2JGYA

The crystal structure of human orotidine-5'-decarboxylase domain of human uridine monophosphate synthetase (umps)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
257
structure length
249
Chain Sequence
SMELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UMP SYNTHASE
publication title The Crystal Structure of Human Orotidine-5'-Decarboxylase Domain of Human Uridine Monophosphate Synthetase (Umps)
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 249
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2007-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2jgyA00
3PF3A 1LOSA 4A29A 4QJ1A 2A7RA 3KVLA 4NJKA 3GK0A 2NX3A 1F2JA 2ZZ4A 3DU0A 2J27A 1GPWA 3S1XA 3G3DA 4IMCA 2B4GA 3C0JA 1MEHA 3ABOA 3SECA 4RXFA 5LHFA 3BARA 1OX5A 1AL8A 2V8ZA 3UPWA 3W7MA 5FF2A 4KWWA 3IRDA 4GWEA 2HMCA 1KFJA 2BWGA 4QSHA 5IBXA 3TW6A 3I65A 1XL9A 2E6YA 2Y7EA 3VI2A 3T55A 3P84A 2FB3A 3LHVA 5D30A 1P0NA 4A22A 4Y90A 3RU6A 3W1UA 3ATYA 4HKPA 4NX0A 4AF0B 1RQHA 1WX0A 1SO5A 1H51A 4NXKA 1Y0EA 2VEPA 4LNYA 1UCWA 3A22A 4O1CA 5KZDA 3QW4B 2E6FA 1TJPA 3GVGA 3EXSA 3VE7A 3CHVA 3IGSA 3W86A 3ZWSA 2WQPA 4ADSA 4UTTA 2B0MA 1OFRA 5K3VA 2QKFA 3UYCA 1DORA 2QCCA 3Q58A 3NOEA 3OEXA 1MEIA 1YDVA 5KZEA 5D32A 3P80A 2VOMA 4I7VA 1XDLA 1VZWA 3GNDA 5EYWA 2JKAA 4HNVA 2FFCA 1ZALA 3CT7A 3G1XA 1H7OA 1VJIA 2ZFAA 4HT3A 1WYIA 5C54A 3NXFA 4JD4A 1K7EA 3OVRA 1LP6A 1PCWA 3HPSA 4UNKA 4P2VA 3HG5A 1XM3A 3B03A 5HWNA 2G97A 1I2PA 5F2MA 1KTBA 1Z48A 3O05A 2C16A 1C8VA 4OE7A 1QMLA 4KFNA 3EX6A 1OF6A 1SW7A 4S1FA 3OIXA 2RDWA 3T4CA 3W1LA 3NYZA 3HOJA 4EOUA 2ZZ7A 3P60A 3OA3A 3L21A 1FCVA 3QM3A 1MSSA 3TC6A 2I1OA 1LRTA 5CG7A 1H60A 1K02A 3MWAA 5D37A 3GXNA 4HHPA 3OG3A 1X7FA 4GUGA 4Y9AA 4OT7A 2EF9A 1J5TA 1W3IA 1ONRA 1G4EA 1IGSA 1SR9A 4IMDA 4DF0A 3W2NA 3HO8A 2TPSA 2WNNA 3QF0A 5A8GA 2VEKA 2RFGA 3DHDA 4O28A 3TAKA 3QSRA 3LV5A 1KV8A 3C2VA 1KV5A 4UCGA 2E77A 3W2MA 3W07A 1A53A 4CNPA 3VKJA 1SW3A 3W84A 3M41A 5F1UA 3JR2A 3M1ZA 1GJPA 2CZ5A 3WK2A 3LRMA 5MHBA 4O4WA 3KAOA 2ZRYA 5TBOA 4DBDA 5FEPA 3PVFA 3U2OA 1AW1A 1JRBA 3WJWA 2BLEA 3PUEA 2YFNA 5DCDA 4UXDA 1U5JA 1M6JA 3OBKA 1TV7A 3LM7A 1VS1A 5EMUA 2A2IA 1W54A 3SSJA 3LB0A 3HG3A 3C3NA 4UFHA 1OVDA 3PB2A 4JIPA 4LT9A 3IEBA 2ZRVA 4NZJA 4ADTA 3EEGA 1YXYA 4OQVA 5DY2A 1P5BA 3NQ2A 4QNEA 4TU1A 4Q4KA 3BG3A 4LVFA 3PWAA 2DZXA 4IMGA 3THAA 1KFEA 1DKWA 2XN2A 4BK9A 1P1XA 4HNTA 4E0CA 3TKFA 2Y62A 3O06A 3NQCA 3BLIA 3EWZA 3N19B 4RV8A 2P1FA 4Z08A 3EKLA 1OFPA 4RLIA 4N02A 4NUWA 3HBLA 2QCGA 1VPXA 2I9EA 2Y70A 4O1BA 3NQAA 4DBEA 4DEFA 1KFBA 3UWWA 3C2OA 5G4EA 3H54A 3C2RA 4BI5A 4O4VA 2W0UA 1TV8A 3P74A 1YPFA 1WA3A 1FDYA 1W1ZA 4K37A 2FQIA 2J6XA 3QQ0A 3EX3A 4KKXA 3GXPA 1UUOA 3UNDA 3MMTA 4AB4A 2NWSA 3QMSA 1LRQA 2WSQA 1FBAA 2CWNA 4IUOA 3UQNA 2E5CA 5F1VA 3VE9A 5EY5A 5LNVA 2NXIA 1KBIA 2Y89A 2TMDA 3V1PA 5LSMA 2ZBTA 3TFCA 4NU7A 3STCA 3EB2A 2GUUA 2VFEA 2ZYFA 3P82A 3LTSA 4WY0B 5BMWA 3MHGA 2V9DA 3AJXA 2NUYA 2AQWA 1Q45A 1CX9A 2CLEA 1OABA 4WUIA 3N2MA 3IIXA 3TSBA 3CM4A 3LCLA 5AHNA 3R2GA 4QISA 3TIMA 4QM1A 1ZY9A 3QJAA 5LGZA 3R5EA 4O53A 3CIXA 3BW4A 3KRSA 3N73A 2WNQA 2GVGA 3QW3A 2EPHA 5SWUA 2E5DA 2CZEA 3NQEA 3WK3A 1W5PA 1EPXA 1LORA 3S5OA 3S42A 3FA5A 1LLWA 3TA6A 1XC4A 4G1KA 4O52A 5DY3A 4Z0JA 5C55A 4IWWA 1Z41A 3KRZA 1KM3A 3UY7A 2A7PA 2QAFA 4CNNA 3B05A 2WSRA 3GDRA 5D05A 2ZRZA 3UWZA 3F03K 4JS3A 4MIMA 3ABRA 4DXVA 4MY9A 1XBZA 5HUPA 4ZZ9A 3W7QA 4LOCA 1HUVA 5GVJA 1HL2A 3WK0A 1NF0A 1QDSA 4JTLA 1IF2A 1PVNA 3VFLA 2H8XA 3AO0A 3MP4A 1VGAA 3SZ8A 4AMAA 1G67A 3MYOA 2EGZA 4BFAA 5AC6A 1W5NA 2ZZ3A 3LTPA 1SQ7A 1TTQA 3W3OA 3L68A 5DXXA 3UY8A 1NF7A 4TMBA 4QAIA 1IXQA 3FYPA 2Z1BA 5FEZA 3W85A 3W1TA 1R30A 1QPRA 4MZ1A 1H50A 1Z44A 3O6DA 1Q6LA 1A5SA 1TO3A 4LVAA 3QRHA 5AN7A 3OVQA 3C8FA 4XWUA 1CW2A 4LTSA 2DZVA 1OK6A 6ALDA 3GLCA 4Z0SA 3W7NA 1B3OA 4IJBA 1K8XA 2YW4A 2Q3RA 1WAUA 3DH7A 4WJEA 3KRUA 1KW1A 2NV2A 1KM0A 3P67A 2TYSA 3ABQA 3TXZA 2A7NA 3W7IA 3L9CA 5G1TA 1NAL1 4NJGA 3Q94A 3TAOA 4BR1A 2C14A 2CLFA 4N6EA 2FPYA 4U28A 4POCA 3PG9A 1M7OA 3E02A 4JTEA 1LBMA 1F74A 4PH6A 3RNDA 3K30A 3BK0A 4OGZA 4WY0A 3HPXA 5EKYA 3HGRA 2EKCA 3W7KA 2YGYA 5J5DA 1PS9A 4PL2A 5G2HA 4UTJA 5F4WA 4UFIA 1QCWA 3UD6A 1WBHA 1PHWA 3LCHA 1T8XA 4XBSA 3V75A 3W22A 1EP3A 1W8SA 4RKAA 1SZFA 2OT1A 4RK8A 4MY1A 1D3GA 1B57A 2CZFA 8TIMA 4MY8A 4PEKA 5CZJA 2WV8A 1T0OA 2ZQ0A 3FYOA 2KZHA 3M6YA 3BVJA 1F73A 4CLMA 1YADA 2DZSA 3E96A 4GUIA 3PBYA 4ZMGA 4WX2A 3DFPA 1WV2A 2OT0A 3A5FA 2E6AA 3FS2A 4N9DA 1H62A 5HINA 4L4LA 1FWNA 1O5XA 2V0TA 1TPUA 3NG3A 1GG1A 1ICPA 1F76A 3DFNA 5HQEA 1TPEA 1Z42A 3DGRA 1KLZA 2X1RA 3G1VA 5LKYA 1SO4A 1L9WA 2QDGA 1S5WA 4DO6A 1JR1A 1JCNA 3UXAA 4JY8A 2H3BA 2B7QA 3NQ8A 5AC8A 2PRLA 4HNNA 2CU0A 2R94A 3DXIA 5A5WA 4NX5A 1CI1A 3CWOX 3TXVA 1KFCA 2VC6A 4ICNA 3SGUA 2DORA 5CKSA 3QMRA 1XDMA 1QOPA 1SZEA 3RFAA 4O50A 1OYAA 1OHLA 3LCWA 2QCLA 4N9EA 2V2CA 3TSMA 2JGQA 1JJKA 4ORMA 3P7YA 3W83A 1JULA 1LYXA 3M47A 1BWLA 3I6RA 4LUIA 3PR2A 1GYNA 1JVNA 4WOZA 3LCGA 2QJIA 2QJHA 3VCRA 2YCEA 1U83A 5D2TA 4ZQOA 2BTMA 1XKYA 1OYCA 4JICA 3UXDA 2C1HA 1DV7A 1TB3A 3S5YA 4A3UA 2GOUA 2IQTA 1T99A 3FOKA 3LI0A 3ATZA 1MZHA 3CPRA 1W37A 3LCFA 3HGOA 3G1FA 3TH6A 5K4XA 1X1ZA 5AHFA 2NV1A 3LERA 4O18A 4XZ9A 3PS7A 1K3UA 3LV6A 2GPTA 2QUTA 4MOZA 2ALDA 2Y61A 1UB3A 3L5LA 1TPB1 4EWND 1N55A 5E0KA 5KTLA 4K7VA 4UTWC 2J9XA 3KXQA 5E1QA 1BWKA 3T78A 4N9CA 1TQXA 3O6YX 5AFDA 2A85A 1WOBA 3EX4A 4AH7A 5LZLA 2Q8ZA 3BV4A 2A1YA 2CLHA 3TFXA 1KM5A 3M5YA 4Y6GA 1QPOA 3P61A 3QMTA 1FQ0A 1QPQA 3E12A 2FTPA 4R33A 5D04C 4OV4A 2NLIA 2NXGA 4WOQA 3PBWA 3W1RA 2QF7A 4MLRA 3DI0A 3LX9A 3KVMA 4N9BA 1K8YA 3MHUA 3EWXA 4DF1A 1F7BA 4EIVA 2WO5A 1K8ZA 4M7SA 5DCEA 3RF9A 5F2IA 3STFA 3NM1A 2JBMA 2G5WA 3DBPA 2YXGA 1SU5A 4A2RA 1KM4A 4I9AA 3NPUA 3L65A 1YDOA 3PG8A 4IOTA 3A9IA 3W9ZA 3QQ1A 4LVBA 3HQ1A 1BTMA 3W1PA 1O60A 4XKYA 1ICSA 1IXNA 1R47A 4HN4A 3O63A 5BOOA 1S5VA 3W88A 1ML1A 1YDNA 1KM6A 4MKNA 4ZVJA 1WQ5A 3H53A 3BLEA 1XI3A 3NPWA 4E38A 5HR6A 3RLUA 2R91A 4WQ6A 2QCNA 4AWTA 1JUBA 2QCMA 3R8RA 1SW0A 4CCDA 4O16A 4UNLA 5KMYA 2ZTJA 2C0AA 3S0CA 2JKPA 5F2GA 4R7JA 3R12A 3SFKA 4ZL1A 2PRHA 2JKEA 4GUFA 1H1ZA 4FNQA 1HG3A 1LLZA 4NZFA 4AEOA 5U4NA 4FIRA 1RPXA 3HG4A 1UJPA 5AC7A 1DQWA 2CLKA 2WOQA 2FIQA 3G0UA 1MXSA 1I2NA 2DJLA 1GVFA 3LCXA 4MUZA 3BG9A 4IXXA 3S1UA 3UZJA 4HIBA 1W5MA 1JCLA 4CQ9A 2EHHA 3W71A 3EWBX 1W3NA 3HGSA 2UV8G 4GE8A 2YZRA 4LC6A 5LNRA 4LV4A 3LXCA 2WPBA 3P81A 3O15A 3PC0A 2Y7GA 1G7UA 2QUVA 3QEZA 4FO4A 1AK5A 2TRSA 6TIMA 1IXPA 3I7QA 1Q6OA 4WXYA 4LC8A 1VCVA 3PUDA 3EWYA 1RQBA 4UTTC 4O0KA 1GOXA 3TROA 1QAPA 4H4IA 4UR8A 5G4WA 5L6UA 3L66A 5K9CA 3U6WA 3Q37A 5F2LA 1RVGA 5U7SA 5CZSA 5KITA 2A4AA 2P10A 3NQMA 3W2JA 2ZZ2A 1ZNNA 1EEPA 4BI7A 1FXPA 4UFJA 2RKXA 3ZWTA 1W31A 2CLMA 1ZAIA 4I7WA 3TV8A 1D3HA 3NQDA 5TIMA 4AVFA 2GJNA 5AYZA 5I3GA 1YYAA 3TK7A 1GYLA 3LHWA 4FX8A 4AHOA 1FCBA 2QCFA 5FF0A 3GNNA 1HO1A 1H7WA 4RZ5A 4P61A 2NZLA 3JRKA 4U4MA 3SI9A 2HSAA 1EWEA 4PA8A 4KFPA 1LTDA 4A2SA 3W7OA 3LBMA 5LGXA 1PV8A 3N14A 1TREA 1O94A 3O1NA 1JCJA 4TMCA 1LDCA 3W1QA 4DF2A 1X6UA 3E49A 5AYXA 3CC1A 5AYYA 4OV9A 3IGXA 4O1DA 2J88A 3B8DA 5E93A 3NQVA 4WZHA 2RDUA 1SZNA 4NVTA 5C6MA 1TRDA 4UFMA 3M43A 4MVAA 4BWLC 4M6PA 4B5NA 4NNBA 5I3IA 1D9EA 1SFJA 4ZQPA 4E2DA 3W87A 3EX2A 3FKRA 4UMCA 2HS8A 2CLLA 4JX5A 3IVUA 1VR6A 3GDLA 1THFD 3GDTA 4TO8A 2DZPA 3G8EA 2A5HA 1LOLA 1ZFJA 2YPIA 4JTGA 4K36A 1OYBA 3RLVA 3W76A 3GZ3A 3S1VA 4MYXA 5G2WA 4AHPA 3M44A 4JTHA 3TC7A 5EPDA 4RX0A 3WJZA 1ZCOA 1XBYA 2A6NA 3L2IA 4S2BA 3EKZA 1I2QA 4IPIA 2OMAA 1OFDA 2ABAA 3O16A 4EF8A 1PHQA 5CZTA 3W1NA 5IM51 1HFBA 1NSJA 2F84A 2J9ZA 4R53A 2ZRUA 2R8WA 3TQKA 1AW5A 2PC4A 3M5ZA 4TR9A 3C6CA 4FXSA 4QIUA 4K8EA 2VFHA 4NJHA 3GDMA 4ONVA 4X3ZA 4NJJA 2JGYA 4UIOA 1XXXA 1MEWA 3TUUA 4JDBA 3O8AA 3MYPA 3PUOA 4O54A 3P5ZA 4HPXA 2FB2A 3BG5A 2Y7FA 4UTUA 2YYUA 1FCQA 3W1MA 3G1YA 1AMKA 2JK2A 3LLFA 2YDAA 4YL2A 4FX7A 4MJZA 1F6KA 3UZ5A 1EP2A 3BW2A 3S8HA 1WOAA 5EA9A 4BI6A 3C61A 4UFKA 1AG1O 2PURA 3B0VC 2VFDA 2X2GA 1M5WA 4YWIA 5L9FA 4JTJA 2WSYA 1H1YA 2A0NA 4IGHA 3G8RA 1QWGA 5H91A 3PSWA 3TMQA 3EWUA 2Y88A 2BZNA 4QNWA 2GVLA 3INPA 4XQ6A 1O5KA 2Z0IA 3GAKA 4GRSA 3BGJA 5G5IA 1R2TA 3RMJA 2X30A 3WJSA 5T26A 5D02A 4FXRA 1JCXA 3IIVA 1I4NA 3MO7A 1DHPA 5D2WA 2Z2UA 2W6RA 4JNMA 4GXMA 4O13A 3FFSA 3JS3A 4JN6A 2ZCGA 3W1XA 3CQ0A 1G4PA 3TDFA 2HS6A 3MI2A 5BW6A 5CGQA 1FUYA 3PBUA 2GJLA 3W1AA 2H3DA 1I45A 4JTFA 5I3HA 1JRCA 1OX6A 1ZENA 1VCFA 3EWWA 3MHFA 3PB0A 5K9DA 1FY6A 3ZS4A 4M19A 1G6CA 4QITA 3CWNA 3DFSA 3LXBA 3B06A 5HR7A 1I2RA 1ICQA 3NEVA 3HG2A 2YFOA 4K8HA 4JTSA 1VH7A 2DZTA 3MP5A 3W7DA 1XFBA 3KVJA 1EA0A 2CZDA 4TX9A 4LS0A 3LGEA 3LRKA 3T7VA 4JGDA 2W79A 4YCOA 4YCPA 2ZA2A 4CCEA 1JUKA 2V5BA 1W5QA 1VYRA 4NJIA 2VXNA 1OFOA 2LLEA 2H6RA 4O19A 3EXTA 3NPXA 3LI1A 3O6CA 3CB8A 3KOFA 1QO5A 1VCGA 1YXDA 3M7WA 2ZDRA 4KFOA 1H7PA 1SPQA 3W7GA 4JTTA 3QC3A 4UFLA 1YTDA 2NX9A 3L0NA 4JYEA 2HTMA 1GVSA 4TIMA 4MFEA 2B7NA 1KA9F 1JUEA 4CNOA 1LCOA 3G3MA 3CU2A 1A5CA 5AHIA 3GIYA 4FEZA 1QNVA 1W56A 1EUAA 1O95A 4KWVA 3C2EA 3G0XA 5HMSA 3UWQA 5CPLA 3E0IA 2BSLA 2VFIA 2ZZ5A 1EUNA 4FNPA 5AB3A 2D73A 1VQTA 2G96A 1QOQA 2BXVA 1A5BA 1V7YA 4RJEA 4LVGA 3A5VA 3W7EA 4XKYB 1V5XA 3KHJA 1KM2A 3PULA 3W7LA 3TCEA 1TMHA 3HIJA 1FWWA 2GQ8A 4UTWA 1K7XA 2ISVA 1KM1A 3TQ0A 1G7VA 4RZ6A 5BMXA 4IQLA 2VFGA 5C2XA 2A6LA 3KX6A 2ZZ6A 4HSOA 2GVJA 3CEPA 4LU0A 2QEZA 3TQVA 1OG0A 3F4NA 3H55A 3TJXA 2NUXA 1TSIA 2C19A 1NEYA 3MI6A 2V30A 2J24A 4JEQA 2NX1A 1DVJA 3E9AA 3N9RA 2B7PA 4IMEA 4NNCA 1TPH1 5DXYA 1YXCA 2VEMA 4K38A 3S5ZA 1N7KA 2YW3A 1HO4A 3GXTA 5D2YA 4A21A 2GQ9A 4AAJA 4JYDA 1EB3A 4RCXA 1EX5A 1JCMP 1R46A 1GVRA 2G95A 4CCCA 1RQEA 3TX9A 4FHAA 1TQJA 3UWVA 1DJQA 1G4TA 2ZA1A 4M7TA 1DBTA 4PC8A 2YSWA 4MYAA 4DPPA 4FB7A 1GG0A 1KTCA 3PY2A 4UMBA 1QFEA 3BGGA 3HB9A 1FDZA 3STGA 2R14A 1VC4A 3GDKA 1MO0A 3ABSA 3HMJG 4M6VA 4N6FA 1VYSX 5H2ZA 1ZHAA 5G1YA 1XCFA 4O15A 2DU2A 4N2YA 4RR4A 2FLIA 4JTIA 2Y63A 1PE1A 3MW7A 5I3KA 1KFLA 3IVSA 4UTIA 5KZMA 3S9YA 3G1AA 3SJ3A 1YLVA 4GC4A 3LHYA 3CEUA 4M6QA 3DAQA 1TCDA 5I3FA 2I14A 2FPVA 1SO3A 2XN0A 3NQFA 4JTUA 3TW7A 4O1AA 3S1WA 2RH9A 5FF7A 3SW6A 3EXRA 3UWYA 4BF9A 4OWGA 1IXOA 1F05A 5FI8A 3S5NA 1BKSA 3NA8A 1A5AA 2OCZA 2QCEA 2F7FA 5FEWA 4R34A 5AHMA 4O10A 1H63A 3G1SA 2FPTA 3IV3A 4Y96A 4WXZA 2VELA 3C4UA 2Z6IA 3DKJA 1LOQA 3DENA 1OX4A 1VLIA 2DZUA 4IMFA 1R2SA 1K03A 4H3DA 5D33A 1VRDA 3MBDA 4GFSA 4O17A 2C18A 3HPZA 4UTKA 3M16A 3MP3A 5CSRA 1GQNA 3NL2A 1I8JA 4CQAA 1GVQA 2RDTA 3DKLA 3F1QA 1GZGA 1H7RA 2X1TA 4NQ1A 1OFBA 1FDJA 1LROA 7TIMA 4ALDA 4XUGA 5TQLA 4YLWA 5BRBA 3DFOA 4UTMA 4H6KA 4JIQA 1XBXA 3FIGA 3LCIA 3YPIA 3GKFA 2CW6A 2X1UA 4XBKA 4FNUA 1L2UA 3G22A 3P8JA 1EP1A 4C1LA 3L67A 1YTKA 1P4CA 2H8ZA 3SY5A 4JDYA 2ABBA 4QQ3A 3G24A 3PSVA 3R13A 4JX4A 4O8RA 3LXAA 1W0MA 4MZ8A 5BNKA 4FNTA 5K2ZA 5IBXC 3L0KA 2ZRXA 1H7NA 4Q32A 3IIZA 1P0KA 3NM3A 2OZ0A 2PRMA 1VLWA 4WY0F 3NQ6A 2NWRA 2QUUA 2V5LA 4PFMA 3LRLA 1FWSA 4PCFA 1GTEA 3FKKA 2AAMA 3EX1A 3M5VA 1ME9A 3QSTA 1Q6QA 3ZFHA 5HULA 3OVPA 3QYQA 3S6DA 4Z1CA 3VNDA 1ADOA 1G69A 2Q8LA 4UTHA 3DI1A 2QCDB 1QO2A 2E09A 4WD0A 2DJXA 5J5RA 3WJXA 3NO5A 1FCUA 4BWLA 1TJRA 5F4SA 2QR6A 1TPDA 2C6QA 3NZ1A 5K4ZA 5EBUA 3MJYA 3C2FA 4AHQA 3GR7A 4DO4A 2FJKA 1PCKA 3LDVA 3RK8A 3FLUA 4GNJA 3N2XA 1SSDA 4X2RA 4JY9A 1EIXA 3W23A 3B04A 3NAVA 4Y8FA 1O4UA 3LBCA 3IIOA 3P8IA 1YTEA 4X22A 3T40A 3GYEA 3WFAA 1HTIA 1BEUA 4W9TA 4PL1A 1TV5A 4AWSA 1JQVA 5FF3A 2PCQA 5FF4A 2B7OA 2QDHA 4AF0A 3NVTA 4DELA 3A23A 4O0ZA 4I7UA 4DPQA 2E68A 3N9SA 1OFAA 4DQWA 1L6YA 1PL9A 5CPNA 3LHUA 5CSSA 3BO9A 3THQA 3CLMA 3QH2A 4ML9A 4OBTA 1H5YA 5LNWA 2P0OA 4HSNA 3BPWA 1NFBA 2E1DA 2C3ZA 1B4KA 4FIQA 2CFFA 2YYTA 2VENA 1K7FA 3CTLA 1JCYA 2DP3A 3BLFA 1KFKA 3MUXA 4N4PA 3U8GA 2ZTKA 1OFEA 1YPIA 4MZYA 1UUMA 3L0GA 4LWWA 1DL3A 1GVOA 1SUXA 3DHFA 5EL1A 3NGJA 2DZWA 4GUJA 3QPZA 4EF9A 3NDOA 3LHZA 1DOSA 2Z6JA 1XUUA 3WJYA 4ADUA 3DZ1A 3GX9A 2ZZ1A 5CZ0A 4Z1AA 1E51A 3TR2A 1ME8A 4NT0A 4DO5A 2V2DA 1SFLA 3G1HA 3L5MA 2NXHA 2VEIA 1H7XA 1AL7A 4IX2A 3NL5A 3R89A 2J9YA 1KBJA 5D09A 1B9BA 4JXCA 1PIIA 4LY8A 3LOTA 5C5YA 3GR8A 3BW3A 5K9XA 5DELA 2Y85A 3W7PA 3FEMA 1OFQA 3W7JA 1X8FA 4RXGA 2QCDA 3I7SA 3G0SA 3QFEA 1TRIA 2C15A 2V81A 4EVZA 1FWTA 1WDWA 3MI3A 2WNZA 1B4EA 1XBVA 3QPYA 3DFQA 1OF8A 3LTYA 3N3MA 3NPVA 5D2VA 2NUWA 3STEA 3FJ6A 2CLOA 2ATSA 1VYPX 2V82A 4PODA 3W75A 2H90A 1NVMA 4YXGA 3SIZA 2WKJA 3W7HA 1GTHA 5DBTA 1OJXA 3PAJA 3O07A 1UASA 3M5XA 5K7JA 1W5OA 1LM1A 4NNAA 4UMAA 1LZOA 1A50A 2Y7DA 3TE9A 1TPC1 4LV9A 1TTPA 4XTIA 5D2XA 4IXHA 3SR7A 4ZQNA 1F6PA 5AOUA 3FJLA 1TTIA 3G18A 3IGUA 4LVDA 3W70A 3CIWA 1FXQA 4LRTA 4MFDA 2VKZG 2XFWA 3D0CA 1LRNA 1EWDA 1VHCA 2RHGA 2BX7A 4JR5A 2OJPA 4O11A 3KFTA 2X16A 3USBA 4FNSA 1ZJIA 3SGZA 5LHEA 4ORIA 1JQXA 2ATMA 2OX1A 5HNRA 3HJZA 2VFFA 3NL6A 1FX6A 1Q3NA 3NQ7A 1TPVA 5FEXA 2C13A 3GKAA 4AXKA 1H61A 4Z1DA 1TPWA 2AGKA 1DJNA 4UC5A 4CQ8A 4S2CA 1L6SA 3B0UX 4MPQA 5G2IA 2V2HA 4ZQCA 5I3JA 1X1OA 3UWUA 3I7RA 2O7QA 3W73A 2YX0A 1R2RA 4PTNA 4FF7A 3Q2DA 1GWJA 1Q6RA 3WK1A 4RZ4A 4IPJA 4E2BA 4YMZA 1DQXA 4O14A 3TJLA 4LUJA 4UTLA 4HPJA 1WBJA 1J4EA 3N34A 1IIHA 4OU1A 3GAYA 4O57A 3T44A 3ZR4A 4L4MA 3G1DA 4D2JA 3LHTA 1KTNA 4Z1BA 3W7CA 4M5PA 4JTKA 1QR7A 5LNSA 4IX0A 3W72A 5HJLA 3NNTA 1RR2A 2QCHA 3TNOA 3IIPA 2ZA3A 5HWJA 4O12A 5DLCA 4J9JA 1S5TA 1QPNA 5AHLA 3UPBA 3ANYA 2Q3OA 1LBLA 5FESA 5D38A 3C56A 2QJGA 1AW2A 4LS1A 3LLDA 3TU9A 2O7SA 1UBSA 4Q33A 2FDSA 4K6AA 4K7YA 3NZRA 4OHQA 1TIMA 1SSGA 1F5ZA 3PBVA 1ALDA 3QZEA 4N4QA 3GB6A 4ZQRA 2XN1A 3W7RA 1OX4B 4GUHA 4X9SA 4JYFA 5KSWA 1GEQA 4UUIA 1XUZA 3HF3A 4FNRA 3TMLA 3C52A 3NL3A 1FWRA 3W74A 1C9DA 3B0PA 5AHEA 5ABTA 5HWMA 5F4XA 4UR7A 4AWUA 1T96A 2ZRWA 3OHIA 4NXSA 1SO6A 2PE4A 2QAPA 1S3HA 3TSDA 3IVTA 2YR1A 3W6YA 2E6DA 2E5BA 2TSYA 4LS2A 1I2OA 2Y6ZA 4FX6M 3A21A 3F4WA 3P5YA 1VHNA 1W3TA 3PM6A 5DCBA 3ELFA 4JX6A 3W2UA 5DBUA 4C1KA 4MLJA 1L6WA 3NQGA 1SZGA 3MBFA 1IIGA 1WXJA 1RV8A 3M0ZA 3M9YA 1M7PA 3A24A 2WJZA 3I68A 1TTJA 5CPOA 1TPFA 1OK4A 1RZMA 1J2WA 1ZAJA 3P62A 1ZAHA 1G4SA 4LRSA 5DN1A 3NR0A 1GT8A 4GJ1A 5HUOA 4LW7A 3L5AA 2CLIA 2GQAA 2X1SA 3KVKA 4XTDA 1RD5A 5KINA 5CPMA 2ISSA 1LBFA 4GBUA 3W2KA 3HGJA 4K39A 3W2LA 4HNUA 2EAWA 4MJMA 5LNUA 3B4UA 2ISWA 1N8FA 3DFTA 1ME7A 1TYGA 2A21A 1KLYA 1C29A 5D03A 4ZQMA
chains in the Genus database with same CATH superfamily
3Q65A 4AIBA 3BZJA 2F61A 1EDTA 2A7RA 4NJKA 1F2JA 3GHTA 3DU0A 1GPWA 4P7RA 1CLXA 3PUGA 3S1XA 3FAWA 2BXYA 4IMCA 4QE1A 3GU9A 2VGBA 1FWCC 3CGTA 2DH2A 1OX5A 3W7MA 5CXPA 3FJ4A 4GWEA 1E6RA 4N7QA 2YL9A 5IBXA 3UXIA 3EAUA 4G9PA 3E2QA 1IWPA 1D7FA 3IS4A 3P84A 4OFCA 4E2OA 5F7UA 3LHVA 1P0NA 4AD4A 3RU6A 4KESA 4HKPA 1RQHA 2VRKA 2V5DA 4EKJA 4NXKA 1FWEC 1IZCA 3TYZA 5JH2A 4URIA 3VE7A 1FOBA 2ESCA 3CHVA 3W86A 3ZWSA 3NO3A 1NDVA 4NILA 3NZQA 1GOQA 3L2MA 3UYCA 4XD4A 4IIEA 5FSDC 3Q58A 3IPWA 3OEXA 1YDVA 5KZEA 1GHSA 3GNDA 2Z24A 1UD3A 4HNVA 1ZALA 3TN6A 3AHZA 1H7OA 4V28A 3PAOA 2WANA 1EHNA 1K7EA 1LP6A 4UNKA 1H2JA 2G97A 3WD1A 3ALGA 1I2PA 2X41A 2PTYA 1DWHM 2A3HA 1QMLA 1NOUA 4BZYA 2RDWA 3T4CA 3VNKA 4EOUA 3P60A 3QM3A 1MSSA 2I1OA 3U2EA 3RPMA 5CG7A 5G4HC 1H60A 1I75A 1SVDA 3RITA 1VFHA 1V03A 3QYSA 4OT7A 1W3IA 1ONRA 4IMDA 3QR0A 4J5NA 2ZX7A 1F4HA 1IEVA 2TPSA 3DHDA 3QSRA 3LV5A 4H41A 4UCGA 3W6MA 3VKJA 4GACA 1VFSA 4LEFA 1GJPA 4KERA 3WK2A 4F4RA 4DJEA 4X61A 2UBPC 4O4WA 4ZFMA 3KAOA 3GIPA 5FEPA 5CLWA 1JRBA 3WJWA 2VX4A 5DCDA 2PGFA 2FDMA 3OBKA 1UP0A 3UW6A 1EA9C 3LM7A 3MMWA 5EMUA 3CT2A 4JTQA 1RA0A 2VZOA 3TCSA 1J12A 3B9EA 3HG3A 1XINA 3C3NA 1OVDA 1Q63A 3AS3A 4LT9A 3IEBA 2ZRVA 4DY1A 4ADTA 4FXFA 4PCSA 1E6QM 1YXYA 1AUSL 4PMJA 2MUCA 4Q8NA 3KL3A 2JQXA 1UZHA 1VEOA 1V3HA 3NQ2A 4QNEA 2XVLA 4Q4KA 3RILA 4F9DA 4Z42C 2ZXAA 4LVFA 3PWAA 3EOLA 1KFEA 3GBEA 4BK9A 2ZXQA 4HNTA 2Y62A 5JQ9A 4QEEA 1EZ2A 3V0UA 3EWZA 3L4ZA 3TZFA 1BYAA 5I2UA 1ZBCA 4H9UA 4N02A 1UPPA 1M7XA 5HMDA 3HBLA 2Y70A 4KEUA 3WNLA 4B5VA 4DEFA 3D46A 1W8GA 2Z2AA 3VO0A 5G4EA 3H54A 4BI5A 1IZKA 2DDXA 2W0UA 1TV8A 3ZO9A 5CJ5A 4P7LA 1RJPA 1FDYA 4K68A 1UKTA 3DEQA 3QQ0A 4KKXA 4H8HA 1BPLB 5D4YA 4UWMA 4HN8A 4JHZA 3MMTA 4CD8A 1TZZA 3ARXA 4F2TA 4PGLA 4YU1A 4AB4A 2WZEA 3QMSA 4C1NB 1WUFA 1WKEA 4D1JA 3VNMA 2CWNA 3BSGA 4IUOA 1ZZMA 1EGVA 2E5CA 6A3HA 2Q09A 5ABEA 2TMDA 1X6NA 2ZBTA 4H9MA 3T8LA 3S5SA 2ZYFA 3LTSA 3IAPA 5A95A 4ZO9A 2V9DA 1JEZA 1UG6A 2AQWA 1ITQA 1BVWA 2P8CA 2YCJA 2YA1A 2DFAA 3CM4A 3DESA 3H4XA 3S2MA 3TYUA 1J6OA 4PBEA 4ZE5A 7TAAA 3COTA 3QJAA 3QXBA 1GOKA 3R5EA 2GGIA 3RCYA 3CUZA 1J96A 3BW4A 3BV7A 3ZJKA 4DB7A 1A4MA 2GVGA 2BY1A 2XTKA 1W5PA 1TZ7A 4CD5A 4O52A 4Z0JA 2VTFA 4ZOAA 3UY7A 4CNNA 2OB3A 4H9VA 5ABHA 3UWZA 3U0HA 3F03K 3GBDA 2O9OA 2EG7A 2NQZA 1WO2A 2BOGX 4DXVA 4MY9A 5HUPA 4HPNA 1ISXA 4LOCA 4A4AA 5GVJA 4RE0A 1S2AA 4HGXA 1HL2A 3WK0A 1QDSA 3GR4A 1PVNA 3MP4A 1DEDA 3DIPA 3NXLA 2E67A 5C9ZA 3PN8A 4DRSA 2GSHA 4BFAA 5AC6A 2DIKA 3PHAA 1SQ7A 1TTQA 3W3OA 4KGJA 4TMBA 3PFMA 1T6MA 5FEZA 4MTVA 1H50A 1S5NA 3QRHA 4EANA 1CCWB 4XWUA 4AZCB 6ALDA 4P7NA 2YW4A 3GVQA 4E4FA 1ISWA 1NU5A 5GNXA 2Q3RA 1WAUA 4F0HA 3DH7A 1DJGA 3CZ8A 4WJEA 2E9BA 3WL0A 3WBEA 3W7IA 2ZXDA 1OCJA 3Q94A 2PDJA 1QK2A 2CLFA 1U5HA 2FPYA 2QULA 3DX5A 4U28A 5T9BG 2JIWA 1WXYA 3E02A 1LBMA 4WGXA 4DWSC 4C6KA 3BK0A 4OGZA 5EKYA 4DJFA 3GC2A 5BXSA 1R9ZA 1XSKA 2BS9A 2XISA 1EPVA 1GUVA 2W91A 4FMVA 5J5DA 1MDLA 3WH6A 4PL2A 4PCTA 5G2HA 4UTJA 3TYDA 1PHWA 3LCHA 3W22A 4GGHA 4RKAA 1BVZA 3QGVA 1R9YA 2I16A 4AVOA 4MY1A 2OLSA 1B57A 2A3LA 4GO8A 4MY8A 3TTEA 7REQA 1EZWA 1GOIA 5EMLA 2KZHA 3M6YA 1NWUA 1F73A 2FJUB 4CLMA 3EDDA 1OCQA 4J40A 4EPDC 2MNRA 1GPFA 4XO6A 1EJRC 1DIDA 1PUDA 4MNLA 3UT0A 3FS2A 1H62A 2YL5A 1VD6A 5HINA 2VMFA 3ZOAA 4LUSB 1JPHA 3DFNA 3SIMA 3DGRA 4LBRA 1KLZA 2PAJA 5M3WA 4RZBA 3SCNA 1RY8A 3GE7A 3UXAA 4D9PA 3KCLA 2H3BA 3KW3A 4IP4A 2B7QA 5AC8A 7ENLA 1Y65A 4KMQA 3CWOX 3RM4A 1A80A 2VC6A 1W3LA 3SGUA 1QNSA 2V67A 3QMRA 3QY8A 1R38A 1V77A 4RL3A 2C71A 3PANA 2F9RA 2J66A 5JUVA 1UWIA 4N9EA 3TSMA 3W83A 1JULA 1LYXA 3WYZA 4IG2A 3I6RA 1RCQA 4XD6A 3EEZA 2QGYA 1HKVA 3PR2A 2QJHA 4ZQOA 2VGGA 4JICA 3UR5A 3WMBA 2BHYA 3VTRA 3OA5A 1S38A 4C6JA 1YNPA 1MZHA 1C8QA 5M03A 4WJXA 1X1ZA 3ECQA 4O18A 4XZ9A 5AZ1A 5E0CA 2GPTA 2ALDA 3ISIX 1F6YA 3L5LA 4EWND 1N55A 4H1ZA 2YL8A 3OVGA 1YEYA 3JZEA 2OKTA 4DXKA 2J9XA 4H19A 1UZ1A 2ZX8A 1BWKA 3T78A 4N9CA 4IGNA 1R3TA 2Q8ZA 3BV4A 2A1YA 2OLHA 2X7VA 3RJXA 1CNVA 3M5YA 4Y6GA 1QPOA 3QHOA 4D6FA 2IPFA 5XIMA 2NXGA 3PBWA 3W1RA 2ANUA 3FDGA 3KVMA 3RRAA 4N9BA 5C9XA 2DW6A 1O1ZA 4DF1A 1F7BA 4MAVA 3APYA 2HK1A 5F2IA 5GPRA 3NM1A 2JBMA 1O5QA 2OZ8A 2GWGA 4GZIA 1UW9A 5ABGA 1PKLA 1CB2A 4I9AA 3L65A 2DW7A 1TV4A 2OR2A 1Q2SA 2BVDA 3QQ1A 3HQ1A 3UR2A 1ICSA 1AD4A 4LCRA 4E3VA 3V3WA 1R47A 2EPMX 4PUEA 1HL8A 4QTGA 4L64A 1A5NC 4ZB0A 3WMSA 3WDIA 3VIGA 4G6CA 3BCJA 3BLEA 4Q3MA 1B90A 2XVGA 3SB0A 3IWPA 1E71M 1JUBA 1VFUA 1DWGM 1U1HA 4O16A 2GJXA 2OZ3A 2Q02A 2C0AA 5F2GA 3S2JA 4UZSA 1DWAM 1HG3A 5HDRA 4NZFA 1Q65A 3EOSA 3R43A 4LBSA 5U4NA 4MUPA 4MADA 1DQWA 2AL2A 5D9OA 2WOQA 2DV0A 4P7OA 3R7MA 1GVFA 3BG9A 4IXXA 3AMKA 4CQ9A 2EHHA 1W3NA 3HGSA 3WLOA 4GE8A 4LC6A 1UR8A 1JI2A 2P3ZA 3LXCA 3BTNA 3O15A 4QE5A 2IQ0A 5CZKA 3R58A 1PTGA 4FO4A 1IXPA 1ONWA 3BAIA 3GNPA 4BCEA 2EPLX 1GOXA 1HKIA 3TROA 1QAPA 4H4IA 4KIRA 3K13A 3KOZA 3H2FA 1TJ1A 1RVGA 1Z7AA 5JIWA 3FJNA 5FL0A 4L6DA 2ZZ2A 3RR4A 1W1IE 4PR4A 3CUXA 1REQA 2XH7A 1ZAIA 4PMDA 4P5UA 3BDKA 4H6QA 3E6EA 2AL1A 5I09A 1N8IA 3BJSA 1YYAA 3B0XA 3TK7A 4HSHA 3USZA 2WJDA 2PLKA 3WMLA 2QCFA 1M7JA 3KE0A 5GNZA 3K1DA 4HA0A 1BF2A 2OQYA 4FALA 2NZLA 1J0ZA 2BVYA 3KOYA 2G3IA 1EWEA 2A3AA 3V0TA 5LGXA 4ERGA 4JN7A 4S3KA 4TMCA 3NUKA 1X6UA 2VOTA 5AYYA 4P7QA 4QCEA 4WDXA 4TTGA 3BAXA 3CZGA 2P88A 1W9BM 4WZHA 3SUTA 4H00A 1KC7A 4BWLC 4NNBA 1D9EA 4E2DA 2QMKA 3DERA 6PTDA 3EX2A 4GKLA 1WE5A 2HS8A 1NDWA 4JX5A 3IVUA 4CU8A 2WMJA 1VR6A 4TO8A 1EOMA 2DZPA 4JTGA 1LOLA 3M0LA 1PKYA 2HROA 1OYBA 2WWCA 4KEZA 1JZ8A 4XB3A 1EJWC 4MYXA 5EMJA 3CPUA 4NYUA 3EOUA 3L2IA 3GNXA 4IPIA 3B8SA 3VM7A 1YKWA 3ZXWA 1E4MM 2ABAA 1AFSA 1GVYA 4EF8A 4MKSA 4RV3A 5CZTA 3W1NA 4H2CA 4V33A 2Y1HA 1E1CB 2ZRUA 3SCPA 3KDOA 2WBGA 1AW5A 1CT5A 2VC7A 3M5ZA 4TR9A 3RIKA 4FXSA 4K8EA 4G8TA 2VFHA 4QGCA 3GDMA 4X3ZA 3H2CA 2JGYA 4UIOA 4XISA 3TA9A 5C7HA 1J0JA 1MEWA 2C8NA 3FSTA 3TUUA 3QR3A 4O54A 3WZ0E 2YDQA 3WFLA 3RPDA 1TR9A 4C6PA 1MRAA 2Y7FA 4UTUA 2YYUA 1XR2A 3G1YA 5A6BA 3Q4DA 1HW6A 4RW3A 4G7EB 4ILSA 1F6KA 4JAWA 5EA9A 2X42A 3OLDA 4GZ7A 3AYTA 1HP4A 3QV8A 3GHSA 2VFDA 4ML4A 2RJGA 4S3GA 1M5WA 2WSYA 3WLRA 4MMWA 4HU3A 4WLCA 4W8BA 1P0BA 3CUJA 2OO6A 2Y88A 3U57A 2BZNA 2GVLA 2W67A 3GTIA 4B5UA 3KL0A 4RE3A 3BGJA 1R2TA 1AH4A 4D6IA 1CLKA 4HZMA 3GTNA 1Z6KA 2QUMA 5D02A 3IIVA 1I4NA 2INZA 1DHPA 2W6RA 1DE5A 4PTMA 1FUYA 2GJLA 2J78A 3QVQA 3W1AA 2UY2A 2CNCA 5I3HA 1OX6A 4M82A 1Y5XA 4AISA 1FY6A 4REQA 1G6CA 5B7YA 4JKMA 3LXBA 1V3JA 1ICQA 2FKPA 2YFOA 2PU0A 1E6ZA 3AXMA 4JTSA 1VH7A 1EBHA 2DSWA 3MP5A 4AY1A 1XFBA 3KVJA 2CZDA 4LS0A 1H1NA 2FZBA 1WKYA 3M0HA 2YXOA 3LPPA 4CCEA 5LIYX 1X96A 2V5BA 1U1UA 2OTDA 2VXNA 1OFOA 4L1GA 1VCGA 4KFOA 1X98A 1SPQA 3XISA 4JTTA 5CPTA 1KCXA 3L0NA 4TIMA 4D8ZA 1LCOA 3W27A 3G3MA 2HVNA 4US5D 2VZTA 4Q8TA 1Q8AA 2BHUA 4L4PA 3WBAA 5AECA 2J47A 4F40A 1O95A 3UWQA 5CPLA 1BSIA 4PTDA 3W01A 4C60A 2D73A 1A5KC 2G96A 3TLQA 1EBGA 4RJEA 4OTKA 3UERA 1V5XA 1BQCA 1CXIA 4W93A 5I0DA 2ZWYA 4IQLA 4AZBA 1TKKA 5C2XA 3KX6A 1XF0A 1C7SA 5DO8A 5IDZA 1XYLA 2CITA 1LJYA 1NEYA 2QNEA 2J24A 2NX1A 3SGGA 3N9RA 5DXYA 5C70A 4K38A 3UEQA 4CQDA 1HO4A 3GXTA 5D2YA 4U5KA 4A21A 1E43A 5ECUA 2WLYA 2FFIA 4JYDA 4MJ2A 2PWEA 2G3FA 1GNXA 2PP1A 3CAKA 4HA3A 1A0EA 1E6PA 4QFUA 4DPPA 3DCPA 2SFPA 3PY2A 4QQUA 2J4GA 3N11A 3LBOA 4XZLX 1FDZA 3GDKA 3ABSA 3HMJG 3N25A 2FGLA 4M6VA 1VYSX 4LCQA 3VDAA 5IXEA 2DIJA 3IRSA 4RR4A 2FLIA 3OW1A 1SM9A 1KFLA 3DBNA 3S9YA 4AY7A 3SJ3A 3R10A 4C7GA 3CEUA 2R1NA 2FVKA 4MDPA 5EBAA 4E3TA 4K8GA 3MC5A 5MKGB 1KRAC 3VZYA 3OYXA 5DT7A 2XN0A 3DG3A 2QPXA 2QYGA 5DRIA 2BODX 4O1AA 3BJTA 3UZXA 5FF7A 3SW6A 2EG8A 1UC5A 5CPQA 1BYCA 2WPGA 3SDOA 1F05A 4PTVA 5FI8A 5AVHA 1QHZA 1FHLA 1P1MA 4ZSUA 3EPMA 1C8YA 1AJ0A 4XIMA 3HQPA 3QKEA 2FPTA 3TQPA 3QFWA 4Q8PA 1QHOA 4WXZA 1UWAA 5D8ZA 3C4UA 1KB3A 4NYYA 4OZOA 1W1VA 4H3DA 2PPGA 2IKGA 2NV9A 1ENUA 1FP8A 3MP3A 4ACZA 1I8JA 1C92A 1GZGA 1FDJA 3SY1A 3QQWA 4ALDA 7TIMA 4PN2A 4XUGA 5BRBA 2OYMA 1R3VA 3WQEA 1VFFA 4JIQA 1M04A 4YVVA 2VCAA 1YBQA 2CW6A 2WSPA 3EA3A 4X60A 1EP1A 4C1LA 2GOKA 4ECLA 1YTKA 5AYBA 1P4CA 3O2LA 1X1NA 1HJQA 3KZPA 3R13A 4JX4A 4RDYA 1Q6EA 1V8EA 1W0MA 1YRRA 2JEPA 1VEMA 4M24A 4JIRA 5IBXC 2ZRXA 4M29A 1IHIA 4JFVA 2OZ0A 2PRMA 1YNYA 1L0PA 3VD3A 2ZUSA 1VPYA 3K1GA 4PFMA 1V3IA 1X97A 2REQA 1E1FA 5HA7A 1U1JA 2DQWA 2GDVA 2GZXA 2XIOA 4P8UA 3DG6A 2OWXA 3K8KA 3ONBA 2HE8A 3F7JA 2FYMA 1V6YA 1QO2A 2HXUA 5A6LA 2WZTA 4MB5A 3H26A 5F4SA 7A3HA 2QR6A 1TPDA 2C6QA 4OJYA 4FA3A 5K4ZA 4K1GA 2EKGA 5A6AA 2R1PA 3NO1A 1PCKA 3LDVA 4GNJA 4GIYA 5A2CA 1GHRA 3O9NA 1DXEA 3MZNA 2DZAA 3B04A 1JPKA 5E9XA 2XIQA 2BG5A 4GG9A 1V3LA 4PUKA 2J7BA 3GYEA 3WFAA 2OGJA 1ECQA 3GWQA 1BGAA 2XU2A 3FN9A 3QTPA 1AODA 1EHAA 5FF3A 1KQZA 2PCQA 4EXBA 5I78A 2QDHA 1B3WA 5C9WA 4ZB5A 2GVEA 4IP7A 1NDYA 1XW8A 3THDA 3LHUA 4KT2A 3QH2A 2XH2A 3AMDA 3GC5A 4O1EA 1H5YA 4J3XA 3NEHA 2Z2BA 2EPOA 3T42A 2GGJA 2C3ZA 2PDUA 1HIZA 1JCYA 3C5QA 3F4VA 2VX6A 3BLFA 1KFKA 3MUXA 1M1BA 1KCKA 2VCBA 3U4AA 2ZUNA 1SUXA 5EL1A 2BB0A 3NGJA 4C7DA 2HEJA 1JNEA 1Q5MA 3D47A 1RP9A 5H8PA 3LHZA 1ITCA 2Z6JA 2YOCA 3WJYA 1K4GA 1SJDA 2X7WA 1FWJC 1W1TA 2ZZ1A 5CZ0A 3AIVA 1ME8A 4GYKA 3T0CA 2WZHA 1EF2A 1KWGA 2BVWA 1B9ZA 4ICMA 1JDCA 1AL7A 4IX2A 3Q45A 2G4JA 1IGWA 3S83A 4JZ5A 2DVTA 4GJIA 2XFRA 4LY8A 3LOTA 4I5XA 2H9AB 5A6JA 3W7PA 3FEMA 1FWIC 2XHYA 2DT3A 2QCDA 4GX8A 3QFEA 2V81A 3QTGA 4EVZA 3SCQA 2ZIDA 1B4EA 2WC4A 4FP1A 2WJFA 2CLOA 3QOKA 3C0SA 2X0YA 1JDAA 2V82A 1E72M 3GH4A 2H90A 2EBNA 2WKJA 3P6LA 4HQVA 3QBUA 3O07A 5K7JA 2R9RA 1JYWA 3AZTA 4NNAA 3H21A 5B7ZA 4UMAA 1OC6A 2PUZA 3GNOA 3TE9A 1TPC1 5I5RA 4Z2LA 2VC5A 3SR7A 1V0MA 4ZQNA 3IJ7A 3OZOA 4BA0A 4H9ZA 3MWCA 1TTIA 4ZENA 3R1ZA 4LRTA 3VNJA 4NSBA 1EWDA 4IMAA 2PTWA 5E6ZA 2DT2A 2RHGA 4GIEA 1D8CA 5IRPA 5BXRA 4NZ5A 4JR5A 3KFTA 2AMGA 1CGYA 1ZJIA 2OX1A 1FX6A 5BRPA 3VOJA 2CC0A 1CGTA 3PZUA 4F8XA 3NQ7A 5FEXA 3WNOA 1WZAA 3C86A 3RGTA 4A8LA 1PX3A 2AAAA 4CQ8A 4S2CA 1L6SA 1UR9A 2XVKA 5I3JA 3AS1A 1MUWA 2WNWA 2PMQA 3SCOA 1S46A 1R2RA 4PTNA 3V35A 1Q6RA 2WCSA 1Z69A 4RZ4A 1DQXA 4O14A 4H6EA 3B9AA 3PTDA 3N34A 2E9MA 3N6JA 3ZR4A 3UCDA 3G1DA 4H7VA 3T1GA 4CNSA 4NAFB 3W7CA 1QR7A 5AY7A 4XD3A 4AWEA 3WH9A 3W72A 5EFFA 3WQVA 3NNTA 2FMOA 1E0XA 1VFLA 3W53A 4TXEA 4ZTXA 5A8OA 2ZA3A 5JBFA 1ZLPA 4LAUA 5HWJA 1JXKA 5I23A 3ANYA 1W3KA 3TTQA 4YWSA 4R27A 1PDZA 4Q33A 2FDSA 3H70A 1JZ4A 3ZSTA 3VD4A 4AD3A 1OC5A 1P43A 1TIMA 1SSGA 1F5ZA 2ZWZA 3PBVA 1XCXA 3QZEA 3ZIZA 1LL6A 3CV1A 4GFIA 3HURA 3RAOA 1PSCA 5PTDA 2YA0A 4ERAA 2WMHA 1GEQA 3MV01 4UUIA 4FNRA 2CIPA 5HATA 2NQ9A 4A05A 4Y9PA 1T96A 3B9NA 3OHIA 3EPNA 2EJAA 3S6OA 2BDQA 1JGIA 4W4QA 2WVUA 3IARA 1I2OA 4S3DA 3P5YA 5G1MA 1MUMA 4IGSA 3PM6A 4BS0A 4QX4A 4DJFC 2PU1A 4DZIA 1L6WA 3NDYA 5B80A 1WXJA 1RV8A 1O68A 1ZP3A 1ZAJA 1ZAHA 3AXIA 3N6QA 5A1AA 1UWRA 4LRSA 3QV6A 4AZCA 3L5AA 3NIYA 2X1SA 7PTDA 4US5A 1RD5A 5KINA 1EGZA 3GG0A 4GBUA 4MJMA 1QU4A 1KR1A 2A21A 2VWSA 1FA2A 3G5EA 1CBGA 3EA2A 4XZWA 4PEEA 3OB8A 3IAQA 1JFHA 1R3WA 4QJ1A 3GK0A 1LF1A 2ZZ4A 5H1WA 1EDGA 4UQDA 3LNMA 2ALRA 4U3CA 4UNIA 1V6XA 4UCFA 4JQ1A 4JIEA 3VD7A 1AL8A 2V8ZA 2VQUA 3PZGA 3IRDA 3WBWA 3E1F1 4M6UA 2HMCA 1CPUA 3LMZA 2AQOA 4QSHA 1KRBC 2NT0A 3PNUA 4F0RA 2OEMA 2WAGA 4Y90A 1U33A 3W1UA 3KLKA 4NX0A 1SO5A 4ATLA 4H9XA 2IS7A 3GG7A 4W87A 3K8MA 2VEPA 4LNYA 4BEUA 2OGYA 4O1CA 4ZOCA 2DT0A 4KWSA 2GSEA 2E6FA 3PZOA 4HK7A 3IUHA 1C90A 3IGSA 4LUSA 3P2VA 4ADSA 4UTTA 1OFRA 5K3VA 5IFPA 3NOEA 4IH3A 3P80A 2ZUVA 2QJNA 3AHTA 4HPHA 2FFCA 1F3EA 4HT3A 1WYIA 2Z1WA 2VUYA 3B8TA 3HG5A 1WKDA 2OXNA 2POZA 3UFYA 3HA1A 1KTBA 3O05A 3CK5A 5E9AA 2CXGA 4PULA 2V63A 1SW7A 1JPIA 1ONXA 2Y8KA 5DQPA 3L21A 4R9OA 3TC6A 4KPLA 1E9YB 2OSWA 1ZTVA 4WDUA 4AX6A 1TX2A 4DAFA 1S2VA 3R25A 1MXGA 1X7FA 3SQMA 3OOQA 1CENA 1KQYA 1SR9A 3SEPA 4DF0A 2WNNA 3HU7A 4UTFA 3GVWA 1NWTA 2VDGA 1WZMA 1KV5A 1A53A 3UESA 1SW3A 3DGBA 3JR2A 1HQTA 5LIUX 3LRMA 2ZRYA 5TBOA 1LQ0A 3WLPA 2BLEA 1QI3A 2YFNA 1RJQA 1TV7A 1TWWA 4BKNA 1FWGC 3CO4A 3A12A 3SUVA 2OQHA 3W00A 5I79A 4DUXA 1XH1A 1EJVC 2DUZA 5C2GA 1P5BA 3VMOA 3AYSA 1DJWA 3BURA 5M5DA 5EU9A 2DZXA 3L4YA 1JGMA 4CU7A 4HK5A 2XN2A 5GJNA 2B31A 3TKFA 5EMKA 2FZ9A 1DJYA 1OBAA 5LXEA 3NCOA 4PMYA 4ZR8A 1OFPA 1S1PA 3V5OA 1PBGA 2I9EA 4O1BA 3N4FA 3S6TA 4B2DD 2OQLA 1K9EA 4S3AA 3WSUA 4ZO8A 1MW1A 1J8VA 4O4VA 3WF2A 4IIHA 1OB0A 4YTTA 3MDUA 1GVIA 4WJ8A 1YPFA 1E5JA 4WK9A 1J5SA 1W1ZA 1OIFA 4AG0A 3EX3A 3ID7A 1XLEA 2Y2WA 1UUOA 2G3NA 2HV5A 3UNDA 3A4AA 1KBLA 1PKMA 4HMNA 2ZC1A 1B1YA 1FBAA 3MUY1 2WW5A 2P50A 3CL8A 1HKMA 3S2LA 3UQNA 3QV7A 2C7FA 1VRXA 3CH0A 5LSMA 1EYEA 4ZB2A 3RLGA 4ZEPA 2XIJA 1RK6A 3AJXA 5HQLA 1K6AA 3XINA 4DAIA 4WUIA 3IIXA 2OWWA 3TSBA 2P8BA 3LCLA 4OOZA 4DN1A 3R2GA 4KCUA 3DUGA 2DSUA 3U7VA 1E9IA 1OWQA 6XIMA 5LGZA 2VDHA 4PUNA 2PWHA 4JFSA 3CIXA 2FVMA 3N73A 2ZDSA 3EZ4A 2EPHA 4HYRA 5SWUA 1OIMA 3WK3A 2ZX5A 4I9JA 1OADA 2RJHA 3IV8A 2G0WA 4XUYA 1POJA 3S5OA 3FA5A 2NLYA 2CERA 5C55A 1Z41A 1KM3A 2A7PA 1F3WA 4D6JA 2VEGA 3R11A 3OHMB 2YA2A 4ZODA 4FPSA 1PZ3A 1MFVA 3MUAA 4JS3A 4MIMA 5FCZA 1BXNA 1NF0A 4I5RA 3LLXA 3VFLA 1H11A 3AO0A 5FKYA 3SZ8A 1X7IA 5FOOA 3MYOA 2B81A 3SBFA 3HQOA 3GW3A 1NF7A 4QAIA 1IXQA 3FYPA 4YJ5A 1RY0A 1R30A 1L6GA 1Z44A 1M9HA 1Q6LA 4IQEA 2P3EA 3KS6A 4JTRA 3U5UA 4LTSA 2DZVA 4F0SA 2HBVA 3LGGA 4Z0SA 1B3OA 4IJBA 1EEXA 3MCOA 2D0GA 3OODA 2Y5EA 2PWDA 4WKHA 3T0AA 2NV2A 2TYSA 1EJSC 3L9CA 4HJWA 4DO7A 3XIMA 1LL7A 1A0DA 3VUSA 2C14A 4NHVA 4N6EA 4IP5A 1ELSA 4KCTA 3SM0A 1Q2RA 3PG9A 2WMKA 4JTEA 3BSHA 1CDGA 5BOFA 4IIBA 1RALA 3HGRA 2EKCA 4AZ7A 2V5CA 3GZAA 2YGYA 3VMNA 4H04A 4UFIA 4EACA 1F3XA 4KRUA 2ASHA 1W8SA 2E8YA 1SZFA 1Y7VA 5CLTA 4RK8A 2XVPA 3UG8A 4PEKA 5CZJA 4JFUA 2WV8A 1E1CA 3FYOA 3BVJA 2NVCA 2DZSA 4GUIA 3CAVA 4HK6A 2E6AA 1OSEA 4CEXC 4N9DA 1Q66A 1RJRA 1I0BA 1FWNA 4I6KA 4CN4A 1T41A 2BGQA 4EX4A 1US3A 4MWAB 4WSJA 1GJWA 4DBSA 3NSMA 1F76A 1TPEA 1Z42A 2NVAA 4Z2HA 3E5PA 3L23A 2X1RA 6ENLA 4G7EA 1L9WA 2QDGA 1S5WA 4DLFA 4V1YA 3BOXA 1MQPA 3EB3A 5BYWA 3B8WA 4JY8A 5AC4A 4KWUA 5EGRA 4C6FA 2PRLA 2R94A 5A5WA 5BU6A 4A35A 3S9IA 2W92A 1DIKA 4IQJA 1KFCA 5DF0A 1V6VA 4ICNA 3CS2A 4FF5A 2VQTA 3V16A 2V3FA 4L9ZA 1R0MA 1B3YA 1OHLA 1A4LA 3LCWA 4L1XA 1XD0A 3P3BA 4I6VA 1JJKA 3MSRA 1BWLA 2DY3A 3K4DA 3MKKA 1GYNA 4OBSA 2QJIA 3VCRA 1U83A 5D2TA 3E38A 3UXDA 2QXWA 1RLCL 3S5YA 5A8NA 2IQTA 1HGYA 1PKNA 1T99A 5M1TA 3FOKA 1EO7A 3LI0A 2CHNA 3FK4A 3LCFA 4C91A 5LA1A 3TH6A 3K4AA 4W8LA 2VZUA 4LAOA 1UH4A 1K3UA 3GYCA 4KRTA 1OQFA 3AWOA 2Y61A 4AC1X 1ZQ5A 2ZXBA 4V27A 2ZUTA 5KTLA 3FY1A 4XX6A 2OVLA 5AFDA 3AYRA 4AH7A 3CYVA 3ITCA 1KM5A 3P61A 3QMTA 3CO8A 1FQ0A 3H22A 2FTPA 5D04C 1ZJBA 3REQB 1BRLB 4OV4A 5KEZA 2NLIA 3OGVA 3R79A 4WOQA 3UCCA 3DN5A 3FEQA 3DI0A 3CMJA 3AAMA 3WELA 4D6HA 3GW0A 4H01A 3MCNA 3MHUA 3EWXA 3APGA 2ON3A 2WO5A 4ZE4A 4M7SA 2G5WA 2QV4A 2FVLA 1FWHC 2C1GA 3SRKA 3VCNA 2YXGA 1SU5A 2HPMA 3NPUA 3BICA 1ZP4A 3W9ZA 2Z25A 1CEOA 4LVBA 3W1PA 4QS6A 2KAUC 3R8GA 3VX1A 5FSEC 1WP6A 4HN4A 3O63A 4B9YA 4C6LA 3CV6A 5BOOA 2OKOA 3M0JA 4DJED 3KS5A 2HNHA 3H53A 1XI3A 4E38A 3H7UA 3RLUA 4FOUA 1YNQA 3EDEA 4W7WA 3RO8A 1TX0A 4DM1A 2GWNA 3VKKA 4GVIA 4D71A 4MB4A 1RH9A 3BAWA 1Q13A 3BH4A 3PPCA 4C7FA 2WZMA 4R7JA 3R12A 2O0TA 4GUFA 4FNQA 1LLZA 1QTWA 2I5GA 1SGJA 3OBEA 3CH9A 3HG4A 1UJPA 1XKJA 1HJUA 2INEA 2CLKA 3AXXA 1PEZA 3KOXA 3G0UA 4PUMA 2I5QA 1I2NA 2D1ZA 1F3TA 3EBVA 3UJSA 1E5NA 2PLCA 3S1UA 1F07A 1DJXA 3W71A 4Q8OA 1GKQA 1OGGA 3SUWA 2YZRA 3H7VA 2HVMA 4KETA 3QGKC 1CWYA 1UQYA 1XRSA 3P81A 2Y7GA 1AK5A 1LT7A 3O0KA 3VIKA 3T6CA 4UOZA 3PUDA 3EWYA 2YB1A 5LYRA 5H8MA 2TAAA 2JE8A 3L66A 3CASA 3VDBA 5K9CA 3Q37A 2WHLA 5F2LA 1NP2A 5U7SA 5MKGA 2PWUA 3NURA 3S2CA 5BXTA 1Q6DA 1H0IA 1EEPA 4TVUA 4GKTA 1DYSA 1FXPA 4UFJA 3QC0A 3ZWTA 1W31A 3WQ6A 2AGTA 3TV8A 3KUMA 2VD9A 3NQDA 2GJNA 5AYZA 4E4PA 1XYBA 3RDKA 1GYLA 3LHWA 4FX8A 4IPNB 5FF0A 1H7WA 3GD6A 1OD0A 4KFPA 4A2SA 2Z26A 3LBMA 1PV8A 2D3NA 3N14A 1TREA 1O94A 1LDCA 3W1QA 3HV9A 3CC1A 4O1DA 1TG7A 1XYMA 1XIMA 3B8DA 4PUUA 1GZ1A 4GISA 1SZNA 2V3GA 5I03A 3A4XA 5C6MA 3M43A 4MVAA 1SFJA 3U2CA 3UVAA 1GORA 2Y8UA 2PP3A 3FKRA 4MF4A 4GH3A 2CLLA 1KD0A 1XSIA 1A5MC 1GW9A 1XRTA 8CGTA 3UJFA 1THFD 1V6TA 4PRTA 3G8EA 1ZFJA 1P7TB 1ZCCA 3N4AA 3N2TA 3GZ3A 3PNZA 5G2WA 4AHPA 4F48A 3M44A 1EC8A 3TC7A 1CXLA 2PDMA 2Z29A 2O4MA 4Q8VA 1E9LA 4RX0A 1JAKA 1QUMA 2PC8A 1RCOB 1P6WA 4PSRA 1I2QA 1J0YA 5GNYA 1OFDA 3AUJA 4PMNA 2XGIA 3VGDA 4UBPC 4B2DA 2C79A 1HT6A 3QZ6A 1HFBA 3WUGA 1NSJA 3ITXA 1AQHA 2R8WA 1NFPA 3WENA 3OGRA 3RRXA 3BQ6A 4ONVA 3AYVA 2VX7A 4X0VA 1XXXA 2YB4A 4W7UA 3O8AA 5JH1A 1NOFA 3P5ZA 4HPXA 3BG5A 1FCQA 1RBOB 4MKVA 3W1MA 1AMKA 3SJNA 2JK2A 4NZ3A 3LLFA 1FFRA 4MJZA 4HMCA 1V0NA 1EP2A 3QY7A 4BI6A 4IL2A 4O1FA 4M1BA 2PURA 3ITGA 2X2GA 3DG7A 4JTJA 4D8AA 2A0NA 3BCDA 3BJFA 3WQPA 2V3EA 3G8RA 1QWGA 2VRQA 3PSWA 3URAA 3ZR6A 4QNWA 3GAKA 3RMJA 1E0UA 2X30A 4W5ZA 2QUNA 5T26A 3N13A 1JCXA 2VI0A 3RX4A 1E40A 2FHFA 4O13A 4JN6A 3GY1A 1VKFA 5MF5A 3UJEA 3S9ZA 2W4XA 1G4PA 1ZBWA 5BW6A 5CGQA 1BVNP 4YTRA 3PBUA 2CCRA 1N8WA 3LENA 4JNYA 4LUTB 1CECA 2H3DA 1R3SA 4JTFA 3LZ3A 3TC3A 3ENLA 3LA4A 4H2HA 4GA8A 1OGBA 3EWWA 4XG1A 1VJSA 3CWNA 3DFSA 2WCAA 3LK6A 1O12A 2WSKA 3AISA 5HMFA 1ODZA 2XIIA 1EJXC 4AX7A 3W7DA 1EA0A 1I9CB 1E6XM 2ODOA 4MNMA 3LGEA 3LRKA 3T7VA 4YCOA 1UP2A 1J9YA 4ROQA 1VYRA 4Q4QA 4QDPA 2LLEA 3KHDA 4QHRA 2H9AA 3BUVA 3EXTA 3NPXA 1YW1A 3CHFA 2PDCA 3HQNA 3LI1A 3CB8A 4U3AA 1YXDA 2ZVRA 2ZDRA 4QLKA 2EEXA 1DXFA 1BYDA 3A4WA 4MFEA 3AXHA 4HA1A 5CC6A 1RP8A 5E09A 1A5CA 5AHIA 4JCMA 1QNVA 3AIUA 4KWVA 1OZQA 2VFIA 3AHYA 4P8WA 2QVNA 1QBAA 1QOQA 2BXVA 2YLAA 3A5VA 3W7EA 3HPFA 3UGVA 3SN4A 3TCEA 1FWWA 2GQ8A 1K7XA 1KM1A 1ZBVA 5LIKX 3TQ0A 2ISFA 3S2NA 2VFGA 4ROPA 2A6LA 2ZZ6A 4GVFA 1TCMA 3CEPA 4Z2GA 4IT1A 1OG0A 2GYIA 5HJXA 4J2PA 3F4NA 3H55A 2MANA 2OO0A 1TSIA 1QW8A 1YHTA 2NVDA 2Z00A 3MI6A 2V30A 3RCNA 4F9JA 3VNIA 3UF9A 2B7PA 3S5ZA 1N7KA 3PZMA 2YW3A 1D3CA 1P6BA 3VVGA 2GQ9A 2G3JA 4AAJA 1RLDA 4RCXA 3MUZ1 2G95A 3ARWA 1UIPA 4FHAA 1YPXA 1DJQA 1J79A 1DBTA 2JALA 2YSWA 1WUEA 4TVCA 2VHLA 4FB7A 4UMBA 4RPQA 1I1WA 1XIJA 2R14A 3ZJ6A 1UROA 4IFOA 3S3GA 4PRWA 1C7TA 1EIBA 2XSXA 4N6FA 1EH9A 5H2ZA 1ZHAA 4MWAD 1XCFA 2VVNA 4UQCA 4GCXA 4O15A 1EF3A 3DFHA 2DU2A 3KBMA 2EQDA 3EMQA 2PLJA 4JTIA 2RGLA 3MW7A 4GYFA 1T40A 3P0XA 3UG4A 4ZGYA 1PO9A 3G1AA 1UR0A 1YLVA 3OGSA 3QY6A 4NAFA 4M6QA 1WAWA 2WCGA 5I3FA 3CUFA 4FLOA 3OJGA 1UD4A 5BROA 4PSPA 2PBOA 4JTUA 4EPEC 1XLBA 3AJ7A 4F2BA 3BXWA 3UWYA 1NWSA 2DGAA 1IXOA 3CHEA 5A6TC 3OYZA 1A5AA 3CL7A 2OCZA 3B0YA 4R34A 3CL6A 5AHMA 1H63A 2Y5SA 1L2QA 2DH3A 3ZT7A 1DJHA 3IV3A 4Y96A 3ZLHA 1AQFA 5CBJA 3DENA 1CGWA 1WPCA 1K03A 3MBDA 2HVOA 3SUUA 2GGHA 3E2VA 3GVVA 1EFZA 2BV9A 2XM1A 1XG4A 5CSRA 2GK1B 2AKZA 4E8CA 3DKLA 2X1TA 1JG9A 3NSXA 3PWGA 2W27A 2X40A 2Y8VA 4XZIA 2WVVA 3QLDA 4CD7A 4G2DA 3FSUA 3APTA 2DEPA 3FW6A 2XINA 3GKFA 4MPKA 4TTUA 3HN3A 1MQRA 2X09A 1F9CA 3U4FA 2PF0A 3T05A 5FJOA 3V0SA 4Q4PA 2CEQA 2ABBA 1TZ9A 2J13A 3ZVIA 4O8RA 3WQ5A 3S1GA 1RBAA 5K2ZA 3T4WA 5C0QA 4LFYA 3IIZA 2ACUA 1EXBA 2WLZA 3KDNA 1U30A 3KZSA 2QUUA 3VKBA 4DI8A 3LRLA 3FKKA 3EX1A 1GEHA 4FXJA 4QE4A 3O0FA 4XAGA 2VL4A 1ADOA 2Q8LA 4UTHA 3DI1A 3LPOA 2QCDB 2E09A 3BOFA 2VRJA 5EBUA 3FV9A 3MJYA 4AHQA 4K1WA 1MRQA 2PI6A 1FP9A 2FJKA 1F8IA 3CUIA 1H3GA 8A3HA 4YN5A 4PBGA 4IPLA 2O56A 4KF1A 2UY3A 4MWAE 4FR6A 3LBCA 3ZT5A 4OBRA 1ZSXA 1SMDA 3NGFA 1I1XA 4BQ3A 5I02A 4GX9A 1W17A 3FHQA 1KXQA 4I7UA 4B4FA 4A3QA 2BOFX 3BMWA 3S46A 2E68A 5JVLA 1PL9A 3BO9A 2FH8A 4W5UA 3LPGA 4I90A 3A4JA 4E6MA 1NFBA 3ABZA 2CHOA 2CFFA 1P0DA 4M0XA 2V68A 4ZXLA 4CKQA 3N2BA 4N4PA 4J7RA 5BRQA 4TX8A 3U8GA 3VC5A 1YPIA 3L0GA 4RNIA 4TV5A 4I5UA 2VGIA 4LAKA 3K8LA 1HX0A 3NSNA 5REQA 5CCZA 3WLKX 3U7BA 3KCJA 3NDOA 3OZMA 1DOSA 4ADUA 3CV2A 3DZ1A 3MB9A 3GX9A 4G5DA 3LU2A 2OELA 1UKSA 3PWIA 1SFLA 3G1HA 5A6BD 3L5MA 3ZJ7A 2NXHA 5H8UA 2VDIA 4LSBA 1A0CA 3ME3A 4GQBA 3WL1A 5IOBA 3NL5A 3R89A 4E4UA 2JEQA 4KEMA 1PIIA 1AA1B 4GQQA 2Z7GA 3PBMA 3BW3A 1TWZA 3IJQA 1JPDX 5K9XA 5DELA 4FI4A 4A3RA 1UKOA 4PMVA 3W7JA 3I7SA 3JVAA 3G0SA 3UZWA 3TJIA 4S3CA 1FWTA 3CPGA 3KTXA 3VABA 2Z4GA 2WNZA 4GNVA 3MZ2A 1EJUC 2NUWA 1WCGA 1OD8A 3T81A 4AZGA 1V7AA 3ARRA 3RU8X 5DEZA 3W75A 1NVMA 2VURA 4YXGA 3W7HA 1XIGA 1DJIA 2VX5A 3GG1A 3WQOA 5DBTA 1UASA 4IF2A 1MMFA 5C2CA 1L8PA 2XH0A 1P0EA 1LZOA 1A50A 4LV9A 1TTPA 2VZSA 4XTIA 5D2XA 3WQ8A 1F6PA 1F8MA 3IGUA 3W70A 3VUPA 1TV3A 2X2YA 1LRNA 4EK7A 4F79A 3HFTA 3AHXA 3F5KA 4DX3A 5EMYA 4IIGA 3CQKA 2OJPA 2X16A 3USBA 4B3LA 5FJUA 1JI1A 5CC3A 1C9WA 4ORIA 1JQXA 5HNRA 4AXNA 2WM1A 3ARUA 3CZLA 3GO2A 3NL6A 3VGHA 2QPUA 3ARTA 3BAKA 1GGOA 4TVDA 2C13A 1UD6A 4AXKA 3UP8A 3VC6A 2FZNA 1DJNA 2VC9A 3W4RA 4AEFA 5EFDA 4MPQA 3H4GA 5G2IA 5A8QA 1QI0A 2V2HA 2FZMA 3OZPA 3CZKA 3VNZA 2GSJA 2J8FA 3IUIA 4EXAA 1KXHA 1E3ZA 1XIFA 3I7RA 4YNGA 4Q7BA 4XKMA 2YX0A 4G1NA 4IFKB 5AKQA 1GWJA 4GH1A 3ZLGA 4WDTA 3MKVA 1D7KA 3N12A 3RM8A 1IV8A 4UTLA 3DC0A 1WBJA 1J4EA 4C90A 2OG9A 3LN3A 3E0VA 2G3MA 3GAYA 1BQGA 1OCBA 2PP0A 3HFYA 3WEOA 3OLIA 4CEUC 4D2JA 3LHTA 3W0KA 4OVXA 4Z1BA 3VOIA 4XZBA 5LNSA 3K5XA 4LUYA 2QCHA 4GZEA 1LG1A 3LSCA 4O12A 1SZRA 1UHVA 5DLCA 4YVPA 1S5TA 3BLDA 1XIEA 3UPBA 2Q3OA 3GUWA 4XAFA 5FESA 3C56A 5HXMA 3DDMA 2QMJA 2VO5A 4UR9A 3WUEA 1AQMA 2XN1A 3W7RA 1OX4B 4RNJA 4BF7A 4X9SA 4XD5A 3BANA 3C52A 4JOMA 3NL3A 4YPJA 1C9DA 3B0PA 5AHEA 1Q7MA 4UR7A 4IL0A 3WY1A 1XGDA 4AWUA 4ZO7A 2ZRWA 4AVNA 2XSAA 3CAWA 4NXSA 1SO6A 4XV0A 1S3HA 5BU9A 2E5BA 4LS2A 1JF6A 2XH4A 4FX6M 5E0FA 3THUA 3F4WA 2YLLA 1NFGA 2GFTA 3F4CA 4AY8A 2CXEA 4RW5A 5DCBA 3ELFA 3EOOA 3W2UA 5DBUA 3D3FA 4MLJA 3MBFA 1IIGA 2OEJA 5D8WA 1XYAA 1HF6A 1M7PA 1TTJA 3TYAA 4XVDA 3WBXA 1AQ0A 5A8MA 1GT8A 2GUBA 4AUBA 2CLIA 2GQAA 1V6UA 3I6EA 3SCWA 1LBFA 3OPSA 1B0IA 5AYIA 2EAWA 2WMFA 1N8FA 1UZ4A 4F0MA 1KLYA 2BOEX 5D03A 3POCA 1R7AA 1UMYA 1LOSA 3MMDA 3AMGA 2PS2A 2WKGA 4A29A 2PD5A 5M2FX 5I24A 3KVLA 1SYTA 2B4GA 3C0JA 3ABOA 3AICA 3SECA 3A6OA 3VILA 4RXFA 3GM8A 1XLGA 5LHFA 4L80A 5FF2A 4CVUA 3TWAA 1OT1A 4KWWA 4PRRA 3KBJA 1UKQA 3TW6A 4QG6A 3VM5A 2E6YA 2Y7EA 3VI2A 2I57A 1FWAC 4NAEB 5D30A 3B8IA 1H51A 4Y2WA 1XGZA 2PTXA 4KS0A 1WZLA 1MI3A 1SFTA 1UCWA 3A22A 5FAJA 3W25A 4FAMA 5KZDA 5BCAA 3GVGA 4HMDA 3BE7A 1J93A 4BQ4A 4HOWA 2J7EA 4MWAA 1GOOA 2WQPA 2B0MA 1E15A 2QKFA 2QCCA 3LD5A 5D32A 2VOMA 4A3HA 4I7VA 5A8PA 1VZWA 2BMBA 3UGRA 2JKAA 3CT7A 4PUDA 4QAWA 3G1XA 1VJIA 2ZFAA 4PFHA 4QLLA 1BYBA 3OVRA 3HPSA 4P2VA 1XM3A 4KRZA 5HWNA 1JYXA 1WXZA 3VMPA 5F2MA 1G1YA 1W3HA 1Z48A 2C16A 2X8RA 4GI4A 1UWQA 1GOWA 4OE7A 4KFNA 3TYEA 4EPKA 3FX4A 1OF6A 3OIXA 3W1LA 3H7RA 3SRDA 3OA3A 3AMLA 1FCVA 3AI0A 1A49A 1K02A 4UQEA 2E40A 3AIRA 5D37A 3WLMA 3JU2A 3GXNA 3UZZA 2J7FA 4G7FA 4WGHA 4GUGA 4Y9AA 1J5TA 1EC7A 1G4EA 1IGSA 3W2NA 3AZSA 5A8GA 2VEKA 3UG3A 1ECEA 1KV8A 3C2VA 4GXWA 2E77A 4CNPA 1NP0A 3W84A 1Q6FA 1UR2A 1X8CA 2DVXA 3KP0A 4MB1A 2IXVA 2XUCA 3RHGA 4DBDA 3PVFA 1Q85A 5A2BA 4UXDA 3FYYA 1M6JA 1CXFA 1XC6A 3M46A 4LH8A 5CC5A 1PJ9A 2A2IA 3SSJA 1GCYA 4AIUA 2V38A 7ODCA 1SFSA 4UFHA 3B97A 3PB2A 3K2GA 3F2CA 1JF5A 4NKCA 2P76A 3I3BA 1M65A 4AMCA 4H6RA 4OQVA 5DY2A 4HYWA 3REQA 1BRLA 3THAA 1P1XA 4E0CA 1E55A 3O06A 3NQCA 2BY0A 1Z32X 3BLIA 3I3DA 2NT1A 4Z08A 3EKLA 1EDQA 3HPAA 4RLIA 3CIVA 4QJ3B 4NUWA 3U3HA 2QCGA 5HOSA 4WRHA 1BKHA 2AKMA 2XWDA 3NQAA 4DBEA 1ITUA 4JFWA 3SCRA 3ZT6A 3UWWA 3C2OA 1Y8BA 1X6LA 1GK8A 4QROA 1U5VA 2D20A 2GJRA 3KCOA 1DQUA 3P74A 1WA3A 4HPGA 3WNPA 4K37A 2FQIA 1CGVA 2J6XA 1MW2A 1JZ3A 3SN0A 1ZU8A 2W61A 1OZMA 4ZOBA 2PWGA 2PA6A 3VYLA 4F0LA 2XGBA 1E9ZB 1LG2A 2WSQA 4I3GA 1K4HA 3ZSSA 1I60A 2XWEA 3BMXA 3R6IA 5F1VA 1KBIA 3EDKA 1A47A 1SJBA 4HOZA 4EPBC 1RK5A 1K77A 3EB2A 3TOYA 3P82A 4K2SA 5BMWA 2DVUA 2NUYA 1Q45A 4C6DA 3HTWA 5DFAA 3I10A 5AHNA 2BGNE 3TIMA 1T7LA 2OODA 4QM1A 2ICSA 4RDWA 1BTCA 9RUBA 1V08A 2E5DA 3NQEA 4MNKA 3RYSA 1LORA 3H2OA 2BNJA 3TA6A 4H83A 1XC4A 4G1KA 4IWWA 3VXGA 3KRZA 2WSRA 3GDRA 5FL1A 3RX2A 3VD5A 4F0KA 1B31A 2Q8XA 3ABRA 1XBZA 4ZZ9A 2VCCA 3ZZ1A 3W7QA 3CLWA 1KR0A 1AMYA 1XRVA 2H8XA 4LANA 4QG8A 4PB5A 1VGAA 4DHGA 1Q7ZA 2E1WA 4B92A 5XIAA 4AMAA 4CNTA 3ARQA 1W5NA 2ZZ3A 3LTPA 3UY8A 3R94A 3VIIA 2Q6ZA 1R6WA 2Z1BA 3AIWA 2PDBA 4MZ1A 2EO7A 2RUSA 1EQPA 1QT1A 1TO3A 3C8FA 8XIMA 3KM8A 4C6NA 1OK6A 4K3ZA 1K8XA 4I9MA 3ITTA 3EOEA 5FACA 4ZCWA 4Q7NA 4J3VA 1M68A 5HAOA 2VP8A 3KRUA 3KBVA 1KW1A 3ABQA 1XLCA 1AH3A 1TUXA 2A7NA 5G1TA 1NAL1 4DWDA 4NJGA 3BAJA 3R4IA 3CMFA 3GTXA 3TAOA 4BR1A 4MSSA 1R3RA 3N2OA 5JU6A 2VR4A 1DP0A 1OC7A 4POCA 1X38A 1M7OA 2OLAA 4C6MA 1ZBKA 2J6VA 3I4KA 2R82A 4LJ3A 1UR4A 1L6FA 1P7TA 4WY0A 3HPXA 5J8LA 2YJQA 3W7KA 1JD7A 3M0VA 2RGMA 2Z7KA 3CNYA 3N6HA 5F4WA 1AZ2A 4LCSA 4BEQA 4QSFA 2J7HA 3V75A 3GU1A 4L9XA 1DWJM 1D3GA 1XD1A 8TIMA 4DVOA 1T0OA 1DWIM 2ZQ0A 5FJJA 3GXMA 1NY1A 1C93A 5DMMA 1LWHA 2YCKX 3BLOA 1YADA 4C6IA 4WX2A 3B4YA 1WV2A 1UBPC 3A5FA 3TEVA 1XLKA 3PZNA 4S3JA 1GJUA 3KWSA 1HN1A 3AUOA 2CETA 1ICPA 5HQEA 2YL6A 1LLOA 5FJIA 2FH6A 1SO4A 1POKA 2OWCA 1JCNA 3SQSA 3NQ8A 1LT8A 4R88A 3GTHA 3GXFA 2CU0A 3DXIA 1J0HA 3NVDA 1CI1A 1XLMA 3TXVA 1RSCA 1JXJA 4CN6A 4ATDA 3G77A 5CKSA 1JCTA 2G37A 1SZEA 3Q67A 1OYAA 5TD4A 3WF1A 3TZNA 1RCXB 1SJAA 2V2CA 3LQGA 4ORMA 4KEVA 3P7YA 3M47A 4MNJA 1TE6A 1V02E 2EPKX 1CTNA 2BTMA 3E0FA 1NJJA 1OYCA 1XLDA 4D1IA 3PPGA 4CU6A 1DV7A 2GOUA 4IISA 5FJPA 4F66A 3ATZA 4OUEA 4LUTA 1W37A 3G2GA 3WDQA 5K4XA 1JPMA 5AHFA 2NV1A 3LV6A 4HNLA 2QUTA 2Z1SA 3CWHA 4M3PA 2J8GA 4R7WA 1UB3A 3SCSA 1OY0A 5JBEA 4WSKA 5E0KA 5HNTA 3WDJA 3STPA 4K7VA 1ITXA 2HXTA 3KXQA 2HWGA 3VU2A 3AOFA 3O6YX 2A85A 4WKFA 2CLHA 1Z89A 5BOEA 3BAYA 3IUDA 4ASTA 3E12A 3M0KA 3LG3A 4R33A 1H09A 2PZ0A 4LF1A 2QF7A 5LA0A 4E8GA 1UPMB 4GO9A 2IPJA 5D9MA 1K8ZA 1TV2A 1J01A 4AW7A 3STFA 6TAAA 3WLSA 2Y24A 3DBPA 5HQMA 4A2RA 5E5CA 1KM4A 3SSZA 4IOTA 3A9IA 3SUSA 3LS9A 1QXLA 1B30A 1JZ2A 1IXNA 1W6TA 1UD8A 3WQCA 1G5AA 3A9BA 1QJWA 4W7VA 4ZVJA 1Q4NX 1OCNA 1WQ5A 2G8ZA 2QLYA 3F4DA 3RM9A 1ZPTA 3ES8A 4QR6A 2YKKA 2QCNA 4AWTA 2QCMA 4PMZA 1SW0A 4CCDA 2IUZA 4UNLA 2ZTJA 2JKPA 3PZIA 3SFKA 3AU6A 3T2OA 1ZJAA 4DUOA 2PRHA 3THCA 2JKEA 1H1ZA 4HNOA 1PIGA 2E25A 1AD1A 4H8NA 4AEOA 1R9XA 4C6CA 3WX7A 1RPXA 4IGMA 2CBIA 3WQWA 4PCNA 1I0DA 1NWRA 1MXSA 2DJLA 3UR8A 1UA3A 3H23A 4MUZA 2J77A 4HIBA 1KCLA 4HCHA 1W5MA 1UH3A 2UV8G 3ZMRA 4LV4A 2V6AA 1G7UA 2YDRA 2OYKA 6TIMA 2BY3A 2PGRA 1Q6OA 3V18A 4U33A 4LC8A 1W1A1 4WXYA 1RHCA 1BG9A 2OSXA 1BG4A 4O0KA 5D9PA 1A3XA 1KXVA 4J27A 4GZJA 5L6UA 3TN5A 4CD4A 4N0RA 1YQ2A 3F5LA 4U31A 1R7OA 1X39A 3OTRA 3NQMA 3CTTA 3W2JA 4ZXOA 2VR5A 3IJDA 5C9RA 4Q6XA 2RKXA 1EC9A 2CLMA 1OINA 1C3FA 4I7WA 2ZUWA 3T9PA 1FKXA 4J35A 1Q6GA 3M07A 1G9HA 4HMEA 3GNNA 1VBGA 4RZ5A 3AIQA 4U4MA 1RAKA 1DXIA 4PA8A 1LTDA 3FA4A 2DPEA 3ICJA 4LNCA 2V5JA 3MSDA 3W38A 3URBA 2OFJA 4B90A 1PXGA 1JCJA 2GK1A 4L5ZA 3MY9A 1QBBA 5AYXA 3WLTA 5A3HA 1ADDA 2CBUA 3VIHA 1KBKA 8RUCA 2J88A 2D3LA 1XLHA 2RDUA 4DJEC 4GYPA 2D69A 1P6CA 1EQCA 4M6PA 3UR7A 3ZVHB 4ZQPA 3NYDA 3W87A 4UMCA 2PTDA 4B91A 4GJJA 1TMQA 3A64A 1ZS2A 3CZJA 3GDTA 1OG6A 3A13A 1G01A 3MV11 3T08A 3PZVA 4PCPA 3RLVA 3W76A 4QDMA 4AZHA 5A2AA 1R87A 1WDDA 3WJZA 1ZCOA 2PLMA 4W85A 1EL3A 3VZXA 3EKZA 1QK0A 3PJXA 2D2GA 4YIWA 3LNPA 1KO0A 3O16A 4GY0A 1B54A 1PHQA 2Q01A 5TF0A 2F84A 2CYGA 2PC4A 3SAZA 5C9UA 3T0TA 3AALA