPH 5DVKA 2HLAB 1NAML 1FZKB 3VD1A 3CUPB 2D31A 2GWGA 3S6DA 1P69B 4G7QB 4WU5B 4FFVC 1KXQA 1NEPA 4GE8A 1NCDH 2MQGA 5EYWA 4H5SA 4PS4H 4X99A 4PRID 4F5CE 3CZGA 1KTDA 1XCQB 4BGLA 4WUKL 5GGSA 3PS7A 5ESQA 1JPKA 4KI5F 4PRIA 2CLRA 4PB4A 3AISA 2YAQA 5GQBA 2P47B 3GG0A 5GISL 3WAJA 5AC8A 4X8GA 1E9LA 2AJZA 3QYMA 5DMKA 1PEWA 4NPYB 1URZA 4XP1H 1F97A 4EACA 1XSOA 4ELKB 2XWBB 4IRZH 1W9UA 5DC2A 1NF7A 2PD9A 2FIQA 3AQXA 4Z7QF 3RAJL 1JCKA 3W1AA 1ECZA 4IDJL 1HE7A 2IAMD 3ULUF 3G5XB 1A0EA 1QNIA 2NXHA 3IEBA 1KRBC 4OI9A 1GSMA 2QJHA 3UFYA 1INDL 1LO0H 1W80A 1K77A 3PTMA 3B9KD 2X4TA 1U8CB 4AEHL 1FUYA 5I09A 1HCVA 3TA4D 3KTXA 3F7QA 3RZWA 2QGEA 1CXLA 1WO2A 4R84A 4LJ3A 1KB9K 3SCUA 3BIKA 4LLQB 4NILA 2FSEB 2NT1A 1ZANL 1MG3C 2WWNA 1I1AC 2AAMA 4A7SA 3S35L 3L5WA 2W0LA 5CCGE 1E0XA 5FOJA 1VHNA 1PG7H 4QXVA 3IDIB 4PYGA 3T4WA 1U8HB 3RVWD 4C60A 5A1AA 1BZ7A 4K9EH 5D7JD 4AGLA 3SO7A 1F61A 4H83A 3FB6B 4Y89A 3HPJA 1AZVA 3X1NA 4ZSTA 1KXQE 2CHWA 3NQ8A 2DJUA 3S88H 3SZKC 4QCIB 3FMGL 3NMEA 4GLRI 3QMRA 3NCBB 4GIEA 4FOMA 3OV6A 3D69B 4ACZB 4EE9A 5IOKA 2QQLL 5E0KA 4HOXA 2X28A 4YMPA 2I57A 4Y2DA 5JW4Q 4JN7A 3KOYA 3PZGA 2R1WA 2R0WL 4PEKA 1I8IB 3OKLA 1U8QA 3V0GA 4QCIA 2J74A 5CFHA 4UV7H 1TQJA 2PR9A 2R4SL 3P60A 2WJ5A 3LD8C 1OQXA 2K9UA 4GHRA 4O9HL 5GS0L 4ORIA 2UY7B 4ACPA 2J88A 1JIBA 1MJJB 1YNTB 1S5IH 4DM1A 5JHDB 2VFGA 8RUCA 1QMUA 1YO4A 3ZYOA 5E1IA 1UC6A 4OIFA 1DN0A 1RCQA 1Z9PA 4NO2A 2XFXB 2VDQB 3MRCA 5IVXF 1B57A 3X12B 1CB4A 3EDKA 2KDGA 2D24A 2OOFA 2PODA 4LHJB 4C56D 2GOUA 2PF6A 2OI9C 3VXRE 4LVHB 3PABA 4BZ1H 5BRZB 4QCEA 3UZXA 4AZCB 1HFBA 3SOTA 2A74A 1JNNH 4R2GD 1FDYA 5GGUB 1XLKA 3ZRFC 1CD1B 5DRXA 1VCGA 2PW1A 1SY6H 3RIKA 1OCWL 3VGGA 4Y2DD 2Y8KA 3QQNA 2BOBA 1YNQA 5IB3A 1NARA 5I1HH 4KO6A 3LUTA 4L64A 4Q4IA 2AJZB 3BJ91 4B5SA 4XVTH 1AODA 3IPEA 2A79A 1I8LC 3CK0H 5DVMA 3S2AA 3LBCA 3C5QA 1I9RH 5FYJE 3VA2C 1NPNA 3VXUE 3VFSA 4NRZA 4CMHC 4ZW3A 4Q7NA 3FFCD 1VLXA 2NNXA 4JG1H 3IXAA 4P4RA 2X70B 5FYLH 3MV8E 1MZZA 2JJSA 5TJWK 2CWXA 4JZOA 5D71H 3MBXL 1VFSA 2IPGA 4MB5A 1EGJA 3D0VA 1TPUA 2LLEA 4LYPA 4R4FH 1YJDC 5GSRB 4U6TA 4BKSC 4N6RA 4L8CB 2EVHA 4LVGA 1D8CA 5I26A 4N6EA 5CG7A 1QLFA 3CZFB 4Y9AA 4M8RA 1FWDC 3M8OL 3ABSA 3B9KA 2FX7H 4PJFB 1UWAA 4JTSA 3X2QB 3SKNA 1X7TA 1BBDL 2WV3A 3QPQC 1Z9SB 4U1LA 4LUTA 3FQNB 3IK2A 4GW5B 1TJIL 5DLMH 3W76A 4X7CC 3PAUA 5B1AB 1CXFA 3QUZD 4Y5VB 4EUPA 3RITA 4F57L 2WLYA 1R5VA 2OP4L 3BEVA 3L2NA 1BDYA 4DGUA 1TKWB 4BK4A 1SM3L 1Y0LA 3G5YB 4ZO7A 3TYFA 1A6PA 1UACL 3BQUA 2ZRXA 5C08B 4X6FA 3K4DA 5HDBB 2R82A 1G7HA 3DSNB 3HI6H 4PTTA 1RP8A 5I19H 3JXAA 1KLUA 3NIDE 4O2FA 2QTVA 1JVNA 3A4XA 4JD4A 4PCKA 4YHLL 3MRFA 3VMPA 1P48A 2QCDB 2Z1VA 4QP0A 5FAGA 5DDHA 3WQ4A 4UILL 1G9EA 2Y5TB 4LNYA 3NPWA 1QATA 5BQDA 5HGGS 5HDWA 4ZBCA 4KWWA 2IC2A 1F1GA 3MY9A 5E2WL 1L9SA 2YSWA 3DURA 3PXJA 2PWGA 4Z23A 2VLME 5TDNB 3AU2A 1IGFH 2ADJA 2CHNA 1FTXA 3R10A 4O15A 3QUXC 2ICEB 4PR4A 5KINA 1UGKA 1G7LA 1L0YA 1HKMA 4EXPX 4IGSA 1KKOA 2BHYA 1HHGB 2A77L 1O7VA 3CFMA 3NWRA 2HBXA 4W89A 3E8VA 4Z3FA 4F3HA 4R7JA 4PY8J 1EZVY 1HHIB 1XIEA 5D2NB 5EN2B 1IE7C 3FH8A 1UEYA 4QGTA 5D8JH 2OSYA 3HHSA 2R0ZH 4NKMB 3HI1A 1NP0A 1CFTA 1MCWW 2TYSA 3BO9A 4GT0A 3VK5A 5E4AA 3PIQB 1JFXA 2X0WA 3QRLA 4L3AA 2GUOB 5HI5D 2UWFA 2HISA 2B0MA 1IEIA 4RIRA 2APXA 5I24A 5JOEA 5FV1L 4GBXB 4UMBA 1CXEA 4OCRL 1JDEA 1OK4A 1U8MB 1IZCA 3B0VC 5HA7A 4TN9A 4ODUA 2HG5A 3A4WA 3RN6A 4W6WB 5FJOA 3FA5A 5HQEA 1AAJA 3PWPE 1ZLPA 3IJ8A 1DVSA 2ZXDA 1R3LA 4X5QA 4Y4HA 3VFMA 5CEXB 4KVPA 3ZX1A 2HKFH 3AREB 4GRLB 1VKXB 4I3RH 3KNBB 5FYLE 3MXVL 3H8AA 1IJNA 3WNNA 4NUQA 4MAYD 3OLGA 5CIPA 4PCFA 1OB0A 3LEYL 4RCXA 5F6IB 1U42A 4B3VA 3OD3A 4M43L 4AC4A 3VH8B 1EBAA 1JF1A 4LQFL 1QNRA 2OFQA 4W8LA 1MAJA 5D9SB 3CO8A 3GVGA 3NDZA 2YB1A 2VKZG 1R0AL 4G9FA 1EPVA 1UR2A 2IXQA 4GKNB 4YSPA 3U0PA 1P4IH 3APTA 5BQ7B 2WWMD 1A02N 1NLDL 1YE6A 2WQPA 4R0LA 5DZOA 2CLPA 2PLCA 2BP3A 2QW5A 2E9IA 1Q38A 3MUZ1 3WIHA 4J2MA 2Y4SA 4ALDA 4H01A 1YUHA 3WLIA 2BO0A 1I60A 2OXGA 3IJEA 3MNVB 4ZZKA 5MENE 3I6EA 4XB8A 1SJXA 4FQLL 3PPHA 3AS0A 1JF6A 3C12A 2Q76A 1JVLA 3MLPA 1DVYA 4Y16C 1Q7QA 1MCLA 3PGDA 4DEUA 3R8HA 4HC1L 4YHOL 3JTTA 3O6KL 3H7RA 3W73A 3WQCA 4CNNA 4UOW1 1FNGB 1X9RA 3NQ7A 2O5XL 2DDQL 5IVXA 1R6WA 1DBJH 2E7MA 5HI3D 2REQA 3G0SA 7TIMA 2G3IA 2VAAB 1PCXA 2J2ZB 2XV6B 5LG1A 3W6MA 1QZNA 3HE7A 1TZHB 2BVQB 1XHGA 3AALA 4PGJA 5IGXH 1H5BA 4Z7UA 4QHKJ 2ZWYA 4EN3B 4TUKL 4AT6B 1QR1A 4IFKA 1A6WH 3K1DA 4WSJA 1V6TA 1UD8A 3GLAA 3DI1A 3HB9A 3PJSA 3H3PL 3TMLA 1C9DA 3J27A 4ETYA 1KV3A 1WTGT 2A74C 4AISA 2E0PA 3BAEL 2EYRB 2YGOA 5F9DC 4AITA 1HOCA 3R11A 4YXHL 1J18A 1ZV9A 3VD4A 1ZGLB 4FG4A 5FAAA 3QWRA 3UROR 4HPOL 2W3ZA 5HHNB 5LGHH 2DZSA 4KEVA 2HMIC 1OX4B 1B4LA 5FL1A 3OVRA 3FQUB 4N68A 1Q8MA 3S3DB 3BAWA 2WZIA 1SN5A 1QWUA 3L95A 2OODA 2ZG3A 5AW4B 1BZ9A 1WYJA 1VYPX 4U1KB 5B1JA 3LDBC 1V54B 1MUJB 2FEJA 3KOWA 4Q6IB 3A4DA 3RWGA 3MRJB 4OFIA 1WGVA 4IKNA 4B2DD 4MAYB 2I9LB 2VLKD 1OAZL 1Q1JH 3WD5H 5IEHB 2P5EA 1JNJA 4LF1A 1J9RA 3O3DA 1H09A 4O1BA 4N5UA 1FFPB 1KLYA 3WEZA 3HN3A 2P76A 5D93B 1H6TA 4AU0A 4FI4A 2ZRUA 4ZQNA 3T3PE 2Y36L 3B40A 1MCHA 2NY7H 4L1XA 4L80A 4L9LB 4AH2B 3NVDA 4O52A 3WFHB 5B1CA 3W9EB 4O17A 5IFAL 1BTCA 43C9B 1OALA 1AH1A 1RLCL 3MLWL 3GJFH 1ZY9A 4I2XB 3K2KA 3E6FB 2WMPA 3UJJH 1T8XA 2DQHH 4FQQB 1SW7A 1NGXB 2WXRA 3H2QA 3H9SB 4O51B 1P7QA 2R39A 4POZC 1NLBL 1VCFA 3ZHFA 1MHPH 5KSAC 4IT1A 3LENA 1T0NA 3GGWB 3MKKA 4QWWD 43C9A 4DFIA 5ICYA 1HJXA 3IDGA 1E4HA 1W8NA 3EOYG 2G50A 2WOQA 4D94A 4MJ5A 1FCQA 3F84A 1EIXA 1G6CA 3TV8A 3BVTA 1NPUA 1MHCA 3LHPL 3DI2B 1B0RB 1P5VA 1TPEA 3QDGA 1UJTA 3MFGB 4IIHA 2WXKA 1F2JA 4HU4A 3UXAA 1A7PL 1X9QA 3MSRA 6TAAA 1N6QL 2FIRT 5I1KL 3LMJH 3OKKB 5HTSA 2ATKA 3SGEI 5C92A 1QOQA 1BVKB 3K5XA 4DYKA 1ZLWH 3U5YA 4NUJA 1ECEA 4LGPB 5B38B 2E6QA 4GI8A 4AYEC 1LROA 4W9TA 1HAWA 1HGYA 3UG4A 1G7HB 3TM6A 1BW8A 4JQXC 3HG3A 3RU8L 3T2OA 2GOKA 4PLJC 3G77A 3KYAA 3D07A 4OZIB 4IRSD 2YA1A 1Q5MA 2UZXB 3IFNL 4Z7QE 2Q3OA 3X11A 1Q6EA 4IDLA 2XZAL 3LKOB 5DHVB 2R24A 4GYPC 1MAML 2J1XA 4QDPA 2J8TA 3CFDA 1QA9A 4RH4A 4ODWA 4X0KA 3D47A 5ABGA 4W6XB 1T04B 2ZYHA 1GAFH 3T0WA 4BDVB 3BGJA 1UC5A 3DESA 1WWAX 2P8MA 4QHLA 1JZ6A 3IGKA 2ATPB 3V0IA 1OZQA 3DI3B 1ZHNB 2UXVA 1WZKA 1FWIC 2IQTA 2XBZA 3IUHA 3QGKC 5BRPA 1OF2B 5GXBB 4CD5A 4HCRH 2HKFL 5CM1A 5ICYB 2JIWA 3WN5A 2B1OA 2ZIDA 3PAJA 1HHJB 1UURA 1H9VA 4JFHE 4X6EB 2X6CA 1J1XL 4BZ1A 1VBJA 2OZ0A 5EU3A 1FVPA 1DCLA 3E6FA 2CKBL 4MJHA 1S9YB 4TM9A 5F6HJ 3FPXA 1CDYA 4Y0GA 2XQ0A 3VFNB 1GOXA 1QOPA 3O9NA 1WBYB 3EBVA 4TMCA 1KCSH 2HVJA 3VPLA 2ILLA 1FC1A 2YRPA 4F0MA 1P7QD 2ZYIA 2K78A 1IHIA 3OLIA 2JMRA 4M7LH 4MJ5B 5I2IA 1K9TA 1DUZB 1WBJA 2VVSA 1EJ7L 5DRXB 5DWPA 1FHDA 1SFTA 1ACCA 2NYZA 1KFWA 1R86A 3B97A 1VS1A 3QPZA 4QXIA 1YEIH 4ZQRA 4WY7L 1CENA 1PLGL 3LKSB 2ZADA 1DLFH 3V0HA 2P8BA 3VMNA 1LRNA 4IWWA 2I69A 4JRXB 1IBGL 3JV5A 1G4SA 2VOTA 2E6DA 3IFLH 1JF1B 4NNPH 2CFFA 4NDMA 1X5AA 5E00A 4B9IA 2P5ED 4KKXA 4KRZA 3GU9A 3L2MA 1WT5C 4IBSA 5I79A 1WDRA 4JY5L 4N9DA 2JF1A 4PJEB 3L9BA 3AREA 4GRLA 4Z7WE 5AVUB 3TYGL 4KUCD 4WI6A 2CNZA 1HXJA 1HSBA 3EO0B 3MYJB 3OWRA 2X30A 3US1A 3NCCB 1SFLA 2GSEA 1UQSA 4ENEC 1L9PA 4L61A 1A7OH 1WHOA 1FYTB 4MQSB 3VDBA 2TRHA 4NKIH 4R33A 4HJ0C 4ATLA 2VQUA 3Q05A 3NIDF 3FGCB 3TOYA 3BDBA 5HQMA 2HPMA 4WWKC 5D1ZC 4XHJD 3DBXB 1KDJA 4TSBH 5A3IC 1NCUA 5CC7A 1T6WA 5F3FA 3RWJA 4A3YA 1TTAA 1MFVA 3OKOB 3PWVB 1M2VA 5KG9A 1T6VN 1W1PA 3O6LL 1RZPA 2EG8A 2V8ZA 4QRNA 2YN3A 4ZFOL 5I6NA 3ECWA 4I6KA 3ZMRA 4URTB 1NUNB 4ZMZA 4H8WC 2RA1A 4NWTL 5A7EA 3DVGA 1WVZA 5JHLA 2AL2A 4H7CA 1K85A 4YXKL 5BMWA 4S3DA 4NB7A 4X0NA 4EQ3A 4DO7A 5T1LB 1JFQH 1QUPA 5LXGL 5DA0B 1J93A 4GQ0A 5J6SA 1ZKAA 5DMGD 4LAKA 1UUQA 4QAMB 4FI7A 1B4RA 4N0CD 4NZTL 4D8PB 2J8UF 2SEBB 3HI6L 4ZG1A 1I7RA 2XQYG 2G2RA 2XRAL 1CF1A 2FYVA 1PDZA 2Z26A 3VXPA 4JDVB 1Z3GL 4UM9B 4ZTOL 3BN9D 5JHDE 2EPHA 3X3GL 2GI0A 1UWGL 3KAAA 5DQDH 5I9QC 4BFAA 5D9NA 4JHVA 3F2DA 4Y19A 5HD8D 2AK1L 5GVJA 2VXQL 4L37A 2YL5A 4XD5A 1AANA 4DERA 3HG1D 4P2OA 5I76B 4AC2A 1DQJB 1MCOH 4BQ4A 3ZM8A 4I48B 4KK6C 4UQ3A 1TOXA 3U36B 5KBNC 2PWEA 4IIZA 3BUPA 4Y2OA 3QV7A 2KHAA 3PGDB 5E94A 3S3PA 2WC3A 2ZRZA 4O1FA 4MD5B 4ATTA 4MJJA 1UR0A 1FWTA 4LNRB 1AR1C 4K3EH 3VNZA 1TE1A 1BA9A 3T5WA 3FO1A 3TJEL 1HNGA 1F05A 2CDEA 3UBFA 3GMPB 4DUXA 2WB5A 4RDVA 1NAMA 4F66A 1I2NA 1IE5A 1AOHA 1ZHBA 1OG6A 2JKIS 4N1HB 4LOCA 3MWAA 5CD3A 1K8IB 4J6RH 5L6UA 4HS3A 3UYPA 5KSBF 1TMHA 5CNHA 3ZUNC 1UR1A 4A3UA 2ICWJ 3II1A 4HQQH 5HYJA 4OLUL 2NCEA 4XPTL 4G1MA 3CM4A 5AW3B 1E4WH 2WNNA 2I56A 3KNBA 1PZ2A 3LHUA 3N0PB 3QIUB 3V0AC 4ENLA 3ULVF 4WV1A 4DKEL 4G7SB 1Q72L 1SUHA 2CUAA 1BSLA 3ANVA 3WLMA 1VFTA 3MUCA 4GUPA 3ULUL 4NZ5A 1BYAA 5FCZA 3MI2A 4R88A 1JPFB 3SCNA 3W26A 2VMFA 5J11B 4AIUA 1D5IL 2XKNB 4F9JA 1MW3A 1FHUA 5LGJB 2J6EA 2UWEF 3T6ZA 3GZOA 4HKZB 1KB9J 2RAMA 3G1YA 1BP3B 4KKQA 4JANB 4Y19E 4RFNB 1P0KA 1XDLA 2QDDA 3CV1A 2L7QA 5DJ0A 3S98A 4B96A 2RDUA 4NQCE 4M7JL 3HO8A 2AQPA 3QQ4B 2EXYD 4LGSB 2X0HA 4GJIA 4QG8A 5EBWA 4FQCH 5GJSL 3DV4A 4F0KA 4F8XA 3L16A 3J7HA 5K69A 5BRBA 3UTPE 3VXMB 5KSBA 1HYSC 1HQ4B 2DOCA 2BSDA 2FIKB 2C4XA 2X7LB 3ECBB 3MU3A 4JM2C 4Q2ZA 4HC1H 2VCBA 1LNUB 1XF5B 4GABA 2B7NA 4OECA 5CILH 1E28B 3T1WA 3DC8A 1G6RA 3QDME 1J5HA 1VYRA 4L4VA 4Z2GA 1OYAA 1SN0A 4WK4B 4X5XB 2IAMB 4XC3L 2APFA 4P2RB 1AIFB 4EWJA 4XX1E 3ULVL 3L5JA 1C8VA 4PTUA 4KXCA 3HC0B 1D9EA 5D2YA 2DZBA 4KZ0A 1V3IA 3BLPX 1WDAA 3O4LE 1I1AA 4OZ4A 1EWEA 1XYAA 3PDGA 4MWAC 3L3DA 4P57A 4Y1AA 3QUZA 3RUGE 4H8UA 3L1GA 2OQLA 4Z2JA 5C2XA 3FTUA 4G3YH 4KRPB 1H3PL 1TO4A 3QNYB 4HBCL 2W0PA 1W2PA 2WGXA 5CZJA 3ML9A 3N4FA 2PPEA 5DVLA 2ESVB 5DZJA 3RU6A 3CSYB 5CZVH 1P6CA 5D55A 5EBUA 3B2UC 2DTSA 4DESA 3H24A 4G59C 3ARDC 1YN7B 3QZLA 4CN4A 2GK0B 4DVOA 4TNGA 2G2PA 3AWEA 2D3LA 3LGEA 5HR6A 4KNUA 4LOUC 4ODHL 4XMLH 1J5CA 3FFCA 3K46A 3TL5A 1VESA 3SDDB 4KFOA 1DQQA 4KUCF 5HHOA 3OIHA 1JGDB 3IMWA 4KY1H 2NY6C 3Q3GA 2AK4A 1QBBA 5I15L 3UR5A 5AVNA 3FJ4A 4OFPA 2HS6A 2O6EA 3MSDA 3NSFA 4JEJA 4R2GB 5C0CA 1VEOA 2R4SH 4MGGA 2DZAA 25C8L 4GMEA 2XIIA 5BRZA 4ABWA 2DQGH 1T1XB 3VWJB 2YMXL 5K9QG 4KX7A 4F40A 3EYQC 1FLRH 3QUXB 4HF5L 4YE4H 1KEGL 3WEMA 3OQ8A 5HDBE 3WLJA 5CSRA 2AJYL 5F9OH 3M5VA 2QHLA 4M62H 4W4NA 1UXMA 1JK9A 4WO0A 5HDOA 2YHGA 1J9QA 4IPPA 3L3GA 4LOUD 1DR9A 3ZE1E 3PQYE 5IB3B 1A9BB 1X4YA 3QNFA 3O9WB 3PUUA 4ANXA 3AVEA 2JKXA 2XWBA 5D30A 3VG0L 4NHUB 1EIBA 1YEHL 5D5ME 3EOBB 1Q9KA 3SE4C 1I7RB 4BHYA 3UBXB 4GRWH 1G1CA 2EYSB 43CAA 4WNQB 3Q9QA 1EHXA 2J24A 4JKMA 3S36H 5HJBA 1PZCA 1YEDA 3QDJB 3MX0A 2FVLA 3MMEA 2DSKA 5CSYA 4GAJH 3EYQD 2FMOA 3R43A 2Y72A 2W94A 3GK8L 4C4KT 1UWTA 4DJFA 4DJEC 1CBVL 3LM7A 3TT3L 5T9BG 5BZXA 3GD6A 1FGVH 2RDTA 3ZYZA 1ZXKA 2PWDA 1MDAA 1U58A 4NENB 1Y65A 4PJCF 5KG9B 2VQTA 3R58A 3NSCA 1NELA 4IJ3B 1AGBA 3M7OA 4OJFH 3V6FB 1PLAA 1Z1WA 2J78A 5EU6D 3P3SA 4MKMA 3NRQA 3IGXA 2MKWA 2D69A 3HOGA 3DSFH 4G9FE 3ZJ7A 3C2SA 1YVLA 2VDKB 5BV7L 1BZ7B 2LLGA 1ZLVH 2BP0B 4PY7B 2QKIB 5DI8B 2GC7C 2YGNA 5FEBA 4CKQA 1V0MA 2YRLA 1KRCC 1WCGA 2GIXA 3MV8B 5FLUA 3BLLA 3O63A 3QRBA 2V5MA 3P0VL 2Z3FA 5F1NB 3APCA 2X8RA 4Q8PA 2FEEI 4A7UA 5E6IB 3MRQA 3CHQA 4HJTA 3I9IA 2P7TB 3GXMA 4KROD 2CUMA 3BPLC 3CHOA 2VQ1A 3MRKB 4RGND 1F6PA 2CMRL 1OD7A 1TTIA 4JFDA 2R69H 4WHYG 3O06A 4Y9NA 4D1JA 4GW1A 4Z77A 1XGDA 1WA0X 3P4MB 4YHEA 2NTFA 5AVYB 4IHCA 5K9OA 4QS6A 3KGSA 4Q6KA 2G9HB 2PW2A 3P9LA 2IALB 4JPWL 2DKMA 4F7MA 4FA8A 2ODIA 2BGNE 4RDQF 3CUXA 5DUMH 4ZMOA 5HDRA 1XRVA 4GMTH 4BIKA 1MJ8L 2FGZA 2KUTA 4DVBA 1TJGH 3SUSA 3VDGA 5LGJA 3S8HA 4XXCC 3QJVB 1CYWA 4OCRH 3DOPA 3GHEL 5I19L 3DLQR 1UWXK 3N1PC 1EHLL 5K9XA 4UTJA 4ZOEA 2IBZX 5F6HI 2PURA 1BG4A 3ETBF 4HMCA 3RGVC 2VDPH 3WEBA 1I6NA 1KCRH 2PF0A 1OM3L 9RUBA 2WWOA 2NY2B 4PI2A 3BUTA 1F8MA 1CZ8H 4QYOA 3C8FA 5FC9A 1DVQA 3K30A 5B7EA 3TYCA 4PFEA 4CD6A 2GEQA 4K7PH 4GH7B 2AV7B 3GNDA 1JNHA 1NMCC 5G4OA 5EEWA 1ECQA 2NY2D 4ZGYA 3R1GH 3V1PA 5SWUA 3W07A 2F74A 4MCYB 2HJKA 3D30A 2V5RA 1BPVA 1HG3A 3VIFA 5HMSA 5CILL 3RE0A 2NNRA 1SVBA 4Z7VB 4RFOH 4ZFFB 1YHTA 2XFWA 4OZIF 4F9DA 1W1B1 5CKAA 1OGTB 4JKPL 1D5MB 4Q74A 4LNRA 1A4CA 3HUJA 3WS6A 3KM8A 3AY4C 5LCVL 4E41B 2IXVA 4N2HA 5AYYA 5A8QA 4AQLA 5EO9A 8CGTA 3VXSD 4JTJA 2ITCB 4OGXH 4K8HA 1BZOA 3NM1A 1W0VB 3AGWA 2NSMA 1ORSA 5FHBL 2Z0UA 1UWQA 2XYLA 1JPGB 1JWSB 1T2XA 1XHHA 2G2NA 2VLKE 1SYTA 3CU2A 3OA3A 3WDIA 4A38A 4JICA 4AJ0A 2QVKA 4NI8A 2EZ0C 3WBWA 5AFDA 2ZKMX 3C6CA 1AQHA 2ZUSA 1C93A 2IKJA 4PYSA 1QSED 3G1VA 1H4PA 3VCCA 5CPMA 4HC1A 1SLXA 3N06B 5CP7A 2Z2BA 5E8PB 3U2OA 2WTOA 3GSNB 3RY5A 3V52H 4FQXB 3WKML 3ESUF 4BKTC 3E2SA 4Q33A 5I66B 4KPHL 4ZUWA 1KWKA 4FQ1H 2GCYA 4M51A 3QJFA 1YEIL 2YBGA 3NABH 3VFRA 2P26A 4DPRA 2NNAB 3G7TA 3T0XA 2QJMA 2JKJA 4CNUA 4NT0A 1IBGH 1JRBA 1S5HA 2XIOA 2XH7A 2Z31D 1EZSA 1TFHA 3HVNA 2J77A 4TQEH 3UTSA 3W70A 3RHWF 2XGZA 4QTHB 5AOMA 1DIEA 4PGDA 2EC9T 2MPAL 4I2XA 1RZGA 4LSPH 3DTUB 4NZFA 2HH0L 3RKDC 5CEZE 1ZENA 3GLCA 2BLFA 3ITGA 3MYPA 3NIGB 1RZJL 4MKSA 2JCCB 4YE4L 3PQYB 3WCYA 1KEGH 5EUOB 1BLIA 2UZIH 1PKMA 2XKSA 1W3TA 3OKNB 5CPQA 1NJ9B 3WGUB 4UTTA 5JNYA 4Q14A 1RIVL 3CBRA 5JXEA 1M7JA 1SYVB 4ODSL 3G6JB 1IIKA 1WA3A 2G95A 2YCJA 3EX1A 3P74A 2APTA 1J7VR 4L4LA 4DP8X 4N5ED 3H22A 4AX6A 5BNXD 2R1XB 3WDQA 2LOEA 3PHQB 5GGVY 1A4JB 2UYLB 4B5ZA 2A0NA 4FF5A 3T2QA 4HNNA 4NYYA 3LOWA 1NCCL 1OAXL 3UNDA 4PRNA 1TLMA 4L3EB 3TV3L 1PKQE 1JAEA 2H4EA 5F97E 4ZUVA 5AG9A 3WTWA 1YDOA 4F7CA 2V81A 4RX0A 3M5ZA 3OWEA 2BIMA 1WF5A 2OSWA 2APVA 2CBJA 1M7IB 1XWVA 3CFEB 4H2AA 4Y4FC 1FQ0A 3OKMB 5D7LE 2QUNA 1CURA 3AWNA 1M7OA 2QR0B 3EH5B 5AW6B 4LSSL 3DXAD 1UD6A 1UKSA 3F7YB 3O4LB 3BRGC 1D6EB 3UJJL 2JIXD 1SXAA 2YPLB 4ETQB 1XLJA 4A8IA 4XN4A 4DZ8A 4PH6A 2V63A 1MQKL 1E72M 3S8GB 4IMAA 4N5EC 4IBTA 4DM2A 3BUYA 3B7TA 4ORGA 4G82A 3LTSA 1NA8A 3S4SB 2ESVD 3LZQA 1J11A 3POHA 5EA0H 3SPIA 3DOIA 3AADB 1Q9LA 4HPOH 3EHBD 5TQ2H 1SQ7A 5D8WA 5I02A 4PB9L 1Y8BA 4XH2A 1E4WL 5SWSD 4JX4A 3EYOA 2ENJA 4O2EB 2NLJB 2BVPA 1GW0A 3W88A 3NDYE 5AHEA 3XINA 1I3GH 3WFZA 3ZUCA 2BNRB 3NYKA 4YL9A 2P43B 1Z32X 2CDFB 1QFEA 4K23L 4EI5A