2NQJA

Crystal structure of escherichia coli endonuclease iv (endo iv) e261q mutant bound to damaged dna
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
279
structure length
279
Chain Sequence
MKYIGAHVSAAGGLANAAIRAAEIDATAFALFTKNQRQWRAAPLTTQTIDEFKAACEKYHYTSAQILPHDSYLINLGHPVTEALEKSRDAFIDEMQRCEQLGLSLLNFHPGSHLMQISEEDCLARIAESINIALDKTQGVTAVIENTAGQGSNLGFKFEHLAAIIDGVEDKSRVGVCIDTCHAFAAGYDLRTPAECEKTFADFARTVGFKYLRGMHLNDAKSTFGSRVDRHHSLGEGNIGHDAFRWIMQDDRFDGIPLILQTINPDIWAEEIAWLKAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA apurinic-apyrimidinic site binding and excision by endonuclease IV.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords 5'-D(*GP*CP*GP*TP*CP*CP*(3DR)P*CP*GP*AP*CP*GP*AP*CP*G)-3'
total genus 105
structure length 279
sequence length 279
chains with identical sequence B
ec nomenclature ec 3.1.21.2: Deoxyribonuclease IV.
pdb deposition date 2006-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 2nqjA00
4QDWA 3VNMA 4GLEA 3AAMA 5B7YA 5XIMA 4K1GA 4K3ZA 3M0MA 3LMZA 2X7VA 1XLIA 3C0QA 3C0SA 1XLBA 3ITLA 4QE5A 5XIAA 3DX5A 4A8NA 1XLLA 1S5NA 3AYVA 1MNZA 3UXIA 2QUNA 3QZAA 8XIAA 1XIGA 1I6NA 1MUWA 3CQKA 3P14A 4OVXA 1XP3A 3JU2A 4XISA 3C0LA 1DXIA 3VNLA 5XINA 3KTCA 4LNCA 3OBEA 2J6VA 3CQHA 6XIAA 3M0HA 1XYMA 4W4QA 1BXBA 4QEEA 5AVHA 1QUMA 3IUDA 3ITYA 3KBVA 3UVAA 1BXCA 2NQ9A 5C9ZA 1XLAA 2XISA 2GLKA 3VYLA 1XLFA 3U0HA 1S5MA 3IUHA 4X60A 5EMJA 3UU0A 4DUOA 2GVEA 6XIMA 3KCOA 5EMKA 4X63A 3TC3A 4QDPA 1XISA 2I56A 3KBSA 1DIDA 5J8LA 2GYIA 4HGXA 5EMLA 2NQJA 4XIAA 3ITXA 4G56A 5AVNA 1A0CA 1OADA 2Q02A 3M0XA 4US6A 3UA3A 2X7WA 5EMMA 2ZDSA 3ITOA 1DE5A 4XSMA 4A8IA 4Q7IA 3L23A 4A8LA 3AALA 1XIBA 1A0EA 1XIDA 2G0WA 5FA5A 1XIJA 4XIMA 8XIMA 2G4JA 4YTSA 3BZJA 4HNOA 3CNYA 2HK0A 1XINA 1A0DA 3KBJA 2QW5A 3CQIA 1QT1A 3BWWA 3BZGA 3M0LA 3N4AA 3UA4A 4E3VA 3VNJA 1YX1A 1TZ9A 3QXBA 4XKMA 1XIMA 1O1HA 3FVMA 4GJIA 3QC0A 3DBNA 3M0VA 4HHLA 4J4KA 3WQOA 4EACA 9XIAA 4ZB5A 5TNVA 3QYSA 3KCJA 1QTWA 1CLKA 2XIMA 5I7GA 1DIEA 4EAYA 1XLKA 1XLMA 3BDKA 3IUIA 3XISA 2QULA 2QUMA 2OU4A 4YTTA 1XLGA 3BANA 1XIEA 4HHMA 1XLHA 2HCVA 4QEHA 1D8WA 3P6LA 3VNIA 3AYTA 4ZB0A 1GW9A 3XIMA 4X61A 4YTRA 1XLEA 4YTQA 1K77A 4A8RA 4ZB2A 2GUBA 3U3HA 3ITVA 1XICA 4GJJA 1XIIA 4QE1A 9XIMA 1XLDA 1XIFA 1XYAA 4ZBCA 1DE6A 3GNXA 3CQJA 4XSLA 3CWHA 2ZVRA 3XINA 3M0YA 5H6HA 1XYLA 1XLCA 2XINA 1XYCA 3KBMA 1XIHA 5B7ZA 3ITTA 3KCLA 3KWSA 3KBNA 3VNKA 1XYBA 4PGLA 3NGFA 4DVOA 2NQHA 5B80A 7XIMA 3TVAA 1XLJA 2I57A 1I60A 4KW2A 4GQBA 2HK1A 3KBWA 4PFHA 5H1WA 4QE4A 4YTUA
chains in the Genus database with same CATH superfamily
4NY2A 3S47A 3N14A 4UFLA 4UR8A 3TSMA 4PMJA 3LQLA 4AY7A 2WV8A 4RW3A 3WEZA 4GD0A 5LIYX 4IJCA 2ZRXA 1MFUA 1QI0A 5BXSA 1EUNA 1UKQA 3AS2A 2Q71A 2WWCA 4XAGA 3FX4A 1N55A 4LNYA 4DN1A 3W88A 4QEEA 3THCA 1JF5A 5C8BB 1OF8A 4FXSA 4GYPA 4FNTA 2CLEA 1E0TA 6CGTA 3SRHA 2OJPA 1Z69A 3PP7A 4AIOA 1S2VA 4O10A 1ICSA 1XIDA 3S6DA 2DW6A 4B5WA 4XZHA 1R8LA 3NPWA 4XZBA 3IACA 4JD4A 3W53A 2X2YA 1F3XA 3S2MA 4LYRA 1LCOA 1XJBA 3LHYA 3NYDA 4NF7A 2GSHA 1RQEA 2J9ZA 4PMYA 1NFGA 4DELA 2QZRA 4IFKB 4US5D 3LBCA 3II1A 4UUIA 1F7BA 1X7FA 2W6RA 3NQAA 2BNJA 4ACZA 1LDCA 5CLWA 3UVIA 4PRRA 3T08A 3B8IA 1YMYA 3UT0A 3BAXA 1KTNA 3FHQA 3WLJA 3CUHA 3LYEA 1A50A 4XSLA 3C2EA 3MANA 1XYLA 1K4HA 4ZQOA 1BKHA 2GSEA 2ZZ7A 1GZJA 2WK2A 3ZWTA 4TXEA 2PDFA 1IEIA 3CQ0A 1NDZA 1QPQA 2HK1A 1KR1A 4NAEA 3MP3A 1ONWA 5HR6A 5TQLA 3M47A 3S3GA 3ITLA 4I5XA 2RGMA 4C6EA 3FKRA 4NZ1A 1JZ5A 3T09A 3DGRA 4NQ1A 3P0XA 2BSLA 4PH6A 2F6KA 5HQEA 5LNVA 4GI8A 1JPHA 3CTTA 1C7SA 3W7CA 1H4PA 3B8SA 3P84A 3TW7A 4TVUA 2GGGA 3EBVA 5EFDA 3LPFA 1EDTA 3QR0A 2GUYA 3P7YA 4QNWA 3OIHA 3C3UA 3GDMA 3TSBA 4GQ0A 1PHWA 3G1XA 3NTYA 1TZ9A 1CDGA 1T41A 2YB4A 3CV1A 3S1XA 2FTWA 3VNYA 1XLKA 3CZLA 4MKVA 4NJGA 5GNZA 3EEGA 1XLGA 3H2FA 4BQ3A 3KX6A 1RLCL 1F8IA 1XLEA 3TZNA 4L5ZA 3HJEA 3NQFA 4M81A 2E6FA 3BTNA 3GTIA 1EDQA 4H41A 5F2LA 4IUGA 3FGCA 2XINA 3OA3A 2A4AA 2VGBA 1YDYA 3WQ6A 3G0UA 1H7OA 1TVNA 2Z1SA 1OIFA 2PTYA 3DFPA 3LI1A 1FQ0A 4QDWA 4S3JA 1I1WA 1XBZA 3EWDA 3QJAA 1Q85A 4LUSB 5L6UA 4ENLA 3LCXA 1EDGA 4GXMA 2JALA 4GVHA 4R9OA 3G1SA 1EZ2A 4JTKA 4C6OA 4O28A 3EXRA 5CAHA 5GJNA 1IEXA 1AW2A 3ZLFA 1R46A 3MBFA 2NX3A 2V5LA 3KUMA 4DUOA 2WZEA 4AIUA 3S1VA 3W00A 4CD4A 1KO0A 1LQ2A 4KCUA 1Z48A 4DBEA 3HQPA 3U7VA 3KVMA 2V8ZA 3ANYA 1X8FA 4C90A 4IQLA 2E9BA 1I75A 5FESA 5IOBA 5KINA 1O1HA 4YWIA 1JIBA 3U6WA 5DRCA 2QCHA 5EY5A 4RDYA 1W9PA 3KRZA 5CAKA 3T55A 3WNNA 1XIEA 3HV8A 4XKYA 3WL0A 4L80A 4ZL1A 8RUCA 2FFCA 3FA4A 3HGOA 1R86A 1K8ZA 1VPXA 2WM0A 3HG4A 3PZIA 4G1NA 1R3SA 4AZ5A 1QOXA 2HQAA 3C0JA 2WJEA 2VP8A 2PWFA 3NGJA 3SW6A 1ECEA 1N7KA 5BXRA 1OY0A 4NI3A 3W6MA 5DX7A 3LV6A 5HQMA 1DTUA 1Q7QA 1C3FA 2PC8A 3TK7A 4OOUA 3H7RA 3URBA 3G3DA 5AHLA 2FDSA 3EWBX 3FAWA 4XZWA 2DY3A 3BW2A 1MRAA 3D47A 1GVYA 4N6FA 3L0GA 3TQVA 1QUMA 3KP1A 1ZAJA 2HE5A 3RCYA 2YCLB 3ENLA 1Z3NA 3WKZA 2ATSA 1KGXA 4MIMA 3LXBA 3UA3A 3MUY1 4X9YA 4DJDA 1GVSA 3QOMA 3W01A 5AC4A 4FP1A 1V0MA 1CGUA 3RUBL 5JH2A 3M0LA 4M8UA 3AMGA 1XI3A 5FL0A 3W37A 4IXHA 3I6EA 2D2GA 5T8GA 3RJXA 3HGJA 1Q2SA 5K9DA 1AG1O 4AD3A 2OU4A 1ZS2A 3TQPA 2XH0A 2WMGA 1BPLB 1FH9A 3ONCA 5FAJA 4C6JA 4ADTA 1Y0EA 3LTYA 3A3XA 4FXFA 2QR6A 1WZMA 5HPOA 1PEZA 1EA9C 1UA7A 3RHGA 5AYXA 4DO7A 1RUSA 3IIZA 4JIIX 1H5YA 5XIMA 2PDWA 3G2GA 3C0QA 3AHVA 3LXCA 1Q2RA 1VEMA 2OX4A 3JS3A 2QJNA 3CLWA 3LGGA 1YTDA 2PRLA 3D3AA 1UUQA 1D7KA 4GACA 4KT2A 1Q45A 3QH2A 5HJLA 3GG0A 2C1HA 2CLMA 4X63A 3UXLA 2VFFA 2VR2A 3WQVA 1YPXA 3MYOA 5DXXA 1IZCA 5SWUA 1OEPA 1YPIA 3FSUA 2PF8A 4WJ8A 2QUTA 4B3ZA 1TPH1 3UA4A 3NO5A 1ZJIA 4XBKA 5E09A 3EEZA 4QAWA 1XIMA 4RDVA 1EGVA 3RPTA 1K3UA 3O8AA 2REQB 1YE4A 1DIEA 5I6SA 3GIQA 2ZICA 4B90A 1EJ7L 1S2AA 2PUZA 3R25A 1I1XA 2E8YA 4AWEA 3W2MA 3GYEA 4EWJA 4A4AA 1TIWA 3LD5A 1QNQA 1RPKA 4Q8MA 1EC8A 4HHPA 3FDKA 1K1DA 2VUNA 1YDOA 2OEJA 4Q22A 3A6OA 4ATDA 4LW7A 4GGHA 1SFJA 3CL6A 2DZVA 1FWAC 2YCIX 1KLYA 3EA1A 1VGAA 3EWYA 4ML9A 3ABRA 3TROA 2YOCA 5AYYA 4PR4A 4AX6A 3K8LA 3V75A 4P7NA 4WDXA 2PDXA 1FHUA 1D7FA 1OSEA 1XW8A 1QAPA 3AIVA 2WVSA 1XLAA 4P7RA 1O5KA 3UU0A 2X09A 1HP5A 1BEUA 5I3JA 2VCCA 4ZE4A 3N2BA 2EEXA 4ES4A 4XK2A 5D2TA 3ITXA 1TG7A 3B04A 3VIHA 1AFSA 2FHCA 3SCWA 3ITOA 3UY7A 1TREA 4JKLA 4Q4OA 4QRNA 4W85A 5C55A 2Y70A 2YFNA 1KM1A 4PMDA 5MHBA 4CQ8A 1EIBA 3LB0A 1WDDA 3KTSA 3F4NA 5I7GA 3RMJA 1IZKA 4JFVA 3LSBA 3BANA 2PFHA 4NJHA 4F79A 5HUPA 1K7XA 4KWWA 3XIMA 1EX1A 1QW7A 3QLLA 1POJA 5A2CA 4XO6A 1W31A 2ADAA 3CLMA 5FIPA 3UERA 4LANA 2W0UA 1QPRA 1JI1A 1XYBA 5ABTA 2W27A 4HU4A 5F7UA 1QFEA 2PWVA 1HFBA 2EJAA 1I2RA 3NPVA 4TUFA 4RNFA 3TN4A 3QGVA 3SI9A 2F6UA 3BG5A 4NYYA 1M7JA 3GUWA 4CQCA 2QPUA 2DVUA 3POHA 3O6AA 4OBTA 1MQRA 3B0XA 1ZBKA 3TR2A 4ZTYA 3VZXA 1QWKA 4S2CA 4HNTA 1UR0A 5IFPA 3NZGA 4P8XA 1LRTA 1Q4WA 3LHUA 3SCRA 4AQLA 2P1FA 4LVGA 4ICCX 1IF2A 4NJJA 3CTLA 1HKMA 1H7RA 3C2FA 4QG9A 2DP3A 3R7MA 1L6WA 1E71M 4IIDA 1TUFA 3OG2A 1J0YA 4AIEA 5E5CA 2Z29A 3KE0A 2D69A 4Y90A 1YRRA 4HHLA 4AG0A 2B7QA 2WWDA 3ES8A 1DWFM 2ZXQA 1W9UA 4N6EA 2YGYA 3S6OA 1LG1A 4XVDA 3W1TA 1E5JA 1GOMA 1SMAA 3FNDA 1FHDA 3SECA 1DQUA 1V6UA 3HPXA 4PMXA 4E8CA 4HVXA 2JE8A 4WOQA 4DXKA 2OT1A 5BU9A 4UOZA 4H01A 5FF2A 1EYEA 2ZDRA 1QHOA 4TQTA 4S3AA 2WKGA 3EXTA 4DM1A 1V02E 1WKEA 3GK0A 3VNKA 2CW6A 1Z44A 4HSNA 3TJLA 2J78A 1J8VA 1RJRA 3WDIA 4CU7A 4AZHA 3OA5A 3VNMA 4MUPA 2QV4A 3Q4DA 3S46A 1B57A 3C4UA 2XH4A 3T40A 3JRKA 2FGZA 2EG8A 4AHQA 3B05A 2ODOA 4F0KA 4OVXA 3GU2A 5EL1A 3BAKA 4K7VA 3N2TA 3NUKA 3L66A 5I24A 3DFNA 1BXCA 1YLVA 2QJGA 2WLZA 4UCGA 4Y9OA 1C91A 3QM3A 1D3GA 3KCOA 1Q63A 1ZBWA 4QNEA 4HGXA 2V3DA 4PCTA 4QJ1A 5MF5A 2NQJA 3EDEA 3UXKA 1W5MA 4C6LA 3PJUA 4LUYA 3IK4A 3VA8A 2RDWA 4IG2A 1JPKA 4FXJA 2PTDA 1TPEA 1SSGA 1UKSA 4O1AA 1W17A 3SCUA 3O6CA 3NIYA 3KM8A 1A4MA 1XR2A 1OVDA 2ZA1A 3GFZA 3WK2A 3SAZA 3DYPA 2CLLA 1A4LA 4JL1A 3VNIA 1UG6A 1FWCC 4H1ZA 4HZ6A 4D8AA 3B0UX 4K36A 4CNPA 2FVLA 4JIQA 5DN1A 3XINA 4N9DA 1F76A 4A3QA 4GY0A 5I3IA 3UW6A 5GNYA 2R9RA 3BPWA 2XVPA 4A29A 2OZTA 3ARQA 5HNRA 1CGTA 2ZUNA 4CN6A 3OYXA 2BODX 4V28A 3ALGA 1H0IA 1OFRA 2XN2A 3K4AA 2MANA 3DOPA 4CN1A 2ZTKA 4G6CA 3SQSA 4F0SA 1Z7AA 2OCZA 4QHRA 1J6OA 1JJKA 2VFHA 3IJ9A 4RK8A 3PANA 3WF3A 4JFUA 1BYBA 4CNUA 4H8HA 4MYAA 3H55A 4GQRA 5A8MA 3W3OA 1TKKA 1R87A 4JEQA 3TU9A 3M0XA 1R38A 2A3LA 3TEVA 4TU1A 4GG9A 2BGSA 3CAWA 1JNDA 3NDYA 3GE7A 2E68A 5AHFA 2A85A 3KVJA 1SZFA 3UGVA 4O0ZA 3GIPA 1UW9A 4YHGA 3CZGA 3VIMA 1YX1A 4BF9A 3AHZA 2OMAA 4TTGA 4EKJA 1MW3A 3FXYA 1KGUA 2WNNA 3QYSA 4RR4A 4DM2A 1SJBA 2B31A 2E25A 1OABA 3IRDA 3RN6A 5E0CA 4JN8A 2Z2UA 4H8UA 3G0XA 3TX9A 4M82A 9XIMA 2RGLA 2ATMA 3LUTA 5D2WA 4K68A 3L4TA 3PFMA 1V79A 3WZ0E 2VHLA 3PUDA 2WNZA 3AWNA 5K9CA 3BG3A 4ZO6A 4MB1A 3KBWA 3F2BA 1VEOA 4E4UA 2QPSA 1GQNA 1RPXA 1MNZA 2VR4A 2X0SA 2YCJA 3KTCA 2CHNA 1XYMA 1VBRA 5HWNA 1FCBA 4EPEC 2NXGA 1UP2A 3T78A 2A1YA 2OWXA 3LGDA 5DCDA 4LBUA 5DEZA 3NQEA 4DAFA 4RDWA 1E0UA 1J18A 1W8GA 4MZ8A 1J0KA 2WSKA 5K2ZA 1PKYA 3ZR5A 2V5BA 3TLLA 1T6MA 3TTYA 1QI3A 1ZENA 2OQHA 1W5OA 1R9YA 4JR5A 4H83A 1TTPA 2TODA 4K8GA 4MJZA 1EL3A 3AUOA 4DO5A 5KEZA 2F6XA 4HPXA 3WQ4A 1O94A 4DUVA 4LUTA 3THQA 1SMDA 3VC6A 4QLKA 3FJNA 3BH4A 1FTXA 3R8HA 4WKAA 1EOKA 3GH4A 4XZIA 1OYAA 3P8JA 4PA8A 4AZCA 3WBWA 3ZR4A 1DJIA 1PX4A 4PUUA 3ZJ7A 3LCLA 3VX1A 2OYMA 1UASA 2OYKA 4WGXA 4LJ3A 5KZEA 5AZ1A 2HXTA 9RUBA 3VD4A 3GR8A 4DVOA 1UH4A 2XVGA 4FNSA 4M24A 3VM7A 1EHNA 1IT8A 3UYIA 2E28A 5ABGA 4O54A 1NH6A 3CZ8A 1W0MA 3WDJA 3DC0A 4PEKA 4LY8A 3QN3A 2ISDA 4FOKA 1EJTC 4XISA 3GNDA 1IQ8A 3N04A 3H21A 3MUXA 1BXBA 2C0AA 2F7FA 1Z42A 3CBWA 2GGIA 4JTUA 1SFSA 1W8SA 4GI4A 1Y5WA 1FCQA 1X1NA 3LCFA 3GTXA 4ADUA 5LIXX 1GTEA 5A6LA 2O9PA 1EP1A 4EPDC 3TYUA 3ZVHB 3S5NA 4AD0A 3UXDA 2OQLA 5U7SA 3NZRA 4LC6A 5AY7A 4WSHA 2HZGA 5H91A 4AC1X 5HJYA 2R1KA 1SJCA 2HNHA 4S3DA 4IL2A 3PPGA 2D73A 1ME9A 3IUIA 3BICA 8A3HA 1JAKA 3CV2A 3I10A 2BS9A 4YTQA 1K6WA 1XCWA 2GUBA 3GKFA 2AAAA 4XTIA 4NJIA 1XPYA 1VZWA 4Q4MA 1P6BA 3QPYA 1XIHA 4INFA 1DWJM 3WK1A 4ZODA 1U1JA 1E40A 4IWWA 1VFLA 3RAOA 1P0BA 1IR1A 6TAAA 2OLSA 1G5AA 4B4FA 4H3DA 3KVKA 1WDQA 3NNTA 1XLIA 1ZB5A 1LZOA 3C2VA 1UR8A 4B3KA 3CO4A 1D3HA 3Q58A 1I6NA 2VGFA 4L61A 1OCQA 2X1SA 3WMLA 4KEUA 2YLLA 3VMOA 2CETA 4EWND 1CXHA 1PYFA 4JAWA 2I5GA 1K8XA 4YVXA 4WXYA 1VENA 1V8EA 3F5KA 4AF0A 2XH7A 4QSFA 5MKGB 1QW9A 3KZPA 4IGSA 3UPBA 4W87A 3LOTA 3NM3A 3UR7A 2AQVA 3R94A 3BK0A 4RZ5A 1WYIA 2W66A 1OG0A 2O9OA 4LRSA 3S5YA 4FI4A 1OGBA 3BJSA 3NZPA 1B2YA 1HJVA 4D8ZA 4DXVA 4AZBA 1RP8A 2G3FA 4BHYA 5HQLA 3ZJ8A 2X8RA 1DYSA 3PUGA 4AEFA 4MB4A 3I4KA 1FWTA 2V5JA 4Q8QA 4GYFA 2PGFA 1FXPA 2BDQA 1IGWA 4JXCA 4F0HA 1EJRC 5D2YA 5FJUA 2CESA 1MYRA 4ZSUA 3LENA 3FJ4A 3R11A 1LUCB 3NGFA 2PU1A 3TMLA 3L21A 2QYGA 4YTUA 3R1ZA 2OWWA 1TPFA 3R58A 4Y7EA 3UZZA 4DJDC 1FDZA 2GSJA 2GVYA 2AL1A 1XLBA 3IVTA 3FVDA 4A8NA 4JFTA 4FNPA 3TKFA 3EX1A 1VCGA 1O5QA 4C91A 1SPQA 1H41A 4IP5A 2J7EA 2FHFA 4OV4A 2ZE3A 2OZ0A 3N2OA 3VIFA 1QBAA 3BGJA 2X0YA 4GNVA 3FJLA 4U3CA 5CC6A 3ABQA 4B3LA 3O1NA 4POCA 1JYWA 1X8CA 2G96A 3RG6A 5G1YA 3JVAA 2WVTA 4H6KA 4DO6A 4QLLA 2Z00A 1RA5A 2V0TA 4A6GA 3WG6A 5CPNA 1MDRA 1TJ2A 3MP4A 4GYJA 1EXPA 2MNRA 4CNSA 3E9AA 3QXBA 4OUIA 5AC8A 1DKWA 4AZGA 2YDSA 3STEA 3IIOA 3N2CA 1TWWA 2P10A 4OHQA 2QCGA 2YW3A 1EJVC 4EK7A 1UC5A 4GY7A 4Q8TA 1X6LA 3VDHA 1EO5A 4IPJA 4MWAE 1XICA 2OWCA 3PNUA 4HBKA 4CVUA 3WEMA 3CAVA 3BCDA 2CFFA 5CPOA 3WFAA 3LSCA 4QLJA 1VFMA 4AD4A 1Q6GA 3OO2A 6A3HA 2GJXA 1UR3M 1DL3A 3G8RA 4W7UA 3A4AA 1O5RA 4W84A 3W73A 5GVJA 2X7VA 3KHJA 5C9WA 1LRQA 1XDLA 3CUXA 1XLLA 5T26A 1K7FA 1E6ZA 4MY1A 1XCFA 2AQWA 2QDHA 2XIIA 3W2KA 1E43A 1PX8A 4REQA 3EWWA 3GXMA 5FF7A 4LNCA 3SN4A 7ODCA 3EOSA 1XFBA 5IBXC 2UY3A 4KKXA 4UTFA 1TX2A 4GI6A 1JCJA 2BGNE 3PVFA 4ORMA 2GVEA 1VPQA 3E0IA 2EG6A 2ONEA 5D9NA 2VEMA 2G3MA 4H6EA 4W5UA 1F73A 4A8IA 5BROA 2WHJA 1A0EA 1BVWA 3BOLA 3VI2A 4DYKA 4RE4A 1MW2A 1SJDA 1FX6A 3JZEA 2J77A 4WJEA 3L4WA 3CIWA 4PUNA 3B9EA 2PDCA 5A94A 3DBNA 3M0VA 3GVGA 1CGXA 3B4UA 1WDSA 5AYIA 2VVSA 1HL2A 1Q8AA 1QRQA 4I6VA 5DT5A 2Z7GA 2NUWA 3L4XA 3WQCA 5I79A 1B3VA 1TPC1 1JCMP 2YL5A 1QI5A 5A6BD 1RD5A 3BAJA 2WMFA 3E0VA 2ZWYA 2EO7A 4BR1A 1M3UA 4XAPA 1BSIA 3OHIA 3QQ0A 3VNDA 5M17A 3W27A 1GHSA 1TJ1A 3W81A 2Z1XA 4MJMA 4JHZA 5D2XA 5E70A 3AYSA 4RJEA 1MUCA 4OE7A 4MG4A 1US2A 4JTAA 2V67A 3R8GA 1NSJA 2RDUA 3MMWA 4PMZA 3IJIA 4S3BA 4EF8A 3R0UA 3TC3A 3GR7A 4N0RA 3VU2A 3QFWA 2WSYA 3WLNA 4DUXA 5AC7A 4JX4A 3P0WA 3H24A 4D6DA 3V0SA 4E8GA 4DX3A 2QMJA 4O53A 3PTKA 3F5JA 3N4AA 5A8OA 3SJNA 1XD1A 1W1IE 5A95A 4P7OA 1WXYA 2GPTA 3M0JA 3WQOA 3H8AA 1EEXA 3A4JA 5GJMA 1DIOA 3RO6A 4O15A 4YN5A 3VGFA 4AEEA 1TX0A 3U2CA 1XRSA 3H4WA 3C2YA 2I7GA 4AZIA 3SCNA 3MKKA 3R0KA 1TO3A 1ELSA 1BRLA 2V5KA 4M56A 1F9CA 4X22A 2NZLA 3GU1A 3LTSA 2ZOXA 2HPIA 3H2AA 3GTHA 3S1UA 4E5TA 3SSJA 4DZIA 2Q6ZA 3OVQA 1RBAA 5FD0A 1I2OA 2X1IA 4ACYA 2HXUA 3SUUA 2AGTA 2PGEA 1S5WA 3NL3A 4K1GA 3M0MA 4DF2A 2GQAA 3PZGA 3OVGA 3GH5A 8XIAA 4JQAA 3A64A 1UB3A 4JN6A 5LXEA 4OOZA 2NVDA 1P0KA 1WXJA 3VABA 1J4EA 4D6JA 2GLKA 3PBWA 2PU0A 2XYLA 1JI2A 3HA1A 4O14A 4UMAA 3BLDA 4IIBA 3OQEA 4LEQA 3NQVA 3QY6A 3WJYA 4D6EA 4CQAA 3H7UA 3HPSA 2BVYA 3PSWA 5DMLA 1VQTA 2A7NA 2NXIA 5E0FA 2CPUA 3UWQA 4P7LA 3PZ9A 4I3GA 3UG4A 1VIZA 3WQPA 1V0NA 5BXPA 1V3IA 3HMJG 2W61A 1DHKA 1PZ0A 3GRIA 1KC7A 4PTDA 1UZ4A 3SY1A 3MV11 2WYSA 1XS2A 4J2PA 4JKMA 3PPFA 4WDWA 2QJIA 1QHZA 2NQZA 3WBYA 2JIWA 2Y6ZA 4B9ZA 1FFRA 2EPNA 4ERAA 1HGWA 2OOGA 3RRXA 4GABA 3L67A 3WDHA 1BD0A 2ISVA 4M7SA 3AHYA 1SZEA 1G94A 3C56A 3REQB 3L9CA 4NVTA 3S4TA 5LNWA 4PCPA 2Z1VA 2WNQA 1TIMA 2DT1A 4G7EA 3ZT7A 4H9UA 4FMVA 1TVLA 1HJWA 1C9DA 3WNOA 3URQA 3TMQA 2WJDA 3SGZA 3A12A 3BLKA 3OVRA 2CCRA 1UZ1A 3W2NA 1GHRA 1VYPX 1XP3A 3VDGA 3ABZA 5D9MA 2QDGA 1KV5A 3WLQA 5REQB 3OTRA 4NIRA 1Y7VA 1UWRA 4HNCA 1MEHA 3BV4A 3LN3A 4U2YA 3KRUA 1P4CA 2X1TA 3T2PA 4QM1A 3TZFA 5D8WA 1PB0A 2RJGA 1F4AA 1LLWA 1MI3A 2A6NA 4BWLA 1M1BA 1ICQA 1V6TA 4WXZA 4F0LA 2WCAA 1ZJBA 2ZC1A 1QPOA 5CQ1A 2EQDA 2WVUA 8TIMA 2Q01A 3U9IA 1CEOA 4KS0A 3OIXA 1TYGA 2VD9A 2BY0A 2G95A 3NYZA 2GWGA 3NDOA 4B2DD 1K7EA 2G50A 1BG9A 4JQ4A 1M65A 1AMYA 3PSVA 2WNWA 1KBKA 4KBXA 4MKNA 1J0ZA 4PUKA 5B7ZA 4E2OA 3F4VA 3HJZA 5LA2A 4NX5A 3MKCA 3CS2A 5FEPA 1R7OA 1GPWA 1VHNA 4N4QA 5JBFA 4UIOA 1B54A 1A5UA 4MSSA 4L64A 5CSYA 1RA0A 1V3LA 2VX7A 2IPWA 1JRCA 2XZ7A 4IP7A 2CERA 3U5YA 3E12A 3DFOA 4KEZA 5CZSA 4K1WA 2H8ZA 4L9XA 3MA8A 2DT3A 3O7UA 3ZFHA 5E93A 1NQ6A 4DBDA 3IUHA 3NQ6A 2YXGA 1OD8A 3TTQA 3AZTA 3W86A 1ZP3A 3E3HA 5TIMA 4GUFA 1J12A 2OEMA 4IGNA 4JY8A 1N2VA 4NZ5A 1SO4A 4Q4KA 4US6A 1TQJA 1A5AA 3NCOA 1E6XM 1BVNP 1Z89A 1SJAA 1QATA 4GC3A 2W79A 3M6DA 1B3XA 1VBUA 2XGBA 4MPKA 1PS9A 5DCBA 2WLYA 1DORA 4UFKA 1PJ9A 4IIFA 4LBRA 3W71A 3WK0A 1U33A 3REQA 1CYGA 2AMXA 2PD5A 2XPKA 4AISA 4FB7A 4EPBC 5AB3A 4LFYA 2A3BA 5EBAA 1TWIA 3FHAA 2JGYA 1CBGA 4JHMA 4PMOA 2PZ0A 4HTBA 3WJZA 4AFYA 1ME8A 3RX4A 1IXNA 1V03A 2YXXA 5FF0A 3WUFA 3AAMA 1EEPA 2CLIA 7REQA 4CD8A 2Y4SA 3KS5A 1QI4A 4UTWC 2R6OA 3DN5A 1GORA 3BURA 2J75A 1DJWA 3PWIA 1CLXA 1WQ5A 5XINA 2VR5A 1ZP4A 1LJYA 3V4BA 1JFXA 4Q7NA 2Z24A 5C9ZA 4DYEA 1LYXA 4H2CA 3SIZA 2Y8UA 5A8QA 1NQKA 2D0HA 2YBVA 4YVPA 1EUAA 3RPDA 1G4PA 3FA5A 1XF0A 4PL1A 4HNLA 4E4FA 1YBQB 2VEKA 5FA5A 3B8UA 4BKNA 5AHIA 1LBFA 5I07A 2QW5A 3UGRA 4JTSA 2OGYA 1J10A 3THDA 1NAL1 4UNLA 4HMNA 4XKMA 2W4XA 4P8UA 1F2JA 4GXPA 2CXEA 3ZMRA 4UBPC 1PIIA 3UZJA 2PCQA 2QQ6A 3MTWA 2XH2A 4JX6A 4UCFA 3N3MA 1QW8A 3SEPA 4QISA 4LXFA 5HANA 3B3DA 1LWHA 3TWAA 2OZ3A 4B5XA 1S2TA 4Q7BA 3VGBA 4H19A 3HQ1A 2XIQA 3RX3A 4MY9A 2H8XA 4O12A 3HQOA 4GBUA 3DG6A 2A0NA 2Y24A 3B03A 2C79A 3FOKA 2FMNA 3IV3A 4M7TA 5CZ0A 3ECQA 4EPKA 1UWSA 2ALDA 4H9YA 2ZA3A 1KFKA 3TOPA 4F66A 2DUAA 5BW6A 1A5KC 4HJWA 3GNRA 3EX6A 3FXGA 4J3WA 2PWGA 4EXQA 2UY5A 2Y1HA 3ABOA 2I56A 3HBLA 4JZ5A 4GVIA 1W1B1 5JQ9A 1EC9A 2F61A 5AVNA 3NQCA 1JR1A 4M1RA 1GZGA 2P53A 1GVRA 2J47A 4TX9A 4GIAA 4LV9A 3QW4B 2V2DA 2QJMA 1FWSA 1OYCA 2P8CA 3HG2A 1PCWA 1YEYA 4AH7A 5LGZA 3L4ZA 4AVOA 1TV8A 1DWIM 2VX6A 5DQPA 3H2OA 4W9TA 1TPDA 1U1HA 3RR1A 4GO8A 1KW1A 1AMKA 3NVDA 2WSQA 4UZSA 2WC7A 1ZBCA 4PUJA 4F0MA 2XM1A 1YHTA 1ZQ5A 4KERA 5I02A 1OK4A 1DWGM 1E1FA 2V3EA 1LQAA 3GXFA 1S1PA 1UH3A 4UTLA 3IPWA 4GQBA 3W26A 4MNMA 1QASA 2P50A 4QE4A 3W2LA 3LX9A 4Z1AA 1E0VA 4QE5A 4JS3A 3OLIA 4KF1A 1ODZA 4IMCA 5EB8A 1PTAA 3CB8A 2FZ9A 1HKKA 1S1RA 2HPMA 2ZXDA 2D2OA 1IXPA 1ZFJA 5C54A 4KWUA 1S2UA 4B5VA 1ML1A 5F2MA 1XHGA 4TMCA 3WNLA 3IJLA 3A3WA 1DV7A 2INEA 2VI0A 4XSMA 1T8XA 2QUVA 5C0QA 4G1KA 2PWUA 1JZ3A 3FY1A 5E9XA 2DT2A 5FSEC 3SZ8A 2J79A 3WH7A 3CJPA 3W6YA 1A5MC 2ZZ6A 3W7NA 1F05A 1J2WA 1OFPA 5CH9A 1RBLA 1PWLA 3KHDA 1ZSXA 3T2QA 4LUTB 2XIMA 3LNPA 3DENA 3LV5A 4YTTA 3SSZA 3RIKA 3CM4A 4ZB0A 4YTRA 1E6NA 3AU2A 4DJFD 4LS2A 1UROA 4J7RA 3TNOA 4BY3A 4CUCA 4RXFA 2XN1A 4NAEB 1H5VA 1YXYA 3GWQA 1AD1A 2INFA 3THUA 5EBUA 3EPNA 4BZYA 4ADSA 3CZEA 3WLKX 3Q2DA 3IGXA 4C6FA 5H8PA 3GTFA 3EGJA 2ZZ1A 1GKPA 2Z27A 1D8CA 2CITA 2PC4A 1GW1A 4MZ1A 2ACSA 1UWAA 3K13A 5HK4A 4LVBA 4UTIA 3AHTA 1FWJC 2E4TA 3MMTA 4XVEA 4HZ7A 3WH9A 5JVLA 3WLTA 9CGTA 1TA3B 1MDLA 1QHPA 1A5NC 3BMWA 4AZ6A 5A6BA 2VX5A 5T9CE 1MXDA 3JUGA 1X6UA 4IMFA 4Y2WA 2QGYA 4ZQPA 2JF6A 3IGHX 2WM1A 4ZQMA 3DG7A 3ZLHA 2GK1B 3LU2A 1SW0A 1YQ2A 4MM1A 4BWLC 2CLOA 1DJGA 2DZUA 3KXQA 4C7FA 1NFPA 4D6IA 3W7EA 2XG9A 5HXMA 2HV5A 2DDXA 3MB9A 3HTWA 3GVRA 1UBPC 4UQ9A 9XIAA 3BO9A 3IGSA 1WO2A 5CEWA 3CUGA 2WZTA 2F38A 4J5NA 2Y0FA 5CGQA 4D6HA 3WK3A 2ZX8A 2NUYA 1EP3A 3VD9A 1LWIA 2IQ0A 3JR2A 4UNKA 1AODA 2R1PA 1BYCA 2HRWA 1XYAA 5F2GA 1QO2A 1IWAA 4XBSA 3E1F1 3NSXA 3EX2A 3UWZA 3BCFA 1NOUA 1PXGA 2IW0A 1JNEA 1U5HA 4EIVA 1L0PA 4FLRA 2VEGA 1KCXA 2BGQA 1H60A 2VENA 1E9LA 4GIRA 1BTCA 3W74A 4PMRA 2AMGA 5C7VA 3MBDA 2QVHA 2VOTA 3USZA 2WANA 5D04C 1AJZA 3MUAA 1QOQA 1WAUA 2DIEA 4L7ZA 5KZ6A 3ATZA 4K8EA 3SY5A 2C13A 5HPCA 4GINA 4MJ2A 4JNYA 4LS0A 1U5VA 2E67A 4WY0A 4PZVA 3VDBA 1C9WA 4KCWA 1IV8A 2BMBA 5A5WA 4MNJA 1U83A 3O6DA 1HZYA 3ZYZA 4Z1CA 2AKMA 4PUMA 3KL3A 3TYCA 1DXEA 3B97A 2WKJA 4TOQA 5I3GA 4AIBA 3SIMA 1MNSA 4HJFA 2Y8KA 1E6QM 4PTMA 3U2ZA 4DJEC 3GG8A 5E6ZA 4WQ6A 1PAMA 3FCPA 2QDEA 2FZBA 4KFOA 1GVOA 3SUVA 2DZBA 1SQ7A 3SQLA 3WLIA 2VVNA 1WDPA 1GOWA 4CNTA 3H22A 3PBVA 5A8NA 4MB3A 2C18A 1H61A 4ERIA 5REQA 2WJZA 3TCEA 2W5FA 3DUGA 4IJBA 3B4YA 1HL8A 4LAUA 3AISA 4HZMA 1NWUA 1XDMA 3AS0A 3MMDA 3KOZA 4NZFA 2CKRA 1CPUA 1VBHA 1I8JA 4Z08A 4M19A 4DXXA 4C7GA 3CGTA 3MZ2A 2FFIA 2E40A 1EA0A 2Y7FA 3N6QA 4ECLA 2PURA 1NF7A 1RK5A 3A23A 2V2HA 4FXRA 2GVJA 3F4WA 3COTA 1RQBA 2R24A 3MI2A 3B06A 1G1YA 4DZAA 3W7LA 4JTEA 4G2DA 2OYLA 4K7YA 4A22A 4W7WA 5M2FX 2GQ8A 4B5TA 5LSMA 4NL1A 4QITA 5EGRA 2BXZA 3H26A 4XG1A 3CWOX 3HPAA 3WDRA 3FLUA 3O63A 4AAJA 3QYQA 1EWEA 4D6CA 2ZX7A 5DMMA 4ZOAA 3FK4A 2A7RA 1OT1A 1YIXA 3WQFA 3SFKA 3MC5A 1A3WA 4EF9A 1WOAA 3LBMA 3E5PA 4J4KA 2GDUA 2YDRA 4UMBA 3UZYA 1KCKA 1NDYA 1HKVA 1KA9F 1ZTVA 2BVTA 2JEQA 1D8WA 4WSJA 2XTKA 1EQCA 1XG3A 3EX4A 1FHVA 2DUZA 5TAOA 2QGHA 1UWUA 2BX7A 2ZKMX 3PM6A 2Q3RA 2DFAA 4ASTA 2Z0IA 4NNBA 2PMQA 1OGGA 2IUZA 5JBEA 4RE3A 3UG8A 1ISXA 1RD6A 4WHBA 1FWDC 2G41A 3CUZA 3POCA 4PFHA 4GUGA 4C7DA 2EPKX 1ZAIA 4NRRA 3TDFA 3NQDA 3DI1A 1ITQA 4OGZA 3N6HA 3BLEA 1IEVA 2G3IA 4RZ4A 4YL2A 3N6JA 4GE8A 5CG7A 1W3TA 2VXNA 3ICJA 3LERA 1JD7A 1XFCA 2G37A 4IMAA 2CZ5A 3O6YX 4R33A 1RLDA 3T2OA 3KWXA 4E8DA 1WZAA 2BV9A 1BF6A 1UD2A 1SU5A 4MWAC 1QOPA 4XUGA 4DPQA 4GBDA 3DFQA 4PUWA 3HF3A 2WO5A 3MHUA 1LQ0A 4GX8A 1RJPA 1H7NA 2D2JA 1F4HA 3CEPA 1XC4A 4XD5A 4AVFA 1A49A 3MP5A 1B3YA 1VHCA 2XDFA 2ZADA 3QV6A 4TV6A 4IM4A 3T8LA 2Y2WA 3PPHA 3W1XA 2ZRZA 3PZMA 1KXQA 3QR3A 2YYUA 3VOJA 4QJ4B 3CMFA 3PBGA 2Q3OA 5TNVA 3HIJA 1AH4A 1RY0A 4AHPA 3S5OA 1XCXA 5IBXA 2CZEA 3H2EA 3N18A 1EBHA 3AYTA 5HINA 3AUJA 1E56A 2FKPA 1P0DA 2PRMA 3M0YA 3MZNA 3W82A 1VFTA 2B7PA 2NWRA 5CPLA 3E0LA 4PFMA 1IZJA 3MHGA 2WZMA 2WMIB 3EOUA 4DIAA 3OW1A 4WJXA 4EOUA 4UFJA 1ZGDA 3W75A 2XIBA 2VC9A 4WUIA 5DMYA 3LMZA 3AHXA 1KM2A 3BQ6A 1RK6A 3L5AA 4MDPA 3MJMA 1EKOA 3B0YA 2R91A 4GI9A 1I45A 5LNRA 1FKXA 2PDIA 4FNUA 4DBWA 4DF0A 1RHCA 1NY1A 2XVKA 4K6AA 3CXOA 1NDWA 4R27A 2GGHA 4WDTA 3VUSA 3M5YA 1CECA 3QR1A 4MGGA 4PMVA 2RUSA 4Q8PA 1K9EA 3ZIZA 5E1QA 5G5IA 4BK9A 1KWKA 3MSRA 3M9YA 4G56A 4RZBA 5M1TA 3DDMA 1Q66A 1NJJA 1WZKA 3UFYA 4MAVA 4P61A 1QVBA 1F3EA 4OTKA 1VYSX 3BARA 4X0VA 1KR0A 2CU0A 3R5EA 4RXGA 4NNAA 3BSGA 3QC0A 1E6PA 1L9WA 3NOYA 3DXIA 3HM7A 1KCLA 1F61A 3UZWA 2WZHA 5MKGA 2DT0A 3DFYA 3W7RA 5FACA 5F4WA 5HNNA 2D0FA 3S0CA 3PTDA 3IJDA 4J35A 1UUOA 4GIYA 1WXZA 3WNMA 3GD6A 5AHEA 1E1CB 1CB7B 2GDVA 4O8AA 3KDOA 3GDLA 2OXNA 3WFLA 3DX5A 4E2DA 3VKDA 4MNLA 1CGWA 1B9ZA 3PR2A 3M16A 3M41A 1SW7A 4CQ9A 4DWSB 2Q8XA 4Q3MA 4ZTXA 4NHVA 5GNXA 1MZHA 4EXAA 3OLGA 3KBVA 2PE4A 1JYXA 2CBIA 5EMJA 3VKBA 2VGIA 3MDWA 4ILSA 1LTDA 3QQWA 4QDPA 3RMEA 2YJQA 2JKPA 2PDYA 4UR9A 4JOMA 3W2UA 1FDYA 5KZDA 3PWGA 2NXHA 3C8FA 3CL7A 3L2LA 4NP7A 4IGHA 4JNMA 3QPEA 3BLIA 1GYNA 3UY8A 2IKIA 3ZVIA 2ZUMA 4LTSA 5CPQA 2VURA 3SUWA 3W38A 3VOFA 3S42A 2XSBA 1L6YA 3T07A 1E0WA 4NAFA 3VKKA 3VM5A 3U2EA 1H62A 4ATWA 3EKGA 3WQWA 1WZLA 3PZNA 4DBUA 4ZOEA 2F2KA 4PODA 1HX0A 4CD6A 1F3TA 3EB2A 2CZDA 3VCCA 1KFEA 3GSMA 3RF9A 4HYVA 5C5YA 1XIIA 3PN8A 4MLRA 1OCJA 2JIEA 4M80A 4R34A 4CD5A 3EDDA 3NEHA 1KTBA 2GJRA 1PV8A 4QROA 3F1QA 2DUXA 1KKRA 4W7VA 2DSVA 3VIIA 1TJPA 1EWDA 4O50A 3AFBA 2UY4A 1UHVA 4LYQA 1FXQA 3BCJA 4EP8C 2DJLA 1TWSA 2PDJA 4PCNA 1DXIA 1OBAA 1WKDA 1PDZA 1JCXA 3ITYA 4LAOA 3EA3A 4O1EA 4DEFA 4B16A 1H63A 3CYJA 1OFBA 4IXXA 1G4TA 2VRJA 1DIDA 5I2UA 3FYPA 2GYIA 1PL9A 2PDKA 1HIZA 4JHOA 4ONVA 3USBA 1DWHM 2HS8A 1WDWA 2Y5EA 3DKJA 1VJSA 2WVVB 2HK0A 1XRTA 1UA3A 1EYWA 3E38A 2W92A 5EMUA 4UQEA 2PPGA 3W7IA 2B4GA 4D1IA 1GG0A 2OODA 3LA4A 2ZE0A 1EJSC 1R30A 2G4FA 3O06A 4Q8UA 4KRZA 1FHLA 5DLCA 5GPRA 1JYNA 3W1PA 4B4HA 4W8AA 1GW9A 4IFRA 4R9XA 3MO4A 4H9MA 4RNIA 5I3HA 4CLMA 7TAAA 1Q6EA 2X0HA 3P8IA 3SRFA 5FKYA 1V93A 1V6VA 3WF2A 4YYCA 3VKAA 1XDJA 4F4RA 1XLJA 2F9RA 2MUCA 2E7FA 1ZLPA 3K4WA 1WKFA 2FB3A 1S5NA 2VEFA 1WBHA 3M44A 4UMCA 5DT7A 3BW4A 4YJ5A 2DORA 4JYEA 5AHMA 3JU2A 4MADA 4KESA 2AGKA 4J1OA 4RCXA 1VLIA 1THFD 1Q5MA 1FVPA 4R3UA 4AHOA 1OC7A 3QSRA 2CHOA 1DOSA 2J7CA 2A3CA 4NAFB 3TH6A 3ARUA 2GQ9A 1OWQA 2DGAA 4HN8A 3VGHA 3F2DA 3TWBA 1CXKA 2UWFA 2FYMA 5HR7A 1VBJA 2LLEA 3APTA 2OTDA 3PAJA 4TMBA 3I3EA 2QCFA 3M1ZA 1HVQA 5IFTA 4OZOA 3TTSA 3MV01 4WLCA 5KTLA 1FWGC 1A3XA 3RLGA 5CJMA 1G7VA 2PGWA 4LWWA 1Q13A 2YR1A 2CZVA 2BOEX 3S1GA 3KVLA 2A3HA 4IMEA 4NZ4A 3KP0A 1RALA 1ODUA 2JBMA 1XLDA 4HD5A 2PD9A 7CGTA 1XL9A 3STGA 4IQJA 4JDBA 4MKSA 1CZ1A 4Q32A 2WCGA 4JQ2A 4QCEA 1UOZA 1GVQA 3ZT5A 2I57A 3K2GA 1R3RA 2YBUA 1F6PA 2Z2AA 4Z1DA 4C5YA 1B31A 1W1ZA 3BLPX 1E5NA 1OJXA 1BQGA 4GKLA 4KCTA 5AKQA 1M41A 1W1A1 1PZ2A 2E0PA 1CTNA 1DQWA 2QS8A 3EAUA 5CC5A 1LL7A 3W0KA 3LDVA 4EANA 2PDNA 3H23A 4XB3A 3DHPA 3VIGA 2DPEA 2QNEA 1KFWA 1XQLA 1FH8A 1WCGA 4DO4A 3TJXA 3U4AA 3ZSSA 4GCXA 2XFRA 4HSOA 3S2CA 1HN1A 3TONA 1VB9A 1IGSA 1DWAM 4HNVA 2VNCA 3M5VA 3PZQA 4ZOBA 2GZXA 3CNYA 2IPJA 1BSLA 1JGMA 4L56A 5LA0A 2A21A 2C8NA 2B81A 2Y7EA 1JYVA 1UZDA 4X2RA 2BOFX 3W29A 1P43A 3W1AA 1MW0A 1JFHA 5AC5A 5G4WA 1P1MA 2CLFA 3W7KA 4CCEA 2OKOA 3HPZA 3UCDA 2DH3A 3UR5A 1SFLA 2Z7KA 3NXFA 2YZ5A 1K03A 1XC6A 1T0OA 2GOUA 4KEMA 3W23A 4B5NA 2G8ZA 3O3RA 3AICA 3LGEA 1OFAA 4K3ZA 2CBJA 4R7OA 3L4VA 4I90A 4M1BA 1E51A 2QUNA 5C9RA 1DEDA 1AH3A 1KM6A 3AWOA 1S38A 3INPA 5BYWA 2FVMA 4CVWA 1VLWA 4RUBA 3SN1A 3VOIA 1K9DA 3B8TA 2YL9A 1H1ZA 1M53A 2V9DA 2HISA 2ZBTA 4DJED 1GJPA 3N4EA 1TV3A 3KBSA 5J8LA 2PDUA 1EZWA 4O11A 2E09A 2CLPA 5HAOA 4LGXA 2FLIA 1BRLB 3TA9A 1QR7A 2X2GA 4IUOA 3A47A 5IRPA 1E4NA 3NWRA 2F2HA 3OGSA 5C9XA 5BOOA 3TXZA 2DIJA 3W2JA 3IIPA 5DBTA 2VM8A 3G1RA 1TMLA 3CEUA 1OHLA 3QBUA 4HHMA 3LCHA 4WF7A 4BF5A 2QJJA 3UJFA 4HPGA 1JZ8A 4O57A 3U3HA 5KITA 3DFHA 2ON3A 2AL2A 1I9CB 5I06A 1BHGA 3CV7A 2ZQ0A 2Z1WA 1J5SA 3MS8A 4X2PA 3UWVA 1US3A 3WUGA 1KB3A 3CZJA 2A7PA 4JL2A 3KTXA 2R1NA 1GUVA 4QGCA 1ZBVA 1ZZMA 3U48A 1TWZA 3QTPA 1J93A 3BSMA 2ZUUA 3DKLA 4H7ZA 1AL7A 6XIAA 5KZMA 1AD4A 2BWGA 1X96A 3WMBA 4FNQA 5AOUA 3W1NA 5A1AA 3RITA 2ZRYA 4Y9NA 2NV9A 4QJ5B 3P80A 4ZVJA 3ITCA 2FZMA 1KQZA 2BG5A 4DWSD 1W91A 4PBEA 4BEQA 3W1LA 2G0WA 4S38A 4YTSA 2D3NA 4H2HA 2DV0A 3VAVA 1H49A 1G4SA 5LA1A 2XWEA 3LQGA 4JTFA 2HEJA 1QJWA 1NDVA 6TIMA 5JMUA 2NVCA 3OB8A 4LT9A 3EXSA 3V3WA 4C60A 1LOSA 4G9PA 2A6LA 2VZVA 2QUUA 2Y7GA 5G2HA 2QCMA 2PDPA 2OZ8A 2V30A 4GJJA 3KOFA 2PDMA 5D03A 4ML4A 1VFUA 5EA9A 3E0WA 2IPFA 3GNXA 4D71A 1V3HA 1BYAA 2QHAA 2PWHA 1JXJA 3S9IA 2XN0A 1TZZA 4JBRA 5K4ZA 2V2CA 3MUCA 4LV4A 1CWYA 2FTPA 5JUVA 3KZSA 5FJTA 1R9ZA 1PIFA 3LY0A 4G7FA 5HATA 1JUKA 3QEZA 1VH7A 1X38A 1DJQA 3T44A 4HMDA 3MT1A 3T0AA 3IAPA 1BQCA 4KPLA 4FR6A 2PEVA 2X42A 3LRKA 3F2CA 2F84A 4R88A 1Q65A 1NFBA 2VQTA 5AVHA 1V0KA 5FJIA 2D22A 4FO4A 2YA2A 3O0FA 1ADDA 1VFHA 2RDTA 3THAA 3TFCA 1JQXA 3OOQA 1JZ6A 3QMRA 5AZ0A 4HCDA 3GTNA 3VGGA 3GZ3A 2EKCA 1VJZA 1GOXA 3KW3A 4O16A 5ABFA 3LEPA 1A80A 2SFPA 3K8MA 4I5RA 3SBFA 3LHZA 4HK6A 3UBPC 4AX7A 3UZXA 1QK0A 2XZ9A 3QV9A 2ESCA 3A3HA 1X97A 3TJ4A 2ZRVA 4FF7A 3N9SA 4G8TA 4I9JA 4MVAA 3SCTA 1S46A 3XISA 4DHGA 3QW3A 4Y96A 1J96A 2VC7A 3T6CA 3A5VA 4QJ3B 4AC7C 5FF4A 4I8YA 3FGCB 4IJRA 1M01A 3VUPA 1BGGA 3OP2A 5AC6A 1SO5A 3OLEA 1GKRA 3C52A 3FYOA 4DJEA 4M6UA 4B9YA 1ADSA 3PFRA 3QZEA 1KM3A 5A6TC 3W7PA 1W3KA 2QT3A 3C0SA 4C1NB 1XQKA 3IJ8A 3G8EA 4F3HA 4E6MA 4CN4A 1EPVA 2BXYA 2EHHA 1JDEA 4F2TA 1AQMA 1P5BA 3UVAA 1P48A 1PTGA 3HMCA 3I65A 4PRTA 1JPDX 2E77A 3ARTA 4QXIA 1TV2A 1O12A 5CJNA 4LU0A 3PNZA 3K46A 3L0NA 5M03A 2H90A 4OWGA 1Q6LA 3GZAA 1OB0A 2W67A 3UNTA 5J04A 4A21A 1OCBA 2ZC8A 3QV7A 1QXLA 4L9ZA 4DNHA 2KX9A 5IHRA 2ZCGA 4XWUA 2FZNA 1B1YA 2QEZA 1QO5A 3T0DA 1SGJA 1ZPTA 2GJNA 2B0MA 4XZLX 3QVQA 5BRBA 1KM4A 5DANA 1EP2A 5FJOA 4UTKA 4UTHA 2PDGA 3PUEA 5DY3A 2YCLA 3S1WA 2V68A 2BB0A 2ZVRA 4J27A 1ZY9A 2Y5JA 3GY1A 3WBXA 2WZIA 3UD6A 1TJ0A 3DCPA 2O4MA 4Y6GA 1UH2A 2POZA 3P82A 3WDQA 3LXAA 1DJZA 3LRMA 2R1MA 5FSDC 2UBPC 3D0CA 2QDDA 4ERGA 4UNIA 5M5DA 3QRHA 1FP9A 2ISFA 3WD4A 1DXFA 2TMDA 3P14A 2CBVA 3QV8A 4XO7A 2RJHA 3DYOA 4JTIA 1K8YA 4Q8VA 1IT0A 1C29A 2X40A 5HA7A 2NQ9A 2PP0A 1S5MA 3UJ2A 3LM3A 3DAQA 4PC8A 3ANUA 3SRKA 1FP8A 4MF4A 3WD0A 3PK7A 2CLKA 4HU8A 4GKTA 3FA3A 3AALA 4OV9A 3VOHA 3GDRA 4U3AA 4HOZA 5L9FA 1ONRA 3KLLA 3VMNA 2WHLA 1S39A 1EF2A 5DXYA 3MUIA 4HYWA 3W87A 4LOCA 4JX5A 3S9YA 4KCVA 1TVPA 2PDLA 3R0DA 3MCOA 5D05A 3KCJA 1QTWA 2EKGA 2PWEA 5CBBA 1LROA 3P93A 3QGKC 3TYDA 1R3TA 3SY8A 3WEOA 4HCLA 1GVFA 1SZNA 1OG6A 2BBFA 4AVNA 2WMIA 4QIUA 1EGZA 1XPGA 3WMCA 1RVGA 1M68A 4HB7A 4QG8A 2P0OA 1VIWA 3Q67A 4XAFA 2YB1A 2O9RA 3GBDA 1R2RA 3CYVA 3WLSA 3M6YA 3VPLA 4YHEA 2ISSA 3BAWA 2PODA 5JIWA 4OU1A 1LUCA 2WBKA 2EF9A 5FAGA 2R94A 4PB3A 1CXIA 3QGAC 3B8DA 4GVFA 3ZWSA 2YKKA 3C5QA 3T81A 3W4RA 4UXDA 2FZ8A 2X05A 2J62A 5I09A 4W4QA 1KCZA 1TWDA 4YWSA 1LG2A 4IPLA 3BLFA 4GFIA 2EBNA 3EOOA 4EE9A 4U5KA 2TSYA 3B9AA 1V4YA 3G1VA 2VUYA 4LH8A 5D37A 1JDAA 1JDFA 4GVGA 1EIXA 2ZZ3A 3EA2A 1PTDA 2WPGA 2V3GA 1L2QA 4DQWA 5CPSA 1TE1A 4Y9PA 2WB5A 1GVIA 4FZIA 3PY2A 2HCVA 1GOOA 3M0ZA 3PTQA 2FDMA 4IT1A 2VGGA 3H4XA 4LB3A 2OG9A 1TPUA 4AD2A 1H1YA 2C0HA 4GGBA 3N4FA 4JTRA 5LNSA 4HTYA 4DZHA 2IKJA 2D24A 4MWAB 3SJ3A 1WOBA 3IARA 3T1GA 1D3CA 4BI7A 3EWUA 2VEPA 2HSAA 4P2VA 3ARYA 3K8KA 4LAKA 1JVNA 4UTUA 1C8QA 3FSTA 2J7DA 1TE6A 1XYZA 1E15A 3AXHA 3NXLA 5K3VA 2YLAA 1ENUA 3WBAA 5HNTA 2RFGA 5T9BG 1UWTA 2INZA 2J8FA 3D46A 3AMLA 3LS9A 3GHTA 3QF0A 4WZHA 3VIPA 3NQ2A 5I3KA 5H8MA 4JTQA 4GRSA 4J40A 4HU0A 3RU6A 5I5RA 1F8MA 2H9AA 4FOJA 1J6PA 4N7QA 1W2PA 1HVXA 4AWSA 4OBSA 1VP5A 2QAPA 4H00A 4MY8A 1Q6FA 1YTEA 4J3VA 2FPTA 5DF0A 5BXTA 1SW3A 2J7GA 1O5XA 3H2CA 1SZGA 1OX5A 2BY3A 4GJIA 4EACA 5HMSA 4GIEA 1R3WA 1OGSA 2VFIA 4QSHA 4FSAA 4AYSA 2TYSA 2ICSA 3GC4A 4YLWA 1YXCA 5AFDA 1GVEA 5E9AA 3C61A 2FQIA 1KNWA 4J9JA 3RU8X 5I23A 2VD8A 4A2RA 1CB2A 3OQ8A 2CWNA 3N34A 6PTDA 4QG6A 1W56A 2J9XA 1QBBA 4GUJA 1M04A 2ZTJA 1R5YA 4WRHA 3OHMB 4KRUA 4WIWA 2IXVA 3GQYA 5FJJA 5LIKX 3SURA 3GH7A 1LWJA 4CD7A 4QAIA 3NM1A 1KBBA 3CHEA 2P88A 3WD1A 4Z0JA 4RZ6A 2XGZA 3MSYA 4TO8A 2BTMA 3MYPA 1EBGA 2KAUC 1HKIA 5EKYA 1LBLA 1JCTA 2YZRA 5D9OA 1F6YA 1E72M 3IUDA 4MYXA 3OVPA 3AYRA 1E73M 4H7CA 2ABBA 1POKA 3L5LA 3N9KA 3CAKA 2R1LA 2WVVA 1T40A 3W28A 4WR3A 1DE5A 4B15A 2J24A 1W1TA 1LOLA 3G0SA 5EU9A 1KFJA 1U30A 2GVLA 1GJWA 2VFDA 3TOYA 2XIJA 4JTHA 2CHRA 3KL0A 4L4LA 3H54A 2VEIA 3OG3A 2WMJA 1W3JA 4ZQRA 3ZS4A 1Q3NA 1UP3A 4MWAA 3L7RA 2FMOA 2JFEX 4J3SA 4A3RA 4KFPA 4N9BA 1MEIA 1MSSA 3I4EA 2FH8A 2NLIA 1GWJA 5TD4A 3KRBA 1L6SA 1SSDA 1GQLA 5BU6A 1YTKA 4D2JA 1JG9A 4K8HA 2QXWA 4C5ZA 2D23A 1YNYA 3SCQA 2VC6A 4C1KA 2PAJA 2RAGA 4AWTA 1RCXB 2DSZA 3WUEA 2YDAA 3NEVA 1SR0A 3GX9A 4L9YA 3U4FA 1JGIA 1FWHC 5G2IA 4KQNA 1RQHA 4C6MA 3GNPA 3ZT6A 2YX0A 3CQHA 3W1UA 3T7VA 3MUZ1 1VD6A 5CCZA 4ZQNA 1VRDA 1KBIA 4MFEA 3DHDA 3VINA 1HJSA 5IHSA 5DY2A 5I77A 1ISVA 2PSNA 1H7WA 1K4GA 4GNJA 5A6SA 2DQWA 1KWGA 2DZTA 4U10A 2DU2A 2HS6A 5CSSA 1XGDA 1X1ZA 5EMMA 3VKCA 1QNRA 1EB3A 3CHVA 4V2XA 8XIMA 2W63A 4O4VA 4WOZA 1E4MM 1HO1A 4TX6A 4Y9MA 1W1PA 3W25A 2CYGA 3IVUA 2YCKX 1Z9AA 3N13A 2W9MA 2YPIA 1W3NA 1PKMA 3GHSA 4U2ZA 1T5AA 3W24A 1N82A 4S39A 1HJQA 4DWSA 1B3ZA 1UD6A 1XLHA 3CIXA 1ESWA 1WE5A 5BOFA 2VQUA 3ID7A 2Q8LA 1DTNA 3EMZA 3PTMA 4Z2IA 2V82A 1AZ1A 4R85A 5CPTA 1GOKA 1AA1B 1UR1A 1V0LA 2Z2BA 2A5HA 4LRTA 3OODA 1FA2A 3MSGA 2WC4A 3E0FA 3MJYA 2YBTA 2BOGX 4XZ9A 3GC2A 2OEKA 3PZOA 4IX2A 1B9BA 2HNEA 5XIAA 4JQ1A 2VTFA 3CHFA 1AVAA 2D1ZA 3N2MA 2PTWA 1RCOB 1KFCA 4AMAA 3OBEA 1EJXC 1XD0A 1OFQA 5JU6A 1SZRA 3C86A 1LLZA 2E5DA 1E6SM 1JUEA 4S3EA 1V6YA 3B9DA 5A2AA 1D2KA 1V3KA 1H3GA 2IPGA 1HUVA 1EGMA 4GNKB 4NRSA 3WYZA 4RX0A 3AS1A 3P81A 1PO9A 1AZ2A 5IDZA 1TV7A 3CASA 3VNJA 1J0IA 3M0IA 4BQ2A 1AW5A 1R85A 3LZ3A 3RLVA 4Q6JA 5FEXA 4ICNA 5G1TA 2WPBA 3LK6A 3TYZA 4HMCA 1XKYA 4ZB2A 3MCMA 1XSKA 4B5UA 2J8GA 1AJ2A 1RV8A 1TPB1 1Q6QA 1G7UA 4FA3A 4BFAA 4ROQA 3GKAA 1B0IA 1VFFA 2J13A 4WD0A 1BKSA 4ZZ9A 1QNVA 3LHWA 1MWOA 4M51A 1M7OA 4RKAA 2D2HA 1FWBC 1W6TA 1V6XA 4H7VA 3WLLA 1XM3A 2Z1BA 1BG4A 5C7HA 3AYVA 3R4IA 4O19A 3BAIA 2ACQA 2R8WA 4JFWA 4B5SA 4LYPA 7A3HA 4ROPA 3W7DA 4DZ5A 4I5UA 4DI8A 1NEYA 1UJQA 2Z1KA 1HKWA 4GH3A 1Z8AA 3KS6A 2AOSA 1H50A 1QCWA 1XBXA 1Z41A 5LHFA 4IQDA 3VOCA 4O1CA 1L6FA 4KIEA 1UWIA 1YNPA 2Q09A 5I3FA 3GYCA 4PB5A 1EJUC 1V7AA 1XH2A 2ZRUA 1FKWA 4HMEA 1O60A 4AEOA 3GNNA 2Y89A 1TUXA 1CXFA 3CH0A 1J01A 4B2DA 5CZJA 2RHGA 3VDCA 4UQBA 3UP8A 1YYAA 3GNOA 1C8YA 3IJ6A 2WHKA 4ATLA 3UWYA 1V08A 4PCFA 5CSRA 1HT6A 2OR2A 2ZUSA 4F48A 3DI0A 1H09A 1O1ZA 3ONBA 1FDJA 4HSHA 3MKVA 3VD3A 2ZZ2A 1R6WA 1JD9A 3P5ZA 4Q4SA 1FCUA 4H6RA 4L4MA 1M5WA 2G5WA 3T0TA 2A3EA 4XZNX 3KAOA 3WLRA 3AXIA 1H11A 5D9PA 3L2MA 3PB0A 5CBIA 3BG9A 3TYAA 4GQGA 2OLHA 3LM7A 4MNKA 4DWDA 3ELFA 2GJPA 4IPNB 3W72A 3WQEA 1SYTA 5BRPA 3T8QA 2E8ZA 3HG5A 1UMLA 1VS1A 3V1HA 1Y8BA 4GLEA 2VZOA 4A05A 2REQA 4F2BA 4YU1A 2QF7A 1UOKA 2C6QA 3G1AA 5FF3A 3EPMA 2ZX6A 5CG0A 4AF0B 3IJQA 5M3WA 4HKPA 3VGEA 2FTYA 1QPNA 1J0JA 3D3FA 4I7UA 2XISA 4P5UA 4AY8A 4E0CA 1JZ4A 3E49A 2DW7A 3A4WA 1N8FA 4LCRA 2ZXBA 1E9ZB 1CI1A 3TLQA 2DSUA 2EG7A 3A22A 1UQYA 1W2VA 3G24A 1SR9A 4EAMA 3M7SA 2HBXA 2XWDA 3NA8A 3M43A 3GM8A 2NQLA 3RYSA 3M5ZA 5BOEA 2PCEA 1ISYA 4U31A 4PSRA 3NSMA 3V18A 4HPJA 5LZLA 1FY6A 4O18A 5LNUA 5IDIA 4YMZA 4UTTC 3NAVA 3VC5A 2ZVIA 1AH0A 1CXLA 3QKEA 3AXMA 4C6PA 4HK7A 4BS0A 2GUUA 4JYFA 2WXDM 3KLKA 1GQKA 2YCEA 2EXOA 2A79A 3F03K 2J88A 4RV8A 3KCLA 4S3FA 3WQGA 4ZE5A 3DC8A 4F9DA 5CJ5A 1FWNA 3TVAA 3B9NA 3OZMA 1GKQA 3AI0A 3VX0A 5RUBA 1CGVA 3FJ6A 3CMGA 1O68A 4MZYA 5D02A 3QHNA 3GXDA 4V27A 3N12A 2NT1A 1EX5A 4PULA 3U2OA 3VNLA 1NWRA 1PYMA 1XXXA 1KXHA 3GDBA 3MY9A 4JICA 4A35A 1GEQA 3K1DA 3EB4A 1A5CA 3U0HA 3Q45A 1Z32X 4IFOA 1NELA 4L1WA 3UXAA 3BJFA 3RNDA 3W7MA 2OO0A 5EPDA 3WQ5A 4QP0A 5F4XA 1T96A 2CBUA 1C7TA 3RM8A 4WGHA 2QCDA 3BZJA 3E2QA 1MFVA 1R47A 2GJXB 2BVDA 7REQB 2Y63A 5G2WA 2CWXA 2DZWA 4WY0B 2ASHA 4W8BA 3NPUA 4L4OA 1CGYA 3HGSA 4GCAA 4EVZA 6REQB 3RLUA 3DERA 4H8VA 2I16A 2OGJA 2Z6JA 3GDKA 4W89A 4X61A 4AZCB 3CAQA 4JQ3A 1KD0A 3I6RA 2Z6IA 4P8VA 3TSDA 4FF5A 1UIOA 3M64A 2OQYA 4NILA 3O9NA 4PMQA 2VDGA 3QHOA 3NO3A 3H2MA 1N8WA 4XKYB 4KEVA 2V3FA 3CH9A 3BLLA 2FZDA 3RM9A 4H04A 1UR9A 3BW3A 4WKHA 4CNNA 3ZO9A 1GT8A 2BASA 4XTDA 1P7TA 3QZ6A 4AYGA 1ONEA 1RP9A 5LIWX 1TTIA 3JW7A 2E6DA 4JTJA 3GW3A 4O1FA 3W7HA 4Q4RA 4YCOA 3SN0A 3WCZA 5HOSA 3ZXWA 4JGDA 1JULA 3OJGA 4Q4PA 4JKKA 3T4CA 4O1BA 1SUXA 3A9IA 3O15A 1I2QA 1W54A 3W85A 4IFKA 1JEZA 4US5A 4NASA 4O4WA 4J3UA 1GCYA 3PULA 1P6CA 4HNNA 3RGTA 4A3HA 3SQMA 3PF3A 3NR0A 2ACUA 1T7LA 4YPJA 3OZYA 4M29A 1J0HA 3O05A 4Q33A 3PBUA 4WKFA 4X3ZA 1AJ0A 4PE8A 4NYUA 2HTMA 1P6WA 4D1JA 3ALFA 4ICMA 4JCMA 5CZTA 1WV2A 4YCPA 4V1XA 4JPGA 1U1UA 2QVNA 1W32A 5JBDA 1XYFA 3NG3A 4NUWA 4DLFA 3ABSA 4LVAA 4CKQA 1JUBA 2BFGA 1QMLA 1WKYA 3QKZA 1TV5A 3PHAA 2ZA2A 3ZZ1A 2JKAA 4HP5A 2DZPA 2YA0A 4ZCWA 5AECA 4HNUA 3H2NA 1ITUA 1BWLA 1UD3A 4IOTA 3M46A 3G1FA 2J9YA 3STPA 1ZJAA 5H1WA 4PBGA 3TQKA 1L2UA 3LBOA 4WK9A 4ZXLA 1AK5A 3TFXA 2WMKA 4Q8WA 3UEQA 1N8IA 2FPYA 3VCRA 3UJEA 1REQA 2BHUA 4IIGA 1IYXA 2AQOA 1LBMA 1VFSA 1QWGA 5K9XA 1NTHA 3UQNA 2X1RA 4F2UA 3CL8A 2VZSA 3DYMA 3TXVA 3G6MA 1EQPA 3WELA 3H7VA 1WB0A 2J25A 4HA3A 3L23A 4A8LA 1LP6A 1XSJA 1I2NA 1QU4A 3Q94A 5HULA 1XIJA 2Y61A 4HNOA 5T91A 2BY2A 2HE8A 4YIWA 3UJSA 1A0DA 4IQEA 4OQVA 1HW6A 1P1XA 2EPOA 3VE9A 3DG3A 4RE2A 1OZMA 2QCDB 4ZXOA 2WOQA 1H2JA 2IMRA 3M4HA 4GUIA 3HOJA 3ZVHA 2V81A 3UWUA 4C6QA 4LSBA 2QULA 3GBEA 1BF2A 1TTQA 3I3DA 5I3DA 3P2VA 4FPSA 2J7BA 3R12A 3PS7A 1TA3A 3NOEA 2Y62A 1FOBA 3IRSA 4KRTA 1B4KA 1V7YA 2JF7A 4I7VA 4ACZB 3WH6A 5LYRA 3BL3A 1AQ0A 2VJXA 1FUYA 3UETA 1UWQA 3LPPA 4S23A 3WQ8A 1W5QA 1BFNA 3AMDA 4NT0A 4S3GA 2TPSA 1MMFA 1TELA 4OJYA 5JIPA 1U2YA 4FLSA 3KOYA 1E6RA 1GQIA 2ZZ5A 3FEQA 1HJUA 3AJ7A 4FOUA 1KFBA 3IWPA 2XFFA 4AXKA 5IM51 4YVVA 1HXJA 5D8ZA 4A3YA 2PWDA 3F5LA 1A5LC 3ITGA 4IPIA 1A3HA 2VX4A 3L5MA 4GYKA 3G1YA 1A5OC 4C1LA 4MWAD 1S3TC 3TC7A 5G4EA 1V5XA 5HDRA 3T0CA 1LT8A 3WQDA 3W83A 4X0NA 1S2WA 4E2BA 2BLEA 1XWYA 2FB2A 1AQFA 3WD3A 2Y7DA 3D5HA 1UD5A 1VF8A 4CQBA 2GDQA 1LT7A 3U7BA 5I0DA 4UTJA 3HZ3A 3BAYA 3H12A 4GO9A 1W3LA 1UZHA 1HNYA 3O07A 3V16A 3GXTA 2VDHA 4C6IA 3D6NA 3KEHA 5D32A 4DI9A 2HWGA 3AJXA 1XLCA 3S2LA 2VWTA 2ISWA 2OVLA 1EH9A 1YPFA 7XIMA 4W86A 3RR4A 1KM5A 2EPLX 1K70A 1YADA 3GW0A 5BNKA 3NVTA 1ZRQA 3N15A 3HO8A 1IT7A 1HQTA 4NKCA 4D8LA 1MUWA 3QY7A 4XD4A 1BWVA 2E3ZA 4REQB 4CEXC 2XSXA 2XM2A 1F5ZA 1I0BA 4TVDA 1IWBA 5A3HA 1YNQA 4I8DA 4C6KA 1WNOA 3DH7A 3HB9A 3VYLA 2I9UA 4ZMGA 3NQGA 1WBJA 5J5RA 1WP6A 4QQ3A 3ATYA 3RJYA 5DELA 1BLIA 3UCCA 3MWAA 3ZR6A 3VMPA 1OYBA 3QMSA 4D72A 3Q37A 1A53A 2V5CA 1OD0A 1I2PA 5ECUA 4GZIA 3UR2A 1NVMA 3HV9A 3RO8A 1Q6CA 4S3KA 5GQBA 3UPWA 4ZB5A 4UFMA 2D20A 4DJFC 1S3HA 3CU2A 4K39A 3BOXA 1RJQA 5EMYA 1LLOA 3SRDA 4EAYA 4UWMA 4RL3A 3U5UA 1TR1A 2FJKA 4MJ4A 1NARA 2XVNA 3UJRA 3VE7A 4GUHA 4D6GA 5C2GA 3G77A 1KBLA 3CWNA 4GPNA 5ENLA 3V35A 1WA3A 4F0RA 2I9EA 4RLIA 2PF0A 4IX0A 2ZZ4A 4EX4A 4I9AA 1IR2A 2YYTA 3IEBA 2DVTA 4W88A 3Q65A 4JIHA 1R2TA 3JZUA 1Q6DA 3CC1A 1DBTA 1CCWB 3NQMA 3QZAA 2DSKA 4UTMA 3WH5A 4XBJA 1E4LA 4QTGA 2YW4A 2E6YA 3R2GA 4FX7A 4QBXA 3ARPA 1E1CA 1YDVA 3QLDA 2J4GA 2VOMA 3WD2A 2CKSA 3UF9A 3MO7A 4GXWA 2Q02A 4TV5A 3VIJA 2C15A 2HDJA 3FAXA 1OINA 3PJXA 4WY0F 4UR7A 3TQ0A 4XAYA 1PBGA 1X6NA 2G4JA 3CUJA 1GGOA 4H6QA 4ZQCA 3IIVA 5DMNA 3VFLA 1QI2A 1GYLA 2WCSA 3G1HA 3BQ5A 4DUWA 3BOFA 3F7JA 3ES7A 1RR2A 2E9MA 3R89A 2KZHA 1RSCA 5C70A 5CPMA 2EJ1A 1JDDA 2JEPA 3BDKA 4DJDD 1CT5A 1G69A 4HA4A 4PMUA 1FRBA 5G1MA 3URAA 5K4XA 4ZA0A 3GG1A 2UZ9A 4IF2A 2HMCA 3IGUA 3TC6A 2QAFA 1K02A 2VT0A 4QQUA 3W7QA 2ZYFA 3SO7A 5C71A 1O4UA 2NQHA 1PX3A 3UG5A 3P3BA 4IG2B 3PZVA 2O56A 3E02A 4KW2A 2JKEA 5A6KA 3V0UA 2G3JA 4BJHA 1PSCA 3RLHA 1NP2A 2BHYA 1KRCC 1UQZA 1FFQA 4HZ8A 1R3YA 1VRXA 3C6CA 3M0HA 3WENA 3R8RA 1UCWA 1IXOA 5CC3A 5EMKA 4BQ5A 4H4IA 1JQVA 2YL8A 3EB3A 2GFTA 3STCA 1FWIC 3WNPA 4KETA 5F2IA 2X41A 1SFTA 3EWZA 1TSIA 3DZ1A 3W1MA 4WVXA 3TUUA 4GHRA 4QX4A 3AQUA 1GTHA 5HNUA 4WEVX 1RXOB 2PZNA 3VO0A 5J5DA 4BCEA 2FJUB 4C6NA 4N4PA 4QFUA 4DWSC 1JAEA 2OX1A 5I03A 4YNGA 1IXQA 3QSTA 2PBGA 3PJWA 5A8PA 3DFTA 1J2BA 3GXNA 2ZXAA 3LLFA 3E6EA 3B40A 5D33A 2GGEA 3LTPA 3UWEA 4Z2GA 4GA8A 3DBPA 5LGXA 1Q4NX 3BC9A 2J7HA 3VOGA 3W70A 2JQXA 2EGZA 3CUIA 1BYDA 2GK1A 2ZUVA 2DZAA 5JXQA 5A6AA 3B8WA 1AUSL 1FWEC 2E5CA 1HTIA 4DAIA 1PKNA 1JF6A 1SM9A 4IZGA 4L65A 3TW6A 4NI8A 3TYBA 4FIQA 2PB1A 3AROA 1RAKA 3NDZA 4S3CA 3S9ZA 1BAGA 2FPVA 1GONA 4NXKA 5FJPA 1EF3A 1E3XA 3M5XA 4YS1A 4Q7IA 3MQTA 1ZUAX 3RPMA 2XFWA 4TX8A 1XH1A 1UIPA 3GO2A 3DGBA 1NIUA 1HJXA 3RFAA 1JRBA 4H9VA 4P7QA 3S2NA 2EPHA 4AXNA 1NM9A 4G7EB 1TPWA 3RXZA 3CHDA 3WLPA 4MAZA 1R3VA 3E2VA 1B30A 3RRAA 3BVJA 3GR4A 2W3ZA 4ZOCA 3DHFA 3YPIA 3IAQA 5EFFA 1G9HA 1RH9A 2OO6A 4H9XA 2NQ5A 2VFGA 1VFOA 3R79A 2B7OA 3KWSA 1OX4B 4Q8NA 2YL6A 2ZUWA 3NQ8A 3A5FA 1QK2A 1ZL1A 4LCQA 1UC4A 1KFLA 2XUCA 1K8CA 1XX1A 4NSBA 3DIPA 4RW5A 2RH9A 1XIGA 1HO4A 1WUEA 4KWVA 2WQDA 2A3AA 4GISA 4U4MA 1IIHA 2J6VA 3S5ZA 4LBSA 1XSIA 4IMDA 1ICPA 5KSWA 1MUMA 3SM0A 5CKSA 2ZIDA 2GL5A 4MOZA 2EPMX 3EDFA 3BUVA 1L8PA 1QNPA 4XIAA 3TJIA 4C65A 1M6JA 2I17A 3HPFA 6REQA 2XSAA 4DY1A 3M7WA 3IANA 3BWWA 4ZO9A 3U8GA 2UY2A 4LAZA 1TR9A 1G6CA 1G0CA 4GFSA 4JTTA 3W7OA 3WJWA 5HWMA 5E0KA 2CIPA 3SFWA 4RNJA 3N2XA 3HGRA 3BMVA 2R82A 4BA0A 1UKPA 4WCJA 2QIIA 4W93A 2DQXA 1WUFA 4AUBA 5LHEA 3I6TA 2ABAA 1DJNA 1XRVA 4CNOA 2OT0A 2J74A 1S5VA 2O4QA 4ORIA 4PTVA 4DPPA 5ABHA 1BGAA 2YSWA 3S83A 1HF6A 3SCOA 4LEFA 2NX1A 2P3ZA 1PCKA 1JCNA 2AAMA 1O66A 1OK6A 2C16A 1JPMA 4N2YA 3UR8A 5CLTA 2DZSA 4P8WA 1DPMA 2PS2A 1O6IA 4PYSA 3SGUA 1FWWA 1G4EA 2IXUA 3ORWA 2VCBA 4PTWA 4MLJA 4IIEA 3L12A 1DHPA 3P61A 3UESA 4O13A 3GG7A 4XQ6A 6XIMA 1E0XA 3RM4A 3GVVA 1X7IA 4NU7A 1EXBA 3VXGA 3NPXA 1R2SA 3E74A 3W07A 3ZQ9A 3DHUA 1S5TA 2H3BA 1TQXA 4LAMA 1X98A 1WX0A 3B8VA 3EX3A 4E3TA 2FHBA 3FV9A 4UQCA 4IGMA 2DEPA 4M6QA 8CGTA 2VRKA 1KLZA 1JL8A 3L65A 2YDQA 4M3PA 2WAGA 3DESA 1ISZA 1ONXA 1RVKA 3ARRA 3P6LA 5FEWA 5A6MA 3NZQA 2QJHA 2I5QA 5KMYA 3A4XA 2PBOA 5HMDA 1AQHA 1H7PA 1Y5VA 4D6FA 4IPPA 3WH8A 1VYRA 3NQBA 2XHYA 3V5CA 5A8GA 4O52A 3AO0A 4WDUA 3DECA 2EAWA 4JIRA 1K9TA 1IEQA 1RBOB 3W76A 4DBSA 4OT7A 1V3JA 7TIMA 3PC0A 3TTOA 4QS6A 1KV8A 3EKZA 1R7AA 1TCMA 5E6YA 1DVJA 1M7PA 3SGGA 2IKGA 2V69A 3ISIX 4AU0A 3UXIA 4DYJA 4OKDA 1US0A 2L5HA 3N29A 1UP0A 2CXGA 3WLHA 4AZ7A 2D0GA 3HURA 4J3ZA 1UUMA 2C14A 2PTXA 1UD4A 2CEQA 4LS1A 1JDCA 2X16A 2Z28A 3WUBA 1XLFA 4AY1A 3TP4A 4OBRA 3UYCA 2D3LA 4PCSA 1PE1A 4V15A 4DB7A 1OX4A 4R7JA 1OM0A 3KRSA 3VKJA 1ITXA 2IQTA 1VPYA 3NQ7A 4CCZA 5PTDA 4CCDA 1ZHAA 3K4DA 5D2VA 2OELA 4BI5A 4UQAA 1LRNA 5HBFA 2NVAA 3NL5A 2BZNA 4HT3A 3TE9A 5C2XA 1XLMA 1GJUA 3RILA 5LKYA 2E1DA 2DIKA 3EDJA 3NL6A 4MHBA 3S8HA 4M0XA 3PBMA 3STFA 1GYMA 1U22A 4HU3A 3ZJ6A 4Z2LA 2YA1A 4ZEPA 3PPCA 1SO3A 3L0KA 5C9UA 1W37A 4GZJA 2FGLA 1OC6A 4PTNA 2O7QA 3CMJA 2VC5A 5D09A 5BWFA 1QPKA 3ME3A 2PA6A 1RZMA 1WPCA 1WAWA 2O55A 3B9OA 2GOKA 4L6OA 5BMXA 3QFEA 3ABXA 3CQKA 1CENA 1B5TA 1E3ZA 4M6PA 3VCNA 4UFIA 1F6KA 3WY1A 1KRBC 3IJ7A 3SADA 1RY8A 2AL2B 2VFEA 1CLVA 4UQDA 4LUJA 5AYZA 2G97A 1W1YA 3PG8A 2NWSA 3WF0A 1XG4A 4FHAA 3G5EA 4IMGA 3WFZA 4Y8FA 4QR6A 1PZ1A 1TRDA 2DZXA 3H6OA 2QIWA 4KGJA 3ERPA 4N02A 4NZJA 3W7JA 4NG3A 3FIGA 1TFVA 1DJXA 5C6MA 1TV4A 3GLCA 4MTVA 3BXWA 4N9CA 4PUDA 5DRIA 4HA1A 4XZMX 1HP4A 1V3MA 1H51A 1GOQA 2E9LA 2P3EA 2XJ7A 1GNXA 3TNBA 3UNDA 1CLKA 5BCAA 3A21A 1W9BM 1XH0A 1I0DA 3GHUA 3LLDA 3L2IA 1IWPA 4Z2KA 1UPPA 3NZ1A 3F4DA 3ARXA 1BXNA 3V0TA 2O9TA 1OZQA 3UPMA 1KRMA 4FIRA 1PPIA 2E6AA 3WL1A 2Y8VA 1PDYA 2NLYA 1KM0A 3MDUA 2WJFA 4Z0SA 3S6TA 3MCNA 1GOIA 5H8UA 4BQ4A 1W3HA 3LHVA 4QCFA 1GK8A 3TV8A 4UOJA 5DBUA 5BZAA 5HUOA 4E4PA 2W62A 1OCNA 2CLHA 3IS4A 5F1UA 4RPQA 1YE6A 4NJKA 3AOFA 4LX4A 4ZENA 6ALDA 2CZFA 2BVWA 1A5SA 3CPUA 1C92A 3ARSA 4JEJA 4FAMA 3TYEA 1VC4A 3CIVA 4GMEA 1FH7A 4GC4A 2E5BA 3A9BA 4Y9AA 1JCLA 3CB3A 3BJTA 3GXIA 3BV7A 2YFOA 4IISA 3ZJKA 1P0EA 2J6XA 4NXSA 1MXSA 3KBJA 1FWRA 3QMTA 1XRFA 3SUTA 7ENLA 2HVNA 3E2SA 2B7NA 3PG9A 1VJIA 4JTCA 2OPJA 2TAAA 5CBJA 3WMSA 3PAOA 4LUIA 1Z6KA 4YYFA 2DJXA 4F8XA 4ZFCA 1E9IA 4GOAA 3TN5A 3SB0A 4DRSA 1MW1A 3APYA 2NT0A 4N9EA 4G5DA 1WDRA 1NWSA 4KGLA 3KBNA 2PTZA 1KTCA 1NP0A 5G4HC 5FL1A 3J7HA 4J3XA 1AW1A 1YKWA 3LRLA 1FCVA 4XX6A 4MPQA 5CGTA 5FEZA 3TN3A 3IK2A 2OSWA 3G1DA 1Y5XA 4FNRA 5U4NA 1UYQA 4GYPC 5TF0A 2QKFA 3PBYA 4ZFMA 4Z17A 5F4SA 4X9SA 3APGA 1EFZA 4LVFA 1L8NA 1TMHA 4RPPA 3EMCA 4X60A 2H3DA 3T4WA 3QQ1A 4DJFA 4KWOA 4LPCA 2NSXA 4R53A 3ZOAA 4RE0A 3OBKA 1YDNA 4J2MA 3I7SA 2YXOA 3URNA 2WHMA 2ZUTA 1H1NA 1LL6A 1XINA 5CXPA 4BF7A 4F40A 1Q8JA 3NL2A 2J7FA 3QC3A 1P7TB 4LB4A 4IICA 2QCEA 4AD5A 3PZUA 3IVSA 4MMWA 5DFAA 1Y65A 2QUMA 4Q6XA 4A2SA 1OFEA 1XUUA 3SCVA 1VR6A 1DE6A 1OF6A 1W9DM 1K9FA 2Z25A 3MMUA 4GZEA 3AIBA 2VWSA 3FW6A 1F07A 4CU6A 1HKJA 3ZSTA 3WO8A 3EKLA 3EWCA 3CO8A 3AU6A 4ZR8A 3A24A 2OOFA 2FH6A 4HQVA 4ZO8A 6ENLA 3L4UA 3ZLGA 3V5OA 1GG1A 2C1IA 3ZM8A 3PJTA 4JNZA 1FWFC 4FX6M 2XFYA 3BGAA 1XUZA 3NO1A 3T42A 3WF1A 3GVWA 4PL2A 3P5YA 5I78A 3LLXA 3SCPA 3S2JA 3N19B 3FKKA 1BTMA 3TW9A 4HYRA 4U5IA 3WLMA 1A0CA 3EWXA 1OQFA 2VYOA 4K38A 1XV8A 1ZALA 2VRQA 3VIKA 2QMKA 1REQB 1BWKA 3L4YA 1HGYA 5CC7A 2IS7A 1D9EA 4IIHA 2PGRA 4O0QA 1CW2A 2JK2A 3RDKA 5D30A 3GDTA 2V5DA 3TA6A 1TMQA 3I7QA 1R9XA 4RV3A 3GXPA 2UV8G 4E2VA 3HQNA 1X39A 2C91A 4MFDA 1MQPA 2F8QA 4RNHA 2Y85A 2PDBA 2BY1A 2C1GA 1CIUA 2WQPA 3LPOA 1ZCCA 3K1GA 3ARWA 2BHZA 3VD7A 3UCQA 3KBMA 3ITTA 1DJHA 1VBGA 4NZCA 3CT2A 3IIXA 3WBEA 3AMKA 3E96A 1AL8A 4TR9A 1UJPA 5D38A 4J3TA 3C2OA 4PSPA 3E5BA 1DIKA 4R5EA 3LPGA 3GAYA 2J27A 4PN2A 1VCFA 1ZNNA 4FK9A 1KGWA 3MI6A 5BRQA 2OSYA 2GGJA 3K5XA 1U5JA 3AIQA 4GY1A 2RDXA 3T05A 3OGRA 4CQDA 3WLOA 2X1UA 3BSHA