3ZQ9A

Structure of a paenibacillus polymyxa xyloglucanase from glycoside hydrolase family 44
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
512
structure length
512
Chain Sequence
AKTITIKVDTFKDRKPISPYIYGTNQDLAGDENMAARRLGGNRMTGYNWENNMSNAGSDWQQSSDNYLCSNGGLTQAECEKPGAVTTSFHDQSLKLGTYSLVTLPMAGYVAKDGNGSVQESEAAPSARWNQVVNAKNAPFQLQPDLNDNYVYVDEFVHFLVNKYGTASTKAGVKGYALDNEPALWSHTHPRIHGEKVGAKELVDRSVSLSKAVKAIDAGAEVFGPVLYGFGAYKDLQTAPDWDSVKGNYSWFVDYYLDQMRLSSQVEGKRLLDVFDVHWYPEAMGGGIRITNEVGNDETKKARMQAPRTLWDPTYKEDSWIAQWNSEFLPILPRLKQSVDKYYPGTKLAMTEYSYGGENDISGGIAMTDVLGILGKNDVYMANYWKLKDGVNNYVSAAYKLYRNYDGKNSTFGDTSVSAQTSDIVNSSVHASVTNASDKELHLVVMNKSMDSAFDAQFDLSGAKTYISGKVWGFDKNSSQIKEAAPITQISGNRFTYTVPPLTAYHIVLTTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords XYLOGLUCANASE
publication title Structure and Activity of Paenibacillus Polymyxa Xyloglucanase from Glycoside Hydrolase Family 44.
pubmed doi rcsb
source organism Paenibacillus polymyxa
total genus 184
structure length 512
sequence length 512
ec nomenclature ec 3.2.1.151: Xyloglucan-specific endo-beta-1,4-glucanase.
pdb deposition date 2011-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12891 Glyco_hydro_44 Glycoside hydrolase family 44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3zq9A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3zq9A02
4CGTA 3K8KA 3SCTA 1JYWA 4MNKA 2QHAA 4BQ5A 1DHKA 2CHOA 2J79A 1EO7A 2WSKA 1GOKA 3BLPX 4AD0A 3UERA 3A24A 1W3HA 2YBTA 3AROA 2G8ZA 4W85A 1UOKA 2D3LA 3EJQA 1GZJA 7TAAA 1XH1A 2J4GA 5A6LA 3K46A 4PYSA 4P7RA 4FLOA 4AC1X 1UWSA 5LA2A 1B1YA 3GNPA 1G94A 3W28A 4D6GA 2XGIA 3MMWA 3AIVA 1F4HA 4WSJA 3AHTA 3AIEA 1MQQA 3CH9A 3U5UA 1JGIA 1WCGA 3D50A 3BH4A 1MWOA 4ZFMA 5AYBA 2G3MA 4PSPA 3D3AA 4U3CA 4WK9A 2AOSA 1JZ2A 6TAAA 4ZXOA 4TVUA 1ISVA 4LYQA 2V5CA 1JZ3A 4ACZA 1EDQA 3II1A 4JCLA 3AYSA 4UR9A 2VVNA 1W9BM 1LG1A 4JHZA 1EIBA 1HJQA 2IUZA 1QNRA 3ARQA 2X2YA 5A69A 1JFXA 4EK7A 1B3WA 1M7XA 3ARVA 3ZJ8A 1EQCA 1B31A 2WWDA 2WANA 3RM8A 4CN6A 5C70A 1RPKA 2A3AA 4PMXA 1TUXA 3FAWA 3EMCA 4M81A 3WN6A 5A94A 4AZ5A 4U31A 3EMZA 1I75A 5I79A 1H49A 4C7GA 1KGWA 4CCEA 1PJ9A 5A95A 3D52A 3W26A 3T0BA 1JXJA 1PS3A 1J0ZA 1FH9A 2WVVA 2WW5A 4GZJA 2A3HA 1WDQA 3CHFA 4PMOA 1WDSA 3KL3A 2WKGA 1E40A 5EMYA 2NSXA 1J0IA 4XX6A 4HPHA 3WKZA 3D5HA 3CTTA 3BC9A 3BCDA 4MJ2A 3WL1A 4OIFA 3OGSA 4UQ9A 1LL6A 3PZMA 3TOPA 5A8NA 1NM9A 3ZQ9A 1HTYA 1W9XA 1O7AA 2VI0A 2X1IA 4J3VA 5CSYA 2WHKA 2CHNA 2EABA 4UQBA 3RJXA 5C8BB 4H8UA 3AJ7A 1CXEA 2AAAA 2YL6A 2WMHA 4UFIA 4D6IA 2CBUA 3AMLA 1QBAA 3CGTA 4JZ5A 2V3EA 1FP8A 2WVTA 4PSRA 1MQPA 1VJSA 1Z32X 2X05A 1PX3A 2O9RA 2VVSA 3WMCA 5IHSA 3BLBA 2OWXA 3WDJA 2VZSA 2J7BA 1LWJA 3AIQA 1TQWA 2QF8A 3MANA 5I77A 3EJSA 1HP4A 1PZ2A 3WDRA 1QNQA 3PZIA 1C93A 1KCLA 5GNZA 4CUCA 1UH2A 2F7OA 2VR4A 1ITCA 5JBFA 2TAAA 1JD9A 5E6YA 3NUKA 4W93A 1QI4A 3GBEA 4DUXA 1X6LA 4J3UA 4HMCA 3CHDA 4AYGA 3IJ9A 2WC7A 3VIGA 4H04A 4CU7A 1GQLA 3AZTA 4U5KA 1QW8A 3A4AA 3WEOA 1PIFA 2WZHA 3K4AA 1JDCA 1UHVA 2CERA 2V3DA 4J3XA 3VGGA 4M1RA 1RP9A 1PAMA 2YDQA 4RE2A 4OBSA 1JZ7A 3EYPA 2XTKA 5CJ5A 1CWYA 2ZXQA 5TD4A 1UR4A 3E1F1 3WNMA 4U33A 4F79A 2G3NA 4AIUA 3AXHA 1ISXA 4GZIA 5FKYA 2VZUA 4HOXA 4UOJA 4MNJA 1W91A 5CG0A 3VGHA 2DDXA 1OM0A 2DSZA 3MO4A 2OSYA 1UKQA 5IFPA 1RH9A 2DGAA 1EOKA 2W66A 3VDAA 1QWUA 4FNTA 1E1FA 4HP5A 4MNMA 1UQZA 1UZ1A 3THDA 1CTNA 4C7FA 5BXTA 3DYMA 3QHOA 3CC1A 3VSTA 3AMCA 4F9DA 5HNNA 4HOWA 5CQ1A 3N04A 3RJYA 3EJTA 2CNCA 1C7SA 1BG9A 1GOOA 4N0RA 5CGMA 1MVYA 2QPSA 1V3IA 3AHVA 1CBGA 2XPKA 4PMDA 1E4LA 4CCDA 1QPKA 1HN1A 5JBDA 1J9YA 1QW9A 3DYOA 3WD4A 3WDHA 3AQUA 1WO2A 5AC4A 4JFWA 2W61A 2JE8A 2WMIB 3CZLA 2VRJA 1NOWA 4DWSB 2VC9A 2FHBA 2ZOXA 3BVWA 1JXKA 3THCA 4AYSA 1D2KA 2E8YA 2W63A 1UUQA 1QHOA 2VL4A 3MMDA 1ZL1A 1ZBWA 2GK1A 1FFQA 4B16A 1R33A 1OGSA 3LPFA 4NSBA 3SCNA 1E6QM 5D8WA 3WNLA 1E43A 1KWGA 4YHEA 1GHRA 3F5LA 1ITXA 2EPMX 1UWIA 4TOQA 3WL0A 4Z2HA 1UD4A 3BUPA 3ZJKA 1NP0A 2UY4A 1W9PA 5CPSA 1V3MA 4QLKA 1CXKA 4PRWA 1L0PA 4GI6A 1QI2A 4ACYA 4WF7A 5A6MA 1GPFA 4W89A 1H4PA 3EDEA 3AISA 3GXPA 1BAGA 3VSVA 4MAVA 3MI6A 4R27A 2ZIDA 1RP8A 3A21A 1IT0A 4LYPA 4LX4A 3EDJA 2PWFA 5HDRA 5M5DA 1TQSA 3VIJA 1AMYA 1ISWA 4ML4A 1E5NA 4GQQA 4UQDA 5GQBA 2E40A 1TQVA 4V28A 1A3HA 4P7NA 1TMQA 3OA5A 1GHSA 3BUBA 3PZTA 1MFVA 3W27A 6A3HA 3EMQA 3WF4A 1CEOA 1OD0A 3DC0A 2ZX7A 2D20A 2W62A 3OGVA 3W24A 2EBNA 3QR3A 4M82A 1V3JA 3WH8A 5KZ6A 2CITA 1TG7A 4UOZA 2ZUVA 4AEFA 2Y24A 5HBFA 1B2YA 2A3EA 1E6RA 2ZX9A 3VMNA 3ZR6A 3N9KA 1V0KA 2CYGA 1QNPA 5A8MA 1V6YA 2XVGA 1B30A 5FIPA 3WSUA 1GOIA 3GXMA 3S5YA 1EGZA 1CIUA 3L4WA 3WNOA 4JAWA 2YA0A 3BCFA 1WNOA 2BV9A 1LL7A 1ESWA 1HIZA 2HISA 3WBAA 1G9HA 3CZ8A 4CN1A 5FCZA 1JF6A 4PTXA 4AW7A 2XJ7A 1MW0A 4TVCA 4CU6A 3WNPA 3VIKA 4KWUA 5I23A 3ARSA 1C8QA 3QOKA 3BSGA 1UD2A 3OLDA 2BVDA 3WF0A 2HVMA 2J75A 2WM0A 2OW7A 4JKKA 2CETA 2NT1A 3WIJA 1B3ZA 4OZOA 2ZUNA 5CPQA 1R86A 3AIBA 5A2AA 4ATDA 3IJ8A 1H2JA 3AHYA 5E6ZA 2PWDA 1J18A 4FK9A 4Q22A 1AQ0A 2CBIA 3FAXA 1BTCA 4B3KA 3BAKA 3AHXA 2GJXA 3F4VA 3NSXA 2OYKA 3VPLA 3SCUA 2CPUA 1MW1A 1UKTA 4QLLA 4AZCB 4QAWA 3MUY1 2D22A 2V3FA 4W88A 2PB1A 2CCRA 4QCEA 5I24A 2X8RA 3WQVA 4Z2KA 4W87A 2EXOA 1ZB5A 3OLGA 2D0GA 4C7DA 4CD7A 3A4XA 1KCKA 2YL9A 5JBEA 5EBAA 1UASA 4JCMA 5A6KA 1QHZA 1UD3A 1WKYA 3OZOA 3W38A 3VIMA 2VTFA 1UWUA 5LA0A 3TTSA 1E15A 1V0MA 2DIJA 5BXSA 4M24A 1M01A 3GNRA 1WZKA 2PBGA 3QGVA 5I0DA 1C8YA 4KH2A 1XCXA 3T0DA 2YDRA 1HKKA 1GONA 3DYPA 2WCGA 3ZIZA 2ZX6A 2GJPA 2VO5A 2XFRA 3ALFA 1CXIA 3W0KA 2VX5A 2OW6A 4D1IA 4YN5A 5JIPA 1LLOA 2WVUA 1TVPA 2D2OA 4EE9A 4JIEA 4PMNA 5EFDA 3AS0A 3IANA 1XCWA 1GVIA 2OWWA 3DX0A 3BSHA 1MQRA 1JAKA 1UD8A 2AMGA 1KQYA 1NP2A 3CUJA 1B0IA 3RILA 3WD1A 5BYWA 1KXHA 2JFEX 4M29A 1I1XA 3LRMA 4WKHA 4U5IA 2JALA 1BYCA 4D6HA 1MW2A 1GVYA 1GUVA 2W67A 1OD8A 3CZEA 5DO8A 4TXEA 4IPLA 2JIWA 1BF2A 3U57A 2PBOA 3PZQA 1KGXA 1R34A 5AC5A 3L4UA 2XVKA 2WZEA 3VD7A 1GW1A 5HOSA 1UWQA 4GXPA 3GYCA 3WH7A 2XSBA 1QWNA 1PIGA 1YHTA 2DT3A 1EOMA 2XIIA 3PZOA 3AIRA 2J62A 8A3HA 2J7GA 1ODUA 3QHMA 4AD4A 3SEPA 1V6WA 1XHGA 3GBDA 1WPCA 2J78A 3I3DA 1Q6EA 1FH8A 2QPUA 1KR1A 2WCAA 4UFHA 1YQ2A 1O7DC 1KB3A 2WNWA 1HT6A 3KWXA 2J7FA 3U7VA 3DX4A 4P8UA 1TA3A 4PCSA 1ZBVA 1L8NA 3KZSA 3FW6A 3SURA 2JEPA 2OWCA 5ABFB 3EDKA 1NOFA 2X2IA 2D23A 1GOWA 2VCAA 3SIMA 1TQUA 5DMYA 5AY7A 3DX2A 4DO5A 1W3JA 3T2OA 3PBGA 1K9DA 4MNLA 4OOZA 4AD1A 9CGTA 2DSKA 4AD3A 1CGXA 3UG4A 3OZPA 4JFTA 1OIMA 4TX8A 2WHMA 2CBVA 1X6NA 4PTWA 1EQPA 3VMPA 3GM8A 3N1AA 2XWEA 4V27A 1QI5A 3ARXA 3N17A 3CUFA 2ESCA 3N12A 4DUVA 1PEZA 3OLEA 1J01A 4FLRA 1E5JA 4E2OA 1GNXA 3WNKA 3WUGA 5BRQA 3ZT7A 4XZBA 4AZBA 4NRRA 3NDZA 1MFUA 2VRQA 1UR0A 3JUGA 1KFWA 3VKKA 4NRSA 4D71A 2EPNA 5E0FA 3TV8A 1B3YA 1W3LA 3AS3A 3W81A 2Y4SA 3TONA 4HMEA 2BXZA 3NDYA 1C90A 1I1WA 4UTFA 4KRTA 2YFOA 1JL8A 1CLVA 1VFFA 4HA3A 3SUWA 1UYQA 1JNDA 1IV8A 5LA1A 4PMUA 3AI0A 5D9OA 3LPGA 1GOMA 5GPRA 1JZ4A 1JYXA 2XYLA 4H41A 3PTMA 3J7HA 4M80A 2VZVA 4JFUA 3W53A 1OB0A 4M8UA 1UWRA 2BS9A 2BHZA 2D73A 7CGTA 3NIYA 5EB8A 3UG3A 2D1ZA 3GDBA 3BMWA 2V3GA 3GH7A 5A1AA 4RE4A 2E9BA 4DM1A 1JFHA 3UCQA 4HMDA 3LRKA 5A8QA 1BVZA 2ZE0A 1E6SM 4PCTA 4NXKA 3N15A 4W7WA 5E1QA 3G6MA 1E0VA 1H0GA 2MANA 4D1JA 2OSXA 4NZJA 3A3HA 2O9TA 4KGJA 1QBBA 3M46A 1QI3A 2FDMA 3BUDA 1ZS2A 2F7QA 1EHAA 1OWQA 1W2PA 2IXUA 3G6LA 1V0LA 5GNYA 5FOOA 3ZM8A 4E8DA 3H54A 1HJWA 6CGTA 3KL5A 4JL1A 3WQWA 1TR1A 3WD2A 1JDAA 3A5VA 5A6SA 4QDMA 1US3A 3QOMA 4M56A 2F2HA 1CXLA 2WLYA 2VURA 2BY3A 2WSPA 3WMSA 1SZNA 3PHAA 1TVNA 4WIWA 1V3KA 3WDPP 2X2HA 4AMWA 4D6CA 1LF1A 3L2LA 4BA0A 2BHYA 3IK2A 2WMIA 3ARZA 5BRPA 3IJ7A 3H55A 1EO5A 4AMCA 1E1EA 2UY2A 3GXTA 1A47A 3LXAA 2A3BA 1XGZA 3PTKA 1JD7A 1J0JA 4ZE4A 2A3CA 2XUCA 3PZGA 3HZ3A 4CD4A 3EDFA 2QLYA 2Z1KA 1NWSA 3RM9A 2XN2A 2DPEA 3M6DA 2DSVA 5F7UA 3B9AA 3CMJA 4NXSA 3K1DA 5FL1A 1OGGA 3L4YA 1VJZA 2NW0A 3W4RA 4XB3A 3UR7A 1CGYA 1E4IA 3VIFA 2QMKA 3DX3A 2PWGA 3MUIA 3PTQA 4AIEA 1QOXA 2F61A 3BAWA 1T0OA 3VD5A 2ZXBA 2CXGA 3W29A 3LRLA 2J7HA 2PWHA 1DWIM 2XWDA 4A4AA 4F9JA 1E4NA 2C8NA 4NI3A 3WMBA 2DT0A 2V5DA 3ZMRA 1HWWA 4MB5A 1E55A 1W1PA 3AICA 3BUIA 2GFTA 2VUYA 1FHLA 3CHCA 2WC3A 5HPOA 4BQ3A 1NOUA 2E4TA 1WB0A 1TFVA 4MDOA 3LPPA 1N82A 2CIPA 1HKJA 1GJUA 1BVNP 4J3WA 4V2XA 4OOUA 3ARWA 4MTVA 2DQXA 1R7OA 2UY3A 4HZ7A 5LYRA 4TTGA 3HG5A 3SUSA 3VGFA 1XRVA 4KRUA 1GJWA 5CXPA 3LXCA 1WDPA 4KGLA 3CZGA 1UA7A 2JF6A 3O2LA 4LYRA 2YA2A 1HJVA 1UQYA 4Z2IA 2JIEA 2O9OA 1V6UA 3SCQA 4D6DA 4AMXA 2W92A 4OUEA 1CGWA 2WBGA 4P7QA 4JKMA 3GXIA 1JAEA 1UZ4A 3UEQA 5IFTA 3T2PA 3W82A 1K6AA 4B9YA 3CHEA 1JDDA 3GXFA 1J10A 2VR5A 1QNOA 3MKKA 4Z2GA 1PZ3A 2FYVA 3S6TA 3O6AA 3NSMA 1D7FA 1UD5A 4HZ8A 4IISA 3A23A 3ARRA 1HL8A 2VX4A 5HPCA 2XVLA 3ECQA 2G41A 4GZEA 3CZSA 2ZUUA 1VAHA 2EPKX 4HU8A 4AY1A 1C7TA 1W2VA 1H5VA 1CGTA 3A22A 4P8WA 2YFNA 3T09A 1CXHA 1B90A 3WUEA 1HVXA 1ODZA 1JZ8A 5E70A 1B3XA 4OGZA 1K9FA 3AZRA 3MS8A 4S3KA 1UR8A 4CVUA 3S5ZA 4L4PA 4BQ2A 2EJ1A 3VGDA 3ZJ6A 3WQ6A 1DWAM 1CENA 3HJEA 1DWHM 3RO8A 1XSIA 2GK1B 3SCPA 5BXRA 1UD6A 2XG9A 4AZCA 4W8BA 4ZEPA 3T0AA 3VDHA 3ARYA 3L4TA 1W3KA 3VM5A 2OLHA 2Y2WA 4PMQA 3I3EA 2DH3A 4UFLA 2DT1A 3U5YA 1VFOA 2BXYA 1G5AA 3KLKA 1CGUA 1UKPA 3WQ8A 3CV5A 3KE0A 1E6XM 2BY2A 3VGEA 1SR0A 1G0CA 1Q6CA 3WY1A 3VTRA 3AHZA 4TX6A 2WCSA 1BYAA 4ATLA 1E73M 4AISA 2CBJA 3HG3A 4PBGA 5GNXA 3WUFA 3ZOAA 2EPOA 2YA1A 1SMAA 1CZ1A 4UOQA 3BGAA 3VM7A 2W91A 3FHQA 2C0HA 3L4VA 1UA3A 4BQ4A 2D24A 4CU8A 5FL0A 3NJ3A 3HU7A 1LG2A 3O9NA 4L4OA 3WELA 1OSEA 3VD4A 2XM1A 4UFKA 1W1VA 4WKAA 1BGAA 3B9DA 1XD0A 1J0KA 3SUVA 4H8VA 1D3CA 3DDFA 3M07A 4F8XA 3UR8A 4TVDA 1JYVA 1J0YA 1NH6A 3L2MA 1HVQA 2VX6A 4UNIA 3MV01 1H09A 3NYDA 4WJXA 2RGLA 2GDUA 1HP5A 3CBWA 1R47A 1WZAA 4MJ4A 1KXTA 1OBAA 1R7AA 1JIBA 1M03A 4HOZA 3W37A 3VINA 1FHDA 3CUGA 3VDCA 1V0NA 4S3JA 3KL0A 4W8LA 4N42A 1XYZA 4QLJA 2YL8A 3MSDA 2GJRA 1V3LA 1FH7A 2XVNA 2F18A 1DWJM 1VBRA 1CYGA 1DWGM 1R87A 3A4WA 5I6SA 5A6AA 3GNOA 2O9PA 3BXWA 3MMUA 2YKKA 2DEPA 1DEDA 4DO6A 2GUYA 3CUIA 3VSUA 3ARTA 3RDKA 1UH3A 1K9TA 2VQUA 2GVYA 4OBRA 4WLCA 3FXYA 3WD0A 3HG2A 4W84A 3UESA 1KBKA 3K8LA 1PBGA 5C71A 3KEHA 4H8HA 2ZWZA 3WY4A 2ZICA 2WZIA 3ZR5A 2WHLA 3FHAA 1EA9C 2EO7A 1QVBA 1P6WA 1M53A 3WF1A 1GOQA 3VIPA 8CGTA 1JI1A 3ZSTA 2WK2A 2EADA 2XN0A 3SCWA 4AZIA 3N13A 3OGRA 4A3HA 4MPKA 3AZSA 4EANA 3DX1A 3VMOA 2BVYA 3BAJA 2E9MA 4A3YA 4UQEA 1BFNA 5ABFA 1VEOA 3L4XA 3MUAA 4J7RA 1JNEA 4PTMA 1U2YA 1BGGA 1E3ZA 3SCVA 3WY2A 4D72A 1SFSA 1Q4NX 4GI9A 3SCOA 4CVWA 3WBEA 3PZ9A 1WAWA 3DECA 1CLXA 4TUFA 2VQTA 2XM2A 3WENA 3VNYA 1QI0A 4AZ6A 5JUVA 3ZSSA 3H53A 1US2A 2WPGA 4AZGA 4AZ7A 2B31A 4P8XA 3VX0A 1HKMA 4TTUA 4AZHA 4DUWA 1E70M 4CN4A 2ZUMA 1V03A 3EDDA 4W86A 1HJUA 2WVSA 2VMFA 2WMGA 3GXNA 1ISZA 3SUTA 2XVPA 2X2JA 1BSIA 4AD5A 2J8FA 2O92A 2CEQA 5JIWA 5ECUA 5BROA 2FHFA 2FE0A 2Q8XA 1E4MM 2G4FA 2Y8KA 2ZXDA 2FGLA 2F1AA 2F1BA 1VFUA 4NF7A 4HA1A 3PZUA 5A6JA 3LX9A 2Y5EA 1U30A 1WZLA 1RD6A 4BF7A 1ISYA 2GSJA 3TTQA 3IAPA 3APGA 1NWUA 3MU7A 5D9NA 1U33A 4QCFA 3ARUA 1V02E 3ZJ7A 2D3NA 1ZBKA 2Y8VA 1J11A 3BVVA 2WXDM 1NWTA 2UWFA 4B15A 2UY5A 2ALWA 4GKLA 2VCCA 3AMDA 4Z2LA 1HF6A 2EQDA 1BQCA 3VIIA 5KEZA 3ARPA 4GINA 4FMVA 5D9MA 2VNCA 3VOCA 1B9ZA 4J3SA 1UR9A 1FFRA 2VJXA 4FLSA 1MXGA 1OT2A 3VX1A 1Q6FA 2XSAA 1GORA 2YOCA 3CPUA 1NWRA 1TCMA 3FN9A 4AIOA 4YPJA 2ZX8A 2EACA 3HG4A 2E9LA 1S46A 2EPLX 5D8ZA 1Q6GA 5DT7A 3WUBA 3KLLA 4HZ6A 1KTCA 1TE1A 1CECA 2WYSA 4MADA 2ZUWA 3TTYA 4Q7NA 3GZAA 1OGBA 3NCOA 1GQIA 4ACZB 3CUHA 1ZJBA 4LQ1A 2J7CA 3SCRA 1ZJAA 4PMZA 3GH5A 3LXBA 1VEMA 1UH4A 4E8CA 1TA3B 1KXVA 5D9PA 3POHA 2VT0A 4P7LA 5DEZA 1DTUA 2J25A 1PX4A 2E0PA 5DT5A 4UCFA 4IUGA 2XGBA 7A3HA 4D6FA 2ZXAA 3A47A 3VD9A 3FNDA 3WH6A 2WMKA 3LMYA 4AXNA 1VEPA 4H2CA 2BY0A 4JL2A 3WDIA 2WMJA 4URIA 4XV0A 4PMRA 3VD3A 1H0IA 1EHNA 2FH6A 3BVTA 3D4YA 3L4ZA 4Z2JA 4JHOA 1TQTA 1UKOA 2WVVB 3WEMA 4DM2A 2YLLA 4QP0A 1JI2A 5I3DA 3B9EA 1V02A 1EXPA 1MXDA 4F66A 2ZWYA 1KTBA 2OSWA 1NQ6A 3AXIA 1XV8A 4P7OA 3TA9A 1O6IA 2QMJA 4GQRA 2J8GA 3K8MA 4FNPA 4JKLA 3VO0A 1E0WA 1M04A 1OCQA 3OLIA 3TP4A 2F7RA 2E3ZA 3HMCA 4DWSD 4ZE5A 4WSKA 4GI8A 1E71M 3W6LA 3BUQA 1F4AA 5M03A 1UR2A 1R46A 4MB4A 1VBUA 4U2YA 1QHPA 5BWFA 1SYTA 1CGVA 3AS2A 1H11A 1EDTA 4DWSA 3NSNA 2W4XA 2DIEA 1JZ6A 3M7SA 1HJXA 1AQHA 3K4DA 1FOBA 4EKJA 3AMKA 1DP0A 4UFMA 2PI6A 1E72M 1E6PA 1BPLB 4W5ZA 1BYDA 4HPGA 4XUYA 1VIWA 5CGTA 1C3FA 2XHYA 3VIOA 3OBAA 1LJYA 3BAXA 2PWEA 3WH9A 4QFUA 1W1YA 2WAGA 2WC4A 3BVXA 2OYMA 2WMFA 1VB9A 1VF8A 3RMEA 1G01A 3VNZA 5A8OA 2VZOA 3UETA 4FNQA 3WFZA 1E0XA 2FHCA 2EEXA 1VRXA 4UQAA 3VDBA 4NZCA 1TZ7A 4H7VA 1JYNA 2BNJA 4GO9A 2ZUSA 4AD2A 3ALGA 1GCYA 3WY3A 3DDGA 2DSUA 2VX7A 1XH2A 3SCSA 4J3TA 4ZENA 5HXMA 3VUPA 1Q6DA 3F5JA 4LGXA 4LPCA 2YJQA 4ZXLA 5CZKA 3GXDA 1NARA 3AYRA 2G3IA 1E3XA 4HA4A 1R75A 1AVAA 2OYLA 2XFYA 5E09A 4FNUA 3TTOA 5I5RA 2X0HA 4FNSA 3T2QA 4X9YA 3WEZA 4FLQA 3F5KA 2J7DA 1MYRA 1J0HA 2WBKA 1W9DM 4BCEA 4MB3A 2VZTA 4U2ZA 1C91A 3PN8A 4KMQA 3RM4A 1JF5A 1AQMA 3OB8A 2D0FA 2WKLA 3DHUA 3A6OA 3VVGA 5E0CA 2YDSA 3EJRA 3BAYA 4B9ZA 4PTVA 4BS0A 2V38A 3AOFA 3SUUA 1VENA 2J47A 5I78A 1IZKA 3EJPA 3WF3A 3MUZ1 4K68A 1OT1A 4U3AA 1BLIA 4RL3A 3I3BA 5A6BD 3VU2A 1EH9A 4MAZA 2VCBA 1V08A 3T08A 2VOTA 1R85A 3WNNA 1KR0A 4CCCA 4CD8A 5BXPA 3WD3A 4NZFA 4W8AA 2J77A 1QX1A 4JFVA 1UR1A 3HN3A 5A6BA 2CKSA 2WB5A 2VRKA 4PUEA 2JF7A 4LXFA 4PMVA 4FNRA 4J28A 2QV4A 1WDRA 1W1TA 3GTNA 2DT2A 5IDIA 3CLWA 2YL5A 1WZMA 5BCAA 3CO4A 4JFSA 1KBBA 1W9VA 1C92A 4UQCA 3ZT5A 3EBVA 2X0YA 5A3HA 5A8PA 1K9EA 5D4YA 1E6ZA 2E8ZA 4Y7EA 1GQKA 4OKDA 4W7UA 1EDGA 3WFLA 5ABEA 4EAMA 3BMVA 5E9AA 1LL4A 3FY1A 4E4PA 2F7PA 3AMGA 1UWTA 1DWFM 1XC6A 3GH4A 4W7VA 1V6VA 4YHGA 2Z1SA 4GPNA 3AIWA 1CDGA 3LPOA 1XH0A 5ABHA 5M3WA 1VFMA 3U7BA 3RIKA 2GDVA 2ZUTA 1HL9A 1GQJA 1HXKA 1XD1A 1Y7VA 3AXXA 1KXQA 5DFAA 5FD0A 4UZUA 3CIVA 1B3VA 5A2CA 5CPTA 1PX8A 4PMYA 1HJSA 3AIUA 2NT0A 2X09A 3BLKA 1CPUA 1LWHA 1XSJA 3EJUA 3ZT6A 3IGUA 5CLTA 2PF0A 3MSGA 1H41A 2D0HA 3CZKA 2ZX5A 1JZ5A 4HU0A 2EAEA 1E9LA 4DWSC 3OIHA 2WLZA 4ATWA 3S2CA 2XN1A 2XIBA 2J7EA 1SMDA 1HXJA 5ABGA 2YIHA 4J27A 3MV11 2JEQA 3POCA 1UG6A 4UFJA 5CLWA 2WWCA 4NX0A 4PUDA 1V6XA 1QNSA 1CXFA 4B3LA 3CZJA 3WF2A 5I2UA 3BVUA 5IHRA 1KGUA 4CD5A 3VGBA 3PZVA 3WH5A 4BZYA 3AFBA 1PPIA 1V3HA 2CESA 1X1NA 2YBUA 2XFFA 4DO4A 1G1YA 3D51A 4MB1A 4AWEA 3OG2A 2CKRA 1H1NA 5EFFA 1R8LA 2BVTA 4R5EA 3WQ4A 3BAIA 4GIAA 1XYFA 4W5UA 2DSWA 2W5FA 4RE3A 4FF5A 1KQZA 1IZJA 1KWKA 4X0NA 1BHGA 2PC8A 2RGMA 4PN2A 1XSKA 1BYBA 5M17A 1WP6A 1UKSA 4PEEA 4XZWA 3RCNA 4CKQA 2G3JA 2FGZA 2IXVA 1OIFA 2BHUA 3DHPA 4OJYA 4WKFA 4HTYA 3W25A 2DH2A 5CSUA 1CNVA 5A2BA 1MW3A 1W9UA 3PZNA 1E6NA 4X0VA 1ZU8A 3ZO9A 3AS1A 4IM4A 2F8QA 4D6JA 3UG5A 1H3GA 3VILA 1FA2A 4IPNB 4UZSA 2J74A 4P8VA 2GJXB 4D6EA 2YLAA 1E56A 3N11A 3WQ5A 2WHJA 1ZBCA 1LQ0A 1JG9A 5IXEA 2FH8A 2BY1A 4GO8A 1ECEA 1HKIA 5DF0A 5AYIA 3RPMA 3VIHA 1J12A 3QHNA 3IAQA 3W6MA 3CZNA 3WDQA 1W32A 1BG4A 2BFGA 4MDPA 2IGTA 1C8XA 2C7FA 3B8SA 1HX0A 4CD6A 4AEEA 1WE5A 1FP9A 1OINA 1HNYA 3N18A 3D4ZA 3CMGA
chains in the Genus database with same CATH superfamily
4NQED 5LG6A 3TYEA 1LOQA 1A4KA 1KELH 2ACUA 1AH1A 5EU6B 4S1SH 1OWRM 5IMMA 5AZ0A 1D7DA 4NHCL 1KIPB 4PJIE 3RQ3A 4BUQA 2EKCA 2VEGA 4QIRA 2R91A 4PBFA 5IB5A 4WSJA 4OZFH 3VTTA 2Q71A 4GX8A 3TLRA 4CQ8A 1W2KT 1E6JL 4U3CA 5F7HA 1DE6A 2AOSA 4PQXA 1J48A 3DV6B 5IWLC 5C2BH 3NGJA 1TZHA 4F0MA 5I2IA 3GW3A 4NJJA 4KX7A 4LKCB 1UBSA 4O1CA 3FC8A 2F54A 5A69A 3GVWA 4P9HC 4GSRA 1A7NH 2Y7DA 1SSGA 1EJ6A 3OXRB 4DF0A 4DHGA 4U31A 3DEQA 3EMZA 4EI5B 3KTSA 3BWZA 1NGPH 4MA3B 5LNRA 3VFVB 2V8LA 2MEJB 3KL3A 1I60A 1M6OA 3BGMA 3TN5A 1YMMB 1AZRA 2HKHH 1DBBH 2WIMA 4KWVA 4X2PA 1RVFH 4U3HA 1TSHA 1MI3A 3ZMNA 3KPSB 4C6NA 4QTHA 4YEFA 1FWHC 1R24B 3TW7A 3TCLB 3FDGA 4UFIA 3LNMA 2CBUA 3UTSA 5I8KH 2IWGA 5SWSA 3MI2A 2FZBA 3BLBA 3QDME 5I6PA 1QBML 3WJLC 2PW1B 4PZVA 1E9YB 1A6AA 1K4GA 1TRIA 4FXSA 3MP3A 2COQA 1JD9A 5E6YA 3HBPA 2WQVA 2VDMH 4AYGA 3U46A 4R3UA 2W9LA 2VLJE 3W7OA 5KANI 1CBJA 3VGGA 4DTGL 4HD5A 1BIHA 4HNOA 2EZ0C 3UZVB 1W5QA 1UR4A 3E1F1 3QI9D 4HJUA 3CFCL 4ZDHB 4QAMB 1XLAA 2PW2A 5I8EB 3ARDB 1II4E 1KNOA 4DAIA 4NKIH 1AA1B 2F8IA 3TBTA 2OSYA 4FF9A 1TJHL 3H9SB 3DV4B 3QDMD 2BZNA 1BRLB 4XGZB 1AY1H 3UOAB 5D37A 1G6RB 3QAQA 3PBUA 2Z2BA 4O1AA 8XIAA 1VQTA 2WBJC 2BX7A 2OELA 3R58A 2Y3AA 1ZLVH 2ICWB 4O5LH 4HTBA 3F4DA 1SDAB 1J9YA 3NO1A 2VC2L 3F7VB 4OLYL 3DFOA 5E8OA 2P50A 4LFYA 1U92A 5B7FA 2VLJD 1IJNA 1M57B 3S9YA 4I0PC 2E8YA 3CC5B 4NUJB 3ZJAA 3EH4B 4ODUA 3SCNA 2FKPA 4MAYC 4CILA 1PKMA 4B2DD 2IPFA 3LY6A 3H7VA 2RFXA 1LE9A 3CWHA 5DU7A 3AISA 2ZIDA 3BPLB 1IT0A 4LYPA 1L7IH 1L5GB 4E0RA 5JO5A 1XDJA 2R8WA 4LL9A 3W2DL 1N4XL 3V4PB 4F1ZA 4OF5A 3VG0H 4KJWC 1JPTL 4JAMB 3C6EA 2OZ4L 2ZX9A 1T6VN 4N6RA 2X88A 4LAKA 4YZFE 4M1BA 3H6OA 4ERSL 1AR1B 3GSVA 2DWDB 2ICSA 3KGRA 5L7XL 3LZNA 1CW2A 4ERGA 5BNKA 3S5YA 2HT4C 4I48B 1HIZA 4E2BA 2OXHA 2V2TA 1JF6A 1MW0A 2CLIA 3U1SL 1F76A 5C0GB 1G7UA 5I6NA 4KX9A 4QBXA 5TDNA 5J4MA 1KOAA 5CHNB 3ZGHA 2ZKWA 5F9OL 3FXIC 2R4RL 4F9PC 5CPQA 2CLVA 3UZEC 3LV3A 3Q8EA 1PY9A 3IJ8A 1KTLB 3PRZA 2Y5SA 3LHWA 4HUWA 4OFDA 2ATKB 2MQGA 1QEWA 3A9BA 1XYCA 3ZR4A 2CRMA 3TCXA 3D0VB 3DOIA 3VWJC 4XCYA 4P5KA 4CNTA 1XWVA 5FFGA 1DFXA 2EXOA 3MCLH 2Y2TA 1HGWA 4K3DH 2WJ5A 3QQDB 5F7AA 4C6IA 1WF5A 1VBJA 2Y7QA 1KPVB 2HJKB 2LV4A 4P2OA 4HUUA 1BOGB 2XKNB 1OGAB 4ICMA 35C8H 5C9JA 2BB0A 3GNRA 2ADFL 2OK0L 1C8YA 4KH2A 2XLLA 5J5EA 3VFSA 4HYTB 4L3EB 4RZ6A 5I9QC 5JIPA 2C9AA 4R9OA 1HZHH 3WLIA 2Y85A 3ISIX 3DX0A 4GG6E 1MI5A 4OGQC 1WQVT 3UJJH 5DUML 4HS8L 4GBXB 5EA0L 4IJTA 4N2BA 2EKJA 1ZMYA 3U9PL 5JW4M 3EGDB 1SJVA 2VM3A 3I10A 2WV3A 1OD8A 2VERA 4NO2A 4KEVA 1ADQA 3KHOA 4OU3A 3MNVB 2XVKA 25C8H 4IOSD 4JRFA 4F37F 4YMZA 4W9KC 5HJ3B 4MZ1A 2IPTL 1AUSL 3O2DL 4TSCL 1K85A 2ICWI 1BGXH 2B0MA 3CQFA 4GKNA 5CFHA 2A6JA 3D05A 1NCCL 1M7DB 1E6OL 3E1ZA 2ACQA 5C0DB 3HGRA 2IOMA 4MHHI 2P1FA 5D8JL 2DQUL 4NZTH 1V8HA 2YGYA 3C60A 3QJUB 5M95B 4RIRA 1QSEA 2OWCA 2NY5H 2HBVA 2X2IA 4FP1A 2UZYB 3MA9H 3BD5A 4WUKL 3DOHA 5KS9F 2X9XA 3E6HA 4NKMA 4AE0A 2CLEA 1GZQB 1SEQL 2DSKA 1M41A 1B4LA 3PQYB 4FCAA 1XBXA 2Q02A 1RHHA 1QI5A 1E0UA 2L04A 4ZUTA 3D18B 1MRQA 1B9KA 4P57B 3N14A 2F7IA 4BI7A 1HSAB 4IG2A 4PIBA 4F0SA 4LOCA 3MYPA 4GQBA 3CU7A 2R2BA 4KZCA 4M7ZB 1BSLA 4K07A 5LKNA 2X4RA 3GNML 2YD6A 2O30A 1NGYB 1LLAA 1U5JA 4OV5B 4R96B 2BZCA 4JFEE 4PMUA 5LQBL 1JZ4A 3G6DH 3MY9A 1IEWA 3C5ZB 3W53A 3L9CA 2CR0A 3IVSA 1S5TA 2CQVA 3B40A 5ITBH 4N1EA 1LE5A 3KWUA 2EUWA 2KPNA 3IARA 1FPTH 1SYVB 4HBKA 3L17A 2WZ6A 4K8RL 4KGJA 2FRGP 3P11L 3ZM8A 3HS0B 3ZVVA 1J05B 1Q63A 4AGMA 2A5UA 3PUGA 3S88H 1GYMA 1ONQB 3OD3A 5DJCB 1SZNA 4K7VA 1XISA 1N70A 1AQDA 1XIWB 1I7UA 5C6MA 3HNVH 1LF1A 1OY3B 1AMXA 1KJVA 4JFED 3GR8A 4WY0F 3URAA 3OKNA 3CL8A 3VG9C 5IBXC 4GBUA 2EDTA 2X7VA 2R1YA 3IM1A 4R7DB 4TPRH 3EDFA 3BVDB 1CL7I 1JRHL 3DTDA 1PD0A 3S0PA 5I1DB 3EWDA 1BVKB 5HYSA 2NW0A 1T5AA 1AQKH 3KWWA 2UUDK 3IMTA 5C3IA 2WUCH 1CZ8H 2LGNA 2ZXBA 3ESUF 3HZYA 1JR1A 4N0UE 4PJBB 5DD5H 2IQAA 4L18A 4Z8FH 1R17A 1M3IA 5CP3A 4G5AA 3C6LD 3GIPA 1JGEA 5I1HH 1RCOB 1XO8A 1R7OA 5LYRA 4L29A 4GQ9H 1V7ML 5CGYC 1QDSA 2H8PA 1JMZA 5IB3A 4LYRA 2JIEA 2B1AH 3H8NA 3OR7B 2VIRA 4RFNB 5F6IC 2D2CC 2W92A 4AMXA 3ID7A 2VMJA 1EGJL 1K6AA 4IP4A 3ULUH 5LDSA 1FJ1B 2IH8A 3MHUA 2WW8A 4RZ4A 4OCSL 3BH8A 1P4UA 3S3JA 1M1SA 2ZNWA 2GK2A 4J5NA 3M0IA 4Y2OB 2QCFA 3OVRA 4GUCA 2RJMA 3LK6A 2VSDA 5D96C 2IPUK 3DPDA 2ZWNA 3MCKB 3GI9H 3M47A 1H5VA 3D9AH 4LLQA 1B90A 1HVXA 2NY4D 3APMA 2FIKB 1CBVL 4BQ2A 1HG3A 2FPYA 4K3GA 4LSRL 5J57B 4F4RA 3O3AA 2ZUQB 4UTAA 2G5RA 1MHCB 3R0KA 5SWZE 4N2IA 3VDHA 3ARYA 1RJRA 3H4WA 4PMQA 1RJQA 1G9NC 4ZW6A 4Y88A 4IIQA 4JGJA 1UM4L 5IBLD 4UQ2B 1DL7H 3TU9A 3TVMA 3E12A 2Z6FA 4YHPB 3VXPA 3SY5A 3PJXA 4HMNA 4F57L 1REQA 2XWCA 2MH4A 1WV2A 1P43A 3L4VA 4CU8A 4NP4L 3G22A 1FWGC 1DQQA 1N0XH 1XD0A 3O1NA 3TT3L 4Z7QF 5MP6L 3M0LA 5CWSB 3ZXAC 1JZIA 1WBJA 1HVQA 3D48R 1DOSA 3RGHA 4MNQB 2MQ0A 1ECZA 2FPTA 2AQNA 1RIUL 3VOIA 5FLUA 3BJTA 4WCYH 2IVFC 2YAFA 5SWZD 5DZ9A 2J66A 4X6BA 1UM5L 3MJ9A 2HE5A 4HH8A 3TA3A 5HGGS 1VLIA 2X4TA 3P93A 4NZ3A 2AJVH 2VQUA 2H6OA 4ODWB 3Q01A 2E25A 3WY4A 2NX3A 1MHPH 1T5KA 3GGWA 1YMHB 1H3PL 4GP5B 3ABZA 1R9FA 4XSMA 2W80C 1LQSR 4JFPB 2X6MA 2OJPA 3F5WB 4JRLA 2EYSB 4PTMA 2WYIA 3MKCA 5D2VA 5K59F 4QHKI 5SWUA 2XIMA 4EIBA 3DX5A 4YXLH 4LUYA 3KVMA 3MJYA 1MELA 1N64L 2HFFA 5D6DA 4GRWB 4PJAF 4HNUA 4UQ3A 4E41E 1ET5A 5MF5A 2NLJB 3D85B 4Z7NE 4HIQA 2X70B 2B3IA 1QUPA 3PZUA 5K9JL 3QVAA 3LX9A 4BHUA 3NAAL 2L3BA 3IAPA 3MUHL 2Y7SA 4W4OA 1PG7H 1D5XA 3QRLA 4Y2NA 1NWTA 1XRFA 3WLQA 4PIRF 1CLYL 4RUBA 1A9EB 1GZGA 3EPOA 3ARPA 4J3SA 1VESA 1MXGA 1JCXA 3FUHA 3GUGA 3G5XB 3F8UB 3VSQA 1UURA 3E8UL 3JTSA 3FQRA 1R3WA 4A7UA 2E9LA 3SE8L 4ES4A 4I9TA 3WYRA 2ZUWA 4HAKA 4LSSL 5HQLA 3FVMA 4E41D 2EH7L 4DPCX 5REQB 3ZRFC 4V1DE 4HIHA 3SCRA 2DZVA 5CZSA 5HHQB 5HR6A 2AV1A 4L1GA 3MMEA 3POHA 3RGBA 5DEZA 1QFUH 5DYFA 1U83A 3LERA 5HINA 3TO2A 7A3HA 3CVCA 3VD9A 5LXXA 1LD9A 2KZHA 3RCMA 4H2CA 3O05A 1EO8H 1FDLH 5IB4A 2QS8A 3ZX1A 1SUJA 3DO7A 4GO6B 4Y9GA 4ZFGH 1JZDC 2BNRE 4WUUB 1S5HA 5DD0H 1JHTA 5FHBH 1U9KA 1UXLA 1A8JH 3S3SA 3VFGL 2QMJA 2UV8G 1GGCH 2LU3A 3EO1B 3PV7A 4B5ZA 3QA3B 2EYRA 1F18A 4WSKA 1FWEC 2ZYIA 3OKEB 3ZDXB 2PLKA 2FEDC 5INDA 3HI5H 5BWFA 1CGVA 3TWCH 2DJUA 4V1DD 1DP0A 4DJFC 1ICQA 1VIWA 5F0JB 3VZZA 5C0QA 4TIMA 4K2SA 2NUTB 3REQA 5DR5H 4QOKA 2WAGA 3BVXA 4M1DL 5TDPA 3RWJB 3TEWA 1SEBB 1E0XA 3PJTA 3NDOA 4B9FA 1EPVA 2BNJA 2BNRD 3WTWA 3SKUD 2ZWKA 2UWEF 1PFCA 4LGXA 2ALDA 3QPKA 2E7LC 3UFIA 3VJ6B 4ROQA 1EJOL 5L8KB 2CK0H 2WQWA 1O94A 3DFYA 3P54A 5ETUB 2WBKA 4UM9D 4XNZC 1X5GA 2VZTA 3O3EB 2MMXA 1LL1A 1RJLB 4A2FA 3BAYA 3LLDA 1BBDH 4PRNB 1FH5L 4K68A 3MRHA 4GZ7A 4EN3A 1HH9A 5DS2A 1BLIA 4UWQB 2VCBA 3B0YA 1IBYA 5XIAA 4OQTH 1OP5K 5DANA 4WGVB 4W8AA 3TBWA 3SY0B 5IEHA 1R9ZA 2MHAB 2JF7A 1AIZA 2NOYA 4LXFA 4PMVA 2LW3A 5GVJA 3QW4B 3VRIA 5G5DB 3P2DA 5FYKH 4A2RA 2G9HB 5E95B 5E2UH 4MPQA 1IB5A 3RLHA 3SODB 4QKTA 3FB8B 1RURH 1UVQB 3ISYA 1UC5A 3BMVA 3QRBA 4P2QA 5ECGA 3EGJA 3L5XH 2F74B 5PTDA 3IDNA 1RA0A 4WHTB 1QPQA 4HNCA 5C0FB 1P0SE 2CIKA 1CD1A 3DJ9A 3QO1B 2QCDA 1HJSA 4FXJA 1JCYA 1A14H 4ZFZB 5CN1A 4H5SB 4RZ5A 2X4SB 3CO8A 1T8QA 3PAOA 3DUSA 2K70A 3EFDL 3VXRE 1VRDA 2WLZA 1DLFH 1MSSA 1SMDA 3MV11 3QFJE 5C9WA 3I74A 5T1KD 5EU3A 1RJZB 4TQHA 5E1AA 1NLBH 1FLTX 1NGWA 3MT1A 2FGWH 1UB5B 4XTDA 4PV9A 4MZ2A 4ADJA 1NMBL 3UJEA 1W8EA 2OP4H 2PXYA 4LC6A 1OSPL 3P82A 2HFEB 3HHSB 3PP7A 1WP6A 1NPJA 2P52A 2G3JA 4LCVA 4M43L 1C8PA 3O6LH 4NQDE 4AQAA 5IW6A 5CSUA 2PZ0A 4WEEA 4Y5VA 2O7SA 4GVGA 1TV2A 3TV3H 3FTGA 1FGNH 4L5FL 4YZWA 3PAJA 2AV7A 3VXRD 3H2WA 1HJBC 4CW1B 2CZVA 5H35A 1MLCA 4MBRA 4X6EA 1LQ0A 4DB7A 3QFJD 4KVNH 3GBNH 4PL2A 2MQ3A 2BW5A 1NBZB 2DQIH 1ZAIA 3AUVA 1LO3L 1DSFL 4WU7B 2ZD0A 3OR6B 1XXXA 3K8KA 3FSVA 1B6UA 3HW7A 1IAOA 2ANUA 5E6IA 4LF1A 5EO0A 2HTKD 4HCGA 3PJSA 3T6XA 2NDGA 1E5ZA 4UNKA 3EJQA 2V5SA 3P5YA 5IHZA 4POCA 5T1LA 2J4GA 3EEZA 3K46A 3FFCB 4P7RA 4FLOA 1L9PA 3MMWA 2X4PA 3AIVA 2VR6A 3AIEA 3A3YB 2E86A 1CB4A 2W9MA 4NQDD 3VA8A 4JFQB 1HFUA 3AT8A 1EC8A 4DJDC 2NQCA 3GMRB 2Y36H 3O3RA 4MQXD 4X42A 4LYQA 1YPXA 6FABL 1EDQA 3MJWA 4ZBJA 3NJIA 2NY0C 2AKRB 4BA8A 1S5WA 2UY7A 2X2YA 4EK7A 1ZXQA 3N6QA 1A8ZA 5EF2A 2HJFA 4PMXA 1QMUA 1OC6A 4M81A 1CK0H 1PLAA 5LCVH 2A73B 1YAIA 3QPXL 3ATYA 3W26A 3CUXA 2WVVA 4OCRL 5LB1A 2PPFA 1NEZG 4AX7A 2B0SH 5F4WA 3HG1A 4H2HA 1S39A 2J6XA 5EIVA 4ASTA 5EKYA 1R0AH 1H60A 1S9XA 1M6JA 2AQQA 1W9XA 5L6YH 4TUKL 2CHNA 3RPKA 3UBGA 4E8GA 3TZVA 2AAAA 4N9OB 2WZAA 3CJJA 3TWYA 1WZ1H 4O0KA 4Z0XA 1QBAA 3CGTA 4QJ5B 3KCJA 3WMCA 1PFOA 3P69A 5IVXB 2BOBA 3RRQA 3MR9B 4K7YA 2WLNA 1KTJA 2R0KL 5H2BB 3EZ4A 2PDYA 4PJEE 1WEJL 1QFWL 3G1DA 4LCUB 4ANKA 4I18A 4PJ8A 3NUKA 3MLUH 4C1NB 5D7SL 4DUXA 4J3UA 4ZZ9A 4JO5A 4CU7A 4DPQA 3KH3A 2VW7A 1EJ8A 5FAJA 1MCHA 1KLYA 2KS0A 3BD4A 3UWVA 5IV2B 1JZ7A 3LCIA 5CZXC 5CJ5A 3AXHA 3ECBA 4ALAL 3QQ4B 5BVJA 5ISZE 3EWXA 4KRLB 3F65A 4S3FA 4MAUL 2YZRA 1TZIA 1KCRL 3GYRA 3MLXH 4F7EA 3IACA 4U1SB 3TYGH 3L5WB 3TK7A 4QTFA 4MA7H 1QSFB 1VGKA 3F03K 5AZ2L 4S38A 3KW8A 1JWSA 4UIMA 3WSQL 4JLRB 4JQ2A 3BO8B 1RERA 1T7YA 4K7PH 3W7MA 1JGVH 5F1IA 4S1QL 4DQWA 1WO2A 4XIAA 1JQXA 2OZ4A 7PAZA 4I13B 3HI1A 4DWSB 3GK0A 4X4ME 2XPGA 3P9LA 1CLCA 5GRXG 3L48A 1YQVH 5EBMB 1FVPA 3PWIA 5HI3D 2VL4A 2QUNA 1GS8A 4M7KH 3STCA 3NABH 3RE0A 5KYYA 3WUWB 3F5LA 5ISZD 2V2WB 3GUFA 3E49A 4DGYH 4HT3A 1IAIH 4AEHH 2QVNA 3RAOA 4ZPTA 4KQ3L 1LP9A 1WBZA 2JI3A 4PB0L 5D1QA 2BSBA 3GXPA 4YDLC 4R27A 43CAB 3F2DA 1OCRB 4KX8A 4JKWA 5LXEA 3WKMH 4CRPA 4NC0B 3VFOB 3HR5A 1HQTA 4P7NA 4I3RL 1A0CA 4I0KA 2ZZ2A 1WUNT 3KOWA 5D2WA 3GKWH 5FOBA 3LZ3A 3FU3A 4HPXA 5DWUH 3LHPH 5K9KB 5KZ6A 3N2CA 3UPBA 5BMXA 1E8YA 2WXGA 2O4MA 2A3EA 3HGSA 1C12B 1X5AA 4LOUD 3UGVA 1RSCA 3SGKA 2HVKA 5C2CA 1UUMA 1PL9A 1V6YA 5IOKA 1KG0B 4R0LA 1ZA3A 4HC1H 1E5BA 4ZTOH 1U8MB 3L65A 1UENA 4UDTA 5CGQA 5GIRA 3BCFA 3W1UA 2I7SA 4K6AA 4C6LA 5FK9B 4ACTA 1YY9D 3ZVHA 5A2KH 2CAKA 1ZLUK 3A64A 2XA8H 2VWSA 3MDWA 3SBFA 2WM0A 3QQ0A 1ZXKA 2NY1D 1MO0A 1A4MA 5FJJA 2F8XC 2KL6A 1KN2H 2CA4A 4BJHA 5GZNC 5JHDA 4JG1L 3N34A 3MGAA 4ZO7A 2OX5A 1BTCA 3CCHA 1XGRA 3F4VA 4YNYA 3KXFA 4MZYA 1MRFH 3QUYB 5EO1B 3WLBA 4QAWA 3T6VA 4JG0H 4AX3A 3ES7A 2WXOA 4WNQA 1M5WA 4YXKL 1T5WA 5BV7B 5H6HA 3RYMA 1P1XA 3RYSA 3WN5A 3O2DA 3BDXA 1YKWA 3HB3C 1J5OH 2VTFA 2G2RA 1TE6A 3DFQA 4YDVA 4ZUSB 4IXXA 1TZGL 1JPGA 1B3OA 2PBGA 4RGNC 3D3FA 4OUIA 4ODXA 4ICXA 3EG9B 3DGDA 1LK3L 8XIMA 5AL8A 5SX4I 1CI5A 2XG5B 1AGCB 5HMFA 4AK2A 3UJTH 5ICYA 2FL5B 5F2GA 4XVSL 4FQLL 1MNNA 1KQYA 1RZJL 3B1UA 4X98A 3PS6A 4M29A 3TMLA 4EUPA 1EEYA 2JALA 2RBLA 2OTUA 1MW2A 4IU2A 3U8GA 1I7ZB 2XICA 3VXNB 3OZ9H 3APCA 1TUFA 4OZIA 3V5DA 2EDXA 2WZEA 3L81A 3Q6GL 1T22B 5HOSA 3JWDC 1OX4B 4P23D 5FYLE 3S2JA 3MLRL 5JH2A 4ACPA 4M62L 3S5LB 3B6SB 3TCSA 3FQYA 5DXYA 2WNWA 1DZ0A 3NPWA 4GHRA 4QT5A 2VN6A 2HTMA 3P7YA 3I7RA 2V81A 3EDKA 3QNFA 2IG2H 2V8MA 4LVEA 1YEDA 3ZZQA 3DX2A 3IJHA 3OVUB 4DO5A 3NQCA 1UTDA 3R10A 2QGHA 3UG4A 5A3IC 5C55A 1H0DA 4G7RB 2IV9A 3GR7A 4UMAA 3HI6H 3N17A 3CUFA 3HMXH 3EA2A 5E51A 3SQBA 1Y5WA 2G3FA 5D1ZI 1NGZB 4I3SL 3WTUA 2VABB 4AZBA 3G8EA 2QAPA 4QE5A 2W65A 3B9KC 5CLXA 1WLHA 2VRQA 5IROA 4N2MA 3T71A 5FYLD 3VFUB 3HC4L 3UAEA 4FI4A 2YFOA 1TPXC 3KP1A 1IV8A 2R7EB 3L3OA 2XWRA 3J7HA 5D7IB 4JFUA 1W8GA 3AU0A 2JLPA 3WJJC 3HOJA 2CLZA 4LHQB 4JY4B 2UZXA 4AM0B 5AG9A 4TM9A 3BJFA 5IB1B 1A5CA 4LNRA 4FOMA 2ZA1A 4Q4EA 3WLRA 3IIPA 2H9AB 1WHOA 4HKXB 4KTEL 4LUIA 1HHJA 4Y1TA 3L7EA 1NFAA 3ARBA 1MDLA 4MJZA 4OUOA 5HDWA 3APNA 1H6EA 4RA0C 4LSPL 1EC7A 4JY6B 3EJZD 3HZ3A 5D4JA 3BUYA 3RX3A 2CDEB 4LLMA 3SB0A 3TH6A 2QSQA 3K1DA 3DARA 3OO2A 2FTPA 4KXZI 1EJRC 1U36A 1ZHKA 4PJCB 3WCYA 2IGFL 2RACA 3KPNB 3E5PA 1FNSH 1IR2A 2VN3A 4FPSA 3AQZA 2JK5B 5D6CB 4YVXA 4MXQD 2I69A 3X1FA 1UROA 3MV9E 1S9YB 5EMUA 4KXAA 1WXZA 3B3BA 2OTWB 4GFXA 3I9GH 3G04A 3E6EA 1LP6A 3UCRA 4KRUA 5F89B 1J5CA 2A74B 3ARGB 3N42B 3EO9L 4ZB0A 1AGFB 3T1GA 5ID1B 1YXYA 4HUMB 5BZDA 5H2ZA 4EUPG 4U1IA 1GZPB 1KLFA 4N6FA 3IXAB 4L8CB 4Y0GA 3CHEA 1KT2A 4KKZA 2XBTA 3O6AA 2H1LM 4CDGC 1N3NB 4P5MA 4GP8B 2KMWA 1T4KA 4WWNA 1F4WH 2GB2A 4MA1C 4M8QB 4G1EB 4J3BA 1U3HA 4HH9B 3A22A 2BRRH 3FUJA 2WZPA 4NQSA 3MV9D 4WHDA 4HFWA 4PY7A 1YPFA 4BKSC 2HUHA 5DN1A 4BFBD 1CR9H 3P0VL 4H8PA 1DWAM 1CENA 4R7JA 3FMGH 4PJ9A 4AMKH 4XBPB 1OZQA 1WH0A 4OF6A 3LBOA 4WO0A 2AVGA 2BXYA 3KE0A 4EBQL 3FQUB 4RK8A 2JCCE 1FQ9C 4QG8A 3VXSB 3B03A 2APWA 5DS8B 3HFFA 1SMAA 1KELL 3FUKA 3IPEA 4HN8A 2G0LA 4R2GD 5JH1A 4BQ4A 4S1SL 5GS3A 2NTFB 3O9NA 3PL6A 1RPQA 3ZKXB 1OSEA 1ICTA 4UFKA 1EQWA 3DENA 1XIFA 4DP7X 1OTTD 3TIMA 4M7LH 3L13A 5LAXB 2A1YA 4MNGE 1KXTA 2XV0A 2H6UA 3VOJA 4XNMB 5C2BL 1KTDA 3M1CA 4GW1B 1MY7A 3FRUA 4G6KH 1UWXH 2I1OA 4E9LA 1A7NL 5I6SA 1JNHA 2DEPA 2R51A 1DUYB 2Y6SC 3MI3A 1ZA6A 3KLQA 3GI8H 1MCFA 1ONWA 5J5DA 4RX0A 3ESPA 1AGBA 2VLLB 1NGPL 1C5BH 3KEHA 4FQ2H 3RUGF 3HRZA 1RHFA 1M53A 3MRBB 3IJSA 2R82A 1QTWA 2HKHL 2PLCA 3B3DA 1DBBL 4LVDA 4XD4A 1FWCC 1RVFL 3EOAA 4HIJB 3GG0A 1Q7MA 2PDQA 5F2FA 2B9BA 2GJ6E 4QTIH 1BFNA 5J8OA 4P4KA 2XZ9A 3GTHA 1EGVA 3W39A 1GH7A 2NLIA 1I9IH 4B9JA 3FSZA 1ZQ5A 2VFFA 1CG9B 2D31B 4IMKC 4FXKC 4LCWB 4BWUA 3W7IA 5I8KL 1QT1A 1QMLA 4LOEA 2INZA 2NY3B 2JB5H 5EC2B 1FFOB 4L61A 2K6YA 3EBIA 1GGBH 1RH8A 3KDOA 4AD5A 3P8JA 2QVFB 4PJBF 1VCGA 3KBHE 2Y23A 5B80A 4OCMC 4P5TC 1I2PA 2GC4C 4DRSA 2UV3A 2GSGA 2Y5EA 2VDML 3FQWA 1I8IA 4Y5XC 1RD6A 4BF7A 4ZMOA 4MVBC 1F11B 3EBAA 1PW3A 2GJ6D 3D2UD 3HV8A 5EIIA 1F6KA 3ZE0B 1EJSC 3CDZB 4F0HA 4YBLB 3GY1A 3AAZB 1BQCA 2BVOA 2Z7ZA 3KBVA 4NKIL 4PP1C 3U9UA 4J3OG 5CEZH 1G7LB 5FO7A 4AVOA 1FG2B 4PJFA 4ZTPL 1AL7A 1ASQA 4IOFC 1KCUH 3BT0A 1AY1L 2FO1A 1M3UA 3T1WA 2OFJA 4AY0A 2LU4A 3SSGA 1OGBA 4JMNA 3CUHA 1ZJBA 3GSNH 3S3CB 3CFJA 4GK8A 4Y8FA 3V7MA 3D39A 4KCTA 2WMPA 2HG5B 1QATA 5T5NF 3V4LA 2VT0A 3UPAA 1K8YA 4XI5C 5KTLA 1V7AA 4O5LL 1MEXH 5CAYB 3CYJA 4ZFOL 1P4LB 3VD3A 3L67A 4Z2JA 1XX1A 4BK8A 3B4UA 1HOCB 1MWAB 1DVQA 1NIEA 4E9TA 4I6KA 1K6QH 4D9RE 3O2WL 1E90A 1RVKA 4GYPA 1XRSA 2CHRA 4EX4A 4PRPA 1PYWA 2F7RA 2QXWA 3JZEA 1QWKA 1E71M 5D7LB 2IBZX 1UR2A 1OC5A 4L3CB 1H11A 1L7IL 5AYZA 5T1DH 3T4AA 1U8CB 3NQ7A 1U3ZA 3UBFA 2VM9A 5DHYB 1Q9LA 3VG0L 3GDKA 4M6AA 1JV5A 5TNVA 5C0AE 3WI9A 4FNQA 3RPIA 4NN5C 3P1VA 2FHCA 4CVXA 5AW2B 4FA3A 5IR1B 1ACYL 3ABOA 2ETWA 4O1EA 5GGVL 5DMKB 5G2NA 4DEWA 2A0NA 5F4SA 3B3IB 4D9RD 2IPJA 2WSDA 3WX7A 4ZENA 4QD2E 4NB7A 3B8TA 2YJLA 4QRQB 1OX5A 2KZKA 1AO7D 4N0CC 1VS1A 5TGBB 1KB5H 2LOEA 1YRRA 3ETSA 3T2QA 4WIQA 5C7VA 1OF2A 5I6LA 2WLIB 2VELA 1JK8B 4PHXA 3S2MA 5E0CA 1S3KH 4PTVA 2V38A 4BGLA 1ZAHA 2QTEA 2QGDA 3KJ6H 2AVFA 2XC8A 1PKNA 4U3AA 5IFJB 1V8EA 5C0AD 3F64A 3QPQC 2VOTA 3ZBMA 4DXVA 4H9VA 4Y9BA 4GRWF 3MCLL 5A6BA 3NJVA 1GGIH 1TTAA 5CEYA 1BDYA 2XXFA 5F7KC 1D9KC 2N0MA 4BEUA 1DYZA 3PBYA 3F6IA 3S1GA 5HYJA 1I53A 2BMKA 35C8L 5AOMA 2EAWA 1O5DT 3IJEA 1E0TA 4YE0A 5AVSB 4HU4A 2DZAA 1QP1A 4UV7H 5KSAA 3SJNA 1K2DA 1HHIB 3MRDB 4JO3H 3VCLB 4H83A 4LIQH 4E4PA 2W27A 3AMGA 4BI5A 1XC6A 1HZHL 4B5NA 4Q6YA 5F7DA 2NQLA 2FFCA 1OF6A 3UJJL 1ZT1B 2XPZA 1SJEB 4Y16B 4ZFCA 1Q8MA 5EIIG 1KXQA 4UZUA 4UM8A 3QUXA 1A1OB 1B3VA 2VD8A 3AIUA 2BC4B 3UYRH 3TQVA 1H9DA 4KI1A 2P5EE 2NXYD 1A5FL 4HX1A 4XWGH 3NPSB 5IG7A 25C8L 3R79A 2NUXA 2NUWA 1VHPA 1T83C 1TKKA 4HUVA 3V9CA 4BKLB 1OK6A 2P1YA 1ZDQA 3MROB 3QORC 4Z7VB 5FM5O 3TROA 2D7OA 2XWJB 4M1CC 4NZTL 5EBGA 4UMSA 1P0KA 2XG4A 3QG6B 4WJEA 2HRLA 3AYVA 1Q85A 1XLHA 4AH2B 1A3LH 1H7PA 3UTTA 2FGZA 1HDMB 2DMHA 1PZ5A 3STFA 1Z5HA 2X9WA 1Z0NA 2DQFA 4JZNA 2P5ED 2EDEA 4Q0XH 1ZLSH 3AU6A 5LXGL 1J8HE 3CAVA 1XMEB 3RVUC 2QKIB 2WQAA 2YLAA 5I1JL 3GLDA 3ZDXF 1ECEA 5HPMA 4GSQA 4PCPA 1OABA 5CD3A 3CZNA 2UXFA 3OYZA 1DXFA 1PKQB 4I2XE 1BG4A 3UWUA 2ZSVA 2I7OA 2G3XA 1OINA 1D5ZB 1U3NA 3KUMA 3D4ZA 4V1YA 3BP6B 1DXEA 3BV7A 5C09E 4J1OA 1MUJB 3G6DL 4L4VE 4HGKC 3PSWA 5EL1A 4L8DB 1S7QA 2P4AB 1ZPTA 5ITBL 1CICA 4FR6A 5CO1A 1XHHA 5JXAH 3CN0A 1G94A 2IXQA 3JWNG 1FPTL 2ICES 2VR3A 3MNDA 3O16A 4YXGA 3D50A 2VJ8A 3LB6C 5L8LB 4L8SA 5DFTA 4UTHA 5H8PA 3VD1A 3VI3A 4YFEA 1JZ3A 1J8HD 5JQHC 4E36A 2DPKA 5I71B 5E93A 4PYGA 3DMMD 1X5KA 4JYDA 3EJYD 3S88L 1EQCA 5D9SA 2NX5A 4OZ4A 3HE6C 2BIIA 3NJHA 1QSZA 3BSMA 3HNVL 3MRJB 5I76B 3STLA 4MJIB 1KM2A 3P9MA 5C09D 4TNWK 4Y7MA 1Q8JA 3WLJA 2FIRT 1SXAA 4L4VD 1EEQA 3KPLB 1NSNH 4PMOA 4TPRL 3UNTA 5AYYA 3M88A 3VXOB 1A4LA 1QPRA 5JW4N 1KZQA 1AQKL 2APSA 2IADA 3R2GA 1IXQA 3SE3A 1LEKA 1CZ8L 1QLEH 1AKJD 4UQBA 1YNQA 2JKJA 2JTYA 4QO1A 3DOSA 1NCHA 4XPAH 3FSOA 3MGOB 5DD5L 3FN0H 1YEEL 2XRAH 4WU5B 4H13C 1X9LA 5I1HL 5F3BB 4JFOA 4XZ4A 3OU8A 4F2MA 1J5SA 4GT7A 1FZMA 2NW2B 1PHWA 2OSLA 1SGJA 3X3GH 1HP4A 4AQ1A 4M48H 1OTSD 2VDQH 3JV6A 5DZPA 2B1AL 4PB3A 3HV9A 4Z7OE 5D93B 1FNGA 1YSOA 4HMCA 1XGEA 3PM6A 2XQYA 4BCZA 3LEYL 4U5KA 4JR9H 2HEJA 1MFBH 4CMMB 2YDQA 4ZSOB 5CSRA 4Y19B 4HLEA 1Q9WB 3MW7A 4GZIA 4CSZA 4MNJA 4R83A 5LVEA 4W70A 3NP4A 5CG0A 3VGHA 3UPWA 3GI9L 3D9AL 2R9HD 4E9SA 2DSZA 2OR9H 3DRTB 4LHUD 3MRLA 5DZOA 4PREB 1S78C 4MWAA 2E77A 1VFAB 1ROWA 4Z7WE 1UZ1A 4URTB 1OEPA 4A38A 4IW4C 3PDOB 4H20H 4HPOH 4OKVA 3FKRA 3RHWK 1RUQH 2YAEA 2CNCA 1C7SA 1GOOA 3DVGB 5HI4D 1GZHA 5T3XH 3VFLA 1UCBH 2Y1VA 4NASA 5KVGE 4C59B 4QRRA 1DL7L 2OMVB 3FTXA 3WDHA 2Z6IA 3QJTB 2OMWB 2JE8A 4LEQA 2A6KA 5EZIH 1GR7A 3L5JA 3PPSA 4JM2D 4KKRA 4KRMB 2YR1A 4TR9A 3FQNA 1Z9PA 3S6OA 3L6FB 4NBXB 3RHWF 3QC6X 1OGSA 1N0XL 3NQFA 4YHEA 2DMBA 2UY4A 2W0FA 1UZ8B 2P0IA 3B97A 3OMNB 1U8LA 2PUZA 3K4WA 3TSBA 1RP8A 3QR1A 4TL4A 1YHPA 1YXDA 2QDGA 2NV2A 4L37A 2FBJH 1ISWA 3SD2A 5GQBA 4WCYL 3BUBA 1QWGA 1CEOA 4RLIA 2ZX7A 4EIGB 4A05A 3BH9A 3RAJH 4IZGA 1T1XA 2IBGA 5DK0A 3EWBX 4LTSA 5IQ9A 3QUHA 1NMAH 4B0MM 4E2VA 3PGDB 4KJQD 3H42H 4DIAA 5ILTH 1GJIA 1SO4A 2GGIA 2AFNA 3CZ8A 2DEYX 3CPGA 1CB7B 5CM1A 3C87A 3ARSA 2E5BA 3F4NA 2UVFA 4JB9L 4Z5RA 4YXLL 3AYTA 3RG1C 3QXAB 3WKPA 5ICUA 5I1CH 3LJ3A 3E9AA 4P2CG 1SUXA 3MRIB 2AF2A 1VCFA 4R9XA 1YPIA 4WCJA 4UUJB 3LZFH 2Q7AA 2JFCA 3IFOA 3O0FA 4JHBA 1YEWA 2ITDA 3Q2LA 2R1PA 3LDBB 2X53A 2VFEA 2OZTA 4RXFA 5A6IA 3HUJA 3HFMH 4N4YB 1QR1B 3RVXC 2CM6A 5CEXB 2G97A 5K9OB 1HKLH 5JBEA 4MZ8A 3QUGA 5IVXF 5EU4A 4Y4HB 1KJMB 1MDRA 3E3QC 4PJDB 2UXGA 1N2RB 1PG7L 4YFDB 4H8QA 4WHYG 4XX1G 4DCQA 1J5IA 4QXTB 5E08H 5I0DA 3QUZC 4XNUL 2YDRA 4LMQE 4HA0A 2PYEB 3ALFA 2E7FA 3RX4A 3MLTA 2NCEA 5D2NB 2WVUA 5GJTH 1VBGA 5D7JB 2D2OA 2RQ8A 2DIKA 2XQYG 7ENLA 3AQDA 2X7LB 3K2MC 1S8DB 4JS3A 3ZIMA 1OAQH 4IIHA 3FBKA 1C5CH 3SJ3A 4OZHB 3ITTA 1GUVA 1NGXB 3EXJA 4UTKA 4UTIA 4TXEA 2JIWA 2F08A 1QFUL 2B59B 2NMSA 2HLFD 1LUCB 4N7QA 1EO8L 1FDLL 1I1RA 1V6WA 4R4BB 4XR8C 4ZNEA 3WV0A 1Q38A 1OD7A 3V9FA 1KR1A 4X99B 5EUKB 3WZ0E 3EO0A 3OAWA 1TA3A 1S7RA 1GGCL 4YVNA 1RPXA 5KVDL 2WAQA 4H6KA 2VCAA 1FYTB 5DHVB 1E27B 2F5AL 4P9HH 3HI5L 3SJVA 1CGXA 5B8CA 3VACA 3UGXA 3TWCL 2JI1A 3ABSA 1N9PA 4XO9A 2HVJB 1KV5A 3CV6A 3N12A 1OHLA 2KAUC 5F70A 4L4JA 3WNKA 5DR5L 2OS7A 5BRQA 2CDGB 4DFHA 4QLRA 9XIAA 3KPQB 2W3ZA 2ZOLA 3BDBA 4YK4C 5I02A 4UTFA 3GSWB 1JNDA 4PRDA 3FUMA 1X44A 1I9EA 4C5ZA 1DQML 1O6SB 4N2AA 2V3GA 1TITA 3GH7A 1WC7A 2VEKA 5T9CE 4LNYA 2LFEA 1PD6A 2R59A 2ZA3A 1A1MB 4FLHA 1QI3A 3KDMA 1BBDL 4O51B 2FDMA 3UABA 2F7QA 1EHAA 2X4OA 2A9CA 2LAGB 4QGYA 4HT1H 3J07A 2FSEB 1O5KA 4MVAA 5BQDA 3L3DA 4FQXA 2E6JA 4WNJA 3QQ3A 2EE3A 3SGGA 5CBEB 3BLDA 5BMFH 2EO9A 1K8XA 3TJLA 5SWQB 4QRNA 5J1SC 4LS1A 5DQJA 1CF8L 3T0EB 2FATL 4GA8A 2V69A 5TE7H 5FYKL 5E8PB 3IETB 2G96A 2HFGH 3LM7A 1RR2A 2B7QA 5E2UL 5F71A 4PYHA 5F7UA 3B9AA 1OGGA 3PWUA 1RU9H 5C0JA 4Q4MA 4GRSA 1RURL 4KWOA 3O4LB 4XB3A 4Y2DA 1E4IA 3P4LA 3L5XL 2WIIA 1YN6A 3RWIA 2XWDA 4F9JA 1GYNA 3WMBA 3T1FA 1NC2B 5EBLB 3X11A 4K2UH 1EZVY 2Q8ZA 1DSYA 3CHCA 4BQ3A 2XJLA 1D5IH 1KSRA 5JLZA 5LNWA 1TFVA 3W1RA 4MDOA 1WRFA 1A14L 4O54A 5DMJB 4J3WA 3DVFA 4AJVA 3GLEA 4HZ7A 3ORWA 4UT9A 4FG0A 5B38B 5TK2A 1GJWA 5CXPA 3LXCA 2R8SH 1DLFL 4APQC 2EKGA 3U6RA 1IXNA 3IDXH 1L9NA 4GMSH 1TYGA 2I26N 4P7QA 1INQA 1F3TA 1XX9C 3HC0A 1NLBL 3L5MA 1KV7A 4O11A 1J10A 3LQMA 4DWHA 2FGWL 1DKWA 3NSMA 1NEZA 3CLFL 4S39A 2W6RA 2OP4L 2V5MA 4QMEA 3N1FC 4X5QA 4KVCH 1W8NA 4R4FH 1JPST 3QNXB 2YFNA 5MHSE 4OZFA 3F7KA 1B3XA 4ORZC 3W07A 3O6LL 4I0CC 3BPNC 4L4TB 3KX6A 4JTGA 3G5YA 1BJ1J 2FB4H 2PRLA 5KOVC 2GK1B 3TV3L 3SCPA 1FGNL 3KYOA 1XIIA 1E7VA 1XJBA 4MQ7B 2C9VA 2C1HA 2DH3A 4ZXBB 1GTFA 3QDHA 4KVNL 3GBNL 4QYAA 1EL3A 2YEVB 1T0NB 5EOCL 3GIYA 3F00A 4H00A 2DQIL 2HH0H 2BX5A 2YBRA 2B7DT 4UTMA 2J3SA 2QHLA 1OP4A 1MCPH 3CDFA 4C60A 3SDCB 2V7NB 3KRSA 3BJSA 3C56A 4TU1A 3JTTA 5IREA 2C0HA 4L4MA 3N0AA 1TPUA 5EH1A 1PSCA 4CBZA 2EVFA 4C56E 3P4MA 5MHSD 2APBA 4IWWA 2AKMA 5E5RB 4HS3B 2ISWA 5FEWA 2CW6A 5ECVA 2Y36L 5D2XA 5D7IF 3E3HA 2ZOWA 1ME9A 3GHSA 5GGRA 4YSOA 1L3WA 2HRWA 2AK4A 3QFDA 2VDLB 3FJNA 4X7SH 2OZ8A 4Q8UA 3LHAA 1YRKA 2RFGA 3DGCR 1AG6A 1XFCA 3KHDA 1VLWA 3B5HA 5J1AB 1CK0L 3RDKA 5LCVL 1U5VA 3CNKA 4AYID 4K7FA 3WLOA 4Q8PA 3IGAA 4XTRD 4NENA 1P7QA 2EADA 3QFEA 4MKMA 3SCWA 1SFHA 4MMZC 3N13A 2B0SL 1HHGB 2NCMA 4C56D 1R0AL 2E9MA 4A3YA 4J1UB 2DBLL 4X63A 5T3ZL 2DWTA 5CU9A 4O57A 4RDQF 1JNEA 3KBJA 5ICXB 4GI9A 5ESAB 2V5TA 3LH2H 3OHXC 5CAKA 2DZTA 1WZ1L 5KVEH 3HZVA 2Z1WA 1F2QA 2WPGA 4AZGA 1SDDB 3GKZA 3DGBA 4U0RB 3G5VB 4PJCF 4W86A 4Y8EA 2H90A 3PGCA 5H4ZA 1BSIA 1YEKH 2DM2A 3R19A 5ECUA 1SY6H 4XVJL 1U41A 2JQMA 4DWDA 1LRTA 5LGJA 3LRHA 3MLUL 4ZFOA 3LNIA 4YH6A 4AKOA 1UA6L 2PS2A 1CE1H 2E46A 2GFBA 4QCFA 5D09A 3ARUA 3VXMB 3NFUA 4NGHH 3IVKA 4JPQA 3N6JA 3VWKD 3V35A 2EQDA 3QC3A 4KXBA 1N12A 1AGDB 1R19A 5BZXA 2CPCA 5KZCB 4ORMA 3VX1A 1R5IA 3MLXL 4IH3A 2DZSA 1TCMA 1J7VR 4YPJA 3KCPB 4NM4H 3S34H 3TYGL 3ZKNC 3W11C 5AHLA 4Q7NA 2F8OA 4MA7L 4NC2B 3XISA 4AX6A 1XAUA 5F0MB 3K6SB 5B22A 4WR3A 5HDLA 4E8CA 1K5NB 4OZFG 5D03A 7FABH 5H1WA 2R2HA 4IUGA 4K7PL 2YKLH 1JGVL 4JN7A 3WH6A 5CPOA 3JZUA 3NQBA 1R3HB 3G5EA 4JFHE 4PJGB 5KAQF 4BSVA 2FH6A 5FA4A 3IDIA 1YQVL 2YQBA 4DJED 2HMCA 3FOMA 4M7KL 2YD9A 3NABL 1PZAA 3Q8FA 2AXGA 2Y22A 4AEHL 1Y8BA 3UYPB 4ZE5A 3L4CA 4GI8A 1VBUA 1XCTB 1OK4A 4YLCA 5HVFB 3WKML 1YDYA 4D0DB 2DKUA 1S2WA 4W5ZA 2G9KA 1KBPA 1DBTA 3L21A 1TRDA 3BAXA 1UWGH 3GKWL 1XL4A 1DQXA 5DWUL 4Q4IA 3LHPL 2Y6TE 3LTVA 2NX9A 5EFIB 1JPFA 4JFHD 5EEVA 4F7TB 2WWKO 5AOIA 4GNJA 4XXCA 4LVNB 1DBAH 2PTDA 2E09A 4WW1B 2WKJA 4HC1L 3GMNB 2D03H 5D02A 3DDGA 2VX7A 2BVEA 4KAQH 1XH2A 4MS8D 1HZLA 4NNAA 1QLFB 1KIQA 3LN4A 2VSKB 4J8QA 4UCGA 1S9WA 3CIWA 4M0XA 5E5CA 3AYRA 4ENEC 1D5RA 2XA8L 3ZZSA 4RDYA 1N67A 3H0TA 2D2HA 3FO9B 3PUUA 1RZ8B 4FNSA 4DI9A 2YD4A 4P2RA 3OSKA 4QHMB 1YPZE 1KN2L 4AQEA 4IDLA 2CCVA 2K3TA 3FCTB 4ISVB 1X1ZA 2NSMA 4ZI8A 3LU2A 1G7MA 5GS0C 3MQTA 3KVKA 2J47A 4FFZH 3WF3A 3CQJA 2GJZA 3FJ6A 2HRPH 4B4FA 5ACZA 3VU2A 4JG0L 2G5BA 6PAZA 2AHIA 4QJ4B 4L56A 5K69A 4X80H 4JEJA 2WB5A 2WWNA 3BWAA 5AL0A 2XDFA 4X6DE 2QV4A 1WDRA 3GTNA 4EIZC 1J5OL 1IM9A 4QWWD 1O5QA 4P46B 3CO4A 5FO2A 1N55A 2R69H 1A5UA 3QJSB 4A2MA 3REVB 2OR2A 1JZEA 4DEFA 2CKBB 4OKDA 3GTIA 4BDVB 2DORA 1T7VA 2GZXA 4KROC 2FWSA 3RI5K 3GSRA 1TR9A 1PZCA 3RA7H 1FDYA 5FKAB 3ZL4H 3CH1B 3W1AA 1BFSA 4NQXA 1FKWA 1YECH 3R4RA 4NQCA 3PJUA 4O2EB 1J86A 4NVTA 1KM0A 2WUBH 4X8JB 5LIWX 1G9NH 3ZE0F 2X6CA 1RLWA 5SX5K 3AWNA 4NERA 5K1VA 3F7JA 3F7YB 4TLSA 1LWHA 1W72H 3D3VB 3OZ9L 4XMKH 1RXOB 2QADD 3LGEA 3QEQE 1VADA 1W17A 2D8KA 3OKKA 4RQQA 3WQCA 1PZDA 2BVQA 1EGMA 4NI8A 1CYWA 1WBXB 1TZ8A 1YUHB 1RUAL 1H15A 1RCQA 1QASA 4PS4H 4B3LA 2W9DH 3NYKA 3W85A 2ZXGA 4H6EA 4GAJH 1RZGA 2LLNA 3QB7C 4E4FA 5D72H 1A80A 4OFPA 3RF9A 3CFBA 2YCLB 4P61A 3TYZA 2BVTA 4Z1BA 1QZNA 5GJSH 2JI2A 3BG5A 1BIIB 3HTLX 3TTEA 2IG2L 4X0NA 2YWYA 2PC8A 3NCYP 5M17A 3ATZA 4GRLA 3RCNA 2IXVA 2GY5A 2EC9T 3B7TA 1NAL1 2RDWA 5GISH 4Q8OA 3CL6A 4Z9KB 1NC4D 1PY4A 3HI6L 4I5XA 4R5XA 4NQ1A 2BW4A 2HAZA 3EH2A 3QEQD 3RY6A 5AYXA 1T5XB 3MBDA 1KIRB 1H3GA 4EWND 4V33A 1N2VA 5JPMC 3N11A 2WHJA 5C0BA 2D7NA 5DF0A 3VUAA 1FRGH 2IPKA 2VGLM 3W6MA 1Z5LA 5F72S 3RBGA 1F6AA 1KEMH 3ZN6A 5IMLB 1O5RA 3Q5YA 3VFWA 3CMGA 4XH2A 2OR7A 1MF2H 5AC6A 4H25B 1JVKA 3RVVD 2JIXA 2CHOA 5TK4A 2ERJB 3N91A 4F7CB 1UOKA 3UPRA 1JK9B 1T04A 5A6LA 3QAZB 4W6WB 3EFFA 4LCYA 5CH9A 4XE5B 3KLSA 2PLTA 4X8GA 2W94A 4EXAA 5SWSE 2WN2A 5AFDA 3EKZA 3SCMA 1J96A 1T20B 2OKMA 1ML0A 1MFMA 4BUGA 3II1A 4PMJA 3IXTA 1JFXA 1CC3A 3IUIA 5C0NC 4LLUB 4GYBA 2XN9A 2IAMA 1TJPA 3DHFA 3RUBL 4HPYH 1LQBC 4YS4A 3EGXB 5I79A 3W1NA 2CALA 1WAUA 2RCSH 4GGHA 4ZMTA 3QNYA 3RU8X 1T6BX 4Y9PA 5H4YA 4POYA 3IJDA 4OU1A 3CTTA 4F58H 3BCDA 4XKMA 1DCEA 1IGMH 1Q7QA 3CFNA 3MJGX 3FPXA 4S1FA 1F97A 1P5BA 1O7AA 5DFWH 3QEHB 1T03H 1U91B 1IT7A 3UTSD 4U7MA 1QYGH 5SWSD 3I75A 4R5TA 3SB3A 1FNSL 3BP5B 5AHEA 4B5UA 3MRGA 4ODTH 2WMHA 3NIDB 1F3JB 1G0DA 4FQHB 1MQPA 3CEUA 2ZQKA 2DWSA 3QLDA 4W9JC 3I9GL 1O12A 3I68A 3FONB 2G2NA 4GX9A 2ZOUA 4JXCA 2OTDA 4BEIA 5EBWA 2CDFA 3RR1A 3J8F7 4IMAA 4MKVA 3RWGB 4U4IA 3DNKA 4R34A 5I00A 1MIEH 2Z0UA 4FFWC 1MFEH 4WO4A 5AVHA 3IJ9A 3O6KH 5DRWA 4L48A 2CO7B 3ZHKA 1ZV5A 1QW8A 2QCCA 3QIBB 3N9GH 1AD4A 1YYLL 4M1RA 4FA8A 3U4BH 4O2FB 2QDEA 3E96A 1IC5H 2FNBA 4K39A 1F4WL 1X7TA 2D2GA 3N3TA 3APDA 2BRRL 4Z7VF 1EGJA 3GNNA 3MREB 2X3CA 4YGVA 2RQEA 1CR9L 4LVOC 1IKOP 1ZHLB 4AMKL 4WJ5B 1C29A 4F8TA 1XZ0A 4HOWA 2OL3B 1XFBA 2J27A 4M7ZC 3P74A 2E6PA 1I85C 4Y9OA 4IRJA 4QGCA 4MYAA 1XF2B 4CNOA 2QPSA 3WHXB 4AT6A 2HPTA 1QPKA 4X61A 1QW9A 3C5ZC 3C0QA 4RGMC 3LN9A 1CDBA 3V0GA 5AVYB 4WSHA 3LLXA 1IEBB 4V2CB 2V2XB 4L9LC 1D2KA 3GHPA 3MMDA 1UT2A 4TUOA 1PB0A 1XG4A 3GD1C 4C65A 1H5BB 2CG9X 2AJ3B 1IGJB 1W9PA 1L4IA 3L66A 2QELA 2QT6A 5D1XE 5EMMA 4KK5D 5F7NC 2YLHA 4WF7A 2I5QA 4GQPH 3EFOB 3A21A 2AS5M 2OMZB 4MYPA 3EDJA 1A7BA 3HCVA 1IXOA 2FJGA 4R7WA 4GKSA 4XBEH 1XIWC 4G6KL 5F2MA 5FAAA 1MFVA 4U3XA 4U1NA 2B08A 1J79A 3C5JB 3DC0A 3W24A 4M82A 1ES0B 1KGJA 2DI7A 4GP4B 5KUMA 2IANA 5TPWH 3DHDA 1C5BL 4MKNA 1IEIA 4R7NA 2YD5A 5ALCH 1V0KA 5EOTB 4FX5A 4WEUD 1MAMH 32C2B 1GOIA 4C6OA 2Z4QB 3WNOA 4DP9X 1N0LA 4JKPH 2P80A 4HHWA 2Z31A 1HILA 1O4UA 4QTIL 4D9LH 4KWUA 1XF4A 4YJ5A 5D1XD 4ZB2A 4H1LB 3OLDA 3MNZA 1A6TB 3T3PE 1U1UA 4JTEA 1GOFA 2CUIA 1I9IL 1MI5E 4PUNA 1XR8B 4ATDA 4HPJA 3T44A 1QOQA 5E6ZA 3PP3K 2JB5L 3TPUA 2CBIA 5AVTB 3FU8A 3GIQA 5FFLA 1AZBA 3PPFA 1GGBL 4IMFA 2Z35A 3T0XA 3RZCC 4MDJB 4GKZB 4MMYA 4GY1A 2CCRA 4Z78B 4TQIA 2X1RA 2VW6A 4TF4A 4E42A 2FJSA 4P2OD 4BSWB 1ZB5A 1FHNA 1EX1A 1A5LC 1AS7A 4G2AA 3W9DA 4HPNA 5JPNB 3LBCA 4JTKA 3NQEA 3UZJA 1V0MA 1UXMA 3MJ7B 3ORJA 2EIDA 3TA6A 1RAMA 2NVDA 1EV2E 1FO0H 2VFDA 4L1HA 3N85H 2FZNA 1QSEE 4JJ5A 1MI5D 4XP4H 3DI0A 3VOHA 5L0QB 3MRFA 2HT3C 3GFZA 3QIWA 1Y1DA 1DQJA 1WTLA 2W0PA 4QRBA 2DIBA 4LBAA 3GG8A 2ZUQC 4LCCC 4G82A 5CEZL 1DN2A 3ARFA 2I5IA 4QXUH 1KCUL 2VZ3A 4KI5E 1ZALA 4GABA 4BQ6A 2O6PA 5DMIH 5FDWB 1QK2A 2XV3A 3VRLF 3H2EA 4I5BA 3NZRA 3GSNL 3IS4A 3QJFA 3CFUA 3L0KA 1THFD 1G7HB 4BF5A 4AW4A 2Z93A 2ATSA 4XO5A 4L1SA 2K4AA 2WQPA 1BVLA 1MEXL 3VB9A 1PTDA 1UWQA 2EIKB 3QXBA 4EPBC 2WHVA 3QIUB 3TN3A 1R3VA 3V6ZA 1I8KB 4WWKA 3EOBA 2Z8RA 2XFXA 4AD4A 1DLHB 4YU1A 2BWQA 3C60D 2YXGA 2OMXB 4JRYA 4NKOA 5CBJA 2QPUA 1T1ZA 1QSED 2AQWA 1K6QL 1J2BA 2JJSA 4PLKD 5EB9A 1E5UI 3U7VA 4JQ1A 3GC5A 3ALPA 5C0CB 5GGQH 4UQIM 4NPYA 4LHJB 2OZ0A 2D23A 1I8LC 1EX5A 3T2OA 4KI5D 3OJ2C 1AD9B 4DNHA 5T1DL 3BQUA 3GM8A 4ZCWA 5DBTA 2GBAA 3DXAE 4EI6A 4EOWH 5DJ2B 3CSYA 1TPEA 1J01A 1KJ2B 1A21A 4XZBA 4D9PA 1J5HA 1IE7C 1XRTA 2Q3AA 3P84A 2VDOH 4OE7A 5E0FA 4I4WA 5EZJB 4KUCD 1TTGA 2GSIA 4H44C