3ZQ9A

Structure of a paenibacillus polymyxa xyloglucanase from glycoside hydrolase family 44
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
512
structure length
512
Chain Sequence
b'AKTITIKVDTFKDRKPISPYIYGTNQDLAGDENMAARRLGGNRMTGYNWENNMSNAGSDWQQSSDNYLCSNGGLTQAECEKPGAVTTSFHDQSLKLGTYSLVTLPMAGYVAKDGNGSVQESEAAPSARWNQVVNAKNAPFQLQPDLNDNYVYVDEFVHFLVNKYGTASTKAGVKGYALDNEPALWSHTHPRIHGEKVGAKELVDRSVSLSKAVKAIDAGAEVFGPVLYGFGAYKDLQTAPDWDSVKGNYSWFVDYYLDQMRLSSQVEGKRLLDVFDVHWYPEAMGGGIRITNEVGNDETKKARMQAPRTLWDPTYKEDSWIAQWNSEFLPILPRLKQSVDKYYPGTKLAMTEYSYGGENDISGGIAMTDVLGILGKNDVYMANYWKLKDGVNNYVSAAYKLYRNYDGKNSTFGDTSVSAQTSDIVNSSVHASVTNASDKELHLVVMNKSMDSAFDAQFDLSGAKTYISGKVWGFDKNSSQIKEAAPITQISGNRFTYTVPPLTAYHIVLTTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords XYLOGLUCANASE
publication title Structure and Activity of Paenibacillus Polymyxa Xyloglucanase from Glycoside Hydrolase Family 44.
pubmed doi rcsb
source organism Paenibacillus polymyxa
molecule tags Hydrolase
total genus 184
structure length 512
sequence length 512
ec nomenclature ec 3.2.1.151: Xyloglucan-specific endo-beta-1,4-glucanase.
pdb deposition date 2011-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12891 Glyco_hydro_44 Glycoside hydrolase family 44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3zq9A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3zq9A02
5A2BA 2CBVA 4OIFA 2ZUTA 2GK1B 3DYPA 4JHOA 4AC1X 2DT1A 4J3VA 3IJ7A 3D52A 1CXHA 2A3BA 1WZMA 4DO4A 5FOOA 1IZJA 3L4WA 2JIEA 1HJUA 1CXFA 1UWRA 5HPOA 5A8OA 2EO7A 3VO0A 1H41A 4AY1A 3SEPA 1NWUA 4DUWA 1UKSA 2E3ZA 4X0NA 3WD4A 4MTVA 3ZT6A 2EPMX 2BXZA 5M3WA 4TUFA 4BQ2A 2E0PA 1E1FA 1R86A 2CPUA 2J62A 4UFKA 4P7LA 1DHKA 1GCYA 3NSMA 3K8MA 3NCOA 4HMDA 3LRMA 2ZWZA 4D6CA 1QW9A 4W5UA 3WMCA 5E6ZA 3IGUA 2WKLA 4P8UA 3N15A 2NSXA 3OLGA 1OGGA 1VBUA 3VMNA 2WBKA 1HL9A 2GJPA 3OB8A 4H8UA 1EH9A 3IJ9A 1JZ4A 5BCAA 4CN6A 2BVYA 4ZE4A 2YFNA 2GJXB 1J0IA 3QGVA 1W9XA 5I0DA 4EKJA 2J4GA 4AZ7A 1AQMA 4MAVA 1GOQA 2QMKA 2RGLA 5CG0A 5LA2A 1KQYA 5E9AA 2XM1A 3LRKA 1Q6GA 3I3EA 1FP9A 3VILA 2W4XA 1HJWA 4J3TA 2F61A 1W1PA 3BUPA 2PBOA 5ABFA 2CIPA 2WVTA 1HWWA 7CGTA 4TX6A 2G41A 3CHCA 3DX3A 4PUEA 4A4AA 3MMDA 3A22A 2ZUWA 1H3GA 4PN2A 2YFOA 1B3YA 3MU7A 3HMCA 1E0WA 2ZOXA 5DFAA 3BAKA 1ZBVA 4S3KA 2C0HA 4LQ1A 2JEQA 3CBWA 3SCNA 1JNEA 4ZFMA 3GXTA 3CUHA 1UD4A 1JL8A 1OINA 3WEZA 2DGAA 4PSRA 3AS1A 2EQDA 2IGTA 1WE5A 1WZKA 3QR3A 4AZIA 3TTSA 2WNWA 3MMWA 4P7NA 2ESCA 1CWYA 4N0RA 1UR1A 4LX4A 1M7XA 4J3XA 3TTQA 1HJSA 5A6BD 1R46A 3ZJKA 2WANA 1ITCA 1OT1A 1FH7A 4GI9A 3MSDA 1H0GA 4DUXA 1MXGA 1MFVA 4GO8A 2E8ZA 3LXAA 1UA7A 2VTFA 2VRJA 5IDIA 3ALGA 2PWDA 3MI6A 1W1VA 2V5DA 1C8QA 5A2AA 1J12A 1XSIA 2EPLX 1AVAA 3CTTA 3VMPA 4W8LA 1A47A 4E2OA 1BVNP 4QDMA 3S5YA 2JF7A 2Y8VA 2EAEA 3SIMA 1V3JA 1GJUA 2V3GA 4W7UA 4D6IA 3ZQ9A 4D72A 1J0ZA 4DO5A 3AI0A 5A8QA 1HTYA 1VFUA 1UD8A 4AIUA 3CV5A 3EDDA 2PBGA 3VGDA 3RPMA 3ZT5A 4PTWA 2VRKA 3AICA 1QOXA 4HA3A 4PMRA 4HPGA 5LA1A 1F4HA 4WSJA 1E6ZA 2FE0A 4WIWA 1JFHA 2XGIA 5EBAA 2EPNA 4TTUA 4NZJA 1RH9A 1ECEA 3ZSTA 1HKJA 4D1IA 1TQUA 3WH7A 4CGTA 1E5JA 4ACZB 3VDCA 3FNDA 6CGTA 1KXVA 3EJTA 3MANA 1FHLA 2WMIB 1UR4A 3E1F1 1VJZA 3PZGA 3D4YA 4HA1A 1KR1A 3CH9A 3WELA 4M82A 4D6HA 1QNSA 2UY3A 1KTBA 5GQBA 5A2CA 3AISA 1XHGA 1ODZA 2VRQA 1CNVA 2WMIA 3W81A 1DWAM 2G3IA 1DP0A 2W91A 3A4WA 3VIHA 3MV01 1TVNA 4F79A 3WMSA 4W7WA 4W84A 1V6UA 1PZ2A 1QHOA 1LJYA 1TFVA 2W5FA 2GVYA 2PI6A 1W91A 1QNOA 4JL2A 1E4LA 1L8NA 2OYMA 1BYBA 1V3LA 1XH2A 1C3FA 1HKMA 1BYDA 2XIBA 2XN2A 3LPOA 3VIOA 3PHAA 1G5AA 1VEMA 3ARTA 3VTRA 1V6YA 3LRLA 1FP8A 1QI5A 2PB1A 1IZKA 1CGTA 2CHOA 1UD5A 5FD0A 2W62A 5HXMA 2WSPA 1M04A 1H4PA 3T2OA 1H11A 1E0XA 5CPTA 1HT6A 5BWFA 2CHNA 2VUYA 2VL4A 1E43A 3SUTA 2JEPA 3N17A 3ZT7A 1PX8A 3BLBA 3APGA 3T0AA 2XN1A 1BLIA 1V02A 3PTMA 4A3YA 2J74A 2AAAA 1AQHA 4JKMA 1KQZA 2YDRA 4AIEA 1JDAA 2J7FA 4AMXA 3LMYA 3UETA 3VIJA 1FH8A 4P7OA 1E6NA 4FLSA 2XFFA 1HP5A 1C7TA 2WM0A 2X2YA 1DWHM 3CO4A 4MDPA 2X2IA 1WP6A 1TUXA 4L4OA 2J78A 2D2OA 3ZMRA 4D6GA 4Z2HA 1EHNA 4W85A 1UZ1A 3UG3A 2XGBA 1TQVA 4LPCA 2OWCA 3WFLA 5I3DA 2D3LA 4U31A 1KWKA 1LL6A 4CN4A 4D6JA 1BYAA 4BS0A 4MPKA 3IAPA 3VOCA 3BMVA 1AMYA 2O9RA 2Y24A 4PTMA 1MW3A 3RMEA 1C8YA 1CZ1A 1IT0A 3SCUA 3D51A 3KL5A 2CITA 1WKYA 2JFEX 1WCGA 1I1XA 3BSHA 1XC6A 1VFMA 1R47A 3EJQA 1YQ2A 1HP4A 1UKTA 3ZR5A 4PMOA 3W4RA 2X05A 4J28A 4AD1A 5A6MA 3VM5A 5C71A 2FHCA 4RL3A 3ARWA 5A6KA 2WCSA 3THCA 4JZ5A 1E6XM 2CCRA 1MXDA 2ZXQA 3LXBA 3FN9A 4ZXOA 4M1RA 1KWGA 1E6RA 2XIIA 4ZXLA 4MB4A 1PIFA 2WHKA 5I23A 3PZNA 3GXDA 4ZENA 2J7HA 3K4DA 3VM7A 4CU8A 5ECUA 5CGTA 2YOCA 3VGFA 1JD9A 3PZMA 4W88A 2D3NA 5HOSA 4CVWA 3L4VA 2VJXA 3ZOAA 2HISA 2DH3A 1W2PA 1CECA 4OOZA 5JUVA 1GOOA 4WLCA 5DO8A 4IUGA 1JZ8A 3EJUA 3W24A 3SCQA 4JFUA 3H53A 4FMVA 4NXSA 2YL8A 1FFQA 3OLIA 3ECQA 2ZX9A 2FHFA 2VCCA 1YHTA 3WDHA 2J7DA 4V2XA 1GZJA 4S3JA 1M01A 2OYKA 4AEFA 3ARRA 3N18A 3CZJA 2UY5A 4C7GA 1OIMA 4PMUA 1V6VA 4D71A 1HXKA 1E5NA 3PTKA 3GBDA 4D1JA 4FNPA 5AC4A 1HJQA 1VJSA 3OGRA 1HL8A 4X9YA 3TP4A 2F7RA 4W93A 3B9AA 1UQYA 4CU7A 4UNIA 5E6YA 1GOMA 1E4NA 1QW8A 2A3AA 5D4YA 3A21A 2BNJA 4AXNA 3WEMA 4W7VA 2VC9A 2VOTA 3WF3A 4V27A 4F66A 2D73A 3VVGA 3WDIA 3KL0A 3EMZA 3DDGA 3K1DA 1ISVA 5A8MA 1JDDA 2Z1KA 1WAWA 3DX2A 4UFLA 3ZSSA 4AMCA 1EDTA 3AIVA 1KGUA 3N1AA 3TTYA 5LYRA 2DSWA 4FK9A 1E3ZA 4ZE5A 2PWEA 1CGVA 3K46A 1C7SA 4H8VA 5D9OA 4W8BA 2BY3A 1E6QM 1OD0A 4MNLA 2WVUA 1BHGA 4DWSB 2UY4A 2EACA 4ML4A 4CCEA 4Z2KA 3VNYA 2DPEA 2ZXBA 1ZU8A 2XWEA 1UD2A 4CVUA 2WWCA 3FAXA 3GH4A 3VDHA 2WAGA 5ABGA 3AMKA 4GI8A 3BVUA 1MYRA 3SURA 4IISA 2GDUA 3FW6A 3GXPA 4XB3A 3BUQA 2J7BA 2WHMA 1OWQA 4FF5A 4MNJA 4WKFA 4ZEPA 2TAAA 2D20A 2XG9A 4NSBA 4HOWA 1W9VA 2J75A 2PF0A 1ESWA 2W67A 3O6AA 1QX1A 3WUFA 1HJXA 4YPJA 4B15A 1OBAA 1TQTA 2Y8KA 1F4AA 2VMFA 1W9UA 2D23A 3AHVA 2DIEA 1JAEA 1QHPA 3SCVA 2DT2A 3G6MA 4F9JA 2W63A 3WUBA 1UWUA 2VCAA 4CD5A 1BG4A 2XM2A 4FLQA 2DH2A 2YLAA 1KBBA 4DO6A 2NW0A 3IAQA 3F5JA 2JE8A 1BYCA 3EMCA 1W3JA 3LPGA 3N04A 4PBGA 1VFOA 3DX1A 4HOXA 1UWSA 4GI6A 2WK2A 4HZ6A 1V3MA 3AZTA 4D6FA 1RPKA 3OGVA 2AOSA 3WQ4A 3AMCA 2XVGA 1XH0A 2VCBA 1UASA 1UWQA 4TVCA 2JIWA 2PWHA 3DYOA 4UQEA 2VX6A 2F8QA 5E1QA 3U7VA 1R34A 1HN1A 2WC3A 4NRRA 4HMCA 1B0IA 3BVVA 3W29A 2CKRA 4OGZA 2WXDM 1UWIA 3ARXA 2XPKA 1LWHA 1H49A 1R7AA 3BUIA 4Z2GA 1OGSA 4WKAA 4LYQA 3KL3A 5FL0A 2ZE0A 1U2YA 3WNNA 4PMYA 3DX4A 3H55A 3WD1A 2O9TA 3BVTA 2D1ZA 5FIPA 5ABFB 1W3LA 1BPLB 1DEDA 3BGAA 1KB3A 1HIZA 3UESA 3CLWA 1DWIM 4CD7A 3DDFA 3SCSA 4P8XA 1UKOA 4BQ3A 2EEXA 3EDJA 4UZUA 4CN1A 5HPCA 2WSKA 1SR0A 4P8WA 3EDEA 2F7OA 1UHVA 3CUJA 3VSUA 1NWSA 2ALWA 1TG7A 3BUDA 3EDKA 4FNQA 3ZM8A 2GSJA 3CZ8A 3OLDA 5JIPA 4HZ7A 2DIJA 3CZNA 1E70M 4LYRA 1FH9A 3SUVA 5A3HA 1VAHA 2ZUNA 5HDRA 3VIMA 2CBIA 4EAMA 1CDGA 2XFRA 2WPGA 1VB9A 3CHDA 3PZVA 2V3DA 4MJ4A 1I1WA 2XYLA 1HKIA 1J0HA 1MWOA 4MB3A 2PWGA 3D50A 4GPNA 3UCQA 3WH8A 2HVMA 2QV4A 1BVZA 1UG6A 3CZKA 4QLJA 4ATDA 3AS3A 2XVLA 2G4FA 3K8LA 1GJWA 1JYWA 1OD8A 3CZSA 1KXQA 4C7DA 1BSIA 1JF6A 4KRUA 4UQDA 4H7VA 7TAAA 1R75A 2G3JA 1ZB5A 1US2A 3HG4A 1J9YA 2WLZA 3AZRA 4WKHA 2ZXDA 3BAIA 3BXWA 4OUEA 1JI2A 2D22A 1NP2A 2F1BA 5M5DA 1EIBA 1ZBCA 3POHA 4CCCA 3B9EA 3RJXA 2ZUSA 5DT7A 1BGGA 4E4PA 2WBGA 1WPCA 1QNRA 1JAKA 2AMGA 3BH4A 3KLLA 4IPLA 1B3VA 4RE4A 3BAXA 1V3IA 3PN8A 1EOKA 3WBEA 1G9HA 5I5RA 2WC7A 4CCDA 2IXVA 1ISYA 1E4MM 3SUSA 1CXEA 2WMKA 1E72M 1GW1A 1UR2A 5GPRA 3A4AA 1KCLA 1GQLA 1UR0A 4C7FA 4UOJA 2ZIDA 3KE0A 2CETA 4Z2IA 1VEPA 1XCXA 6TAAA 2CNCA 4PEEA 1WNOA 4PMDA 4EE9A 4PUDA 2O9OA 2DEPA 2WVSA 4JAWA 5A6BA 2VX4A 1B3WA 2WCAA 3WD2A 3FAWA 2YIHA 3WY1A 3PZOA 3WF2A 4CD4A 5KEZA 2A3EA 2X8RA 1NH6A 2J7EA 4L4PA 4AD2A 2XWDA 3EYPA 2EABA 2E4TA 3D3AA 3WL1A 3AZSA 4JKLA 1K9FA 5CPSA 1E15A 4JCMA 1VEOA 2DT0A 3VPLA 1WDPA 1B3ZA 4AD0A 3WENA 3VGEA 3VNZA 4W89A 1MW0A 3SCPA 2XSBA 3K4AA 1VBRA 1ITXA 1JI1A 3KZSA 4RE3A 2Y5EA 4HPHA 1HVXA 4QCEA 4K68A 4Z2LA 4UFMA 3T09A 3KEHA 5CSUA 3T08A 1JNDA 3LPPA 1H2JA 5JIWA 1GPFA 1VRXA 3THDA 1E73M 5CXPA 1HF6A 1TVPA 3I3BA 4W87A 5FKYA 2GFTA 2E9BA 1B3XA 3GZAA 5C70A 2F1AA 3OG2A 2BV9A 1UKQA 4J3SA 3M6DA 2E9LA 4NZCA 3D5HA 1JXKA 4KRTA 1JYNA 1W9BM 5I24A 1B90A 3VSVA 4QAWA 3TTOA 2X0HA 2OSWA 3WY3A 1VENA 4M8UA 1E6SM 2BS9A 3I3DA 1R8LA 2OLHA 3BSGA 3CMGA 1RP8A 1E9LA 2EXOA 1C91A 3ZJ7A 2ZUVA 4GZEA 5JBDA 2YKKA 1TR1A 4OJYA 2FH8A 4H41A 3CHEA 4R5EA 1UH4A 3BAWA 3HZ3A 3RILA 1NQ6A 1OM0A 1CBGA 2D0HA 5D8ZA 3M46A 1LLOA 2DQXA 4GINA 1QWNA 1SMAA 1NARA 4YN5A 2J7GA 3B8SA 3VIFA 4TOQA 1WDRA 4PTXA 4HMEA 1DWGM 1R87A 1HVQA 4UFIA 3WFZA 2OSYA 2WMGA 1TA3B 5I2UA 1A3HA 1W2VA 3ALFA 1FA2A 4Z2JA 4J7RA 3CUIA 2FYVA 4PMVA 5E0CA 1ISZA 3BUBA 1CPUA 1TA3A 1E40A 4Y7EA 4PTVA 3II1A 4H2CA 3CHFA 2XFYA 1FHDA 3VINA 2Z1SA 3WUEA 3WQWA 3AYSA 1W3HA 3ARUA 4KGLA 2YA2A 3BAYA 4U2ZA 3CUGA 3BVWA 2G3NA 1UWTA 1QNQA 4PCTA 4H8HA 1FFRA 3QOMA 1D2KA 1LL7A 3A4XA 3HG2A 3WL0A 1TCMA 2V5CA 2FHBA 1E55A 3VDAA 3BLKA 3TA9A 1UYQA 3AIWA 3AS2A 4JIEA 4KGJA 3AHZA 3MUIA 3O9NA 5BXPA 3WQ8A 3ZIZA 1RD6A 3GDBA 1QNPA 3WNOA 4UTFA 3PZTA 2XVPA 1HXJA 1J01A 4AIOA 1PAMA 1TZ7A 1XH1A 4JL1A 2G8ZA 1XD1A 3ARSA 2J7CA 3EJRA 1GOIA 2A3HA 3UR7A 1JGIA 1ZJAA 5F7UA 3ZR6A 3WY2A 1GVIA 3RCNA 2BY2A 2ZXAA 4JKKA 3OGSA 3W28A 3GNOA 4NF7A 3EMQA 3T0DA 2YDQA 2YDSA 1QBBA 1NWTA 3WNKA 5BRQA 3VD3A 3WQVA 4DWSD 3IK2A 2A3CA 2F7QA 3W6LA 3VSTA 2VNCA 1GOKA 3A47A 1D7FA 3ARQA 1QI4A 5A1AA 3AMLA 3VIPA 3CZLA 2V38A 2GUYA 1GQIA 4AEEA 3AJ7A 1ZBKA 5CLWA 4Q7NA 4BF7A 4PMXA 1B30A 4OKDA 2YBTA 1XCWA 1EA9C 2QPUA 2YL6A 5FL1A 1J0KA 2ZX8A 1V0NA 4D6EA 4XUYA 5GNZA 5E09A 1PX4A 1W3KA 3CZEA 5DT5A 3A5VA 5IHSA 4AZGA 2Q8XA 5I6SA 4P7QA 2OWWA 5D9MA 2BFGA 4HU0A 2UY2A 2J8FA 1GQJA 7A3HA 5EB8A 3CZGA 1NM9A 1JD7A 1E71M 4U3CA 5I79A 3RDKA 5CQ1A 1NWRA 1CENA 1DWJM 4XX6A 1LWJA 1HKKA 1PEZA 1P6WA 3HG5A 3VD7A 2XSAA 1LG1A 1Q6FA 1O7AA 3AHTA 2V3FA 1JZ5A 1MW2A 2J25A 4OOUA 3SCOA 3T2PA 1J11A 2YLLA 1CLVA 1X6LA 3PZUA 3QHOA 4HA4A 1XSJA 3W27A 4PMZA 3AIUA 3BCFA 4IPNB 4JHZA 2WC4A 2CEQA 3OA5A 2BVTA 3HG3A 2ZX6A 3ZJ8A 3FHQA 4GZIA 1WDSA 1PBGA 3POCA 4PRWA 5KZ6A 2C8NA 4W8AA 3KWXA 1Q6DA 3MO4A 3WBAA 4GIAA 3M7SA 4TX8A 1LF1A 2YL9A 4HTYA 1NOUA 4ATLA 1H5VA 2VR5A 1WO2A 1O6IA 1CYGA 2VI0A 4GZJA 4UOZA 1OIFA 1B1YA 4CKQA 1R85A 4LXFA 3U5UA 4MB1A 5GNYA 2WZIA 2XN0A 3BAJA 3B9DA 3WEOA 2D24A 1EQCA 5E0FA 3DECA 3UR8A 1SMDA 1Q6EA 3L4YA 4TXEA 2CKSA 4KMQA 3TONA 3AFBA 1BFNA 1JZ6A 1MQQA 3GM8A 1R7OA 1VIWA 4YHGA 2GK1A 4M24A 2YJQA 3BMWA 1E56A 3VD9A 3DYMA 1UQZA 2J8GA 1E3XA 1JYVA 2VZVA 3AOFA 2XUCA 3J7HA 1VFFA 4UQAA 3IANA 2XJ7A 2F7PA 3AHXA 4DM1A 5FCZA 1CGYA 3VMOA 3D4ZA 2DSUA 1JXJA 4U2YA 2FH6A 3AS0A 4M56A 1XYZA 3W6MA 4UQBA 1GNXA 2DSVA 3NSNA 1UH2A 1BG9A 1LQ0A 2J77A 2CESA 3AXHA 2VZTA 3A6OA 4AZ5A 1JG9A 2EPKX 3WF1A 1J0YA 2WB5A 3WH9A 2Y2WA 2WLYA 1MFUA 1N82A 4URIA 1XRVA 1MQPA 3QHMA 3DHUA 3GH5A 4MB5A 1E1EA 4RE2A 3WD3A 2PC8A 3VGGA 2OWXA 1GHSA 1WDQA 2IUZA 3ARVA 4AMWA 4OBRA 3NDZA 3AYRA 3HJEA 4PMQA 1MVYA 4NXKA 1NOFA 2GDVA 1UH3A 1KGXA 1C90A 4AW7A 3HU7A 1LL4A 5LA0A 3VX1A 2GJXA 1G1YA 3AXIA 1V03A 3AMDA 4OZOA 3ZO9A 5AC5A 1GONA 3G6LA 1M03A 1GOWA 3GYCA 6A3HA 4EANA 4UFJA 4BZYA 5AYBA 1U30A 5DF0A 2X2HA 3NYDA 1W9DM 5A6JA 2VX5A 2WW5A 4OBSA 1KFWA 2EPOA 3VX0A 3BCDA 1MW1A 3MV11 5A6AA 2VURA 3RM9A 1SZNA 1UA3A 1FOBA 3MUAA 3U57A 2DDXA 1K9TA 3NUKA 1SFSA 3MUZ1 3PZIA 4WSKA 4NRSA 5A6SA 2EADA 1W1TA 2EJ1A 3SUWA 2CYGA 2W92A 1I75A 1EDGA 1QHZA 4U5KA 3WKZA 5IHRA 1G0CA 4AD3A 1K9EA 2IXUA 2VQTA 3F5KA 2V3EA 4MADA 5A8NA 2VR4A 3DHPA 2VO5A 1QVBA 3WD0A 4QLLA 3WSUA 4GXPA 5BYWA 4J3WA 4JFVA 4BQ5A 5I77A 2JF6A 1BQCA 1EOMA 4E8CA 3UERA 4AZBA 5AY7A 3T0BA 3N12A 4UR9A 1X1NA 1UD3A 1OCQA 1QBAA 1GUVA 4XZWA 5CPQA 4FLOA 1CGXA 5TD4A 5E70A 5IXEA 3S2CA 3MUY1 2BHUA 3WIJA 2WYSA 2YA1A 3WQ5A 2VQUA 2PWFA 1M53A 4U5IA 3CGTA 1E0VA 2J79A 3WH6A 4BQ4A 2O9PA 4UQ9A 2J47A 3DC0A 3F5LA 1CGWA 4NI3A 4TTGA 3L4UA 4FNSA 1Q4NX 1MQRA 5M17A 5DMYA 2F2HA 3CPUA 3LX9A 4NX0A 1OGBA 4M29A 3W37A 3GBEA 3WF4A 3BVXA 4UQCA 1EXPA 2ZUUA 4JFSA 1L0PA 2ZX7A 2FGZA 2VT0A 3A3HA 3VIKA 4CD8A 3S5ZA 3VU2A 5HNNA 5CJ5A 3JUGA 3N13A 3GNRA 3KLKA 3ARZA 2GJRA 2WKGA 3M07A 2E40A 3HN3A 3DX0A 1O7DC 1JZ7A 1S46A 1V0LA 1C93A 1XSKA 3L4XA 1Z32X 3L4TA 2JALA 3PZQA 3WN6A 1BTCA 2WVVB 4X0VA 5ABEA 4ACZA 1B2YA 5IFPA 3WQ6A 1BF2A 3UG4A 5ABHA 3OIHA 4KWUA 1PIGA 4DUVA 3NIYA 2WVVA 3ARYA 1V6WA 3O2LA 3VKKA 1R33A 3AROA 3SCRA 5A8PA 3A24A 3RIKA 1V0KA 4D6DA 3CUFA 1KXTA 4H04A 1XGZA 3AIBA 1QPKA 4AYGA 3T2QA 4E8DA 2ZICA 5C8BB 1PZ3A 3GXFA 3L2MA 4U33A 2FDMA 1BAGA 4MAZA 3BC9A 8A3HA 2DSZA 2NT1A 2WMFA 2XTKA 4LGXA 2ZX5A 1TE1A 4FNRA 1OSEA 2CXGA 4GO9A 1UD6A 1HJVA 1HX0A 1DTUA 2W61A 4A3HA 5BXRA 4MDOA 1US3A 1CEOA 4WJXA 4EK7A 2Y4SA 3VIIA 1RP9A 1ISWA 4B9ZA 3RJYA 4CUCA 3CMJA 3NDYA 4FLRA 3AMGA 1QWUA 3WDJA 2X0YA 3AIRA 2DSKA 4W5ZA 4UFHA 2WMJA 2F18A 5CGMA 3UEQA 3AHYA 4WK9A 4GKLA 3H54A 2O92A 3EBVA 2VZOA 5D9NA 4AISA 1Y7VA 1WZAA 1UR8A 4FNTA 4B16A 1XV8A 1J18A 1UUQA 5D8WA 1KR0A 1JZ2A 4MNMA 1EO5A 3L2LA 1H0IA 4PCSA 3L4ZA 1GQKA 4GQRA 5JBEA 1HNYA 1UOKA 1QI2A 3TOPA 3IJ8A 3W25A 1JIBA 4QP0A 3VUPA 3U5YA 3VGBA 3SCTA 4AWEA 1V3KA 1KGWA 3WY4A 2B31A 2QMJA 1BGAA 4CU6A 1JDCA 3GH7A 2BY0A 2YL5A 3OBAA 5EFFA 1JZ3A 3W0KA 1V02E 3OZOA 3RM4A 4QCFA 3VIGA 2BHYA 3NJ3A 3PBGA 3F4VA 2YA0A 4JCLA 3GNPA 2FGLA 2WCGA 1GVYA 1KCKA 3LPFA 3PTQA 1G01A 1QI0A 3VGHA 2QLYA 4GQQA 1EO7A 3WDRA 1CLXA 4IM4A 3AQUA 1C92A 1ISXA 2D0FA 4HP5A 3EJSA 4V28A 4JFTA 4P7RA 5HBFA 2X1IA 2XVNA 2C7FA 4DM2A 4R27A 2D0GA 3CC1A 5CLTA 1Q6CA 1QI3A 2CERA 1CIUA 1VF8A 1KTCA 1OB0A 2BY1A 3AIEA 2WMHA 1E4IA 4ACYA 3MS8A 5BROA 2VZUA 1W1YA 4M81A 4W86A 4TVDA 4B3LA 2WHLA 1U33A 4UZSA 1B9ZA 1ODUA 1LG2A 2BVDA 4QFUA 3UG5A 2ZWYA 1EGZA 1JYXA 4MNKA 4XZBA 3W82A 1D3CA 4KH2A 1C8XA 3AIQA 3GXIA 1PX3A 1TQWA 3RO8A 1H1NA 2DT3A 2VVSA 5I78A 1OT2A 4F9DA 1EQPA 1CGUA 4HU8A 5EFDA 1DWFM 1X6NA 4NZFA 3BLPX 3WNPA 2QPSA 3TV8A 2BHZA 3WDPP 2E9MA 1JFXA 4MJ2A 4LYPA 4M80A 2XVKA 3S6TA 1K9DA 2OYLA 4ATWA 3FY1A 5AYIA 3U7BA 1IV8A 1CXIA 4J3UA 4P8VA 2VVNA 2G3MA 4AZ6A 3EJPA 4AD4A 4JFWA 2QF8A 2W66A 1V3HA 1CTNA 2E8YA 3N9KA 1E6PA 4HOZA 8CGTA 3FHAA 3AXXA 4QLKA 3W26A 4F8XA 1J0JA 5DEZA 4AYSA 4TVUA 3CIVA 4AD5A 3EDFA 1ZJBA 2OW7A 1ZS2A 3GXMA 4N42A 1ZL1A 1V0MA 1WB0A 4CD6A 3WNLA 3MSGA 3RM8A 2X09A 1T0OA 5BRPA 1CXKA 1KXHA 4PYSA 5A69A 1EHAA 3VD5A 2VX7A 2BXYA 1PPIA 2ZUMA 2OW6A 4WF7A 3A23A 3WH5A 2CBUA 3GTNA 5A95A 3N11A 3WMBA 5CSYA 1GHRA 1UZ4A 3GXNA 3SUUA 5A6LA 1H09A 1W9PA 1EDQA 3W38A 3VDBA 1J10A 2MANA 3K8KA 2WHJA 2XHYA 3ZJ6A 4YHEA 4DWSC 3OLEA 3WUGA 1WZLA 5EMYA 4Q22A 2EBNA 4J27A 2OSXA 2X2JA 1W32A 1UR9A 2CBJA 1TMQA 5GNXA 2VZSA 5D9PA 3VD4A 4B3KA 4XV0A 1UKPA 1V08A 5A94A 5BXTA 4AZCB 1AQ0A 1NP0A 3MMUA 2YBUA 2UWFA 3ARPA 3WNMA 3FXYA 1CXLA 2NT0A 1V6XA 3MKKA 5M03A 1B31A 3PZ9A 4DWSA 4PMNA 3QHNA 4AZCA 4HZ8A 4AZHA 4B9YA 3QOKA 4PSPA 3NSXA 3OZPA 5CZKA 1GORA 1K6AA 1KBKA 3LXCA 2RGMA 1PS3A 3SCWA 1XYFA 4U3AA 4BCEA 5JBFA 3W53A 4UOQA 4UCFA 4BA0A 1TQSA 9CGTA 5BXSA 3WDQA 1JF5A 2WZHA 2WZEA 2WWDA 5IFTA 1PJ9A 1ZBWA 1XD0A 4FNUA 3WF0A 1NOWA 2QHAA 1G94A 1SYTA
chains in the Genus database with same CATH superfamily
4OIFA 2FB4H 5BOEA 2CCLA 1ZT4A 3QH2A 2AAMA 5F4XA 1IZJA 3S5NA 1S1RA 2FO1A 1UWRA 4AY1A 3MLUL 3P6LA 3QK0A 5D1ZD 2AQRA 3R8QA 3U48A 2EPMX 2ODIA 3NESA 3WLKX 3MV7A 2YXVA 1T89C 1S9VB 4FHJA 3WMCA 4RFOH 5LGKA 3N15A 2BSDA 4OECA 2FVNA 1HL9A 3RNKA 2BSTA 3V6ZA 2G50A 1SUHA 4MAVA 3SGEH 4QOKE 4DI9A 1GAFL 3BZFA 1OTUD 5TJWK 5JXQA 5D8JL 3GRIA 1EXHA 1ES0A 2DEWX 4PIRF 4A2RA 1JPEA 3LV3A 4FFYA 4AYFB 3ABZA 1Z7AA 4R7NB 5G5DA 5FOBA 3WEZA 2A2IA 1Z44A 4TKWA 3QR3A 4D9QE 3AUOA 2DQEH 1I3RB 4HUMB 1MLCA 3HMWL 1PKLA 1A5FL 4PJBE 4I8YA 1D9KB 3V0EA 2R0WH 3VXUB 4QGTA 3HRPA 3ZY7A 1I7ZA 3GHSA 5I6NA 2LVCA 4N9BA 3ZQ9A 3L5MA 3EDDA 4JTFA 3QDAA 3VGDA 5BO1H 1U83A 5JYMA 1JHTB 4WUUE 5AVWB 5DY2A 2LABA 2CLLA 2MCG1 3QIUB 1PEWA 4KKBC 3UGXA 5HNUA 1FY6A 1TEFA 4I4WB 5T3ZD 4JGJA 5L2KA 4ACZB 4PV9B 2A6DB 5IMMB 1BD2D 2J5LC 4HA1A 5HGDA 2X0WA 3VE7A 3V6FA 4Y1AA 1TTCA 2F6XA 4OCRH 1QA9A 4NJGA 2LU4A 1QEXA 3IMUA 1QNOA 4A2MA 1OCRB 4OZGA 3FU6A 1E28A 2ZCKH 2F9RA 3H7RA 4GMEA 5CPLA 1YNYA 3FXGA 1DEEA 2CKBB 5I74B 4C83B 4YJZL 4R7JA 4H5SA 3GFYA 1WFUA 1JWMB 1PX8A 1FRGL 4H88H 1BLIA 4Y5VA 1UM5L 1CT5A 1MCNA 4LAQL 1I8IB 5F97E 3LCYA 2ED7A 5HMFA 1YEDB 4CQDA 5IUCA 4MBOA 1XLGA 4LS2A 1MJUL 1HGYA 4D2JA 5KMYA 5ISZD 2Q6WA 4WVXA 4Z2HA 1EHNA 3RGVD 4DJDD 2AABH 5EZPA 4PZVA 4FG0A 4LPCA 5I3DA 1RHCA 1FFOA 4M7ZC 1TWWA 4XNUL 4L37A 3HS8A 4CVZA 1J5HA 1F4WH 2GQAA 1EHKB 3D51A 3P4MA 3SDAD 3X12A 4OF0A 5I71B 5F7DA 1R30A 1M6OB 3QV6A 3W7EA 3LI1A 3IU4H 4DKTA 1K8ZA 3U2IA 3TW9A 3RBSA 3CK0L 4P57A 2X05A 4AD1A 5C71A 3OGCA 5EYWA 3THCA 2V5KA 1WLHA 5B1BB 4NYLB 4HULB 5HDQH 1NEZG 4CU8A 4F7PB 1TQJA 1OXYA 4RSVA 5CGTA 1S3KL 5J5RA 3OM3B 3IIPA 3SSGA 3T4CA 3W24A 4HSNA 2ZYSA 1CGSL 1BA9A 3OLIA 4S3AA 1XX1A 3UR2A 5GRUL 4XZNX 1A2YB 3G6JA 4DERA 4NQDB 2WB1A 2ZZ5A 1UOZA 2TMDA 2XUWA 1BTMA 2J88L 1LK2B 1HXKA 1TPVA 5FA4A 3N50A 2OJZH 1KPUA 3OQ8A 1CIDA 2Y1VA 1OE1A 4M7JH 3CH0A 1VQTA 4QT5A 1JGEB 3VVGA 5AW3B 3WDIA 1OQOA 2AXGA 3K1DA 2DB8A 4LHUD 25C8L 5KSUA 2CO6A 4S2CA 4WX2A 1E3ZA 3EPMA 3LRSA 4PJ9A 1Z9AA 1F6AA 4MNLA 3TO2B 4DWSB 2XG5B 2E7LC 3HI6H 4MJ5A 3VNYA 5FHBL 3L12A 1ZU8A 4GX8A 1PY0A 2VDKL 4ZUSB 5J1AA 2B0SL 3ZJAA 3M5VA 4EAYA 3BVUA 5ANME 1GZHC 5HI4C 3T9PA 4X8GA 3COTA 4EOWL 4MS6A 3W2JA 3S96B 2WHMA 3HS0B 3UZ5A 4XTIA 1BFOA 4HOWA 2J8UE 2ISWA 3W22A 3H9SB 4YDKH 2GLKA 4HKBA 2C18A 1W9UA 1IXNA 1I8KB 5IHUL 1XM3A 3TN0D 2HP4A 5IFHH 3IPBA 4UTAH 4FTVE 3IPFA 3W7QA 1GKPA 2Z91B 1JXGA 4WNJA 1N7MH 4L29A 2PP0A 3V9EA 4LSUH 3EMCA 2Z9TA 4PWIA 3BH9A 1WT5A 3VJ6B 3QJTB 1PS9A 4HIEA 1ND0B 4YDLC 1NLBH 4UAOB 2IO5A 3Q2CA 3BP6A 4GMSH 3AAMA 1XI3A 3V75A 3FEMA 4ZFCA 4KJWC 1EFXA 4UMSA 4KKRA 2DM3A 4AY7A 2F8QA 2IQTA 4JDVA 2WLLB 2Q76A 2XPKA 2D7TH 3RB5A 4BH8B 2X4RA 4YBHA 3T5WA 1I9RL 3ARFC 1O94A 7FABH 3KDMB 4DZAA 1U2YA 2FGWL 4FHKA 3ITYA 3WGVB 4O10A 4HU2A 4J2XA 4UF7C 1GS8A 2V2WB 3ZXAC 5D7IA 3QKZA 5KVFL 2IGFL 1YMME 1UHVA 3ZTCC 5I02A 4L8BB 4C6KA 2J6VA 1FDYA 3M1OA 2F7IA 5TDPB 4MHBA 3SKJH 4NWTH 1Q2RA 4MWAE 1XS2A 5XINA 4PRID 2C4FT 3SBQA 2QUUA 3X17A 4P46A 2FWLB 3SGJC 2DQGL 3VOJA 1EJRC 4K7PY 2O4QA 2OMAA 1U4EA 3PAYA 4ZW6A 2EIEA 2HVMA 4XH2B 1M2VB 1LRTA 3KPQA 4ZSUA 2YXOA 3BPOB 3NPZB 2APXA 1LP6A 3VWKC 4DGVH 3P67A 1US2A 3CVIH 4HZLA 1A7QL 5DC2A 1J8HB 5LAPA 4M62H 2D3JA 1ZBCA 3C8DA 5DMGC 4XO5A 1UUOA 2AMGA 5HHMD 4KU1A 2HSIA 3BAXA 2UXGA 2WXKA 1K6QH 2GVLA 1CL7I 1OGAD 1X5ZA 4L9ZA 2WCPA 4FQQA 4HYWA 3DGGA 2NY4D 5J0BA 2QAFA 1QOKA 1TQCC 3GHTA 2A0LD 3TN3A 3QXDA 4H20H 5GS1B 3NZGA 3EJYD 4YHIB 3VABA 4X6CE 1TYEB 4WEUD 1EJVC 1ZSDA 1ZXQA 1ED3B 3L3OC 2FYYB 1YYCA 5JHDA 4G70B 2H8PB 2FDSA 3GW0A 2UZYB 4K3JH 3SDYH 5DTFA 4K5LA 3RMJA 4A7GA 3P11H 1RMFH 1RIHL 1K9FA 2A9NL 2R4RL 1JPST 4NPYA 3KR3H 3ZE2F 3MT1A 3UPBA 1WOBA 2ZUQC 1GGCH 5C0QA 1CQYA 1GGIH 2C3GA 2J21A 3B40A 5IHHA 1PNDA 1H2JA 4AQ1B 3PWNB 5E4EB 3WJJA 1B4KA 4APQA 1EFZA 3VYLA 3NPXA 4JRXB 3EA2A 3M6DA 1W5PA 4YTQA 3IMSA 3VSVA 2ZKHL 2I9UA 3TTOA 2DVXA 3I02B 1XDLA 3MNWB 2VENA 1KN2L 4KK5D 2D0HA 4Y9PA 3CK5A 5HHQA 4FQHA 4RRPM 3SQMA 2VD8A 5C7ZA 3FA4A 2X4TB 5AC6A 2I7SA 3C09B 1WDRA 1DLFH 2LTQB 2AQVA 4L8SC 5D1XA 3KTSA 4MQ7A 2XTJB 1MAKA 2JJWA 3KCPA 4FRWA 3EX4A 3L68A 2FYVA 2EH7H 4RZBA 5BQDA 3NJKA 2IAMD 3LZFH 1FL6A 4DT2A 3CHFA 1RZFH 1T3FA 4Y4KB 3SE3C 5BPPA 2DMCA 2A73A 4GY7A 4C58B 4ERSH 5C0RH 4AEOA 3E8UL 3HAEG 1Y8BA 3HG2A 2JQAA 5KYYB 4KV5F 2GHZA 3CFUA 1EX0A 2XZQH 5JHBA 3X1BA 5AVZB 4DAGL 3B0YA 4N2FA 3GMMB 5C1MB 3AS2A 1TOXA 4YU1A 3CJJA 4HG4K 4KXCA 3CFCH 1R0MA 4O2EA 2N1KA 1B3IA 2NY6D 2WQXA 1KYUA 1VPOL 1UMLA 1VCAA 5HQLA 4HN8A 5KSAC 1XH3A 4HWBA 3GVWA 3ZE2B 5BVJB 1IEAB 4UUJB 1JGVL 1Q0XH 1XRSA 4RA0C 2WLMA 4IK6A 4JFFE 4NF7A 3GG8A 4XBEL 2X4NA 2GY5A 3MREB 4NQCE 5BOOA 4GXUM 2FX8L 4XBSA 4KX7A 5SWQB 3SY8A 1NCNA 4QHNB 4X50A 1E51A 1X3DA 5E2WH 1G7IB 3APFA 4PGDB 3H22A 3OF6A 4OZIF 4QQUA 3HV8A 4O13A 5H8MA 4PJIF 3W7HA 1E9OA 1S7SB 3W0WD 5CZVL 1IBDA 2VEGA 3MUGA 1NM9A 5CIPB 1EERB 1JD7A 4ONHB 5E9DD 4EI0A 5KBMA 1XFBA 2VQ1A 1NWRA 4L4TE 4KKZA 2O7QA 3K6FA 1UBPC 1OGPA 5FK9A 3WQDA 1O7AA 1ZLEA 1OX4B 5B38A 2AQSA 4PRTA 5I3FA 2WP3T 3QQ3A 3KVKA 4AG4L 3AQDA 5I1HL 3UPRB 1UM4L 3QHOA 3GMLB 5A16A 2DKSA 2PTUA 4PTTB 3SY1A 1NEYA 4DPQA 1BEXA 2Z25A 3ZJ8A 4ZAKD 3UROR 5AOJA 2C3VB 4Y16B 4I9TA 4RDYA 3N43F 4UU9B 4TN9A 1UZDA 1H5BB 4UOZA 1N5YH 2J44A 2E6AA 2FSDA 3IU3B 3O41A 4ZUWB 3S3JA 5DCCA 3TF4A 1TFHA 3TR9A 5MEOB 1JCMP 3N3TA 4XZ9A 2P76A 4TXEA 4GKZA 2ATPA 3KPRD 4JM4L 4XVUC 1SXAA 3GMQA 3AWGA 5MHBA 1WD9A 3TBVB 2JKJA 4RAHA 1S2WA 4HYVA 2VZVA 3AOFA 2XUCA 2GITA 1DUYB 1XF4B 4DP5X 2W27A 4A3RA 3P4NA 2HT3C 3AHXA 3VMOA 1F6FB 1K4CB 5CU9A 4OGXL 3DUSB 4XNQB 1JXJA 1L7IH 3L3HB 5E7FA 1C5DA 4K3DL 4AZ5A 2PWUA 1XW8A 4AIXA 1NDTA 3N3EA 2XETA 4C55A 1DLHA 1VFBB 5LGZA 5K39B 3C52A 3Q8EA 3TASA 1GYLA 4OZIB 3CM4A 2A4CA 3NDZA 4PJIB 2VD9A 3LHPH 2PA6A 4OZOA 3ZO9A 3FCSB 4NHCH 3MKVA 3CS2A 1S5HA 1FO0A 4EANA 4UFJA 4EI5D 1EJWC 2CR3A 2HUHA 2QCGA 4XCNB 3V9FA 2FATL 5IBTL 4DJEC 2WXJA 3M5ZA 1AHKA 1E27A 2VURA 2DW6A 3V0SA 2E5EA 3P62A 2QUVA 4NQSB 5EO1A 3PZIA 2EADA 3P5ZA 2V0TA 4UTHA 5B7YA 3JWNH 1IGML 4I1RA 4BRJA 4HYTB 1L9TA 3N43B 1XR9B 4ZRGA 2XWCA 2IOOA 3FOLB 1INEL 2F0CA 4J6RL 3G5VA 3QZBA 5DUPL 1F3JB 4NZ4A 3NFPB 4FLOA 5DEFA 3GVQA 1G1OA 2PWFA 1HYSC 5E4IA 3M64A 5CNHA 5J13C 1AUSL 3BVNA 3SOBL 3O2WL 2XINA 1CDHA 1GPOH 1OGBA 3TWCL 4P9HC 4IBYA 1MDAA 5FCUL 2INZA 4WI0A 4MG4A 1ZMYA 3KJ4C 2BWQA 8RUCA 3D05A 3IDYC 1QWKA 4WY7L 5GRYA 1XSKA 1C93A 5F6HI 4CC4C 2AJYH 3NSDA 1Z48A 3PSVA 2HN7B 1PKQB 4AQAA 3QZWG 3LZ3A 3KOWA 5H8PA 4C6FA 5I3KA 3FJNA 3ZXWA 3FIGA 3N1QC 5BVPH 4HNTA 3L3GB 3CXDL 2XPYA 3TJEL 3KNBA 2VR6A 3WN5B 2XJLA 4OCMC 3GXFA 3NTYA 1TE1A 3M17B 3EGSB 1B4JH 4AGMA 2DV6A 3DHMA 3VIIA 2XY2A 4HJFA 4HGXA 3AQXA 2REQA 2X4PB 2HFEA 3QDGB 3SN1A 2VLMD 3RWEB 4Y8DC 2DSKA 4UTUA 4NKDB 1W1B1 2HKAA 3BW3A 4BJHA 5ID1A 4MXQC 2CZ5A 1J18A 3ULUL 3Q67A 2XA8H 3TT1H 4MBRA 4OAWB 4MAYD 1T1ZA 4GUJA 3V5DA 1AG0A 4F0KA 2CU9A 4WDIA 3QC3A 1WBXA 1F2QA 4PPTA 3ASWA 4HETA 1TJIL 3LIZA 4YBQC 4LCRA 4XN8A 1UUMA 3KPSA 3T4YB 5EORH 4XN2A 3HO8A 3PBUA 3M0LA 1IU1A 4B95C 1EJTC 3WFEL 1LRNA 1QI0A 3FT0A 3VGHA 5LXGL 1EO7A 4A8LA 2HZGA 2ATMA 4POUB 3QEUB 1WFTA 4HP5A 1B0RA 3TYUA 3CQFA 4R27A 2IBZX 4C6QA 4HCGA 1MEXL 3AREC 4ACYA 4JHMA 4HAFA 3C60B 4WY0A 4UZSA 1MZHA 1LG2A 2CDFB 4DYKA 1AHWB 3B8DA 3BSZL 3AIQA 1QSED 1P7QA 5DR5H 3ARDA 4P04A 3FT2B 4F9DA 4O02L 3UPWA 2KZ1B 1G4EA 1FGNH 1RLBA 4JRYB 4U4IA 1F00I 1AR1C 1KW1A 3TNNA 1PGRB 5DJ0B 3UVIA 3LAFA 4CLMA 3ZO0A 4RDQF 3WLWC 4LAMA 8CGTA 4CC1A 4AYSA 3PIQB 3U4AA 1M3UA 3MSGA 3R2GA 1RV8A 4WWKC 3Q06A 4Q9QH 2GIXA 2ZCHL 4M6QA 5IB1A 4AYMC 1X7TA 3W1PA 2VX7A 2WZPA 5FYLL 3BPCA 4R5TA 3Q58A 3TBSB 3GVRA 2BBFA 3TQPA 1JRCA 2APFA 4GVGA 3TEXA 2UZIL 4Z7VA 4L0YA 1XGPA 4F8LA 2IH3A 4E41D 3GXNA 3DJSA 5GZND 4XTRC 1A9BA 3RWFA 1JCYA 4R4FH 1DUZA 3C9NB 5EG6C 3GO2A 1LT8A 2VFGA 4ZPTA 4P2QA 4NENB 5JW4Q 1POJA 1QFWI 3ECUA 2RHGA 5M03A 3MRKB 3KWSA 5C09A 3MJ8B 3F4NA 1OYAA 1IC7H 4OB5H 4BCEA 3FFCD 2R82A 2TRSA 3W53A 1JV2A 2WUBL 4FX5A 2KQNA 5HHNB 2WWDA 5DJZB 1ZBWA 1A5LC 3THUA 2R8SH 1BD0A 3OYXA 2BVEA 3CFEB 3PXJA 5DZPA 1CXFA 4HH9A 3OQ3B 5AZEL 2R0KH 3P4OB 1T5WA 3QCTL 4YEEA 1DBJL 2P28B 1R9ZA 4K07A 3ZE1E 1A6AB 1KTKE 3WBXA 1Q5MA 3ZS4A 1NBCA 4QEGA 1KGCE 2RDXA 4KIEA 3LH8A 3WLOA 5AYZA 2P52A 2V9QA 4JO3H 4ZGYA 3TYCA 5IJCC 3PUOA 3T04D 4HN4A 4R83A 1KBVA 1Q6GA 3BOXA 1HJWA 3U9UA 3BUPA 3JZ7A 2PP3A 4DEUA 2NY2C 2WVTA 4FPSA 3AXMA 2CIIB 3MJGX 2ZUWA 3QQNA 2PRHA 2LR4A 4AYFA 1N12A 4PJDE 4YTRA 1DQJA 4G59C 1LOSA 4PGBB 4B0MB 4GX9A 1BZ8A 3VI4E 3TTSA 3BCJA 1VGKB 1TNNA 5ANHA 5G2WA 1J5CA 1KC7A 2R51A 4PWEA 1ZWIB 5IG7B 3LQLA 4L5FL 3BW4A 1INDL 4DTGL 1VSCA 1KFLA 3IJQA 2IALB 1P1VA 1I7UB 2BOBB 3MI3A 1OAKH 2FIQA 3E0FA 5FAAA 1D9KA 4E4UA 3UY8A 3VXUA 5I00A 1IXQA 2YWYA 4AL8C 3NL5A 1LMKA 2B81A 3NIDB 3P3BA 1AZUA 3SZ6A 5IIEA 1N0LA 4HW6A 1H3VA 3OWEA 4M7LH 3VFOB 5CSZB 5LA1A 4R7OA 3SKNB 4HJTA 4DP8X 1UT1A 4R34A 4N2HA 4FP1A 2Z7WA 3N42F 3QIUA 1FCCA 2QDHA 2PPEA 4DPCX 1KXVA 3OC8A 5DRXA 2C3XA 3WD5L 2D4DA 4PV9A 4UTCA 2A6DA 4ZMWA 3AC0A 4UV4H 4JM2D 3ARBB 3QJZA 3VIHA 4O17A 6XIMA 1IR1A 2C1PB 2CLZB 3BZ4B 1C3FA 1KLFA 3C12A 5BW7C 2XQYA 3RF9A 4PGCA 1OCZB 2WWKO 3WEXB 4KDTC 3V7AE 1C29A 4F37F 1FP8A 4B6ZA 4QXUL 1N6UA 2WINB 1DTNA 1RZ7H 5HXMA 2WSPA 4N8PA 2I25N 2NUPB 1X5IA 3UJTL 2CHNA 1E43A 1JFQL 2BS8A 5AAMA 2JEPA 3D5OF 2IH1A 3ZT7A 2CKBA 4DGYL 4X61A 1AJ0A 4KZCA 1T2QH 4C83A 3UAEA 4YS4A 4OGYH 4NJAL 1JWMA 1M9SA 1TTUA 3HBGA 3AQYA 1KQZA 3NQ8A 3C8KB 2HVNA 3LMYA 3VIJA 3LBMA 3LM7A 2K6WA 1HP5A 3L1GA 1I8IA 3CO4A 1TUXA 1QRKA 4JTAA 1XIDA 1PMYA 3BUYB 4GB9A 3CMOL 5D70L 1JPSH 1WX0A 1LYXA 4CN4A 1GEQA 4UZGA 3W3OA 4BQ6A 2YQ3A 1UWGH 1ICPA 1JV5A 5K9OB 3QJHB 2V8MA 3E9TA 1I1XA 1V10A 4M6ML 3NA8A 4IHCA 3EJQA 1OHLA 3L9RB 1HP4A 3ORJA 4RV3A 2ABAA 4AHOA 2CCWA 1M6OA 5IEHB 2YN5A 5J6GA 5TQ0L 4KPLA 2X4OB 3O8XB 3TEZA 3N42B 2PDFA 4D0CA 1N10A 4NYLA 4M6NH 3MI2A 3TA3D 4DQWA 4L6DA 1NMBH 4F7PA 3H53A 5HPMB 3VQ1C 4N0CD 4FMVA 4NXSA 1ZTVA 4O1CA 1HCFX 4RMBA 4LBUA 2OBGA 2CG9X 1N6QH 1A2YA 1V6VA 5MF5A 4PQXA 4NQDA 5EOQH 3VU1A 4G8GE 3CFDB 3IWUA 5AYYA 4D1JA 4AH2A 4JG1L 4TRPL 5EH1A 4ENED 4JR9H 3BIAX 3FT1A 4RRPG 5MKGB 3F5WB 1V27A 1OF2B 2QPEB 3NSJA 5DUJA 4YHMH 4BXVA 3IVSA 5EMKA 3LEYH 2DU2A 4OFIA 3NG3A 3S7GA 5KANI 4JQIL 1A7OL 1CB4A 1JJUA 3P30L 1TTFA 1KGUA 4J5NA 2DSWA 2B2XH 4H8VA 1OD0A 4RWHA 1R2RA 2ZXBA 4DBDA 3UTZA 3TO2A 3QYSA 1MCWW 3F7YA 5C86A 5C0AD 1BAFH 3SURA 3A67H 3W9ZA 3EWUA 3G08B 4FTDA 5FFLA 4FF5A 2R0LH 4WFGD 4UNLA 4W9EC 3BLLA 1NL0L 4K8RH 2AK4D 1ESWA 2YLKA 2HKFH 2YBGA 2NNRA 2D23A 5MENB 4UQ3B 3RJQB 5HQEA 3GD6A 2XXCB 4OT1H 3SCVA 5LWYH 3LOTA 1RIVL 1SM3H 5KOVC 2G96A 1SR9A 4FLQA 2NLJB 2YLAA 4H1LB 2I26N 2Q10A 1I8KA 2A4EA 5A6IA 1T41A 3SADA 2C71A 3LPGA 1AI1L 4ABWA 4I85A 5D96C 3ES6A 2LLEA 4ODSL 3VJ6A 1XMWA 3CHOA 2QJIA 3M7FB 3QEQD 3ZQWA 4N2OA 3MU3A 4PBFA 4U1MB 4PJ8B 2BSSB 1IBGH 3TJHD 1Z1WA 4C4UA 1EXUB 1F58L 2VZ3A 4IRJC 3BLOA 4LYQA 2XA3A 3PNRB 4AG0A 2WLLA 3WNNA 1LO5B 3D25B 3KDMA 2BWGA 3NPVA 1QYGH 1RUPL 2EEXA 4LSRL 5DD5H 3BKCH 4TQIA 3BDBA 4ACPA 3B2UD 4KY2A 3V1HA 3O3RA 1B3JA 4ORGB 5I30H 4L8BA 1NCJA 2CBIA 5TDPA 1NCGA 2WPGA 2VR7A 1NKOA 3U4FA 1VB9A 4FQXB 1TQBC 5HI3D 1QWHA 2P1FA 4WFEE 3H8AA 1QBMH 4OQTL 5IMKB 1DE5A 3WXVL 1CDBA 3GT6A 2VDRH 1RPUA 5CPOA 1S7RB 5DZVA 2XV6B 2F2KA 5KYUB 2VXTH 4KRUA 2Q8AL 1M2VA 4HJ0D 2DPKA 3BXWA 1JI2A 3GYEA 1DDHB 5J11B 5KSVB 4Y89A 5BMFH 4IU3B 1WPCA 2Z3FA 2YGYA 3KLLA 4AEIH 3CL8A 3HTWA 1L3NA 1G7QA 3PWJB 1MCBA 1B9KA 1E72M 4FXGC 3UZYA 3CU7A 3LRGA 3KE0A 2GWNA 4XZIA 1A9EB 2NWRA 4EE9A 2I7OA 5GS1A 4RGOL 5CD3A 1I1FB 3HAEH 2Y7FA 4NUJB 3WD2A 2NY3C 3WF2A 4WJG3 4N1EA 1ED3A 2GSEA 2QVTA 4AD2A 2FYYA 4MZ8A 2E6FA 4UDTB 3AZSA 4P3CH 1IAKB 2H8PA 3WFDH 3T0EC 1IEHA 3W87A 3CUPA 4F9LC 1C5CH 4TUOB 2BOGX 1XKJA 4XN9A 4O1EA 2AF2A 1KB9J 5IT2L 4BXSV 1GOXA 1L0YA 2DFAA 4UFMA 3T09A 1QLRB 3LPPA 5D7JD 1NM4A 1VRXA 1J8KA 1J86A 1MSPA 3HFFA 5JDSA 1PYWB 1B3XA 1QRNE 4J3SA 4V33A 4AQ1A 1OV8A 1AH3A 1ADQL 3MX0B 5JXAL 2I9TB 4ZG1A 4ENZA 3UO1H 1H62A 3CMGA 1WAUA 4NNCA 5JBDA 4NQUA 3N0AA 3GKAA 3C2FA 2CIKB 3I02A 1CBGA 3MNWA 1EUAA 1K7XA 2HVKB 4YN5A 5ESQB 3UTPE 3LDBB 3EYUH 3MJ9L 1GKOA 1R87A 4DGWC 2X4TA 2J3SA 3H70A 1T6MA 2PE4A 3SDDC 2ADFL 1M4KA 2VM9A 1E9YB 3QRHA 3TC3A 1MFMA 1YEHL 1ISZA 4NU7A 5G1YA 4X8XA 4DQOH 1A6WH 3RFZB 2OMZB 3NPSC 2JIXB 4G5ZH 1TWDA 3BOFA 1EBAA 1Q13A 1K7FA 4Y4KA 2BCKB 1N2VA 1E55A 5KYYA 3VXRB 1WA1X 3DMMC 4CNIA 1QSVA 3CXFA 4XWGH 3GMMA 1QNPA 1U91B 3EWWA 4PD4K 1F74A 2J7CA 4K5PA 3W86A 2O55A 1ZJAA 3NCMA 1DJHA 5FESA 4JN1L 4B2DA 1GVIA 4FKEA 4XWUA 1A3RL 3H4WA 3W28A 4RFNB 3G1SA 3G3DA 4JPGA 1IEAA 4UUJA 1KFAL 4HSHA 1UCWA 2NUWA 4M0XA 2GC4C 5FGBA 3ZFHA 1N0XH 2ESVE 3Q1EA 4X9GA 4AEEA 2EDMA 1CG9B 2QSTA 2W88A 4Q7NA 3BP4B 1U3HD 5SWQA 1FG2A 4M4RB 5FPIA 4QHNA 4PJEB 4L1BA 1G7IA 1TJHL 3MLRH 3DETC 5AKVA 2K7PA 5D9MA 2WUCH 3PFUA 4BR1A 3QUYB 3WLBB 3CZGA 1ETZA 4ODXB 1AY1L 1UOLA 3UBGA 5JDJA 1S7SA 3I4KA 2QUMA 1NGYA 5CIPA 2MTAA 1B6UA 4ONHA 3MA8A 5F7KC 3ATEA 3WLMA 1DVFB 1Q90A 3UJSA 3ZUNC 4E2VA 4XX5A 3QPQC 1XLKA 4O1DA 1VPYA 5DS8B 3BLEA 1BBJB 5M94B 3UPRA 3GMLA 2P48B 4DAIA 4JTRA 4PTTA 3RTQB 4OZHB 4U4MA 4PHZA 3Q1SH 2C3VA 5AAPA 4HFWB 3CAKA 5ECJE 4S3BA 4UYPA 3WCZA 2JKRM 1H5BA 3O2DL 3IU3A 3BJFA 4B90A 3GSNL 2R23A 1J96A 4ZUWA 2X9XA 3VFRB 1ZUAX 3NSCA 4PP1C 3W11C 2VP8A 5MEOA 4OLYL 1UQZA 4ICXA 3SN4A 1JYVA 2H26A 4Z6AT 1KEMH 4YVXA 3TBVA 1BIIB 2P3EA 1LTXA 3P02A 3ZX1A 1DUYA 3MLTB 3W6MA 2DSVA 2OB3A 2I60L 4N3TA 1K4CA 2MJWA 4RRPA 1R3VA 4XNQA 4XMTA 2EPKX 1DOSA 3VTAA 2Y2WA 3L3HA 1N82A 4URIA 3KLAA 2PC8A 2OWXA 1G7PB 3QDJB 4HIHA 3E3QC 2JJVA 1VFBA 2CBPA 3MQTA 4MAUH 1UH3A 3F7LA 4J39A 2PLJA 1EUUA 1ZSXA 3LD8B 4P9HL 5AC5A 4JYEA 2O6FA 4I77H 3LEVL 3VG0L 4PJIA 1DN0A 3VI3F 4NQ1A 5ESAB 1RZMA 3GS0A 1GOWA 2MQGA 3T40A 4KCUA 5B3SB 5DCDA 1KBWA 2NYYC 4I18B 5BW6A 3WTWA 3EWYA 4EACA 1JGDB 2FGBA 4JIHA 3T3PF 3TPUB 2Q0ZX 4XCNA 3EW3B 1AANA 3W7LA 1IB5A 3MB9A 3TBWA 2W92A 1W72H 4LKCB 3WKZA 3DBNA 3D6NA 4OVXA 4NQSA 4NZUH 4B9FA 4G6ML 5EC1B 1QOQA 5A8NA 3B8UA 4JDTL 1JVKA 1PSKH 5TQ2H 4YFLI 3IMTA 5G1MA 2E68A 2PO6B 4UR9A 3PG2A 4Z7IA 1XR9A 4PWJA 3MGOB 1JPMA 3KZPA 2VQUA 3FK3A 1FLTX 5D7LB 4HUNB 2O9PA 4XB8A 1RK1A 4YIWA 4Y5XA 1S4IA 3E74A 4M29A 2R27A 2QVNA 4UTTC 1MG2C 2LT9A 3VU2A 1S7UB 2I85A 1I2QA 1UC5A 2W9MA 1XYBA 3I85A 2X40A 3K2KA 4JX6A 4L9XA 2G60L 4YN3A 4OLWH 3FGCB 3OXRA 4PBVC 2HN7A 3MO1B 5BZXA 3AROA 4DGIL 3MLPA 1EHLL 1V7NH 3NCYP 1TZHB 3KBHE 1U6AH 5LQBH 3AIBA 3VI3B 1H15B 1OZUA 1FFPB 3AYVA 5C2BL 4ES4A 2FDMA 2RR3A 3OJ2C 5EA0H 2DSZA 3H42H 3J2PA 3HCVB 3WN5A 1U3JA 5CJOL 4MDOA 4BWTA 5KYNA 4QG8A 3LZNA 1PE1A 2PUQT 1V54B 3M17A 3EGSA 3E2QA 1IJ9A 3ZL4H 3T3PB 1CICB 3AMGA 3MV9D 3TYGL 1T03L 2ZJSL 3U25A 2OCCB 4GSUA 3QFGA 2ZTJA 1MFCH 3NZHH 4PUWA 2X4PA 1UYWL 1R3JB 4P59L 4UT6A 3RWEA 5JZ7D 5CZJA 2Y5SA 3MR9B 2OOFA 4RMRA 1B4EA 3WMQA 5LLIC 4D2NA 2EDHA 4NZRH 4QP0A 3VUPA 4JEGB 3U5YA 5KVEH 5HSFA 3U7WL 1BXUA 3UXKA 3PREA 3TL5A 1MCCA 3QZMA 1ZP3A 2NSOA 3W9EB 1ZPLA 5B38G 4GAGH 3OZ9L 2FTWA 1CUOA 3GNPA 2OI9C 4LQFH 3F4WA 3GHUA 2VW4A 3QRFM 1XJBA 3VFTB 3AQUA 1ISXA 1IIHA 3EJSA 1F6LL 5KZDA 1XC4A 4W9FC 1OTTC 2QSCH 1TRDA 4DJFC 2YMOA 2YJLA 3QEUA 4AYID 1U8JA 1QI3A 3KM2A 4F4RA 1KTCA 2PFHA 1W1YA 1Z6JT 1XDTT 4BI7A 4PG2C 5DJ8B 1RK5A 3TN5A 4C6MA 3GXIA 3OAUL 5DK0B 2ZF8A 2YD9A 2DT3A 3C60A 2VVSA 2IBZY 3ENLA 1AHWA 4L3EB 4LUIA 3PBVA 4MRCA 1X6NA 3WNPA 1Z7JA 4LSTH 3B4NA 2XVKA 3S6TA 3FT2A 5IFJA 2Y6SC 4JRYA 5JHLA 4AK1A 2DQWA 2B20A 3RUBL 2VLRD 3N9KA 1Q72H 1GK8A 3MLXH 1J0JA 2FLBT 5DJ0A 4LF3B 5T1MB 3TWYA 5DHYB 5IFAH 3EDFA 3L81A 3ML8A 3NTCH 4CD6A 3W3BA 4HZ1A 3JTSB 4PYSA 2IIJA 4QJ5B 3VD5A 2J5WA 3ELAT 2OW6A 2VKWA 4EVZA 3C6SA 5EZIH 3U9PH 5AQ0A 5HQMA 1VBHA 5TK2A 3TBSA 3MBEB 2PCQA 1ADDA 1CDJA 2A74B 5C54A 5F1UA 1Q38A 4OLZH 2OSXA 2X2JA 4W6YB 1J8VA 3HPFA 5I1KL 2CBJA 3RI5K 2VZSA 4BH7A 4BSWB 1KM2A 1OAQH 3RIAF 2GC7C 3C6LC 2J66A 2QQLL 3BL3A 4NENA 3DOSA 4XP9H 4MSWB 3MJ8A 4AX3A 3A6CL 1A3LL 5XIMA 2X6AA 4UCFA 5AFDA 1JK8B 1I45A 4FFTA 1C5BH 2J43A 2GQ8A 1HQ4B 4OJDH 3HNVL 4OJFL 4DPRA 3GO1L 1A0EA 4Z3IA 3EFOA 4K94L 2ZUTA 4TSCH 2MCAA 4S1DC 4PVBA 2H0EA 3NH7H 4DO4A 3V0TA 4HXBL 1QTSA 2GOUA 1UKSA 4QRPE 1XAKA 2E3ZA 5H35B 1U8CB 4KCTA 5M3WA 3P4OA 4RNFA 4Q8BA 2VDNL 4RGNC 4F0LA 2VZ1A 2IBBA 1HU8A 3LHVA 4G71B 3S37L 1NCTA 5GRJH 1A6AA 1QBLH 4H8UA 5BCAA 4AL8L 4JN8A 3T71A 1W9XA 1FUNA 4EKJA 4XVSH 2P8PB 3LGGA 3X13B 1MHHB 5ABDE 2QMKA 3CWOX 4L7ZA 2E46A 4CBZA 5E9AA 5DWUH 2VJ0A 3GB7A 4X83A 4XBPB 5DHMC 3S9ZA 5ABFA 2ZAHA 4AVHA 1B3YA 3MYJB 1QUPA 2RBLA 1RHFA 4Q4MA 5I1CL 4LQ1A 3E1ZA 1MCPL 2NX3A 2JCCE 3H3BC 5DJYB 1Q7MA 1AE6H 4H1ZA 1P2CB 3MMWA 5D1QE 1CWYA 2JTYA 1BZQK 4PGBA 1IFRA 4MKNA 4Z0XB 5BQ7B 1I85A 1CLKA 5E9XA 1XEDA 2GTZB 1ZNNA 1Q3NA 1VGKA 4CRPA 1QSFA 3ZK0A 2VRJA 5IG7A 3LN4B 2GW5A 1YN6B 4DGUA 2W94A 1M7IB 2A38A 3ENEA 2DQDL 3BJLA 1I7UA 5CBEB 2BOBA 1QABA 1GJUA 2Y1YA 3AI0A 1I2PA 1TJ2A 1IXPA 4AIUA 8XIAA 2HDJA 5DFTA 4AQ8A 5CP7A 5DUML 2P5WD 4N0YL 2FNBA 1BEYL 1XFPA 2TRYA 4FYRA 4WSJA 4Q8WA 3WZ0E 3VFOA 1MRFL 5CSZA 5EZLB 3SGUA 4KK8C 3SKNA 4MMWA 1E5JA 2PGRA 2HSAA 4WO0A 3ZW3A 2MNWA 3UJIH 2WMIB 1UR4A 4XXCA 1IAII 3PZGA 3CH9A 3W7NA 4Q4PA 3D46A 4EBQL 2IC2A 1JCTA 3QEGH 4I9WD 2IKGA 1I1YB 2Q8BL 1RD5A 5L6YH 3H6OA 4CNTA 4TTDD 1TFVA 2F53B 1RFDH 1MKFA 4ORZC 4RX4D 3S3CB 1DQDH 3LPOA 3VIOA 4NCC2 3ARTA 2C1PA 4GGBA 2CLZA 3BZ4A 1V6YA 2PUZA 3UGRA 4QEEA 1VDGA 4QXVA 5ADPH 5KVFE 3EFDL 4AUBA 3WEXA 4P9ML 4YFLF 2EC9T 3W7RA 4O00A 1D8WA 3QIWB 3W2LA 2WINA 3DSNA 4O18A 3RY6A 2NUPA 4W9HC 1O6VA 2W9DL 4DEPB 4ETYA 3TX4A 1XO8A 4JKMA 3G7TA 3FONB 3EYQD 3B8TA 3VFSB 4FLSA 3P0VH 4Q8MA 5C3LD 1KBJA 3FSTA 3C8KA 4Z76B 3D85D 4Z42C 1W8NA 1N55A 4IT1A 3V2AR 2VLLB 3WFLA 1MJJA 4D6JA 2TSAA 4DVBA 3BUYA 3GC4A 4IIEA 3OKOA 1ITUA 3FRPB 3U1QA 3NJJA 4FFYH 1ZCOA 2ZZUT 1VFMA 2F08A 1MAJA 3PXLA 3QIBD 4PTUB 3L9RA 2HB0A 2WCSA 2ADJB 1C12A 4HUUB 4M1RA 3IMVA 1KWGA 1E6RA 4PJGE 4R3UA 3RNQB 4U3SB 5D37A 3RKDC 12E8H 3O8XA 4PJHA 5IQOA 5JUEL 4I0PA 4QTFA 4UB0H 1GOOA 2IPTL 1F4YL 3TMLA 5T33L 1IL1B 2AEQH 4KRPC 4U1GC 3WO4B 2WQ8A 1A7RL 4JFDD 4IOSA 4J3BA 5H94B 4HZMA 1EZUA 3TJXA 3PTKA 4Q3MA 2BVUA 1XGTB 3D4GA 2EDXA 3CFDA 3D9AH 5DXWA 5F8QC 3N85H 2NX5D 1L7TH 4D3CL 4C47A 5MKGA 1C1EH 1HKWA 4IMLA 1ZEAH 1LBMA 1PY4A 1ZANH 5IEKA 2ZC8A 4KZDH 3HG1A 2OM5A 1N3NB 4U7MA 1LM8V 1QUMA 1EDTA 1DQUA 2E7FA 2DD8H 2J2ZA 3DVFA 3TV3L 3AO0A 2P3ZA 3W1NA 1E6QM 1L2UA 3K2GA 5CKAA 5E6IC 2L0DA 3L3KB 3SB0A 4PE8A 2DQHH 1VYPX 3TVMB 3PUGA 4NNXB 2CRYA 3C5ZC 2A6JA 1Y5WA 4HUXB 5J5DA 3S1XA 4TQPA 5HI5C 1X5HA 1KY6A 3CFIC 5DJDA 1W9VA 2HFTA 3I68A 1HJXA 4P23A 1V79A 4BWUA 5C0CB 4E0CA 4GSQA 4E36A 3EFFA 2VDPH 4GNKB 1AO7B 2XWRA 5FACA 5MENA 4UQ3A 4GUIA 5CJQH 2NLJA 5IESL 3SDXF 1RR2A 4H1LA 1B2WH 4NKQB 2O0TA 4PMEA 3LLDA 2MKWA 3TSMA 1KG0B 2JIWA 3K0YA 2LW3A 3XIMA 1B0IA 1FYTD 4HS3B 3V5KB 2BX7A 2O61A 3FOKA 2HBXA 2H3NA 2ZOTA 4WKAA 4LEBA 1YE4A 4U1MA 5EO0B 2BSSA 4PMYA 3BVTA 3UVAA 4WI3A 2LV4A 1DEDA 2VERA 2ZA1A 3CLWA 4OTKA 1UKOA 3SO5A 3EDJA 4PB9H 4MZ2A 1RJZB 5I6XB 2IW0A 3D25A 4O19A 4O4VA 3W9DB 1XXXA 4BKLB 4XI5C 1YXDA 3DX6B 3ILQC 2XPGB 3HZYA 2XQYG 2L7JA 1E70M 4FI4A 3GJFB 3SCMD 5C0DB 3US9A 3P61A 4IFKB 3EXTA 3BYTA 3B03A 3V9CA 1FWAC 1R5IB 4UT9L 3UXDA 2OQJB 1MCKA 3FJ6A 3S97C 2BZCA 5E0QA 2QJDA 1L5GA 1IJNA 3KXFE 4FQXA 2COVD 3G6DL 4XWOD 4JW3A 1MAML 2RFGA 4I3GA 4GG9A 3DJRA 7TAAA 1CBJA 5H2BB 2O5ZL 1S7RA 1GZQB 5KYUA 4XP1L 4DKDC 3FB6B 5EFIA 3GSUA 2P49B 2CLVB 1OY3B 3N6QA 5DT7A 4JQ1A 2NUTB 4KFZC 2IAND 2YAHA 4PWGA 4U05A 2R1WB 1DDHA 5KSVA 2VFEA 4Y90A 5D7HA 4IU3A 3F1QA 4Y5YB 3SDXB 4M1DL 3T1GA 1GCFA 4IDLA 3PWJA 4NC1E 4GP8B 4WXYA 5AEAA 4DNMA 2QW5A 4PMDA 4P4KC 2GGGA 1CYXA 4PIBA 1YAZA 3VXME 1MJ7H 1AP2A 3TEUA 4LPVA 4JZJA 4YHNB 3FZUD 2IMMA 4ABVA 2D4FA 3AT0A 4OH2A 3FDGA 4NUJA 3OR7A 1UWEH 1XYCA 1EAQA 3VPLA 4HJJH 3NACH 3SPVB 1HVXA 1WEJL 1MI3A 2Z24A 4QCEA 3TC9A 4TUOA 4HV8B 3THDA 1E73M 3GIZL 4M48L 3WIHA 5C9WA 1CO1A 1QLRA 1H5YA 4IQJA 3G1AA 5I24A 1PYWA 4OCYL 5BS0B 1NCWH 4UNVA 4LGPB 2OLHA 4KMTL 5GXBB 1XF1A 2WWNA 2DQJH 3QPYA 3CHEA 3MX0A 2I9TA 4G6AD 3QCUL 4M6PA 2FZ3A 4HBCH 4KOCA 4PL1A 1RUKH 5FIEA 4CBPA 4KTYA 2CIKA 2B15A 4JE4B 2A79A 1HO4A 3NIGE 2HVKA 5ESQA 4U1NA 2WMGA 3VE0A 1TA3B 3PUDA 5HJXA 4DP0X 4MQSB 2XC8A 1R3IL 4Y7EA 3GR7A 2L04A 3DSFL 3G3LA 3KBWA 4MMYB 1WISA 1P4BH 1YNTF 1OAYL 3QOMA 5DT1L 4CNPA 1S9WA 2V5CA 4L4VE 1TIUA 2JIXA 3EJZD 5EZOL 4WU7A 1OARL 2BCKA 3GMOA 1TENA 5GGTA 3VK5A 3ANYA 4GIOA 5IJVB 1VGAA 2I17A 3B7SA 5I76B 4XPHH 4X6DE 4ZS6C 3VXRA 1QUNB 1OE3A 5CZ0A 4B0MM 2AGKA 3MMEB 4JL1A 3OTTA 3B9VA 3QWRD 4U7SA 2A3HA 3WLJA 4J1OA 2P5EB 1AS7A 3WG7B 5FB8B 3QV8A 4U6VH 2RH9A 3UXLA 2ZXAA 4D9RE 2HVOA 2X30A 2YDQA 2CK0H 1AL7A 4IKKA 2XBTA 1IE7C 4A29A 4MDIA 2V38A 3FQ4A 1UXMA 2SODB 3LI0A 4F0RA 3NZQA 4PJBF 1J0KA 1V0NA 4CL7A 3DZ1A 5E09A 1CG9A 3MLSL 5KZCB 3BP4A 1WFOA 2AVGA 4XBGB 1ITQA 2CHRA 3S34H 2GGEA 1EMTH 3IUDA 2I7GA 5U4NA 3ESOA 4P2RB 3S47A 2W0PA 3PL6C 5B3JE 1YN7B 3WLBA 2DZUA 4ODXA 1S5MA 1G6RA 1MFBH 3ULUE 2MEJB 3EJJX 3JZYA 1J7VR 4H7ZA 2VXVL 1CLVA 2WO4A 3TESA 1OEPA 3WHE0 4KERA 3TEYA 4IPNB 1YNTB 3HG3A 1FA4A 5GJPA 2GJ6D 5C6TH 3POCA 2EKGA 1XIEA 1XBVA 1FNSL 4YO0B 3M7SA 1QT1A 3FKKA 5G4NA 1BBJA 4G1KA 1EX5A 4L8CB 3LEPA 1OFEA 1KV8A 1OIFA 2Z28A 1I7TA 1B1YA 4CKQA 4MB1A 3RTQA 4LCWD 4XHQA 3SD5A 1OFRA 4QOKB 3K6IA 2D24A 1DQWA 4A7UA 1EJXC 3GMRB 5BO0D 3NIDF 4M1CC 4CDGC 4LASH 3VFRA 1E3XA 4L1TA 1MIMH 2HKHH 3F7PC 4LLDB 1P4LB 1RZKH 3FLUA 4QPEA 4OU3A 2OMVB 4JNXA 1CC3A 1CWVA 5B4MD 2J77A 1JHLL 3T1FB 2Z1XA 1PZBA 1EXGA 3MLTA 4H0GA 1MFUA 1S9VA 1ME8A 3HC2A 3KDPB 5EIIB 3C2AL 4S11A 3ITCA 2JJSC 1QK2A 3MLZH 2OULB 1GOFA 4PJBB 5E24E 3I6LE 5HYSB 1OQFA 2G4JA 1GGYA 3SBPA 2CGZA 2DM7A 1AG1O 5IROA 1YQVH 3G1FA 4NQTA 3ORWA 3KAOA 3REVB 3WG6A 4LVHB 4HWBH 3LTSA 4LVFA 1HH9B 1NUDA 5ESAA 3U2OA 4OBSA 4LSPH 3KVMA 3MCMA 2QCLA 4YE0A 3PB2A 1P6AB 4I18A 3NG5A 4WUUB 4M61B 3QUXC 4R7NA 2Q02A 1HCVA 3EKCA 1YG9A 3PQYD 2WNQA 3O4OB 1JGDA 2B1HL 3TPUA 4OTXH 3URBA 5DQDL 4NRYB 3IWPA 5DU7A 3TW6A 2YEZB 4LKCA 4DXXA 1CE1H 1I3RA 3UX9B 3YPIA 2UY6B 5LIXX 4NO5B 4B5EA 2JKPA 2PO6A 3M7WA 2KMWA 4B9PA 5F2LA 2JK5B 4H4IA 4C54A 4JTJA 3F5LA 5TK4A 1ZLUH 1MUWA 3MO7A 5D7LA 3X3GH 2XSXA 1DBBL 1MIEL 1XAUA 4K8RD 2FGZA 1NY1A 3CSFA 3HF3A 1JHTA 4CD8A 3MRCB 3GNNA 4LANA 2WQUA 2XV2A 1SO3A 1W2KT 1S7UA 4I2XE 3U9WA 1KM5A 1KCZA 3O9WD 4X7SL 2VC2H 2BSEA 4NCDA 4I4WA 1A3QA 5ABEA 4KVPA 4ACZA 1GEHA 3WQ6A 5ABHA 5IMMA 4LU5L 1B4RA 4GSDL 5FXCH 2H1XA 3OTRA 5LBGA 3QYMA 3FGCA 3VKKA 2N3JA 4J3OF 5TDNB 1U5VA 3AADB 4H04A 2RH0A 4FG6D 4ODUB 3MO1A 3N2CA 2O6EA 1TZHA 4ZFOB 2WMFA 3VI3A 2B7QA 4WOQA 2XN9D 4MDRA 5FUOL 1H15A 3QUML 1FFPA 2I16A 1IMHC 5BZDB 3K5XA 4N6EA 3IGSA 4MTMA 3HCVA 4K37A 5ADOL 1SOXA 3BDYL 2J8UF 5EKYA 3UQNA 2B4CC 3KOZA 1CICA 2E7DA 4GCXA 1CK0H 1Y7VA 4Q2ZB 1UR8A 1EO5A 3L2LA 3KFTA 3A6BH 4RWYL 1R3JA 1YEDA 4IMGA 5FI8A 3OYZA 4FDWA 3KP0A 4YQXL 2VEFA 3MR9A 4L5FE 3VW3L 5FJIA 4FSAA 4BK9A 1LK3H 1KRAC 1JCXA 4C91A 1U2HA 2W0UA 4Y9AA 2HXAA 3OBAA 4WO4C 3KTXA 4QCFA 1BWLA 1UCBL 1FO0H 3UTTE 4JDYA 1XBRA 2WXGA 3N91A 1WA0X 3ZTDC 2WCGA 4FF7A 3W9EA 5K2ZA 5LAXB 4YDIL 4QBXA 1RKRA 2X1IA 2BHFA 2FBJH 5DJXB 3VFTA 1WUZA 3OMZA 1ZZMA 2RUSA 2BY1A 1FWDC 5JW4M 4HLZG 2WMHA 4IZGA 4MLJA 3HR6A 2R1YB 3MODL 1EGZA 2AJUH 2NXZD 1M6UA 3U46B 1U4FA 1PHWA 4W4QA 4EDWH 1T0PB 4FJYA 5DK0A 3QCVL 4NZFA 2EE2A 3TV8A 4LUTB 2ZPKL 1K77A 2BHZA 3CH8A 1JFXA 1GGBL 2HVBA 2OELA 5HAOA 4L3EA 4IRSD 4WZ9A 4J3UA 3ZTNH 2Y61A 1W0MA 4R26L 1V3HA 1MI5D 5ANMB 1SN2A 4HPNA 1LK2A 4HOZA 3AXXA 4WFHD 4JRWA 1DJXA 4HWEL 3HPSA 1KN4L 3WNLA 2J8UB 1KXHA 4L56A 4P2OC 2YGQA 5DHYA 1FNEB 3LEXB 5DD3L 1DBAH 3EWBX 4U1IB 4PB0H 1E42A 1T6WA 2ZQKA 4J4PC 1NCBH 4LNRB 1JN6B 2PZ0A 5HD8D 1JGEA 5D4IA 4FTVB 4RESB 4JVUA 1ZIAA 1UZ4A 5EOCL 3G1XA 3W38A 3FYYA 1J10A 4BEUA 5A8GA 2HH0H 2BVQB 1V08A 5A94A 3H24A 3FXYA 4X6CF 1CLZH 1B31A 5IVZB 4DWSA 4BSWA 4XNXL 4PMNA 4JBSA 2XG5A 4B7LA 4UMBA 1D5ZB 4ZUSA 4K3GA 1A25A 1BVLB 5FSEC 3H3PL 1X5YA 2XHNA 3W1RA 4MSWA 3S96A 3HS0A 4AH7A 5KOMC 1XD0A 1F86A 2E3VA 4YGVB 1HQ4A 2RGSA 2XIJA 2BNUB 5H8DA 3L9CA 4A63A 3H9SA 1CXHA 2WXMA 3QSKB 1YMMB 3M47A 1HJUA 1KSRA 3L1EA 5DJ6B 5EEWA 2I07B 1EJ7L 4MWAB 2Z91A 4ADTA 1F8TL 4JREB 4HK3J 3RDJA 4BQ2A 1ICQA 4JFXB 1RULH 3QLDA 4G6JL 3LIZH 1ND0A 1QW9A 5DGQA 4Q8QA 1MZYA 3PFRA 3WLPA 4ICCX 3MWCA 1OD7A 2WBJD 32C2B 4P05A 1DYZA 2CUAA 2OCFD 4MGXA 1R9FA 5GGTH 4LKXB 3X1NA 1AD0B 2RGLA 4R96B 2D7QA 4BH8A 3NR0A 5BOZG 4DP4X 3O07A 2P8PA 1MHHA 4QJ3B 4G3YL 4PWKA 1UURA 1TNMA 4WEEA 2G41A 4DESA 4ONGH 4XBPA 1BZDA 1BEUA 1HINL 2V2WA 1OCJA 2W3ZA 5CEYB 1S78C 2ZTKA 3VGAB 3AAZB 4S3KA 1X96A 5HHOD 2IPGA 3CBWA 4NLAA 3TFXA 3FU9A 5FFGA 4EN3B 1WE5A 2X88A 4X6CB 1M9HA 2VGIA 2ICCA 3QDME 2QVKA 4N0RA 2HTLC 2WOQA 2BB0A 3GUTB 4ZNEE 5DJYA 4DN1A 3F6IA 4GI9A 1ERNA 4GO8A 3QR2A 4Z0XA 2VTFA 4N22A 4XH2A 1ASQA 2GTZA 4HBQA 4W8LA 5B21A 3JRKA 3LN4A 1YEKH 4A1RA 2QADB 3SSZA 1J8HA 4NB7A 2J20A 4IIQC 1FLRL 3TLLA 2GVEA 5CBEA 1F61A 5F9OL 2YXWA 3I75B 3CV5A 4IFOA 2C79A 5DMNA 2O6PA 1H3XA 5DK3A 5FYKL 5C8JB 1FRBA 4S1QH 2BMBA 3QYQA 4KEZA 4M93C 1JNNL 2VXNA 4K5MA 3BISA 1OP4A 1UA6H 2V5BA 1J1OH 1FWWA 3DCPA 4YHIA 4YVUA 5T5FL 1OHZA 3NJIA 4JR5A 4QTGA 3HIJA 1OYCA 4M6UA 4Q89A 3CWGA 1PCXA 1ODZA 3ITGA 2VRQA 2WMIA 5D4JA 3ULVC 2DVUA 3TFKC 2UZYA 3WS6C 1QHOA 3D39E 1EX1A 3HQOA 4IGHA 1M7PA 4H3DA 1IR2A 1A6VL 3EGXB 1I1YA 2ALRA 1HKMA 4UTWA 5M7QA 2K4AA 3F58H 2YPIA 1RL1A 1IM9B 1QI5A 3GK8H 4AENB 5DJ2B 4JJHA 2CHOA 2DRUA 1G9EA 1H4PA 4KI5C 2VL4A 3PWNA 5CAYB 1RA5A 3MXVL 4GG6E 3DKJA 3KG5A 4JRXA 2XN1A 1VJIA 4XP4H 2ZAIA 2VLJE 4JGMA 4AIEA 4PJEF 4YGAB 2AJSH 4ML9A 1KFKA 5K9KB 1GWJA 3QUZB 2FX9H 4X99B 4CQ8A 3FONA 3FUHA 3ZDYE 4QXWA 1TUFA 3VFSA 3V4PL 4Z76A 2RDTA 3GIVB 1P7KB 3S35L 5EU7C 2RJHA 1SBSH 2Y0FA 4CGUB 3GKWL 2PYED 1BBDL 4XXWC 5ECVA 3V4LA 4JFFB 2NZ9D 4P07A 5DJCB 3FRPA 3GSWB 3S5LB 2Z31D 3E0WA 2KQMA 4NQCB 2HRPH 4YS1A 3V52H 2EDTA 2J13A 4JZ5A 4PTUA 3M0IA 4OZHF 3V6OA 4ZI8A 1HKVA 4QUOA 1Q2SA 3PZNA 3BW9B 1G9MC 4PM1A 3K4DA 2ADJA 2H9GB 1ZLVH 4HUUA 4JY6B 5LGYA 3PNUA 2YC1B 3RX5A 4MD0B 4RDVA 4KS0A 5AVSB 1IBHA 2VCCA 1YHTA 2ZG1A 1H7NA 4OF8A 1MSSA 4L4TB 3QQ9C 1IL1A 3ERXA 3IMBA 4Y7OC 4EWJA 4D71A 1NGWB 5BVJA 1ONWA 4QXGL 2F54E 4ORMA 1BJMA 3QG7L 1NANI 4EQ3A 2LFGA 1NCAH 5L88L 2V9TA 3K3QA 1RI8A 3ME3A 2DQIL 3MREA 4KUCF 4DIXA 5F9DC 2H32B 4RDQG 1ZQ5A 4XO8A 2GIYA 3NJNA 4DZ8B 1ISVA 4PGDA 1JDDA 4OV4A 3ZSSA 1XL4A 4N6QA 1O60A 3IIZA 2EZ0D 1BQHB 4JTEA 1LO0L 3KS0J 4P5MB 3CQIA 3M5YA 4IIHA 2PR4L 4CCEA 2FBOJ 2I57A 3UAAA 4EPKA 4A2SA 1YDYA 1MYRA 1FGVH 2F19H 3Q5TA 1S3RA 3FW6A 1OX4A 3LRHA 3BUQA 1J4EA 3L3KA 4F91B 5GGSY 2CKBH 4NNXA 2J75A 2LLLA 2W67A 2ALAA 3FUMA 2WJDA 4B15A 5ICZB 4IG2B 4HUXA 3RG1C 4HS6B 2V4LA 4Y16A 1Q0YL 4C1LA 5IKCB 4UU9A 5C0CA 3E2HC 1KBBA 1MCQA 5CPMA 1N8ZB 1ROCA 1KCXA 1W3JA 1AO7A 4R8WL 1VFOA 3DX1A 3JYCA 4GI6A 4YDZA 3WLLA 4X4ZA 3CHVA 3QV7A 2DTSA 4ODTL 4TPRH 5AKSA 4LDCA 1KG0A 1XF4A 4QRSB 2ZE0A 2FFIA 4L6OA 5KJ4A 3DUSA 3V5KA 3GB6A 4X5XB 5FIPA 3OG3A 5D71H 4WV1B 4RZ6A 5I15L 2KH2B 3M0YA 1EIXA 5K39A 3T6VA 2F7OA 4A7SA 1NWSA 1D7DA 1A4JB 4OZIA 3OLDA 4JPVH 1ZV2A 4XCCL 3JV4B 4A2EA 3FCSA 2XPGA 3LVTA 3GJFA 2CGRH 5C0DA 2PPFA 4A6YL 2BNQD 4NSKB 3KCWA 4OM1H 1ZLUK 3C4UA 1TIMA 1R5IA 4MB3A 2OQJA 2DJ4A 4GBXD 2ZUYA