2JGYA

The crystal structure of human orotidine-5'-decarboxylase domain of human uridine monophosphate synthetase (umps)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
257
structure length
249
Chain Sequence
SMELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords UMP SYNTHASE
publication title The Crystal Structure of Human Orotidine-5'-Decarboxylase Domain of Human Uridine Monophosphate Synthetase (Umps)
rcsb
source organism Homo sapiens
total genus 93
structure length 249
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2007-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2jgyA00
3C61A 1GG1A 3G18A 3YPIA 3SGZA 4NUWA 5F4XA 3W71A 5BNKA 2E68A 5D2VA 2ZA1A 4GE8A 1SW0A 3F4NA 4UTIA 3SFKA 1KM1A 5FI8A 3PULA 3I7RA 4MZ1A 1ZJIA 1JQVA 4M6PA 4O8RA 2C15A 3S9YA 4OT7A 3BGJA 3G1HA 2VFIA 1QPNA 1PV8A 2E6AA 1OFEA 1S3HA 4E2BA 4TMBA 5I3IA 3EWUA 2H3DA 3W88A 1THFD 5CPNA 3GZ3A 3TAKA 3NYZA 4XKYA 3PAJA 1JUEA 4UNKA 4NQ1A 3DZ1A 5F2GA 1LRTA 3OIXA 2RDWA 1P1XA 1F6KA 2ZZ5A 1TIMA 4Y8FA 3UY7A 1X7FA 2C3ZA 1L6YA 2PRLA 1SW7A 2ATMA 5DXYA 3GAYA 1HL2A 2ZRUA 3D0CA 1WDWA 4TU1A 1GVOA 4O17A 2GVGA 5K2ZA 2QUTA 1F6PA 5HR6A 1NAL1 2WSQA 4NX5A 4DEFA 4BFAA 3ZR4A 1JCMP 3GLCA 3S5NA 3OHIA 1D3HA 1TPB1 1PS9A 2C18A 4JTLA 4GBUA 5AHMA 4HN4A 3WJZA 2G97A 3THQA 5KITA 3LOTA 5EYWA 3QSTA 1H60A 1V5XA 4RK8A 1KA9F 3U2OA 5IBXC 1VH7A 1G67A 5DXXA 4X9SA 3W7LA 4EIVA 1Z41A 4XUGA 4XBSA 2V81A 4RXFA 3G3MA 2A6LA 2D73A 4UCGA 3G1DA 4XWUA 3UXDA 3HBLA 2YYTA 1TYGA 4UUIA 4ICNA 2ZTKA 4CQ8A 2A2IA 2LLEA 1KLZA 2FPVA 1DJQA 2YW3A 3N9SA 3DKLA 4UTTC 1LM1A 1QMLA 4DO4A 4HNUA 1XBZA 1N7KA 5K3VA 3FKKA 1JVNA 4O0ZA 4I7WA 1H5YA 2HMCA 5EKYA 3TJXA 4MUZA 3LLFA 3BLFA 2ZRVA 3USBA 4UXDA 1AW5A 1XKYA 3PUEA 3DFPA 5U7SA 2CU0A 4PA8A 1VCVA 3FOKA 2J6XA 4MY1A 2FJKA 2TMDA 3KVMA 3I7QA 3NAVA 1LZOA 4DBEA 4RR4A 3W1XA 2A6NA 2ZTJA 2OT1A 3BVJA 1A53A 2ISWA 2Y7FA 5FF4A 1MO0A 1JULA 1WOBA 3UQNA 1H51A 3M5ZA 4LS1A 3NOEA 3W7HA 3NDOA 3P81A 4MY8A 1AW1A 3UY8A 1U5JA 1E51A 2ABAA 3GXTA 4WUIA 2NZLA 2DZSA 3TSMA 5F4WA 4CLMA 3LCHA 2A85A 4YWIA 5E1QA 3DFQA 2QUVA 4NVTA 4NZJA 3BPWA 5CZJA 1H1ZA 2GJNA 1RD5A 4WX2A 2ZZ6A 3G0UA 3W75A 3CB8A 3ATZA 1EWDA 4WOZA 2ZYFA 1B57A 4Q4KA 1D9EA 3M43A 1W5OA 1TQJA 5DELA 1SO4A 1KFBA 1LOLA 4CNNA 4WOQA 2CLFA 3I7SA 1FDZA 3LERA 1I2NA 2YXGA 3TFXA 1KTCA 3TH6A 1YADA 4U4MA 5AHFA 4JS3A 1SZFA 5AC6A 2Z6JA 3DXIA 3EX1A 5J5DA 5K9DA 3TNOA 1KM2A 4HT3A 1EPXA 5LHFA 3S5OA 3W72A 1RPXA 4HSNA 1ZNNA 2Y7EA 2Y89A 3OG3A 1VR6A 1ALDA 2O7QA 3FYOA 4S1FA 4YCOA 1KM4A 5D02A 4EF9A 4GNJA 2WNQA 1GZGA 2YFOA 1T0OA 3HGRA 3IVUA 4AHPA 3NEVA 4H3DA 4ADTA 3HB9A 3SR7A 3B05A 1VLIA 4L4LA 3S5ZA 4S2CA 1UASA 3KOFA 1SFLA 4LC8A 1KFLA 4WY0F 4WY0B 4L4MA 5IBXA 3L0NA 1AG1O 2OX1A 1DKWA 5HQEA 2V0TA 3NL3A 5D2WA 2QCLA 3W1TA 5F2MA 4NNCA 4JDBA 5AHLA 3B0VC 1S5WA 1TREA 1YLVA 3AJXA 5LZLA 2H8XA 3LV6A 3U8GA 2VFGA 1S5TA 3P61A 3EWXA 1XDLA 2QJGA 5A5WA 4UTKA 1LTDA 3G24A 1OFRA 1QFEA 3G22A 2CZDA 3JS3A 4I9AA 3TX9A 1JCNA 2WKJA 4H6KA 4N02A 3UZ5A 1F5ZA 4GC4A 3TKFA 5G1YA 1GJPA 3RF9A 1LOQA 3DHFA 3E49A 5C55A 2QF7A 3W1LA 3W23A 3EX3A 4A2RA 1XUUA 2RDUA 4N9BA 3PM6A 2OT0A 1OABA 1WYIA 3LTPA 1TTIA 3F1QA 3C6CA 1YPIA 4HNNA 4IXXA 1A5SA 3AO0A 2V2HA 1TSIA 3NQFA 3W22A 4LW7A 1WXJA 3MYOA 3TR2A 4CCCA 2V2DA 5DY2A 2O7SA 5KZDA 2QCCA 4UMBA 2PE4A 1RQEA 1H1YA 4M5PA 3QQ0A 3R8RA 3DENA 5FF3A 3MYPA 1KLYA 2CLOA 1I45A 3P5YA 4Z0JA 5I3JA 4OV4A 5LNVA 2P10A 1X8FA 1JCLA 1OFPA 2ATSA 1LCOA 3TQ0A 4IJBA 1BKSA 2B7PA 1KFJA 4LUJA 3LHWA 4Z0SA 1VRDA 3ATYA 3SJ3A 2Z1BA 2TRSA 4LVFA 3W70A 4KFPA 1YXDA 3BG3A 3SGUA 4N9CA 1Q6OA 4JTKA 3SIZA 1VCGA 3NQDA 2P1FA 4UC5A 4AH7A 3OVQA 3KRSA 3F03K 1OHLA 2Q8LA 1K7FA 3LCGA 2DU2A 2RFGA 3B03A 3A24A 4Z1CA 1JCYA 3W7NA 1ZAHA 1Q6QA 5BRBA 3B04A 3TE9A 2HTMA 3EX4A 4LT9A 3UWWA 3MW7A 4LU0A 1TPFA 4FNUA 4OE7A 5AC7A 1TPDA 2ZA3A 3KRUA 2YFNA 3W7CA 4FB7A 4AWSA 1F05A 3EWZA 2C13A 2CLMA 2WQPA 3O15A 3LHYA 1YDVA 1VLWA 1DQXA 4QISA 4FXRA 3F4WA 4O1AA 3FEMA 2QCMA 4HSOA 4JGDA 4PL1A 4TIMA 2Q3RA 3CHVA 5I3KA 5G1TA 4LUIA 2QCEA 2ISVA 3M5YA 4JX4A 3KFTA 1H63A 5EY5A 1OG0A 1A5AA 3HOJA 3EX2A 4ORMA 2FPYA 3B4UA 2YX0A 4B5NA 2E6YA 1GTEA 2VFEA 4YLWA 3BGGA 5L9FA 3HF3A 1GQNA 2YDAA 4KFNA 3QM3A 4MKNA 4FXSA 1O4UA 3PBWA 1W3TA 3NM3A 3DFOA 4RZ4A 3QYQA 4O53A 3U6WA 3IEBA 2DZXA 1TPWA 2E77A 4NXKA 2Y62A 3LCIA 1BWKA 4Y9AA 3CM4A 3L0GA 4DF2A 3LDVA 3WK1A 5L6UA 3E02A 3EWYA 1AL7A 3IVSA 3TC6A 3B06A 2ZRWA 3DFNA 1QDSA 1IIHA 4DF1A 1O60A 2VFFA 2YYUA 4RV8A 4K39A 4IX2A 3ABQA 2EKCA 4CQ9A 1TJRA 1I2RA 3MBDA 1EP1A 4RX0A 2QDGA 2RKXA 3HQ1A 3LTSA 3R89A 5SWUA 2CLEA 3LRLA 1RQBA 3NPUA 1L6SA 5T26A 3ELFA 3WJSA 2V82A 1ICQA 4RLIA 3W2KA 5K4ZA 1W5MA 1EP2A 2A7RA 3EWBX 3LCFA 3GXNA 1SZNA 3O07A 1T99A 1GTHA 1WV2A 4JTJA 3A21A 3MP4A 3IGSA 3NG3A 1VS1A 2ZZ4A 3VE9A 5AB3A 1FCUA 2BLEA 2J9XA 4TX9A 1OFBA 3C2VA 3NQ2A 3LCWA 2EF9A 3P62A 2R8WA 2A0NA 3EKLA 5J5RA 4NJIA 4IMCA 3KVLA 3QFEA 5BMXA 4O11A 8TIMA 4BWLA 1GVRA 2HS6A 4AF0A 4RJEA 3TAOA 4O18A 4WQ6A 3EXTA 3NQ8A 2FPTA 3DBPA 1A50A 3MI2A 1EA0A 2Y7GA 4LTSA 4RCXA 4UTHA 3P82A 1OFQA 1XL9A 5LNUA 1ZHAA 2DZWA 1AW2A 4ONVA 4QAIA 3V75A 5K9CA 3PB2A 3H55A 3W2LA 2OZ0A 5CKSA 1SQ7A 2RDTA 4O15A 1GG0A 2ALDA 1L2UA 4UTWC 1UBSA 5G4WA 4QSHA 2WSRA 2V5BA 4LS0A 4MLRA 5ABTA 1XBVA 3G0SA 2Y85A 3CEPA 3UWQA 3A9IA 1J5TA 3ZFHA 5LNWA 4X22A 1G7UA 2V8ZA 1LROA 3G8RA 2A21A 4M7TA 4IGHA 3LCXA 1H50A 3HGSA 1DBTA 4POCA 4QITA 1GYLA 3T4CA 3C2EA 1N55A 1LYXA 5D09A 4IPJA 1YXYA 4WXYA 3O6YX 1OK6A 5C5YA 4FHAA 1O94A 3S1UA 4FNRA 1HFBA 2WSYA 3JRKA 3PBUA 3RU6A 3T55A 3QZEA 4JTUA 3TXZA 4LRTA 4UTMA 1JCXA 5LNSA 5A8GA 5KZEA 1F2JA 1VHCA 1DQWA 1H7RA 3TROA 3C52A 2G5WA 5DY3A 4H4IA 3W7IA 3PG8A 1WA3A 1FWTA 3BARA 3I68A 2VEIA 1KFKA 1SW3A 3TCEA 1PCKA 3R5EA 3EB2A 3W1UA 1R2RA 1UB3A 2PC4A 5FEXA 5DBUA 4LVAA 5FEZA 1QCWA 3QW4B 4MLJA 4Z1BA 1ICSA 1WAUA 5HNRA 4IMGA 1B4EA 5HINA 2FB2A 1FCBA 2E1DA 2H90A 3HG2A 1VGAA 5E93A 4UFLA 1VYPX 3GNDA 5LSMA 1QWGA 4E2DA 3NQEA 1XI3A 1SU5A 4GJ1A 3Q94A 2VOMA 3TMLA 1GWJA 3LX9A 1TTQA 2E09A 1R30A 3LHTA 1KV8A 4K38A 2JGYA 3W7KA 3KHJA 1LRNA 1SZGA 1UUOA 3C4UA 4ZQPA 2NXIA 2AAMA 4K8HA 1RV8A 2CLLA 1ZY9A 3W1AA 5HMSA 1NEYA 3MI6A 5LKYA 4XBKA 3W7QA 1OYCA 3G1XA 1AL8A 3N73A 1TPUA 4UR8A 1VC4A 1FXPA 4O52A 3W7RA 3O8AA 4JYFA 4JX6A 4MYAA 5CZSA 3TA6A 3LB0A 3NNTA 5K7JA 1PCWA 4A3UA 2BWGA 3C8FA 4PC8A 3TSDA 2ABBA 3T44A 4UTLA 1J2WA 3P67A 2JKEA 3QPYA 2YPIA 2A4AA 1G4TA 3DFTA 3W7EA 1OF8A 4OV9A 4NNAA 3RNDA 3W7DA 4LV4A 3QPZA 4KFOA 1ZAIA 1FDJA 3E96A 3L9CA 1Y0EA 2QUUA 5KSWA 1Z42A 1MEIA 4PH6A 4A2SA 4AEOA 3WJYA 3QMTA 5BOOA 1XBYA 4M6VA 1KFEA 3HJZA 3LM7A 5BMWA 1OJXA 2Z2UA 1FCQA 3B8DA 3TQVA 1F7BA 4Q32A 1O5KA 4DF0A 1KTBA 3CQ0A 2WPBA 4TR9A 4LWWA 3RMJA 1X1ZA 4UTWA 4LS2A 2CLIA 1Z44A 3MI3A 3R12A 1KW1A 4I7UA 1MEHA 3B0PA 4ALDA 2VFDA 1OVDA 4NT0A 4GXMA 5AYYA 2X1RA 1RR2A 1QOQA 3LHZA 4JY9A 2X16A 2GQ9A 2J88A 3CC1A 3HG4A 1K8ZA 1Q3NA 5CPOA 4R53A 3HGOA 4M6QA 3VFLA 1TPEA 2ZBTA 3QEZA 3DHDA 5FF2A 1TPC1 1UUMA 1GVSA 2J9ZA 4ZL1A 3ABSA 1GYNA 2NWRA 4HNTA 1KBIA 2ZZ7A 3I65A 5DCDA 1OYBA 4IPIA 3PWAA 1FX6A 2QJIA 1I4NA 2QCDB 2DORA 2ZRXA 2QCHA 3CU2A 4UMAA 3SI9A 2R14A 5HULA 1TTPA 3G1YA 1QPRA 1V7YA 3C2OA 2C0AA 2WNNA 5AC8A 3O16A 3IIVA 2VXNA 4CNPA 4FX8A 3M16A 4A21A 4GUHA 4GUFA 4JYEA 3EXSA 2KZHA 2I1OA 5D30A 3KRZA 4AB4A 1M5WA 3QW3A 3DAQA 1YXCA 2NX3A 4QQ3A 2WO5A 1EUAA 1FY6A 1FXQA 4O1BA 2QAFA 4DBDA 4AHOA 1ZFJA 4EVZA 1B3OA 4MIMA 3G8EA 3S1VA 5HUPA 6ALDA 4FX6M 4XTDA 2CLHA 3LHVA 3S1XA 3HGJA 5HUOA 2DJLA 3NO5A 3Q58A 4OHQA 3VKJA 4ADSA 1VPXA 4UNLA 4FNQA 3HPZA 1GPWA 2R94A 3L5AA 4IXHA 1EX5A 4CNOA 4XZ9A 4MVAA 4WY0A 4AWUA 4MZ8A 3NL6A 3BG5A 4A29A 2YW4A 4UTTA 5CZ0A 3TUUA 4EF8A 3EX6A 3MHGA 1GVFA 3S0CA 3A5FA 3B0UX 4AAJA 1ME7A 2C1HA 4DO5A 3ZS4A 4GFSA 2A7PA 4OBTA 3GB6A 4JTFA 5DCBA 3FFSA 3WK3A 4DQWA 1OX4B 1L9WA 4O4WA 2Q3OA 4Y96A 5FF7A 3GDRA 4JTIA 5F2IA 3CIXA 2I9EA 4IWWA 2VEMA 3IIZA 4BI7A 2NUYA 3TSBA 4RZ6A 2ZA2A 3CEUA 1SFJA 3C0JA 3QH2A 5C6MA 1JRBA 3GDMA 2ISSA 4HPXA 1IGSA 1H7NA 2Z0IA 3W7MA 1YDOA 4Z1AA 2HSAA 1NVMA 1QR7A 2XFWA 5HR7A 1HO4A 2B7QA 4Z08A 2V30A 4JNMA 1JR1A 2DP3A 3L5MA 4G1KA 5D37A 1W0MA 2BXVA 3NVTA 1TPVA 4M19A 5AYXA 3N2MA 1YTEA 1TPH1 2XN0A 1YPFA 4LRSA 4LVGA 2ZQ0A 3KVKA 5LGZA 4JTEA 5LNRA 4ZVJA 5AN7A 5MHBA 3FJLA 4JICA 1ML1A 4UR7A 4IMFA 1BWLA 2NWSA 4DELA 1R2TA 3PSWA 1XXXA 1SO3A 4O14A 5FEPA 1D3GA 4OWGA 1FWWA 3STGA 1T8XA 3P80A 2I14A 3GXPA 4N4QA 3W7JA 2FFCA 3FYPA 3W1MA 1JCJA 1I8JA 4PFMA 2PRMA 4R7JA 4AVFA 1SZEA 2YZRA 2X2GA 3FJ6A 4R34A 1LLWA 3DI0A 1L6WA 1PIIA 4IMDA 1IXPA 5KZMA 1K3UA 1OX5A 5EL1A 4PEKA 3ABOA 3NQMA 5FF0A 4MFEA 3W2JA 4LY8A 4NZFA 1CW2A 4K7YA 4JTHA 2EGZA 1DOSA 3WJXA 3NM1A 4Y6GA 3FIGA 3GK0A 3HPXA 5D33A 5G2HA 4O0KA 3BW3A 5TQLA 1KM0A 1FWNA 4GRSA 2Z6IA 4QM1A 1OYAA 3BG9A 3G1VA 4BF9A 1BTMA 4UMCA 5CSRA 3KXQA 2EAWA 2QJHA 3LHUA 1FBAA 2Y6ZA 1JUKA 4Y90A 5I3GA 3ZWSA 1ZENA 1OFDA 3LGEA 1R47A 3P7YA 4FNTA 2B7OA 2YSWA 2GPTA 2QKFA 3W76A 3L0KA 5AOUA 3CT7A 4P2VA 1ZALA 1G4PA 4HHPA 2FLIA 3MUXA 2FQIA 1XC4A 1KV5A 3PUOA 3WFAA 2QAPA 3GNNA 3DU0A 3IRDA 4JN6A 1EB3A 4NNBA 3EWWA 3L68A 1UCWA 3NQ6A 5K9XA 3NXFA 4UTUA 4MY9A 2C19A 4C1KA 1KM3A 2ZDRA 1M6JA 4RKAA 5G5IA 4NX0A 3Q2DA 1WBHA 3MHUA 5TIMA 3M0ZA 2E6DA 5CG7A 1G4SA 3TC7A 1TO3A 2JKPA 5D04C 3SSJA 1FQ0A 1Q45A 3N19B 1JRCA 1LBMA 5FEWA 3BV4A 1DORA 5U4NA 3FA5A 2BZNA 2JKAA 1LDCA 2OCZA 4MOZA 2DZVA 2NX9A 1YTDA 4O54A 3TK7A 4NJKA 2HS8A 4DPPA 3W1QA 3TQKA 1YDNA 5CPMA 5HWNA 2VFHA 3NQAA 1BEUA 1ME9A 3L65A 1O5XA 3OVRA 7TIMA 2CZ5A 2VC6A 3QJAA 4XTIA 2FB3A 3OEXA 1Q6RA 1WX0A 2TPSA 3M1ZA 2NUWA 3W87A 4K37A 3DI1A 5KINA 4FX7A 5EPDA 1OFOA 1NSJA 1LP6A 5DBTA 4JY8A 3UYCA 4I7VA 3PVFA 2NXHA 3SW6A 3GDKA 5AYZA 4UFMA 1XUZA 3PG9A 1W1ZA 3NL2A 1MXSA 3W1RA 4RZ5A 4NJHA 3L21A 3PS7A 4UIOA 3NL5A 3N3MA 1W8SA 3MJYA 2W79A 3OA3A 5HWJA 2NV1A 1JQXA 3S42A 1B9BA 5FESA 4PL2A 5AHIA 4WXZA 5C54A 2NLIA 3IIXA 1KFCA 2DZUA 4ZQMA 1GOXA 3CIWA 5EMUA 4XKYB 1AK5A 3ZWTA 5D2XA 4AHQA 3BLIA 1UJPA 3NQCA 2Y61A 2FTPA 1W3IA 3M5VA 4YXGA 4JEQA 3GKAA 1QPQA 2AQWA 1SSDA 3N34A 4NU7A 2Q8ZA 4KWVA 1Q6LA 4BI6A 6TIMA 4FF7A 5F1VA 1VZWA 1R2SA 4O13A 5IM51 3IV3A 2B4GA 3N9RA 3DFSA 3PC0A 1HO1A 1IIGA 2ZZ1A 1VCFA 3V1PA 4UTJA 4K36A 3GYEA 3W7OA 1QNVA 1EEPA 3L5LA 3G1AA 3LXAA 5DLCA 3QC3A 2P0OA 2X30A 3HPSA 1TB3A 4K6AA 2X1SA 4AMAA 4C1LA 3A5VA 4S2BA 3GAKA 4O50A 5E0KA 1FCVA 2BX7A 5D05A 3KAOA 4KWWA 1W31A 3W2UA 3RFAA 3M6YA 4YCPA 4RXGA 4ZQRA 5AHEA 4FNSA 2X1UA 3NA8A 3TXVA 2VKZG 3FKRA 4O4VA 1LLZA 3E12A 5K4XA 3INPA 4IQLA 4HNVA 4DXVA 1P5BA 2GUUA 3I6RA 3UZJA 1O95A 3OBKA 1S5VA 1MZHA 3H53A 4JD4A 2C16A 3A22A 1AMKA 3PBVA 4GUJA 3TIMA 2J9YA 1NFBA 3W1PA 3LV5A 2C6QA 2A5HA 2WOQA 5HJLA 1I2QA 3ANYA 2BTMA 4CQAA 1SR9A 2DZTA 1C8VA 2V2CA 4X3ZA 2QEZA 3NPXA 5I3HA 1JUBA 3M7WA 3PUDA 1XDMA 4JR5A 1H7OA 1B4KA 1OF6A 1SO6A 2JK2A 3GR7A 1P0NA 2NUXA 4ZMGA 1NF0A 2ZZ2A 2AGKA 4ZQNA 3LCLA 4E38A 2Y70A 3W2NA 1I2PA 2QCNA 1I2OA 3A23A 3VCRA 3TDFA 3S6DA 3LXBA 4PTNA 1CX9A 1EP3A 1VHNA 3NPWA 4ZQCA 3W84A 4O1CA 4U28A 3WK2A 2B0MA 3W85A 3IGXA 1W5QA 3W2MA 3STFA 1K02A 3STEA 2R91A 1DHPA 4N2YA 1XBXA 2EHHA 3C2RA 3LTYA 1WOAA 3KX6A 5BW6A 2G95A 2FDSA 2YCEA 4IMEA 4MJMA 3T40A 4TMCA 3LXCA 2BSLA 3MHFA 3TMQA 2E5BA 3MWAA 1DV7A 2OJPA 1R46A 3LBCA 3M44A 4MFDA 3O63A 4O12A 2PCQA 4WJEA 4KKXA 2E5CA 4IOTA 5D03A 4FIQA 1HUVA 1W37A 2YGYA 3LI0A 1PL9A 4JDYA 4JXCA 3T78A 1IXOA 1G7VA 4UFHA 3LBMA 1LBFA 2CLKA 4EWND 4O19A 3O06A 3VI2A 2E5DA 2Y7DA 1H61A 3O6CA 4QJ1A 1ICPA 5I3FA 4MJZA 1W54A 5GVJA 1RVGA 2V5LA 4BK9A 1QOPA 3O6DA 1K7EA 1FWSA 2J24A 3G3DA 1PHQA 5D38A 3DH7A 3TFCA 1TMHA 4FEZA 1ZCOA 4JX5A 3BK0A 2TYSA 4JYDA 4QNEA 1EIXA 1KM5A 3ABRA 4PCFA 3M41A 1W3NA 3SECA 5LGXA 4JIPA 3N2XA 2QCDA 3STCA 1SPQA 1OK4A 3JR2A 1LORA 3Q37A 4A22A 1P4CA 3P5ZA 2W0UA 1G4EA 3W6YA 2ZZ3A 3THAA 1M7OA 1TV5A 2WV8A 3L2IA 2DZPA 2CWNA 2GJLA 3NR0A 2GQ8A 4NJGA 1SUXA 4R33A 5AHNA 3T7VA 3TW6A 4K7VA 3H54A 3G0XA 3HIJA 4AWTA 2WJZA 5H2ZA 2W6RA 1CI1A 1VQTA 4N6FA 3UPBA 1VYSX 3UWVA 3WJWA 2G96A 3IIOA 2CFFA 3P8JA 4JTSA 3W9ZA 2CZEA 4BI5A 2TSYA 2UV8G 3E9AA 1C9DA 3BLEA 2DJXA 1EUNA 3QMSA 1KBJA 2VEPA 4X2RA 3O1NA 3LLDA 1DVJA 3K30A 2E6FA 1ME8A 4N9EA 3FS2A 3S8HA 2C14A 4IUOA 1WBJA 4LOCA 4NJJA 1G6CA 1W56A 3TJLA 3W74A 1XM3A 3RLUA 4N9DA 4AXKA 2VEKA 4O16A 1F74A 4MZYA 1K03A 3S5YA 1N8FA 2WNZA 1YTKA 4OQVA 3NGJA 3NQ7A 1TRIA 3M5XA 2NX1A 4TO8A 4E0CA 3M47A 3TU9A 1X6UA 3P60A 1OX4A 5TBOA 2VENA 1HG3A 1QAPA 5HWMA 4O10A 3P84A 1RQHA 1M7PA 3S1WA 4UFIA 2FIQA 2F7FA 4QIUA 3LRMA 3KVJA 2QCGA 1IXNA 1K7XA 3R2GA 4GUIA 3W73A 4BR1A 4J9JA 1A5CA 1H7PA 3GKFA 1PHWA 1YYAA 1FUYA 1LBLA 1H7XA 3RLVA 4ZQOA 3NPVA 4P61A 2H3BA 1TTJA 1IF2A 3PBYA 3UPWA 4LVDA 3UNDA 3PB0A 1XFBA 1K8YA 1A5BA 2GVLA 3P74A 2A7NA 3P8IA 3G1FA 1SO5A 2X1TA 4ADUA 3MBFA 4LVBA 2JBMA 4NXSA 5F1UA 3VE7A 1U83A 4D2JA 3PSVA 4JIQA 3LRKA 3N14A 4BWLC 3O05A 3QF0A 3TW7A 1NF7A 5DN1A 5G4EA 3W1NA 3EKZA 1PVNA 2VELA 1TCDA 3BO9A 4GWEA 4PODA 3W07A 5D2TA 3RK8A 4ORIA 4YMZA 2QCFA 4K8EA 3BW4A 3MO7A 1ZAJA 5D32A 4JTGA 3FLUA 4UFKA 1H62A 2J27A 1ONRA 2RH9A 3W3OA 5KMYA 3C3NA 1WQ5A 3NQGA 1GT8A 3HO8A 3PY2A 2GQAA 4WZHA 1LRQA 1F76A 1KM6A 5G2IA 3UWYA 1KTNA 4XQ6A 1DL3A 3GDTA 2F84A 2QDHA 5KTLA 1ADOA 1TJPA 1QPOA 1QO5A 2XN2A 3SY5A 1MEWA 3UWUA 2QR6A 2PRHA 5D2YA 4WD0A 2ZFAA 2A1YA 4CCDA 3GIYA 3IIPA 3OVPA 1J4EA 2V9DA 3GDLA 3LI1A 2NV2A 4DPQA 2XN1A 3IGUA 3C56A 1JJKA 4O28A 4N6EA 5AFDA 2H8ZA 4LV9A 3W7PA 3GX9A 4W9TA 2ZCGA 5DCEA 3C2FA 3EXRA 1K8XA 1X1OA 1FDYA 3W83A 4JTTA 3CPRA 2YR1A 2H6RA 2EPHA 1IXQA 3UWZA 4EOUA 4UFJA 3NQVA 3CWNA 2IQTA 1RZMA 2CW6A 3SZ8A 1QO2A 3DKJA 1H7WA 3R13A 2Y88A 1TV8A 1MSSA 4LNYA 1LOSA 1F73A 1T96A 4HPJA 1XCFA 4FNPA 4O1DA 4Z1DA 3EEGA 3CLMA 1TRDA 3QMRA 4HKPA 4ML9A 4IX0A 3HG5A 5F2LA 1TQXA 2GVJA 3W7GA 4M7SA 3HG3A 3CWOX 3W86A 2ZRZA 2CZFA 4MYXA 4FIRA 1FWRA 3DGRA 1EWEA 1W5PA 3PR2A 5CGQA 3GVGA 3WK0A 3MMTA 1GVQA 4CCEA 1OFAA 4MPQA 3E0IA 3HMJG 4LC6A 4Q33A 3VNDA 3CTLA 1GEQA 4FO4A 4DO6A 5LHEA 4O57A 3G1SA 3M9YA 3IVTA 3QSRA 3L66A 1VJIA 3NZ1A 2NXGA 1G69A 4GUGA 2Y63A 3QRHA 1Z48A 4AF0B 4N4PA 5CZTA 5EA9A 4ZZ9A 1TV7A 2JGQA 5F4SA 4HIBA 2OMAA 2ZRYA 3QQ1A 4OGZA 5H91A 3MP3A 1SSGA 5CPLA 3GR8A 4QNWA 1VYRA 3BW2A 1W5NA 3PF3A 3UD6A 5C2XA 2GOUA 1C29A 5G2WA 3TV8A 2RHGA 5CSSA 4YL2A 3UXAA 2PURA 3L67A 1DJNA 1OX6A 2B7NA 4OU1A 1P0KA 1PE1A 5EBUA 3NZRA 1HTIA 3MP5A
chains in the Genus database with same CATH superfamily
3YPIA 4ERAA 3W71A 3WYZA 2OGYA 2DVTA 4EK7A 5AZ0A 2YL5A 3F4NA 4UTIA 1MRQA 2PSNA 4F0SA 4PEEA 2P76A 2WLYA 1QPNA 4P8XA 2HVMA 2E6AA 1OFEA 5J8LA 2WZEA 3H8AA 3EWUA 9RUBA 1THFD 3B8SA 4XKYA 3G2GA 4UNKA 1EXBA 3DZ1A 5LIXX 2PB1A 2PTDA 1V3HA 4AZBA 1P1XA 4HA4A 2PTWA 2ZZ5A 5BU6A 3VABA 1UR8A 4AC7C 1SW7A 3GAYA 1LJYA 1HL2A 2MUCA 3OQEA 3D0CA 1WDWA 1EO7A 1JI2A 3QHNA 2WSQA 3IGHX 3QLDA 3PZQA 1KBBA 1JCMP 4XZWA 4B3ZA 1H49A 1HGYA 1TPB1 1B2YA 3KBWA 4JTLA 3WLQA 3R6IA 4XK2A 1UD3A 2HDJA 4KETA 2J77A 1Q13A 1HKWA 1XYZA 5KITA 5EYWA 3QSTA 4AMCA 3RITA 1IZCA 4R3UA 4RK8A 1V5XA 1MNZA 5DXXA 3Q65A 4X9SA 3W7LA 4EIVA 5A6MA 3GYCA 1B3YA 3VDHA 4XUGA 2V81A 4RXFA 3P0XA 2A6LA 3VO0A 4UCGA 4QBXA 4B9ZA 3KWXA 3GO2A 2XJ7A 3HBLA 2ZTKA 4Z2JA 3N6JA 3N9SA 1JPIA 1PX8A 4DO4A 1E55A 1CLKA 3TJIA 4X61A 1FP9A 2HMCA 3USBA 3N2TA 4UXDA 2R1KA 2A3CA 3BAKA 2GSEA 2P8CA 3F2BA 3KL3A 2FTYA 2EG7A 4WDUA 4PA8A 1VCVA 2FJKA 2TMDA 1HJQA 3K1GA 1JXKA 4DBEA 1YBQA 4RR4A 3R0DA 3R79A 1A53A 1HKKA 2V69A 4LS1A 3TN4A 1NM9A 2XVNA 1UUQA 4YN5A 5FAJA 1E3ZA 1CXIA 2ABAA 2NZLA 3TSMA 4QS6A 2FVKA 1XYBA 2A85A 5E1QA 4NVTA 1H1ZA 1EQCA 2ZZ6A 2VDHA 2ZYFA 1D9EA 2EEXA 3M43A 1W5OA 1TQJA 1DIDA 1NY1A 1SO4A 1PJ9A 2Z26A 1LOLA 5JXQA 1JZ3A 2XIIA 3ARRA 3SY8A 2XSAA 5HOSA 1YADA 2P3ZA 4JS3A 5AC6A 4YJ5A 3JW7A 5GNXA 2PDNA 2WZMA 3L4WA 3S5OA 1ECQA 1VFUA 1BG9A 3CGTA 1ZNNA 2HVOA 3WQOA 4XBJA 1A5KC 2O7QA 3CUIA 4BKNA 4EF9A 4GXWA 2YFOA 2DT3A 1F3XA 1DJHA 1XRTA 1JF6A 3CZ8A 2Z1VA 4JNYA 5FJRA 1V79A 1YHTA 4D6IA 4LCRA 1IWPA 1SFLA 4LC8A 2ZXQA 3UESA 1DHKA 1YIXA 3EDDA 4KS0A 1AG1O 1DKWA 3W1TA 3NL3A 3MUAA 3LM3A 3U2CA 1QK0A 5AHLA 1OY0A 1M01A 1TREA 1X39A 3G6MA 3DN5A 5LZLA 3VINA 4Q4PA 3URQA 3SGGA 3QR1A 2YOCA 3QQWA 1BG4A 1XDLA 2QJGA 4UTKA 3UR7A 3FYYA 2BVYA 3N2BA 3Q67A 1ECEA 1HIZA 3WQDA 2JE8A 3WQPA 3NQBA 2WKJA 3BMVA 1BQGA 4N02A 3UZ5A 3TKFA 3QV9A 1GJPA 4HGXA 1Q6DA 3E49A 4V2XA 4QJ4B 2QF7A 4A2RA 1R7AA 3GHUA 4AIBA 2NLYA 1VBHA 1XDJA 2OT0A 3K46A 3TTEA 2OWXA 3BL3A 3D3AA 3GG1A 3TR2A 3W25A 3V0SA 1E15A 2V2DA 1V0NA 5DY2A 1HKJA 1PAMA 2AL2A 1QNPA 4UMBA 1ZJHA 2VZUA 3R8RA 3HU7A 5FF3A 3MYPA 4YYCA 4Z0JA 1OT1A 5LNVA 3OPSA 2P10A 4UCFA 2ATSA 1LCOA 2ZXDA 2Z7KA 2B7PA 3ATYA 2Z1BA 4LVFA 4X60A 3W70A 3UW6A 4KFPA 4N9CA 2XIBA 2PCEA 1KXHA 1E1CA 1MRAA 4XSMA 3SCNA 4D8AA 2CHOA 3N29A 2CEQA 2J66A 3VDBA 1M9HA 4KWUA 4S39A 4JBRA 1RXOB 3C86A 5DANA 3LCGA 3JZEA 3B03A 3A24A 2YCKX 1LQ2A 2VR4A 3UWWA 1TPFA 4FNUA 4Z2IA 3RHGA 1G01A 4FB7A 4P8WA 1F05A 2OSXA 3EWZA 2C13A 2YCLB 2OGJA 3O15A 2B31A 1ZRQA 3B9EA 3LHYA 5CC7A 1DQXA 4PMOA 3USZA 2PWGA 2ANUA 3HV9A 4O1AA 4OOUA 4Q22A 3XINA 2QCMA 4DI9A 4PL1A 3EMCA 1AJ0A 3M5YA 1Z69A 1CYGA 1NWTA 5EY5A 4G5DA 3GM8A 3VIJA 1D8WA 3UT0A 3ONCA 1XHGA 3B4UA 1XGDA 3WEOA 4B5NA 1GTEA 1R9YA 4KFNA 3ABXA 3A4WA 1O4UA 3NM3A 2UY3A 4XD4A 3QYQA 3IEBA 4GISA 2VR2A 3BAIA 4GNVA 1B3ZA 1BWKA 1MW3A 4UQCA 1UKPA 4EPBC 3LDVA 4C6BA 2DIEA 3H6OA 3OZPA 4REQB 5L6UA 2Z1XA 1XYFA 4Q8WA 1AL7A 4B15A 2GWGA 4MB1A 5ABEA 1IIHA 4DF1A 2F38A 4H41A 3N15A 4C1NB 4R9OA 3P93A 5BOEA 1VPYA 3K13A 1RQBA 1L6SA 3MUCA 3DGBA 3N6HA 1HKIA 3ELFA 2WMKA 2OEJA 2EPMX 2A7RA 3LCFA 5C9XA 3WMCA 3G1RA 2D0GA 3LEPA 1KNWA 2EJAA 1WV2A 3CZJA 1Q4WA 3MP4A 4EXBA 1Z32X 4B5UA 2PLJA 3VFCA 3LMYA 3IK2A 4TX9A 3CYJA 3WH5A 4X9YA 2WCGA 3WF2A 4IMCA 3T2PA 1P7TA 4BWLA 4WSKA 1WDPA 3AIUA 3T0AA 3ONBA 3EXTA 1E4MM 4KEUA 3VC5A 4E8CA 4LTSA 3RM4A 3P82A 1VBGA 1OFQA 2FH8A 5BYWA 4FI4A 3EMZA 4G2DA 2DZWA 5REQA 3CLWA 1F8IA 4ONVA 4QAIA 3V75A 3PB2A 2VUYA 2XVPA 2OEMA 3RRAA 1LUCB 4A3RA 1SQ7A 2RDTA 3N4EA 4O15A 2ALDA 4UTWC 2ISFA 4H9UA 1NP2A 4AC1X 1RLCL 4F2BA 1TZZA 3G0SA 3A9IA 2WMHA 1J5TA 5D8WA 5LNWA 4LB3A 4X22A 3G8RA 5I0DA 3LCXA 5ECVA 4W8LA 4HBKA 1JDCA 3T4CA 4C6MA 1XQLA 5D09A 2Z7GA 3F4CA 3WQ5A 1NARA 4FHAA 1O94A 4LQ1A 3QZ6A 1QVBA 1TKKA 1XYCA 3WLLA 3T55A 2FYMA 2QIWA 3K8MA 1FWFC 3TXZA 3ZIZA 1JCXA 3ITYA 1E71M 3L4XA 1UZHA 5KZEA 1VHCA 1DQWA 4KRUA 4IIEA 1F3WA 2G5WA 1Y65A 2POTA 3FY1A 5ABGA 1SW3A 3TCEA 1PCKA 3R5EA 3W1UA 2DUZA 5BCAA 1YQ2A 5FEXA 5FEZA 2WSPA 2WXDM 5JQ9A 3PZOA 1FCBA 2E1DA 5E93A 2ZUNA 5FSEC 2YKKA 1V8EA 2ZX5A 4L9YA 1SU5A 2VOMA 3DC0A 1OB0A 1TTQA 2R24A 5H8UA 4D71A 1LWHA 1XRSA 1A0EA 2JGYA 4DJDC 1LRNA 1SZGA 4ZQPA 5CAKA 4KW2A 1W32A 3B8VA 1BTCA 4DZHA 5A6LA 3K4DA 4C65A 3TJ4A 1V0KA 1NEYA 3CZLA 5A94A 4GGBA 3UF9A 4M81A 1REQB 3WLKX 3TA6A 1AH3A 3LB0A 2QJMA 1RCXB 3OB8A 1HGWA 4I5XA 4PC8A 3TSDA 3K1DA 2YL8A 1XF0A 5PTDA 5D8ZA 2QT3A 3WMBA 3BWWA 3VIFA 1JPKA 3E96A 1UA7A 3L9CA 3GUWA 4PH6A 2X0SA 3WD4A 3AXHA 5A1AA 2D2GA 1KFEA 3LM7A 4MWAD 5BMWA 1OJXA 1F7BA 3A6OA 4TX6A 2WPBA 1ADSA 4TR9A 3B9DA 1MW1A 4UTWA 4GACA 2BDQA 3MI3A 1CXHA 4FMVA 1QOQA 3MA8A 2E8YA 1T5AA 1XINA 4S3AA 4YNGA 4F40A 4K68A 1K8ZA 2IS7A 4CUCA 5HMDA 4R53A 3HGOA 4M6QA 2ZBTA 5FF2A 5DFAA 1TPC1 1X6NA 4D6GA 3ABSA 1KBIA 2ZZ7A 3WF1A 3I65A 3WNOA 4RE3A 3FVDA 1E0TA 1AJZA 4WGHA 2QJIA 3S2JA 3VVGA 1U22A 2X0YA 4JEJA 2ZRXA 2QCHA 1MUCA 3G1YA 3OYXA 3GXDA 1GKPA 5BOFA 1QRQA 2YA0A 4FX8A 3T2OA 2CKSA 4GUHA 3GNRA 3M0XA 3B8IA 2I1OA 5D30A 1F9CA 3LPGA 1KWGA 3DAQA 3CNYA 3OGVA 4JIRA 4DBDA 1ZFJA 4X0VA 3UZWA 1RD6A 4RE2A 4DWSD 1KRCC 4EVZA 3LU2A 1JDFA 3RO6A 1FA2A 3CUFA 3TLLA 4NI8A 2A79A 4V33A 3UR5A 4O8AA 3LHVA 3GUGA 1X96A 4ADSA 2BP1A 2J7HA 4M3PA 2QYGA 3UR8A 3HPZA 1B90A 2R94A 2I56A 1JZ7A 1RCOB 1EX5A 2NV9A 4AQLA 4MKVA 4MVAA 4U31A 4C6QA 3BG5A 4LUSB 4UTTA 4DJDA 3MHGA 2E3ZA 2J75A 2HE8A 4PB5A 4DO5A 3WQ8A 3OLIA 4U5KA 3GB6A 4S23A 1R3VA 3ARSA 4KEZA 1KB3A 4FF5A 3AIRA 2DGAA 1FWGC 2L5HA 4DQWA 5FA5A 3C0SA 3M0YA 1P1MA 3S5SA 3VUSA 3WFLA 2PGEA 3UJSA 3VM7A 2P8BA 3GHSA 3HJEA 2NUYA 4IGNA 2IPJA 1EZWA 1JRBA 4HPXA 5MKGB 1H7NA 2FZNA 2G4JA 3MSRA 3APTA 1EH9A 4LALA 3H2NA 1T41A 4DUVA 3TLQA 4CVUA 4PZVA 3RJXA 4H83A 1JR1A 3W6LA 1BGGA 4G1KA 2Y8VA 2BXVA 1TPVA 2PZNA 1QI3A 3N2MA 2P5NA 4K8GA 4LAUA 4LVGA 3UA4A 3KVKA 1CENA 4JTEA 1E1EA 2PI6A 5AN7A 5MHBA 3FJLA 4LYKA 4QEHA 1EHNA 4YVXA 2WVVB 2PGRA 3WY1A 1BXBA 4PR4A 3PSWA 3EZ4A 3VKDA 1XXXA 4IISA 4AX6A 4O14A 1TX0A 5FEPA 3CK5A 4KCWA 4OWGA 1GOOA 3AHXA 1T8XA 3GU1A 3GXPA 1JCJA 2F61A 3WMLA 2YL6A 1P0BA 4AVFA 1SZEA 2YZRA 2X2GA 4CGTA 4IMDA 5LIWX 1V6YA 1B30A 1AMYA 1B5TA 1KFWA 3VIIA 2QS8A 3ECQA 3LPPA 3NM1A 5BZAA 3FIGA 3GG0A 3B4YA 5G2HA 1S39A 4O0KA 4HB7A 4DX3A 2GFTA 2OG9A 5BXTA 2PDJA 3OLDA 2QIIA 3IS4A 2YCLA 4B91A 7A3HA 3DBNA 2FJUB 2VYOA 3KXQA 1V4YA 4H1ZA 1OC6A 4IJRA 4JFVA 1JUKA 3MVIA 2EBNA 2Z29A 3S4TA 5I3GA 3ZWSA 3PHAA 3QHMA 2Z1KA 2B7OA 2PU0A 4B92A 2YA2A 4I8YA 3QKEA 3AHTA 1G4PA 3ITOA 4G1NA 2FLIA 2VRQA 2O4QA 1PYMA 1Z89A 3D47A 1KV5A 3GFZA 3WFAA 3GNNA 1EB3A 3U2EA 1ZZMA 1UCWA 3GE7A 4UTUA 1XLAA 4PTWA 2P0IA 2C19A 1Q63A 3EA1A 4IQJA 1FWEC 3AXMA 1O1HA 2EJ1A 3A47A 2QVNA 3CB3A 1NOUA 3Q2DA 3MHUA 3IWPA 2QQ6A 3EDFA 4HCLA 3TC7A 3IJLA 4DNHA 5D04C 3EOOA 3RJYA 2PUZA 4W87A 3GNPA 4LYQA 5FEWA 4C1NA 4V28A 4S3DA 1LDCA 2OCZA 4MOZA 2DVUA 4H9VA 1YTDA 4HPHA 1QPKA 3TK7A 1H0IA 1S5MA 1I75A 4DPPA 1HT6A 3TQKA 3NQAA 1MFUA 1ME9A 3L65A 5B80A 4EP8C 3M0JA 1Y8BA 3JVAA 1EQPA 2FB3A 3OEXA 4HPGA 4H7VA 2EPKX 2NUWA 4HMEA 4K37A 3DI1A 5KINA 1NSJA 4HYVA 1FFRA 5DBTA 3KEHA 2NXHA 2CWXA 3SW6A 3RXZA 3QV8A 4AY1A 4AXNA 1CNVA 1U5VA 1W1ZA 1FHUA 1UBPC 3NL2A 3L21A 2WJFA 3PS7A 1OGSA 2D0HA 4HN8A 1Z3NA 2W79A 3OA3A 4BA0A 2P88A 3O3RA 5HWJA 3URAA 1B9BA 5FESA 3KZSA 5E0CA 2PBGA 3RLHA 5IFPA 3RGTA 3CPUA 3IIXA 4QGCA 4L6DA 3OBEA 1O1ZA 1XSIA 3CIWA 3N11A 3ZWTA 4F0KA 4WDWA 4YXGA 4UNIA 4JEQA 1UR4A 4UWMA 1UZ4A 2PDFA 1SSDA 4QFUA 1P6CA 4XUYA 5FL0A 2OVLA 4NU7A 4KWVA 6TIMA 3ZR6A 2OWWA 4F8XA 1M3UA 3UG4A 5C2GA 3B97A 1TMLA 3PC0A 1RCQA 2HBXA 4P8VA 1IIGA 1VIWA 1WXYA 4K36A 3GYEA 4L1WA 3W7OA 1BFNA 3N18A 1QNVA 3PNZA 3G1AA 3LXAA 2J79A 4GZJA 2X30A 4PCSA 1ZB5A 1TB3A 4HYRA 4HOXA 3GAKA 5E0KA 4AW7A 4KGLA 1CT5A 4HMCA 1RP9A 3OP2A 4U33A 3W02A 3NA8A 2VKZG 3FKRA 1NH6A 4G8TA 4YTRA 2XH0A 4HNVA 1P5BA 3SO7A 1HZYA 1NTHA 1LL7A 4JD4A 3A22A 2AQOA 3TIMA 2J9YA 2QMJA 3WLMA 3M0HA 2C6QA 2OLAA 4CQAA 1WP6A 1XIMA 1HKMA 4C7FA 1SM9A 2DIKA 2VL4A 4MKSA 2ZOXA 3VK5A 3NPXA 5I3HA 2P50A 3AS1A 3M7WA 4M80A 4IJCA 5T91A 4ATDA 3B40A 1XIHA 3DFHA 2DDXA 4ZCWA 1H7OA 2UY2A 2WC3A 4I9TA 3SCRA 2BHZA 1SO6A 4H00A 4J35A 2ZVRA 3KWSA 3W37A 1FP8A 4B5XA 2NUXA 5FKYA 2BHYA 4ZQNA 2QCNA 3FGCB 3TDFA 3S6DA 3STPA 4PTNA 4XZBA 1VHNA 3NPWA 1E6ZA 3AXIA 1REQA 3MMUA 2WJEA 4V27A 1JI1A 2O0TA 2J7GA 1EXPA 3NWRA 5LXEA 1TV3A 3NFUA 2WMFA 3STEA 1CECA 4N2YA 3LGGA 3KX6A 2VMFA 4TMCA 5TF0A 1DV7A 4Q7NA 4UOJA 4XG1A 3FX4A 4KERA 4O12A 3H2CA 1FKXA 2NVDA 1BVZA 2E5CA 4GVIA 1E0WA 1EJRC 1HUVA 3UYIA 1MQPA 3SRKA 4JDYA 1LBFA 2CLKA 4EWND 3M46A 4O19A 3O06A 1UR0A 2J8TA 3WLNA 1OZQA 4QJ1A 1ICPA 4JCLA 1W54A 3BJFA 3A64A 2FZMA 4UOZA 3NZGA 4C7GA 1VEMA 1K7EA 2J24A 1ISWA 4JL2A 3FHQA 1A5LC 1TMHA 4FEZA 3RMEA 1KM5A 3SCSA 2EG8A 5LGXA 1XCWA 1PKMA 4J3WA 3M07A 3P5ZA 2PDLA 2WHJA 1M7OA 1B0IA 1TV5A 1DJWA 2I57A 3PTMA 3NR0A 4IGMA 3KDNA 4QG8A 1EX1A 2J74A 3IJIA 4AWTA 2RDXA 3SADA 3AICA 3KS5A 2D2HA 1VYSX 1TWWA 3WJWA 2G96A 4DZ5A 4BI5A 2HK1A 3TA9A 2UV8G 2ADAA 1EUNA 3QMSA 4OIFA 1IR1A 3KLKA 3UR2A 4QDWA 3LLDA 3T42A 3DC8A 6REQB 4LOCA 4H7ZA 1Q2SA 4LUSA 2WKLA 4ROQA 1C8QA 5HA7A 6CGTA 4PTMA 1XLGA 4MZYA 3TC3A 3S5YA 4H6EA 2WNZA 4OQVA 5IDIA 3FA3A 2QPSA 4E0CA 4PUUA 3AS2A 3RO8A 1X6UA 5BXRA 1WO2A 4PCPA 5TBOA 3ZSTA 4OJYA 1HG3A 3VMNA 4IGSA 3GBDA 3P84A 1RQHA 4NAEA 3OQ8A 2V5DA 3S1WA 2FIQA 4CNSA 3LRMA 3B8UA 2QCGA 1BYDA 3PPCA 3CO8A 4CD7A 4BR1A 4J9JA 1FH7A 1A5CA 1H7PA 1PHWA 5MKGA 1YYAA 1ODZA 1TR1A 3RLVA 4ZQOA 3UETA 5TNVA 3PBYA 3UNDA 2HCVA 4DVOA 1XFBA 4H6QA 4BS0A 4KWOA 3ENLA 2PAJA 3P74A 1UKQA 2A7NA 3P8IA 4LVBA 2JBMA 4NYUA 8XIAA 3T0BA 4FXFA 4D2JA 2G8ZA 1X98A 3LRKA 3N14A 3O05A 3QF0A 2FMNA 4Q6JA 1UKTA 3D5HA 2D2OA 3UG5A 2VELA 1IT8A 5I03A 5FJJA 3GC2A 5D2TA 1CGYA 1BWVA 3DCPA 4AIEA 3E74A 3RR1A 3MO7A 1ZAJA 2W5FA 4ZOBA 2OOFA 5D32A 3WELA 1UWSA 1EFZA 2J27A 4NSBA 1ONRA 5CC5A 5KMYA 3W4RA 3PY2A 4YHGA 4FPSA 2GQAA 3S2LA 1LRQA 3MO4A 2HE5A 4DBSA 4AVNA 1DL3A 5XINA 3GRIA 2R6OA 1ADOA 4QDMA 1TJPA 4DUWA 1JCTA 2XN2A 4B3KA 3SY5A 1G5AA 2QR6A 5HMEA 2PRHA 3HM7A 4NILA 2G4FA 4Q8OA 2XH7A 3E5BA 3LI1A 2NV2A 3WF4A 4HMNA 2YB4A 2CPUA 4WEVX 4Q8QA 1ITXA 1I6NA 3PUGA 2WC7A 3W7PA 1KGUA 4W9TA 3UBPC 2ZCGA 4P7QA 1JD9A 4WLCA 3OZMA 1EBHA 1RY0A 4TX8A 1K4GA 3SUWA 4QHRA 4JTTA 4WKAA 2CYGA 4AD2A 4P7OA 2EPHA 2VRKA 4UFJA 2AKZA 3NQVA 4FLOA 2PDKA 4L1XA 4IT1A 1QO2A 3DKJA 2R1LA 4AVOA 1ZBVA 4JQ1A 1QTWA 1ODUA 2DW7A 1W91A 3S2MA 4HPJA 3GU2A 3W82A 3DHUA 3VIHA 1TRDA 4NF7A 4JHMA 1TQXA 3WLTA 3SY1A 2CZFA 3BMWA 2WHLA 3L4ZA 5I09A 1FWRA 1PO9A 1PKNA 4LAZA 2I5GA 3CHFA 1XPGA 1YKWA 2HQAA 3FJ4A 3CTLA 1GEQA 3EEZA 4L64A 1GW9A 3V5CA 1P6BA 4DO6A 5LHEA 2Z28A 3G1SA 3M9YA 3KOWA 4GO8A 3AYSA 2X41A 3BMXA 2NXGA 2XVGA 5EA9A 4W88A 4GABA 4QNWA 3HTWA 1VYRA 3FXYA 3R4IA 3PF3A 5JMUA 3ZMRA 2R1PA 2Z2AA 2PURA 1DJNA 1R3SA 3ITCA 2EPOA 1R3RA 1P0KA 3EBVA 2PWHA 5EBUA 3THUA 2NQHA 4NUWA 5F4XA 5BNKA 1E72M 5D2VA 4JKMA 3H4GA 3PZVA 4GE8A 1DJIA 1SW0A 4G7EB 2PDPA 1KM1A 3PULA 4MF4A 2V5CA 3I7RA 4MZ1A 4PUDA 5HK4A 2ZADA 3KCOA 1J11A 2C15A 3NVDA 3S9YA 4OT7A 3BGJA 3G1HA 3BSMA 3OOQA 2JFEX 3II1A 2ZX9A 4XSLA 1ZTVA 3BQ5A 1V0LA 4RV3A 3W88A 1GW1A 3AHVA 4MB4A 2NQZA 3NYZA 4QCEA 4R7WA 4NQ1A 3D6NA 4IP7A 2CITA 3UPMA 1E9YB 3OIXA 1F6KA 3GXIA 1TIMA 1HN1A 5H8PA 1X7FA 3TTQA 2BVDA 1L6YA 4C5ZA 1ZPTA 3H2MA 4XV0A 4PE8A 3OHMB 2GVGA 3BJSA 2AGTA 2DEPA 2CXEA 3WQCA 4BFAA 3IUIA 5D9MA 3GLCA 3EOEA 2GK1B 3TN5A 2VX4A 2GGGA 4M0XA 1PS9A 2C18A 5A3HA 2WLZA 1YE6A 2HBVA 3WJZA 3WCZA 1OD0A 3A3HA 7ENLA 2WM0A 3ID7A 2Q8XA 1KA9F 2WQDA 1UC4A 1G67A 4S38A 1Z41A 1XLEA 2XWEA 4XBSA 1D7FA 3G3MA 4PUKA 1K9DA 4RPPA 3VNJA 3W01A 2X7VA 1AH4A 3ITXA 4M24A 3G1DA 1GK8A 2YYTA 1TYGA 4ICNA 3AU6A 3ZVIA 1HVXA 1KLZA 4FALA 1DJQA 1CXKA 1LM1A 1QMLA 1GEHA 3CYVA 2ZICA 3RR4A 1N7KA 3AZRA 4GQGA 5CCZA 4O0ZA 1JVNA 4I7WA 3VIPA 5EKYA 5FJOA 3TJXA 4MUZA 4YTUA 3LLFA 1L6FA 3UJFA 4W8BA 1AW5A 1R9ZA 2XFRA 3PUEA 2IUZA 1Q2RA 1TJ2A 4UQBA 2O9TA 4KIEA 4IUGA 4MY1A 3I7QA 2OSWA 3NAVA 1QHZA 4AU0A 4OTKA 3AYVA 1NWRA 4GYPC 3W1XA 1XIEA 4WJXA 2ZTJA 5FF4A 1WOBA 1H51A 3M5ZA 2ZC8A 3NOEA 3NDOA 3WBAA 3THDA 1XP3A 4MY8A 2FFIA 1U5JA 3WQVA 5F4WA 4CLMA 3PP7A 2WVTA 3CHDA 2GDQA 1GOWA 2QUVA 4DN1A 3BPWA 3WDRA 2GJNA 3ZJ6A 3LN3A 3H7UA 3W75A 2CBIA 4DWDA 4WOZA 3UP8A 5F7UA 1QBBA 2Q71A 4WOQA 1XG3A 3AQUA 3EWDA 3H23A 4J3ZA 4NP7A 2YXGA 3TFXA 1E4LA 4LCQA 2HPIA 2C71A 1SZFA 2Z6JA 3E0FA 4LH8A 5K9DA 4GXPA 1KM2A 1EPXA 4HHLA 3W72A 1RPXA 4PB3A 3MTWA 3OLEA 3OG3A 1ALDA 3FYOA 3WNNA 3DYOA 3TTSA 1KM4A 1UZ1A 3ITVA 4IG2B 4Z2GA 1GZGA 2HISA 4E4PA 2H9AB 2IQDA 2IW0A 3T0CA 4AHPA 1V02A 1VLIA 1GQJA 3MSGA 2VC7A 4S2CA 5DX7A 3EMQA 1UASA 3KOFA 3H26A 1ONXA 4WY0F 4WY0B 5A8MA 3TYBA 3HQOA 3L0NA 3UZXA 3SFWA 3WEMA 5HQEA 4RDVA 2QUMA 1NELA 3A13A 5F2MA 4NNCA 3T4WA 3B0VC 5DMNA 4PSPA 2WWDA 1S5TA 3P61A 1FHDA 5A5WA 4WRHA 1BF6A 2CZDA 2GGEA 4I9AA 1JCNA 3H70A 4H6KA 5E0FA 3MC5A 1MMFA 3MZ2A 2VWSA 3W1LA 3W23A 1H41A 4N9BA 6REQA 2Z1WA 2VVNA 1JPHA 3AO0A 2V2HA 3NDYA 1D3CA 3NZQA 4GYPA 4NRRA 1EJWC 1AQHA 2J7BA 1B1YA 1DJYA 1XISA 3CUZA 4IP4A 4AWEA 2OZTA 4URIA 1QI2A 1GGOA 2QCCA 3PPFA 4G9PA 3ARXA 4M5PA 3UXLA 3DENA 2CLOA 5I3JA 2Y5SA 4OV4A 4U2YA 3GH5A 1JCLA 2YDQA 1OFPA 1KFJA 1UKSA 3ISIX 1VRDA 4Z0SA 1DIKA 1Q6OA 3SIZA 4LYPA 3SCOA 3F03K 4FSAA 1Z7AA 2Q8LA 1K7FA 2V3GA 3E2VA 1W1YA 4UB9A 3SJNA 4DJDD 3A9BA 1JCYA 3I4EA 1B9ZA 5BRBA 4HNCA 3QGKC 1E6QM 4LT9A 3GG7A 3L23A 5AC7A 5D9OA 4A4AA 1K1DA 1M03A 3MV11 3LZ3A 3WD2A 2CLMA 3KOYA 2CZVA 2WQPA 1V7AA 2X05A 3VU2A 1VLWA 1G1YA 2XFFA 4HQVA 1QU4A 1NDZA 3HN3A 2GGIA 4GG9A 2E67A 3T09A 1D2KA 5I3KA 3CL8A 1F3EA 3KFTA 1GJUA 2BOFX 4JPGA 3B9NA 3XISA 3FDKA 1A5AA 1W9BM 1ISXA 2WBGA 3HOJA 2VO5A 5I78A 4YLWA 3C0QA 4WGXA 4BQ3A 2BY3A 3QM3A 4FXSA 4MMWA 1UIOA 3MS8A 4O53A 3ZZ1A 1OZMA 3U6WA 2DZXA 1EJTC 1TPWA 4NXKA 4MB5A 1EKOA 4J5NA 3VX0A 3WK1A 5HNUA 4EANA 1WDSA 3E02A 1P43A 4KQNA 5EMLA 4HVXA 3GTNA 3GH4A 2ZRWA 3DFNA 1WKYA 3HQPA 4LEQA 1O60A 4S3JA 4RV8A 5BU9A 1CZ1A 1RA0A 1EPVA 2EKCA 1TJRA 3LK6A 3PTDA 4CQ9A 3U3HA 3R94A 3K5XA 3MBDA 1HP4A 4IPPA 3LTSA 2RKXA 4WIWA 3NPUA 1XLMA 1OINA 4IL2A 5CPTA 5T26A 3N9KA 1ICQA 2PWEA 4RLIA 1Q8JA 1EP2A 3MMWA 3WNMA 4JTRA 3RIKA 2OKOA 3EWBX 7ODCA 1SZNA 3O07A 3NTYA 1T99A 1GTHA 4ZODA 3A21A 3IGSA 7XIMA 2W61A 4ZGYA 2YB1A 1CWYA 1L2QA 5FJTA 3BV7A 1E4NA 1FCUA 2BLEA 3NQ2A 3LCWA 2EF9A 2XVKA 2R8WA 5EFFA 2A0NA 4HOZA 5J5RA 4MUPA 4NJIA 5C7HA 1V77A 5BMXA 4AD4A 2PWDA 8TIMA 3VNMA 3WD0A 1V3IA 4NY2A 4RNHA 4RJEA 3AROA 4WQ6A 5I24A 3DBPA 1A50A 3BAXA 3VNZA 3MI2A 1KD0A 2DT1A 3H12A 5XIAA 2XDFA 1ZHAA 3CL7A 4IQDA 2V63A 1XGEA 2YBTA 1AW2A 2HV5A 3W2LA 1VJZA 1IEIA 5CKSA 3BLOA 3RPMA 1BLIA 1L2UA 2HNHA 1UBSA 1WZKA 3BLPX 3W27A 4HCDA 5G4WA 1Q66A 2WSRA 2V5BA 4MLRA 1S1PA 4AIOA 3CEPA 3ZFHA 1G7UA 2V8ZA 4G7EA 3W24A 2WANA 4H9TA 4QITA 1CTNA 1GYLA 3WLOA 1YXYA 2DSZA 3WF3A 4L61A 3OZOA 3SCPA 4FNRA 3PBUA 5B7YA 3RU6A 1FWBC 3ES7A 3WDHA 3IK4A 5C70A 4J4KA 3BXWA 1TE1A 1EHAA 5LNSA 2E0PA 4JFWA 3P6LA 1DWFM 4LEFA 4H4IA 2OFJA 1UQYA 3BARA 2YZ5A 2J8GA 4IZGA 2PLMA 1R38A 4ZXOA 1E5NA 4XB3A 4LVAA 1ONEA 5HNRA 3M0KA 4IMGA 4ZENA 3CUXA 2GK1A 4C7DA 1QNQA 4UFLA 3T05A 1H2JA 3H2AA 3IUHA 4DRSA 4GI6A 4E2DA 1XI3A 3Q94A 4X0NA 3LX9A 1TUFA 3VIKA 1KV8A 4J3VA 3W7KA 5HNNA 2JF7A 4CD8A 1DWIM 1N2VA 1UUOA 3KS6A 2AAMA 2PF8A 1RV8A 1J0HA 2CLLA 1UWRA 1ZY9A 3QN3A 4JKLA 2DY3A 1C9WA 4AD0A 4I5RA 1XLHA 1OYCA 1AL8A 3AIVA 1TPUA 1R3TA 4Z17A 1VC4A 4O52A 3N2CA 3W7RA 4GKLA 4JX6A 1UH2A 1J01A 2XIMA 4OBSA 4CQBA 1C3FA 1W9PA 5IRPA 4A3UA 1A0DA 1XLCA 4MJ4A 4UTLA 1J2WA 3P67A 2JKEA 3QPYA 1IEXA 2YPIA 2OYLA 2UZ9A 1UWTA 3W7EA 4NNAA 3RNDA 1PEZA 2XSXA 5GNYA 4XD6A 4KFOA 1E6SM 1TVLA 2QUUA 3UXIA 3EKGA 3GC4A 5C9UA 4A2SA 2E28A 1GJWA 5AECA 5BOOA 3LQGA 4M6VA 1DXIA 3I3DA 3B8DA 4M6UA 4GZIA 4DF0A 3W0KA 1O5KA 3CQ0A 3OODA 1KQYA 4TV5A 2WW5A 1X1ZA 2CLIA 4QR6A 3B0PA 3QOMA 5HJYA 4NT0A 2QV4A 4GXMA 3LHZA 5AC5A 4AY7A 3CC1A 3HG4A 4H9XA 5TD4A 3TYCA 5CPOA 3M64A 4QXIA 4RNFA 5LIKX 3VFLA 3UXKA 2PDHA 4ZL1A 1UUMA 2J9ZA 1GYNA 5DF0A 2PDQA 4RPQA 4MDPA 1XIIA 1FX6A 2W3ZA 1I4NA 3QR3A 4JFSA 2RJGA 1TTPA 4ACZA 1S5NA 2C0AA 1QHOA 5M3WA 2WNNA 5AC8A 3IIVA 3VC6A 1BSIA 3M16A 4A21A 1EGZA 3PTQA 5LXXA 4JYEA 1EYEA 3EXSA 4W86A 2KZHA 1CGWA 4QQ3A 2NX3A 2WO5A 1FXQA 1NQKA 1AQFA 4NZ5A 4XX6A 4LBSA 4IG2A 4MIMA 3S1VA 1UR3M 2H9AA 4GI9A 2PP0A 3UVAA 2X8RA 4XTDA 2GVEA 3MKVA 3VKJA 3Q58A 1VPXA 4C6EA 1OEPA 2PGWA 1E1FA 1VBRA 2DPEA 1EEXA 4M8UA 4CNOA 1FVPA 4XZ9A 1GONA 4EXQA 4WY0A 4AWUA 4I6KA 2QJJA 4ATLA 5CZ0A 4J3UA 3B0UX 4J28A 2BOEX 1FWDC 3ZS4A 1ZP4A 2Y24A 4GFSA 3IJ6A 5I2UA 4JTFA 1V6VA 3AHYA 2PZ0A 1PDYA 4H04A 3WK3A 3GDRA 3CIXA 2INEA 4B5TA 2PDCA 1O5QA 4HZ8A 1OCJA 4DUXA 4IWWA 3H2OA 4RZ6A 2CETA 3C3UA 1UC5A 2UY4A 3C0JA 1W1B1 3GDMA 2ISSA 2HRWA 1IGSA 3PWGA 5RUBA 1NVMA 4Z08A 2B7QA 6A3HA 2J78A 4U10A 2W27A 4WVXA 1SYTA 3O2LA 4PRRA 2E7FA 2OX4A 3GHRA 1YPFA 1RSCA 3U4FA 5LNRA 1Q7MA 4IM4A 2A3LA 4JICA 1BRLA 4L7ZA 1BWLA 3VGFA 4C60A 1SO3A 9XIAA 1FRBA 2PP3A 1D3GA 2ZDSA 1OIFA 3WMSA 2FZDA 1CGVA 2IPWA 3P80A 3FYPA 3W1MA 2QW5A 4CNUA 3L4UA 3NOYA 4XAPA 1GOKA 3K8LA 3VDGA 1AH0A 1IXPA 3APYA 5KZMA 1K3UA 2GZXA 4MFEA 1WXZA 4LY8A 2OYKA 1TZ7A 5JH1A 1DOSA 3WJXA 1ONWA 1J8VA 4Y6GA 2KAUC 2HXUA 3ARVA 3LSCA 2J4GA 3UWEA 2O56A 2QPUA 3E0WA 1FWNA 4GRSA 2Z6IA 1K77A 1OYAA 3L2MA 3G1VA 4LX4A 3EDJA 2EAWA 2QJHA 3KTSA 1UW9A 1XV8A 3SCQA 1ZENA 3LGEA 1R47A 3P7YA 4MDOA 1YMYA 2YSWA 1EF3A 1V08A 2GPTA 2V38A 3W76A 3L0KA 2AAAA 3K4WA 3KBMA 5I06A 1XC4A 3DG7A 4JN6A 1AODA 4YU1A 4NNBA 4QJ3B 4B2DA 5K9XA 5TAOA 4W7WA 2YJQA 2VGGA 1EJSC 4F0HA 4C1KA 3CL6A 5G5IA 2G3JA 4NX0A 3U7BA 4QSFA 3F2DA 5TIMA 3DYMA 5CG7A 1TO3A 3SSJA 3S1GA 3TYDA 3N19B 2VUNA 3VMOA 2E1WA 1WKEA 3BV4A 1DORA 5U4NA 4EXAA 4AYGA 1K8CA 3ZM8A 6XIAA 4ES4A 3TW9A 4HZ6A 2RGLA 3VCCA 2VOTA 2DZVA 1VFLA 4O54A 4NJKA 1AQMA 3CUHA 3W1QA 2PPGA 4RE4A 2AMXA 2VFHA 1BEUA 3OVRA 2RJHA 1O5XA 7TIMA 5MF5A 3FV9A 1JFHA 2PWVA 1M1BA 2JQXA 4GQ0A 1E9IA 3N4FA 3SUTA 1WX0A 1BYBA 1DTNA 3HFYA 4RNIA 2V3DA 3CZEA 3UYCA 3VIMA 1XUZA 1MXSA 4NJHA 3URNA 1W8SA 2BNJA 4DY1A 2XG9A 1Q6EA 3RM9A 2C1IA 4ZR8A 5A95A 4F9DA 4FR6A 4ZQMA 1PKYA 2W66A 1GOXA 3WKZA 1AK5A 4AHQA 4AIUA 3WENA 3NQCA 2HZGA 2FTPA 4NYYA 3ZQ9A 4AX7A 2Z00A 3LQLA 3N34A 3ME3A 4Q6XA 1S2WA 1QNOA 3HA1A 4QLLA 1Q6LA 1WCGA 3MQTA 4BI6A 5FJPA 3POCA 1R2SA 1F6YA 7TAAA 1EO5A 1Q7QA 2WHKA 1XH1A 4Q4MA 4P7LA 1HO1A 4MWAB 4RW5A 4UTJA 1CBGA 2Q02A 3HMCA 3HPSA 2XIOA 1FCVA 3KAOA 3RFAA 4ZQRA 1M04A 5AHEA 2XH2A 3TXVA 4KBXA 3E12A 1J0JA 3ARWA 3H21A 1PUDA 1WDQA 3GC5A 1KRAC 3AC0A 3E5PA 4DXVA 3UZJA 1M7JA 2PF0A 4GI4A 5FSDC 3W6MA 4HJFA 1XIJA 4GUJA 2ZUTA 1IT7A 3W1PA 4Q4QA 3UG8A 3LV5A 2A5HA 3SN1A 3N6QA 1I2QA 4PUWA 3ANYA 4X3ZA 5I79A 1GOIA 4HU0A 2GSHA 2CKRA 2WB5A 3TN6A 1TWZA 3CMGA 4KRTA 3PUDA 2C91A 2YCJA 2BMBA 4JR5A 4HZMA 3TWBA 1OF6A 3GR7A 4D8LA 4EAMA 1JNEA 4ZMGA 4QDPA 2O92A 4CU6A 1R0MA 4C6DA 5EFDA 1U1JA 1S1RA 4FAMA 1LQ0A 3A23A 4GY1A 3LXBA 1E0XA 3APGA 1A5UA 3V18A 2D1ZA 4MADA 1D7KA 3W85A 4H2CA 2CHNA 1A3HA 3W2MA 1K02A 2CNCA 1DPMA 1XBXA 2EHHA 5BW6A 2G95A 4IMEA 4MJMA 3T40A 3UZZA 3LXCA 1GYMA 3VMPA 3OBAA 3HV8A 2OJPA 3VXGA 3LBCA 4LANA 3M44A 3H7RA 3PJUA 4BZYA 4MFDA 2OO6A 4E4UA 3UGRA 4FIQA 1W37A 3NSNA 2GVYA 4JXCA 1IXOA 3LBMA 5I6SA 3SQSA 4XZLX 3GFYA 3NURA 3KOZA 3ZO9A 1H61A 1R85A 2YLAA 1CDGA 4MJZA 5GVJA 2WVSA 1RVGA 2E9LA 1Z8AA 4ACYA 2QULA 3MDUA 3VX1A 1PHQA 1ZCOA 4YTSA 5E6ZA 3WEZA 2PD9A 4JYDA 2VCAA 2J6VA 1EIXA 2ZUWA 3ABRA 1C90A 2FVLA 1DJGA 4XVEA 1TVPA 4JIPA 3VA8A 3N2XA 1ZS2A 1SPQA 3WD3A 2VTFA 1LORA 4A22A 4PBEA 1P4CA 3VOIA 2W0UA 5DT7A 2DVXA 3T0TA 1XJBA 3NSMA 1TIWA 4CQDA 1EJUC 2GJLA 1SUXA 4CN6A 3ARUA 3ALFA 1POJA 4R33A 4F9JA 3R11A 3T7VA 3TW6A 3I3EA 1N8WA 1I0BA 4DJFC 2O9RA 4GVFA 2OU4A 4BQ2A 5H2ZA 3WQGA 1HJVA 2VC5A 1VQTA 2DH2A 4IICA 1LG1A 3UWVA 1C93A 4E5TA 1CXLA 4JTSA 2CFFA 3W9ZA 5FOOA 1MUWA 2WMIB 5DMLA 1JDAA 5CC6A 2TSYA 4J40A 3E9AA 2DJXA 1G0CA 4WDTA 3O1NA 1UR2A 2E6FA 4N9EA 8CGTA 1EJ7L 4NJJA 1G6CA 1QBAA 4NG3A 1ZQ5A 3TJLA 3W74A 1UOKA 4N9DA 1UOZA 4O16A 3UVIA 1N8FA 3NGJA 3EYPA 2OZ3A 4TO8A 5E9XA 1YW1A 3EDKA 3WDQA 3TU9A 5CC3A 4TUFA 3P60A 1TZ9A 4KH2A 3F4DA 5CG0A 1Q6CA 1U33A 1QAPA 2AMGA 4DB7A 4CU7A 1M7PA 1ZJBA 3LBOA 4QIUA 4L65A 4ML4A 4RDZA 1K7XA 3R2GA 4US6A 1BKHA 4GIRA 3GKFA 4D1JA 5DRIA 4JOMA 1LBLA 1A49A 1PZ3A 3U57A 1EGMA 4P61A 3T08A 1RJRA 1XW8A 4ASTA 3ZT5A 1IF2A 4E8DA 1B54A 3UPWA 4LVDA 1K8YA 4GO9A 4RNJA 4UBPC 1A5BA 3CBWA 3BOLA 5DO8A 3CT2A 2X1TA 3VE7A 5FJUA 4L5ZA 4J3TA 2V6AA 3PSVA 2R1NA 3VGGA 5A6BA 1S46A 4BWLC 4YIWA 2OWCA 5G4EA 3R8GA 3W1NA 3EKZA 2D23A 1TCDA 2CBUA 3SN0A 4Q8MA 4NIRA 1QI4A 4YS1A 4ORIA 4K8EA 3WH6A 3QTGA 4LUYA 3LG3A 1DWJM 4DYJA 4UFKA 4ZBCA 4WF7A 3EOUA 3NQGA 3HO8A 4WZHA 4I9MA 5G2IA 1ITUA 4LBRA 2ZC1A 2VR5A 4WR3A 2OQYA 4ZO8A 2QDHA 4IP5A 3VNLA 1QPOA 3LPFA 1QO5A 2WMJA 3PZ9A 1CXFA 4CCDA 3KW3A 3OVPA 1RJQA 5I00A 5EMJA 4EAYA 4FOKA 4DJFA 1OD8A 1JJKA 4O28A 2H8ZA 5DCEA 3QY7A 3BAYA 4IIGA 5I23A 3SN4A 2W63A 1V03A 1VRXA 4OFCA 2YR1A 2H6RA 5IFTA 3UWZA 1S2AA 3CWNA 2IQTA 3SZ8A 3U2ZA 3HQNA 3SCUA 3V1HA 1H7WA 2CIPA 1TV8A 1TV4A 1UWQA 4BF5A 1T96A 3AFBA 1XCFA 2D3LA 2Y0FA 4O1DA 2WKGA 9CGTA 4Z1DA 3REQB 3CLMA 3QMRA 4HKPA 3HG5A 5F2LA 3H22A 2GVJA 4N42A 1C7TA 2NQLA 3CWOX 3W86A 2ZRZA 4MYXA 3DGRA 1W5PA 1R8LA 2W4XA 4G7FA 3WK0A 1JGMA 1NOFA 2OEKA 4CCEA 4PCNA 4MPQA 3E0IA 1ZL1A 5HQMA 1XCXA 4LC6A 1K4HA 1XSKA 3L66A 4QS5A 5I3DA 1GKQA 4FP1A 4WKFA 2PGFA 2VDIA 1UWAA 2Y63A 4N4PA 4F2TA 2IPFA 3MPGA 3T8LA 1ISVA 4BQ5A 2JGQA 4FLRA 2GYIA 4QCFA 4HIBA 3QQ1A 5XIMA 4OGZA 1SSGA 3GW0A 1US0A 4GZ7A 1W5NA 3N4AA 3CAQA 1C29A 5G2WA 3ICJA 2RHGA 4PMYA 1DXEA 4L4PA 4PTVA 3UXAA 4GCXA 3L67A 2PTYA 4ICMA 2B7NA 3VNKA 4ZTXA 3TZFA 3EWCA 1HTIA 3MP5A 1UR1A 1GG1A 5GQBA 1KRBC 3SGZA 4H6RA 1AQ0A 4R88A 2WZHA 3SFKA 3LYEA 4J2MA 1QOXA 4O8RA 4TXEA 2DUAA 1V3LA 3ZLGA 2VFIA 1QNSA 1PV8A 4QAWA 4HU4A 4TMBA 4D6JA 1P48A 2OODA 2H3DA 4I5UA 1XLDA 1PTAA 3AIQA 4BJHA 4HTBA 2C7FA 3PAJA 3LUTA 3KLLA 4ERIA 1NQ6A 5F2GA 1LRTA 5A2CA 4ATWA 1VAHA 1MNSA 3M0MA 2ZXAA 1UHVA 2PRLA 1R3QA 2CBVA 2ZRUA 4TU1A 1GVOA 3C8NA 2QUTA 1F6PA 5HR6A 1NAL1 4DEFA 4QX4A 4IIBA 3ZR4A 3V5FA 3B9AA 3OHIA 4W8AA 1D3HA 2UY5A 4MM1A 3NO1A 3ZLFA 1QUMA 8XIMA 4GBUA 5AHMA 1BXCA 2G97A 2VDGA 3AMCA 5KEZA 4Q8UA 1E5JA 3LOTA 2BY2A 3SRFA 4K1GA 1ZSXA 3U2OA 5IBXC 3KHDA 6XIMA 2QDDA 1C91A 1U1HA 5T8GA 1QK2A 1WUFA 2F6UA 3MU7A 4J3XA 4DBWA 3IANA 3MT1A 2G3IA 3ZLHA 3DG3A 3GVQA 3U48A 4XWUA 3UXDA 2VD8A 2VZOA 4DNMA 2BXZA 4UUIA 2A2IA 2FPVA 1YRRA 4FLSA 2YW3A 3DECA 3DKLA 4UTTC 3BANA 1JGIA 1EDQA 2NQJA 5K3VA 5M1TA 1H5YA 1KQZA 4AEEA 3BLFA 4KT2A 2ZRVA 2ZWZA 4BQ4A 2DW6A 3WLSA 3HPAA 3DFPA 2VX6A 4HP5A 1UD5A 2CU0A 1BF2A 3FOKA 1JYVA 3KVMA 3LS9A 2X40A 1TJ1A 3DEQA 1AVAA 2A6NA 2OT1A 3I6EA 1XGZA 3BVJA 2ISWA 2ZE0A 1JULA 3P14A 3UQNA 1PWMA 3VTRA 2HJPA 3BQ6A 3ERPA 3LGDA 1EDTA 2GUYA 1P0EA 1AW1A 3KL5A 4IMAA 3UY8A 4WUIA 3VGBA 1A0CA 3ITGA 5C8BB 5J04A 3LCHA 5M5DA 1J0IA 4ZFCA 2DH3A 1L0PA 2WYSA 1XS2A 4ROPA 3WUEA 1RD5A 4XD5A 4B90A 2XVLA 4WX2A 3G0UA 3AUOA 4TQTA 3VILA 3O0FA 2RGMA 3OZYA 1JZ6A 5DELA 4LY4A 5EGRA 5IOBA 4CNNA 1XIGA 2CLFA 2XINA 1FDZA 4JFTA 4XZHA 4Z2KA 3K4AA 1VBJA 1D8CA 4RE0A 3TH6A 3GNOA 2REQB 3EB3A 3EX1A 4ZA0A 5J5DA 3P0WA 1PXGA 4HT3A 3XIMA 3ZXWA 3QV7A 2FMOA 4HSNA 1J18A 4C91A 4GIYA 2Y7EA 2Y89A 1KR1A 4S1FA 4YCOA 1QXLA 4BF7A 4GNJA 1TX2A 1ZLPA 2WNQA 1T0OA 2BS9A 1GORA 3TVAA 3QTPA 3L7RA 4LBUA 2FGBA 4ADTA 4XZNX 3SR7A 3A4JA 3B05A 2YBVA 4MJ2A 1A47A 5HXMA 3MUY1 1A3XA 1O7AA 1BYCA 4G56A 5CLTA 5IBXA 3AZSA 2V0TA 3VKBA 4LSBA 4HZ7A 1YLVA 3AJXA 2H8XA 3KCJA 4D6FA 3U8GA 4Z42C 1Q4NX 3W26A 3FDGA 4HYWA 2HPMA 1LTDA 3IJ8A 2YL9A 3G24A 5JU6A 1R3YA 2FZBA 3G22A 4IPNB 3JS3A 1DWHM 3TX9A 3CH9A 2V5JA 2GJPA 2GDUA 3RF9A 1LOQA 4CQCA 3MZNA 5JIWA 1LWJA 2IMRA 2WMIA 4NAFB 3EX3A 2XH4A 5BRQA 1HL9A 1GQIA 4NZ4A 1OABA 2C0HA 1WYIA 2FZ9A 2F2HA 1TWSA 1TTIA 3A3WA 3C6CA 1YPIA 3MUZ1 4RDYA 1JAKA 5GJNA 4C6PA 5GNZA 2ICSA 5D9PA 4DI8A 3NQFA 3W22A 1OCBA 4LW7A 1WXJA 3MYOA 5T9CE 4CCCA 3GH7A 1MQQA 1OADA 2O7SA 1GVEA 3FA4A 5LA0A 4JAWA 4D72A 2PE4A 1H1YA 1JF5A 4GA8A 4Y9NA 4L6HA 4NZCA 4C6CA 1KLYA 2EPNA 3P5YA 5C2CA 6ENLA 3VPLA 4XAGA 3ZSSA 1UR9A 3TQ0A 4IJBA 1BKSA 3LHWA 1XLJA 1FWIC 3SJ3A 2TRSA 1YXDA 3BG3A 3SGUA 1YPXA 4JTKA 3TN3A 3R7MA 4XZIA 1UD6A 2P1FA 1P6WA 1A4MA 4AH7A 3QVQA 1JYNA 3CAVA 2F8QA 3KRSA 1WUEA 3GSMA 4GQRA 3IAQA 1V6TA 2DU2A 3RDKA 3OG2A 4Z1CA 2W62A 1I60A 4M56A 3CV2A 2YBUA 3WBYA 1ADDA 2BOGX 2C8NA 2HTMA 4MNMA 3EX4A 3MW7A 2WHMA 1J6OA 4QEEA 2JEQA 1B3XA 2ZA3A 3KRUA 2YFNA 4UQAA 3JU2A 2R9RA 3A4XA 3BCDA 3CZKA 3N1AA 4FXRA 1SGJA 2WK2A 4JKKA 3FEMA 3WBXA 4TIMA 5G1TA 2QCEA 2ISVA 2ZVIA 3QGVA 4XO7A 3TOPA 4AUBA 1H63A 3N25A 1OG0A 3BAJA 2FPYA 2R1MA 1TUXA 3RPDA 4PUNA 2E6YA 2VFEA 3BGGA 5L9FA 1JNDA 3HF3A 4MHBA 1GQNA 3VGDA 4P5UA 1OSEA 1W3TA 3WDPP 4GD0A 2OQHA 2E77A 4DHGA 3MV01 4Y9AA 3CM4A 4U5IA 1HW6A 4L9XA 1RVKA 3EWYA 4QTGA 3IVSA 3B06A 1ZU8A 2VRJA 3VOJA 3KDOA 2YYUA 3DFYA 3PNUA 3CAWA 4NASA 3M6DA 4I3GA 1KCLA 1DWGM 1VFSA 4RX0A 2WVUA 5SWUA 4F0LA 2CLEA 5FD0A 4REQA 4AYSA 5D9NA 3U5UA 2WPGA 3WJSA 2YDRA 5H6HA 5K4ZA 3W2KA 1JPMA 4A8RA 4DZAA 4S3EA 4M1BA 3GXNA 4MTVA 3REQA 3L4YA 4XAFA 3L12A 2ZX7A 1I1XA 5EBAA 2Y2WA 3T8QA 4I9JA 4ZSUA 1VS1A 5HPOA 3ZJ7A 4JQ4A 3VE9A 1MZRA 5AB3A 1W8GA 1HF6A 1KRMA 1OFBA 4ECLA 2G0WA 3ITLA 4DJEC 1E6RA 3W53A 1EZ2A 3AMGA 3EKLA 3QFEA 4O11A 1GVRA 2HS6A 3TOYA 2D3NA 1CGTA 5EB8A 1TWIA 3NQ8A 2FGZA 1EA0A 2Y7GA 3SBFA 1VP5A 4PUJA 4RCXA 4UTHA 1A4LA 1XL9A 1CEOA 1J79A 3RX3A 5CBJA 3S46A 5K9CA 5ECUA 1XR2A 2OZ0A 2QV5A 2TODA 4B2DD 1GKRA 1NP0A 2QDEA 4RUBA 2QGHA 4QSHA 2DUXA 4LS0A 1CB2A 1XBVA 2Y85A 1SMAA 3S83A 4F3HA 2ZX6A 1LROA 2A21A 4IGHA 2W67A 3HGSA 1DBTA 1QW9A 1LUCA 1N55A 4JZ5A 1HJSA 3BCFA 3O6YX 1OK6A 1MXDA 1PKLA 3U9IA 3S1UA 2O55A 3JRKA 1WDRA 2OPJA 3GQYA 3QZEA 3WSUA 4JTUA 2GWNA 4UTMA 1MXGA 3S3GA 1V02E 2QJNA 1H7RA 1GVIA 3T9PA 3TROA 5DY3A 3W7IA 4IIFA 4OUEA 1H1NA 3CIVA 3AZTA 1FWTA 4M29A 3I68A 3V5OA 3EB2A 1R2RA 4BEQA 1UB3A 4MLJA 1T7LA 1H4PA 1KC7A 1ICSA 1WAUA 2PLKA 3COTA 1YNYA 2FB2A 1TWDA 2H90A 3HG2A 1VGAA 3VDCA 1VYPX 3SCVA 3GNDA 5LSMA 2GLKA 3ARPA 3GW3A 3GVWA 3CH0A 3TMLA 1GWJA 2E09A 2PDGA 3LHTA 1W9XA 4K38A 3AJ7A 4TTUA 3KHJA 1LT8A 3C4UA 3R25A 3WLRA 1VENA 3FN9A 2NXIA 5CGTA 4OBRA 2R82A 4MAVA 1H0GA 3W1AA 4ZFMA 3CWHA 4GY7A 3MI6A 5LKYA 4KWSA 4XBKA 3W7QA 3QXBA 4LAOA 1FOBA 3N73A 4UR8A 5JBDA 1FXPA 1W1TA 1NIUA 3IRSA 5K7JA 4M51A 2OOGA 2PMQA 1BYAA 3FXGA 1CGXA 4DJEA 2CERA 1VIZA 3OW1A 2BWGA 3C8FA 2ABBA 1FKWA 2A4AA 3T81A 5M17A 4HA1A 3DFTA 3W7DA 1V3JA 3QPZA 3H4WA 2I5IA 4WCJA 1EDGA 1FDJA 1ZAIA 1QWKA 4M82A 4GPNA 1Y0EA 1Z42A 3AIBA 5E70A 3ZOAA 3WJYA 4AEOA 3U7VA 3HJZA 2VZSA 4A35A 3TQVA 1J9YA 1KTBA 1OGBA 3QR0A 3UEQA 4LWWA 1JXJA 4LS2A 4ZSTA 1Z44A 1TELA 4HNOA 1EC7A 1OWQA 1MEHA 1XC6A 4ALDA 5A8OA 3LPOA 2PDMA 1RR2A 4GYKA 4S3CA 4YPJA 3OTRA 2XGBA 1GNXA 4BEUA 1JYWA 4XAZA 3UJRA 2BY0A 4QG9A 4CU8A 3QEZA 3DHDA 5BWFA 5G4HC 1T6MA 1GVSA 1F4HA 2NWRA 5DCDA 2Z4GA 3LNPA 3PWAA 2DSWA 4KIRA 5JUVA 1AD1A 2QCDB 4FOJA 1IE7C 5HULA 3T6CA 3W28A 4B5WA 1QPRA 1J10A 3C2OA 5IDZA 4GK8A 4LFYA 3AU2A 3R8HA 3GNXA 4CNPA 2REQA 3W00A 2VX5A 3FVMA 4HU8A 2F6KA 1M5WA 2GOKA 4GMEA 1Q85A 1PTGA 1YXCA 3SDOA 4O1BA 2QAFA 5C9ZA 4HA3A 2BODX 2V3FA 3RILA 1B3OA 1FWCC 3G8EA 3FSUA