1M6JA

Crystal structure of triosephosphate isomerase from entamoeba histolytica
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
260
structure length
260
Chain Sequence
GAGKFVVGGNWKCNGTLASIETLTKGVAASVDAELAKKVEVIVGVPFIYIPKVQQILAGEANGANILVSAENAWTKSGAYTGEVHVGMLVDCQVPYVILGHSERRQIFHESNEQVAEKVKVAIDAGLKVIACIGETEAQRIANQTEEVVAAQLKAINNAISKEAWKNIILAYEPVWAIGTGKTATPDQAQEVHQYIRKWMTENISKEVAEATRIQYGGSVNPANCNELAKKADIDGFLVGGASLDAAKFKTIINSVSEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Triosephosphate Isomerase
publication title Structure and Inactivation of Triosephosphate Isomerase from Entamoeba histolytica
pubmed doi rcsb
source organism Entamoeba histolytica
total genus 94
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2002-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1m6jA00
4S2CA 3C2RA 4NJGA 4LY8A 3IVSA 2A7NA 1B3OA 1B9BA 2WSQA 2Y70A 3NEVA 4BWLA 1M6JA 4FHAA 4RCXA 3W84A 4I9AA 1KFKA 3ELFA 1GG1A 3QEZA 4JX6A 4LS1A 4QIUA 1HL2A 4ZMGA 5KTLA 3QQ1A 1RVGA 2WJZA 1J2WA 2V2HA 1I2RA 4QNEA 3W71A 4HSNA 5HR6A 5TBOA 3M16A 4K8EA 3UXDA 3S1VA 2NX9A 3BO9A 4ONVA 3EWZA 3A21A 3L5AA 4FNPA 5EPDA 3LI0A 5HUPA 2OCZA 4AMAA 1G69A 2VKZG 1RPXA 2CWNA 1S5WA 3P80A 1WDWA 3S5NA 4CQ8A 2ABAA 2NUYA 3DBPA 1D3HA 4FX8A 1ZJIA 1K8ZA 1H5YA 1XBZA 2E09A 4EOUA 1VQTA 2WQPA 1K7FA 3UPWA 4UMAA 6ALDA 3HIJA 5I3HA 2ZA2A 1ZFJA 3W1AA 3W88A 2Q3OA 1G67A 5ABTA 3KAOA 1G4EA 1R30A 5FEPA 3DGRA 2XN1A 4WX2A 3W74A 1C29A 5TIMA 4JTHA 4O1AA 2V30A 2H8ZA 3BLFA 5G1YA 2X1SA 4A21A 3NYZA 2CLOA 1Q6QA 1O4UA 4K39A 1ADOA 5A5WA 3UXAA 5J5DA 2BSLA 2ISVA 3TE9A 1AW5A 3TUUA 1FWSA 1KV5A 4DBDA 1C8VA 1WOBA 1X6UA 2LLEA 4WUIA 4XKYB 1NF7A 3HPSA 1GYNA 1EP2A 5CG7A 1OK4A 4Q32A 4H4IA 2BWGA 1OFQA 4B5NA 3TV8A 3W22A 2Z1BA 5CGQA 1F6PA 5AOUA 4PH6A 3GDTA 4Z0SA 5EKYA 4GWEA 1JRBA 3CTLA 1GVFA 1THFD 5K9XA 3W9ZA 3CLMA 4JICA 1JCJA 3L2IA 4UTJA 3TQVA 4KWWA 4O1BA 4UMCA 3W7EA 5C54A 5EA9A 3LRKA 1V5XA 3B0PA 4NXSA 3LXAA 3L65A 3ATYA 3C2FA 2WOQA 3MBDA 5AHIA 4ZQOA 5D05A 4MJZA 3GVGA 3LHTA 1T96A 2ZZ4A 3SIZA 4FNSA 4MY9A 1EA0A 3NL2A 1TO3A 3CC1A 1H7RA 1FCUA 1W3IA 3P84A 3NNTA 4R33A 2O7QA 1W5PA 1WBJA 2NV2A 4NUWA 1H60A 5CSSA 1XKYA 3MI2A 3NG3A 2W0UA 4MOZA 3RNDA 1IIHA 4O11A 4JYFA 1LP6A 4JDYA 1SFLA 4S2BA 3P8IA 2VOMA 4LV9A 4W9TA 5EBUA 3CPRA 1UBSA 1L6YA 2A21A 3NQ7A 4NNAA 1QPQA 4CQ9A 1TRDA 2PCQA 5HWMA 1TPB1 1ZAIA 3W23A 4RXFA 3NQEA 4LNYA 3IGXA 1K8YA 5DY3A 4HN4A 1I2PA 2UV8G 1TPUA 3TR2A 3GXPA 4UFMA 3T55A 4A22A 3ZWSA 1SO4A 2KZHA 2OX1A 4CNNA 2OT1A 3R13A 3M6YA 5I3KA 4JTUA 5T26A 3W7GA 4DF1A 3L66A 3GZ3A 3GLCA 5MHBA 2H90A 1KLZA 2QCCA 3NQ8A 1I8JA 3W1XA 1K8XA 4AF0A 1WAUA 1KFEA 3LCIA 4X2RA 1O5KA 4MYXA 3YPIA 4JIQA 1K7EA 2ZRZA 5AHLA 5DBTA 3CQ0A 1OHLA 1LLZA 5CPNA 1OYBA 4UIOA 4IMFA 4M19A 2OZ0A 1JCMP 4JEQA 1TPWA 5K2ZA 3BLEA 4E38A 4IUOA 2OJPA 2GVLA 2QCFA 3W07A 4N4QA 3HJZA 3LOTA 2ATSA 1AL8A 2EAWA 3TFXA 3SI9A 4O17A 3BW2A 3THQA 3N2MA 4JYEA 3IIXA 5D30A 5GVJA 1AW1A 5LNWA 3E49A 3C0JA 1OABA 3QRHA 1I2OA 3TAKA 3L9CA 3W83A 1T8XA 1OX4B 4YCPA 5HR7A 4GJ1A 3IIZA 1W5OA 4JN6A 1WBHA 2H3DA 3MWAA 1NVMA 2Z6JA 3O1NA 1ML1A 2XFWA 4IQLA 4PL1A 1WQ5A 5FF2A 3EKLA 4EVZA 3TKFA 2FLIA 2C14A 2YGYA 1P0NA 1HTIA 3WJXA 5DXXA 1TSIA 1T99A 1M7PA 1IF2A 4AHPA 3W75A 4ADUA 2NX1A 2YDAA 3R8RA 3I7SA 1Q45A 3BPWA 3W2MA 4FIRA 3M5ZA 4MZ8A 3Q58A 2J24A 2NZLA 3MYPA 3M47A 3BVJA 1XFBA 5F4WA 1H50A 2B4GA 2NWSA 3TW7A 3BV4A 4ALDA 3C61A 3IVTA 4RLIA 1HO4A 3P62A 2A85A 5FI8A 1EIXA 1GJPA 5L6UA 2GVGA 3PWAA 3W1LA 1VHNA 4ADTA 1QFEA 4ORIA 3QJAA 1O5XA 1DQXA 3P67A 4CCEA 1G4SA 1JUEA 2D73A 1VGAA 4I7VA 1OJXA 1XL9A 4JTFA 5KSWA 5IBXC 1GVSA 1F05A 1YTEA 3CIWA 3M5VA 3L21A 5DY2A 3LTYA 5KITA 2PURA 3NO5A 1W0MA 1UCWA 4ZQMA 2WPBA 3W1UA 4RX0A 1TPVA 3NQAA 1H7OA 3E0IA 2WV8A 3QMTA 4O52A 1GYLA 2YXGA 3KVMA 5AC8A 2GVJA 2P1FA 4JTSA 4PL2A 2RH9A 4PFMA 1SW7A 5C5YA 2QCMA 1OF6A 2QJHA 1TQJA 1N8FA 4NQ1A 3N2XA 4WD0A 2G95A 2QAFA 4S1FA 2RKXA 3NM1A 3W7LA 1SZNA 2ABBA 4NU7A 4FIQA 1YDVA 3WJSA 4RZ6A 3BW4A 1Q6OA 4E2DA 3C52A 2ZBTA 3OEXA 3RMJA 4GXMA 2ZYFA 1UASA 1B4EA 1VH7A 2CLFA 3P82A 1OFBA 2YCEA 3W1RA 1ZALA 4RZ4A 4UTWC 2E5CA 2J88A 3TJLA 1IXQA 1VHCA 3NZRA 1BTMA 2C1HA 5CZTA 2VXNA 5DN1A 2E1DA 1SPQA 1FWWA 1KM5A 1TJRA 1IXNA 3EX6A 2ZRYA 3HGOA 2X30A 3MP3A 3T4CA 3M5YA 2JKPA 3VKJA 1SU5A 2FPTA 1QO5A 2EKCA 1G4PA 1KTCA 3W7MA 1GVRA 4MZYA 4K7YA 1RZMA 1Q3NA 3P81A 3LI1A 1KTBA 2NUWA 1EB3A 3LHUA 1A50A 3DKJA 4NZJA 4UTTC 4DF0A 5FF4A 4O4WA 4C1LA 4O8RA 5C6MA 2CZFA 1GZGA 5LNVA 4GUGA 3SY5A 2VELA 4A29A 1A53A 2ZZ2A 2X16A 4IMGA 5G1TA 4UNLA 3GDRA 1XXXA 3BW3A 3OHIA 1VCFA 3S42A 3OVQA 3DFPA 1X1OA 4GC4A 2ZRXA 5DELA 3NZ1A 4YLWA 3HOJA 2Z6IA 3PG8A 1ICSA 5IM51 2GOUA 2V5BA 3GDMA 3LTPA 3CWNA 3PUEA 4OV9A 1VCGA 1GTEA 1EWEA 3B04A 4KFNA 1XC4A 5HUOA 5CPMA 4PA8A 1X8FA 4XTIA 1ZAHA 2QDGA 4PEKA 1OFDA 3TSBA 4PTNA 1R47A 1D9EA 2PE4A 2YPIA 1SUXA 2H3BA 1PS9A 3MMTA 4O0KA 1J5TA 2Q3RA 3O05A 1KM6A 1W31A 1BWKA 2ALDA 2ZRWA 1KM1A 2ZDRA 3L5LA 1GEQA 2YX0A 3QW3A 2AQWA 1P0KA 4HKPA 3P5ZA 4LS2A 3SR7A 2DU2A 2W79A 3GKFA 1ME9A 4OU1A 3W1TA 2C15A 3LM7A 2GQ9A 2ZA3A 1K03A 4ML9A 3N19B 3QPZA 1EUAA 2C3ZA 3DKLA 1QCWA 3IVUA 1FUYA 3MBFA 4U4MA 5E0KA 2VFDA 2B7OA 3UWQA 1XI3A 3DAQA 5CPOA 3VNDA 4WY0B 1B57A 3RU6A 3O07A 4AHQA 1RQHA 3N3MA 4FO4A 1SSGA 1PCWA 1W5NA 3DFSA 3LHVA 3SZ8A 4Q33A 4O57A 1KFLA 1WV2A 2ZZ1A 4GNJA 4CQAA 3KXQA 3V75A 3W3OA 3QH2A 1DOSA 2V2DA 2DZPA 1GT8A 3NQVA 3PB0A 4NZFA 3W2NA 1HFBA 1E51A 2JK2A 5I3GA 4XUGA 4O4VA 1I45A 4MLJA 3SECA 1W54A 4IXXA 1DHPA 1VZWA 2WNNA 3LCLA 4BWLC 4NJKA 3E02A 3FKRA 1O94A 3O16A 4ZQCA 3LHYA 2CFFA 5CZ0A 5FESA 4JGDA 3UD6A 1H63A 2FQIA 1TYGA 1UJPA 1OX4A 3N34A 4LV4A 4A2SA 1QNVA 2F84A 1ALDA 1KM0A 1KBIA 4CCCA 3B0UX 3TU9A 5SWUA 1VC4A 4EF8A 2RDUA 3CU2A 4H3DA 3HG5A 3B03A 1O60A 3HMJG 3EEGA 4IGHA 4AWUA 4MIMA 2QJIA 4XBSA 1OYAA 1PIIA 4UTKA 4KFPA 3PSVA 3LRMA 3M44A 4GE8A 4M5PA 2DZVA 3M0ZA 4O54A 2X1UA 3AO0A 3QPYA 1KLYA 4YMZA 1SO6A 3PM6A 3V1PA 1R2SA 2ZZ7A 2CLKA 4JTEA 4E0CA 2C6QA 1L9WA 1JRCA 1XUZA 3OBKA 3DI1A 2ATMA 2ZRUA 4HPXA 2QCHA 5LKYA 3LTSA 1QDSA 5BRBA 2Y62A 4TO8A 3PB2A 4AAJA 4OV4A 3EWYA 5DCDA 2H6RA 4JS3A 1XUUA 3W7QA 5BMXA 4FX6M 3STGA 4CLMA 5EL1A 3EX3A 5I3FA 2QUTA 2V82A 3UWZA 1IIGA 4OT7A 3PS7A 4HSOA 1QOPA 1RQEA 1ZHAA 3L67A 3S5OA 3LGEA 3NL5A 4D2JA 1W8SA 3G1XA 1LOQA 4QJ1A 2DZXA 1ZCOA 1TTPA 4DO4A 3PBYA 3PBUA 1R46A 1KFBA 1GPWA 4GRSA 4KFOA 3UWYA 4LC6A 1HG3A 4RR4A 5A8GA 3FOKA 3M41A 3W1QA 3TJXA 1BWLA 3LB0A 4UMBA 3R5EA 4K8HA 1TREA 2TRSA 1K02A 3ZR4A 2NX3A 3PUDA 3MP4A 1U83A 2CLEA 3W87A 4QQ3A 3GNDA 5C2XA 4RJEA 2F7FA 3NAVA 1N7KA 4E2BA 5D37A 3LXCA 4FNRA 3GB6A 1F5ZA 3S0CA 1QPRA 4L4MA 1NAL1 3G1AA 3MI3A 5TQLA 4M7TA 1X1ZA 3L0KA 3U8GA 1ICQA 2J9YA 2VC6A 1PHQA 4OE7A 3U2OA 2NWRA 3TCEA 3W2JA 3CM4A 2ZTJA 4MZ1A 3TIMA 1LDCA 1FXQA 2GJLA 3HO8A 3I68A 1G4TA 2Q8LA 2ZA1A 1LROA 5I3JA 5HNRA 1L6WA 4EF9A 3R2GA 5AN7A 5HWJA 2J9XA 2VFIA 4IMDA 1B4KA 1UUOA 2DJLA 4LVAA 5F1UA 2QCLA 1SZGA 2E6YA 2WSRA 2PC4A 4WQ6A 2GQ8A 4Z1CA 5LNSA 2Y6ZA 2QEZA 3G3MA 3WFAA 3SJ3A 5AFDA 5AC7A 4I7UA 3LCWA 3LCFA 3IIPA 1PV8A 3W76A 3TX9A 4FNUA 4FEZA 2H8XA 1XBXA 1KTNA 1SR9A 4M7SA 4FB7A 3TROA 1L6SA 2A7PA 3Q37A 3A24A 1JCLA 1JQXA 5LHFA 1XDLA 3CHVA 4UXDA 3CB8A 3MI6A 5D38A 3DH7A 1MXSA 1GWJA 3PF3A 4P2VA 1JQVA 2DORA 2J9ZA 1WOAA 2NUXA 3HF3A 1W37A 1LLWA 4NT0A 1AK5A 4NVTA 1T0OA 2E77A 4MKNA 1W3TA 4M6PA 1SW0A 3OIXA 1M7OA 1TIMA 4Z08A 4CNOA 4LT9A 3M1ZA 1KV8A 2I1OA 2ZTKA 1FX6A 3KHJA 4HNVA 5DCBA 1Q6RA 1D3GA 4QSHA 4UFKA 4FNQA 4POCA 2E5BA 4NNBA 1GG0A 4NX5A 2V2CA 1VJIA 1EP3A 4UFIA 4KWVA 2DZWA 1H7WA 3SFKA 1GQNA 2QCDB 1AG1O 2QF7A 2WNQA 3ZWTA 4KKXA 4N9EA 1GOXA 1UB3A 1RR2A 1M5WA 3PVFA 1ME7A 5AHEA 3L0GA 3S1XA 2XN2A 4FF7A 4FXSA 4YWIA 3LCGA 3AJXA 2W6RA 2RDTA 1RD5A 1SZFA 3SW6A 1SW3A 1OFOA 3A5VA 3FS2A 2HMCA 4JY9A 3DU0A 4LS0A 3NQMA 3P7YA 4UTIA 3S5ZA 3QFEA 1H1YA 4YXGA 2RHGA 1QPOA 1S3HA 2RFGA 5K9CA 1EUNA 3Q2DA 2FB2A 3SGUA 4TMBA 4IX0A 4CCDA 2EF9A 3TMQA 2E6DA 4OBTA 3HQ1A 3HB9A 2QR6A 4O13A 1F74A 4Z1AA 1OFAA 4IOTA 5F2IA 2CZ5A 4ZQPA 4C1KA 5D02A 1LOLA 4MYAA 3R89A 4OGZA 1YPFA 2TSYA 2E5DA 4MLRA 4QAIA 3TQ0A 3UQNA 4LRTA 2VFFA 4RV8A 3A5FA 2YW4A 1OYCA 1PCKA 4N6EA 1DL3A 2FPVA 3E96A 2TMDA 3EX4A 3QM3A 1GTHA 3UZJA 3N14A 2CLMA 3FFSA 3NQ2A 4MPQA 4O1CA 3W7OA 2V0TA 1ME8A 4WOZA 3W1NA 3PULA 1NF0A 3W2KA 2JGYA 3TC7A 3G1DA 1FQ0A 4P61A 4LW7A 3MP5A 2P0OA 3LCHA 4XTDA 1VLWA 3MHUA 4X3ZA 4UR8A 3G0XA 5F1VA 4ZL1A 4Y6GA 1MZHA 1W56A 3GXNA 3LV6A 3NDOA 3PG9A 1GVQA 1Z42A 3A22A 3EXTA 4H6KA 4BI7A 1ZY9A 1TRIA 4QNWA 3GAKA 3LDVA 4LVFA 1H7NA 2CW6A 4DQWA 1EWDA 5EYWA 3F03K 3FJLA 3JS3A 4EWND 3PR2A 2WKJA 3UWUA 3I65A 3L68A 4Z1DA 3O6CA 3BGJA 2B0MA 2ZCGA 3EB2A 2CLIA 3FEMA 2CU0A 3KRZA 4WJEA 1JUKA 3S9YA 3STFA 3N9RA 2VEKA 5D2WA 1LRTA 1P1XA 3W7RA 3NA8A 3W7NA 3W7CA 1CW2A 3M43A 1SFJA 3C3NA 4AXKA 3HG3A 3O63A 4FXRA 2CLHA 4TIMA 1SO5A 3VFLA 3O6YX 4XKYA 3IEBA 5K4XA 1FCVA 3ANYA 3S5YA 2QUVA 3P8JA 2Y7FA 4MY8A 1PVNA 2CLLA 2ZQ0A 1RV8A 4K37A 4BR1A 3N9SA 2A4AA 3DXIA 2I14A 5D2YA 3HGSA 4K38A 4JD4A 1IGSA 4NNCA 3THAA 3TC6A 1G6CA 1IXPA 3NPWA 4AHOA 3QSRA 3STCA 2GUUA 3FJ6A 2P10A 3BK0A 1A5BA 5K9DA 3NGJA 2OT0A 2Y7DA 3JR2A 2PRHA 4O50A 1XM3A 2TYSA 4DPPA 5HWNA 2X1TA 2QDHA 4WZHA 3G0UA 1LTDA 4AVFA 1TPEA 5FEXA 4O14A 4BI6A 5G2HA 3KRSA 3TAOA 4HNTA 1GVOA 3VE9A 4UTLA 1I4NA 4UFJA 3TSMA 1MEHA 2FTPA 4UR7A 5LHEA 3CEPA 4BFAA 4LVDA 2QCNA 3C6CA 5F4XA 4OHQA 1LRQA 2VEIA 2FFCA 4JY8A 3S6DA 4R7JA 1VRDA 4JX5A 2ISWA 4R34A 1MO0A 4PODA 3G1SA 3EX2A 3L0NA 2ISSA 1VS1A 3G18A 1F7BA 3NPUA 4O12A 2OMAA 2QCEA 4UUIA 3I7QA 4MFDA 3B06A 3F1QA 3H54A 1FWRA 3BG5A 3G22A 3P5YA 2B7QA 2GPTA 4RZ5A 1LRNA 3I7RA 3GXTA 2E6FA 3LV5A 2FPYA 1LOSA 3C4UA 4ORMA 3IIOA 1TTIA 1Z44A 3LLFA 3W7HA 3S8HA 4DELA 1QO2A 4UTHA 3PSWA 5LNUA 3DFQA 3WK0A 2V8ZA 3GYEA 1TPDA 5H2ZA 3LERA 5DBUA 3T78A 1JCYA 5U4NA 2YFOA 7TIMA 3S1UA 1P5BA 4O16A 1I2QA 4OWGA 2NXGA 3GDLA 4Y90A 1H1ZA 2A6NA 3IGSA 3O06A 4U28A 1I2NA 2FB3A 3T40A 3HPZA 4HHPA 4K36A 3B4UA 3PBWA 2FJKA 3QZEA 1P4CA 2G5WA 4WOQA 1SZEA 3LX9A 1F6KA 3GKAA 3LBCA 3SGZA 1VLIA 3DHDA 3OG3A 4QISA 3Q94A 4PCFA 2NXIA 1TPH1 1YLVA 2QUUA 1F76A 3MW7A 5DCEA 2FIQA 1R2TA 3STEA 2DZTA 2PRMA 6TIMA 2BZNA 3H53A 5K7JA 3B0VC 3KVJA 3EWXA 5KZDA 1H7XA 3EXRA 3INPA 1DJNA 3W7PA 4Q4KA 3FA5A 1DQWA 2QCDA 1C9DA 3WJZA 1ONRA 3QW4B 1JVNA 1JCXA 1YXCA 4N9BA 3TFCA 4UTUA 3TXZA 1W5MA 4ZQNA 5LNRA 3UWWA 5F4SA 1MEIA 4NJHA 1JR1A 3RK8A 3WK3A 5BW6A 4GUJA 3NQDA 2YYTA 2BLEA 2CZEA 1OVDA 2Z0IA 3WJWA 3TMLA 1FY6A 5G2WA 1TV5A 1OFRA 1H51A 4DEFA 3EWWA 3F4NA 3FYPA 1YPIA 2GJNA 1WYIA 4HNUA 3NM3A 4DO5A 3LCXA 2B7PA 2G97A 1TMHA 4BI5A 3QMRA 4MY1A 3W2UA 4UCGA 4LUJA 4NX0A 2EPHA 5AYYA 3O15A 4JTTA 2Z2UA 2ZZ6A 2ZZ5A 5AHFA 4TMCA 3G1HA 5LSMA 2Y7EA 4IJBA 3W7JA 3RF9A 1YDOA 1FBAA 1KM3A 5KINA 3LLDA 3KX6A 5HINA 3F4WA 1JUBA 3QYQA 2JKAA 2QCGA 2QJGA 1NSJA 5HJLA 3CWOX 4N9DA 5U7SA 1DJQA 1YYAA 3ABSA 3K30A 4LRSA 5EMUA 3G1VA 1WXJA 3MJYA 1TCDA 2Y63A 2C0AA 2NXHA 1FCBA 3G1YA 1Z48A 3JRKA 1LBFA 3KFTA 4GBUA 3CEUA 3TW6A 2YYUA 3UY7A 4AWTA 5CKSA 3W7IA 3W2LA 2AAMA 4LC8A 3HBLA 4Z1BA 3FIGA 3UZ5A 5D33A 1FWTA 2JBMA 4GUHA 3RLVA 4AEOA 2YZRA 1YDNA 1DBTA 3LBMA 1DV7A 1LBLA 3MHFA 4NJIA 2E6AA 3ATZA 5K4ZA 2A6LA 2XN0A 2R8WA 3ZS4A 1JCNA 1PL9A 1W3NA 4TU1A 1KFJA 1WA3A 1KBJA 2DP3A 5BMWA 2PRLA 4WY0F 3HPXA 3GAYA 5I3IA 3HG2A 3S1WA 1N55A 1KM2A 1TB3A 3GDKA 3IGUA 3IIVA 3PAJA 5AHNA 1LYXA 3W1MA 5BOOA 5FF3A 1YXYA 1YTKA 5AYXA 3PC0A 5H91A 3HGJA 3LXBA 2Y89A 4XWUA 3NVTA 2V5LA 3EXSA 1F73A 5D04C 4XBKA 3W1PA 5G4WA 3H55A 4M6VA 4DXVA 2ZRVA 2A7RA 3A23A 3TXVA 2HS6A 1H7PA 2VFEA 2AGKA 3MHGA 4BK9A 4UC5A 3ABQA 3BARA 3OA3A 5D09A 1QWGA 1VR6A 2BXVA 2Y85A 3BG3A 4HPJA 4NXKA 2J6XA 4IMCA 2FDSA 1VYSX 3W86A 3NL3A 5E93A 5J5RA 4O18A 4UFLA 3P74A 4LTSA 5AHMA 4AB4A 4JR5A 1DORA 1MEWA 3EKZA 4TR9A 4TX9A 3M9YA 3MYOA 2X1RA 5LZLA 4FX7A 1W1ZA 4Y8FA 2BX7A 3BG9A 1K3UA 5FF0A 3VI2A 3UYCA 2VEMA 3U6WA 4QITA 4JTKA 3C2VA 3LHZA 2EHHA 1FDZA 2C13A 1A5CA 2VFGA 3HGRA 3W85A 3GR8A 3DFOA 3LHWA 3E12A 2R14A 1TV7A 4O28A 1EPXA 1G7VA 1LM1A 5D2TA 1TTJA 1WX0A 1R2RA 1JULA 4GUFA 1A5SA 5AYZA 1KW1A 4M6QA 1RQBA 3SSJA 1EEPA 1TPFA 2R91A 4R53A 1J4EA 3TNOA 3OVRA 3KVLA 4LVBA 3I6RA 1TJPA 4JX4A 1HUVA 1QAPA 5D03A 5D2VA 3M5XA 4YL2A 1F2JA 1K7XA 3N73A 3QC3A 2V9DA 1PE1A 3BLIA 2A0NA 4WXZA 2B7NA 1FWNA 4NJJA 3W70A 2YSWA 5CZJA 3VCRA 1QR7A 1KA9F 2C16A 5D32A 1LORA 4CNPA 3BGGA 4UNKA 3NL6A 5F2MA 4DBEA 3TSDA 5FF7A 4WY0A 3ZFHA 4EIVA 2EGZA 3UNDA 5BNKA 2HS8A 2E68A 4ZZ9A 3KVKA 1VPXA 3ABRA 4QM1A 8TIMA 3GNNA 3KRUA 5KZEA 2G96A 3NPXA 1KM4A 2HTMA 1NFBA 4HIBA 3O6DA 3UPBA 4HT3A 2JGQA 2QKFA 4UTMA 5HULA 4LUIA 5IBXA 3VE7A 5G2IA 3O8AA 1OK6A 3HG4A 1TTQA 4RKAA 3QSTA 5D2XA 1PHWA 3QQ0A 2NV1A 1ICPA 4IWWA 1AMKA 4IX2A 1EX5A 3FYOA 1TPC1 1LCOA 4N9CA 1W5QA 1HO1A 3DFNA 4IPIA 3TA6A 1SO3A 2DZUA 4JDBA 5AC6A 5LGZA 5LGXA 1CX9A 2CZDA 4MJMA 3TK7A 4O53A 4L4LA 2I9EA 3ABOA 3OVPA 3RFAA 1ZNNA 2WO5A 5L9FA 5KZMA 1XBYA 2J27A 4K7VA 4LWWA 3UWVA 4IPJA 4Y9AA 4RK8A 3QMSA 3T44A 1OX5A 1QPNA 1QOQA 1SQ7A 4JTIA 4O10A 2YW3A 1V7YA 2BTMA 3LRLA 3WK1A 3PUOA 1TQXA 1XDMA 3IRDA 2IQTA 3G1FA 3GK0A 1NEYA 3TQKA 2HSAA 4UTWA 3NXFA 5EY5A 5CZSA 5KMYA 2O7SA 3KOFA 1G7UA 4JYDA 4MUZA 3DENA 3PBVA 3G8RA 3NQ6A 5DLCA 4O19A 2X2GA 2C19A 5FEZA 5FEWA 3EWBX 3T7VA 3DI0A 3DZ1A 3G0SA 3L5MA 1L2UA 3TDFA 2VENA 4XZ9A 1OFEA 4PC8A 1AL7A 3C56A 2VFHA 3PY2A 1FDYA 4JXCA 1ZENA 4N02A 2C18A 4OQVA 1FDJA 2VEPA 4JIPA 2YR1A 4Z0JA 4DO6A 2GQAA 1EP1A 4LU0A 1IXOA 3W72A 2YFNA 3FLUA 3P60A 1UUMA 4A2RA 4UTTA 4O0ZA 1S5VA 2V81A 3W7KA 1KFCA 2A5HA 3FKKA 4AWSA 2WNZA 1LZOA 4YCOA 4IXHA 1VCVA 3GX9A 4IMEA 3G3DA 5F2LA 5G5IA 5CSRA 4AF0B 3W7DA 3IV3A 3EX1A 3C2OA 1OX6A 5AB3A 3USBA 4JTJA 3A9IA 2ZZ3A 1Y0EA 4J9JA 2ZFAA 4ZQRA 3CIXA 1VYRA 4I7WA 4UFHA 4ADSA 3D0CA 5HMSA 1QMLA 4MFEA 3GIYA 1YXDA 4LOCA 5C55A 5E1QA 1LBMA 4X22A 3C8FA 1VYPX 1ZAJA 4DF2A 1OG0A 3NOEA 3B05A 3E9AA 3NQCA 1DVJA 3NQFA 2A2IA 3NPVA 3NQGA 4XQ6A 1BKSA 3G8EA 3P61A 2DJXA 3EWUA 4G1KA 1U5JA 1Z41A 3NR0A 1Q6LA 3M7WA 4AH7A 3W6YA 3R12A 4A3UA 1OFPA 2Q8ZA 4O15A 4WXYA 5DXYA 3B8DA 4GFSA 4RXGA 2DZSA 1YADA 1X7FA 3DHFA 1S5TA 1JJKA 4BF9A 2WSYA 1CI1A 3DFTA 1AW2A 4MVAA 4N6FA 1FCQA 4HNNA 4O1DA 4JTGA 1BEUA 4JTLA 1SSDA 3CT7A 1MSSA 1YTDA 4N4PA 3GR7A 4ZVJA 1XCFA 2JKEA 1O95A 4K6AA 3WK2A 2A1YA 3G24A 4X9SA 1A5AA 5G4EA 1XBVA 2TPSA 4FNTA 4DPQA 2QAPA 2Y7GA 3QF0A 4LVGA 4N2YA 3RLUA 1FXPA 2RDWA 2Y61A 1TV8A 1H62A 3UY8A 5K3VA 4JNMA 3MO7A 3MUXA 1DKWA 5F2GA 4Y96A 5HQEA 1H61A 2NLIA 4GUIA 2Y88A 2R94A 3W73A 3WJYA 1OF8A 4ICNA 5CPLA 3C2EA 3TH6A
chains in the Genus database with same CATH superfamily
3VZYA 3POHA 4S2CA 1EJSC 3LG3A 3GTNA 1K9FA 3SFWA 5EMMA 3EDEA 3IVSA 2QDEA 2YJQA 2A7NA 2VDIA 2WSQA 1B9BA 4HA0A 3MB9A 2WNWA 4FHAA 2I9UA 3W84A 1XYLA 4XVDA 3CUZA 3QEZA 2DZAA 4LS1A 3MZNA 4ZMGA 3RX4A 2RGMA 1RVGA 5HMEA 2BXZA 1OSEA 4DJFA 1J2WA 2NVAA 3G6LA 4QNEA 4HSNA 5TBOA 3UBPC 5IFPA 5EPDA 5HUPA 3GXIA 4L6OA 3P80A 2X8RA 1WDWA 2OELA 1YBQB 4CQ8A 3CWHA 1DEDA 3JZEA 3SRFA 2PD5A 1ZJIA 2BODX 1XBZA 4GY0A 2E09A 4XZIA 4QJ3B 3UPWA 4UMAA 3HIJA 2ZA2A 4RNJA 2Z29A 3W88A 3AJ7A 2Q3OA 4G56A 2PTWA 3R10A 3KAOA 1G4EA 4WX2A 1BG4A 3W74A 1RHCA 3PZMA 3SY8A 4B9YA 3QZ6A 2ZKMX 4K39A 3KBSA 4W88A 5A5WA 4RZBA 5J5DA 2J66A 3O0FA 3TE9A 3TUUA 1FWSA 1U33A 1JIBA 1X6UA 2YL9A 2XIJA 1GYNA 3LS9A 1TX0A 3S2CA 3P0WA 3R11A 2E9BA 2BWGA 1OFQA 1XHGA 2VR5A 3PPCA 4B5NA 4GYJA 3VGGA 5AOUA 3GDTA 4Z0SA 1JRBA 4IICA 4KERA 1GVFA 1HVXA 3W9ZA 3ZXWA 2VYOA 4UTJA 2NVDA 5C54A 3W7EA 3H70A 2DQXA 1E5NA 3LXAA 5DMLA 3L65A 4H7CA 4AVNA 2ZUSA 1GUVA 5CC6A 4H8NA 1UR1A 2ZZ4A 1Z3NA 3SIZA 3ZT6A 2VJXA 3CC1A 1HJSA 1W3IA 2DT3A 4ZA0A 4HYVA 4MHBA 1JEZA 2BGSA 1M7XA 4ILSA 1XKYA 3OIHA 4RE0A 2W0UA 4MOZA 1IIHA 1V3JA 2Z27A 4FLQA 1E40A 3H22A 5T9CE 3UJFA 5JU6A 1KCZA 1J5SA 1GNXA 5FSEC 3AIBA 2VOMA 4LV9A 5EBUA 3RPMA 1UBSA 4B3ZA 4H7ZA 4NNAA 1C92A 3QC0A 2PCQA 4LYPA 4BY3A 1D8WA 4P8XA 1TPB1 4RE4A 4ZO7A 5A1AA 4LNYA 1PZ3A 1O7AA 1Z32X 1C7SA 2WYSA 4JFVA 5DY3A 2R1LA 4U31A 3GXPA 3EAUA 3L4YA 3ARRA 4TTUA 1SO4A 5DRCA 2KZHA 3AUJA 3KBWA 4JTUA 2BHUA 4HMEA 3W7GA 5BRQA 3L66A 3TYDA 2VX4A 3S9IA 5A8QA 2EO7A 1K8XA 4DXKA 4HMCA 3RJYA 3KCOA 3GIQA 4JIQA 3GG1A 2Z1SA 5DBTA 1LLZA 4BQ5A 5CPNA 3LLXA 4HNCA 4IQDA 1L8NA 4JEQA 5K2ZA 4IUOA 2WHLA 2OJPA 2QCFA 3HJZA 3LOTA 1AL8A 1TWSA 2AL2B 2PZ0A 2EAWA 3SI9A 3BW2A 3THQA 3N2MA 3USZA 1DWHM 4IL0A 4WDTA 3QYSA 5GVJA 5C2CA 1AW1A 3W82A 5LNWA 1OABA 1I2OA 3GU9A 4DBSA 1V8EA 1OX4B 5HR7A 4GJ1A 1UP2A 1VFLA 1ZGDA 1NVMA 4L64A 4E5TA 4IQLA 1MXDA 4TQTA 1SM9A 1TSIA 5EMKA 3UG8A 1M7PA 3WDRA 2Z25A 2NX1A 1FVPA 3I7SA 2J7HA 3PZOA 1MNSA 5A2BA 1GYMA 1R0MA 2REQB 4ZGYA 1PTGA 3MYPA 2D2HA 1SJAA 2PTYA 3WNMA 3V18A 1CGXA 2YDQA 3VIHA 4PSRA 3VD7A 3EA3A 1MDRA 1HO4A 3ANVA 2VMFA 1EIXA 3PWAA 1VHNA 1QFEA 1OCJA 1D7KA 1O5XA 1CYGA 3K4DA 3GNPA 1J18A 4DZIA 4KCVA 4QJ5B 4C60A 4HA3A 4OJYA 1CLVA 1JUEA 1EX1A 2D73A 2X41A 1Y7VA 3LNMA 3WH6A 3PNZA 1PYFA 2HNHA 1W0MA 1UCWA 2CETA 2BY0A 5BWFA 1E6XM 3BLKA 3WD3A 2VZTA 5CLTA 1H7OA 3V0SA 2WV8A 1Z69A 3QMTA 3WDIA 3KVMA 3CBWA 2GVJA 1MXGA 5FJTA 1VENA 3H2NA 2QJHA 1C7TA 4BHYA 4H01A 4S1FA 4JIIX 2CBUA 1HF6A 3WJSA 3I3BA 1SZRA 2ZBTA 3RRAA 3ZO9A 1UASA 3RU8X 2QDDA 2IKIA 3IRSA 3MUIA 5A6JA 1WXZA 3PJTA 4MWAC 3TJLA 3U9IA 5EMLA 4LBUA 2J7GA 4IIFA 4RL3A 1WB0A 3NZRA 3URQA 2WCSA 2A3BA 1JGMA 1FWWA 3T2OA 5BU9A 3KWXA 3QY6A 3T4CA 3M5YA 2ZWZA 4AUBA 3PZ9A 1XLIA 3KL5A 2NQZA 3R6IA 1G4PA 1AA1B 4AD2A 3W7MA 1B1YA 4MZYA 4LQ1A 1XCWA 1QI4A 2NUWA 2DT0A 4HTYA 3DKJA 1B2YA 4LAKA 4C1LA 4GK8A 3ITYA 5C6MA 5LNVA 4EAMA 4IIGA 4REQA 1A53A 4PN2A 3S42A 5A6BD 3DFPA 5DELA 3NZ1A 2AL1A 4QLKA 1ICSA 3RJXA 3B40A 2XH0A 1GTEA 3WD1A 3VO0A 4PA8A 2PPGA 3GBEA 4XTIA 5JBDA 3S83A 4E4UA 4S39A 1D9EA 4C6CA 2YPIA 1YEYA 3TN5A 1XDJA 3APYA 3K8MA 4Y9PA 4EXBA 2Q3RA 5BXRA 1KM6A 1Q2RA 2BVTA 3L5LA 3MZ2A 1BVZA 3RUBL 2QMJA 2AQWA 1Y65A 3P5ZA 1OY0A 3KCJA 3W1TA 2C15A 4JIEA 3WLSA 1R8LA 1BRLA 3QOKA 1DE6A 3ARXA 3AIEA 1UPPA 2NW0A 2PZNA 3IVUA 3RR4A 3ARUA 1UC5A 4XSMA 3UWQA 1RP9A 1WDDA 2ZUVA 1XI3A 4JQ4A 4M29A 1EIBA 3WQOA 1XIIA 4IP4A 3RU6A 4QR6A 1JZ2A 4S23A 4AHQA 1IT8A 3N3MA 1SSGA 3GVQA 2QPXA 4Q33A 4CQAA 3KXQA 4H9XA 4L9YA 4M1RA 4ROPA 2DZPA 2RJGA 1HFBA 1E51A 1Q63A 5I3GA 4NG3A 4H00A 4O4VA 3LYEA 2AGTA 3D47A 4IXXA 5HPCA 3LCLA 4BWLC 3AS3A 1UR9A 2XIBA 4NJKA 1XH0A 3SCRA 4FR6A 5LXXA 1O94A 3O16A 4H2HA 3BTNA 2CFFA 1O66A 5CZ0A 5FESA 2JQXA 2FQIA 2QPUA 3ZR5A 1RA5A 1NWRA 4Q22A 5LIXX 4K1WA 1KBIA 4FI4A 4CCCA 3WKZA 1XRTA 1JD7A 3B9DA 3DG3A 4KRUA 3HG5A 2VUNA 3B03A 1O60A 4IPLA 4IGHA 4K1GA 4XBSA 3LRMA 3S3GA 4MB4A 3DDMA 2YBUA 3BSGA 4NKCA 5E0CA 3M0ZA 1FWHC 3PWIA 4QBXA 2ZZ7A 1XUZA 2PDKA 1EGMA 3DI1A 1PX8A 4LX4A 1QDSA 2HRWA 2Y62A 3R1ZA 2QULA 1QBAA 2GJPA 4JS3A 2PDLA 4XAYA 4G6CA 5BMXA 4FX6M 3KLLA 3F5LA 3STGA 4CLMA 5EL1A 2ZADA 2QUTA 5I3FA 1V0LA 2V82A 3UWZA 2VQUA 3PS7A 3S5OA 1R3YA 3G1XA 1CGYA 2DZXA 1ZCOA 1TTPA 4Y2WA 4DO4A 3NXLA 4DBWA 2D2OA 1YNQA 3E2SA 3GHUA 1ITCA 3URAA 3MJMA 4KIEA 1R3SA 5A8GA 1OC7A 4IFKA 4TVDA 3R5EA 2TRSA 1K02A 3ZR4A 2DV0A 1LQAA 4PCTA 3GNDA 3WDJA 2V5DA 1AH4A 1EHNA 5D37A 4JAWA 1WXYA 1F5ZA 3AS2A 1A80A 2J6VA 4H04A 4L4MA 2KX9A 5I6SA 4Q8OA 5CEWA 3UW6A 1X1ZA 3U8GA 2QXWA 1BWVA 2VC6A 3DG7A 9XIMA 3ITOA 2G3JA 4MZ1A 1FXQA 3I68A 1G4TA 5I3JA 1LROA 1L6WA 5AN7A 2J9XA 3OVGA 1ESWA 2CXGA 1E4NA 3LBOA 2VGGA 2Y6ZA 4PE8A 3G3MA 4ZFMA 1KWGA 1WCGA 4AVOA 4I7UA 2YCKX 1EJWC 4JPGA 3AZTA 3T6CA 3R43A 4FNUA 1PX3A 2H8XA 5AVNA 1VFHA 5A8OA 2VGFA 1W32A 3QR1A 3Q37A 1V0KA 1E9YB 5LHFA 3KDOA 4GQ0A 1UZDA 3MI6A 5D38A 4GG9A 4WHBA 1Q66A 2BVWA 2BDQA 2DORA 2J9ZA 3CH9A 2NUXA 1LLWA 1QHPA 4NVTA 1XV8A 2PDNA 1HGYA 1EF3A 3OIXA 4NZ1A 2WVSA 1US0A 3KHJA 4KCWA 3E5BA 2V3EA 4QSHA 5BZAA 4POCA 4NNBA 2XIMA 1QATA 2GLKA 2V2CA 1VJIA 2VR4A 5ABEA 4XBJA 1GQNA 2VVNA 4W86A 2QCDB 2QF7A 4WKAA 3ZWTA 3OGVA 1V02A 3VINA 2P8CA 4KKXA 3ARQA 3ARPA 2HDJA 1UB3A 4GGHA 2JF6A 3M0JA 5AHEA 4DUWA 4FXSA 1K4GA 2W6RA 2RDTA 1JF5A 4PUMA 1RD5A 5I00A 1SW3A 5JH2A 3UFYA 3IJQA 2P5NA 3L23A 3NQMA 2P3ZA 1ONEA 1VFUA 2DUAA 3AWOA 1S3HA 2RFGA 1Q65A 1EUNA 2FB2A 2YCLA 2JEPA 4IX0A 4CCDA 5HANA 4HK5A 4J2MA 3HB9A 2QR6A 4JHMA 4DYKA 4ZQPA 2HZGA 5D02A 4MYAA 4P8VA 4HCLA 2L5HA 4JTDA 1XYZA 3T08A 1DWIM 4OGZA 1I1XA 1IE7C 4KETA 1J2BA 2OVLA 4QS5A 3PWGA 4ZOCA 1MRAA 3GY1A 3A5FA 3T09A 2PP1A 1PCKA 1DL3A 2FPVA 3E96A 3SRKA 3QM3A 1KO0A 5E70A 2PLJA 2D69A 3DX5A 1UP3A 4PTWA 4QDPA 3PULA 3W2KA 2JGYA 1DJZA 3GSMA 2WMKA 1EQCA 1CTNA 1VLWA 4X3ZA 4GI6A 4UR8A 3G0XA 4ZL1A 2QLYA 4Y6GA 2HCVA 4PTVA 3PG9A 3CL7A 1GVQA 3I3EA 4KMQA 1ZY9A 4QNWA 3LDVA 3MVTA 1E6SM 3MKVA 4YNGA 3DEQA 3P2VA 4EWND 3PR2A 4CKQA 4Q8WA 3H21A 3UWUA 4Z1DA 2B0MA 4AD1A 3R0DA 1QRQA 4U2YA 5I24A 3PAOA 4Z2KA 1P1XA 4MAVA 3W7RA 3NGFA 4DJED 5E5CA 1EL3A 3RYSA 3GVVA 4G5DA 3W7CA 4JHOA 3M43A 3ONBA 1UWSA 3AHYA 4HZ8A 1B3ZA 2ZVIA 3KL0A 1Z89A 4FLSA 1SO5A 5T8GA 3VFLA 2Y8VA 4GPNA 3NO1A 5K4XA 4I8DA 2VD9A 2Y7FA 4OBRA 2CLLA 2GL5A 1Q85A 1K9EA 3LQGA 3GTFA 3HGSA 4H9TA 4L7ZA 3AIVA 1OINA 3IJ6A 2HE8A 4AEFA 2ACUA 1DP0A 1FWJC 6PTDA 3MMWA 5K9DA 3NGJA 2OT0A 2Y7DA 2E8YA 2TYSA 4HSHA 3SDOA 3D46A 3EOLA 3CQHA 2QDHA 6XIMA 4WZHA 3TR9A 4C6FA 4L6DA 4AVFA 1TPEA 4BI6A 4NI8A 4HNTA 1GVOA 1I4NA 4GCAA 4UR7A 5IOBA 4BFAA 1VFOA 3C6CA 5F4XA 3VK5A 2GGGA 4J3SA 1RP8A 2VEIA 1PPIA 2YL8A 3R0KA 3G1RA 2CERA 4UUIA 1TFVA 3I7QA 1V0MA 5M1TA 1ITUA 5XIAA 4NAFB 4Q4SA 3P5YA 4RZ5A 1TMLA 3E5PA 4DWDA 4M0XA 4D8ZA 3PZQA 3STPA 3MQTA 5CJNA 5CSYA 2HXTA 4ORMA 2J4GA 4DELA 1DIEA 4W93A 4A8NA 3PSWA 4GXPA 1NU5A 5U4NA 2FZBA 3K13A 3O6AA 3S1UA 4ERIA 3CH0A 3NDYA 2W5FA 3T0CA 4OWGA 5LXEA 2NXGA 5FL0A 4Y90A 4KF1A 1H1ZA 1EZ2A 1BD0A 1OC6A 1M04A 1V6YA 1KGXA 4K36A 2FJKA 2XYLA 4ERGA 2WHJA 1QHOA 3GKAA 4LALA 2AL2A 4HNLA 4CN1A 1OCQA 3KOYA 4PCFA 1XS2A 1YLVA 5DCEA 3CL6A 1WKFA 3UA3A 1QI2A 1WZLA 3H53A 3DN5A 1GZJA 1B0IA 4J4KA 3KVJA 3EWXA 3K1DA 1H7XA 5KZDA 3INPA 1S2AA 3VD5A 4C65A 2NSXA 1KKOA 3QW4B 4LCSA 4W7UA 1JCXA 1YXCA 4KCTA 5FACA 1KBLA 1HKWA 1XISA 3RPDA 1MEIA 3MV11 1JR1A 4EPBC 5AKQA 4GUJA 8XIMA 1Q7QA 1UA3A 2CZEA 2FHCA 3CZLA 3QGKC 4XV0A 3TMLA 3WUBA 2IKGA 4YVPA 4MWAB 4ZB5A 3F4NA 3FYPA 1RPKA 3KZPA 4BEUA 1YPIA 2CWXA 3DYMA 2XIQA 1WYIA 4HNUA 5C9ZA 3NM3A 2J7DA 4DO5A 2A3LA 2IS7A 2B7PA 8RUCA 1TMHA 2OSXA 3B8SA 4RV3A 3QMRA 1XLFA 3JU2A 4TMCA 1J11A 1KM3A 3WF0A 2PWEA 4IUGA 5EMYA 3RGTA 1Q6GA 4WGHA 3G5EA 3VUSA 2VX5A 4S3KA 1FTXA 3TW9A 1ZL1A 1H41A 3EPNA 3SIMA 1DJQA 4AZGA 3GE7A 4GQGA 3G1VA 2VM8A 5A94A 2OYMA 4V27A 2Y63A 1XRSA 1QI0A 2PS2A 1XLCA 2NXHA 1LUCB 5GQBA 4NILA 3UVAA 2OLAA 4GBUA 2OZ8A 3TW6A 2YYUA 4AWTA 2OR2A 4PMJA 5FJIA 3RX2A 2AAMA 1Q2SA 3VOJA 3HBLA 3FIGA 3UZ5A 2O0TA 1FWTA 4AEOA 1G9HA 1YDNA 2PBOA 4QGCA 4DZHA 2E6AA 1E56A 5K4ZA 4YTQA 1C3FA 3ZS4A 1T7LA 1KRAC 1LQ2A 5CH9A 4EPDC 1W3NA 1KFJA 1V3KA 3GW3A 3KTXA 1ISYA 2IQDA 3GHSA 3HG2A 1TB3A 1KM2A 1N55A 1XLJA 4GY1A 4WCJA 5BOOA 1ZPTA 5FF3A 3DERA 4CUCA 4C91A 1MUMA 2X05A 3EXSA 3L7RA 9RUBA 3ZM8A 5D04C 4XBKA 3GH5A 4YTUA 5D9PA 2WHMA 2Y24A 3LMZA 3A23A 1UD2A 2VFEA 2V38A 2DZBA 3OA3A 2Y85A 1H0IA 1VYSX 3W86A 1TR1A 5A8MA 3N4AA 2ZUMA 5J5RA 1NH6A 3RG6A 3P74A 2J7BA 4LTSA 2YLLA 3U2EA 2D0GA 5LZLA 1W1ZA 1GVYA 4Y8FA 2PDPA 3V0UA 2PMQA 2PEVA 1LL6A 3NZGA 5H6HA 5FF0A 3UYCA 2VEMA 3QXBA 4JTKA 1BSLA 1XJBA 3QV8A 3SCSA 4B4FA 2EHHA 1UWIA 2C13A 2CESA 3ANUA 3FX4A 3QR3A 2IKJA 4O28A 2V5CA 2A79A 2DY3A 2OG9A 1B54A 3OA5A 2VR2A 5M03A 5B7ZA 3BE7A 4U2ZA 2Q02A 3AU6A 1RXOB 4TTGA 1A5SA 1R3QA 4WSHA 1EEPA 1TPFA 4R53A 1BG9A 3ITGA 2CZVA 2E9MA 3KVLA 4BQ3A 6TAAA 2PBGA 1IEQA 1VEPA 1QAPA 1MW0A 4UQAA 4I5UA 1K8CA 1U1HA 1HQTA 4WXZA 4S3FA 4ML4A 5HK4A 1FWNA 3UA4A 1E3ZA 2BVDA 3W70A 4OUIA 4E3TA 2ISDA 3WBAA 2R24A 1KA9F 4XZBA 3V35A 2F38A 4DBEA 1C93A 1RSCA 3HPAA 1BTCA 3EZ4A 3ZFHA 4EIVA 5H1WA 4DUOA 1EC7A 1TE6A 1VPXA 4HZ7A 4YJ5A 3GNNA 2HISA 1ZBWA 4HIBA 1XFCA 3KBVA 3UPBA 3WH8A 1XLAA 4HT3A 1CXEA 3EB3A 1WAWA 2UY3A 4G7FA 2JGQA 2EG6A 3VE7A 5ABFB 5EMJA 3QQ0A 2NV1A 1ICPA 3N29A 2W92A 2X7WA 1Q4NX 2A3CA 1H4PA 4YYCA 3BQ6A 2ACSA 1SO3A 1JXJA 2CHOA 2W91A 2WZHA 4LUTB 1Q8JA 5AC6A 2UY2A 5LGXA 4MJMA 1PDYA 4AEEA 3LM3A 4L4LA 1T6MA 4O1EA 3HPFA 1XPGA 5BXSA 3RFAA 4IPPA 1R85A 5KZMA 4IPJA 4XZNX 3I6EA 4RK8A 3KBMA 1E0WA 3QMSA 1JGIA 1ODZA 5AYBA 4ZO8A 4OUEA 1BPLB 1SJDA 4AZ6A 3LA4A 3DHUA 3AS0A 3IRDA 2BY2A 4ZB0A 1FP8A 3AMGA 3TQKA 1EHAA 2UY5A 4UTWA 3SBFA 4V15A 4EACA 4DJDD 3GRIA 3RILA 3T0DA 1JXKA 1BLIA 2HQAA 2Y5EA 4DNHA 5FEZA 4IM4A 5FEWA 1JYXA 3DZ1A 1L2UA 1TE1A 2VNCA 1Q6DA 3CHDA 3LQLA 1OFEA 4PC8A 1G1YA 5BRPA 4JOMA 4OQVA 5GNYA 2XWEA 2YR1A 4DO6A 2GQAA 4LU0A 3QN3A 4CD5A 4XKMA 2G4FA 5A6SA 3W72A 3OG2A 3ZOAA 2ICSA 3P60A 2YCJA 4UTTA 1S5VA 3W7KA 2PLCA 1KFCA 3MANA 4AWSA 4UQCA 1U5HA 3G6MA 4YCOA 1M53A 3QHMA 1XIMA 3GX9A 4IMEA 5G5IA 4Z17A 1GOIA 5FJOA 3W7DA 4AF0B 1OQFA 3EX1A 1ISVA 1P0EA 1B5TA 3USBA 3A9IA 4ZQRA 2YBTA 3MCNA 3WLNA 1HGWA 2DH3A 2F2HA 1LBMA 4X22A 3C8FA 1AJZA 3ICJA 4DF2A 3NOEA 3B05A 4IQEA 1J12A 5KEZA 4DRSA 4XQ6A 1BSIA 1E1EA 2GSEA 3KUMA 2QF8A 2DJXA 3EWUA 1U5JA 1YHTA 4MB3A 3RR1A 2G50A 3QBUA 3RIKA 2UZ9A 4RNIA 4WXYA 4L56A 2WAGA 2W9MA 3CO4A 2XPKA 1X7FA 2WSYA 3DFTA 2GVYA 4V1YA 2HNEA 2AKZA 4N6FA 2PF8A 1WDRA 5HMFA 1SSDA 1VFMA 4AY1A 3OOQA 1R9XA 1CXLA 1RA0A 3UXKA 1XX1A 4N4PA 3OQEA 2TAAA 4J35A 2WMIB 5AC4A 4ZVJA 5A6AA 4K6AA 3WK2A 3CXOA 2BY1A 2V5JA 4X9SA 1XCXA 4F2BA 3FVDA 5KETA 1R3RA 2F8QA 4M51A 5CGTA 2C8NA 2Q01A 2Y61A 3H4GA 1TV8A 1W3JA 1P6BA 5K3VA 3VDBA 3B8UA 2FGLA 3MUXA 2PGFA 3NTYA 1U30A 4GUIA 2R94A 4ZO9A 2PTZA 5CPLA 2QGYA 3C2EA 1ZUAX 2Y8UA 3TH6A 1X6LA 2J8FA 4Q8TA 3RO6A 3K2GA 4IISA 1QPKA 4E3VA 5CJ5A 1UR3M 4MNJA 4CD8A 1B3OA 2Y70A 3MCOA 3UNTA 2VHLA 3NEVA 4OKDA 4RDWA 4LY4A 4QRNA 3ELFA 1GG1A 3KCLA 4JX6A 4H2CA 1HL2A 3QQ1A 3BJTA 1BYDA 3ITXA 2WJZA 2I5GA 1I2RA 3W71A 5HR6A 3M16A 5E09A 3UXDA 4I8YA 3V3WA 3BO9A 2YBVA 4MUPA 3A21A 3L5AA 3LI0A 3RRXA 1G69A 4GJJA 5GNZA 2WMHA 4ZSUA 3U7VA 1ZBKA 1F61A 3OLEA 2OKOA 1KRCC 1GVIA 1D3HA 2Y2WA 4I5XA 1K8ZA 3CAKA 4IZGA 5HXMA 4I9TA 4GISA 4EOUA 2WQPA 2ZE3A 1WP6A 1KBKA 5I3HA 2OKTA 3CZKA 4DWSC 1ITQA 4CNSA 3PPFA 5ABTA 3FGCB 5TIMA 4HCDA 1AZ2A 2V30A 4ZEPA 1ECQA 4A21A 1CXFA 2VRKA 4IFRA 3CMGA 1O4UA 5REQB 4GJIA 3TYAA 2ZXBA 4PUKA 1AW5A 1JPKA 1VPQA 4PUNA 4DBDA 2LLEA 3CZ8A 1NQKA 4C6OA 1EP2A 5CG7A 1OK4A 5FAJA 4Q32A 4H4IA 3VOFA 5CGQA 1VBGA 5E9XA 3OLIA 4C7GA 1KCLA 2AAAA 4LGXA 3CTLA 4J40A 1THFD 4WSJA 4DY1A 3GIPA 2H9AB 3CLMA 4JICA 1R9ZA 3JUGA 4KW2A 5GJMA 3TQVA 1R5YA 3WLKX 3H2MA 3LRKA 3B0PA 3A4XA 1NJJA 3ATYA 3C2FA 5D05A 1HW6A 2W61A 1AVAA 3LHTA 5M17A 2XVPA 1C91A 1RY8A 2V5KA 2WC7A 1IZKA 4DN1A 1H7RA 4BQ4A 3P84A 3WNKA 2O7QA 3VKBA 3NOYA 3FA3A 2NV2A 4U3AA 2QNEA 5CSSA 3MI2A 1WDQA 4J5NA 4NL1A 2RAGA 3IJLA 4O11A 3ITCA 1SFLA 1BYCA 4S2BA 3MSGA 1BXCA 3OPSA 3R8GA 5CC3A 4D1JA 3DFYA 4QP0A 4IL2A 4UZUA 5HQLA 5M3WA 4Z2GA 1Q4WA 1QPQA 5LA2A 1TRDA 3W00A 2E0PA 2YA1A 3NQEA 3MO4A 1XIDA 3TZFA 4DXXA 1OADA 5DMYA 2F6XA 4JQ2A 4HOZA 4UFMA 3ES7A 3T55A 3WIJA 4A22A 3ZWSA 2WM1A 2OX1A 4IQJA 1GW9A 5RUBA 3M6YA 5I3KA 5T26A 3GZ3A 3GLCA 5MHBA 3CQIA 4KIRA 2H90A 1KLZA 3ZLHA 1UR8A 3C5QA 3MSDA 1CBGA 3NQ8A 1I8JA 3W1XA 2ZDSA 4B3KA 1O5KA 1JZ4A 3RCMA 2ZRZA 5EB8A 3CQ0A 4BJHA 4UIOA 2VVSA 1CNVA 3WLLA 2OZ0A 3BLEA 3COTA 1PTAA 2GVLA 4N4QA 3N4EA 2GJXA 2BG5A 7TAAA 3V5CA 3TFXA 4O17A 4NYYA 1E15A 1IHIA 3IACA 4JYEA 2XIOA 3IIXA 2DSZA 2Z1VA 3GH4A 2PDWA 4PULA 3TAKA 4LJ3A 1T8XA 1IYXA 3IIZA 3U48A 4P7QA 1WBHA 2H3DA 2VC9A 1ML1A 2D23A 1R86A 4PGLA 5E6ZA 4NAEB 4PL1A 1WQ5A 5FF2A 2W67A 3T05A 4F9DA 3TKFA 3HZ3A 4M24A 1P0NA 1HTIA 4H7VA 3WJXA 5DXXA 4XK2A 1KB3A 1IF2A 5LIUX 3KS6A 3IJDA 2YDAA 3GWQA 2J7CA 2QV4A 4MZ8A 1ZJBA 3Q58A 1E9LA 2WM0A 2BMBA 5DRIA 3MT1A 3R58A 3ES8A 1XD1A 4URIA 3C61A 4GABA 3IVTA 3BJSA 3D5HA 2FH8A 3C8NA 4RLIA 1O1ZA 3VDHA 4XX6A 1KCKA 3P62A 2A85A 1XD0A 4DAFA 4PMNA 2O9TA 1OG6A 3SJNA 4MKSA 2C7FA 4KESA 3P67A 3V0TA 1VGAA 4D1IA 4E8CA 1XL9A 4X9YA 1WKEA 1W1TA 3CGTA 4ZOAA 1E6PA 3CQJA 3AIWA 1US2A 3LTYA 3WH7A 2OYKA 4HTBA 4ZQMA 2WPBA 2PD9A 2ZUNA 1AJ0A 1TPVA 2OGYA 3NQAA 2JIEA 3WQ4A 2O9RA 1GYLA 2YXGA 3RO8A 2RH9A 1SW7A 2EEXA 2QCMA 2D22A 2VDGA 1M7JA 1UHVA 4IP5A 4TVUA 1OD8A 2FFIA 3NM1A 2PLKA 2ABBA 4NU7A 3KWSA 4FIQA 3H2AA 3BW4A 4HMDA 3AYVA 1OZMA 3RMJA 4A3HA 2GQ3A 5D9OA 2CLFA 4TV6A 1OFBA 3TA9A 2PTXA 1CIUA 3UR5A 2E5CA 3KBNA 1EOMA 3ECQA 1VHCA 2WSKA 4J3UA 1VBRA 1BTMA 2YL6A 4AZ5A 3M64A 5DN1A 1SPQA 2YCIX 3CPUA 1LF1A 1TJRA 2ZRYA 4OFCA 2JKPA 4H9VA 3FN9A 1QO5A 3EDFA 1GVRA 1XIGA 3VXGA 1Q3NA 4DYEA 1A5LC 1LUCA 4LB3A 2DIEA 1XG4A 3DGBA 4HU0A 1A50A 1E6RA 4NZJA 5FF4A 4O4WA 3LPOA 4JEJA 2EJ1A 3DECA 4V2XA 3AALA 4KRZA 4GA8A 2ZZ2A 1ITXA 3LUTA 5CAHA 3GDRA 1FH7A 4ZR8A 1GHRA 3BW3A 1VCFA 4GC4A 3A13A 5EU9A 3VIFA 2J75A 1ISZA 3HOJA 5H8UA 1AD1A 2EKGA 3TTOA 1CGVA 4OOZA 2Z24A 2VGIA 2W63A 5BOEA 2XH4A 4L9XA 1VCGA 4I5RA 5CPMA 1FH8A 2NQ9A 1X8FA 2CHRA 4ACZA 2ZC8A 2PP0A 4UQ9A 2DGAA 1NDWA 3LZ5A 3MV01 1GQKA 4PTNA 1R47A 4LB4A 1TVNA 1ZJHA 1PS9A 4C6JA 3PZTA 3MSRA 1W31A 3GTIA 1XLDA 2ZRWA 1KQZA 1BGAA 2OODA 4HKPA 2W79A 1JDCA 2E40A 3S6OA 4L6HA 3LM7A 1TZZA 3NSMA 4L5ZA 1X96A 4DM2A 3BSHA 4D6EA 3B9AA 3QGVA 5I77A 4WEVX 3QPZA 1EUAA 3VC6A 3MBFA 4UWMA 2VFDA 4KRTA 5CLWA 3DAQA 4K8GA 4WY0B 4KGLA 3IUIA 3W37A 4H19A 2DSKA 1MNZA 3MUAA 4B15A 2BOEX 3UCCA 1W2PA 3UGRA 2GVEA 5I7GA 5PTDA 2OX4A 2CBVA 1JG9A 3MMDA 4UB9A 3QH2A 1XLHA 4QJ4B 3PB0A 1E0TA 3QV9A 5IHSA 4QHRA 3TC3A 2ZXDA 1DE5A 4HMNA 4MLJA 1W54A 3GYCA 1VZWA 3LY0A 1UKQA 1HP5A 2XZ9A 4JN8A 3AHVA 3E02A 1NM9A 3FKRA 4UZSA 4AQLA 4PUEA 3CL8A 2A3EA 3KW3A 3LHYA 2ZVRA 3UD6A 3REQA 4DJFC 3CHCA 1QW9A 1TYGA 3DG6A 1UJPA 1HKMA 3H26A 1ALDA 1KM0A 4H6RA 3B0UX 3AAMA 3EOSA 3T42A 4EF8A 3F4DA 4H3DA 3UGVA 3IAPA 3BJFA 1T5AA 2WJEA 3EEGA 2OWXA 2YDSA 2QJIA 1PIIA 2PGEA 3BOLA 3GG0A 4W8LA 3M44A 1GOKA 1DJYA 4O54A 2X1UA 3AO0A 1UC4A 3QPYA 1KLYA 4EXAA 2B81A 2X40A 2C6QA 3IUHA 1JI1A 4WSKA 2ATMA 4DYJA 5C7VA 5LKYA 1UP0A 1GKRA 5BRBA 1MZRA 1KGUA 3LSBA 3H8AA 4OV4A 5DCDA 2H6RA 1U5VA 3PTKA 4M6UA 2BOGX 1QNRA 2W4XA 2OEJA 3WMLA 4ZOBA 4BKNA 3L4WA 3CHEA 1ZHAA 3W29A 4KQNA 3NL5A 4L61A 2VURA 4LUTA 4MAZA 1LG2A 3M4HA 4I3GA 4XISA 1R46A 1KFBA 3SY1A 2ZE0A 4KFOA 1GPFA 2JFEX 1MDLA 2XINA 2HJPA 3AS1A 4RR4A 1EC8A 3FOKA 2OLHA 3M41A 4YPJA 1FFRA 1FKWA 2O9OA 1BWLA 3TCSA 4A35A 3LB0A 4UMBA 4K8HA 4BQ2A 3R7MA 2CLEA 4QTGA 4F0SA 4QDMA 1N7KA 3K1GA 4FNRA 2PDCA 3GB6A 4X61A 2ZX8A 4GC3A 1QPRA 1E6NA 2XDFA 3G1AA 3GFYA 3N1AA 1EJRC 5TQLA 4ZXLA 3L0KA 1AQ0A 6A3HA 1QNSA 1F6YA 4EXQA 1NOUA 2PGWA 2QJMA 4OE7A 1R7AA 3TCEA 4GKLA 2ZXAA 3VOHA 1GVEA 4MWAD 4PCNA 4TVCA 2PDMA 5M5DA 3R2GA 3HFYA 3P93A 4IMDA 2BFGA 2F6UA 1ZU8A 3SB0A 1GHSA 3OBAA 1EF2A 2GQ8A 4WQ6A 4Z1CA 1V3LA 5LNSA 1RVKA 5JVLA 5AC7A 4L1GA 3LCFA 3L12A 2R6OA 1EH9A 3W76A 3TX9A 3E0VA 5I07A 2RJHA 1SR9A 4ECLA 4FB7A 5E6YA 3N2BA 1XC6A 3A24A 1JCLA 4W85A 3DH7A 4Q8QA 3PK7A 1HJXA 3PF3A 3URNA 1JQVA 3JVAA 3SQLA 2E4TA 3HF3A 1W37A 1S5NA 2BVYA 1DJIA 4ZOEA 5CC7A 3CB3A 3M1ZA 2I1OA 4F3HA 3LNPA 4HNVA 3UR2A 1FH9A 4MM1A 3VOCA 4XIMA 4UFKA 3N15A 4WIWA 3MKCA 3UPMA 3EOOA 4J1OA 4HN8A 4CEUC 1I0DA 4JTCA 3GH7A 1AG1O 4CD4A 3K4WA 2C0HA 2A3HA 4N9EA 2GZXA 2XG9A 1ME7A 4C1NB 4PCPA 3LCGA 3AJXA 4AC7C 3SW6A 4UTFA 1OFOA 3A5VA 4G7EB 2HMCA 4D6DA 4JY9A 4LS0A 4QCEA 3H2OA 2XFFA 1KBBA 4YXGA 1QPOA 5K9CA 3WO8A 1QOXA 2OGJA 2EJAA 3XISA 5IXEA 3QZAA 4O13A 4IOTA 2CZ5A 3QFWA 1PEZA 3ID7A 2WMJA 1PKYA 1FHVA 4UOJA 5A6TC 3R89A 1IQ8A 1OGBA 1UBPC 2WCAA 2TSYA 3F4VA 2ZUTA 4MLRA 3TQ0A 4FS9A 4C6DA 3UQNA 4NY2A 4RV8A 4B2DD 4N0RA 3SEPA 1OYCA 1YNPA 3UJSA 4G2DA 3N14A 1BXNA 1NOWA 2CLMA 4HOXA 2V0TA 3AHTA 1I60A 4WOZA 1NF0A 3H23A 1MUWA 1XLGA 4P61A 1UR4A 1W3KA 1ONXA 3LCHA 1A49A 4AZCA 3GXNA 3WEMA 4E4PA 4L1WA 4JQAA 3JW7A 5F7UA 3GG8A 5BXPA 1W9UA 4IT1A 3GAKA 3CAWA 4IJCA 1A5OC 1Y5WA 4PEEA 5EYWA 3F03K 3FJLA 1VJSA 2IPGA 4XO6A 4B90A 2G3NA 2WBKA 3L68A 4RE3A 1B30A 1HZYA 2ZCGA 3EB2A 4QEHA 3BAJA 2WKLA 1QK0A 4JTQA 2Y0FA 4X0NA 3T81A 4LAMA 2VEKA 5D2WA 1LRTA 1A5UA 3NA8A 3RPTA 3LMYA 4GO8A 3W7NA 2IKHA 1CW2A 1RCOB 2BASA 3C3NA 3SQSA 3AISA 4FXRA 2CLHA 4TIMA 2PCEA 1QNQA 1XYBA 2RUSA 2EPLX 1FCVA 1GGOA 2QUVA 3P8JA 1RV8A 3WMSA 5DEZA 4Y9OA 3D3AA 2NV9A 1G6CA 1IXPA 3NPWA 1UOZA 5H8PA 3SCOA 3KBJA 3LZ3A 2ESCA 2HV5A 3R94A 3FJ6A 3N6JA 1W9VA 4ZENA 2IW0A 4GACA 2VQTA 2J79A 2XJ7A 3G2GA 2DW7A 1ZTVA 2PDHA 3JR2A 2PRHA 2XFRA 4O50A 2HXUA 1S1RA 2D20A 4Q4RA 5CBJA 3S2LA 4PZVA 3ITVA 4Y9MA 3A4WA 1XF0A 3WF2A 1W1PA 4O14A 4KT2A 2OSYA 1I1WA 3BUVA 3E2VA 1JPMA 3TSMA 3QVQA 4Q4QA 1MEHA 2FTPA 3MSYA 1JD9A 3WENA 5LHEA 1JDFA 2GFTA 2Y4SA 5C2GA 3T9PA 2FFCA 1VRDA 2ISWA 5HDRA 1UWUA 3G1SA 4Q8NA 1VS1A 2ISSA 3G18A 3WBEA 3ZLFA 4E8DA 2OB3A 3BLOA 3EPOA 3B06A 3F1QA 3FCPA 1FWRA 3BG5A 2OO6A 3KP1A 1KXVA 1GJUA 1TKKA 1CZ1A 2FPYA 1LOSA 3CT2A 3IIOA 1Z44A 5C9UA 4GO9A 4XD4A 3W53A 3WK0A 2PDIA 3L2MA 3RX3A 1EO5A 5DBUA 4QSFA 1WNOA 3TWBA 4C6IA 4L1XA 5AC5A 3E74A 1T40A 3GDLA 2WC4A 2A6NA 4F0HA 3FAWA 2E25A 4HHPA 1XYCA 1K77A 5CBBA 3L2LA 1SZEA 2V67A 1F6KA 3FVMA 1ZBCA 3VZXA 4CD6A 1VLIA 3S46A 3PJUA 4QCFA 1WPCA 4FXJA 1F76A 3MW7A 4M1BA 4WLCA 1R2TA 1UW9A 2DZTA 2PRMA 4PBFA 3WLMA 2BZNA 4KH2A 1WUEA 5K7JA 1TA3A 4F0MA 1EXBA 4L80A 3BLPX 1XRVA 4Q4KA 1DQWA 1OT1A 2EG8A 1ONRA 2VOTA 3WLRA 4DUVA 3XINA 3CUFA 3TXZA 4NASA 1W5MA 3DC0A 4Q4MA 4C6QA 2IPJA 4GXWA 2BLEA 1H3GA 3SSZA 1Q8AA 4A8RA 1OVDA 1PBGA 3XIMA 1EDTA 4EP8C 1OFRA 2WANA 4DEFA 1YE6A 1PKMA 4TUFA 4F0KA 3HV8A 1TWIA 1V3MA 3GU2A 1W9BM 3LCXA 4FALA 4WGXA 4BI5A 2XHYA 2DH2A 4MY1A 3W2UA 4UCGA 4LUJA 4ZXOA 4JTTA 2Z2UA 4H6EA 4HQVA 2Y7EA 1QU4A 1GKPA 2INEA 3KX6A 5HINA 3F4WA 1JUBA 3C86A 4EX4A 2BOFX 2QCGA 4DB7A 3WCZA 1P6WA 4D71A 3B97A 2PU0A 2HBVA 2BS9A 3K8LA 1QI3A 4Y8EA 5U7SA 3WELA 2PWFA 1FFQA 3WN6A 1UIPA 4NSBA 1IR1A 1CGUA 3MJYA 1TCDA 5BYWA 2C0AA 2PDFA 1E0UA 3TYEA 1F3EA 3G1YA 3PBMA 5A6BA 3CUXA 4UQBA 3GTXA 3UY7A 2HPIA 5CKSA 1WZKA 3WG6A 2CITA 4ZSTA 3V16A 1PZ0A 3GFXA 4GUHA 2GGHA 3RLVA 1DBTA 1E3XA 2ZUWA 2PU1A 1DV7A 1S1PA 3MHFA 4NJIA 1O12A 3F5KA 3HV9A 2XN0A 3EA2A 2E8ZA 1JCNA 1I9CB 4HU3A 2HK0A 4TU1A 1WA3A 1KBJA 3CAQA 2PRLA 4WY0F 3HPXA 3C0SA 2FH6A 3GAYA 4HNOA 1XLLA 5A8NA 2WMFA 1H09A 1PKLA 3IIVA 3PAJA 1SJCA 5AHNA 4PRRA 3W1MA 6REQB 4HHMA 1UD6A 1YTKA 3N4FA 5I79A 3CO8A 5CAKA 3LXBA 2Y89A 4XWUA 3NVTA 4JL1A 1F73A 3PUGA 1QVBA 1U1UA 3W1PA 3T0TA 4M6VA 4IIHA 1OBAA 2ZRVA 3VNMA 3VUPA 1H7PA 5HATA 2J47A 4UC5A 1P43A 1QWGA 1A47A 4HPJA 3L4UA 2J6XA 4IMCA 2GJRA 3OP2A 2VCAA 4O18A 2CCRA 4UFLA 3UU0A 3AROA 4ACYA 2O4MA 5MKGB 5AHMA 3GC5A 4MTVA 3WD0A 5CCZA 2BX7A 3M0KA 1B3XA 1HXJA 3U6WA 3Q45A 3AU2A 3TN3A 1L6GA 3P3BA 4PTMA 3TNBA 3PPGA 1KQYA 1UIOA 3VGEA 1J01A 4E2VA 1SGJA 1MMFA 4RDYA 1EPXA 1G7VA 5D2TA 1TTJA 3B8VA 4AMCA 1QBBA 4C6KA 2OO0A 5HJYA 3WLQA 5AYZA 4M6QA 4D8LA 1J6OA 3LGGA 4JQ3A 2R91A 3S6TA 1J4EA 4LVBA 3THUA 2FKPA 1XGZA 3I3DA 1TJPA 3C0LA 5D03A 5D2VA 1RALA 4YL2A 4QLLA 1F2JA 3QC3A 3V5OA 3U2ZA 1Y5VA 1PE1A 1V6UA 2Z7KA 2ONEA 3VABA 1CCWB 5ECVA 2MNRA 1K1DA 3SQMA 2C16A 2XFYA 5D32A 2FGBA 5AVHA 4UNKA 3NL6A 1NTHA 1OGGA 4PUWA 3IV8A 5FF7A 4WY0A 3ZT7A 2EGZA 3UNDA 1S2WA 3GQYA 1QI5A 5I3DA 5KZEA 1NWTA 4CGTA 2HTMA 4MSSA 3FAXA 4A3RA 3H2EA 1P7TB 3H6OA 1K4HA 1HN1A 2VX7A 3VOGA 5IBXA 3LPFA 3O8AA 1OK6A 3HG4A 4AZHA 1MW2A 1REQB 5A3HA 4Q4OA 1LT8A 4U33A 3UERA 5BXTA 1A5MC 1JAEA 4N9CA 1W5QA 1AUSL 1HO1A 5C9WA 2WQDA 4GIAA 4IPIA 1ZB5A 1JFHA 2QGHA 1V03A 3WSUA 1EGVA 1A0CA 2CZDA 3TK7A 2I9EA 3ABOA 2WO5A 3SUVA 1OIFA 4Q3MA 1IEVA 3VGBA 1K9TA 1J93A 2J27A 3RLHA 4LWWA 1VBJA 3UWVA 3ZJKA 1US3A 4GX8A 1V51A 3SUSA 1SQ7A 2YW3A 4HJWA 1VFTA 3LRLA 3WK1A 2IQ0A 1OCNA 1TUFA 3BMVA 3IK4A 2IQTA 5T91A 3I4EA 5EY5A 5KMYA 2O7SA 3JZUA 3UEQA 3NURA 3DENA 4LAOA 3G8RA 4FLOA 3TLLA 3NQ6A 1XP3A 1WKYA 4UOQA 3G0SA 3M0IA 4Y9NA 4F40A 1M3UA 3AHXA 4PBGA 2VENA 1VBHA 4XZ9A 2D3NA 1Z6KA 1RLCL 3A4AA 5E9AA 3VIPA 4JXCA 1DXIA 2F2KA 4YN5A 2DSVA 5C71A 4AIUA 2VEPA 4E2OA 4RDVA 3OHMB 1VFFA 3WQEA 2YFNA 3FLUA 2OEKA 5TAOA 4GYPA 4A2RA 3RITA 2V81A 1YRRA 3FXYA 3FKKA 2A5HA 3AMCA 1LZOA 2V3GA 5CSRA 3IV3A 3PZGA 5A69A 4TOQA 3C2OA 4QQUA 1OX6A 4JTJA 2PUZA 4J9JA 1E6ZA 1Y0EA 3PTQA 3CIXA 1VYRA 4ADSA 5HMSA 4J2PA 1QMLA 4MFEA 3U4FA 5C55A 1W8GA 1DWAM 4WJXA 1GQIA 2QJJA 1CXHA 4F2TA 3SCVA 4US6A 1DVJA 2F9RA 3NQFA 1PB0A 1CECA 2A2IA 3NPVA 3NQGA 3GD6A 3TJIA 4C6PA 1R3TA 2VZUA 3W6YA 3R12A 1S2VA 2VUYA 2Y5JA 2V69A 4GFSA 1I75A 4RXGA 2DZSA 3DHFA 4BF9A 3KDNA 2Z4GA 4JTRA 5JIWA 3KOXA 4O1DA 2Z7GA 2Z2AA 1PXGA 4JTLA 4WKFA 1HL8A 1IV8A 1MSSA 1YTDA 3GR7A 1XCFA 1J9YA 1BYAA 1A5AA 1XBVA 1E6QM 3QF0A 4LVGA 3RLUA 1FXPA 3OYXA 1UOKA 3SGGA 1IT7A 3OZPA 4OTKA 1Q5MA 3UY8A 4DLMA 3MO7A 2WZEA 3TOPA 2EPMX 4EPEC 1Z9AA 2AMGA 2NLIA 1FWCC 1FDZA 4NJGA 4LY8A 5FCZA 1J6PA 1XIJA 3EKGA 3GR4A 1ZS2A 4KEVA 2RDXA 4RCXA 3E0LA 2AQVA 4I9AA 1KFKA 2DQWA 3BC9A 4HZ6A 3WNNA 5KTLA 1B90A 4C6NA 5EBAA 4K8EA 3WF4A 2NX9A 3VMNA 4GGBA 1E1FA 5ABGA 4FNPA 3RDKA 2OCZA 1ZQ5A 3WQVA 4AMAA 3ZZ1A 1H0GA 3WFLA 1RPXA 2CWNA 1RBOB 3S5NA 2NUYA 4FX8A 4DVOA 1S2UA 2ASHA 3SCPA 1G94A 1ZLPA 4G7EA 4DJEA 1VQTA 4GYFA 1K7FA 5I09A 4D8AA 5B80A 3W1AA 3DYOA 4QX4A 3VD4A 3NO3A 5FEPA 3DGRA 2XN1A 1PWLA 5FJUA 3KOZA 4PR4A 2H8ZA 3BLFA 3T2QA 5IHRA 2X1SA 1JPIA 1AZ1A 3NYZA 4S3AA 1Q6QA 3AICA 1VIWA 4ZCWA 2BSLA 2ISVA 1Z7AA 1KV5A 3E3HA 1C8VA 4LBRA 1WOBA 4XKYB 1NF7A 3GXFA 3HPSA 3UG4A 4ASTA 4XD5A 3TV8A 1UUQA 3W22A 1N8IA 2AKMA 4UOZA 5EKYA 1ELSA 2P0IA 3VX1A 4MF4A 2FTYA 5CPQA 2E7FA 3L2IA 4J3TA 1MYRA 4UMCA 4O1BA 4JFSA 3GXMA 1B3WA 2GUYA 2WOQA 5AHIA 3EA1A 4ZQOA 3GVGA 1T96A 2E28A 2OFJA 3B3DA 1MWOA 4MY9A 1EA0A 1J96A 3NL2A 1TO3A 3BDKA 4NIRA 2WMGA 1J0YA 4R33A 1NQ6A 3A3WA 1NWSA 1WBJA 2OTDA 3W0KA 4KEUA 3GDBA 3KLKA 2HE5A 3NG3A 1V02E 3IANA 1ZZMA 4JYFA 1LP6A 5DF0A 3TYZA 1JCTA 3BAXA 3N6QA 1NARA 2RGLA 3VDCA 3C0QA 3GW0A 1XYMA 1L6YA 2A21A 3NQ7A 1M41A 4CQ9A 5HWMA 3W23A 4RXFA 1XIEA 1JDEA 1RJRA 3H2FA 3IGXA 3WQ6A 3WBXA 5ENLA 4PMRA 4HN4A 5IRPA 3ISIX 1V4YA 1NDVA 5D9NA 1UZ4A 4J27A 1GORA 1PJ9A 1UROA 1VKFA 1EXPA 1B3VA 3W6LA 1CLKA 3BOFA 2OT1A 4NI3A 3MVIA 4HA1A 1BXBA 2YIHA 3F7JA 2P88A 1S5MA 1LT7A 5HAOA 1KFEA 3LCIA 2E67A 3YPIA 3TOYA 4PYSA 1K7EA 5AHLA 3IUDA 4JFUA 5TD4A 3VKDA 1GZ1A 2HK1A 1J8VA 1OYBA 1CGTA 4US5A 3ZVHB 2QPSA 7ENLA 1XLBA 1JCMP 5BCAA 1TPWA 3W07A 1YPXA 2P76A 3VFCA 1JNDA 4XD3A 4GNKB 4GFIA 5D30A 4AY7A 5JH1A 3HURA 1R7OA 3AXXA 2NQLA 1D3CA 3E49A 3QRHA 3LK6A 2CIPA 4XAFA 3AMKA 3T8LA 3W83A 4DUXA 2WWCA 4YCPA 1RLDA 3OQ8A 1W2VA 5TF0A 1BVNP 1W1IE 4JN6A 4RW3A 2XSAA 3O1NA 4L4PA 1TV4A 3CJPA 2FZ9A 1YIXA 4W4QA 1TJ0A 1PTDA 3EKLA 4WF7A 3POCA 4MWAE 2YGYA 3CUGA 2G3MA 3R8RA 1DJHA 3WNLA 1Q45A 1XQLA 3T8QA 1LWHA 2NZLA 4S38A 3M47A 1XFBA 2Q71A 5F4WA 5AYIA 1HP4A 2NWSA 5GPRA 3C2YA 5I23A 4ATDA 4ALDA 4O0QA 3ERPA 4IGMA 4HPHA 4KBXA 2GVGA 3W1LA 3ARZA 4ORIA 3QJAA 5CSUA 2YZ5A 1DQXA 2F6KA 1RCXB 3GTHA 3UVIA 4CCEA 1G4SA 1V6TA 4I7VA 1OJXA 2VEGA 1SVDA 1OM0A 1F05A 3E0FA 3M5VA 5KITA 2ZX9A 2PURA 4DHGA 5KZ6A 1EKOA 2NSOA 5I5RA 3W1UA 2P8BA 3WLTA 1H1NA 4K3ZA 4IFKB 3S4TA 4O52A 5AC8A 1YBQA 1EBHA 1QUMA 1V7AA 4PL2A 5EFFA 1ODUA 3H12A 2PI6A 5C7HA 5HNTA 1OF6A 3BAKA 4MG4A 1NY1A 2EQDA 3N2XA 2CBJA 4WD0A 3VAVA 2G95A 3W6MA 1YDVA 2Q09A 1HJVA 3A9BA 4RZ6A 1Q6OA 3RCYA 4E2DA 4DWSD 4GXMA 2ZYFA 1VEMA 3S2NA 3AYTA 1VH7A 3P82A 4GZ7A 2YCEA 1ZALA 4RZ4A 4UTWC 1P48A 3WD4A 1B3YA 1IXQA 3VIMA 4WDXA 2VXNA 2X1IA 3BICA 3BLLA 3NWRA 4OIFA 2PWGA 2E1DA 3VTRA 3ITLA 1FWDC 3N9KA 1IXNA 4CVUA 2QHAA 4AYGA 2X30A 1XH1A 4XZLX 3VKJA 4F79A 1SU5A 1XH2A 1DJXA 2EKCA 5JUVA 5A2CA 3WBWA 2PC8A 3NCOA 3THCA 1IZCA 1RZMA 3VMOA 1WE5A 4NP7A 3LI1A 1KTBA 2WKGA 3CV6A 1EB3A 2G3FA 1MQPA 4UTTC 4DF0A 3DFHA 4GUGA 1C9WA 4A29A 3UF9A 3IS4A 5G1TA 3AXKA 1XXXA 4LF2A 1WDPA 4H8VA 1E73M 4YLWA 3PTDA 1OCBA 3AXHA 1CEOA 5IM51 2V5BA 1XIHA 3GDMA 3WLJA 3PUEA 4OV9A 5HUOA 1EWEA 3B04A 3GHTA 2ZXQA 1EEXA 3T0BA 2GSJA 2VO5A 1A4MA 4CNTA 4PEKA 1OFDA 3TSBA 1TVPA 1M68A 2H3BA 3MMTA 5FL1A 5T9BG 3O05A 1BWKA 4B9ZA 4C6EA 1KM1A 1MW3A 3QW3A 1WUFA 2NT0A 2GDQA 3SR7A 2DU2A 1W3HA 3GKFA 1ME9A 4OU1A 3TLQA 1E4IA 2YL5A 2GQ9A 2ZA3A 2WC3A 3H7RA 5MKGA 4ML9A 2YCLB 2C3ZA 3DKLA 1FUYA 3TWAA 2FJUB 2I17A 1XLEA 2PDXA 3VNDA 1UMYA 3B9NA 3RAOA 2DSUA 3CYJA 3O07A 1RQHA 4FO4A 3I4KA 1PCWA 1W5NA 1A0EA 4KPLA 3DFSA 1XGDA 3LHVA 3SZ8A 4H6QA 3SM0A 2R9RA 4IPNB 1WV2A 1A5NC 4GNJA 2TODA 5LIYX 3MDWA 1DOSA 2V2DA 2W27A 1GT8A 5XINA 4NZFA 4L9ZA 3VIKA 4GX9A 3DCPA 2IXUA 3W28A 3SECA 4GY7A 2WNNA 2V3FA 2BGQA 4GOAA 3WNPA 1HVQA 3SUUA 3TTSA 4YTTA 3VDAA 4ZQCA 2Z28A 4JGDA 4Z2IA 4A2SA 1OX4A 5DMMA 4KEMA 2CBIA 2FGZA 1U22A 3DESA 3CNYA 3TU9A 5SWUA 4ATWA 2HPMA 4DJDA 3CU2A 3EBVA 2J62A 1UH4A 3U3HA 5I03A 1GOQA 2MANA 5B7YA 2DPEA 4BCEA 1G0CA 1ECEA 1GK8A 2POZA 1YNYA 4GE8A 4M5PA 3VMPA 3HTWA 1JAKA 1POJA 2WW5A 2REQA 4YMZA 1YE4A 1SO6A 3PM6A 4FOKA 4PMDA 3VC5A 3V1PA 3SCQA 1R2SA 1H11A 4HK6A 3WH5A 3NVDA 2VGBA 1L9WA 1L2QA 4H9MA 3OBKA 4HPXA 1MQRA 3WYZA 1ENUA 1ISXA 1BKHA 1UR2A 1P7TA 4AAJA 4AX6A 1C8YA 3EWCA 1CB7B 4HU4A 4HHHA 1W1YA 2PDYA 4PCSA 1REQA 3S9ZA 3GM8A 3MUCA 2ODOA 7PTDA 4PUDA 1IIGA 4OT7A 4HSOA 1QOPA 1EZWA 3L67A 2VL4A 1NFPA 1W8SA 1K6WA 4D6JA 1LOQA 3M0MA 2YKKA 4QJ1A 4XSLA 2D2JA 1F07A 4ZE5A 3A6OA 3UZYA 5JMUA 4LYKA 3UWYA 4LC6A 1HG3A 2HWGA 1DWGM 3MKKA 4Q7BA 4R5EA 1TREA 3WBYA 2NX3A 3PUDA 4XZMX 4IH3A 4QQ3A 5C2XA 3IJ8A 4RJEA 2J8GA 1XRFA 3MMUA 2F7FA 1JZ7A 3WQWA 4PMVA 3LXCA 4TV5A 2BV9A 3H2CA 1EC9A 2QMKA 3S0CA 4H8HA 4Y7EA 3WEZA 3MI3A 4ICMA 4ES4A 1X38A 2J9YA 2YXOA 2XIIA 5FA5A 2QJNA 3N04A 1LDCA 2GJLA 4TX8A 5LIWX 4EF9A 1HT6A 2ZWYA 4RNFA 4MNMA 2XISA 1B4KA 1UUOA 2DJLA 5F1UA 4CVWA 3KL3A 4V28A 3BGAA 3WF1A 3GFZA 3M0VA 1F4AA 2QEZA 3WFAA 2G0WA 3LCWA 1WZMA 1DTNA 3IIPA 1KGWA 1JL8A 1TZ9A 3WZ0E 3QOMA 1KTNA 3FNDA 1UJQA 5C9RA 1TJ2A 4Z42C 3TROA 4F9JA 2VX6A 1L6SA 2I16A 2A7PA 4IIEA 1JQXA 1FOBA 4UXDA 3CB8A 1X6NA 1MXSA 4I9JA 4P2VA 3ZJ8A 2INFA 1WOAA 1KNWA 1W1VA 1A0DA 4MPKA 3BCDA 1S46A 2G41A 3QPEA 1W3TA 4M6PA 1SW0A 4Z08A 1M7OA 4GINA 4PMOA 4CNOA 4LT9A 1KV8A 1FX6A 1Q6RA 3GU1A 4JQ1A 2VWSA