3ZQ9A

Structure of a paenibacillus polymyxa xyloglucanase from glycoside hydrolase family 44
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
512
structure length
512
Chain Sequence
AKTITIKVDTFKDRKPISPYIYGTNQDLAGDENMAARRLGGNRMTGYNWENNMSNAGSDWQQSSDNYLCSNGGLTQAECEKPGAVTTSFHDQSLKLGTYSLVTLPMAGYVAKDGNGSVQESEAAPSARWNQVVNAKNAPFQLQPDLNDNYVYVDEFVHFLVNKYGTASTKAGVKGYALDNEPALWSHTHPRIHGEKVGAKELVDRSVSLSKAVKAIDAGAEVFGPVLYGFGAYKDLQTAPDWDSVKGNYSWFVDYYLDQMRLSSQVEGKRLLDVFDVHWYPEAMGGGIRITNEVGNDETKKARMQAPRTLWDPTYKEDSWIAQWNSEFLPILPRLKQSVDKYYPGTKLAMTEYSYGGENDISGGIAMTDVLGILGKNDVYMANYWKLKDGVNNYVSAAYKLYRNYDGKNSTFGDTSVSAQTSDIVNSSVHASVTNASDKELHLVVMNKSMDSAFDAQFDLSGAKTYISGKVWGFDKNSSQIKEAAPITQISGNRFTYTVPPLTAYHIVLTTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords XYLOGLUCANASE
publication title Structure and Activity of Paenibacillus Polymyxa Xyloglucanase from Glycoside Hydrolase Family 44.
pubmed doi rcsb
source organism Paenibacillus polymyxa
molecule tags Hydrolase
total genus 184
structure length 512
sequence length 512
ec nomenclature ec 3.2.1.151: Xyloglucan-specific endo-beta-1,4-glucanase.
pdb deposition date 2011-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12891 Glyco_hydro_44 Glycoside hydrolase family 44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3zq9A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3zq9A02
3VIMA 4AZCB 2OYLA 4QDMA 1J0KA 4GXPA 3FNDA 3U7BA 2YLAA 5E9AA 2EAEA 1JD7A 3DYPA 1FH9A 3LXBA 1PZ2A 3M07A 3AHYA 4PMZA 5D9PA 5AYIA 4CGTA 1ITXA 3WMBA 1KXVA 1U30A 4U2YA 1O7DC 1P6WA 3OLGA 5M3WA 4GI9A 3ZJKA 3CO4A 3AMLA 2ZXDA 3CMJA 2GDVA 5A8PA 2Y2WA 1LG2A 5ABGA 4B3KA 1TQUA 1KWGA 4W8AA 3W0KA 2WBKA 2WWCA 5FKYA 4W88A 3ARPA 4OOUA 1R86A 3OZPA 5CPQA 3W27A 1QI5A 3L4TA 3WH6A 3WF4A 1OCQA 4E8DA 1AQHA 2BXZA 1C8YA 4QCFA 4AC1X 1IZJA 4JFTA 4E2OA 4QP0A 2PWDA 2VR4A 1JNDA 2XFFA 3EJTA 3NJ3A 3CGTA 5A2CA 1W91A 2F1BA 3VSTA 2E0PA 1TE1A 3N12A 2VX4A 3VSVA 2V3GA 1KGXA 3WF2A 1PX8A 1CGXA 2DEPA 5FL0A 3EJPA 2QMKA 4FNTA 3HG5A 3WUFA 3AHTA 3MUY1 2ZE0A 4P7RA 1UH3A 4UFMA 3ARVA 2OWWA 3WH7A 5JBEA 5BXRA 4MADA 3QHNA 3L2LA 4CUCA 1Q6FA 3AIQA 1UHVA 3SUVA 1VJZA 1KQZA 3OGRA 5A8NA 3FY1A 4H04A 4HOZA 2PWGA 4AWEA 2YKKA 4FNRA 4V2XA 3LRMA 1QI2A 5CPTA 3L4UA 1JDCA 4CU6A 2CESA 3PBGA 4MB3A 1UKQA 1K6AA 1WDSA 3AIRA 4NRSA 3LRLA 4CD5A 1GVYA 2ZWZA 1R8LA 3VD7A 1UKTA 4FF5A 4HA3A 1OIMA 2CXGA 5CSUA 1OM0A 4CD4A 5I78A 4BZYA 1UD5A 3M7SA 3MMDA 1OGSA 3MO4A 4UQ9A 5E70A 1EQPA 3ALFA 1JDDA 1UR2A 2JFEX 3GXMA 1HKJA 1HNYA 1HKKA 1AMYA 4J3UA 4M56A 2EO7A 4XUYA 3SCUA 3AZSA 3KL0A 3I3DA 3VUPA 1HIZA 1FH7A 5HDRA 2XVKA 4ZENA 5HXMA 1LWJA 5I24A 1UR0A 2GJXB 3NSMA 3WSUA 3WY4A 1NOUA 4U3AA 1BAGA 3WDQA 2V3DA 1J10A 1US2A 1J0JA 2WLZA 2E9LA 4S3JA 2WC7A 4F9DA 4PTVA 2JEQA 3RIKA 3W53A 3WDJA 2O92A 1V3HA 3HN3A 4MB4A 3ZOAA 2VZSA 4UFLA 5IHRA 4TXEA 4ZXLA 3WNNA 3ZSTA 3GXDA 1W1VA 3QOKA 1JZ8A 5DT7A 4UOJA 1W3KA 2UY3A 3T2OA 1AQMA 3ZT5A 3VDCA 4UOZA 4PMYA 4V27A 3T09A 5A95A 1GPFA 3WD2A 2XVPA 2WKGA 3KZSA 2WHKA 3QR3A 4LYRA 5JIPA 1V0MA 4DUVA 2V38A 3OB8A 3VDHA 3PHAA 1JDAA 1LWHA 4P7LA 1CNVA 4KGLA 1QHPA 4M29A 4OUEA 5ABFA 2B31A 2C8NA 3CUJA 5CXPA 1UA3A 4AZGA 4LXFA 1EDTA 1EQCA 3VGHA 7TAAA 2VNCA 1W1YA 2VVSA 4GINA 2DPEA 3VIGA 3WUGA 3AHZA 2FE0A 4D6DA 2XN1A 4JKLA 5DT5A 3UEQA 2VVNA 4F9JA 3BXWA 3PZMA 1ZB5A 4HPHA 3GBEA 3ZSSA 1HJUA 3QGVA 2VCCA 3IANA 4M82A 4TUFA 3SIMA 4R5EA 1TVPA 4W8BA 1LG1A 4LPCA 4D6GA 3U7VA 2DH2A 1TUXA 4JIEA 2XUCA 3KL5A 5A6JA 1BTCA 2CIPA 1ZBKA 1V3LA 3TP4A 3TONA 3CZKA 2G41A 5HNNA 3CZNA 4CU7A 3A4AA 3VNZA 3BAJA 3W4RA 3WEMA 2ZXBA 1KXQA 2EPLX 2QLYA 1EOMA 4IM4A 3OA5A 2A3CA 5FCZA 2D0HA 4UFHA 4Y7EA 5GNZA 3LX9A 1EHAA 1O7AA 1M53A 4AMCA 2ZXQA 1CGTA 4JCMA 2XJ7A 3EYPA 1H3GA 3L4VA 3WNLA 4D6JA 1GOMA 4AMXA 3D5HA 3ZMRA 3THDA 3WKZA 1MW3A 2FHFA 2W62A 5D8WA 3PZUA 5EFFA 3BLPX 3WFZA 2VMFA 2ZWYA 1JIBA 4A3HA 2YOCA 1WE5A 1JAEA 2J77A 1DP0A 4D6FA 1ZU8A 1CDGA 3VGFA 3ECQA 1VEPA 4PN2A 5BXTA 2PWFA 1UKSA 3WY2A 3WL1A 1NQ6A 2VX5A 1ODUA 3D51A 5EBAA 3N13A 3UR8A 3O2LA 4YN5A 1CZ1A 1R7OA 4OJYA 5GQBA 3OG2A 1R34A 1CXLA 3VD9A 3VIPA 3SCPA 3T2QA 1VFMA 1UH4A 1GCYA 1WZAA 1QVBA 5EB8A 3GZAA 2WCSA 3K4DA 4DWSC 5JBFA 1B30A 1TA3A 3WD0A 3VMOA 3ZM8A 3WN6A 4R27A 3JUGA 3B8SA 4MAVA 2J7FA 2FGZA 1E70M 2OSWA 3SCOA 5IDIA 2V3FA 4ZEPA 4EE9A 1GVIA 4WKHA 5CLWA 3VM7A 4HZ7A 4ATWA 3VX0A 1JZ5A 3PZQA 1H11A 2Y24A 1MW0A 5IHSA 3SEPA 5CG0A 1FH8A 2DQXA 5BYWA 4HMCA 2FHBA 2PBGA 5BCAA 1GQIA 1GOIA 1E6ZA 1VRXA 4H8HA 1H2JA 3WQ6A 3AIWA 2WCAA 2WW5A 3VGGA 1HJVA 1J9YA 2WHJA 2UWFA 1LF1A 2QF8A 1GOWA 5A8QA 1EH9A 1JXKA 2WNWA 1H5VA 1XHGA 1QI4A 4H41A 4TOQA 1V0KA 3AICA 8A3HA 2WPGA 4GIAA 5A8OA 3GNOA 1M03A 1ESWA 3WQ4A 2CYGA 1C92A 3L4WA 5A2BA 5LA1A 1KGWA 4H2CA 2W92A 2OSXA 3PZNA 2DSKA 4AIEA 4MTVA 1GNXA 3THCA 2VR5A 3DX3A 2VX6A 2EJ1A 3IJ9A 3OZOA 1TVNA 4MNLA 3N11A 3BLKA 2YA1A 3GH5A 2VC9A 1JZ2A 2WMIA 4UZSA 4WSKA 2DIEA 4JFSA 3BVUA 2F7RA 4NZCA 4MJ2A 3VIOA 2D2OA 2F7QA 3W25A 1R75A 2CBJA 2WVVA 2GJXA 1ISZA 2J8GA 4L4OA 2OW7A 1WKYA 1C93A 1QI0A 2CITA 2ZX5A 4ML4A 2FGLA 3CUHA 1CXHA 2EADA 1K9TA 4AD0A 3KEHA 1G0CA 1V02A 1E0VA 4W86A 5A6KA 1W9BM 4HU0A 3CUFA 4N42A 4UQDA 1EIBA 3AIVA 4AD2A 1PIFA 1UUQA 3IJ8A 3WDPP 5ABFB 1JL8A 3EDJA 1FHLA 1QWUA 3BAWA 1WZLA 1GW1A 1OB0A 1CECA 2BY1A 1PBGA 4LX4A 1LL7A 1JXJA 1QWNA 1TQSA 2E8ZA 2ESCA 3VM5A 5HPOA 1BFNA 4KWUA 1LL6A 5AYBA 3LXCA 4GZIA 1IZKA 3POHA 4AMWA 4FLOA 1PJ9A 5CPSA 3A23A 3POCA 1WDPA 1UASA 4W8LA 3TV8A 3LMYA 3UG4A 2CETA 2XSAA 4BCEA 4JAWA 4AY1A 1KXTA 5AC5A 1NWRA 4LYPA 1OSEA 1NWUA 1BYDA 3N1AA 1QNSA 4DO5A 1OT1A 3VSUA 1E5JA 1UWQA 1LL4A 2WK2A 3DYOA 3VOCA 4OBSA 4ATDA 2PWEA 2X2IA 1RP8A 1C7TA 1H1NA 3WY1A 1V6XA 1RD6A 5D9OA 1V6VA 3VKKA 3AISA 2J8FA 3WEZA 4AW7A 1J01A 1ECEA 1W9UA 1BHGA 1V0NA 2BHYA 2ZX8A 4HP5A 1KR0A 5JBDA 4XB3A 5CSYA 1GJWA 1E6SM 3CV5A 3AI0A 4JFVA 4QLJA 5A8MA 3DX4A 4CD6A 3WENA 2VRKA 3BMVA 3L2MA 4AZ5A 2VX7A 1DWJM 1SR0A 1CGVA 2QHAA 1HX0A 3WDRA 1FA2A 4PUEA 4J28A 2A3HA 2CBVA 1XGZA 2ZXAA 3WD4A 1LQ0A 1JYWA 1BLIA 3RJXA 1MQQA 1J0YA 1E72M 2WMHA 3GH7A 1V02E 4P7QA 4ZE5A 4W87A 4NXSA 2D24A 2G3NA 4M8UA 3VIHA 3I3BA 1PIGA 1XH0A 1MW1A 3VGDA 1DHKA 1MFVA 2FYVA 3EDDA 2VRQA 2E4TA 2PWHA 5C8BB 2XN2A 2WANA 2Y4SA 1KR1A 5D9MA 2Y8VA 1XYFA 4TX8A 4WIWA 4W5UA 4UQEA 3VINA 1TA3B 4J3WA 2WB5A 2XGIA 3ZR6A 1A3HA 8CGTA 2BV9A 3N9KA 1JNEA 4U3CA 2J74A 2F7PA 4AZ7A 1QPKA 5HPCA 3VX1A 4UOQA 3T0DA 2TAAA 2W66A 1CXFA 2C0HA 1RH9A 4P7OA 1ISYA 4U5KA 1UR8A 1BVZA 3RILA 2BS9A 1J0ZA 3T2PA 2GVYA 4PRWA 3MMUA 4JFUA 3NSNA 4J3VA 1ISWA 3RDKA 2VZOA 5IFTA 3WUBA 3KE0A 3SCRA 2G3JA 1QNRA 1HXJA 3DHUA 3BAKA 3VILA 3DDGA 4A3YA 1MWOA 1UOKA 1J18A 1TQWA 3T0BA 3EMCA 4D6CA 3S5YA 1JZ6A 4Z2IA 4KH2A 2EQDA 4NZFA 4WK9A 2ZICA 3TTSA 1W2PA 1Q6CA 2VTFA 4QFUA 4UCFA 1B90A 3LXAA 5CZKA 1JI1A 1JAKA 1CPUA 1UR9A 4MNKA 1VIWA 2VI0A 4NX0A 2WLYA 3OLEA 3GM8A 4D1IA 4PYSA 2D0FA 4JFWA 2XGBA 3AYSA 3U5YA 4AZIA 4MNMA 1OGBA 1RPKA 2YDQA 3VD5A 1B9ZA 3EBVA 5C71A 3HG4A 4BS0A 2WMIB 4AZ6A 4YHEA 3CZJA 3WH5A 3WNPA 3RM8A 4AIUA 1E0XA 1XD0A 1BG4A 3WF0A 2WVVB 1GOOA 2NSXA 2WYSA 1ITCA 5EFDA 2JIWA 1EA9C 5GNYA 2F18A 1PPIA 1QOXA 1W9VA 1OT2A 4BA0A 1E4NA 4GI6A 3FXYA 3EJRA 2F8QA 2Y8KA 3SCVA 1HF6A 3RJYA 3AS0A 1V3JA 2D23A 3AHXA 2WMGA 3AZRA 1GHSA 3A3HA 1JFXA 4CVUA 2CKRA 1QBBA 2WCGA 2AOSA 3BAXA 1FFQA 3WBAA 3IGUA 3MV01 2J47A 1JZ4A 5M03A 1ISXA 4Z2GA 3TOPA 1BG9A 1C91A 3HG2A 4JKMA 1UR4A 5DO8A 1DEDA 5I77A 2XM1A 4KGJA 4WKAA 5IXEA 1W3JA 1UKOA 1MYRA 1X6NA 3L4YA 1V6YA 4E4PA 3GXIA 1RP9A 3EJUA 1E71M 4P8WA 2VZVA 1BYAA 1E4MM 4GPNA 4FLRA 6CGTA 3HMCA 1GHRA 4LGXA 1GQJA 2X0HA 1L8NA 3VGEA 5JIWA 1R87A 1H4PA 1ZBWA 2X0YA 3MMWA 5IFPA 2ZUVA 2VURA 2J7DA 1E4IA 1QNPA 4X0NA 4PTXA 3CTTA 2DT2A 3WQ5A 1M7XA 3BVXA 4CN4A 3SURA 3BMWA 3AIBA 2ZX7A 3GNPA 1J0IA 1UD3A 3BUPA 3MANA 1A47A 2WBGA 3CZ8A 4N0RA 5E6ZA 5I6SA 2D0GA 4PMXA 5I3DA 4LQ1A 2UY2A 2D3LA 4F79A 2XN0A 2ZUWA 2UY5A 1E6XM 4PTMA 3BVWA 1K9EA 5M5DA 1TQVA 1NOWA 5FOOA 1Q6EA 2EBNA 1R47A 3CHEA 1WNOA 2IXUA 3DYMA 2W61A 1G94A 3II1A 3ZJ6A 2Y5EA 1TR1A 3QHOA 1G9HA 4AXNA 1QX1A 1CGWA 4CVWA 3BAIA 2VCBA 4DM1A 4B16A 2CBIA 3O9NA 5A6BD 1UWRA 4UQBA 3CHCA 3CPUA 1AQ0A 4Z2JA 2BVDA 1R7AA 1KBKA 4NZJA 4W93A 4BF7A 1CLVA 3ZT6A 2YJQA 2GDUA 4FLQA 3WNMA 2VT0A 3A6OA 4S3KA 4U33A 3KLKA 5I5RA 2X05A 1K9DA 1E4LA 1EXPA 2DIJA 1BVNP 5I2UA 4D6IA 1YHTA 2OWXA 2W5FA 1EDGA 5C70A 4BQ5A 3VIKA 1E3XA 3ARTA 3LPFA 4AZBA 3BVVA 1XSJA 3NUKA 3W6MA 4P8UA 2WMFA 1QBAA 3VDBA 1XYZA 2FH8A 1ZBVA 2YFNA 3WF1A 3G6MA 4H7VA 2GJRA 4WKFA 1C8QA 3MUIA 3BVTA 3GXNA 2WM0A 3CC1A 4C7DA 4FNQA 1FOBA 4IPNB 3S6TA 9CGTA 4GO8A 2J7HA 1EHNA 3ZJ7A 4OKDA 1KTCA 1NOFA 1FP8A 2EPMX 3QOMA 4MB1A 3MI6A 3DDFA 3EJQA 4H8UA 2WKLA 3RPMA 1E6PA 1UD6A 4M1RA 1CXIA 3APGA 4OBRA 3W28A 2BHUA 4HA4A 1WAWA 4BQ4A 2X1IA 1MXDA 2XFYA 1BYBA 3KL3A 1WO2A 2XVNA 4EAMA 1QI3A 4FLSA 1SMDA 1C90A 3ZIZA 4F66A 4WSJA 4IUGA 1TQTA 4J3SA 1OBAA 2XIBA 1HJWA 5FL1A 2GK1A 1WB0A 1F4HA 4NI3A 2G3MA 1JFHA 3E1F1 5F7UA 3AXIA 3L4XA 1E0WA 4TVCA 2D73A 4QLKA 2YA0A 1QW9A 5BRQA 3LPGA 1UQZA 1D2KA 1VFUA 3AYRA 3T0AA 1EGZA 4XX6A 2J7BA 2XWEA 5A69A 4FMVA 3PZ9A 4PMUA 4PMNA 1C7SA 4B3LA 4ZFMA 1E55A 2FDMA 4GZJA 3GDBA 4ATLA 6TAAA 2XFRA 4HPGA 4TTGA 3W82A 2J7CA 3N18A 4UFKA 1W3HA 4HMDA 2W91A 3AROA 4PTWA 2OWCA 3VVGA 1CENA 3BUQA 3AIUA 3CUIA 3IAQA 4W7UA 2HISA 1V03A 1V3MA 1Q6DA 1UQYA 3GXPA 5CQ1A 5TD4A 2WVTA 2UY4A 1E1FA 4E8CA 3PTMA 2VQUA 3PZVA 5D8ZA 2BY2A 1NWSA 3AXHA 3EJSA 4P8VA 2OYKA 3H54A 3FHAA 3GNRA 1Q6GA 3WF3A 5A6SA 3B9AA 1NP2A 5DEZA 2YLLA 2WWDA 3NYDA 3CMGA 3GBDA 5LA0A 3WH9A 1E9LA 3GXTA 1ISVA 1VAHA 4W84A 3VPLA 1JG9A 4X0VA 3HU7A 3ZR5A 3EDKA 3AMDA 4TX6A 2BY3A 2NT0A 4DWSD 2D22A 4AD3A 2JALA 4QAWA 3J7HA 5BXSA 2QV4A 2F61A 3FHQA 4CN6A 1W9PA 4MJ4A 5E09A 1W32A 3CZEA 2HVMA 3WMCA 3WIJA 1XV8A 4PMDA 3UCQA 2E9BA 3BUBA 1F4AA 1B1YA 3AS3A 4FNUA 4U2ZA 2RGMA 2YA2A 1B3ZA 5CLTA 4L4PA 1V3IA 1WZMA 2DT3A 2Z1KA 3CZSA 1SYTA 1W9XA 3EMQA 4D6HA 2DSWA 2VZTA 3BH4A 5KEZA 2PB1A 3QHMA 3OIHA 2D3NA 1FFRA 4CN1A 4KRTA 3HJEA 3PZTA 5BRPA 3K1DA 1EO7A 3A4WA 2BXYA 3NCOA 2YBUA 3MV11 4MB5A 1KCKA 4Q7NA 2WC4A 3AMCA 4DUWA 2G3IA 4AD4A 3D4ZA 4CCEA 1CLXA 2O9TA 1WCGA 4A4AA 1B3WA 1GUVA 2BVTA 4QLLA 3EMZA 1HT6A 1LJYA 1KQYA 1PEZA 4YHGA 4Z2KA 3NSXA 2XM2A 4XZBA 4AEEA 2VJXA 3U57A 4Q22A 2YDRA 1H09A 3DHPA 3ARWA 4RE3A 2G4FA 3DC0A 1B3VA 4XV0A 4KMQA 5BWFA 1ZJBA 1IT0A 2CHOA 3AXXA 4J3TA 4OOZA 4P8XA 1DWGM 2Q8XA 3WDHA 3VTRA 2BVYA 1C8XA 1DWAM 4AYGA 4PBGA 1JYXA 1J11A 5A94A 1CWYA 2VRJA 1X1NA 2EXOA 3M46A 1HP4A 1V6UA 3VO0A 1S46A 5FD0A 3K8LA 1E6RA 2WHMA 3SUUA 4JKKA 1NP0A 2F2HA 4RE4A 2YDSA 2ZUTA 1V08A 1BGAA 3WBEA 3AQUA 2EPNA 3EDFA 2GFTA 3AFBA 2OLHA 1VFFA 1SMAA 3L4ZA 3KLLA 4JZ5A 3T08A 1OD8A 4Z2LA 4GO9A 4W5ZA 5DF0A 4UFIA 2YL9A 1HVXA 4M24A 3PN8A 1B31A 2E40A 3WMSA 3ARXA 3TA9A 4CD8A 1ZL1A 1CBGA 5E0CA 3RO8A 3CUGA 2RGLA 2E9MA 5BXPA 3UESA 1HJXA 2DT1A 3ARSA 3W26A 2E3ZA 3F5JA 1WDRA 4U5IA 3K8MA 3WD3A 3I3EA 5JUVA 1TZ7A 3ARRA 3K8KA 5KZ6A 3WNKA 2PI6A 3FAWA 2YL8A 2GJPA 4HA1A 2WMKA 3AS2A 4K68A 3BC9A 4NRRA 4AYSA 3H55A 1VFOA 3D52A 2F1AA 2XSBA 1BF2A 1GOQA 3G6LA 4ZXOA 2JF6A 1US3A 1KB3A 4J3XA 2VQTA 3UG3A 1KXHA 5CGMA 1E6NA 2AAAA 2WZIA 3SUTA 5A3HA 2J4GA 2XTKA 1YQ2A 1LLOA 1HKMA 3IJ7A 3HZ3A 3OGSA 1E40A 3OBAA 5A1AA 3WEOA 1VF8A 4HZ6A 1UD2A 3BLBA 1E3ZA 2YFOA 3U5UA 1O6IA 1GONA 5BROA 5A2AA 1WZKA 2IXVA 2GK1B 3AIEA 2W63A 3MUZ1 3WL0A 5CJ5A 4ACZA 3N17A 1H0GA 1K9FA 3MU7A 4LYQA 2A3AA 3FN9A 3CHDA 2CEQA 1W1TA 1SFSA 3W6LA 1R46A 4RL3A 1JF6A 3S5ZA 1GQLA 1XSKA 3VIIA 3DECA 1N82A 4HOWA 2YL6A 4B15A 2XVLA 1KBBA 2XHYA 1XSIA 1U33A 3NIYA 1HL9A 1CTNA 3OLDA 4GQRA 2XIIA 3CBWA 1BSIA 2W67A 4HMEA 5DMYA 1JYVA 1PS3A 5A6AA 1WP6A 4PCSA 2VL4A 2O9OA 4UTFA 5M17A 3OLIA 2J7EA 1E73M 4D1JA 1WPCA 2J79A 1W2VA 2JEPA 2XPKA 5AY7A 2FH6A 3WFLA 3TTQA 3PZOA 1OINA 3UG5A 3CZGA 3VMPA 1H49A 2BHZA 3AZTA 2BNJA 1R33A 1DWFM 3VD4A 2X8RA 1CGUA 1JYNA 4EK7A 4MPKA 1E5NA 2DDXA 1BQCA 1GOKA 4UR9A 3A21A 2CBUA 3AMKA 4IPLA 3BUDA 2BFGA 3DX2A 3VMNA 3MSDA 1JGIA 1IV8A 4CD7A 3WNOA 1UZ4A 4X9YA 2O9RA 3ARZA 4ACYA 1MW2A 2CCRA 1VJSA 4D72A 1EDQA 3VIJA 4D71A 5D9NA 1HN1A 3K46A 2ZIDA 2J78A 5GPRA 3NDYA 3PTKA 5FIPA 1GORA 1CXEA 4DWSB 4M81A 2WC3A 1VENA 4MAZA 4DM2A 1UR1A 2WHLA 2JF7A 4W89A 1UG6A 4PUDA 2WAGA 4PMVA 2OSYA 4JL2A 4AISA 3SCNA 3GYCA 4W85A 2X2JA 2VCAA 2PF0A 1D3CA 2GUYA 4C7GA 3A5VA 4GI8A 3NDZA 2OW6A 1QW8A 5A6LA 1BYCA 2V3EA 3SCWA 1EO5A 1OGGA 4MDPA 4H8VA 4FNPA 1M04A 2DH3A 3RCNA 4NXKA 5DFAA 3SCTA 1ZS2A 2MANA 1U2YA 1I75A 4FK9A 2EABA 2J7GA 4DO4A 1KWKA 4TVUA 1FP9A 1GZJA 1TFVA 4PMOA 4EKJA 3BGAA 3VIFA 1ZJAA 2X2YA 3ZJ8A 4AD1A 1CGYA 4OIFA 2E8YA 5E6YA 1XD1A 4PSRA 3M6DA 1GQKA 4V28A 4HTYA 2CNCA 1MVYA 4JHOA 1PZ3A 3AOFA 4UZUA 1G01A 1PX3A 2X09A 4URIA 1UD8A 1HKIA 4WLCA 1CYGA 4CCDA 4AD5A 3GH4A 2ZUNA 4WF7A 3A47A 2PBOA 4QCEA 5I79A 3MSGA 3H53A 3CZLA 3CHFA 2G8ZA 4OGZA 5ECUA 1W3LA 3CLWA 3BSGA 3KWXA 1E1EA 1D7FA 1Y7VA 1QNQA 3ZO9A 2DT0A 2V5DA 3W24A 1HWWA 3WUEA 5I23A 7CGTA 3TTOA 4OZOA 3WD1A 2X2HA 3DX0A 4B9YA 3ARQA 3HG3A 4JCLA 3N04A 2EEXA 3WQ8A 1QNOA 3IK2A 4AZHA 3VD3A 4AZCA 5A6BA 2GSJA 2EPKX 4PMRA 3WELA 1UD4A 3W29A 3AHVA 4F8XA 3W38A 3DX1A 4MNJA 2D1ZA 4ZE4A 1OWQA 1HVQA 1BGGA 2J25A 1HL8A 4HZ8A 3CH9A 1HP5A 3VDAA 1JD9A 3CIVA 4UFJA 3ARYA 4AEFA 5GNXA 2J75A 2OYMA 1JZ7A 1B0IA 3ZQ9A 1HJQA 4UQAA 3FAXA 3BCFA 3TTYA 3MKKA 2V5CA 4CU8A 1NH6A 1DWIM 1FHDA 1W9DM 2WMJA 1OIFA 4GKLA 3MS8A 1XRVA 1V3KA 1MXGA 3RM4A 2NT1A 2Z1SA 2CKSA 4PCTA 2WVSA 1I1WA 1E56A 4ACZB 3UR7A 3SUWA 2ALWA 1MFUA 5HBFA 2XYLA 2VO5A 3D3AA 3AJ7A 3W81A 1QHZA 3LPOA 4C7FA 1W1PA 3S2CA 1H0IA 3N15A 1NARA 4RE2A 1CIUA 3ALGA 2VOTA 4DO6A 4NF7A 2D20A 4Z2HA 1V0LA 3UETA 1T0OA 2YIHA 3EDEA 2ZOXA 1G1YA 2EPOA 3BCDA 4AIOA 4KRUA 1H41A 3WY3A 2XG9A 2ZX9A 3RMEA 2QPSA 2WSPA 5D4YA 1UWSA 1Q4NX 1XC6A 4JL1A 4PSPA 2BY0A 1C3FA 4J7RA 2ZUSA 2XVGA 3A22A 3AS1A 4DUXA 1E15A 1XH2A 4BQ3A 4HU8A 3OGVA 1AVAA 5E1QA 2VUYA 3A4XA 1KGUA 3VU2A 2ZX6A 4BQ2A 1OD0A 3BAYA 3VNYA 1CXKA 5A6MA 2F7OA 1UZ1A 3B9DA 4MDOA 3AMGA 5ABEA 3ZT7A 2W4XA 1TMQA 2WVUA 1R85A 1JI2A 4IISA 3BSHA 1B3YA 5E0FA 2YL5A 4PEEA 3IAPA 1DWHM 3F5LA 3WDIA 5LYRA 4D6EA 4JHZA 1E6QM 3FW6A 3O6AA 1PAMA 3SUSA 3GXFA 1Z32X 2AMGA 4XZWA 4YPJA 3BUIA 1UYQA 1QHOA 4CKQA 1UWTA 3WQWA 1MQRA 4P7NA 4UQCA 3F4VA 1XCWA 5EMYA 1DTUA 2QPUA 1PX4A 1XH1A 1X6LA 3RM9A 5AC4A 3D50A 7A3HA 2DSZA 2XWDA 1WDQA 1KTBA 3LPPA 4U31A 4PMQA 5HOSA 1VBRA 2WZEA 4CCCA 1ZBCA 1BPLB 1EOKA 1UWUA 4DWSA 2WZHA 3K4AA 1HXKA 1UH2A 1SZNA 2EACA 1JZ3A 1VEOA 2FHCA 1GJUA 2WSKA 4W7WA 1JF5A 3LRKA 2DGAA 2CERA 1CEOA 4FNSA 3WH8A 1TCMA 4M80A 1VBUA 4UNIA 1XCXA 3GTNA 5ABHA 3A24A 2O9PA 3VGBA 1B2YA 4GQQA 1HTYA 1M01A 3SCQA 3MUAA 6A3HA 2CPUA 1NWTA 2JIEA 1UWIA 4B9ZA 1UKPA 3PTQA 2DSUA 4GZEA 4NSBA 4TTUA 1V6WA 3WQVA 1G5AA 3UERA 5LA2A 2IGTA 2QMJA 4EANA 2A3EA 2ZUMA 1E43A 1J12A 1B3XA 2VZUA 1TG7A 2IUZA 2PC8A 2CHNA 1VB9A 1I1XA 2DSVA 2WXDM 2C7FA 2J62A 3W37A 1MQPA 2NW0A 3D4YA 4HOXA 1KFWA 5I0DA 3PZGA 3PZIA 1L0PA 1HJSA 2JE8A 2ZUUA 1UA7A 4TVDA 3ARUA 1J0HA 3SCSA 4J27A 2A3BA 4WJXA 3F5KA 2YBTA 3B9EA 4W7VA 1VEMA 5CGTA 1KCLA 1ODZA 1NM9A
chains in the Genus database with same CATH superfamily
2J1ZA 1PKQA 5IHZA 3FN3A 3TA3A 4AKQA 3TEUA 4IRZA 3CLEH 3MV9E 4RAVA 3FU8A 2DBLH 4OW6A 4KPLA 4L0ZA 4P4RB 2I9UA 2Z31A 1EYEA 4ZS6C 4XP5L 1FDJA 1B4EA 1KLFB 3DI3B 4ESKA 3G1SA 4AH2A 3JZEA 3U0TB 3L12A 2XACC 4K6AA 4AC1X 3KTXA 1Y0LB 5E2UH 1X5JA 2BSCA 1NLBL 3G08B 2VEMA 2IG2H 4BELD 4FULA 2QUTA 4L05A 4Q2ZA 2R1WA 1G7QB 2LU3A 3G77A 3ZHLA 3L2LA 4CUCA 3NP4A 1J5OL 2ZTBA 4UQ2A 1IBGL 4ZBJA 4NFCA 3TTEA 1RK1A 1AG0A 2VR3A 1TREA 4LY8A 2HJPA 2QTEA 4APQD 5CBAA 2AJVH 1WK0A 2FB4L 3DOSB 5J0BA 1R8LA 2IF7A 1RHHA 4D9PA 3F2BA 2DMBA 2VDKL 1BV8A 2MCMA 1TX2A 4LLUB 4X8JB 4KVCL 1A5AA 2DD8H 3KL0A 1HIZA 2CZNA 4FD0A 1XHHA 4AK1A 3I75B 4IGMA 1FYTB 1JNLL 1Q8MA 2B3RA 3FCBA 4PU2A 3CHRA 4L9LC 2R8WA 3A67H 4PJFF 1TYRA 2EIJB 4K23H 1EUTA 4HZAA 3V0FA 3RF9A 1M56B 3BRGC 3P4OB 1JRCA 5BRZB 3U4EB 3CLEL 2WKGA 2DBLL 3L3OA 3Q6GH 3DFTA 1U6AL 1LO0H 3CN3A 3EAKA 5AVVB 1QHPA 5I8CA 1IGYA 5ABFA 3SB3A 3T4YB 4GAYA 3MSYA 1LTXA 3L3DB 4MZ2A 5E2UL 3LKOA 4Z7NB 2HG5A 4L65A 3H0TB 2F8VA 2WNNA 3M5XA 2B20A 5AKSA 3GJFB 1A5SA 2IG2L 2RBLA 3ZE1E 3XINA 3ZSSA 1L6WA 3I9AA 4S38A 1PQZA 3IANA 3CV2A 3SIMA 1TVPA 4XGZA 4JUSA 4P46C 4A04A 1XR8A 5GGVH 1A6UH 1U3HB 2QR0A 3DUSA 3RX7A 3NIDB 2F6UA 3KS5A 1HKVA 4Q56A 4HIIA 1MHHA 3WEMA 2AJVL 5DZVA 2QVHA 3FOMB 5C9JA 5D8JH 3UAAA 4N6QA 1P7HL 2YX0A 1CD9B 1L9TA 4DBEA 5HYQB 2F53B 2NY7H 2DD8L 5EU6A 4PGEB 1T1ZA 3VRIB 3ZKQD 3F85A 4XSLA 3U0PB 3WK1A 4GVGA 4CA4A 1U41A 3W5NA 3O81A 3SE4C 4C1NB 1NQ6A 4I18A 5CLZA 2VMEA 4RK8A 5CJBA 1CXLA 4K23L 1YEFH 4YR6A 4I5XA 3OXSB 4MA7H 5H91A 2PF8A 2FGZA 1CB7B 3Q6GL 3CQHA 5D9SB 4D0DA 1WT5C 2P3ZA 1LO0L 4WKHA 4OFDA 3RNQB 2YPIA 2PDHA 2QGYA 3DSNB 1TV5A 3SN4A 2B9BA 3IDMB 1IZCA 2JTDA 1HQRA 5ECGA 2VGLM 5CCGE 2KQNA 3A6BH 1ZPUA 2MOVA 4A2FA 1LOLA 1BM7A 2PCQA 3P77B 2GIMA 5L2KD 2DSKA 5GGVL 1A6UL 2NTFB 3EWYA 1IAKA 2GSEA 1U3HC 1IL1A 3UOAB 2YA1A 4PGCA 4TVPD 5ICYB 2QCMA 4YVVA 1K7FA 3O6FB 4IGSA 2CBJA 1CDCA 4L4OA 4Z7UA 4XVTL 3ORWA 3DMMC 2NR6A 1POKA 1V02A 1E0VA 5CD5C 4JTRA 2NY7L 5GZNC 2BDNL 3T1FA 2WHVA 1T5WA 1EIBA 1LRTA 1WA1X 3WDPP 5F93C 1B2WH 1GW1A 4J8RA 4G7YH 5JHDA 3IJYB 2JJSC 1TQSA 2FT6A 1RK0B 4GZIA 2Z1PA 1YC8A 4BV1A 5DO2D 1EEXA 3QDME 1YEFL 4QRUB 1KTDA 3GSUB 1ZY9A 5E8PA 4LYPA 1OSEA 1DUYA 4L8BA 4MA7L 3W0WE 3QLDA 4AFYA 2LLLA 5KITA 3AABA 5L0QB 2AP2A 2BLEA 1OX4A 3CU2A 2CLKA 2A6JB 3H3BC 4XPBH 3G5VA 2WUCH 2WY3B 4KKBC 4NIKB 1BZDA 3QFDA 5DS8A 4PB0H 4YX2L 3AI0A 5D5MA 4YFEA 4P5MA 1CFSA 3A6BL 2D03H 4F3HA 1SPDA 3EOAA 3STLA 4URKA 2BWQA 4KTYA 3ZYIA 4YK4B 3F7PC 4XE0A 1BLIA 5KS9E 3OAUH 4U1MA 1SVZA 3QUZA 5FUCE 5J5EA 2CLMA 1DHKA 3GZKA 3WMPA 2P47B 2Z91B 1A53A 4WO0A 3O6FC 5GRZA 5C8BB 2FJUB 1SN2A 1OK0A 1PLGH 1S1RA 3STBA 1TO5A 3QQDA 3N9KA 3RDTD 3SBWC 5BS0A 3HGJA 1QSFA 4AC7C 1DIEA 1B2WL 4WV1B 1UACH 4G56A 2WXKA 2YPLB 3KDPB 2VFDA 3HQNA 4G7YL 3GI8H 5CGYC 3U6WA 3EBGA 2FEDD 4BKNA 2A74C 2YUWA 1OAJA 5BU9A 3ZDYE 4O14A 1U8NA 3BP6A 3CUXA 4ZUVB 4ERGA 3LXAA 5CZKA 2Y3NA 4P3WA 4JR5A 1N6QH 4K8RD 3Q9PA 2B5IB 4UTKA 4LAKA 5C08E 1S78D 1TRIA 3RZWA 5L0QC 1UZGA 4BGLA 1L4IA 3VYOA 1HU8A 2R2HA 4Z7VE 1HO4A 1X4XA 4XPBL 5KBLA 1FWCC 2WUCL 1BRLA 4AVHA 1WIUA 1QOXA 3D39E 3P0VH 3ULSB 3QXDB 4PB0L 3ULUL 5KAQF 1HF6A 4RMTA 2PUQT 3NO3A 4DKAA 5GXBB 3H8AA 1R5VA 2LTQC 3CK0H 2YSTA 3IGUA 1N0LA 1RSCA 4UT6H 1FDLH 4L1HA 3LYEA 4XVJH 1JEZA 1W3JA 2PPCA 3RZCA 1ONWA 5AW9B 4A6GA 1V6YA 2O6PA 2QSCL 1YJDC 3HS0C 2X0HA 1XGQA 3GG8A 2OQJA 1X8CA 3BVNB 3LV3B 3WX7A 4GNVA 1QOPA 3ZE2F 1MDLA 4JGNA 2P5ED 2RDTA 3CQIA 1Q1PA 3U2IA 1UACL 3MRMA 5K69A 4LOEA 2ODIA 3GI8L 1OGAB 2HVNA 4GBXD 3HFMH 4F79A 2BNRE 1YRRA 3BVWA 1AOZA 3AZUA 1XIWA 1HYSD 5DZOA 3FO2B 5FX3A 1TJ2A 4XN4A 3DYMA 3DENA 3ID7A 4NRYA 2B5IC 1U3YA 4UMGA 3KPOA 3RLSA 3KVMA 4LOCA 4HS3B 4I1PA 4LZKA 4LCUB 4NC0B 2D3JA 3HI1A 5F0MB 3WGVB 1YY9C 3NYKA 3ZS4A 2Z7YA 2ZCGA 2WLHA 4LHUA 3ISIX 3W7LA 4ZO9A 1VYRA 1I60A 3QNFA 2KI6A 1XSJA 1ACZA 4QRNA 1YMME 4EIBA 2XI9A 3CK0L 3P2DA 3T8XB 2RCSL 4N8VG 4XN1A 3OZKA 4XVJL 1A0DA 4TQPA 2DZTA 2EPMX 1JVOA 1I8KA 3W28A 2YD5A 3U1QA 4FQIH 1ZLSH 1RH8A 2XVNA 2IFGA 4G6KL 1KGCD 3V0AC 1SMDA 2J3SA 4XBKA 1D5XB 4QY8A 1YBQB 2YAEA 4NFBA 2HMID 2KLSA 3KBSA 3E49A 2G5RA 3DESA 2G3MA 3UPWA 2HFGH 5EOCJ 1JULA 5BRQA 4KK8C 4S3FA 2Y1ZA 3RTLA 1VFUA 1C7SA 4HBQA 1WKEA 1E55A 1ZIBA 2OMVA 2PPDA 4QEGA 4NHVA 4UFKA 3LLDA 4F48A 4PTWA 1T7XA 2QCLA 1U8IB 3GPEA 1IBZA 4DLMA 2HISA 2Z8VC 1UQYA 4KTEH 4DIAA 4XO4A 3GSRB 4E8CA 1LNUB 3TO4B 1NWSA 4PS7A 3HFTA 4ZOCA 5DYOA 5FEBA 4XAKD 3BQUA 4K3EH 1R9XA 4R97B 4G8GA 5KVFE 1IMHC 3I65A 3NJGA 2UZ9A 1TWDA 2DORA 2C4FT 1IEAB 2KYIA 1A4CA 3CV6A 5EMMA 5C07E 5DVKA 3EYSH 5DLML 3IGAB 2IIJA 1L6YA 2BSSA 1VRSA 3MMTA 1RBAA 3QHMA 1NIEA 4ZSOB 5ADOH 4GUPB 3NCOA 1DSWA 4N9CA 1A9BA 4UTLA 1TPC1 2APWA 5C7HA 3V5DB 4B5EA 2W9EL 3TFXA 1WUNT 4Y5XB 4ORZC 4NJAH 5EIIG 4GUIA 4FQIL 1ZLSL 2XM2A 4Y1AE 3LN4B 5SX5H 2DQWA 1H09A 3RPKA 1I6NA 5BW7C 4XV0A 1IXOA 2BODX 3QNYA 3LQZB 1PCWA 1SOXA 4J3TA 1NDVA 3AG2B 1IEBB 2HFGL 3VTRA 1TZZA 4NYLA 2VRJA 4BKLA 5GS2D 2XQYG 4HJJH 4WHYH 2E6AA 5I09A 1V08A 2BNQB 2HPOA 2OLHA 4OFYA 4OECA 3H85A 4JZ5A 3CFDA 3FU9A 3P3UA 3KPTA 3RKDC 4WWPA 3HHMA 1VGKB 4UT9L 3NQ8A 1KPUA 3NVDA 3E1ZA 3CFBA 1N68A 1Q85A 3BO8A 1UC5A 2RGLA 4F27A 4ZFOA 1N2VA 5C0DB 1M3JA 3OPUA 3I3EA 2JWYA 3VG9C 4ZW8A 4IOTA 3TO4C 4P9ML 2GJPA 3QA3B 3TUUA 4K3EL 4NRRA 3QEQD 1GOQA 2CJSA 3S37X 3H4HA 4OUIA 1F74A 5K9QG 1VF8A 4LF2A 1EFXA 5JXED 3U2EA 3EYSL 3T0EE 3BW4A 3LGDA 3FZUD 3MBEB 5H37A 1W1TA 3D5OF 5AUMA 2VXVH 1UZ6E 5CHNA 1TYGA 3NT0A 5C09B 2AXWA 3F2CA 1SBSH 4QJ3B 4B15A 1LBMA 1J87A 1HHJA 1KBBA 1ZP3A 1OVDA 1U33A 3D85A 1V54B 5ITFA 4X6DA 4F0RA 2HTLD 1OTUD 2QBWA 4WUUA 4JFXB 2X1RA 4NJAL 2Y22A 5CIPB 2YRZA 1CDYA 5LHDA 4Y5XC 3LNPA 4DF1A 4BFKA 3QUGA 5K1NA 4NNXB 5EDSA 4FKHA 2BHZA 3LNDA 4YSTA 4JS3A 2X8RA 2YBRA 4MPKA 3HE6C 3QWRD 1R2SA 4HJJL 2X5PA 2EVFA 1KCVH 4J3BA 2MQ3A 3E0VA 3IDNB 4R2GD 1EEYA 1B6DA 3IJEB 4MAZA 3MRGA 1NMCB 2UYLB 4R96A 3BIBX 3QHZL 1ZHKA 1ZWIB 4RMSA 3U6RB 2CUIA 2ZJSH 4HIBA 2GFBB 1OGGA 1E7UA 2VISA 5F21B 4Q8PA 2BIPA 4PJAE 3SCTA 4HU3A 1FCGA 4ADJA 2DZPA 1XLKA 3WJMA 1KWKA 3EXRA 2K9UA 3INPA 1DBAH 1UT1A 3VXNA 1Q6LA 4MVBC 3QUMH 4U1IA 1QEXA 3D3VB 1GQKA 1X1OA 3MBEC 4WI2A 2WJZA 4IMLB 4PC8A 3U9UB 2VLJA 4HEPG 4RZ6A 1UM4H 1M3IA 1SBSL 1KEMH 1ZHBA 3MSGA 2FVMA 2DQIH 5LJYH 4Z7QE 1KM5A 5ECUA 1R6VA 5D93B 3LZ3A 4DGWC 4E42B 2GGHA 4P5TB 5LKYA 2XVBA 4EDXB 1NKRA 5AAWC 3VNKA 4AZHA 4ANVA 5JYMA 3FB7A 4M9PA 4JDEA 2BSED 4MNJA 2ACUA 3VDAA 1JD9A 3SGJC 5C6WH 4DCQA 4HCIA 2YARA 1KCVL 4DVOA 1IT9H 3QRFM 4IP7A 3W1UA 4O15A 1XS2A 4LEFA 2E3VA 4N2LA 4JRXA 1XG4A 1OF6A 2H3XC 2ISWA 3W81A 3I02B 3SPJA 3N15A 4X98A 1CIUA 1NMCC 3RLGA 3NWRA 5D1QC 1U5HA 1IBBA 3EWBX 2ZJSL 1OP9A 2CO4A 1LP9E 2X0VA 2Z27A 3IU4H 1Z5LB 5CILH 1INEH 4IIDA 3UTTD 3DIVA 1QAPA 1RSYA 3VU2A 1TFPA 1DBAL 1S4IA 2F7OA 2OQYA 3QUML 1XYBA 4TYUA 3O6YX 2ZRXA 4L2LA 2IPFA 5IUCA 4Y5YA 2Y7DA 3QIWB 4PFMA 1DE4A 4OFVA 1UM4L 3MRCA 1OO2A 3B9KB 1KCZA 1RLCL 2QHLA 5C0FB 1KEML 4JHZA 2VZ1A 3LHWA 2CDGA 2DQIL 3ARGB 4YPJA 3PWPE 4Q7BA 5EPMA 1XH1A 4IFKA 3ARFA 1KACB 5D93C 4P5TC 1JRHH 3P30H 4Q4SA 4X7FC 1F2QA 3HZVA 1WDQA 4MM1A 4NAEA 4FYQA 3RVVC 1YPFA 1I7ZA 4C54A 5M95B 2O72A 4RMBA 3L08A 2J12B 2AKRB 3L5IA 2O0TA 2EG8A 5CSSA 3QJZA 5TE6H 4OZFA 5I8KH 3VGBA 2QPXA 1FNEB 1GZHA 3UY7A 3SAZA 4IZGA 1VBGA 2C16A 4XBGA 1UWIA 2OGYA 5EU9A 43CAB 3L17A 2ISSA 4GZEA 1NEZA 3EGSA 2BOEX 4HX1A 2CR6A 5T1KA 4PTTB 4DTGH 4Z3TA 4GAAA 5ESAA 3W37A 5AOIA 5J04A 1IGIL 4EKXA 5ID1B 3IU4L 2WPBA 4G43A 5CILL 1VCAA 1INEL 2PGRA 1RZMA 3ESPA 2JJTC 4W9EC 1EJTC 1JD7A 1C9WA 4HHHA 2DUZA 1I31A 3GS7A 3PRZA 5FA4B 3OLGA 1OWWA 1W37A 1K85A 2WQXA 3ARGC 1TVHB 1A0CA 3T55A 3V5HA 4J5NA 1JNDA 5CM1A 1L8PA 5EIIA 1JRHL 2KT6A 2FDSA 4BR1A 1OGPA 1DXIA 5FL0A 3UPMA 5IJCC 4NAQA 4P7RA 5INCA 1M68A 5BXRA 2RQEA 2P8LA 2FLBT 1AXIB 2X4PA 4HJGA 1FUYA 1NEPA 5TE6L 2ITCB 5I8KL 2XQYA 4HOZA 4O00A 2WXMA 1OKEA 1TYEB 3GSWB 4LUTA 1OFPA 5SV3A 3ZDXE 4DAGH 4FCHA 1OM0A 3MRJB 4Z8FL 4BZYA 1FTXA 2HZGA 3W3OA 3IDXH 2C9RA 2J66A 4TMPA 1HNYA 4DTGL 1TYJA 4X8XA 4XCNB 1PFOA 4K5NA 3S88H 3G3LA 5GRUL 3U4KA 4LOFA 3LI1A 3KVLA 4ELDA 1YNTA 4G7EB 3UP6A 2J5WA 4AM0Q 3CN4A 3BN3B 1XIMA 1E9OA 2MMXA 4O4WA 3EEZA 1US2A 4ISVA 1RIVH 5DUBA 2Q09A 1NLDH 3RIKA 3NXLA 5H8PA 1AJ7H 1HXMB 4ONGH 5C8JB 4HWUA 4HWBH 3SGKA 3B3IA 1NOAA 3NCJH 1GPFA 1V5XA 4JYDA 1N4XH 4IW4C 3WBXA 2ITEA 1IM3A 3V9FA 4YTRA 5IY5B 4XX1G 5FCUL 2BXVA 2B31A 4Y2DA 1XFBA 5KSAD 3OP2A 4MDJA 2FL5A 1CFVH 1E8ZA 2FZ3B 3TN0C 4MS8C 3N4AA 2OTPA 4Q14A 1K8CA 2JKJA 3AHZA 3NJKA 1GKRA 4PY8I 5ITBH 4LT9A 3O45B 2AXFB 1K77A 4G8EA 1E6JH 3UU0A 2GT9A 4M4RB 3WZ0E 5C3TA 4D6GA 2DH2A 1UMYA 4AGPA 4UILH 3TONA 1OTTD 4LF3B 1AR1C 1IO4C 4OJCA 2YYTA 3M86A 5J6GA 3N41B 1EHAA 4LLYB 3EGDA 1HHKA 2WQPA 3IDXL 5IHLB 4PWJA 3D33A 4NNPH 3RVTD 4AMXA 5DD6A 5FGCB 3QSKB 4LIQH 4H9UA 5I1DB 4FX5A 3S88L 1XZ0B 4LGPB 4QRPD 3QCUH 1RZPA 3DFHA 4FQHB 5D37A 3UIZA 1LDPH 3UJIH 4V1DA 5BMFH 2EE6A 5IUSA 3F6IA 4IJ3C 4PN2A 2X6AA 4PRPA 3WS3A 1NCWH 1ZVHA 3RI5K 4MYAA 3T6ZA 2YGNA 1OQOA 4OJYA 4HWEH 4BFJA 3W1ZA 4Y2WA 3VD9A 4UIKH 2QUUA 4Y2OB 4ONGL 1E1CA 5ABDE 2ZG3A 3PJXA 4HWBL 1QWHA 4HKZA 3NCJL 4CNOA 1N4XL 2VMCA 2FBOJ 4N90D 1E5CA 4HEPA 3LSCA 3M6YA 1XVSA 5BV7C 2IKIA 2ADJA 4P4KC 3L54A 4HZ7A 4N4PA 1MW0A 1CFVL 5F1IB 3EO9H 5AL0A 1U91A 1J9YA 4RPQA 4KI1A 3VXSE 4LL9A 1I2OA 4Q32A 2BIOA 1S7UB 4FTVD 3B0UX 2L0DA 4KKLD 2QTVA 1A5UA 3T6WA 1E6JL 5TDNA 2VM4A 4C65A 2VR5A 3DX3A 4P2RB 4NP4H 2GVJA 2XTSA 3LV5A 4XBPB 5E5CA 4UILL 3KYMA 2WMIA 1CFBA 2ZCZA 4MJ2A 2K4AA 2BP1A 1QTWA 3CZFA 5LAXB 3SE8H 3UJSA 1WQVT 5F8QC 1BQHG 4GFSA 4NQQA 3KEHA 4NNPL 2X38A 3IS1X 4L4VA 4JVWA 1OCZB 1GTHA 4LIQL 1DCEA 3K5RA 2OULB 2XWJB 3WLOA 1PIFA 3QCUL 4LUIA 1FHLA 1QWUA 4JO1H 2BY1A 1LDPL 3UJIL 3TYUA 3U4BH 5F72S 5BMFL 3BE1H 4H8WH 1LQBC 3PL6B 1NCWL 5KZCD 2QPEB 1BXUA 4PMJA 5T3ZE 3EWWA 4TVSa 5CAHA 5EF0A 1BYDA 1S5IH 4G6MH 3NPSC 3C5SA 5F7MC 2WK2A 3O9WC 2E47A 2IKJA 2VDQH 3RNDA 1QFOA 3ELQA 3GIVB 3SDAB 1VF5C 1ECEA 1GC1H 1GPOH 3SPHA 1BHGA 2XN9D 4I6VA 4MFHA 4H19A 4GXVH 1X9QA 2E9JA 1GJWA 3CV5A 1ONRA 4PR5B 2J1XA 2VRKA 3HRPA 2CO2A 5LNRA 2QHAA 3V4VH 1Q9LB 1M7IA 1XGZA 3J27A 2P28B 4YEEA 5DZNA 5H2ZA 2WUBH 4NP4L 4BSVB 4JTTA 3F8UB 3GH7A 3S8FB 1PJWA 1D7BA 4YVPA 3MNVA 3GNDA 2ITFA 4WGWB 3VIHA 5HNTA 1RUPH 1MFVA 2FYVA 4Q4IA 5T1MA 3SE8L 4Y5VA 1AFVH 4DNHA 2ENSA 1Y6MR 5MF5A 1MI5E 5HPCA 5DI8B 2C1HA 2C9XA 2HKHL 1ISYA 1WCQA 4ODWB 2BS9A 4JO1L 4LNVA 1YNKL 1FZOA 4GW4B 5C0IB 4XMZA 4JFUA 1CE6B 3U4BL 3BE1L 2WOBA 4H8WL 1HXJA 3BAKA 3N43B 1UZHA 3B7UX 1TPEA 3UJTH 1MUWA 2VABB 3NQ7A 3VAVA 2H8ZA 3RX4A 2D3VA 4BKSC 3DROB 2XQ0A 3OVRA 5F88A 1TZ9A 4ZQCA 1ZXQA 4P2OC 4XVSH 1B90A 1S5IL 3BN9D 4G6ML 4D0CB 1WUFA 5HI4D 1K4DB 4JFWA 1OGBA 3HG4A 4BS0A 4NZUH 1SFHA 5DXYA 5DK2A 1GC1L 1GPOL 2GK2A 5F9WB 2NSXA 3QC3A 4GXVL 2QCGA 4OV4A 1W9VA 1GYMA 2Z64C 2OKMA 4UV7H 4NQEA 5LWYH 3RJYA 3TH6A 4ZAKA 2HLEB 5JHLH 2Q6WB 2D23A 3WJJC 1DJZA 3SI9A 1WYJA 3NRPA 3V4VL 3TDFA 1EXHA 3VI3F 5LIWX 4YCOA 4Z2GA 2Q3RA 4S1FA 2HRPL 4MJZA 5KVEE 2ZOLB 5GZOC 2QJHA 1OGTB 2YGPA 2PYEE 3PABB 2NUYA 4KC3B 4LPWA 3TYEA 3MUGB 4JO5A 2LV4A 2RFGA 1T6WA 2C1PB 2Z4QB 3HG1E 4GPNA 1XT5A 1RUPL 3BQ6A 2P49B 3THAA 4OTKA 1I85C 4GAJH 3EYOB 4O02B 2NVAA 1RCQA 1P5UA 1NSNH 4IX2A 3QZNA 1GL4B 2X0YA 1I0DA 1RZGB 2WLMA 1KELH 3PU7A 3WLBA 1T3FA 2DT2A 4QO1B 4FXKB 1G7VA 4US5A 1FYHB 3SURA 5KSBE 4PWFA 2WIMA 3IDGA 4DJED 1Q45A 5HWNA 4N0RA 2BVEA 5E2JA 1B0GB 4XP6H 3RFZB 1IEHA 3UJTL 3WLTA 4CNUA 4IRSA 1PSKH 1YCSA 4OQTH 5M5DA 1G7PB 5AKTA 4XVSL 3WLMA 3R0MA 4JHVA 3DBXB 2WWKT 2VSMB 3QY8A 3DCPA 5A6BD 3Q01A 2ED7A 4K15A 1M7DB 4ZMLA 4NZUL 3SCMB 3BL3A 4S2SB 4M1CC 3EHBB 3ANVA 4UTWA 2HCZX 4OTXH 4CNTA 1R5IA 4Q74A 5F9WC 2BS71 3VXGA 4UV7L 2W65B 3KH4A 4QDGA 5LWYL 3H9SD 4G9PA 5JHLL 4LVFA 2A6IB 1E50A 1US0A 3QM3A 4RGND 1FH2A 3DBNA 4DW2H 1YLBB 4ZB5A 3WF1A 2GJRA 4IOIA 5DEJA 2D4DA 4XTIA 3KBEA 1R3LA 5DFWH 3PC0A 1IE5A 2WSYA 4MD5A 3IAGC 1RJLA 2VH5L 3MI2A 3B7RL 2I1OA 3QDJB 4L5FE 5F3FA 1ZPLA 3O41A 4XP1L 2IMNA 4TUOB 4GAJL 3LTVA 4MLJA 5JIMA 4NQCA 4WDIB 1NSNL 1F4HA 4FP1A 5JPMC 1WHPA 4OVUA 1KELL 5CJXC 3OQRA 2G4JA 1JR1A 2FB2A 4FXKC 4PCFA 1D7CA 5D1XD 2GBVA 4NQ1A 2J2ZB 5D03A 1MNNA 4RIRB 5CP3H 2HMCA 5DVPA 2AAMA 2IAMD 1PSKL 4OQTL 3RFZC 4LEBA 5IHUH 1EMTH 4JDVB 4GYKA 1TV3A 1IC5H 2JLLA 1TUPA 4EBQH 1NFDF 4FTDA 3VYPA 3WF3A 3LBMA 3GBDA 2XQBH 1N8ZB 1NDMB 1DL7H 3W87A 4QJ4B 3T3MB 1YQVL 4IRJA 2VC5A 3KPSE 4KROB 4XTRD 1BZ7B 3SCMC 2AQ3A 4MJ4A 4OTXL 5EIVA 3R89A 2IV9A 3FNKA 5HHOA 1Z6JT 1N8FA 5IHHA 2E9BA 3AS3A 2RGMA 1P7TA 4M3JA 5CLTA 1BVKA 4U1KB 4PI0A 4DW2L 5KEZA 4UUJB 4XXCC 2VDNH 3HZMA 4IJRA 5FW6A 4Q0XH 3OSVA 1R24B 3ULVF 2NNRA 5FFGA 5FECB 1K2DA 2E9GA 4AT6B 3M0MA 4JFOA 1NCHA 4ZQKA 4ZRGA 4IP4A 4IBQA 3L7RA 4G9FD 5C0CE 2VDOH 4FFZL 3C9NA 2BVYA 4XD5A 4WO4D 3DURA 4JFHE 3VO0A 4GSUA 1E6RA 4MGGA 3AQUA 3EDFA 5FYKE 4MXQD 4X7EC 3MW7A 1DJHA 5C0GB 4GO9A 3OWRA 1WFOA 1HVXA 4TQEL 5E1AA 2Z0UA 4KX8A 2Z8SA 2LOEA 3WIIH 2VDPB 2OLAA 5IHUL 1NZRA 1EMTL 5EN2B 2DF3A 1IC5L 3N3MA 1A4BA 4NZ1A 1P6AB 2BMKA 2XXMB 1XF3A 4EBQL 3BV7A 1VCVA 1X5FA 1BMZA 2WMKA 1UZ8B 4UIOA 2XQBL 1OYCA 3UJRA 2XSBA 3T65B 1ZVYA 1KF9B 2P5WB 1Q9KB 4C4UA 1RQEA 1OFQA 1RK6A 5IB4B 4KROC 2AJZA 3CAQA 3WL0A 3VNLA 1TZIA 4X80H 1IE4A 5FA3B 4LYQA 1DYSA 4P46B 4XZUA 5D4QA 4EZLA 3UYPA 4ZTOH 4AEOA 4QRSA 3ITYA 4QCIB 4W68A 2QS8A 3IGLA 4PJIF 1N82A 2CDFB 1PDKA 4Q0XL 1F2JA 2WB7A 3WKQA 1M42A 3AYVA 1OHZA 3BJFA 4UAHA 3S0CA 3TJHC 3WBWA 3INOA 5AW1B 1J1XH 3NL5A 1Z8AA 1V79A 4O10A 5F4XA 4N5ED 3O3AB 3PZOA 1H8LA 2E59A 1OINA 2QKSA 2JKSA 5BO0D 2VDOL 1WBXB 2MNJB 3IFPA 2R83A 4YPGB 7ODCA 1KT2A 4DKFL 3TROA 3QULA 4O1AA 4RJEA 4LP8A 4ZTXA 4JTEA 3WNOA 3SRDA 5IVNA 4HPJA 3K72B 3V0IA 3K46A 2J78A 3PTKA 1DLFH 4R26H 5IW1A 1IKNA 4PBWD 4Z0BH 3QEHB 3B2VH 2CK2A 4POYA 3WIIL 1K70A 4HCRA 1U8PB 5C86A 1JTTA 4NNYB 2HCVA 1KIRB 1ZA3A 3VXQA 5EU3A 4OF3A 2Y7QB 2PTTA 1GJPA 1L0QA 2VLMD 4F8LA 5EZJB 3W23A 1DQIA 4X9HA 2YSWA 4KTGA 4LHUG 1TVBB 1J8HE 2XFWA 3C5ZD 4KI5F 4FI6A 3KS0H 5T8GA 3P9LB 1TPXC 1OY3B 3GMNA 3ZQXA 1XD1A 4YSUA 4JHOA 5C6PB 1PX3A 4URIA 3NZHH 4ZTOL 4YHMH 2QFPA 5D7LA 7PTDA 1ONQA 1ECQA 2PBOA 1JV5A 1IVTA 2CDEB 3CHFA 1O7DE 3B5GA 2PO6D 2FSEA 5B1JA 3PANA 1EC7A 2V5DA 3DMMB 1J1XL 4HJ0D 2X2HA 3ARQA 4LCYB 4OFPA 2AHIA 3TH4T 4H6KA 1TUFA 1UD4A 4DZBA 3SGZA 1W5NA 4F0SA 5GSVB 4Y8DC 5IIEA 4WHCA 1S3HA 1HVQA 5HY9B 4N1CA 4UFJA 2HPIA 3GR7A 1R5WB 3VXUD 2V8ZA 1B0IA 2WTPA 3MNZA 4LLWB 1TLMA 2YAHA 3C60A 2WMJA 3RHWF 1XRVA 3A67L 4FJYA 1EBGA 3QQ3A 2A2IA 2CKSA 1DLFL 4R26L 3FUMA 4JQVC 2B4CC 4Z0BL 4U1GC 1YMYA 5KZMA 3B2VL 3M0XA 2VCOA 4X9FA 1RERA 1I9EA 4QHUB 1H0IA 4OLXH 3QQ4B 1XAKA 2YQBA 3B0XA 2LR4A 5HGDA 4XISA 2A99A 3ZZLA 4C90A 2EDDA 2ZX9A 2QVIA 5E1IA 1A6TA 1GZPA 2OZ8A 3O07A 1XH2A 3ZO0A 4C1KA 1OM9A 3US1A 4JO8A 1T66D 3IIPA 4NUJA 1DTNA 1UZ1A 3B9DA 4KS0A 4HUVB 2X4RB 3RTQA 3MBXH 4OH2A 4FX6M 4PBVC 4GE8A 4FQQA 2IDCA 5E0FA 3NZHL 3LCWA 2R1XA 4JPVH 4YHML 4GIPD 2V5KA 2IPJA 4OCMC 2KZKA 3TFCA 4N2GA 4UM9B 2ESVB 3NCYP 3NEVA 3QIUD 3DARA 1WBYA 3QW3A 2WNQA 4P3CH 1ASOA 3CU1A 2A83B 2QPUA 3RVWD 5D8JL 3BTNA 35C8H 1S9XA 1SLXA 3SDXA 7A3HA 3VXPB 4LKXA 2PDQA 1NIFA 1FG2A 3T5WA 1RZQA 4Y16C 5HOSA 4JKPH 2Q87A 4K7PH 4X5PA 3RX3A 1M1XB 1P84K 1ZLWH 3KHJA 1WS7A 4KXZI 1GKEA 1HI6B 5JMUA 4ETYA 3WH8A 1S6NA 3ARED 2A74B 1AKJA 1OOAA 4L3EB 3H24A 2Z4TA 4U1LA 3H22A 3BW3A 1U8LA 1E9PA 4B9ZA 3FDGA 1UKPA 4I9AA 4NQSB 1YO4A 1V6WA 2PDXA 4PM1A 1ESOA 1ZIAA 4OLXL 1LL1A 4PG2A 3SBRA 1NGZA 4BFNA 2M2DA 4XODA 1J12A 5E9DE 1TVLA 1YPZE 2PC8A 1FIGH 3WOVA 5FAAA 4ADSA 1V5JA 2PDLA 1BX2A 3GG1A 3SKMB 1SZRA 3LH9A 1UADC 3HQOA 3AAZA 2AL1A 3PBMA 3A0OA 1YE4A 1W3IA 4J27A 1REQB 1OCRB 1S2UA 1KCLA 5H37G 4LT7A 3M7FB 3T6XA 4WTXA 2LTQB 3GMPA 4GXPA 3FNDA 2AQOA 2OS7A 1FH9A 1AW2A 2YZ5A 2RR3A 5DYFA 2EDLA 2W0PA 2APVA 3RIAK 5M7QA 4JPVL 4K5OA 2NV2A 4K39A 4YHIA 5LBSA 4BH8A 1UC6A 1S9WB 4I77H 5FKYA 2GQHA 4PLKC 2FRGP 3HS0B 3MLUH 2VIRB 1E9YB 4P3CL 2NQZA 3GVVA 4U6YB 1IBDA 1AQHA 4PJ7E 1JN6B 4O58H 2P43B 3B1TA 5H4YA 4C4KO 3CGTA 4F15C 35C8L 2VITA 4YXLH 1VRDA 3DRTB 1GOHA 1KGXA 4AIBA 2DJMA 2QMKA 4JKPL 1PG7X 1EYWA 1FWEC 3VFCA 3FQXA 2BRQA 3AHTA 2CC0A 4K7PL 3I6TA 3F7QA 2O30A 3DX6B 3QHNA 1J9SA 4AENA 4JFDB 3SUVA 2ZAHA 5D70H 3UADA 4JFEA 4HWZB 3W7QA 4PWIA 1K5NB 2NPLX 3ME3A 1KJMA 1W3NA 1INQA 1LT7A 5FKPB 1G6RH 3AIRA 4L4TB 3LRLA 3KP0A 5CEYB 1OIMA 1L3NA 3X14A 2CXGA 43C9B 4XO3A 3WIFA 3H12A 3FO9B 1UD5A 4OZHF 1U8HB 3WMLA 4UQ9A 4JAMA 2COVD 5A2JH 4J3UA 2ZG2A 5IVZB 3PWNB 1SY6H 3QO1B 5G5DA 3FULA 2VUKA 1AZRA 4ODTH 5E2VH 3LKRA 4PIRF 2PABA 2FO1A 3MV9B 2V3DA 2E5BA 3CL6A 1F41A 2BVOB 4S3JA 4MB4A 2O92A 2Y0SA 2D03L 3KZPA 4WDXA 2KDGA 1KFJA 3GXDA 3D46A 3UF9A 3ITOA 4UOJA 4JQAA 3QUYA 3VDCA 4YBLB 3V5CA 2VUNA 2YZ8A 3OM3B 3OAUL 3L9RB 4RNFA 5JIPA 32C2B 5E08H 4I77L 3STZB 1F3RB 2CIKA 4K71C 4AQ8A 1XRSA 4U0QB 3BIAX 1DXEA 3MLUL 1VCGA 1ZS8A 1T7ZA 2IMMA 4AZGA 4ANKA 4O58L 3E0IA 2VVSA 4GINA 4YXLL 1PLGL 5D71H 5DJZB 2C91A 4ECLA 4ETQA 1GMEA 3UEQA 5J8OA 2W9LA 1T20B 1QLRA 4IU3B 1ULVA 1TJGH 1TTFA 3PS6A 3TGXA 5D70L 1OCCB 4QOKE 5HJ3B 1QO3B 4OCYH 1TNNA 1AP2A 3BQ5A 4UBDC 5JQ6H 5CJMA 2JK5B 1G6RL 2JXMA 3VSQA 4IM4A 1OF2B 1WC7A 1J5TA 4UFHA 5EA0H 5J57B 5ISZE 4TKWA 3NXFA 1XBYA 1RXOB 4Y88A 2YW3A 1N6QL 2ZXQA 3SN1A 2X12A 2WSRA 4BCYA 3BGFB 2TRHA 4JIHA 4IS6B 3LHPH 5DS2A 4B9CA 3LZOA 1SY6L 2D2JA 1UXWB 3ULUE 1EHXA 4ODTL 5F7YC 3U2SB 3HBLA 2PP0A 1AH3A 2PCFA 2YOCA 5FJPA 5DMKB 3N42B 2QELA 3P0VL 4M03A 4LUYA 4FERA 5HI5C 5EBAA 3NJXA 3DFSA 2ACQA 3JTSB 3FXGA 5IM7A 4UT6L 1FDLL 5JOPD 2NQ3A 3BJLA 4YBLC 1RA5A 4MA3B 3FQRB 1XF2A 3OQ3B 3U8GA 3GSXA 2NX9A 3OR7A 5E08L 2Y85A 5CLWA 3VM7A 2BSRB 3ZE1B 2FFCA 3H7LA 2BASA 5CKAA 3MTXA 1RZIA 5BYWA 5C0AE 3KWSA 2WCAA 1HJVA 1U8JB 5D71L 1DQVA 4A55A 2Y5TA 4G6FD 4PJXE 2WBJA 4HUXB 4OZFG 4LCQA 3GUGA 1UXSB 4NAFA 4PV8B 5HHME 4LLDB 2ICES 3UJ2A 3BXNA 5FIEA 3DSFH 3WTWA 1TJGL 4N0UE 2FVKA 4MNLA 4OCYL 4AYMC 5CGQA 5GS0H 1NEZG 1JGDB 5JQ6L 3HFML 1CFTA 3W76A 2J27A 1DVFC 3FLUA 3M88A 3KHQA 3WXVH 4JQ1A 4JNYA 1N2RB 3PWLA 2PXYD 3VG9B 2AJXH 5EA0L 4JGJA 3DX8B 1C93A 4RNJA 5DBUA 2ZX5A 3SDDA 4AV0A 5C1MB 2ZWLT 3QIBA 3SGEI 2R15A 3PBYA 3BGFC 1MUCA 1TJRA 3O3BB 3T05A 5C3IA 1LVEA 2J8UB 3NMEA 1MFCH 2YHGA 3HMXA 4X9GA 2I9LB 4HU4A 4PJHB 5LGJB 2ESCA 2P5PA 3VM5A 4JKWA 1SVDA 5AVSB 1UASA 4JQ2A 4OV5B 2VN6A 3DJTA 2DLIA 4AY1A 5D96C 3ARBC 3HC0B 1QNSA 3KPRA 4WU7B 3FS2A 1ICTA 2CLEA 3VOCA 4K5PA 2NY0B 4X61A 2FQDA 4WNSA 3B3DA 1RJZA 4MKVA 1RD5A 1I1FB 2LU4A 5F7WC 1TJPA 2Y88A 5J11B 1WV7T 5JBDA 5CSYA 4CC4C 4X4YA 3HE6B 3S83A 4EI5B 5IOBA 1AI1H 3MJWA 4U1JB 2Q86B 5IB2A 4F7PA 1T1XA 5AFDA 4JJ5A 4KKQA 2H8PB 3U9IA 1MCQA 5T3XE 3CL7A 3DO3A 2DWEA 2ZZ4A 1NAMA 1V10A 2DICA 3TO2A 1EGJA 4E5TA 4L3CA 4IT1A 5U4NA 5GS0L 5E5MB 3BKYH 3EO1B 3BRDA 3WXVL 3L5JA 4KTEL 1KFBA 2PDPA 2AJXL 2B3IA 5FFOA 3AXLB 5D2NE 4XMKH 2NNXA 2R1LA 1G4TA 1VD6A 4UU9B 2CMRH 2GY5A 2F7PA 3FT2B 4XMPH 5L88H 1TTGA 4I8DA 5F2GA 3QDMB 3BH8A 4PRIE 1G9NH 3ULVH 1MFCL 2GITA 4NZRH 4RDWA 4LDCA 3W0WB 1H5BA 1QNRA 5D2LF 4FA7B 2BWIA 1J18A 3HPZA 3O4LE 3ZTJG 2HK1A 4N26A 4S3AA 3UXKA 2COQA 1AO7E 1W2PA 4PJ5B 5ADOL 5DEGA 1JPDX 4JS7A 1BZEA 3OLEA 2QCNA 2XGBA 5ABAA 2VB5A 4G1NA 3QV9A 1NBZA 3VD0A 2YDQA 2NY0C 2YR1A 3HAEH 2EDYA 1GKQA 2CCWA 4NVTA 3BLOA 5B3JE 4Q9BA 4GABA 1A4AA 5JZ7D 1E0XA 3CK5A 2EDEA 2WVVB 1C08A 5EFDA 3UXFA 1FL5B 2GK0A 2Z6FA 5KS9B 5LAPA 1OT2A 2ZQ0A 5J11C 2UZIH 5ENLA 2VXQA 4PBFA 4EI5C 4M6AA 4DAFA 4ZS7H 1FFQA 3PUDA 3II2A 3D4GA 1ZLDA 4HLEA 4GISA 2I16A 2FK9A 1DJSA 1O1ZA 4I6KA 4PRHD 2D31B 1YAZA 4M02A 2R0WH 5IMKB 3OKYA 4C56E 3BKYL 1RP9A 3MJ8A 1GHRA 5D1QB 1UWAA 1HSBB 2DZAA 1OZQA 4AG0A 2V7HB 3RIFK 4XMKL 5CC5A 2DQEH 1BKHA 3PHOB 2AQ1A 3GMRA 4L1SA 2CMRL 3UVIA 1J93A 4XMPL 1T96A 5L88L 4RWHA 3MRFA 1RQBA 3ZJAA 3ULVL 1UD3A 2GI0A 4NZRL 2P53A 2REQB 1AR2A 4X4XA 1QSEA 5C08B 3O63A 4JY6A 1HH6A 3BDXA 3O8XD 2G0WA 2VXVL 2ROYA 4OZGF 4KQ3H 4NJKA 4L64A 4DN1A 4IM8A 3NVQA 1J8KA 3D39B 1XLAA 4GKTA 1F13A 3VTMA 4DM1A 1XIEA 3ZXWA 1GOFA 5T1DH 2BVDA 4IIHA 3K6IA 3N40P 3OMAB 5INDB 5JIIA 3ZDZE 3WIAA 3B43A 1SYSA 4LLQB 4HKBA 4HETA 3P4MA 4E3VA 1QA9A 4OUUB 4WEEA 1E3XA 3LPFA 2AXJA 2UZIL 5CR8A 4XH2B 3BP7A 4Z42C 2E74C 4ZS7L 4JXCA 3CSYA 5FUCC 2P50A 4ZMWA 3ZKNC 4A6YB 4ORGA 4HH9B 3IIVA 4YBQD 4XAPA 3MI6A 4H8UA 3EJQA 3MV8E 3GFYA 1Q2RA 5A6IA 5JPNC 1THCA 3RRAA 1K4CB 3MOQA 3JT2A 4LC8A 4F0KA 3BG5A 3LZLA 4M5YH 4KBXA 2LFGA 4I5BA 2DI8A 1YEDA 3KOFA 3EOSA 3G1AA 2OKOA 2DQEL 4OLUH 3UP8A 4L9YA 4LRIA 1UATA 2ZQKA 4ZFMA 2YC1B 3T1WA 4WRLA 2J7CA 2VLKA 4IQEA 3CFCH 5DC9B 2YCLB 1YKWA 3BUQA 2GDQA 2V2WA 1V03A 2J21A 1GZQA 2VLRE 4KQ3L 2OL3A 4O8RA 1VPOH 4RA0C 3R10A 4TOYH 2I5GA 1OARH 4LDLB 4F2MA 4IOSA 3QJHB 3RUGF 3V0VB 4W84A 3VPLA 5T1DL 4EN3A 1YMMB 4FHAA 4GRLB 2AQ2A 4DWSD 4EUPA 4H1ZA 3CPLB 5F6IB 3FHQA 5E09A 1ALDA 1W32A 4O0KA 3MRRB 1E8XA 4U49A 3C2SA 5DMLA 1XV8A 3PP7A 3QG6B 5EO1A 4FL4C 2EKSB 1SLUA 1K02A 4P49A 2Z1KA 2DM2A 4NC2B 4AIXA 4D6HA 3REVB 2I26N 1XIFA 3DXIA 3OIHA 5FCSH 5IQNA 1FNFA 4PQXA 4WOQA 1IT9L 1UBPC 1X5MA 4M8VA 3DVGA 3MRHB 4NQTA 2BVTA 3PV6B 3RRQA 4XZBA 3QNZB 3FQTA 4C6CA 4M5YL 5F89A 3IMBA 2X3AA 3UGVA 5BWFA 4QTGA 1J9QA 1BXXA 1XSOA 5AOLA 4HLJA 2V9TA 3G0XA 4OLUL 5J1AA 1LUCA 1WBJA 1OFEA 3TBWB 5FD0A 2E1WA 1N8OE 3TA3D 4N4QA 1JHTB 4IBZA 3WBEA 1TV4A 3O3EB 4FFVD 1DVYA 3F7LA 3CFCL 2G5BA 5FEXA 6FABH 1MFAH 4RGOH 2Z31D 1UM6H 2HTKD 3HPLA 5AOZA 1PZ1A 1T5AA 1FHVA 2TODA 1YC7A 3KPLB 1KJ2B 4U1HA 2DT1A 5FF3A 5D2WA 3WD3A 5IEHA 4TOYL 4PJBA 4GYPC 3D06A 4MAUH 1OARL 2H8XA 3TN0B 5KYYA 1E28A 1S7WA 2VQTA 4HOMA 5F1UA 3W73A 3S8GB 1KXHA 4LCWD 4MNQA 3P30L 3M0LA 4GRLC 1ND0B 1EF2A 4N1EA 4Q6XA 5I6XB 5F6IC 3GJFK 2DP3A 4AEHH 1XX9C 4CVXB 5IOPB 3V9CA 3W6LA 4Y1AB 1JF6A 5I9QB 4ZFZB 3LKNA 1G7UA 4AU0A 3L3GA 3IRZA 1AR1B 2VOMA 2D7OA 2HFFB 2WYZA 3RN6A 3CDZA 3NIFE 3ZLHA 1BSIA 2YO3A 3RWIA 3UXIA 1KBVA 5M17A 4UM8B 4NQVA 4ZW3A 5IREA 5G55A 2OZNA 1JVKA 3BDBA 3BO9A 4FXRA 4FA8A 3V5FA 4YIQB 4W70A 4JFPB 4YSSA 2DMKA 1M41A 1TG8A 3R7MA 3F7RA 3MZTA 4HJTA 1VHPA 4ZQNA 3KVQA 1UT2A 1YTDA 3BURA 3VMNA 3V4UH 4JQ3A 4IJ3B 4I3RH 2EDKA 4Y7MA 5E94B 2ZZ2A 2IDSA 1MW2A 3HPFA 1CFQB 4D72A 1EUNA 5DC0A 6FABL 1MFAL 4RGOL 2X6BA 2INEA 1KBJA 1UM6L 2JCCA 2X1SA 5DJ0A 2H2PD 1TE6A 3H3KA 4DPCX 4RQQA 3QMSA 3HE7A 5BV7B 2OKTA 5FPIA 4P4KB 2GUYA 3TXAA 1W2KT 4KUCD 3T0EB 4R5VA 3PM6A 5ICXA 4K3DH 2EDQA 4R7LA 3UFIA 2DH3A 2MANA 5C2BH 2J7GA 4DO4A 4EKJA 3O11B 1UJPA 4H9VA 3TQPA 5I6XC 1NICA 4Z0XA 2X4OB 4GXWA 3TU6A 4MA1B 1IRAY 3M6DA 4AEHL 2GWNA 4CCDA 2Q2LA 3ECBA 5I9QC 4UOW1 2V5JA 1G7LB 3ZL4H 2A5UA 3F00A 3FUFA 4PN6A 4QHMA 5EC1A 4DAGL 4WAFA 3KHDA 5EU6D 7CGTA 1ETA1 5I1HH 1N67A 1RUAH 3TNBA 3WELA 3N40F 2CAKA 2FGWH 1AQFA 1EBHA 4ZE4A 2XHNA 1A3QA 1T99A 3H6AA 3IB4A 2ZKXA 1OSYA 4I3RL 1JZ7A 4UQAA 4PH6A 1RIVL 1NH6A 2OR8A 4GKLA 1NLDL 3JR2A 3TYAA 1C12A 5T1LA 3WFBH 2EC8A 1BYOA 5BNXD 1AJ7L 3GC2A 3NPSB 2XYLA 1N5AB 3H8NA 4PJAB 3EFFB 4H20H 3SQMA 3O9WB 4AE0A 2EXTA 5XIMA 1F00I 1IQDA 2DTMH 4X0KB 2WSQA 1XIHA 2R51A 2HS6A 3T0EC 5D4YA 4LFYA 4Y2NA 1DE5A 1M7OA 1SXNA 3O05A 4FYSA 2R7EA 5IFJA 5C2BL 1SO4A 2EYSB 1C5DA 5JDJA 4GD0A 5CEXB 1S7XA 1S3RA 5ITBL 5ABEA 5BPPA 3PWAA 4AQ1B 4MWAE 3M1BA 3IDIB 4MA1C 4NO2B 3NJJA 2W95A 2WKOF 3X13B 2V30A 3HJZA 4I85A 4UF7C 4BE6A 1O94A 3AJXA 3KRUA 4KXZH 3IVKB 1RIHH 4R53A 3N1QC 1A1OB 5C2CA 1YEJH 1H15B 2NR6D 1QHOA 4UTMA 4Q9CA 4UQCA 4F37F 2WLJA 5TH2B 3MZNA 2VELA 3QT2A 3GJEB 2HBVA 1TTAA 4QUOA 5I1HL 3F7KA 1EJWC 2P7TA 1RUAL 2AL2A 5JHDD 2FGWL 3BYTA 9PCYA 2EACA 2FHCA 4N1HB 3TPUB 2Q3XA 1FFTB 4V2BA 1JF5A 4C8XA 1YN7B 1SHMA 1GS8A 4HIEA 2ZPKH 2VEKA 3P74A 4GSDH 4FIRA 4ROPA 5IJKA 4Z7WF 4GKNA 2CPUA 1SJMA 5E1HB 1LE5A 3WFBL 4HWEL 4P2OB 4L0PB 3L9YA 4UIKL 1LP9B 2DSUA 1SXCA 4N20A 4KKCD 1SVCP 3AQZA 3ILDA 2IGTA 4H20L 2MNUA 3CT7A 3IETA 3LEYH 2DTML 4S0TD 2CHNA 4MSWB 3IVSA 2C7FA 3K80A 1T0MB 4WNQA 1NUGA 3MJMA 3PPEA 4PJ9A 3EO9L 1S7TA 4PD4K 1TITA 4CNPA 4GAFB 1U8KB 2CO6B 2DIAA 1J0KA 2NX5A 2GOUA 3SYPA 4FOKA 5BMWA 2GTZA 2X4NB 3QUZD 4AQ1C 3ZXAC 3GMLA 3AMLA 4AYID 5ABGA 1RIHL 5J3HC 1F11A 1ORQA 3MOBH 2MQCA 1YEJL 5FO7B 3KBWA 5EZOH 1A6PA 3IXTB 4PRDA 1XBZA 5A2CA 1Q6RA 2E9WA 3MJ7B 1QSFD 4JFFE 2HKAA 1CGXA 1WDWA 4D9QD 3FA5A 3B8UA 3WUFA 4QPEA 4MYXA 1XQ4A 2PKDA 3DVNA 1FZKB 3VZXA 2IQAB 3NJFA 3FUHA 2ZPKL 3WS6C 4GSDL 1F07A 1QI2A 3L4UA 3PBGA 1S9YA 5B1BB 3BK0A 4WTWA 4IBLT 4N9GB 4WKXA 5CSUA 3M7SA 4KX9A 3ALFA 3K91A 2Y1AA 1A0EA 4I2XA 3LEYL 4MD0B 2GGEA 2VDQL 4XUYA 2PYFB 1TELA 3FU7B 2XVKA 3UO8B 4JJHA 3TBSB 1QD0A 1R3JA 1LQSR 1J10A 1OW0C 4N2CA 3RHGA 4OI8A 3IJSA 4AVOA 4BFFA 1EWDA 3WDJA 3DO7B 1Z1WA 2VZSA 2YD1A 3BZ4A 3RZCD 4F92B 4MKNA 2XKSA 2KZHA 1Z48A 3LVTA 5HVWA 4V27A 2YLKA 5JORA 1AJ0A 3GKZA 2WUBL 2WHKA 1AK5A 3MOBL 1JDAA 2K8MA 3V6ZA 1JGLH 1UYWH 3KOXA 1EQCA 4KXAA 3QFJE 1JCYA 1AFVL 5MI0C 5JPMB 1YRKA 3MC0A 2GJ6E 1EJVC 4PJ8A 3LOTA 3GBEA 3QGVA 1Y8BA 3TBVB 2PZNA 2V2CA 5DK3A 5FDYA 5A2KH 1URZA 1Z9PA 3BW9A 1A9EB 4TVPH 1TUXA 1ZJHA 4YHPA 5IF0B 5B1AB 4H2AA 1R3RA 3CZKA 5HNNA 3G6JE 2OPCA 2UVFA 1DQQA 3X2QB 3W6YA 2Z4GA 1W8NA 2F84A 4BUHA 1OP5H 3DKJA 3N6YA 4IX0A 3IKCB 2XJ7A 4D6JA 3HBPA 2E6JA 4MKTA 1YEYA 4LHUD 3LK6A 5M1TA 2NXIA 3E0FA 2BNUA 5L8JB 4KJYB 2R39A 2NX1A 5C0QA 4XR8C 5CU9A 5E99H 1JCVA 5T8IA 2V5SA 4Z1PA 3LU2A 4KWSA 2J71A 3UR8A 3QUKA 1R34A 3SCPA 1P1ZA 3NAAH 3US0A 5KSVB 2HFEB 4R27A 4PGDB 3JUGA 5CC7A 4UTUA 3TBYB 3G08A 5FF2A 2FATH 1WISA 3ZVIA 4DESA 4NC1E 3D25A 5CCZA 1G7QA 3VX0A 3L7EB 1UYWL 1J6PA 3L3IA 4LHJB 4YH6A 3GG0A 3LIZH 2OELA 3HVNA 1INDH 4YSAA 5C3LD 1I8IA 1XICA 4Z7OB 3IE9A 5MEOB 3ABXA 1HC1A 5A8QA 3VFMB 1WOBA 1MRQA 4DETA 3JV4A 3MROB 1ETJA 3RLHA 3L4WA 3G1RA 5E1GA 1GVEA 1D5MA 1EO8H 3SGEH 1KOAA 4TVPL 5CZXC 1GNXA 4UR7A 4WDTA 5IB5B 3IF1B 3QYMA 2EDWA 3UNTA 2JIXA 1N3NB 2Z29A 3LEPA 4YGAB 4XP6L 5HA7A 2WTRB 4X8JA 2P8BA 4M51A 3WTUA 2V9UA 1KLUB 4P2QE 2R59A 1VPXA 3BQUD 1MCOH 3W25A 4G8GD 3CWOX 1T83C 3SKNA 5EO0B 2JKIS 2R69H 2HT4C 1DQKA 1A3LH 1X5KA 3C87A 1OL0A 4BSWA 4HU0A 2DYPB 4PJDF 1H50A 4HKXB 1QR1B 4LAOA 4KFOA 2E5DA 5HAOA 2Q02A 4J6IA 4LOUD 2I60H 1PBGA 1FWHC 5D6DC 3MSPA 5E99L 2V5LA 4HN4A 2BZ7A 1EJ6A 4O51A 3UTPD 4K8RH 2H9AB 3T4YA 3DV6B 2F74A 4TTDC 3KYKH 3OMNB 3NAAL 3WQFA 1ADWA 2HB0A 5EUKA 4YLQT 3L95B 2FATL 3VXSB 2Q3OA 3EOTH 5KSWA 2EKJA 1AW1A 2X2IA 4LY4A 4URTB 3V7MA 1UQSA 1TEYA 1YUHB 5D9OA 3NN8B 2IJ0C 2CLZA 2DMHA 3R25A 4MASA 3LIZL 1INDL 3JXAA 1S5HA 3CDYA 3P54A 3AT0A 4PZVA 1NWOA 4A2DA 1BXVA 4OT1H 3N4EA 4OFYD 2VX7A 1SDYA 1F42A 1XBDA 4RW3A 4XCEA 1F3JB 3VFGH 4PUEA 3C75A 1T03H 1EO8L 3B0PA 4H83A 1WG3A 2AC0A 1I8MA 4D0BA 3AUJA 4M8UA 4AUJA 3SGDI 2BOFX 2IPUG 1MCOL 3FVDA 4MAYB 4L8SB 2PWHA 3PJNA 4XNYH 3HUJE 4QR7A 2R69L 2HJFB 1A3LL 1X5ZA 2A0LD 1OZMA 1EFXD 4U3HA 5BXFA 1NGYB 3V6FB 2DV0A 1DL7L 3QPKA 4U5KA 5J4MA 3G04B 1TPXB 3OXSA 3NSNA 1ISWA 2I60L 2QADD 4OZIE 5IFTA 1NSJA 3SCRA 2DZSA 3DHUA 1UXMA 1UOKA 2NXYC 2WZ5A 1FVPA 1AHWB 1F61A 3GRIA 2ARJB 4OD3H 4K8RL 3D85D 4YDJB 3PXJA 4GG6A 3HHRB 5E8EA 2QJNA 4WUUD 2A5HA 3KYKL 2VDNL 1JUFB 4HD5A 2XICA 5DMGD 5EO9B 1YYLH 1FNSH 3E2HB 3VFUA 2GCYB 1RPKA 4MLIA 5C71A 5DCEA 2WXPA 4NUQA 1I82A 4AZ6A 4YHEA 5ALBH 3P77A 4KZ0A 2DUAA 6ALDA 2R8SH 5F1KC 3AW5A 5GNYA 4HN8A 5DJ8B 2N01B 3OKEB 3MGTB 4OT1L 4WW1B 1V3JA 2A1YA 1ZSDA 3G8EA 4P05A 4S1RH 1GHSA 5HDWA 3VFGL 4A2LA 1T03L 4GZ7A 1DEDA 4XWOD 3O1NA