1M6JA

Crystal structure of triosephosphate isomerase from entamoeba histolytica
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
260
structure length
260
Chain Sequence
GAGKFVVGGNWKCNGTLASIETLTKGVAASVDAELAKKVEVIVGVPFIYIPKVQQILAGEANGANILVSAENAWTKSGAYTGEVHVGMLVDCQVPYVILGHSERRQIFHESNEQVAEKVKVAIDAGLKVIACIGETEAQRIANQTEEVVAAQLKAINNAISKEAWKNIILAYEPVWAIGTGKTATPDQAQEVHQYIRKWMTENISKEVAEATRIQYGGSVNPANCNELAKKADIDGFLVGGASLDAAKFKTIINSVSEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate Isomerase
publication title Structure and Inactivation of Triosephosphate Isomerase from Entamoeba histolytica
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Isomerase
total genus 94
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2002-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1m6jA00
2QAPA 4FNQA 3SGUA 2UV8G 1JQXA 3FOKA 4HNNA 3B8DA 3GNDA 4NJHA 4UTMA 2H6RA 2CLHA 2A1YA 5D2TA 1LM1A 1C9DA 4JTIA 5T26A 4DF0A 1PHQA 3LHVA 2JKEA 3A24A 1R30A 5HMSA 1KLZA 4Y90A 3CLMA 2CZEA 5F4WA 2PURA 1JCMP 3NPUA 3QPZA 2VC6A 4LC8A 5G2WA 3PBVA 4ORIA 3CWNA 5U7SA 1GVSA 5C54A 3E12A 3W7IA 5LHEA 4FIRA 3CTLA 2QAFA 2J6XA 3KRUA 3PBWA 2ZRZA 4WY0A 2NX9A 4UTHA 3NM1A 3KVKA 1RR2A 4RK8A 1C8VA 3TU9A 1M7PA 3JRKA 4R33A 3W22A 2C3ZA 2TRSA 5HWNA 3W3OA 1JQVA 6ALDA 2R14A 3NVTA 3STCA 1Q6RA 1T8XA 3PSWA 4JS3A 1KM6A 1VPXA 2YYUA 1FXPA 1EUAA 2QCNA 2X16A 4FNTA 5KMYA 1D9EA 1B3OA 1C29A 1RQBA 3C6CA 4KWVA 2OCZA 4ZZ9A 1DL3A 3Q2DA 2ZZ3A 3P67A 1KFCA 3HGOA 3L5MA 2CZDA 4QJ1A 2EAWA 5CZTA 4NVTA 1ZAIA 2C13A 5HINA 1FBAA 2FPTA 3RLVA 1KBIA 3BW4A 4FXRA 3CU2A 4NZFA 4WOZA 1ZY9A 1TPFA 3G0SA 3NM3A 5BNKA 5F2LA 3U2OA 4MLJA 1LP6A 3DAQA 1TYGA 4XBKA 4KFNA 1IXNA 3TX9A 4UXDA 3IGSA 5BW6A 1TTIA 3N34A 4HNTA 3CIXA 3GR8A 2FIQA 1SW7A 1ZCOA 4DQWA 2B7QA 1FQ0A 3OVQA 1LLWA 4DXVA 1G69A 4JTJA 3LTSA 4K37A 2CLLA 4JDYA 2JKPA 4WY0B 1THFD 3B06A 4NJIA 4N4QA 1ME9A 2NXGA 1KTBA 4JTTA 4GNJA 4O54A 5FF4A 4BWLA 2PRHA 1O4UA 4E0CA 1FCVA 4LV9A 3EWXA 3NQMA 3W2JA 4MYAA 2Y62A 3UWUA 3TR2A 2ZRUA 4O10A 5CPLA 3LCLA 1VYRA 3TH6A 3O06A 2YXGA 2B7NA 3W2LA 4LTSA 3QRHA 3EKLA 1NFBA 4A21A 3KVMA 1VHNA 4EF9A 4OE7A 5AOUA 1VJIA 2QDHA 1X7FA 3DHFA 5C2XA 4JX5A 4AH7A 1G7VA 5DY2A 4O0KA 4IGHA 3E02A 3TUUA 3IIPA 3NPWA 3M47A 2ZZ7A 2R91A 2YDAA 3LLDA 1NEYA 4K7YA 3I7RA 1CI1A 4Y9AA 1YDNA 3HOJA 1GVQA 3EWBX 3F4WA 4IMDA 3CPRA 2TYSA 2Y70A 4ORMA 3WJSA 2CLEA 3BG3A 4DO5A 4O4VA 3HPSA 5KZMA 4Z1DA 4JYEA 4U4MA 2B7OA 3QZEA 3LCGA 1KW1A 1S3HA 1Z42A 2BSLA 2RKXA 3LB0A 1S5TA 2JBMA 1TRDA 1Y0EA 3S5NA 5FF0A 2B7PA 1IGSA 2BXVA 1W5OA 1SPQA 4M6VA 3HPZA 4QSHA 1H7RA 3LRMA 5IBXA 3B0VC 2X1TA 3NQAA 1AMKA 4OQVA 3O16A 4O1AA 4LS1A 1K7XA 1T0OA 3MW7A 3FIGA 1N7KA 4IX2A 3CC1A 3NDOA 3R5EA 1H5YA 3W76A 5F1UA 3V1PA 1OX5A 4XQ6A 3S1VA 1NF7A 1W8SA 4AF0A 3MBFA 3FJLA 3HGJA 3NO5A 2VOMA 3SSJA 2Q3RA 1G67A 4ZVJA 1HFBA 1TTQA 2FDSA 3G18A 4S1FA 4WXYA 2GUUA 1Q3NA 4ALDA 4ZQMA 5DBTA 4GRSA 1RVGA 4TR9A 1YTKA 1QCWA 3O6YX 1XBZA 2CLOA 1H51A 1XDLA 4MY1A 3O07A 1EEPA 3EWWA 2QUVA 3PWAA 1TJRA 5LSMA 2GVJA 1OK4A 3O6CA 1ICSA 1KFEA 5AHMA 4JDBA 2ZZ2A 2EKCA 3LCXA 1EP3A 2ZYFA 4MYXA 1QWGA 1W3NA 1QAPA 3FKRA 4R34A 4YL2A 3GXPA 3NPXA 5K9XA 5G4WA 3R12A 4I7UA 4A3UA 3ABSA 2EHHA 4IMFA 4NXKA 3A9IA 1YYAA 1K3UA 2QR6A 4O52A 3QMSA 3GIYA 1U5JA 3UWWA 4UTUA 3ZR4A 3DFPA 1WOAA 3GR7A 3WK2A 3PC0A 5BOOA 3N9RA 2ZA1A 3G1DA 1EX5A 4D2JA 3O63A 4O15A 4JY8A 4HIBA 4AB4A 1SO6A 3UY8A 4JY9A 4KWWA 3B05A 1H1ZA 2ZRXA 1OK6A 3PBYA 4Y8FA 4LRSA 3TQVA 3LHZA 5AHEA 3M7WA 4OWGA 1AG1O 3G3MA 3VNDA 1OABA 1ZJIA 3UWVA 3W70A 3TSMA 2W79A 2Y7DA 4DELA 4NU7A 2DJLA 3L66A 3UYCA 4IPIA 3E0IA 4MLRA 4Z0SA 3CEPA 3NQGA 3O8AA 1BWLA 4GBUA 1TB3A 3T40A 3N3MA 4TIMA 2C1HA 3WJWA 7TIMA 3C4UA 3N19B 2ZDRA 4XKYA 4QIUA 3C0JA 1ZFJA 1TREA 4XUGA 2V2DA 3TK7A 3E9AA 3DENA 3NGJA 3W7NA 5I3KA 5I3GA 3CQ0A 4ICNA 2WV8A 5CPNA 1LZOA 1I2RA 4K7VA 2A6NA 5F1VA 3ABOA 5F2IA 3W1NA 3LV5A 2LLEA 3BARA 1RZMA 3MHGA 1EB3A 1DJNA 3EX4A 3KRZA 4Q33A 2DZTA 4LUIA 1RD5A 3LLFA 4JNMA 1MEHA 3DFTA 2A5HA 5LNRA 4LOCA 4WY0F 4M5PA 1EUNA 4HSOA 3PUEA 5AHLA 4OBTA 3S5ZA 3UD6A 3DFQA 4OHQA 2Y88A 3L67A 4UFKA 3CM4A 2Y89A 2P1FA 3B4UA 4IMGA 5KITA 5AYZA 2V81A 3PAJA 3LBMA 3ZS4A 2V8ZA 1LBFA 3UWYA 3C2EA 3O15A 2CLFA 1W1ZA 4NX5A 3L5AA 4UTWA 1GT8A 4UTKA 5LNVA 1LLZA 4CNOA 3TC7A 1QOPA 1BWKA 2J9XA 3P5ZA 2QF7A 3QFEA 3IV3A 2YSWA 4XKYB 4JD4A 4FEZA 2NZLA 4S2CA 4AVFA 3W7LA 3PVFA 3P84A 3NEVA 1VCFA 1K03A 1PV8A 1R46A 3G8EA 5D2VA 2TMDA 4AXKA 2H90A 5KZDA 3T7VA 2WNQA 2GQ9A 3BVJA 1OFQA 1GVRA 5HJLA 1SZNA 1WDWA 3TIMA 3M16A 2Z6JA 3W7EA 2RHGA 2NWRA 3LCWA 2R8WA 2ZZ6A 4MFEA 4CNNA 1A5CA 1DJQA 1MXSA 3P7YA 3UXAA 3EWYA 4G1KA 3GAYA 4RR4A 2PRMA 2EF9A 3GVGA 4AEOA 4C1LA 4PTNA 1Z41A 1HO1A 5G1YA 5HR6A 4PFMA 1F76A 1EWEA 3W88A 4FXSA 2ZQ0A 1I45A 3UXDA 2ZRVA 2NUXA 4GWEA 3QSTA 1S5WA 3Q37A 2E5CA 1TPWA 1XI3A 3GDKA 1HO4A 2FQIA 2WNZA 5D09A 1TRIA 3A21A 1SFJA 1WAUA 1K8ZA 1GPWA 2OT0A 1SSGA 2A2IA 1F74A 5I3FA 4YXGA 3IRDA 5C55A 4CNPA 3L0NA 3C8FA 3WK3A 3QQ1A 1GZGA 4I7WA 1I8JA 1DQWA 4H4IA 3LI0A 5G2HA 4DPQA 1A5BA 2W0UA 3OVRA 3GZ3A 3L0GA 3W1PA 3CB8A 3NQCA 2O7QA 3P8JA 4BI6A 1XXXA 4XZ9A 3YPIA 1I4NA 1OFDA 3MJYA 4PODA 4BK9A 2XN0A 3DH7A 2RDTA 4IPJA 3W2KA 1EIXA 3C2RA 5L9FA 3QEZA 3W7PA 3M5XA 2R94A 3B0UX 4LUJA 1JVNA 5EA9A 3C52A 4RV8A 4FNUA 1I2OA 3VE7A 1ONRA 2VEMA 1GVFA 3PUDA 1OFBA 3M44A 4JTKA 3LM7A 1OJXA 4NJKA 4Q32A 1KM2A 4O4WA 3FLUA 5AHIA 3BW2A 1AW2A 3GB6A 1SQ7A 1CW2A 4GC4A 3A5FA 3HB9A 4DBEA 4QAIA 4LU0A 3TAKA 3EKZA 4Z1AA 3MO7A 3LXAA 4MY8A 5CG7A 2PCQA 2QJIA 3TCEA 1M5WA 1X8FA 3G1AA 3JS3A 1DKWA 3GK0A 3BG5A 5A8GA 1V5XA 3KHJA 3SGZA 2J9YA 1GTHA 1JUEA 3VKJA 2FFCA 5F2GA 1VH7A 4GUFA 4MJZA 1TPH1 1FCBA 4LWWA 3QQ0A 1TPUA 3NQDA 2ALDA 2KZHA 3TQKA 6TIMA 5HR7A 3EWUA 3P80A 4PCFA 3B03A 1IXOA 2CLIA 3NA8A 3NNTA 4CLMA 1FXQA 1O60A 3ELFA 3M0ZA 3OA3A 2QCDB 3W75A 5AHNA 3DKLA 4EF8A 3FS2A 3TE9A 3TSDA 1FY6A 2J27A 3NAVA 2W6RA 3MBDA 4OV9A 5CZJA 4WQ6A 3R2GA 4LS0A 4GUHA 4N2YA 2JK2A 1XBXA 3CT7A 4EIVA 3LOTA 3QH2A 1XBYA 2G97A 3G22A 3HF3A 1W3IA 3L0KA 3OEXA 3SI9A 5FF7A 4LC6A 3H53A 4X2RA 2C15A 2FJKA 2V2HA 2ATSA 3GNNA 4GE8A 4O18A 2ZZ4A 2E68A 5D2XA 2HS6A 3T44A 3NQ2A 5J5RA 1O95A 1L9WA 1WX0A 3L9CA 1IXQA 2V5BA 3SECA 1SW3A 4UTTC 4JYDA 1A53A 4QNEA 4BF9A 1GYNA 3GYEA 3IGXA 4O11A 3L65A 4OT7A 5GVJA 3G1VA 1XCFA 1H50A 3HO8A 1OF6A 1XUZA 4NJJA 1RQEA 1EPXA 3HG5A 2WOQA 4A29A 4NZJA 1I2QA 1SO5A 4RJEA 2FPYA 3G0XA 4PL1A 3G0UA 4MZYA 1JCNA 4HN4A 2C16A 1LOQA 4QM1A 3EWZA 5CZSA 3KAOA 3HG4A 1L6SA 3NL2A 2Y6ZA 2BX7A 8TIMA 4KFPA 2ABAA 3TW6A 4UMCA 4Z1CA 1YPIA 1FWTA 3NZ1A 1L6YA 2GVLA 1HL2A 2D73A 3EXRA 1EP2A 5LKYA 3W87A 4N02A 5CZ0A 3UPBA 5I3JA 5EKYA 3CHVA 1VS1A 4JIPA 5BMWA 3LXCA 5AC8A 4JYFA 2C0AA 4N4PA 5LNSA 3QYQA 1JCXA 1Q6LA 4N9CA 4ZQRA 2CZFA 2X30A 5K9DA 2QCMA 2X2GA 4J9JA 3PM6A 3MI6A 1YXDA 1WQ5A 2E6DA 3WK1A 4FNPA 3THAA 4K6AA 4HPXA 1F7BA 3RFAA 3TSBA 3RF9A 2FLIA 3TFCA 2Y7FA 2QEZA 5LNWA 3TA6A 2VFEA 5I3IA 5K3VA 1OFOA 4O14A 3WK0A 3TXZA 1XKYA 4N9EA 5IBXC 1VRDA 1Q45A 3QM3A 1JUKA 1P5BA 1WYIA 5HNRA 4DF2A 3W1LA 4HNVA 3W7JA 1LROA 5HUPA 3N2XA 3NQFA 1G4TA 5EPDA 3S5YA 5DBUA 2TPSA 1SUXA 4DF1A 5F2MA 3LHYA 1ME7A 3UWQA 1FDYA 3BGJA 3TMQA 2QCGA 4AMAA 5LZLA 3W7CA 3CEUA 1H7WA 1W37A 4UMBA 2ISWA 5HWJA 4MUZA 1OYAA 1W56A 4NJGA 4CQ9A 2H3DA 2G5WA 2DZUA 4AWUA 3JR2A 4O1BA 2ZZ1A 1FWRA 2WO5A 1XC4A 1AW1A 3DBPA 4AWTA 1DVJA 2GPTA 4NT0A 2BWGA 1RPXA 2PRLA 3GDMA 1SR9A 4O17A 1DOSA 2Y61A 3TMLA 3N14A 5HQEA 1UB3A 1NSJA 1VCVA 3F1QA 1DHPA 2A85A 1EA0A 4RCXA 5HUOA 5BMXA 2EGZA 4RLIA 5AC6A 2H8ZA 3BLEA 4ZQOA 1XFBA 3M9YA 4ZQNA 1EWDA 1F6PA 1QPNA 2CFFA 4YCOA 3FYOA 2E5BA 3IIOA 4O13A 3HG3A 1LCOA 3GXTA 4AF0B 4LS2A 3CIWA 5EBUA 3B0PA 3USBA 5U4NA 2Z1BA 3STFA 3T4CA 4QNWA 3NL3A 1XL9A 4HNUA 1LRNA 1N55A 3BGGA 2A7NA 1GWJA 4I9AA 1MSSA 1XUUA 1GJPA 3SW6A 3TROA 3W6YA 2DP3A 4MVAA 3RMJA 5A5WA 4K38A 4TMBA 4ADTA 3K30A 2RH9A 4UNKA 1SFLA 3FFSA 1DORA 5K4ZA 3OHIA 1F5ZA 2Q8LA 3E49A 1OF8A 4AHQA 5KSWA 2I1OA 2F84A 1FDJA 3KVJA 1VC4A 2ZA2A 2ZA3A 1W54A 2ZBTA 2NXHA 2ATMA 2VXNA 3KX6A 4W9TA 5K4XA 3W86A 1ZHAA 3MYPA 1UBSA 4Z0JA 3M5YA 3UZJA 5FI8A 5IM51 3LRKA 3TQ0A 1WA3A 2YGYA 3PUOA 4DPPA 1PCKA 1W0MA 3PF3A 4GJ1A 1JCLA 1LBLA 4YWIA 3AJXA 2CZ5A 2NV2A 5LGXA 1KV8A 1OFAA 5D38A 2A7PA 5DCDA 3OVPA 1T96A 3W85A 2C18A 1JUBA 5C5YA 1U83A 1QFEA 4FNSA 3P8IA 4EOUA 1SZGA 4IQLA 1P0NA 1UASA 4PH6A 1OX4A 3INPA 1L2UA 2YYTA 3MI3A 3LI1A 4WOQA 4NX0A 1G6CA 5CGQA 1G4PA 5DXXA 4O1DA 3EXTA 3QC3A 1TJPA 2OZ0A 4JR5A 3WJYA 5LHFA 1FCUA 3MYOA 1GTEA 3QPYA 1SW0A 4ADSA 3N9SA 1DQXA 2WSYA 4AWSA 5K7JA 2V82A 4CCEA 1ZALA 4XWUA 4JEQA 2HS8A 2ZRWA 3LGEA 5FESA 3DGRA 1QOQA 4K8EA 1G7UA 5C6MA 4TO8A 3PSVA 4UFMA 4FX8A 3M5VA 4MZ8A 3HG2A 4LVAA 1LOLA 2GQAA 3W7DA 3UWZA 3VE9A 3GKFA 4IX0A 1KV5A 2BLEA 2E6FA 1B9BA 1ALDA 3PY2A 4RZ6A 4RZ5A 2VELA 3STEA 3L68A 4ZMGA 5BRBA 3KXQA 4UFIA 5H2ZA 1ICPA 3EXSA 1A5AA 1H7OA 4ZQCA 5D03A 1YTEA 3AO0A 3EX6A 4LW7A 4CCCA 5AFDA 3BLFA 3UNDA 3G8RA 3I7QA 5D30A 2ZFAA 3W2MA 4JGDA 1TPEA 4OGZA 3RNDA 1G4EA 4N6FA 3G1FA 1Z48A 3F03K 3V75A 2RDWA 4JTFA 3W74A 1PCWA 4ZL1A 3PB0A 1QPRA 3P61A 3PG8A 2Z2UA 3B04A 4DBDA 4M7SA 5MHBA 3ABRA 1W5MA 5FEXA 2A0NA 1QMLA 1T99A 1YDOA 2NWSA 2Q8ZA 3TJXA 2E77A 3F4NA 2V0TA 3NQ8A 4DO6A 3PB2A 3IIXA 3M43A 3DI0A 2AGKA 1LORA 4TMCA 1VHCA 3DU0A 2G95A 4UFHA 1LDCA 4LY8A 1YPFA 2X1RA 5G1TA 3S0CA 2J9ZA 5AN7A 3U8GA 3UY7A 2FPVA 3W1RA 4A22A 1FX6A 2ABBA 2X1UA 3BV4A 3GX9A 4MY9A 4EVZA 3IVUA 3GDTA 5TBOA 1K7FA 5D04C 5KINA 3C61A 2RFGA 1TMHA 3CWOX 4FX6M 4ONVA 3HBLA 4RX0A 3W1TA 1WBJA 2WSQA 3LCFA 4HPJA 2QJHA 1YDVA 2ZTJA 3W2UA 2BZNA 4XTIA 5DLCA 1VLWA 2QCEA 2E6YA 5FF2A 2QUTA 4LT9A 5AHFA 3L2IA 2VEPA 1D3GA 1P1XA 4PL2A 1TPDA 2HTMA 3C2VA 4O19A 1V7YA 3HQ1A 1ME8A 5H91A 3S6DA 2VFGA 5FEPA 2DZWA 2CWNA 5KZEA 4WJEA 3NXFA 4E38A 5CSRA 2NLIA 3G3DA 3GXNA 2CW6A 1OHLA 1WXJA 1JRBA 1ZENA 1I2PA 3OG3A 3EEGA 3NL6A 5L6UA 5ABTA 4HKPA 3LTPA 4PEKA 5G2IA 2FB3A 5F4XA 1F05A 3NQEA 4EWND 2DZSA 4PA8A 2YX0A 4TU1A 3W23A 1AW5A 3FYPA 3G1XA 3HGRA 5K9CA 4S2BA 3DHDA 1YADA 3I6RA 3S1WA 3MUXA 3R13A 3LTYA 4LVDA 3TAOA 1RQHA 2A6LA 3Q94A 1J2WA 3PG9A 4GFSA 1HUVA 4UR8A 5DCBA 2CLMA 3L5LA 4NNBA 3NZRA 3M41A 1O5XA 2NUWA 2XN2A 2O7SA 1GQNA 4LVFA 3I7SA 2I14A 4LV4A 2OMAA 4JTUA 1OX6A 3FJ6A 4BFAA 3W7GA 3LCIA 3IVTA 4NUWA 5DCEA 3DKJA 1OFPA 4ZQPA 3TC6A 2V9DA 3ZFHA 1GOXA 4QITA 3HPXA 1UUOA 1TPVA 4UNLA 4WD0A 1KTNA 4UTIA 3R89A 1PL9A 4FF7A 4MJMA 4IXHA 2XN1A 1EP1A 2GJLA 3MP3A 3EX1A 3N2MA 1W3TA 5FEZA 1R2TA 2A7RA 1SU5A 1LOSA 1Q6OA 1K8XA 3QSRA 2WPBA 4FIQA 1K8YA 1KLYA 4JICA 1NAL1 1J5TA 1OFEA 2PE4A 2G96A 4IJBA 2B4GA 1MZHA 5E0KA 4R7JA 3W7HA 2AQWA 4UR7A 1XM3A 5D05A 4IXXA 1IXPA 2P10A 1L6WA 4BI5A 5AYYA 2H3BA 3IGUA 5LNUA 1TPB1 3NPVA 4IUOA 4KKXA 3D0CA 3R8RA 3H54A 2VEIA 1SZEA 3QW3A 1YLVA 3M6YA 4X3ZA 3ZWSA 4RKAA 1TO3A 5CKSA 3G24A 4JN6A 1QO5A 3NYZA 3LHTA 3OBKA 4Z08A 2VFDA 3W84A 4BWLC 4NQ1A 3C3NA 1GG0A 3S9YA 2OX1A 3THQA 2AAMA 4AHPA 4JIQA 1CX9A 4UTTA 1JR1A 2C6QA 1TQJA 4XTDA 1RV8A 5HULA 1FWNA 1TV8A 1KTCA 1FWSA 4Y6GA 1KFJA 3C2OA 2DJXA 1LBMA 2JKAA 4UFJA 1PHWA 4I7VA 2GQ8A 5AB3A 1QDSA 3RK8A 3HIJA 3P82A 1QR7A 4POCA 1GG1A 4TX9A 3NOEA 3L21A 2ZTKA 3LHUA 2QCHA 3W7RA 2BTMA 2Y7GA 3W7QA 1Z44A 4K39A 4UCGA 3GKAA 1UCWA 1KBJA 5G4EA 5SWUA 2C14A 1R2RA 3P5YA 1PVNA 4JTSA 1VQTA 3SIZA 4PC8A 1I2NA 1FCQA 1VCGA 4NNAA 4K36A 1YTDA 2VFHA 3BLIA 3DFNA 1JJKA 4OV4A 3ATYA 1F73A 4MFDA 3QW4B 3QJAA 5EMUA 3EB2A 4UIOA 3W83A 3RLUA 5D32A 1VGAA 5D37A 1VR6A 1F2JA 3VCRA 2EPHA 2E6AA 1TSIA 4L4MA 4LNYA 4YMZA 4A2SA 2VFIA 1MEIA 4U28A 5AC7A 3O6DA 3G1YA 4YLWA 2ISVA 1FDZA 5TIMA 3M1ZA 3PULA 3BG9A 1N8FA 3M5ZA 4OU1A 2JGYA 3TJLA 1WBHA 2QCCA 1ZAJA 4M7TA 4FX7A 1W5QA 1QNVA 1VZWA 2A4AA 2GOUA 3FEMA 5E1QA 4P61A 2PC4A 3VI2A 4Y96A 1OFRA 1S5VA 4MKNA 2CU0A 1LRQA 3NQ7A 1D3HA 3EX3A 1NVMA 3I65A 1TQXA 5FF3A 5D02A 3H55A 4Q4KA 3BPWA 1HTIA 4LRTA 4AAJA 5E93A 1MEWA 5AYXA 1AK5A 2TSYA 3LXBA 3S1XA 1X1OA 2QKFA 4FO4A 4IWWA 3NQ6A 3T55A 1K7EA 3ZWTA 4C1KA 2IQTA 4A2RA 3RU6A 3GLCA 1QO2A 2V30A 4R53A 4RZ4A 4RXFA 2XFWA 1JULA 5I3HA 3MHUA 1JCJA 3IIVA 1Q6QA 1LTDA 1KFKA 1J4EA 2YFNA 1VLIA 1GVOA 2QCFA 4GUIA 1TPC1 1DBTA 4XBSA 1SSDA 3MP5A 3IEBA 1KA9F 4GUGA 3DXIA 3W1UA 4JTGA 1B4EA 1GEQA 4O16A 2V5LA 4X22A 1B57A 2H8XA 3TFXA 4CCDA 2DU2A 4O57A 3W7OA 4JX4A 2YCEA 3W73A 3W71A 5EY5A 2V2CA 3MP4A 4DEFA 1IIHA 2HSAA 1H7PA 3KFTA 2CLKA 4O12A 3NG3A 3TW7A 2DZVA 1KM0A 1TTJA 3LDVA 3PR2A 3BK0A 2NX1A 3FA5A 2YZRA 1UUMA 4L4LA 4BR1A 1H1YA 1QPQA 3MHFA 1O94A 4UFLA 1H60A 4MZ1A 5HWMA 4JX6A 4FB7A 4HSNA 2QJGA 3LHWA 1PIIA 4DO4A 4HT3A 2NX3A 3HMJG 4JXCA 4N9BA 3S1UA 2E09A 4LVGA 2YW4A 1X1ZA 4MOZA 1OG0A 4IMEA 5DY3A 3TDFA 1ZAHA 4K8HA 3DZ1A 3U6WA 5J5DA 2OJPA 2JGQA 1XBVA 2ISSA 2VEKA 5CPMA 1YXCA 3UPWA 2Y63A 5D33A 3IIZA 3S42A 4MPQA 2NXIA 1H7NA 4O53A 1KFBA 2FB2A 4O50A 3KRSA 3O1NA 2VENA 4O0ZA 4JTLA 3WFAA 2WSRA 3W2NA 3HGSA 1X6UA 3DFOA 3W1QA 4P2VA 5D2WA 1OYBA 3IVSA 4N9DA 3NL5A 1AL7A 3MI2A 1BTMA 1OYCA 2Z6IA 4UUIA 3W72A 4LVBA 1NF0A 3MMTA 3HJZA 4E2BA 1H63A 1ML1A 4UTWC 3PBUA 2DZXA 1SO4A 3LRLA 4UMAA 2YFOA 4RXGA 5F4SA 1R47A 1P4CA 2QUUA 4JTEA 3UQNA 3VFLA 1PS9A 4UC5A 5CPOA 5CSSA 2QDGA 3DFSA 4N6EA 3QF0A 4HHPA 3O05A 1DV7A 5KTLA 4QQ3A 4ML9A 1KM3A 3W07A 4E2DA 2WKJA 3NR0A 4IMCA 3W9ZA 3W7MA 3BO9A 3ATZA 1AL8A 3N73A 2FTPA 2Q3OA 3W1MA 3SZ8A 2YW3A 4O8RA 4B5NA 1OVDA 3KOFA 1G4SA 1QPOA 4GUJA 3EX2A 2DORA 2WNNA 4GXMA 1LYXA 3P74A 3W1XA 1PE1A 1A5SA 1R2SA 1YXYA 4UTLA 5K2ZA 3TXVA 1TTPA 2GJNA 5D2YA 4BI7A 1KM4A 3SFKA 1FWWA 3QMRA 4UTJA 2WQPA 1SO3A 3A23A 2Y7EA 3TV8A 1TCDA 3DI1A 2YR1A 3LERA 1ICQA 1OX4B 2F7FA 3BW3A 4WX2A 2GVGA 1VYSX 2E5DA 3P60A 3LCHA 1MO0A 3NQVA 3QMTA 5LGZA 1IIGA 4MIMA 4M6QA 4CQAA 1FUYA 2J24A 1UJPA 3Q58A 4KFOA 3PS7A 1W5PA 1ADOA 5DXYA 1E51A 1K02A 4IOTA 1KM1A 2P0OA 3TNOA 1WOBA 1SZFA 1JCYA 3ANYA 2Z0IA 5FEWA 2WJZA 1H61A 3SY5A 3FKKA 1GYLA 3MWAA 1LRTA 3W1AA 3SJ3A 3S5OA 5DELA 1A50A 2X1SA 3S8HA 3UZ5A 5EYWA 3LBCA 2NV1A 4YCPA 3I68A 1P0KA 4QISA 1KM5A 1XDMA 3E96A 2RDUA 3GAKA 1TV5A 2J88A 2C19A 2E1DA 2I9EA 3ABQA 4AHOA 5DN1A 5TQLA 4JTHA 2QCLA 1TIMA 2ZRYA 1WV2A 3A5VA 2ZCGA 3C2FA 1F6KA 3P62A 3T78A 1ZNNA 2Y85A 4ADUA 3OIXA 3WJZA 1H62A 4WUIA 1BKSA 4FNRA 4Z1BA 4NNCA 1O5KA 2NUYA 4O28A 3C56A 1W5NA 4X9SA 2VKZG 2ZZ5A 5G5IA 4NXSA 4M6PA 3GDRA 4M19A 4H6KA 1TV7A 3GDLA 3STGA 1IF2A 5EL1A 4H3DA 2DZPA 2VFFA 2OT1A 4FHAA 3WJXA 4O1CA 2HMCA 2B0MA 3G1SA 1BEUA 1JRCA 1KFLA 1VYPX 1B4KA 3G1HA 1W31A 2A21A 2QCDA 3W7KA 3SR7A 1HG3A 3KVLA 3TKFA 3LV6A 3P81A 4WZHA 4CQ8A 3A22A 1M7OA 1H7XA 4WXZA 2YPIA 1M6JA 3LX9A
chains in the Genus database with same CATH superfamily
2QAPA 1FWJC 3LNMA 3VK5A 3SN4A 4HNNA 4I3GA 4NJHA 2H6RA 1WDQA 1XSIA 3BMXA 2CLHA 5D2TA 4CNSA 4DF0A 1Q6DA 2JKEA 4YPJA 3A24A 5I24A 1UH2A 4EPDC 5ABHA 1JCMP 2I5GA 2IKGA 5DQPA 3QPZA 1V6TA 2Z1VA 1VKFA 3PBVA 3TOPA 3VX0A 1GVSA 3AALA 3CTLA 2E25A 3KRUA 2E1WA 1TWWA 4GCAA 2TAAA 2NX9A 3K8LA 4UTHA 3SJNA 1O68A 3KVKA 1H0IA 5DRIA 2BHZA 4H01A 1MFVA 3VM7A 1KWGA 3TU9A 3M4HA 3T07A 1A5UA 4HB7A 3KEHA 3FDKA 4H6EA 1Q6RA 4LB3A 1QRQA 2ZUTA 1KM6A 3CZ8A 4HK6A 1FXPA 2X16A 3M0IA 2FDMA 1RQBA 4IICA 2OCZA 1W9DM 2ZZ3A 4QJ1A 2EAWA 3GG0A 4XISA 1AH3A 2NVAA 1ZAIA 3WELA 2FPTA 1KBIA 1JYVA 3BW4A 1HP4A 2CKRA 4NAEA 5BNKA 3N12A 1KR0A 4YTQA 3DAQA 4XBKA 4NASA 1TTIA 4Y7EA 4QE4A 1EC9A 1F3WA 4HNTA 1SW7A 2B7QA 3LMYA 3OVQA 4DXVA 5GPRA 2VCBA 2PU1A 1J01A 3BAXA 4BWLA 4TUFA 1A5OC 3W2JA 2Y62A 1AH4A 3TR2A 3KCOA 2QJMA 2FVMA 1BHGA 1FP9A 3G2GA 5CPLA 4YHEA 5LYRA 1VYRA 2YXGA 4E2OA 3W2LA 3RR4A 1HKKA 3BOLA 1UC4A 1NFBA 1XD0A 2C1GA 5ENLA 2QDHA 4QLKA 4O0KA 3IIPA 2UY4A 4HA0A 2DZBA 3UFYA 4C7GA 3M47A 4YYFA 3WQ8A 2P8BA 2Y0FA 3CUXA 4DI9A 3DEQA 1T6MA 2YA0A 1CI1A 4Y9AA 1M68A 1XKJA 3CUFA 2XWDA 3I6EA 4R9OA 5AYBA 3CPRA 4JKLA 4BA0A 3OGVA 2J4GA 3MPGA 4O4VA 4PUNA 1XPGA 1J79A 4OECA 1OIMA 4Z1DA 2YXXA 1NH6A 3KW3A 2VT0A 1R7OA 4GIAA 3LB0A 3UNTA 2JBMA 2OQYA 4MHBA 1TRDA 4GIEA 1W5OA 4QSHA 3H8AA 4LBRA 2XSBA 2X1TA 1JL8A 4OQVA 3DDMA 2YCKX 2HPMA 3MW7A 3FIGA 1N7KA 3VMNA 2VZVA 3CC1A 1GVYA 3R5EA 3SY1A 1OX5A 4XQ6A 3UU0A 5C8BB 1KCZA 3FJLA 3W25A 3KZSA 2VOMA 1G67A 5EMYA 1HFBA 1TTQA 4IQEA 2FDSA 3G18A 3EGJA 2GUUA 4ALDA 4B91A 5DBTA 5HNTA 1RVGA 1S2WA 3IANA 1N82A 3VNJA 2CLPA 2CLOA 1H51A 1XDLA 1GK8A 4MAVA 4WF7A 1Y5XA 3CQHA 1TJRA 4IIEA 4JDBA 5HPCA 3GWQA 1EP3A 3FKRA 1QAPA 4PCPA 2XGIA 3B9AA 3GXPA 4CN4A 5K9XA 1MXGA 1OCBA 2P8CA 1NJJA 5IFPA 7CGTA 3GVQA 5CBBA 1G0CA 2PSNA 3A9IA 4O52A 2D69A 3HZ3A 4UTUA 2YCIX 3B8SA 4YNGA 2VJXA 3PC0A 2VGIA 1EX5A 1QU4A 4IL0A 1V0NA 4JY8A 1GKRA 4OOZA 1GONA 4FOJA 5FJPA 3CAWA 1H1ZA 1OK6A 1C9WA 3ES7A 1Q85A 1E70M 4KEZA 3WEZA 5HATA 1ZCCA 4OWGA 1P0EA 3G3MA 3VNDA 3C0LA 2Y7DA 2YL6A 2DJLA 4IPIA 3E0IA 2D3NA 5HNNA 1UWQA 4Z0SA 3ZOAA 2Z1KA 3O8AA 1TFVA 2XHYA 1OC5A 3MSGA 4UR9A 3ITGA 4AD4A 1WXYA 4XKYA 4QIUA 4CNUA 4M1RA 1ZFJA 2PBGA 1TREA 4XUGA 2V2DA 4NYUA 3H26A 3NGJA 4QCFA 2V3FA 1UR1A 4AYSA 3Q65A 2IXUA 1PO9A 1E4IA 3W26A 1X6LA 2A6NA 1YRRA 1JPIA 4AIOA 3WNNA 1GJUA 1NDYA 3GUGA 3LV5A 4DJEA 3MHGA 1P1MA 2DZTA 1PDYA 1BXBA 1C8QA 4JNMA 1TVPA 5C9RA 2A5HA 4C5YA 4WY0F 1DWGM 4EE9A 1EUNA 4HSOA 4QDMA 1FHUA 2A3BA 4OBTA 2QF8A 2WLZA 4XZMX 1E5NA 1HIZA 1GKQA 2BP1A 2P1FA 3B4UA 3LK6A 5IDIA 4DXXA 2V8ZA 1FVPA 4R27A 2CLFA 1HZYA 4UTWA 4H1ZA 4M29A 4D6IA 4LAZA 1JZ8A 1FH9A 4ZOAA 2BOGX 4AVFA 2ZIDA 1O5QA 3W7LA 3NEVA 2PZNA 4DYJA 5D2VA 4O0QA 2TMDA 4AXKA 2WMKA 2INZA 3WLOA 4YN5A 2C91A 1CGUA 1B3VA 1B0IA 1DXIA 1R5YA 2YDRA 1R38A 2ZX6A 3AHYA 1ADDA 4R7WA 1CBGA 3PANA 1XG4A 1MRAA 4GI8A 3WUFA 2ZZ6A 3LPPA 4DLFA 3UXAA 3AUOA 2EF9A 3UA3A 3NUKA 2VZOA 4PTNA 1HL9A 3GM8A 3WH9A 3W88A 1DWJM 1W1TA 2HEJA 3UBPC 3QSTA 2O0TA 1S5WA 3G1RA 4NAFB 1YMYA 3UZXA 4UQBA 5D09A 1E56A 3OHMB 3CHFA 1VFHA 3OODA 3MO4A 5CAKA 1SSGA 1D8CA 1NQ6A 1OSEA 4YXGA 4B5UA 1D8WA 4CNPA 1E4NA 1HW6A 3CV2A 4QLLA 2E0PA 4H4IA 1UKQA 3AYVA 1KD0A 2J8FA 3NQCA 4E8CA 3P8JA 2WM0A 3YPIA 1VBUA 5HXMA 3DH7A 3W2KA 5HQLA 3C2RA 1YEYA 1E73M 3AWOA 4D6DA 3I10A 3M0LA 4F0KA 3GXIA 4YU1A 3W7PA 3UESA 3WQDA 4LUJA 5EA9A 2D2HA 4BQ4A 4RV8A 3WLNA 1SZRA 4JFUA 1DXFA 3BZJA 2VMFA 2WHLA 2VEMA 2XJ7A 1GVFA 4MWAD 3DUGA 2CYGA 1GYMA 3UVIA 1XPYA 5CH9A 1NIUA 5EGRA 2R1NA 4O4WA 2OO0A 1D7FA 3HB9A 1E0VA 3VVGA 1TELA 5E6YA 4ZBCA 3AS3A 4Z1AA 1E1CB 5BXRA 3MO7A 3LXAA 4MY8A 5CG7A 3EDKA 1E6QM 4HN8A 5FJUA 1D3CA 5G4HC 1M5WA 2OEKA 3TNBA 3JS3A 3LNPA 3EPOA 5A8GA 1JFHA 3VIFA 4FOKA 5M17A 3VKJA 5F2GA 1JDEA 4GUFA 5HAOA 1FCBA 4LWWA 1TPUA 3AS2A 3NQDA 5E0CA 2ALDA 2KZHA 3TQKA 6TIMA 4WJXA 3EWUA 2PFHA 3VNKA 4FA3A 1XC6A 3G6MA 4NY2A 1EA9C 4CLMA 4AD1A 4LAKA 5A1AA 2A3HA 1XLJA 4C6LA 4CD6A 2QCDB 4H83A 3R1ZA 4PRTA 1FH8A 4GH3A 2J27A 3NAVA 2W6RA 3CYVA 4KCTA 4WEVX 3WIJA 1QVBA 4WQ6A 1UPPA 4GUHA 3F2BA 1J0JA 3LOTA 3QH2A 3AMKA 3HF3A 1GOMA 3OEXA 3B9OA 1LG1A 4LUYA 1UR0A 1EEXA 3GTIA 1E1EA 4ZOEA 3H53A 2ZVIA 4X2RA 2C15A 1UOZA 2V2HA 2ATSA 2FGBA 4ZENA 4DJFC 1ONEA 2HS6A 3OVGA 4GQQA 1V02E 1WX0A 3CGTA 4ZR8A 3D47A 2V5BA 2PWEA 3S6TA 1A53A 1GYNA 3GYEA 3T0AA 2RUSA 2XWEA 3SIMA 1H50A 2VX7A 3HG5A 2WOQA 1I2QA 3CL6A 6TAAA 1MQPA 1QBBA 4MZYA 4AIEA 3WG6A 1KO0A 4QG8A 4HN4A 4QM1A 3EWZA 3HG4A 1L6SA 3N15A 3CQKA 4HHMA 4AEFA 2Y6ZA 2BX7A 3WFZA 3AMDA 1YPIA 1FWTA 3Q4DA 3GIQA 2VDHA 3W82A 2F6UA 3MT1A 1YE6A 4GXWA 3M46A 1HL2A 4N02A 5CZ0A 3GVVA 3UPBA 3GHSA 3HMCA 5I3JA 3BAJA 3KOZA 4JIPA 4UTFA 4F4RA 3GG7A 5AC8A 4N4PA 3VA8A 5LNSA 3QYQA 1JCXA 4J27A 1RD6A 3O6AA 1IQ8A 2P88A 2X2GA 4BHYA 3SN0A 1I6NA 2OEJA 4B5TA 3EAUA 1QASA 4G1NA 2PODA 3TSBA 3RFAA 4JN7A 2DUXA 4DJDA 1KB3A 4HMEA 5E0FA 2QEZA 4U2YA 1W2VA 5I3IA 5JXQA 5K3VA 3TXZA 4TTGA 1XKYA 4N9EA 5IBXC 1P5BA 3U0HA 3LMZA 3W1LA 3W7JA 5HUPA 1U22A 3NSNA 3FEQA 4ROPA 1V3IA 1GOOA 5E6ZA 1PKMA 3ITLA 1ISVA 1DQUA 3W6MA 4DF1A 1PB0A 2Z1WA 1YPXA 4XG1A 1FDYA 1OCQA 4YHGA 2F61A 5HJXA 3ARZA 4AMAA 5ABGA 3A47A 2OYMA 3CUGA 5GJPA 1XV8A 4C60A 1A5LC 3N4FA 4LPCA 4UMBA 5DANA 2ISWA 3TN4A 1XW8A 5HWJA 4GG9A 4YTUA 4DX3A 4A8LA 1EGMA 1V6YA 4A8IA 4S3CA 5MF5A 4Q6JA 1JF5A 1RPXA 3LZ3A 1SR9A 2GZXA 4AIUA 3TMLA 1S1RA 2IPJA 3HA1A 5HQEA 1VCVA 3GD6A 3F1QA 3M7SA 4HA1A 5H6HA 4C7FA 5HUOA 2FZ8A 1LT7A 5I09A 1UROA 4L56A 2AKZA 1VJSA 1XHGA 4ZQNA 1EWDA 2ZX9A 2GSHA 3OP2A 4KESA 2VGFA 5A8QA 1BG4A 5BU6A 3IIOA 4O13A 3HG3A 1UQZA 1LCOA 1E72M 3U57A 3CIWA 1CTNA 3GY1A 1YE4A 5DMYA 2W91A 4A4AA 2VX5A 2V5DA 3T4CA 3ECQA 3PZVA 3BGGA 2OODA 3U9IA 4H9TA 1MSSA 1XUUA 5GNZA 3MMUA 2DP3A 1L6FA 3SRDA 3W6YA 1RSCA 2PC8A 3RMJA 3OZYA 2GLKA 4TMBA 4ADTA 3K30A 2RH9A 3SCNA 1V08A 3OHIA 3LEPA 1KRMA 4ATDA 2C0HA 1S5NA 3V5OA 1X1NA 2EPOA 4W9TA 1ZB5A 5K4XA 2OR2A 1ZHAA 3LQGA 3MYPA 1I1WA 1GVEA 5FI8A 3THUA 3UGVA 3TQ0A 5C7HA 4Y9OA 1YHTA 2Z2BA 1BF2A 2BY3A 1MYRA 2V3EA 4PMNA 2FH6A 3AJXA 4NKCA 2NV2A 5LGXA 1OFAA 2A7PA 1SFSA 1UD8A 1T96A 3ERPA 1A0CA 1EHNA 1A3HA 3FXGA 5C5YA 5CXPA 5B7YA 3D46A 2X09A 4DNHA 1SZGA 4IQLA 1E6RA 3VGHA 2YYTA 1WB0A 3SCQA 3LI1A 2WZIA 4WOQA 4NX0A 1B31A 1G4PA 3S2CA 3EXTA 1C7TA 2ANUA 4FAMA 3WJYA 5GJMA 2YLLA 3GU2A 2QVNA 3TW9A 1SW0A 4XK2A 5EFDA 4C6MA 5K7JA 2V82A 3WH6A 4JEQA 4M82A 3UCDA 2NSOA 2PDIA 4MM1A 3V36A 1B54A 1ZBKA 3PSVA 4UFMA 4FX8A 4JKKA 3M5VA 4MZ8A 2GQAA 1CXFA 4UBPC 3GRIA 2BLEA 2E6FA 3PY2A 5A6LA 1UIPA 1RH9A 4RZ5A 2VELA 4BKNA 4JFVA 1FA2A 3N04A 1ICPA 4ZQCA 4BZYA 5D03A 4LW7A 4HMNA 3WD0A 4CCCA 3SCRA 5IXEA 3VO0A 1CDGA 4FMVA 4DAIA 4HZ7A 3RNDA 1G5AA 1R7AA 2DDXA 2GJXA 4W85A 4JTFA 1QPRA 1UZ1A 2Z2UA 4UWMA 5I3DA 4Q6XA 3GTFA 4NILA 1P6WA 5FEXA 1QMLA 2NWSA 1V51A 1L6GA 2V0TA 3RX4A 3IIXA 1ISWA 3GR4A 5A2BA 2YBTA 1LORA 2YZ5A 3OB8A 3S0CA 5AN7A 1L8PA 3IUDA 3U8GA 1V6WA 2FPVA 4A22A 1M9HA 2ZUUA 2DSKA 1HVXA 4D6HA 3IVUA 4PMYA 2EG8A 1B3YA 5A69A 5KINA 3C61A 4GO9A 1TMHA 4GYKA 3HBLA 4RX0A 3W1TA 4FLOA 2D23A 1W6TA 1YDVA 1WP6A 3W2UA 4XTIA 2DT3A 4MWAB 2G3FA 4KETA 3L2IA 1P1XA 2HTMA 1LL6A 1V7YA 4LEFA 2VFGA 1V02A 5FEPA 3H2NA 5CSRA 3GE7A 4IMAA 3CHEA 3DN5A 2PTYA 3CIVA 1OHLA 1ZBCA 1JRBA 1ZENA 2EXOA 3EEGA 3NL6A 5ABTA 1RJPA 1F05A 3WUBA 3NQEA 5A94A 1LWIA 3VNZA 1VEPA 1EHAA 4QEHA 3QBUA 2O9PA 4ZFCA 3R13A 4LVDA 4F40A 1J2WA 3PG9A 4HMCA 4NNBA 3M41A 5LXEA 2WB5A 3BCFA 3M0HA 1XDJA 5G1MA 3NGFA 1MDRA 2XTKA 4TVDA 4LV4A 5A8MA 1BVNP 3HN3A 3LCIA 1TWDA 1Q6EA 1CXLA 3TC6A 2VR5A 2V9DA 2BVTA 5H8PA 3ALGA 2BB0A 2OSYA 1PL9A 1F4AA 4FF7A 2XN1A 1FWFC 4GQRA 1EP1A 2GGEA 1N8WA 4KCVA 3VNMA 1FWHC 3MKCA 3N2MA 2CCRA 4B2DA 5FEZA 2UWFA 4PUEA 1LOSA 1OCJA 3I6TA 1J5TA 1EKOA 1ZJHA 1MI3A 4R7JA 1UP0A 5D05A 4IXXA 1BD0A 1XGEA 2P10A 4P7RA 1L6WA 2I17A 3UR8A 1XIEA 4JHMA 1YKWA 4PRWA 5I77A 2F9RA 4BI5A 5AYYA 3P0WA 4INFA 2H3BA 4HZ8A 1TPB1 1GZ1A 1JPDX 4UQCA 3IJ8A 3WH8A 3H54A 1SZEA 4X3ZA 3ZWSA 1MNSA 1TO3A 2HDJA 2YKKA 3NYZA 4Z08A 2BG5A 1HKVA 4BWLC 3C8NA 3BCJA 2J62A 2OX1A 1REQA 3WNOA 4UTTA 4IQDA 3APTA 1TQJA 4MNMA 5GJNA 4ZO6A 4F66A 2XFYA 1KTCA 4L5ZA 2DH2A 1LBMA 2JKAA 4UFJA 4HCHA 5A8PA 1Q8AA 3T42A 2GQ8A 4AC1X 4KEVA 1JDDA 4UQAA 3N2BA 3NCOA 3LHUA 1IWBA 1KRBC 3F5JA 3WH7A 1F8MA 3GNXA 4JTAA 1ZJAA 1Q13A 1ODUA 2Y7GA 2MANA 2QPXA 1UCWA 2G8ZA 4L6OA 5AY7A 1X96A 5LXXA 1R2RA 4Z17A 2DSWA 5AVNA 1VQTA 3VCNA 3CQJA 4F2TA 3IJDA 3UZYA 5I78A 3LGDA 3QJAA 3EB2A 3WUEA 1EJ7L 1VGAA 1VR6A 4PMJA 3A12A 2EPHA 4AZGA 1JZ2A 3QXBA 1R8LA 3FSUA 3AIRA 3II1A 3GFXA 2PWFA 1MEIA 3U2ZA 3CHCA 4V1XA 2J8GA 3G1YA 2ISVA 1FDZA 4AISA 2WSKA 5TIMA 3AHZA 3LSCA 3M1ZA 1EJXC 4F48A 3IV8A 3M5ZA 2HVOA 3TJLA 1WBHA 1P48A 5JIPA 3SUTA 2BOFX 1VZWA 5C7VA 5HANA 3T0DA 1TMQA 3VI2A 4MKNA 2PDMA 2CU0A 4L4PA 1TZ7A 2ZXDA 5A6BA 3CV6A 3FX4A 3BPWA 4A3YA 4M24A 4I6KA 2XFFA 5AYXA 3GU9A 3POCA 1X1OA 1DJYA 2O4MA 1KBLA 3RR1A 4RE4A 2AOSA 4CU7A 4DUWA 4MB4A 3GLCA 4PUKA 3C0SA 2BNJA 4RZ4A 2CPUA 4H9MA 1LTDA 1QNOA 2YFNA 3IUIA 1VLIA 3BAWA 4GUIA 4NI8A 3EB4A 3RLGA 1TPC1 4PUWA 3WQ5A 2P53A 3WY1A 3IGHX 1W9VA 3WBYA 3AYTA 4R85A 4GH1A 4MB5A 3UERA 3L4YA 1O1HA 4RDVA 5IHSA 4HK7A 2H8XA 2GK1A 3E3HA 4MJ2A 4O57A 3SCOA 4IFKA 4EK7A 1XLLA 2QIIA 2XH2A 2JIEA 1CLVA 2V2CA 1W3HA 3TJ4A 5DT7A 1H7PA 2CLKA 3NIYA 4C6JA 2ZC8A 4C6FA 3ITXA 3FA5A 4M80A 4BR1A 3DBNA 2Q71A 4EAYA 3MTWA 1PYMA 2Z29A 1IYXA 1H60A 3RILA 1W9PA 4FB7A 3LHWA 3PTMA 3MKKA 4N9BA 2RJGA 4I5UA 1E6SM 4ES4A 4IHCA 1ISZA 1BPLB 2PGWA 3UCCA 4IF2A 3U6WA 5J5DA 3MDUA 3MCOA 2P0IA 4KRUA 4LF1A 2VVSA 5CPMA 4Q8OA 5BXTA 4AD5A 3S42A 3S4TA 1KFBA 1MW2A 2FB2A 3TONA 1JPKA 1XLIA 2WMJA 4B5XA 3PJUA 3KWXA 4JKMA 3WFAA 2D20A 2WSRA 3ITTA 3A6OA 5EFFA 3IARA 3DFOA 2RGMA 1HXJA 1GCYA 4XZWA 2BASA 1AL7A 3ITYA 4LVBA 4GISA 4UTWC 2NT0A 5FAJA 1VFOA 3N1AA 3LRLA 3BQ5A 5F4SA 1P4CA 4J2MA 4JTEA 4DWSD 2ZE0A 1PS9A 3BOXA 1BWVA 5CSSA 4N6EA 3GO2A 2P3EA 1FFRA 3O05A 3RIKA 3QN3A 3VIHA 3A9BA 3SURA 5BXPA 4E2DA 4IMCA 4E3VA 3W9ZA 1XIFA 1OZQA 2O92A 5T9CE 3ATZA 4V1YA 4ZSUA 1AL8A 1UUQA 4GBDA 4GXMA 1LYXA 3P74A 4HK5A 3W1XA 3KCLA 3S2NA 1XSJA 1JFXA 5K2ZA 1TTPA 1LQ2A 2W4XA 1KM4A 3H2EA 3O3RA 1Y5VA 1ECQA 4FF5A 4QP0A 2WHKA 3QGVA 2OGJA 2YR1A 3LERA 5LIYX 1ICQA 4WX2A 5E5CA 2WJEA 2OB3A 4DI8A 4W8AA 3LCHA 4WKHA 1MO0A 3NQVA 5LGZA 4MIMA 2AL2A 4LFYA 1ZQ5A 5ABFA 1HKWA 3AYRA 3PS7A 1A5KC 4EX4A 2W61A 1W5PA 3DG3A 3CUIA 2PB1A 5DXYA 1E51A 1K02A 1XYLA 2RJHA 1DJWA 2J8TA 3O0FA 2EPLX 1KM1A 2P0OA 1BXNA 3U2EA 5KEZA 2FKPA 2NW0A 3DYPA 2WJZA 1H61A 2JIWA 4I9TA 5B7ZA 1DTNA 1WXZA 5I2UA 3GW3A 1TJ0A 4W93A 1FWAC 3ARWA 2NV1A 3LBCA 3GAKA 3SRFA 2WJFA 1OGBA 2I9EA 2XVPA 1GUVA 3VTRA 2WMIB 4JTHA 4QG9A 2ZRYA 1R3YA 2DQWA 1A5MC 4DM2A 3A5VA 2DQXA 4DM1A 3MQTA 4UQEA 3C2FA 1XIBA 1F6KA 1Z32X 3T78A 1H62A 3PWGA 2J7BA 3AQUA 1XIIA 2CBVA 4XX6A 3MKVA 3WBAA 1O5KA 4E3TA 1W5NA 5A8NA 1I75A 3VOCA 1EZWA 2VKZG 2ZZ5A 3GHUA 4ZE5A 4H8NA 3QZAA 5PTDA 1TV7A 3GDLA 4S39A 4WKFA 4H3DA 2OT1A 2PA6A 2QMKA 1BEUA 1A0EA 1KFLA 2VR2A 3CHDA 1VBJA 1B4KA 3W7KA 4FLSA 4IFRA 3LV6A 4CQ8A 1YQ2A 3EDDA 3A22A 3AC0A 4PZVA 4WXZA 4QE1A 3SCSA 4FNQA 3SGUA 2UV8G 1SJDA 3L2LA 1RP8A 3CUZA 3FOKA 3B8DA 1A80A 3GNDA 1Y65A 3MUAA 3ABZA 4UTMA 4IFOA 4US5D 3WN6A 1LM1A 4JTIA 1T8QA 3LHVA 1FOBA 1FWCC 4Y90A 2CZEA 2F8QA 3NPUA 3RCYA 3RX2A 2JF7A 3E38A 2DIJA 4JQ2A 4I90A 4ORIA 5U7SA 3SGGA 1M7XA 4GZ7A 4FIRA 1ENUA 1VEMA 4WY0A 1UR2A 4JTCA 4OBSA 4RK8A 5DMNA 1C8VA 2YCJA 2XH7A 1BAGA 4WKAA 1M7PA 5C2GA 5HWNA 2ACRA 1VBHA 3LA4A 3STCA 3PSWA 1JDAA 4LNCA 1ITQA 1G01A 1IHIA 1TE1A 5BU9A 1H49A 4OFCA 4WHBA 1VPXA 5A3HA 4KMQA 4OOUA 3L4ZA 1D9EA 1B3OA 3PZTA 2V63A 3C6CA 3E5PA 3ZMRA 1LT8A 5KETA 2E40A 2CZDA 2Y2WA 1V0LA 2OWCA 2C13A 4FXRA 3CU2A 3PZNA 1TPFA 1YNQA 3U2OA 4MLJA 1PBGA 3TX9A 3MMDA 4UXDA 4DRSA 1EOMA 3WZ0E 4QJ4B 2PDUA 1G9HA 4TQTA 1IZKA 5CJNA 4FS9A 3L2MA 1ZCOA 1FQ0A 1W3JA 1UMYA 3LTSA 2CLLA 1THFD 3B06A 5EMLA 4N4QA 1ME9A 1ONXA 3DC0A 1KTBA 2DEPA 3NSXA 4E0CA 2HVNA 2HPIA 3NQMA 4DBSA 2ZRUA 1Z69A 3FJNA 1Y7VA 1Q66A 2B7NA 3WLRA 2VYOA 2VZSA 1M3UA 4QJ3B 4A21A 1VHNA 2ZX7A 5AOUA 4QE5A 4PFHA 5C2XA 5J04A 3WDRA 4B9ZA 4GJIA 2O4QA 2XIIA 2ZZ7A 3BL3A 2YDAA 3RYSA 4D72A 4B3LA 2F2KA 3N6HA 5BRQA 2DVUA 1RJQA 3HFYA 1A49A 4ACYA 4IMDA 4ORMA 2Y70A 1P7TA 2CLEA 4RUBA 2VNCA 4DJDC 1I0DA 3N29A 3SADA 5KZMA 1XLMA 1REQB 2B7OA 3ANUA 3QZEA 5JIWA 1KW1A 3VKDA 4BQ3A 1HT6A 2BSLA 2RKXA 3IJ6A 1U1JA 1R86A 7XIMA 1S38A 3A4XA 3S5NA 2VDGA 2PGFA 1HL8A 3HPZA 2VEGA 3WLJA 3NQAA 1AMKA 2DFAA 4IISA 3O16A 4K2SA 2G37A 4LS1A 1K7XA 4GYPA 1T0OA 1J8VA 3NDOA 3H7UA 1J0ZA 5F1UA 1WKDA 3AXMA 2VP8A 1NF7A 4AF0A 3AYSA 3R10A 3ZLFA 1BGAA 3SSJA 4LX4A 2Q3RA 4ZVJA 3ZSSA 2OYLA 4S1FA 1AZ2A 4WXYA 1Q3NA 5BWAA 4EXQA 4GRSA 4HP5A 1CGYA 2XVNA 3N6JA 6CGTA 1PZ2A 1XBZA 4GLEA 1L2QA 2WMFA 3O07A 3R0UA 1EEPA 1DYSA 2HV5A 2NQJA 4A6GA 1OCNA 2FYMA 3QKEA 3K5XA 5LSMA 4OUEA 1ITCA 2EKCA 1HP5A 1G94A 4D6CA 1J6PA 4C1NB 4Z2GA 1PZ3A 1ZUAX 5G4WA 3R12A 3MB9A 1US0A 1KGWA 4KT2A 3QOKA 4GHRA 2VD8A 4DY1A 1P0BA 3QMSA 3GIYA 4WDXA 3V35A 4PUMA 3DFPA 1WOAA 3N6QA 3TZNA 1VEOA 3GR7A 3WK2A 3CL7A 4NIRA 1POJA 5XINA 2YOCA 5A2CA 4GIRA 3A3WA 3O63A 4D1JA 2XGZA 4AB4A 3UY8A 1ZBVA 4GOAA 5CG0A 3B05A 1BLIA 1EGVA 3TQVA 3S9IA 1VFUA 5AHEA 3WDPP 1B5TA 2X41A 4Z2HA 1J10A 4GXPA 1S2CA 1TZ9A 4JOMA 3L66A 2J78A 2WKLA 4AZBA 3APGA 4D6FA 2VD9A 3N3MA 4ZB5A 3F5KA 1PIGA 3UW6A 4JIEA 3G77A 4Q7NA 1US3A 3C4UA 2ZDRA 3MVIA 4EAMA 1E0UA 3TK7A 3E9AA 3E2RA 5I3KA 4GJJA 2GK1B 5CCZA 4W87A 5CPNA 1I2RA 1W1IE 4LH8A 4K7VA 2YDQA 4IFKB 3QHMA 5D9PA 4IIHA 5F1VA 4F0HA 4RNFA 1TWSA 3ABOA 4HZMA 3W1NA 1VIWA 4MKSA 2PPGA 4ZCWA 1DJNA 3KRZA 4CQBA 4C6OA 2IQDA 3GDBA 1NY1A 3LLFA 1E4LA 4S3BA 3NURA 3NJ3A 2YBVA 1XLDA 1MEHA 4ZODA 1Q63A 3IK2A 3OU8A 4M5PA 2V68A 1NDVA 2VC5A 1X8CA 5I02A 3UD6A 2DGAA 3DFQA 2VUYA 2Y88A 4UFKA 3MC5A 4ZB0A 3A64A 4IMGA 5KITA 5AYZA 2V81A 3SRHA 3WEMA 3LBMA 4QQUA 2PLJA 2VQUA 2D2GA 1NP2A 3FA3A 1TA3B 3L5AA 1LLZA 5FL1A 1QOPA 2BHUA 2DW7A 4B15A 2EPMX 3P5ZA 3H24A 2FTWA 2YSWA 5HBFA 4J3XA 2NZLA 5E70A 4US6A 4S2CA 5I23A 4W88A 5DF0A 3P84A 1EO7A 2EO7A 1H5VA 1UD6A 4OUIA 4BS0A 4CEXC 1R3WA 1VF8A 1LJYA 2WNQA 4S3FA 2WYSA 3VU2A 1E1FA 4HTYA 2GQ9A 2DPEA 3BVJA 1OFQA 1GVRA 1SZNA 1WDWA 4ERAA 3TIMA 3M16A 3FHQA 3PPGA 2Z6JA 2P5NA 4W5ZA 2HRWA 3CAVA 4MFEA 4CNNA 4XB3A 1DJQA 1MXSA 3MUY1 4LB4A 1AJ2A 1X6NA 2W62A 1ZTVA 1K4GA 2EG6A 1HO1A 1J0HA 3AIUA 5G1YA 1F76A 1EWEA 4FXSA 2ZQ0A 3ZYZA 3FVDA 4WJ8A 3UXDA 1XGDA 1IT7A 2NUXA 5DRCA 3VOIA 5REQA 1E43A 3Q37A 2E5CA 4W4QA 2PTXA 2JE8A 1HO4A 4MSSA 3DYOA 1BXCA 1WAUA 1M01A 4PBEA 1K8ZA 1GPWA 3TWBA 4U33A 3UPMA 1F74A 3BMVA 5I3FA 3IRDA 3L0NA 1CLKA 3WK3A 4GVHA 3PUGA 3QQ1A 1GZGA 3SO7A 4W8BA 4G5DA 3OVRA 3WNLA 2DVTA 4ILSA 3W1PA 4LXFA 3BV7A 2O7QA 4BI6A 1XXXA 4XZ9A 1I4NA 2Z00A 5LIUX 1DWFM 5L9FA 2WWDA 1K6AA 5FJJA 4EPBC 3AMLA 4QFUA 3B0UX 4HA4A 1U2YA 5FJOA 3P6LA 3PZQA 1NOUA 3M44A 3LM7A 3VIOA 3GIPA 4IUGA 3I3DA 2WVTA 2DH3A 1CXKA 1T40A 3COTA 3FLUA 1A4MA 5AHIA 1XRTA 4CCZA 3GB6A 1SQ7A 1B3XA 2CBIA 3GC4A 4DBEA 3ARUA 2YLAA 3EKZA 4DYKA 3WX7A 3KDOA 1TWZA 1KRAC 1BFNA 3TCEA 3H7RA 4B16A 1W9UA 4QDPA 1OG6A 4FLRA 3WLTA 2QPUA 3NSMA 2I16A 1TMLA 1V5XA 5DFAA 1GTHA 1JUEA 2I5IA 3REQA 3VD7A 5LIWX 1VH7A 4GNKB 1MNZA 3CZKA 1K8CA 4LAUA 1OEPA 4F2UA 1UYQA 4RE3A 3P80A 1S1PA 3RCMA 3KE0A 3B03A 2QJNA 1V4YA 3FAXA 1IXOA 5EB8A 2BOEX 3NA8A 3NNTA 1RLCL 1FXQA 2VWTA 3ELFA 1OC7A 2V3GA 3W75A 5AHNA 4GMEA 4LUSB 3MSRA 1U30A 3KL0A 3TE9A 3TSDA 2OX4A 2NQZA 4U3CA 3R2GA 1MUMA 4LS0A 4E4UA 4N2YA 2JK2A 3WMCA 2G97A 3G22A 3KBNA 3SI9A 4MJ4A 3LUTA 4RE2A 2Q8XA 4V28A 4LC6A 1MW3A 2P50A 3N2CA 3N9KA 4GINA 4LAOA 3IJ9A 3GNNA 4IP4A 3VKAA 2OYKA 4O18A 3E5BA 5D2XA 3T44A 3JVAA 5FIPA 3KLLA 3QLDA 3L9CA 3PTDA 4UTTC 1IZJA 4DWDA 4PB3A 3TYZA 3TVAA 4JQ1A 2DZAA 3QV8A 3G1VA 1Y5WA 1XCFA 1EPXA 1DJGA 4GY0A 2FPYA 2FHFA 3VGDA 3G0UA 3ORWA 2D3LA 3P2VA 4KGLA 1BF6A 3NL2A 4I9JA 2ABAA 2E67A 1SFTA 2KX9A 1V8EA 3S46A 2GJRA 4CD4A 3P14A 4Z1CA 3BH4A 3NZ1A 3SUUA 1KWKA 2VR4A 1XLKA 3WYZA 1E0XA 3E2SA 4C6IA 4UB9A 3RM9A 5LKYA 3U7BA 1VS1A 3H2MA 4L61A 3LXCA 4JYFA 2C0AA 3B8WA 2X0YA 1JD7A 4HHHA 3VNIA 1Q6LA 1H3GA 4LEQA 2QZRA 4N9CA 4ZQRA 1E4MM 4J5NA 1JEZA 2V5CA 1VP5A 3EA3A 1MWOA 3R58A 4MNKA 3K4WA 1R9YA 1FKWA 1XIDA 4FNPA 3THAA 4LBUA 2J13A 4K6AA 4D1IA 1CGTA 1F7BA 3J7HA 3RF9A 3TFCA 3UCQA 3TTQA 3TYDA 3AFBA 4YVPA 4S38A 1OFOA 4PE8A 4O14A 5HNRA 1UWRA 4Q4RA 3VD5A 1C3FA 4Y9PA 1C93A 1POKA 5DBUA 3RPMA 3OTRA 2ESCA 4DZAA 7ENLA 1HJSA 3LHYA 3FNDA 4HQVA 4D9PA 4JCLA 3HM7A 3BAKA 2QUNA 4OBRA 1XISA 3W7CA 4J35A 3CEUA 2XINA 1MW0A 9XIAA 1JIBA 1K70A 4DAFA 3KLKA 3BJSA 3ZT7A 2BY1A 1OYAA 1DIKA 2VUNA 3THCA 1ZLPA 2DZUA 3WLLA 1FWBC 4AWUA 3B8VA 1AW1A 4GI6A 4AWTA 4AIBA 2PRLA 1MQQA 4O17A 3T9PA 1UP2A 3ES8A 1ONWA 2PDXA 1UB3A 1NSJA 1AMYA 2V38A 1VPYA 4ZO7A 3ZXWA 3ZT6A 4GGBA 7REQB 4KWSA 2A85A 1PEZA 2ZOXA 3V0SA 5BMXA 3IWPA 2EGZA 1VFSA 1W2PA 2HBVA 4NI3A 3BLEA 1WKYA 3T1GA 3B0XA 1EJSC 2CFFA 2VRKA 1FWIC 4W7UA 3UA4A 4AF0B 1R3VA 3PJXA 1UD3A 4LF2A 3QGAC 1ADSA 2C1IA 3DOPA 3ZJ8A 5CBJA 3T2OA 5AZ1A 4HNUA 5AC5A 1M65A 1KQYA 1OGGA 1GJPA 2G3MA 4MVAA 3L12A 2WVVB 1EGZA 1JI2A 4J3TA 3CO4A 2YBUA 3FFSA 3N4EA 2Q09A 4NZ4A 2REQA 1EC7A 3VGBA 1KBKA 2F84A 1FDJA 1XYAA 3KVJA 2ZA2A 2ZA3A 3OOQA 2ZBTA 2QVHA 2VXNA 2ATMA 3KX6A 3UF9A 3VOGA 3W86A 5D8WA 4P7LA 1UBSA 4Z0JA 3UZJA 2OU4A 3LRKA 2POZA 3S83A 4PYSA 1WA3A 3RPDA 3UG5A 4E4PA 3SFWA 3FHAA 5E9XA 1YX1A 1V3KA 2E28A 3URAA 3OVPA 2O56A 2C18A 2BVDA 4WSKA 1JUBA 1U83A 5I0DA 3ARYA 1QFEA 4ICCX 1OZMA 4G7EA 5ECUA 4H7VA 4AZHA 3POHA 1XLBA 1UASA 1OX4A 1L2UA 4IG2B 3MI3A 4GQBA 3AROA 3EWDA 5DXXA 3L4VA 2PUZA 5TD4A 4J3UA 3VPLA 1BYAA 4JR5A 2OZ0A 1FCUA 5FKYA 1GTEA 3FXYA 2ZUWA 1DQXA 4NSBA 3P0XA 2HS8A 4AW7A 1RBLA 5FESA 1QOQA 5CBIA 1QATA 5C6MA 4TO8A 3UJ2A 4LVAA 1LOLA 4P8WA 2Q02A 2BS9A 2O9RA 1W9BM 4IX0A 1PWLA 1ALDA 4F0RA 1P0DA 2IXVA 2HK1A 3WLHA 4PTVA 1PZ0A 1X98A 3L68A 5H2ZA 3HPAA 3AZTA 4UFIA 1HJXA 1A5AA 1H7OA 3IJIA 2EBNA 4DBWA 2Z28A 2E7FA 4GQGA 4OGZA 5BXSA 4Q4SA 3F4CA 1Z48A 3G1FA 3L4XA 3DESA 3V75A 2J7FA 3GUWA 1WPCA 3UG8A 3P61A 3PG8A 1AODA 3B04A 4DBDA 4M7SA 4XD4A 3CS2A 3BSGA 4W89A 3A13A 1T99A 2Q8ZA 3VIKA 2Z27A 3MU7A 3M43A 3HURA 2DSUA 4ZOBA 2Y24A 4C91A 4BF7A 3VOHA 2R1LA 1VHCA 3NQBA 1MZRA 4RNHA 1LDCA 4LY8A 3OBEA 5G1TA 5HMDA 1YDYA 2KAUC 2W92A 1XINA 3W1RA 1FWEC 3GX9A 3OLGA 3VILA 1UD4A 1TWIA 3FSTA 3GDTA 5TBOA 2WZEA 1B3WA 3GHRA 2RFGA 4CGTA 4X0NA 3CWOX 4ONVA 4ENLA 3UEQA 1WBJA 3LCFA 2PDCA 2E6YA 5FF2A 2QUTA 4LT9A 2BBFA 4HPHA 3ZIZA 4QTGA 3N2TA 4ATWA 1ME8A 5H91A 4LQ1A 1EDTA 2CWNA 5KZEA 4HOZA 1EJWC 1JZ4A 4LY4A 1DHKA 1Q2SA 3GXNA 4E8GA 4H9ZA 1WXJA 4WVXA 1I60A 1I2PA 3FK4A 3OG3A 1PJ9A 3LTPA 5REQB 3B97A 3ANVA 2GGJA 4EWND 1E5JA 2DZSA 3FDGA 4TU1A 2D2JA 3LGGA 3LPGA 1UP3A 1O6IA 5K9CA 2HZGA 3HQNA 1BVZA 2GDVA 3DHDA 3I6RA 2ZWZA 3TAOA 3LTYA 4NZCA 4IQJA 2E4TA 1HUVA 2POTA 4F79A 2CLMA 2VM8A 3VXGA 1V0MA 3WDHA 2WMGA 1O5XA 4DN1A 6REQA 2XN2A 3U7VA 1GQNA 4LVFA 5D4YA 4JTUA 3NDYA 4RW5A 1AFSA 5A8OA 4KQNA 4NUWA 3IJLA 3TN5A 2IKJA 3M07A 1XLAA 3ZFHA 4QITA 3HPXA 2CITA 4MB3A 5CLTA 2OG9A 4UNLA 4P8UA 1KTNA 4UTIA 3SQLA 3R89A 1YNYA 3EA1A 2Z2AA 2J7CA 1TG7A 3RO6A 3RM4A 5M03A 2QT3A 5CC7A 1PPIA 3CH0A 5EMKA 1R2TA 4Q8TA 1SU5A 1Q6OA 1PDZA 1K8XA 3QSRA 2IW0A 2WPBA 4JICA 1E55A 1BKHA 1OFEA 4IJBA 2B4GA 5E0KA 2AQWA 3VIIA 4LCQA 2VGBA 2OQHA 2QDEA 1X38A 3VOJA 3NPVA 3R8RA 3MSDA 3M6YA 1S5MA 3V5CA 1JI1A 1ODZA 2BY2A 5CKSA 3G24A 2DT1A 4JN6A 3VC5A 2VFDA 3D5HA 3REQB 3W84A 3HPFA 1KCKA 4NQ1A 1QHOA 3C3NA 3EMZA 2VEFA 4AHPA 3K8MA 1JR1A 3SUWA 2C6QA 4XTDA 5HULA 1IEVA 1E6XM 1SJCA 2DJXA 4Q7IA 1PHWA 4I7VA 4DLMA 4PSRA 3E1F1 4QR6A 1Q4WA 3T81A 1GG1A 8A3HA 4AX6A 2J7HA 3AXKA 4HJWA 2QCHA 1XLHA 3W7RA 1F4HA 2BTMA 4Q4PA 3UJFA 4AUBA 1FHVA 3TTOA 3P5YA 3VGEA 1Y8BA 2GDUA 3VMOA 4PC8A 1DP0A 2CHOA 5BRPA 2VFHA 3CZEA 3BLIA 2YL5A 3ATYA 3QW4B 4TOQA 1BRLA 4TX6A 3W83A 3RLUA 1F2JA 3R4IA 3VCRA 2OVLA 3EOUA 2G3NA 4WDTA 1TSIA 4LAMA 2IS7A 4XKMA 5JQ9A 3GTXA 7TAAA 4PR4A 4J4KA 2YCLA 1WO2A 4GYPC 1N8FA 4U2ZA 4XZLX 2QCCA 1W1VA 1KXTA 4M7TA 1UBPC 4QJ5B 3KOWA 4FX7A 4ML4A 2PC4A 2WHMA 1TE6A 2VX4A 4H9UA 1OFRA 1LRQA 1RHCA 3PP7A 1Q5MA 3VUPA 1QWKA 4C90A 1NVMA 1WE5A 3I65A 3VABA 4JNYA 4KGJA 4JTDA 3H55A 4Q4KA 1HJQA 2PZ0A 3MWCA 3FY1A 1MEWA 2PBOA 2QKFA 2ZVRA 3A3XA 8RUCA 3T55A 2R9RA 4C1KA 2IQTA 2W67A 4A2RA 1QK0A 2V30A 3GYCA 4R53A 1XQKA 4A8NA 2DSVA 4AZ7A 2XFWA 4H2CA 3E0LA 7ODCA 4PTMA 3KHDA 2QCFA 3RXZA 2RDXA 1CGWA 3MP5A 4PMZA 3UGRA 3IEBA 3EWCA 4I6VA 1AD4A 3NFUA 4GUGA 1CENA 1XH2A 4JTGA 5FSEC 1GEQA 1VD6A 5CPTA 3WF4A 1DJHA 3TFXA 1QHPA 2EG7A 2IPGA 5MKGA 2YCEA 5IFTA 3FA4A 3WMLA 1GQKA 3M0MA 5EY5A 2YL8A 1EFZA 3IJQA 1QNPA 5ABEA 3CZLA 3BOFA 4O12A 3TA9A 3NG3A 4F9DA 2DZVA 1KM0A 6PTDA 2EKGA 3S1GA 2GFTA 4AD0A 1FHLA 2SFPA 2PTDA 1H1NA 3MHFA 3PZIA 3HTWA 3VDCA 4DO4A 2PDFA 3BSHA 1DJXA 3F5LA 2E09A 4LVGA 3AIVA 4MOZA 1J6OA 4E4FA 4M0XA 1DTUA 4IMEA 5DY3A 4DUOA 1PIFA 4K8HA 3DZ1A 3WNMA 1XLFA 2JGQA 4V2XA 3VX1A 1PAMA 2JEPA 3N4AA 1YXCA 5LIXX 3WLKX 4TXEA 2ON3A 3CMFA 2VZTA 5D33A 3IIZA 2NXIA 4S3AA 4AU0A 4O50A 1EQPA 1KBBA 2VENA 3WQWA 4JTLA 3W2NA 1X6UA 3N11A 3IVSA 4N9DA 3TYEA 3NL5A 1BSIA 4PB5A 1OYCA 1RBAA 4UUIA 3WF0A 3W72A 3HJZA 3ONCA 4E2BA 1OB0A 2YFOA 4RXGA 1R47A 1XS2A 2VURA 3H2OA 2QUUA 3TYAA 2REQB 5BZAA 4UC5A 5LIKX 5CPOA 1EX1A 2PDLA 3K1GA 4QEEA 1KM3A 4PMXA 5JBEA 2ZUMA 2W27A 5E09A 1EDGA 1GW1A 1W3KA 3LU2A 3L4WA 3BO9A 4DUXA 1XLGA 3W1MA 1XRSA 4P8XA 4O8RA 3KOFA 4UOZA 2TODA 4W5UA 4CVUA 1G4SA 1QPOA 1PE1A 1TVLA 5DMMA 2HVMA 2XPKA 2GJNA 3CPUA 4BI7A 3SFKA 2RGLA 4G7EB 3A23A 2Y7EA 1TCDA 1EBHA 1W8GA 2ZXBA 1OX4B 4IJCA 3QMTA 4QAWA 3OZOA 1J5SA 4M6QA 2J24A 3Q58A 4PBFA 1SMAA 2WCAA 3R79A 1CXHA 4IGSA 1UIOA 2G4JA 2D1ZA 1SZFA 2X8RA 3ANYA 4F0SA 2Z0IA 2OFJA 3ARTA 3S3GA 3MWAA 3SJ3A 5IHRA 1MUCA 3DGBA 3GBDA 3UZ5A 4YCPA 4DJED 4L1WA 3E96A 4MADA 4Q8NA 4CD8A 2R1PA 2J88A 1FH7A 2E1DA 1GEHA 2CC0A 4AHOA 3SAZA 1E9YB 1TJ1A 1JZ5A 3B40A 3D3FA 1EXBA 1H09A 3TOYA 5JBDA 3VNYA 2VO5A 3R25A 5GNXA 3P62A 2Y85A 1JDFA 3OIXA 1GOQA 3VYLA 4G8TA 2J7EA 1BKSA 1W1PA 4CEUC 1J96A 3W6LA 3BLDA 4NXSA 4A35A 3PN8A 4M19A 4C5ZA 4H6KA 1IF2A 5EL1A 2VFFA 4FHAA 4O1CA 2HMCA 4MMWA 3G1SA 4IT1A 2OO6A 1FWDC 4IM4A 1W31A 3M6DA 3AIQA 2VRQA 3TKFA 2XH0A 3P81A 2HROA 3VDHA 5C2CA 4HZ6A 3LX9A 4E2VA 1Z89A 3H12A 3SCWA 1JQXA 2WCSA 4GX8A 1CZ1A 3UVAA 1XYBA 2A1YA 2INEA 1DWIM 2PWHA 1Q7MA 5T26A 4A05A 4FLQA 3SB0A 1R30A 3CASA 1KLZA 1XLEA 4HPNA 4U10A 2XIMA 4LC8A 3MJMA 1J0KA 4HOWA 3W7IA 5LHEA 2QAFA 3PBWA 1CWYA 2IMRA 4IPPA 3B3DA 3NM1A 1RR2A 4JIRA 1PYFA 2C3ZA 5FD0A 2TRSA 3NWRA 1TKKA 4AEEA 3SM0A 2OELA 3H4XA 1U5HA 3ARRA 3B8IA 1QJWA 2XGBA 3RRXA 4WDWA 2ISDA 2QCNA 3FGCB 1RPKA 5KMYA 1JCTA 1C29A 4G9PA 1RUSA 4W7VA 4ZZ9A 1DL3A 3Q2DA 5CZTA 4NVTA 2YIHA 2PEVA 3KUMA 3I3EA 4NZFA 5LA2A 1ZY9A 3G0SA 5F2LA 1TYGA 3QR1A 1IXNA 3IUHA 1V3LA 4PTDA 1KFWA 9RUBA 1Z7AA 3N34A 1UW9A 3CIXA 3GR8A 5CJMA 4K3ZA 2QJJA 2L5HA 2GGHA 4DJFA 4X61A 1G69A 3PPCA 3B9NA 4JDYA 1NFGA 4NJIA 3E0FA 3RM8A 1V3JA 2NXGA 1B90A 3WQ4A 4O54A 2QV5A 3W28A 4AYGA 4LV9A 1QI2A 3WF2A 4M6UA 4MYAA 3UWUA 1P43A 5HOSA 3LCLA 1JXKA 3TH6A 3O06A 3UWEA 3N25A 4XAYA 4F8XA 2VHLA 4LTSA 1KXVA 3O0KA 1JYWA 3EMCA 3UZZA 1X7FA 2PD5A 3DHFA 1GOWA 4IGMA 4QS6A 5DY2A 3WD2A 4IGHA 3E02A 4CU6A 4IP7A 1DEDA 3LLDA 2Z7GA 1NEYA 4HNOA 4NAEB 2PAJA 1HQTA 1ISXA 1IEWA 1YDNA 3HOJA 1GVQA 4GQ0A 4Y9MA 2FGZA 3R7MA 3WJSA 1EIBA 3BG3A 4DO5A 1FFQA 2OXNA 3HPSA 1UWSA 4U4MA 3LCGA 2FFIA 1S3HA 1Z42A 5FA5A 4P7NA 4QDWA 1Y0EA 5FF0A 2B7PA 4GK8A 1IGSA 2BXVA 1JG9A 4QX4A 3NXLA 4CKQA 2BVYA 1H7RA 3UZWA 5IBXA 3OZPA 4L64A 2FVLA 3UYIA 4HJFA 3E2VA 2QS8A 1H5YA 3CV7A 3W76A 1FTXA 5I07A 1T5AA 4D8AA 3S1VA 3MBFA 1LQ0A 3NO5A 3HGJA 4KRTA 3HU7A 4B3KA 1MQRA 1AVAA 4AQLA 3CO8A 2C7FA 4TR9A 1ECEA 1YTKA 2HNHA 2FGLA 4PEEA 2X0HA 5XIAA 1V79A 2V5KA 3EWWA 3ITOA 4F9JA 3PBMA 1NWTA 3MUZ1 3RG6A 2GVJA 2F38A 3O6CA 2GYIA 1ICSA 1KFEA 5AHMA 4EACA 1CLXA 3LCXA 3R0KA 1O1ZA 5FACA 4KF1A 3GVRA 2YCLB 4MYXA 1QWGA 1W3NA 4HBKA 4IPNB 4R34A 3NPXA 1IZCA 4A3UA 2OQLA 4XIMA 3WDIA 4GKLA 4PMDA 2QR6A 4H6QA 3FV9A 1K9DA 1U5JA 3QOMA 4QS5A 3ZR4A 2FZBA 1M53A 3RITA 4O8AA 5BOOA 3OLDA 3G1DA 1VRXA 5AZ0A 1IR1A 1JXJA 1EF2A 4O15A 3WQ6A 4HIBA 1DIOA 2BDQA 4PCTA 1SO6A 4LBSA 3OZMA 4DJDD 2ZRXA 5EBAA 4Y8FA 3NZGA 2EJ1A 4LRSA 2GVEA 3LHZA 5DO8A 3M7WA 2Y1HA 1PX4A 1ZJIA 3UWVA 4GGHA 2ZUSA 4NU7A 3WQOA 2AAAA 2QV4A 4MLRA 3CEPA 1BWLA 4GBUA 1YNPA 1HN1A 3WNPA 3QY6A 2C1HA 3QHOA 2I56A 2UY5A 3FCPA 1EQCA 4L6DA 2HWGA 1C90A 3DENA 3W7NA 2CNCA 5I3GA 3VGGA 2XFRA 4P5UA 4J28A 4D6JA 4DHGA 4V27A 4ICNA 3TN6A 4F2BA 1OGSA 1M7JA 3H23A 1L0PA 1LZOA 4U5IA 4ATLA 4E5TA 3C5QA 2LLEA 3BARA 1RZMA 1F3TA 6XIAA 3DHUA 1EB3A 3W4RA 4YTTA 1OT2A 4PBGA 4ACZA 4CD7A 5LNRA 2QMJA 1V6VA 1JNDA 3T09A 1ZBWA 3VDGA 3CM4A 2Y89A 1VENA 3PAJA 1LBFA 3WF3A 3C2EA 3O15A 4ZO8A 3TTSA 5BCAA 4C65A 3U4AA 1Q7QA 3WQGA 3F2DA 4NAFA 1UA3A 4RNIA 2QF7A 2R6OA 3QFEA 1FKXA 3KBSA 1QTWA 4XKYB 4JD4A 4FEZA 4HPGA 1LL4A 4PB4A 3DIPA 2WANA 3PWIA 4L7ZA 2D2OA 3NTYA 3GG1A 3ZSTA 2NSXA 1K03A 1R46A 4HGXA 5KZDA 3T7VA 4X0VA 5D9OA 3WF1A 4FSAA 2XM1A 1TX0A 1UA7A 5HJLA 3TLLA 2NWRA 3LCWA 4QHRA 3P7YA 3EWYA 1NOFA 3WBWA 3GAYA 3EZ4A 4AEOA 4C1LA 1Z41A 2WZTA 4GVGA 4KPLA 4PFMA 1ZGDA 3CTTA 1I45A 2ZRVA 4GWEA 2XSXA 1TPWA 1XI3A 3BSMA 2WNZA 3WL0A 1C7SA 1H4PA 2QGHA 3A21A 3VZXA 1EPVA 1XYCA 3WO8A 5CEWA 2OLAA 3QV9A 1E1CA 2A2IA 4S3DA 5C55A 3LENA 3C8FA 3VIGA 1RAKA 3P3BA 4I7WA 4XIAA 5G2HA 3LI0A 1HJVA 4H6RA 3GU1A 3L0GA 3GS6A 3CB8A 1J12A 3AIEA 3OW1A 3XIMA 1OFDA 3MJYA 4PODA 2XN0A 2RDTA 4IPJA 1EIXA 3KP0A 1EYEA 8CGTA 3QEZA 4GIYA 3WLQA 2IKIA 2R94A 1JVNA 2HQAA 3GNRA 4MAZA 4PMUA 1ELSA 1I2OA 3L4UA 3I4KA 4P7OA 1VIZA 3CJPA 4DXKA 2Z26A 4JTKA 2G3JA 4EANA 1B30A 2J74A 1OJXA 1XIGA 2PI6A 4NJKA 5TAOA 4NF7A 4XD5A 3BW2A 3WMSA 2I5QA 4MWAE 3A5FA 2J7DA 1W1YA 4LU0A 6XIMA 3TAKA 2OLSA 1W9XA 1VPQA 2D0GA 3V16A 4AC7C 2AQVA 2PCQA 4LYKA 2QJIA 1I1XA 3G1AA 2NQHA 4QXIA 3GK0A 2CZVA 4LUTA 3KHJA 3SGZA 2J9YA 2VX6A 3H6OA 4EWJA 1W1B1 3WL1A 4MJZA 1TPH1 3OG2A 1T7LA 1A3XA 1KXQA 3H21A 3UG3A 4YTSA 5HR7A 1EL3A 1R6WA 4PCFA 3SCVA 3SY8A 4DZ5A 2CLIA 2PWGA 3T6CA 4XUYA 1O60A 2R82A 3M0ZA 4EKJA 3DKLA 3VD9A 4PMRA 5FJIA 4EF8A 1Q6GA 3FS2A 3CNYA 2EEXA 4DB7A 4OV9A 4UQ9A 1EBGA 1UJQA 1XBXA 3CT7A 1XBYA 1CT5A 3LLXA 4AZ6A 1W3IA 3L0KA 1R3TA 1M1BA 5HPOA 2FJKA 1W1A1 4NRSA 2ZZ4A 2XISA 1UH3A 3NQ2A 1L9WA 4HCLA 4QCEA 4XO7A 4S3JA 1SW3A 3SECA 2IQ0A 1W17A 1S2AA 4QNEA 3IGXA 1OD0A 9CGTA 2OSXA 2HNEA 1JGMA 4NJJA 1RQEA 4WSJA 4PUUA 1SO5A 4RJEA 4Y9NA 1KCLA 3CH9A 3PNUA 1JCNA 3KAOA 3H4WA 2XYLA 8TIMA 2Z4GA 4KFPA 1Z3NA 2ACUA 3KL5A 4DUVA 1PTGA 3TW6A 4UMCA 5I79A 4Q8UA 2GVLA 4GNVA 2E8YA 1BYCA 1EP2A 1NWRA 3W87A 2YL9A 3BC9A 4DO7A 2V5JA 4B4FA 5BMWA 5BOEA 4W7WA 1PWMA 1NU5A 2MUCA 2DT2A 3ZJKA 2X30A 2QCMA 3WQFA 2CESA 2CBJA 4B2DD 3M0YA 3NDZA 3PK7A 3K4AA 4HPXA 2Y8KA 3T0CA 2Y7FA 2J79A 1JDCA 2HBXA 4MDPA 3TYBA 3EA2A 4MKVA 1VRDA 1Q45A 3QM3A 1JUKA 4DF2A 4BEUA 1NELA 1E6NA 1QNRA 4N0RA 4HNVA 2GDQA 3GHTA 2FHCA 3N2XA 2RAGA 3NQFA 1G4TA 1NWSA 5EPDA 4RNJA 3S5YA 2TPSA 2V3DA 1SUXA 4H8HA 1V6UA 2G3IA 5F2MA 3UWQA 3TTYA 2PF8A 4YVXA 4AZIA 5HNUA 2QCGA 4Z42C 5FAGA 3DX5A 5DMLA 2PWVA 3ARPA 1U33A 1WKFA 2PD9A 1HJUA 4MUZA 1W56A 3WMBA 4CQ9A 1SYTA 2H3DA 4B5WA 1N2VA