2NQJA

Crystal structure of escherichia coli endonuclease iv (endo iv) e261q mutant bound to damaged dna
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
279
structure length
279
Chain Sequence
b'MKYIGAHVSAAGGLANAAIRAAEIDATAFALFTKNQRQWRAAPLTTQTIDEFKAACEKYHYTSAQILPHDSYLINLGHPVTEALEKSRDAFIDEMQRCEQLGLSLLNFHPGSHLMQISEEDCLARIAESINIALDKTQGVTAVIENTAGQGSNLGFKFEHLAAIIDGVEDKSRVGVCIDTCHAFAAGYDLRTPAECEKTFADFARTVGFKYLRGMHLNDAKSTFGSRVDRHHSLGEGNIGHDAFRWIMQDDRFDGIPLILQTINPDIWAEEIAWLKAQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*GP*TP*CP*CP*(3DR)P*CP*GP*AP*CP*GP*AP*CP*G)-3'
molecule tags Hydrolase
source organism Escherichia coli
publication title DNA apurinic-apyrimidinic site binding and excision by endonuclease IV.
pubmed doi rcsb
total genus 105
structure length 279
sequence length 279
chains with identical sequence B
ec nomenclature ec 3.1.21.2: Deoxyribonuclease IV.
pdb deposition date 2006-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 2nqjA00
3KCOA 4K3ZA 1XLHA 2XISA 4X63A 1QTWA 1MUWA 1XLKA 3TC3A 2HCVA 4DVOA 2NQHA 4YTRA 2ZDSA 4PGLA 3CQHA 3P14A 3M0HA 3CWHA 1S5NA 5H6HA 1XIGA 1XISA 3QC0A 2QUMA 3AYVA 1XLFA 3KBJA 2HK0A 3AAMA 4YTQA 3VNKA 1XYCA 2QULA 3ITXA 3U3HA 3IUHA 3KCJA 3CQJA 1XIIA 4QE4A 1MNZA 4A8LA 4LNCA 1XLMA 3UXIA 3ITLA 3JU2A 3NGFA 3KCLA 4ZBCA 4GLEA 3KBWA 4Q7IA 4A8RA 3C0SA 4QEEA 5XIMA 8XIMA 4PFHA 1OADA 1XIMA 2J6VA 5H1WA 4QE1A 1CLKA 5I7GA 4QDPA 3GNXA 4US6A 3P6LA 3CNYA 4GJIA 2X7VA 2I56A 1D8WA 2QUNA 3KWSA 1XP3A 2G4JA 5AVNA 3M0VA 4GQBA 3DBNA 2GYIA 3KTCA 1DE6A 4J4KA 4ZB2A 3ITVA 4QEHA 1XIHA 3U0HA 1QUMA 4YTUA 2X7WA 3BDKA 3XINA 1DIDA 1K77A 3VYLA 3L23A 2GLKA 5AVHA 3XISA 4W4QA 3AALA 3BZGA 2QW5A 4HHMA 4XIMA 1XLAA 3QZAA 3VNMA 3KBMA 1XYMA 6XIMA 5FA5A 4XIAA 3KBVA 4HGXA 2Q02A 1DXIA 3BANA 3DX5A 4X60A 4A8NA 5XIAA 6XIAA 1XINA 1XYLA 2GUBA 4GJJA 5EMJA 1BXBA 2XIMA 2HK1A 2G0WA 5EMMA 3ITTA 4EAYA 5B7ZA 2XINA 1A0CA 3TVAA 1XIJA 1S5MA 1XIDA 1I6NA 5B80A 3M0YA 2I57A 3VNJA 2NQ9A 3KBNA 1QT1A 4XSLA 4G56A 3AYTA 3KBSA 3CQIA 4OVXA 3M0LA 4YTSA 1XLJA 7XIMA 3WQOA 1A0EA 3IUDA 4QDWA 3UA4A 4A8IA 4DUOA 2NQJA 1XIEA 1BXCA 1TZ9A 3QYSA 8XIAA 3UA3A 2OU4A 3ITOA 4XISA 3M0XA 3BZJA 3N4AA 3UVAA 4ZB0A 3OBEA 3FVMA 5C9ZA 3VNIA 4QE5A 3M0MA 1XLIA 1I60A 1XLDA 4HNOA 4K1GA 5XINA 1XLBA 1XYAA 3UU0A 1XICA 1XYBA 3QXBA 3C0LA 3VNLA 5J8LA 3IUIA 5B7YA 4X61A 4ZB5A 1YX1A 2GVEA 1XLEA 1XIFA 1XLLA 1O1HA 2ZVRA 5EMLA 1A0DA 5TNVA 1XLGA 3CQKA 4XKMA 4EACA 1XLCA 3LMZA 3BWWA 9XIAA 4KW2A 4YTTA 4XSMA 1DE5A 4HHLA 1DIEA 3ITYA 3XIMA 4E3VA 1GW9A 1XIBA 5EMKA 3C0QA 9XIMA
chains in the Genus database with same CATH superfamily
3A5VA 2H90A 2ZZ6A 2VI0A 2D1ZA 2I9EA 1TRIA 2Z24A 2FPVA 2ZXBA 4I9JA 3HPSA 1JF5A 3P0WA 4QQ3A 2O0TA 1W2PA 5BNKA 2F2KA 5I5RA 3QW4B 4L56A 3C8FA 2RJHA 2KAUC 1XI3A 1TREA 2Y5SA 1K4GA 3CB3A 4GBUA 3O1NA 2PLMA 1DJXA 1WDSA 3U6WA 1XD1A 1H7NA 1A4MA 2XSAA 3QR1A 4XK2A 1NTHA 1PX3A 2ZC1A 4O0QA 1JPHA 5AYXA 3ZLHA 3W1PA 4CU7A 1S5WA 1US2A 1B3OA 1JVNA 1GZJA 2QJGA 1VFMA 5C55A 1VCFA 2OX4A 4MF4A 4LOCA 3RM9A 1Z41A 1P6BA 5D09A 4M56A 4PMZA 4IIDA 3AI0A 4FNRA 1KKRA 3N3TA 4IGMA 1RR2A 3N2TA 4GPNA 2PTXA 3GFYA 5M03A 1BRLA 1ME7A 3FYYA 3FJNA 4JQ3A 7ODCA 1F3EA 2PWFA 4WDUA 3EB3A 5FIPA 3OVPA 1XSJA 3GTNA 3CZLA 3WQCA 5JXQA 2D73A 3BICA 8A3HA 2E1WA 5D8WA 3ARPA 4UNLA 4A35A 2GJPA 3QY7A 2PLJA 3C3UA 1XYFA 3HGOA 1XJBA 3QFWA 3HA1A 3U8GA 1Q6EA 2JQXA 4KCTA 3P74A 1JCMP 4TIMA 3HOJA 2HS6A 2OEJA 1KM6A 4Z1DA 4IICA 1LRNA 4FEZA 4GNKB 2A2IA 1PCWA 4WR3A 3WEOA 5PTDA 3NQ2A 3RF9A 3MO4A 1OX4B 2PDYA 5GNXA 1IXPA 4IGHA 3I10A 3R0DA 5MHBA 1G1YA 3QR0A 5C70A 3LQGA 1ZBVA 1EGMA 2VUYA 5FJIA 1F3TA 1W1YA 1JI1A 4ZFCA 3E2QA 3LDVA 4TQTA 4BJHA 1A5CA 1S2UA 1TSIA 4JFSA 2C71A 3G1VA 4K37A 1ZL1A 1UH4A 5U7SA 3MU7A 1BHGA 3QMSA 1BXBA 1H11A 2F9RA 3AU6A 3L65A 2NQ9A 1YMYA 2WSKA 2Y7DA 3C2VA 1HJQA 4RE0A 2V2HA 1OFQA 3DFPA 1V7AA 2JF7A 2WYSA 4WDTA 3IJ9A 4N0RA 3TX9A 1WNOA 1M9HA 1RCQA 4OV4A 1KM4A 4CLMA 2V2CA 4DBUA 4X61A 1XM3A 4K2SA 3HG5A 4PC8A 5G1YA 4LX4A 3BJFA 3GU9A 2PTYA 4DB7A 3EDFA 1RY8A 2XVGA 1RZMA 4YWIA 2ZDRA 4O14A 1V3LA 2QF7A 2ISSA 3O05A 5BXTA 4O8RA 5A6BA 4NZ3A 4LF1A 4J3VA 2DH3A 4ZFMA 4GIYA 3D0CA 2VR5A 4P7NA 3H2OA 4AYSA 3GNXA 3WNLA 4CKQA 3RCYA 5BMWA 3TV8A 3HB9A 4XB3A 3EWWA 1Q13A 4HOXA 4CGTA 4FF7A 1YXDA 3W26A 3NZQA 3LCXA 5HJXA 4LB4A 1JNDA 5LXXA 2OKOA 2WPGA 4B90A 5CPNA 3VILA 1A0CA 1LORA 3M0YA 3VINA 3W73A 4U28A 1JDDA 2WNQA 3L4VA 4DWSA 3O9NA 4R27A 1FWBC 2IXVA 1V3HA 1UA7A 3VIJA 3TTQA 1EOMA 3B03A 4Q8VA 4M81A 3DHDA 1Z3NA 4AD5A 1H09A 3ARWA 2ZA1A 3AU2A 5IBXC 3GH4A 1Z6KA 5DMNA 1AK5A 3MSYA 1TMHA 4ZXOA 1P6CA 5LGZA 1W8SA 2OVLA 2PODA 7PTDA 4JAWA 2XG9A 3QZ6A 1TR9A 3CQ0A 1LUCB 3STCA 3UPMA 3GHUA 3OB8A 5HMEA 3DOPA 1M01A 3D6NA 1H2JA 2ACSA 1KRAC 4P7QA 1T41A 1C90A 3N2OA 3W1QA 1ZU8A 1I2NA 3PN8A 1UD2A 2ZZ1A 2W63A 2Y8VA 3V5FA 2G4JA 4NHVA 4W8LA 1TX0A 1DE6A 1JYNA 4OE7A 3KL3A 2FB3A 4DLFA 1QUMA 1TCDA 1F6KA 1VPQA 5JMUA 3T0BA 1YTEA 3H22A 4S3EA 3PBMA 3NSNA 4ML9A 1VHNA 1ONWA 5HULA 3S4TA 1KRMA 1Q3NA 3LI0A 4UWMA 4QS5A 3NWRA 4L9XA 3O15A 3LB0A 4V28A 3HQ1A 5B80A 4LANA 3MT1A 3LD5A 1FCVA 3MMUA 1FHUA 2NQJA 1L8NA 3EX6A 3JS3A 1DXEA 3CZEA 1E3ZA 2EKCA 4UFJA 4LUTB 3SCWA 1OYCA 4A2RA 5AYIA 3MCNA 1O6IA 2YDRA 2PD9A 1WDWA 1NOFA 2HJPA 4DN1A 4B15A 1UHVA 3SCPA 3RR1A 3H2FA 3RK8A 1TPDA 1CXLA 5AB3A 1SZGA 1XKYA 2Y5EA 1W9PA 1K03A 1D3GA 1RBAA 2DY3A 2PRLA 2GK1A 2FZMA 3R58A 3LTPA 3EX3A 5DCBA 4XZMX 4D8LA 4C1NA 5I02A 2JE8A 2GUYA 1F6PA 3LMYA 3K4DA 3KDNA 4FXFA 1WDDA 1NFBA 3SSJA 3FOKA 3VKDA 1XS2A 1WDPA 2YXGA 2ZKMX 3WEZA 1L6GA 4Q8MA 1KXVA 4HHHA 1O94A 4Q4QA 1L6YA 3WKZA 1LWIA 1QI5A 4P8VA 3B9OA 2PSNA 3FX4A 3G18A 1AJ0A 1TUFA 5CPTA 1LBMA 3K1GA 5IDIA 2DW7A 1V0MA 4IPPA 3TN6A 2D22A 3WLPA 4J2PA 3KBVA 1KXTA 4UZUA 4DNMA 3WQVA 1UPMB 3DESA 1OC6A 4DUXA 3VIKA 2PS2A 1UW9A 1OFEA 3NXLA 2FDMA 1XLJA 4EP8C 3DHFA 3OTRA 2J13A 3UY7A 3WUGA 3GDTA 2RH9A 4W7WA 3EA3A 2HNEA 1OCQA 1ML1A 1F8IA 4C1LA 1HL9A 2OB3A 3S46A 5GPRA 1I45A 5FI8A 3DDMA 1WKEA 1ZB5A 4QROA 3G8RA 3AOFA 2CLHA 3BAKA 2HBVA 1CGYA 3BG5A 3H12A 3TMQA 4W7UA 2B4GA 3HPFA 2X0YA 3BGGA 3PG8A 4Q4MA 2WC7A 4AW7A 4BS0A 4RZ5A 1ZALA 5ABGA 2Z0IA 3IIXA 1J18A 1HW6A 4ADSA 2Q8LA 1TJ0A 1VQTA 3SRFA 1QNVA 1E6PA 1R3QA 1C7TA 2XVKA 4XAZA 3LSBA 1M7XA 5CAHA 3ITLA 5CZTA 4YCPA 1P4CA 4FALA 1TE1A 1J0YA 2VZSA 2GPTA 5HATA 3QKEA 4LTSA 3WD4A 3QQ1A 2EG6A 4HP5A 4UFIA 2VVSA 1LG2A 1TR1A 4ECLA 3I6EA 4ZOCA 3ZQ9A 4C7DA 2YR1A 5H91A 5FJUA 1R3SA 2EBNA 2CBVA 2Q3OA 2Y89A 2VMFA 1GVQA 4MPKA 3MKKA 1W9XA 1MNSA 1XYMA 5FA5A 4AZGA 3FKKA 1XGDA 3U7VA 1ZRQA 4GXMA 1LJYA 5G2HA 2OKTA 2VGBA 4U33A 1JCYA 2WMKA 1DEDA 1YQ2A 6REQA 1I0DA 4OOZA 3KBSA 4PR4A 4AB4A 4V2XA 4D6FA 2YYTA 3QQ0A 4P7RA 4PMRA 3SCQA 3FXYA 3B3DA 1THFD 2PC4A 1E72M 2JKPA 4B5NA 3HG2A 3CPRA 4HCHA 1QOXA 5DXXA 4JTAA 2BS9A 3VOIA 4XG1A 4XZWA 3LENA 1RK6A 1GCYA 4LEQA 2R1NA 1IZKA 3PJUA 1MUCA 4ATWA 1J0KA 1U30A 2VURA 2AGTA 3NQ7A 4NYYA 1EHNA 4H01A 1JULA 1OZQA 3RLHA 3T8LA 3OPSA 5H1WA 2E7FA 4MZYA 3CNYA 4ROQA 1E4NA 4ENLA 2YYUA 2EPHA 2OX1A 3PPFA 1HP4A 6TAAA 3PWAA 3M0JA 3U0HA 1TVNA 3B8SA 2CHNA 4MWAA 3CMGA 1XCXA 1GKRA 5A6AA 4Y6GA 3GDMA 5ABEA 4RL3A 1F2JA 2VOMA 1NY1A 3DG7A 3JVAA 1MSSA 2FTPA 3UXAA 1Z48A 1E70M 4DF1A 1JDCA 1T8QA 1WZMA 1BXCA 1ME8A 4MWAD 4UOZA 4YYFA 1FWCC 4GY7A 3GYCA 1SJCA 1JPDX 5FEXA 3TJLA 4JTHA 4TMBA 1XICA 4MNLA 5HA7A 4KGJA 3PJTA 4O10A 2JF6A 1UWUA 3APGA 1EUNA 3CIWA 3NOYA 1SQ7A 1L6WA 2ZUMA 3DBPA 1XIBA 3V75A 3AFBA 1E6SM 1KFEA 3T7VA 2FLIA 4F0MA 4WK9A 3VGEA 1TJRA 1GJPA 3M6YA 2DU2A 4AXNA 4GIRA 1SJDA 2VCBA 2V9DA 1NELA 4ZR8A 4C6KA 4BI6A 3W4RA 3RYSA 4JY9A 4HCDA 3LCWA 3QLDA 4Q7IA 3WJXA 3LCHA 4YVXA 3P62A 1U83A 3BAJA 3U4FA 3LS9A 1JL8A 4LRTA 4K6AA 5I09A 1R3TA 2X7WA 3CT7A 1WUEA 3B0XA 4H7CA 2CZDA 4R3UA 3RN6A 5CC3A 4O1CA 2PI6A 3HMJG 3SEPA 5EMJA 3OLEA 1RLDA 5CAKA 3TLLA 3TVAA 5A1AA 1H3GA 3B04A 4M5PA 3VNJA 2ZZ7A 1R9XA 4LSBA 4US5D 4WSHA 3WH8A 4A3QA 2VWTA 1JDEA 2OLHA 2VZTA 1UUMA 4Q33A 3W7GA 4PTXA 3MQTA 3R8HA 4NAEA 3PJXA 2W0UA 1JZ7A 2XU2A 4UQCA 3PWIA 1RCOB 2GVLA 4XVDA 4HA0A 4CNSA 3AHZA 4Q6XA 4BZYA 2HNHA 2ISWA 2Y70A 4NAEB 3QF0A 1GK8A 4LAOA 1IEQA 3TONA 2HCVA 3PPCA 3A47A 1EUAA 3S2NA 1EL3A 4GY0A 3PZIA 4F9JA 4L9YA 4JDYA 1TVLA 4B9YA 1RALA 2XDFA 4Y9NA 3W7DA 2ZRUA 1IQ8A 5TD4A 4C6JA 1YPFA 4H19A 3M7WA 3MHFA 3F4DA 4HKPA 3PHAA 4AC1X 4GYFA 4D6CA 4E4PA 3EDKA 5CH9A 2A6LA 1OCBA 1PBGA 4EWJA 5HNUA 1YTKA 4L1WA 3WJZA 4GYKA 3SGGA 4UTKA 2TYSA 4CEUC 4L9ZA 2PU1A 3U2CA 5BU6A 2WWCA 3S5ZA 4U5IA 4GH1A 1LF1A 1MW0A 1RH9A 3KBNA 1UZHA 1G6CA 3PG9A 3EB4A 4HSNA 4DQWA 1O95A 2A5HA 2OZ0A 2ZZ4A 4G8TA 3UA4A 2PBOA 1LT8A 3U2OA 1ENUA 1GQJA 4G6CA 4JEQA 1Z42A 1BEUA 4Y9PA 1UC4A 1F7BA 1ZGDA 4URIA 3TW9A 1SZFA 1DVJA 4ACZA 1B1YA 3VDBA 1UP2A 1AL7A 2CBJA 2FB2A 1CLXA 2CERA 4HTYA 4CNOA 2V5LA 3BMVA 4GNJA 1QNQA 2X1TA 1E43A 1CTNA 2OWXA 1DIEA 1UMYA 4OTKA 4OOUA 4TV6A 1O5XA 3BLDA 2ALRA 1WKDA 2ONEA 1TO3A 4UQ9A 2ZDSA 1EBHA 3G8EA 5H6HA 2PGEA 4GXPA 3DFQA 3SGUA 4FHAA 4A8LA 3ABRA 2GVYA 2VEMA 3JU2A 3UZXA 3UJRA 3SURA 4AAJA 5E1QA 1WPCA 2ZXQA 3CEUA 2V3EA 3AICA 3ZYZA 3LGGA 3ZJKA 3KTCA 4F0SA 4YU1A 5C0QA 4AWEA 2Y7EA 1LUCA 1BYBA 2OMAA 1AQ0A 2CZFA 4IF2A 2FFIA 1NP0A 4EWND 4W5ZA 3OVRA 3IAQA 1WKYA 5DY2A 3B8UA 4NIRA 5E0FA 2WCSA 1WBJA 4H1ZA 3GG8A 3AIUA 3KOFA 1ONXA 1OEPA 2J88A 4EXBA 1GOIA 3HO8A 3TAKA 4RNFA 4NU7A 3WQOA 2XUCA 1Q7ZA 2EG7A 3W7HA 4XISA 3AJXA 1K6WA 3LHTA 1IYXA 4FX6M 4JYDA 1GNXA 1W5NA 1Q6OA 3W82A 2OO6A 1TV3A 2CZEA 3S1UA 3CYVA 3ZR6A 4ASTA 2YBUA 3SCVA 4XZ9A 1MUMA 3CL7A 3SJNA 1ECQA 1QHOA 3UXKA 4JFWA 1PDYA 2OQLA 4XAPA 1EPVA 2ZE3A 1XIGA 3TJIA 1XISA 1O1ZA 1YNPA 1ZBKA 3V5CA 4XWUA 1A5MC 3IEBA 4DXKA 3GVQA 3KCLA 3GTFA 3PULA 4BHYA 2UY4A 1EQCA 3A5FA 1M04A 4ICMA 3WUEA 3Q65A 3ALGA 3BCJA 4TTUA 2WW5A 1XDLA 4DJED 2EG8A 5AC8A 3N9SA 1ZJBA 4UTWA 1EC7A 4LYQA 3PANA 3MUXA 1I75A 4GVFA 3WLLA 3HN3A 4Y2WA 2Y88A 4CCZA 2ASHA 3S47A 1B9ZA 2VRKA 1DWJM 4BEUA 4GABA 2YL6A 1XINA 2ZTKA 1EO7A 1TWZA 1P0BA 5M5DA 4J40A 4ML4A 3V18A 2AL2A 5DXYA 1GVOA 1VFHA 1YXYA 2NX3A 1GVRA 4AD2A 1OD8A 2OCZA 4XTDA 1UC5A 1I60A 3QY6A 1KM2A 1IWAA 2ISFA 4HIBA 4WJEA 2J74A 4HB7A 3U57A 1MXGA 3WJSA 2XJ7A 9CGTA 5BOFA 3SM0A 4PB5A 5CC5A 4L6HA 4LY8A 5EU9A 1POKA 4BQ3A 4W8BA 4AX7A 1RUSA 3SRKA 4Q22A 4HA1A 4H6KA 3M5YA 2IPGA 1NWSA 4G9PA 3BAWA 4ZMGA 3WBWA 2VQUA 4PTWA 2TPSA 3IUHA 3PB2A 2ABBA 3JR2A 3T07A 2BX7A 4J27A 1TV4A 2E6DA 4B5TA 1MQRA 2EQDA 3EOSA 3FGCB 3WH6A 1A5AA 1BQGA 2G3IA 2NW0A 3OG3A 1G01A 1OCJA 2DZTA 2GYIA 4YS1A 3UWVA 2E8YA 2X1IA 4ACYA 1T7LA 4Y8FA 3HQPA 2VC6A 3DEQA 4UMCA 3VIFA 3C2EA 2FKPA 4WSJA 2CLFA 2CLPA 1EJUC 5LXEA 1F05A 4I3GA 1RVGA 3CTLA 4H7VA 2QEZA 3AMLA 4A8NA 7A3HA 3WSUA 2WMJA 1P6WA 3DKLA 4KCWA 1Q8JA 3GY1A 1AW5A 1O5KA 3W7EA 1XPYA 3F2CA 4DAIA 1ICPA 1EB3A 1FCUA 1W5OA 4PMDA 3W1TA 2BDQA 1VJIA 1H0IA 4N4PA 4RDWA 2RFGA 1J79A 3UVAA 2QR6A 3F5LA 4GY1A 3SCSA 3OLGA 1F07A 4UXDA 2B0MA 1FWIC 1XLLA 3TNOA 3W9ZA 3NL3A 3THUA 2NSXA 9XIAA 3ZJ6A 2HMCA 3BTNA 3NPUA 2R1KA 3RO8A 4L61A 3NAVA 1JZ6A 2DT3A 5K7JA 1PV8A 1HKKA 4XZHA 1FDZA 3A4AA 5JIPA 4GYPA 3TTOA 2XSXA 3VNKA 1KA9F 1FOBA 1K3UA 3CM4A 2X1RA 1PZ1A 4HMDA 3UNTA 1S2WA 5F4WA 1PHWA 4PFHA 2QQ6A 3RHGA 3APTA 3W02A 1I4NA 4AIUA 2HSAA 4DUVA 5EA9A 2BGQA 3ITVA 3CHEA 4PSPA 2YFOA 4HA3A 4RV3A 1E9ZB 4NI3A 4AD1A 1TB3A 2MANA 2PP3A 2R6OA 5D2XA 1VFUA 1VBJA 3VZXA 3OBKA 3QYQA 4WUIA 3L2LA 3GNOA 4B3KA 3S8HA 1HN1A 1TYGA 4MZ1A 2VEGA 2Y61A 3N2CA 4QJ5B 2AMGA 4GFSA 1BTCA 1OQFA 1UWIA 1V02A 1XDJA 1LL6A 3GAYA 3KRBA 1TTIA 1BVWA 2Z1XA 2GL5A 3GS6A 3TWBA 4GZ7A 1BKSA 5I3IA 2HVOA 4H2HA 2QPXA 3Q94A 1MEHA 4ALDA 4DZ5A 3NO5A 3QV7A 2ZUWA 1XLEA 2YZRA 4HMEA 3DN5A 1RJPA 2QDDA 2XFYA 4F2TA 3Q4DA 3IAPA 2WOQA 3WH9A 5TIMA 5LSMA 3R11A 4HJFA 5DMLA 2ANUA 1EYEA 3AS3A 3CHVA 4MVAA 5LA0A 3EMZA 5DN1A 3TKFA 2Y6ZA 7CGTA 3W1NA 5E9AA 4S2BA 1VENA 5CSUA 4H9UA 4DZAA 2OODA 3AIRA 1U22A 3T0CA 5KZDA 3UCQA 4R34A 1OBAA 1F3WA 5I3JA 2VKZG 3ERPA 4GHRA 3MUY1 1XD0A 4U3CA 1QNSA 2P5NA 2IQTA 2HBXA 2RKXA 4PB4A 1J6OA 5REQA 4L4PA 4GZEA 4UCGA 1LBLA 4HZ6A 5F7UA 4HK7A 2XN0A 4O50A 3ARUA 1Q7MA 2GGEA 1EF2A 5AFDA 5G1TA 4PRWA 1PO9A 1K7EA 2XM2A 3MUZ1 4AMCA 1X6NA 2A3AA 4G5DA 5G2IA 3G1HA 1QCWA 5LA2A 1JQVA 2YIHA 1TWDA 3V36A 1F73A 4FZIA 1KGWA 1ZCOA 3LA4A 1XGEA 3W81A 5HXMA 1KFKA 3CK5A 4FOKA 1HT6A 4XO7A 2FZDA 2QF8A 1HVQA 1A5KC 1R87A 1VH7A 2J9ZA 1C8XA 4S3FA 1VF8A 5F2IA 4M1BA 2FQIA 3NUKA 2Q3RA 2FVKA 5FJJA 1B4KA 4LCRA 1UUOA 4S39A 3GVRA 4GX8A 1XRVA 1X8FA 4FPSA 4LF2A 4YMZA 3RX4A 3LSCA 1KGUA 4ILSA 2ZC8A 2FTWA 2E68A 4C6DA 3AO0A 3VVGA 2WKGA 4Q8PA 4B5VA 2C6QA 2ATSA 3BUVA 4HK6A 3LRMA 4KS0A 2HZGA 1BF6A 1ZAIA 5A8QA 3DH7A 2R8WA 3HJZA 2WJDA 5I24A 3T0AA 1AMKA 4AIEA 4AF0B 1DOSA 2CNCA 3EMCA 5C54A 1GVSA 3RG6A 3TCEA 2Q09A 3AC0A 1AQMA 5M1TA 3TYZA 2ZE0A 4F3HA 3W86A 3RM4A 1M53A 3G1SA 4FS9A 3W88A 2EAWA 5EFDA 4RW3A 3LV5A 4IP7A 3CQIA 3M0LA 5JH2A 3NZRA 2WKLA 3UG3A 3VZYA 1SU5A 4MNJA 4L7ZA 3NVTA 3FHAA 4KQNA 4NNAA 3GB6A 3F7JA 1A53A 3COTA 3VUSA 4RKAA 4WF7A 2PWUA 3PF3A 4KRUA 1PKMA 1XSIA 2ZVRA 1YRRA 4KFPA 2OYKA 1ISXA 3VOGA 3THAA 5JU6A 1VP5A 3VE7A 1R2RA 1CX9A 2WNNA 4BI5A 2GVJA 4DX3A 3LZ3A 4ATDA 4JNYA 3TSMA 3D46A 1NARA 2I1OA 3W2MA 1W37A 1IT7A 3QEZA 4KKXA 4EOUA 1AVAA 3ITXA 3RLUA 1YXCA 1FA2A 3TOPA 3QVQA 3L0GA 3EWXA 4NX0A 2ZX9A 4MPQA 4I8DA 3ZT6A 5A6TC 1EJWC 3A21A 4YN5A 4KIEA 1A3WA 4MFEA 4ZO8A 1NH6A 4NJIA 1H61A 1W91A 3ARQA 4D2JA 1IR1A 2G50A 3SIZA 3IGUA 3USBA 2PDGA 3BC9A 4ORMA 3S5YA 4RPQA 1JD7A 4RE2A 5TF0A 1MW1A 2Q8ZA 4MDPA 1IWBA 8XIAA 1PX8A 1FWDC 3G0XA 1VBGA 4DPPA 1XGZA 5A8OA 3EDEA 3PSWA 2NXIA 2GUUA 5A2BA 1I2RA 2BY0A 1KWKA 1W1PA 5HMDA 1K02A 4DELA 4C6OA 4XZBA 1NU5A 3BLPX 2OYLA 3H6OA 1XLHA 3ZJ7A 3TC3A 1E0XA 3T40A 1T96A 1V4YA 4L80A 4GNVA 4U3AA 5D37A 2CCRA 2VM8A 2GSEA 4PL2A 5CPSA 5T9BG 3VIGA 3BO9A 3MWCA 2G37A 3KBJA 3IIVA 2DSZA 3O3RA 5KZMA 3F4WA 3TYAA 3URAA 2J4GA 4QE1A 4QCFA 3VNYA 3L68A 3V3WA 3ONBA 4WY0A 3I7SA 3EYPA 3WQ4A 5FF4A 3OO2A 4Z42C 4JHZA 3PNZA 4XTIA 1E4MM 3HG4A 4IMGA 3HF3A 4XD6A 3CZ8A 4GBDA 3DFSA 3PBGA 2QJMA 1U2YA 1WDQA 4KWOA 1KV5A 2YLAA 3EGJA 3GXFA 1YBQB 1Y5WA 3H23A 3UT0A 1EP2A 4D6JA 1XCWA 4QCEA 5A8PA 1DWFM 1FP8A 2J77A 3TE9A 5EGRA 3EPNA 1GHSA 1Y5VA 4GUIA 3W22A 2VX6A 2QDHA 1CWYA 3SCTA 3V1PA 3UJ2A 1RPKA 1M6JA 2ZRVA 4Q4RA 4H6QA 3UWYA 3ZS4A 1JCJA 3H26A 1KNWA 4RDZA 4CVWA 4AVOA 5C9RA 1EX5A 1RLCL 1H49A 2BGSA 3NYZA 5CGTA 1ME9A 3NZGA 4EKJA 4XSMA 1H7OA 5C7HA 3PBUA 2WPBA 3CAVA 4MKSA 2ZX7A 1TPVA 4Q8UA 3EDJA 1KWGA 3NVDA 2IPJA 3RR4A 3UEQA 4J35A 1TPC1 3W84A 1IWPA 1MWOA 2DORA 4M8UA 4KEMA 5G2WA 1GOKA 4FIRA 4S38A 5CGQA 4RE3A 2VX5A 2X7VA 3A3HA 2OO0A 1OY0A 1DKWA 4H9TA 3VM5A 5AHNA 5TAOA 4GCXA 4HPJA 1KO0A 3ZJ8A 2QW5A 3TTEA 3GC2A 5IFTA 1KXHA 1CXEA 3RILA 3UZJA 1QVBA 4NVTA 4LUIA 3JUGA 4NZCA 4AY8A 5B7ZA 1HUVA 2HV5A 3VPLA 4F40A 4TMCA 2CPUA 1HIZA 1GTHA 1A5LC 3BLEA 3ARVA 3H55A 4DYJA 2WZEA 1QW8A 3U7BA 1ZFJA 1W3NA 1W3IA 1X1ZA 3AMKA 1HTIA 1LL4A 4WOZA 3SY8A 3RO6A 4BQ5A 3H2EA 3I6TA 1E71M 3TJXA 4B2DD 4IX0A 1Q2SA 2C3ZA 3CAWA 3K8MA 4Q7NA 3UWWA 5JBFA 2YCIX 4H9XA 3C4UA 2DZUA 2GOUA 4YTTA 5D03A 1VCVA 1L0PA 3GXTA 4JIPA 1CB2A 3BG9A 2CEQA 1C9DA 1D3CA 1UQZA 3W6MA 4W93A 4UOJA 2QUMA 3D5HA 5H8MA 3GE7A 3W72A 4S2CA 2ZX6A 1UKPA 4KEUA 3NJ3A 2GDVA 3CL8A 2WSYA 5K2ZA 4LVGA 2RDXA 2ICSA 4A8RA 5SWUA 1JFHA 1FTXA 4GVIA 4JNZA 4NT0A 5CJ5A 3GXIA 4KETA 3O6CA 3ARRA 4E5TA 1AZ1A 3I4EA 3W7PA 4W4QA 4IFKB 2IQ0A 3PJWA 4O16A 2VD9A 4EPKA 3VDAA 1XL9A 3F1QA 3M16A 1XQKA 3AHTA 3QV9A 3KVLA 1UWRA 2A85A 4XKYB 3TXZA 3VA8A 1UG6A 2W67A 1PTAA 3GR8A 3F5KA 1QT1A 5C9UA 3GYEA 1R3VA 3NQVA 4LW7A 1E6NA 4BK9A 4HU8A 3BVJA 1CW2A 4QIUA 3VGFA 1O66A 4AY1A 2BXVA 4G1NA 4ACZB 5LIUX 4GKTA 1P43A 2YZ5A 3TOYA 3NQMA 3URQA 1V3IA 2CLMA 5DANA 3SUTA 3LMZA 4PMVA 4S1FA 5EBAA 1R7AA 1GORA 4KIRA 4HGXA 2AL1A 3WYZA 1T0OA 2Q8XA 4LC6A 5A6SA 4X63A 4G7EB 3LTYA 4S3BA 4PE8A 4GQQA 4YTRA 1UIPA 5C8BB 3KXQA 1FH7A 2PMQA 1JYXA 3VMNA 2G96A 3EAUA 2VRJA 7TAAA 2V5JA 1BGAA 1FWRA 2PA6A 4E3TA 3KBWA 1AH4A 3E02A 2Y1HA 3S3GA 1H63A 3NR0A 5CKSA 5HK4A 1VFSA 5T91A 1UBSA 5LIKX 5ABTA 5F1VA 2PDHA 3A4WA 1ZUAX 4PMXA 3B4YA 4YPJA 1A5SA 4PTVA 1U5JA 3DG3A 2BHZA 4ROPA 1QPOA 3BANA 2IKIA 3VZZA 4MOZA 4JS3A 1XHGA 3ITTA 1FWSA 1ZCCA 1R85A 1E6RA 2PP0A 5I3HA 1E6XM 2QCFA 5MKGB 3L4XA 4E2OA 4DBSA 4AWUA 4LUJA 2W6RA 4HCLA 2QS8A 2J8FA 4XD5A 2VC9A 3G24A 1A5BA 1N7KA 3LUTA 4ERGA 4WVXA 1ZSXA 3V7PA 1G9HA 4XKYA 4YCOA 2GJRA 3HGRA 1D9EA 2OT0A 3OZPA 1WV2A 3RLGA 1W3HA 2ZUUA 5BRBA 2YW4A 2ZRXA 3RX2A 1QHPA 2KZHA 1W6TA 5D9OA 1UR0A 3DCPA 1XBXA 3UBPC 2JEPA 1Q4NX 3ARYA 1OFBA 2NVCA 5AECA 2GGHA 5GQBA 2YL5A 3E0VA 4UC5A 3E2SA 1H1ZA 4HU0A 3VD9A 1VIWA 1TPEA 3GTXA 2PDUA 1UKSA 2BODX 4ZE5A 4QLKA 4KEVA 2DVUA 4FX7A 1GYLA 4KWWA 3H7VA 4ONVA 4HMNA 1DIOA 2WZMA 3IVUA 4YTUA 1EDGA 3PZTA 4QX4A 4GJ1A 3CV6A 2O55A 2WAGA 1C93A 1O60A 3VTRA 6XIMA 3TYEA 2QAFA 3A6OA 3MZNA 5FKYA 1KC7A 1S39A 3MTWA 3UR2A 2O9OA 4EAYA 1GOQA 4PFMA 1OFAA 4Q4KA 2GSHA 1KKOA 4F2BA 4PYSA 2PCEA 1TUXA 1A0EA 1KM3A 4I9AA 1GZ1A 1CI1A 4IG2A 1G7UA 1TPUA 3UPWA 4NAFB 5HMSA 2W79A 3U9IA 3OW1A 1FCBA 2P3ZA 1IV8A 3VIPA 4LBUA 1EIXA 1YPXA 4FOUA 3L66A 1WUFA 4ZE4A 2WMFA 1ZENA 3N4FA 2A4AA 2PDCA 5BOEA 2D69A 1W17A 3WFZA 4Q8OA 4Z2GA 1ISWA 4FX8A 2NQHA 5D05A 4AVFA 3D3AA 3KE0A 1NF0A 4JIRA 3GNNA 2Q6ZA 4FOJA 5HUOA 3NG3A 3WF1A 4M6QA 1QBBA 3O06A 2OWWA 1H51A 4KRZA 4CU8A 3P61A 1B57A 1R86A 4Q7BA 3IJQA 2Z29A 3DYMA 6REQB 5GJPA 1Q7QA 3N04A 3WH5A 4DYKA 1W3KA 4DO6A 4DHGA 3KHJA 4V1XA 4PB3A 2FMOA 2INFA 3USZA 5HPOA 4GZIA 2EJ1A 4N7QA 3NYDA 4K38A 2ABAA 1UJPA 1B54A 3KWXA 2G4FA 3W85A 4WHBA 1LOLA 3B4UA 1JF6A 2NZLA 4O1BA 1HZYA 2XN1A 1T5AA 3OGSA 4Y9AA 4A8IA 5CG0A 5U4NA 4XBKA 4IFKA 5ABFA 2OOFA 1S5TA 4O52A 3AIQA 3SW6A 3E3HA 3NSMA 2ZTJA 1VRDA 2Y0FA 3QPZA 4XD4A 4GVGA 2Y7GA 2Z1SA 3VKAA 3C2OA 5CZ0A 4A21A 1Q8AA 3FA5A 5FL0A 4D1JA 4MB3A 3CH9A 1V79A 1SPQA 1KM0A 1OF8A 1TVPA 4NZ4A 2Y62A 3ITGA 1MVYA 3R43A 3SRDA 1REQA 2QCGA 4QRNA 1I1WA 1FWGC 7ENLA 3ZLFA 3Q58A 3L5LA 1ADOA 2YSWA 4H8HA 2JGQA 1PSCA 2PDBA 4LCSA 3PVFA 1W9VA 2V5CA 1QI0A 3QH2A 4C6NA 3K30A 4E8CA 4I90A 2F84A 1OJXA 3MV01 1BFNA 1KD0A 4JTQA 4U2YA 4JOMA 4C6CA 2Z6IA 4LAZA 3ATYA 1N8IA 2PDPA 3T08A 2PU0A 2AGKA 4DNHA 3QHNA 1A3XA 3K1DA 1XCFA 4ZL1A 4LUYA 1J12A 3WDHA 4HJWA 5A6LA 1HKIA 3PZVA 3MY9A 2QKFA 3CLMA 1K7XA 3FYPA 3EOEA 3CMFA 4KRTA 1WOBA 4Q8WA 1K4HA 1H1YA 2DDXA 2RDWA 4KH2A 2QIIA 3CZGA 5JVLA 4AU0A 3M44A 4MY9A 4X0VA 2J24A 4JGDA 2PB1A 4EACA 3TYBA 2J78A 1UR9A 5HR6A 3ABOA 3WMLA 4IPNB 3PC0A 2AQVA 1ZTVA 4AX6A 4GFIA 5CSYA 4XQ6A 1B3VA 4BQ4A 5FL1A 2GSJA 2WMIB 1G67A 4ZODA 3SJ3A 2JFEX 1WXYA 2D23A 1K8YA 3TQ0A 5BXRA 3LGEA 3STEA 1BKHA 2CBIA 1GVEA 2YPIA 1NSJA 4ZTXA 4QDMA 3A23A 4EPBC 1S2AA 1LLZA 3HQNA 3E9AA 1HXJA 4JTKA 3QSTA 3RFAA 3TTSA 2DZWA 1QU4A 3VUPA 1KLYA 5CPLA 1M3UA 4P8XA 4DO7A 1UR1A 1R3YA 1FWJC 1CDGA 1POJA 1B9BA 3DERA 1M7OA 4Z2IA 4C65A 2DSVA 1ZBWA 3POHA 3PUGA 5I3FA 4KFNA 3FK4A 4L1GA 5AC6A 6XIAA 1C91A 3ELFA 2WV8A 3LHUA 4V1YA 3W75A 1BPLB 1FRBA 1X8CA 2GDUA 4G56A 4MY8A 1TG7A 5DELA 3TCSA 3T2QA 4DWSB 2BSLA 2OFJA 3SCOA 3S6DA 5G5IA 3UZWA 5FCZA 3C2FA 3CIVA 3KRSA 3S2LA 3WBEA 1IE7C 1X7FA 3T4WA 3WBAA 3KRZA 4HNUA 2WMHA 3RJYA 2OTDA 3M0ZA 3ABSA 2BTMA 5HJYA 2WKJA 1E5NA 3CYJA 3UWQA 2AOSA 2QV4A 4JTEA 2QCCA 3AIEA 3WBXA 3UWZA 4WY0B 2WXDM 3VKKA 3QC0A 3SQSA 3OVGA 2QYGA 4J2MA 3UERA 1DQXA 1S2VA 1RVKA 3I3BA 4KBXA 1SO6A 2CKSA 3LHWA 5CC7A 4GWEA 4MYAA 2YCEA 3GDLA 3R79A 4UTMA 4JTLA 3GSMA 4LUSB 4HMCA 1BRLB 3H2NA 5DBUA 1GGOA 2EXOA 3OJGA 2BHUA 3LPOA 3TQVA 2YDSA 4B5XA 2MUCA 3WZ0E 3SUVA 4IP5A 4OGZA 5LHFA 2G0WA 2PURA 4B5WA 1Z32X 4DYEA 4AZIA 2YGYA 5HQLA 3TEVA 4GYJA 3MSDA 4JEJA 4LVDA 1RCXB 2JK2A 3JW7A 2RJGA 5FSEC 5A2CA 1QNOA 4PBFA 2QIWA 4MKVA 3K8KA 2VWSA 4CU6A 2GOKA 4PCPA 4UNKA 1AW1A 1GKPA 1LOQA 4F0HA 3TYCA 1AW2A 2OZ3A 5B7YA 3VOHA 1W3TA 1YX1A 2OJPA 3L9CA 2QLYA 1QW9A 4W87A 4BKNA 3FJLA 1ITUA 2J6XA 4JY8A 1NF7A 5EMUA 5DMMA 3WQ8A 2F38A 2JBMA 3K8LA 1XLKA 2VEKA 2OEKA 1Z69A 3DXIA 1X1NA 3UCCA 1KR0A 3HPZA 6ALDA 4NQ1A 3GDKA 4IIEA 4X2RA 5C2GA 2Z7KA 4C6FA 1TJ2A 3SECA 3U48A 1LZOA 3IV8A 5HWJA 2PE4A 2PDIA 3TNBA 1W5MA 3QPYA 4IT1A 3TFXA 1FWAC 1VR6A 3WUFA 2FGBA 3EB2A 4UTUA 2Y8KA 4GGBA 5FF7A 4U31A 4NXSA 2WBGA 2DIJA 4H9VA 5AVHA 1UKQA 1SO5A 2YBTA 3NXFA 1V6YA 3SRHA 4JX5A 2E28A 1FDJA 1CGWA 1DWHM 3W1XA 4JFVA 4M82A 2VR2A 4TXEA 3N19B 1DWAM 3MPGA 3WH7A 4UTFA 4K7VA 3ZR5A 2E6FA 2BOFX 3HZ3A 2Z2AA 4O57A 5AOUA 1XYZA 4PUEA 4IHCA 3BURA 2O7QA 3LCFA 4AZ7A 3R12A 3CB8A 3EX2A 3LRLA 4I9MA 1J01A 1R2SA 3FSTA 2O4QA 4HZMA 3G22A 1QI3A 3IV3A 1GG1A 1JAEA 1Q6FA 1O1HA 1W1B1 1NOUA 3RPDA 3VD4A 2CHOA 3BXWA 1TKKA 3B0VC 3VX1A 2G3NA 1VEPA 3CHFA 1J93A 2W61A 4LS1A 4BI7A 4DI9A 1S38A 1UZDA 4EF9A 1QPKA 1KV8A 6ENLA 3LM7A 1DP0A 3T44A 1IZCA 2PDKA 3CQJA 2GJNA 3T2OA 4ZQMA 1CGUA 1WZKA 5F1UA 1ISVA 4CUCA 3TN4A 3L5AA 4NSBA 5FF3A 3P82A 4BEQA 1BAGA 1HGWA 4NL1A 1CXHA 2FHFA 1XRSA 4FMVA 3TSDA 3QRHA 5KZEA 4IOTA 4YHEA 4UTTA 3N6QA 4IFOA 1EDQA 4U4MA 2O56A 3SN4A 4AC7C 1ZP3A 5TBOA 3NQEA 1QWKA 1VBHA 2P88A 5C5YA 3WDPP 3GWQA 3UYIA 1M68A 1L9WA 1LM1A 4PMOA 4IISA 3T1GA 2JKAA 2FVLA 4F8XA 4PMYA 3WIJA 2C16A 2C19A 4FLRA 3BMWA 3CV1A 5A2AA 3OU8A 4LYKA 4MUZA 1D7KA 1MDLA 5I6SA 4JCLA 1YTDA 1KRCC 2AQWA 4Q8TA 3MB9A 1J96A 1UZ1A 3W53A 1BSLA 4C60A 8CGTA 2UY5A 3UYCA 3GH5A 4LS0A 3CUZA 3PZ9A 1DE5A 1DQWA 3P5YA 3M0KA 1DWGM 3NL6A 2GZXA 1XC4A 4A29A 3WLKX 5BXSA 3KS6A 1MW3A 3GNDA 2AMXA 1QNRA 4O4WA 3E5PA 2GGGA 5DX7A 2WMGA 4EIVA 4AD0A 5BW6A 4GI8A 3KL0A 3VGHA 2ZZ2A 2A7NA 1GG0A 4XBJA 3N4EA 5AYBA 3KWSA 2GDQA 5D38A 2DEPA 1V51A 3DENA 3UD6A 3WFAA 3S83A 3BZGA 5DF0A 2EGZA 3J7HA 3UWEA 4FXSA 1JQXA 2ZCGA 3L2MA 1S2CA 2RDTA 3W71A 3N17A 1QBAA 1LOSA 3N34A 1UMLA 4IMDA 4H6RA 4ZSUA 2HE8A 3ITCA 1XUZA 1J5SA 1E9YB 2V5DA 3R2GA 4ZQNA 1KBIA 1V6XA 1CZ1A 2PWGA 3LNMA 5AKQA 1XIEA 1IIGA 1SZRA 2H9AB 3BLFA 4LCQA 2INZA 5HQEA 2QJHA 2A3LA 3IWPA 3B8DA 4F0LA 1JDAA 2BBFA 3ZT5A 4AWSA 3EZ4A 3H4WA 4AZHA 3NDYA 2PF0A 3RDKA 5A5WA 2DZXA 2E8ZA 2VHLA 3NO3A 3BQ6A 4K36A 5H8PA 3GNPA 3UFYA 4CVUA 2D0GA 3IRDA 5C9ZA 4RZ4A 1J2WA 2REQB 2F8QA 3B0YA 5I0DA 2Y24A 5AN7A 2W92A 4DVOA 2QCHA 3G77A 1BVNP 5DMYA 3GBDA 1M7PA 4MJMA 4FLOA 1V02E 3VI2A 3FN9A 2DJXA 3PAOA 3RU6A 1VD6A 3TC7A 1E1CB 3AMGA 4O11A 1SMAA 3A9IA 8TIMA 4PZVA 2W9MA 3BAYA 2A1YA 2VFIA 2A7PA 4GQBA 1NJJA 3QW3A 4W84A 4ZB2A 1E5JA 2WO5A 1O68A 1OHLA 1PZ0A 1DBTA 3UZZA 4JKLA 4YHGA 2CESA 5FF2A 3LBCA 4LH8A 3GH7A 3LYEA 3H2AA 4QJ1A 1ZBCA 2WJFA 3R10A 1NWRA 4HNTA 5ENLA 3MANA 2J7BA 1PB0A 3NQFA 3SN0A 3I7RA 3VDGA 4GXWA 3W25A 3TP4A 4J5NA 1JPKA 4W7VA 1T8XA 1WE5A 3FS2A 4D71A 2BVTA 4C6PA 5HWNA 5I79A 4IUOA 1E40A 2V82A 4DM2A 4QHRA 3G0SA 1ZY9A 3EXRA 1YHTA 1F8MA 3IJLA 1Q45A 3WNOA 3CASA 3MMTA 3DFHA 2GJLA 1VZWA 4MWAE 4NUWA 3GFZA 2C1GA 2NWSA 3CV2A 5CBIA 3MKVA 4UFLA 4CD6A 1UUQA 3QR3A 4WGHA 3EDDA 1V5XA 2YCLB 4ADTA 3L0KA 2O9PA 1GUVA 1NFGA 4KGLA 4KWVA 2NWRA 2I56A 1EC8A 5I3DA 3MP3A 4BY3A 5HBFA 4JICA 2V5KA 1XIHA 1GOWA 1MW2A 3WLOA 4ATLA 1RP9A 2PWVA 2BY3A 4JTJA 4WKFA 4UTJA 3DHUA 5D8ZA 2BGNE 1JZ2A 3VDCA 3WLSA 2UZ9A 1XIJA 4AZCB 5CG7A 5HUPA 1UPPA 1XF0A 4GO8A 3MJYA 3N4AA 3THQA 4A3YA 5E0CA 2FPYA 2VGGA 4LAUA 4DBWA 1VFTA 1K9DA 2IKJA 2X1SA 4KFOA 3N2XA 4AG0A 2VFDA 3QOMA 2WHKA 4UMAA 5CGMA 4M6PA 5EMLA 4GZJA 1QR7A 4HNCA 1ZNNA 3S5NA 1Q85A 2F61A 3FAXA 3PWGA 4KPLA 3C0QA 5EKYA 1FDYA 1XG3A 5K4ZA 3GC4A 1W0MA 3M0HA 3C3NA 3EWUA 1J0JA 2WMIA 1RA5A 3CWNA 1K6AA 3FSUA 3RLVA 3W23A 3ORWA 2XGIA 3UXIA 1XW8A 4J3SA 1LG1A 3DC0A 3KEHA 2CLLA 1G4TA 1DJZA 3OZOA 4Y9OA 1DJWA 1TA3B 3TQPA 2YA2A 5BMXA 1EDTA 1JG9A 1SZEA 3M0IA 2QV5A 3GG0A 4MGGA 2R1LA 3EPOA 2YW3A 1PJ9A 2DT0A 1AFSA 2FYMA 2WANA 4EXAA 5I2UA 2OGJA 1PDZA 4HOZA 1DXIA 4N9CA 3MP5A 4IXXA 1RA0A 3DU0A 4GRSA 2QAPA 3GXDA 4LB3A 2V6AA 4CD5A 4QSFA 1W32A 4IJBA 1GHRA 1XDMA 2PPGA 4P8WA 4HPXA 1XWYA 1AD4A 1IR2A 1HQTA 3BW4A 4I7UA 2BB0A 3EKZA 1FWHC 4M24A 4NZFA 2Y4SA 3H7UA 5LNVA 1TPWA 4ZB5A 1GYNA 1TTPA 5HANA 2G97A 3EOOA 2V3DA 1KCKA 5IOBA 2UV8G 3KTXA 3BV4A 4UR9A 2WM0A 4JHOA 4N2YA 2PLKA 3WD2A 2POTA 4G2DA 4FNPA 1H7PA 1N2VA 1Q6RA 3WDJA 3AMCA 1JZ3A 4GQRA 4I5RA 1V8EA 3B8IA 6A3HA 5CBJA 3N11A 4RX0A 1VC4A 4ZQPA 1KTBA 1U1JA 2ALDA 3ZSTA 1LQ0A 1JRBA 3JRKA 1J11A 4PULA 2J6VA 3P8IA 1KQZA 2WLYA 3JZUA 2INEA 4F0KA 3OIHA 2ZXAA 1FUYA 2Z26A 1Y7VA 2J7HA 2ZYFA 1IEIA 1WDRA 4WD0A 4YIWA 3S1WA 2NUYA 2JGYA 2A79A 4IWWA 3UVIA 3DI0A 3UW6A 3MMWA 4REQA 5CZKA 2X0SA 3CZJA 2V2DA 3IACA 2QHAA 4AHOA 3C56A 2HK1A 3EBVA 4L5ZA 3QY8A 1YIXA 1GW1A 3N13A 4L6DA 1FXQA 3GO2A 1KTCA 1VLWA 3ISIX 4A6GA 1TZ9A 4PMUA 4QGCA 2BVDA 3NQGA 1K70A 3G3DA 4Q4OA 4LU0A 1TIWA 4OBRA 1ZJAA 4TTGA 2OWCA 2GVEA 3PUDA 2G8ZA 4QM1A 3NA8A 1SSGA 2OZ8A 4IPIA 3GXPA 1KFLA 1QK0A 4AISA 3WL0A 3UGRA 1I1XA 3H2CA 2W27A 3EEZA 4LV9A 1ZP4A 1A49A 4W88A 1F76A 4GG9A 1W1VA 5AC7A 1VFFA 3W07A 1VPYA 4IFRA 4DBDA 4CQBA 4CD7A 2CIPA 3NGFA 1PWLA 4ZQCA 4MMWA 3K4AA 1SUXA 2XWDA 1CIUA 3VIMA 4O13A 3BLLA 2ZUTA 2R91A 1I2PA 2OOGA 3IGSA 4HOWA 1TMLA 4O53A 1G4EA 3OQ8A 2YCLA 1L2UA 3G2GA 4WRHA 1IT0A 4JQAA 3FXGA 4PTDA 5AHFA 4Q3MA 1I6NA 3CWOX 2BXZA 3H53A 3GXNA 1XRTA 3S6TA 4Z1YA 2QT3A 3ARSA 2DGAA 3N29A 3UESA 4C90A 3ZIZA 3HGSA 3VO0A 4K1WA 4BWLA 2C14A 4Z2JA 1HF6A 3MCOA 1OT1A 4IMCA 4AIOA 5FEZA 2B7QA 3F2DA 3WN6A 2TRSA 4C1KA 2DVXA 3OG2A 3V0UA 2Q71A 3AQUA 1UOKA 1W31A 3NPXA 5DQPA 3H70A 3UETA 3PZOA 2WCAA 4L6OA 3O63A 2E09A 4LBSA 1VJZA 3KUMA 4KEZA 4YLWA 1BYDA 4V33A 4C7GA 1GQNA 1RQBA 2OEMA 2R82A 2QMKA 4DXXA 1F5ZA 1PKLA 1XSKA 5AY7A 4QS6A 3W1AA 1I2QA 3TSBA 2W4XA 1EHAA 1PAMA 2WZHA 4JXCA 3VMOA 3UZ5A 4MWAB 1MYRA 1UA3A 3INPA 3S1GA 2Y5JA 2X2YA 3FAWA 4N6EA 1WZLA 5JQ9A 4HN8A 4Q4SA 3V4BA 1YW1A 3W38A 2QZRA 2V5BA 2GQ9A 1TRDA 3A64A 1XYLA 5A8NA 4PBEA 2I9UA 4B9ZA 5BU9A 2V81A 1HG3A 1QI2A 4NZ5A 5CQ1A 5BWFA 4A3RA 4JTSA 3QV6A 4Q8NA 1S2TA 2V68A 3BLKA 2GVGA 4S3CA 3U2EA 3RU8X 3SFWA 2PDQA 1A47A 5LNRA 4MNKA 2VGFA 2IXUA 4DAFA 3SI9A 3MDWA 4LWWA 2VR4A 1YNYA 4WX2A 3E38A 5AHMA 1YPIA 3CU2A 2XPKA 3SCRA 3QSRA 5AYZA 2I5QA 3O16A 3LZ5A 3WLRA 1KCZA 1KM1A 1TJ1A 3S2MA 4PH6A 2DV0A 5HJLA 4E8GA 4JTGA 1W1IE 2ZX5A 1S1RA 4R9XA 4WY0F 3SUWA 2IQDA 3TH6A 3UG4A 4B4FA 1EKOA 1G5AA 1F3XA 1R30A 3TZNA 2GGIA 3MUIA 1UD5A 2E77A 2XH0A 5A8GA 4JYFA 2CETA 5ECVA 3QFEA 4NKCA 2ZRZA 3PZUA 3UQNA 2H3BA 3OIXA 4H2CA 2QDGA 5FEWA 3W7MA 4DJFC 1Q6QA 2B31A 5A8MA 5KZ6A 3HPXA 2NXGA 2VRQA 4ZVJA 1JPMA 4XZLX 2VOTA 3B05A 1T6MA 4HQVA 2Z2UA 1F61A 2IPWA 1VYSX 3MWAA 3WQ5A 1ADSA 1V0LA 2POZA 1H0GA 4GIAA 3M4HA 3CT2A 2I5IA 4E6MA 1SW0A 3LPFA 1B0IA 3QGAC 2HPIA 4QE5A 4CQDA 2NVAA 3HV8A 5HMFA 4ZSTA 1G0CA 1XLGA 1BGGA 4IG2B 1JZ4A 4MYXA 1NEYA 4PCTA 2FHBA 2WJZA 4MG4A 4W8AA 4JTRA 3UP8A 5EMKA 1Z44A 1O7AA 2G3FA 5KMYA 2YB1A 1UWTA 3SUSA 3W24A 1AZ2A 2NV9A 4GI6A 1LCOA 3OYXA 2OR2A 2FZBA 1ONRA 3AWOA 4AZ5A 3GVGA 4UTWC 3GQYA 1YADA 1EGZA 2HWGA 4XUGA 5CPOA 2D2HA 3WQEA 2OT1A 2DZVA 3O0FA 1TTJA 5AVNA 2E6AA 4UOQA 2ZADA 5D04C 3R1ZA 4M51A 5FJTA 2I14A 3RITA 1TPB1 2I16A 2YKKA 2B81A 4UCFA 2E4TA 4LVFA 3TK7A 1CXFA 1Q4WA 5E0KA 2DH2A 1R9ZA 4QJ4B 1FHDA 5I3KA 4F2UA 3W1RA 1EPXA 1ZJHA 3GZAA 1NDVA 1EO5A 3ZT7A 1CENA 3REQB 4GQGA 4XV0A 5H8UA 3W1UA 5C9WA 1Q2RA 5ABHA 1GEQA 2VNCA 2DIEA 3WQ6A 1V3MA 1LLWA 3APYA 1XLCA 1SW3A 2UBPC 1GW9A 1OG6A 3O6AA 2TODA 1OFRA 3CBWA 2QVHA 3AHXA 4S3KA 4J3WA 4PTNA 5KTLA 3T2PA 1H7RA 1X7IA 1JRCA 3MSRA 3VAVA 2QXWA 3IRSA 3LBOA 5K9CA 1CLVA 1TV7A 2REQA 3E5BA 3KOWA 4AH7A 3CMJA 1UR4A 2Y8UA 3ZVHB 1AG1O 3SSZA 3R94A 4YJ5A 2HVNA 2VXNA 4BR1A 5DRCA 1E55A 3DGBA 1PZ2A 2J9XA 4LRSA 4NRRA 1VLIA 2F6UA 3E49A 4F9DA 4JL2A 3RMEA 3WDIA 4JIIX 4KMQA 3ZFHA 4X0NA 5M17A 4P2VA 4ZO7A 2YBVA 1KB3A 4IPJA 2NX1A 3VNIA 4E0CA 2JIEA 1GTEA 4X9SA 2AQOA 4IQDA 4QP0A 4NP7A 2QCDA 4KWUA 4M29A 5K9DA 1PTGA 3MSGA 4XKMA 3GVVA 4L4LA 5A94A 1BQCA 1YDOA 2OQYA 3NFUA 1BXNA 3CUJA 3B0UX 2P0IA 3N12A 4W86A 1PCKA 2VFHA 3EWZA 4LUTA 3I68A 1LRTA 5A95A 4XZNX 4NX5A 3ES7A 1KBBA 5DY3A 3ZR4A 4Z2HA 2HVMA 3MA8A 3NPVA 3PUOA 3PR2A 1H1NA 2JKEA 4LFYA 4RXGA 2CKRA 4US6A 2HXUA 2V63A 4AMAA 6PTDA 1HJXA 1XC6A 4PCSA 3STFA 1V6UA 2ZFAA 1BD0A 3EA1A 2YXXA 1IEWA 4XUYA 3A12A 4HYWA 4O54A 3AALA 1JUEA 1JUBA 4QBXA 3QZAA 2XWEA 3FEMA 2PDMA 1R3WA 1AL8A 2EPOA 1PVNA 4OIFA 1EFZA 2CLOA 4X22A 3JZEA 4CCEA 3B06A 3ZZ1A 2I17A 1HFBA 3NQ8A 3IARA 3TR9A 2YL9A 4A05A 3QJAA 1XLIA 2PZ0A 2OSWA 4OQVA 2QUTA 3HFTA 3NQCA 3VNLA 5J8LA 4EK7A 1TV5A 1WZAA 1GKQA 3GG7A 4JKKA 3HM7A 3KLKA 5T8GA 1GWJA 3BLIA 2C7FA 1SYTA 2JIWA 4JX4A 1CGXA 2ZIDA 1LTDA 3R7MA 2NT0A 1MEWA 1HP5A 2PDXA 4J3ZA 3G1FA 3L4ZA 3B9DA 3ZLGA 5FEPA 1LLOA 4EPEC 3E1F1 4GVHA 1BTMA 4PGLA 4GH3A 4TVCA 4PUJA 4WJXA 4FLSA 1FH9A 2H8XA 2YA0A 3AXKA 3EEGA 1C29A 4FXRA 1FQ0A 1YYAA 3NL2A 5D2TA 1SFSA 3BCDA 1KLZA 4GUGA 4J9JA 2X1UA 3L21A 3GKFA 5DEZA 2DQXA 3GLCA 4JIEA 3VKJA 3H2MA 2QUNA 1SJAA 3VCNA 3WUBA 1J5TA 2CU0A 2BP1A 2MNRA 1B30A 3S5SA 3L23A 2WC3A 4LS2A 4UNIA 1NIUA 1P0KA 4XD3A 3TN3A 3W6YA 4GI9A 3C5QA 4WKAA 3Q2DA 1OCNA 2E25A 4XAGA 4OHQA 2WVSA 4OZOA 5LNWA 3OODA 4MJ4A 4MAVA 1OGSA 1KCLA 4LAMA 5CCZA 3W0KA 2VZVA 4H41A 4CQ9A 1AODA 1EOKA 3B40A 3OP2A 1JCNA 3KFTA 4ZB0A 3VNZA 4UTIA 3M0MA 2PLCA 4FLQA 2NT1A 1XYBA 3UJSA 4YL2A 4IMAA 1XBYA 4BF7A 2WLZA 2PRMA 4O1AA 2L5HA 2ON3A 1X1OA 4DO4A 3ZXWA 3GG1A 2Y63A 5C9XA 1VHCA 4Y96A 3K5XA 2GQ3A 1W8GA 2YDQA 4DJDD 3LBMA 1DYSA 1PYMA 2FPTA 3GW3A 1P5BA 2VX4A 2GWGA 4C6LA 3DYOA 3BOLA 3GUWA 3TYUA 3U4AA 3SAZA 1RPXA 3P93A 5I7GA 3DFYA 2D3NA 5CXPA 4I5XA 4CN1A 4GJIA 2PTWA 4HYVA 4C6IA 3AZSA 1GPFA 4F0RA 4UZSA 3PTMA 4ZOBA 4XX6A 3H7RA 1TIMA 1R46A 3MI6A 2YXOA 2Z7GA 3S2CA 1OZMA 2CLIA 1ICQA 1GJWA 1H41A 3W01A 1XLAA 4AEFA 2VENA 3MYOA 3QHOA 2XSBA 2CITA 3WK2A 1C7SA 1HGYA 2G3MA 3EX1A 3BH4A 3RIKA 4JQ4A 5FESA 5A69A 2HDJA 4O0ZA 1LRQA 3GRIA 1FY6A 4NNBA 1Y8BA 3M0XA 1PIIA 1QRQA 2NLYA 3WJYA 1WBHA 1RQEA 4E2DA 3VABA 4R5EA 2X0HA 1XLDA 2BXYA 4Y8EA 3WNNA 3NO1A 3QKZA 2WWDA 4PCNA 5I78A 1JYVA 2E0PA 3BWWA 2PC8A 2H9AA 2A21A 3L5MA 1NP2A 3PZGA 2FHCA 3BSGA 3RX3A 3O8AA 2O9TA 3EWYA 3L12A 1KW1A 3F5JA 1LQAA 2FGLA 4RXFA 4H9MA 2NXHA 4EAMA 2R1PA 1S5NA 3UCDA 5D9MA 1RD6A 4BQ2A 2J75A 3EXSA 5GVJA 3B97A 3U3HA 1Q66A 5DCEA 3FW6A 3S9IA 3VDHA 4P7OA 4YYCA 3MS8A 1JCTA 4MIMA 1UR3M 5BWAA 4ES4A 3TZFA 4RNIA 3NQAA 1V6TA 3HV9A 1DJGA 2D3LA 4WXZA 5AHEA 1CGVA 2C1IA 2OGYA 4GA8A 2GJXB 3P7YA 4IZGA 1VEMA 4QEHA 2DPEA 4BFAA 4UIOA 3SB0A 1EA0A 5JUVA 3SO7A 3GNRA 2WK2A 2Z4GA 3UR8A 2BOEX 4TOQA 3W2UA 5F2LA 3EXTA 3HJEA 1UD8A 1W1ZA 4LPCA 1GEHA 3W28A 3VOFA 4DJFD 1TA3A 4R88A 1IEVA 2I57A 3ARTA 3U5YA 4PODA 3M43A 1BVZA 2GGJA 2F2HA 5FAGA 5DT5A 3ITOA 3E74A 2W5FA 2A0NA 4EANA 1XQLA 3KDOA 4CN4A 4I6VA 2Y7FA 3DG6A 3UG8A 4H7ZA 1UIOA 2J9YA 5I77A 1NM9A 3CQKA 3P84A 2ZA2A 3NPWA 3RNDA 1B3XA 4JDBA 4R7OA 1OX6A 1W9BM 2X09A 4DM1A 1PS9A 1R47A 1TWIA 7REQA 1FVPA 3IJ7A 2PWEA 8RUCA 2ZA3A 1YDVA 1CBGA 1ELSA 2PRHA 3PBWA 4PMNA 3SGZA 4D72A 1F4AA 4TX8A 4RCXA 3WD0A 4JD4A 4ZA0A 4OBTA 4H4IA 3GHRA 2VTFA 4QE4A 2VVNA 3PM6A 1FWFC 3T78A 1YDYA 2PEVA 4H9YA 4B5UA 3HURA 2NQLA 2ISDA 3A22A 1X6LA 1BLIA 3C61A 5GNZA 1DTNA 4B3ZA 4FO4A 4GC3A 3S42A 3CLWA 3E0WA 2VDGA 3VE9A 4R7WA 4UBPC 2V0TA 1UZ4A 4WEVX 3PNUA 3RM8A 4CQCA 1K9FA 2XHYA 1TELA 2DSUA 2XFRA 2A7RA 3WD3A 1AA1B 2EO7A 3OYZA 2CLEA 3H8AA 1JFXA 3GBEA 1ICSA 5FAJA 4FK9A 3W2KA 2ZUVA 1EP1A 3F4VA 1W3LA 5TQLA 3AYTA 2A3CA 3VCRA 4XO6A 1EJTC 1QASA 4IIBA 4GACA 4GCAA 4DUOA 1NWTA 4MADA 1UR2A 4Z2LA 1JYWA 2IMRA 1C8QA 1B31A 1RP8A 3PP7A 4QFUA 3NNTA 4HNVA 3G1DA 1XYAA 3E2VA 5HNRA 2PAJA 1PEZA 3LPGA 4H9ZA 2R1MA 4S23A 4JN7A 2WZIA 1I8JA 4MAZA 4TO8A 2HROA 2VO5A 5DCDA 5EBUA 3TA9A 2C91A 3WLHA 2X16A 1GVFA 2H8ZA 1UP0A 3NM3A 4G7FA 4D6EA 1RQHA 1VBRA 3TR2A 3V16A 1EJXC 1TZZA 2AAAA 5K3VA 2DZPA 2NV2A 3S0CA 3FKRA 2X05A 4JL1A 1EQPA 4MY1A 4I9TA 4C5YA 3AWNA 1U1HA 1V7YA 4QSHA 5G4EA 1EJ7L 1V3JA 2XIQA 4DRSA 3BAXA 1DJQA 2WBKA 1X96A 3K4WA 1TTQA 3XINA 4US5A 4MDOA 2ACQA 1JGIA 1H5YA 2FFCA 2V3FA 1RD5A 1H7XA 1VCGA 3TA6A 3NQDA 4NZ1A 3L67A 4FIQA 4JTUA 3DX5A 3IJ8A 3M07A 3EOLA 1KXQA 1P7TA 2QJNA 3ANUA 4GUJA 3CHDA 1O12A 2PWHA 4GMEA 1MI3A 4NJHA 3LERA 1EBGA 1IXNA 4DI8A 1B2YA 3Q67A 4JTFA 3RJXA 1WOAA 2W91A 4FNSA 4S3GA 1XH1A 1EX1A 3FVMA 4OT7A 2D2OA 1RK5A 3ECQA 1KQYA 1P1MA 2OG9A 2C18A 5DBTA 3BSMA 3W7IA 2EJAA 4P7LA 1O4UA 4WCJA 2QNEA 3UR5A 4LGXA 1BYAA 1Q6GA 4YWSA 2V30A 1A5UA 4GX9A 3CAKA 3NDOA 4K7YA 4P5UA 2B7OA 1VGAA 4GD0A 3R0KA 4AWTA 5D2YA 3LU2A 1VYPX 2HPMA 1VFLA 4D8AA 3PTQA 5K4XA 2ISVA 3CPUA 3GD6A 3WNKA 3WDRA 1DTUA 5C7VA 2C15A 1UWSA 3OHIA 3VXGA 3UGVA 3Q37A 3PAJA 1X6UA 3PPGA 2ACRA 4AEOA 3DBNA 4AFYA 3STPA 3TJ4A 4K8EA 5DFAA 3MVIA 4QAIA 1L2QA 3URBA 5I07A 4XBSA 1I0BA 5ABFB 1WAWA 2CW6A 4H83A 3RAOA 4QISA 3WQPA 1ZJIA 1R3RA 5F2MA 2C8NA 3B9AA 3B9NA 1OF6A 2XH4A 4LYPA 4M0XA 1E4LA 4W9TA 1TPH1 2FZNA 2G3JA 2QJIA 4H8VA 1YLVA 2VP8A 1TZ7A 3PK7A 1G4SA 2F7FA 5EMYA 5M3WA 3MI3A 3QGVA 3IJ6A 3LEPA 5LNUA 1JEZA 3E0LA 4DPQA 1P0EA 1FXPA 3PZQA 4HTBA 4IIHA 1CPUA 3KP1A 3ZVHA 3GR7A 1QPQA 1KFCA 5CZJA 4A3HA 3EKGA 1HJSA 2EF9A 1AQFA 3RPMA 1M1BA 4PMJA 3N25A 2P53A 1Q63A 3AMDA 5EB8A 3ZO9A 1SFLA 1ZZMA 1BWLA 1WXJA 4AEEA 1EP3A 1KFWA 3H54A 3BMXA 4INFA 4MKNA 2A3EA 1LBFA 3GAKA 3FA3A 4HPGA 1M65A 3W7CA 5GJMA 4AY7A 3I3EA 1H7WA 4DJDA 5LZLA 5AZ0A 3T55A 1UH3A 4O1DA 3AS2A 4PMQA 1DIDA 1GONA 1TJPA 3GIYA 5I3GA 3BW3A 2Z27A 1UD4A 5DLCA 4AD3A 1LDCA 4LBRA 4GJJA 1E0UA 2XZ9A 1J4EA 2W3ZA 1UH2A 2P50A 2Z1WA 4JX6A 7REQB 1Z7AA 4HK5A 3THDA 5IRPA 3WX7A 3FIGA 3GXMA 7XIMA 4Z0SA 1K9EA 4HZ8A 4NG3A 3BAIA 5J5RA 1DIKA 5T9CE 2NLIA 4WKHA 1F6YA 4JIHA 2R94A 1BSIA 3FEQA 1GT8A 3G1YA 4PUMA 3CV7A 1P48A 3TLQA 1J6PA 3MUCA 1TV2A 3HFYA 2DT2A 1OYAA 2QCNA 3AHYA 2BV9A 4GUFA 3PZNA 4KCUA 1WAUA 3GU1A 1EZ2A 4PA8A 5EL1A 4FNQA 4X3ZA 1M7JA 4RLIA 1VFOA 3P14A 2XFFA 4TVDA 3U5UA 2DJLA 3WJWA 5AC4A 1NOWA 5HNTA 4IX2A 3LGDA 5ECUA 3F4CA 1TE6A 2XTKA 8XIMA 3R25A 1S1PA 2W66A 1UKOA 2VJXA 4RZ6A 3O6YX 3RGTA 4U10A 3CUGA 1XG4A 2G41A 4Y7EA 1UROA 1OM0A 4M80A 2NQ5A 3WF2A 2P8BA 3AIBA 4Y9MA 4L4MA 3G5EA 4J3XA 3L4WA 1W5PA 3LHZA 3WDQA 5MKGA 3EX4A 3ES8A 3QBUA 1D7FA 1CT5A 3OOQA 4FXJA 1X38A 4K68A 3DGRA 4Y90A 1CB7B 1VYRA 2PTDA 1S3HA 4LEFA 3ZVIA 3L4UA 1UKTA 1QO5A 1PZ3A 1MMFA 1PX4A 3PBYA 1HX0A 2X41A 1J10A 1XLBA 2AL2B 4L64A 1W1TA 3LLXA 3IPWA 4LXFA 3V1HA 3LHYA 2PTZA 4Z1AA 1H4PA 2F6XA 3AUJA 4MJZA 3SQMA 3IJIA 1FH8A 3WO8A 1TV8A 4V27A 4FNTA 2J25A 2WNWA 3QQWA 1GQIA 5L6UA 1Q6DA 2PDNA 5D9PA 4UFMA 5C2XA 5DRIA 2QCDB 2E9LA 4HD5A 4JN8A 5FOOA 1R0MA 2F6KA 5A6BD 3OZMA 4ZEPA 1DWIM 3RRAA 1XLFA 1RV8A 3IJDA 4JYEA 4HT3A 1MNZA 3N15A 1NDWA 3VD3A 5LYRA 3QLLA 3N2MA 2DZBA 1WCGA 4IJCA 4K8HA 4M3PA 3AZTA 4C1NB 2ZVIA 4DZHA 1T99A 3TUUA 3XISA 4FR6A 4F66A 4O18A 2E67A 4WLCA 5CSRA 5XIAA 1J8VA 4K8GA 1DPMA 2WM1A 2ZWYA 4DY1A 3DHPA 4WDXA 5G4WA 3TIMA 4DWDA 5KETA 4NZJA 3MBDA 4N9EA 2ZBTA 1OB0A 3K13A 4CCCA 3F4NA 2GWNA 3MBFA 2Z1VA 1B3ZA 4HU4A 4X2PA 4BWLC 3NZ1A 3EWCA 4QITA 5AZ1A 1EF3A 3OBEA 2VUNA 4JTCA 3MHGA 4AZCA 3W7LA 3LHVA 1Y65A 4IL0A 3E12A 3WD1A 3L2IA 2FVMA 5LKYA 1HVXA 4OKDA 3AJ7A 4MLJA 1OK6A 2Y2WA 2OZTA 2QCLA 3R13A 1X98A 5J5DA 2AAMA 1ONEA 2FH6A 1V77A 5AC5A 4AHPA 2P8CA 3LPPA 1GQKA 1XFCA 2HISA 4IGNA 3TXVA 3ANYA 2D20A 4M19A 1SO4A 4UTLA 3VKCA 3SUUA 4JR5A 1SMDA 4O12A 4FNUA 2FMNA 1EJVC 1RSCA 4JCMA 4H3DA 4QNWA 3WG6A 2VGIA 5XIMA 5E9XA 1CCWB 4DWSD 1GOXA 3FVDA 4J4KA 1A3HA 4GGHA 1K77A 2JEQA 4R33A 1JDFA 3UWUA 2GLKA 1NFPA 4P8UA 3BJTA 3I7QA 2VZOA 3G6LA 3TW6A 4K39A 3R6IA 4JFUA 3UF9A 3W87A 1M41A 5FJPA 1FFRA 1MRAA 3CEPA 4HBKA 3CZKA 4WXYA 2IKGA 2ZXDA 4JPGA 2HRWA 4O15A 3TC6A 1SR0A 4XSLA 1L6FA 4CNUA 4N42A 1FWNA 5IXEA 1XXXA 2WVUA 2D0HA 1QK2A 4GINA 1OYBA 2NUWA 1V6VA 2PBGA 1BF2A 3M41A 3VOJA 2CYGA 3VK5A 4K1GA 1DXFA 3PTDA 2EPLX 1EYWA 4JFTA 1C8VA 4O8AA 2PFHA 4RDYA 5A6JA 5TNVA 1E1CA 3OVQA 3A4XA 3I4KA 3WLIA 5C6MA 1E0VA 3CH0A 4TR9A 1OK4A 1UBPC 1UWAA 1TMQA 1ZPTA 3MYPA 5IBXA 3SADA 3AXHA 4AIBA 3G1XA 3T9PA 2VCAA 4B4HA 4NF7A 4HPNA 2PCQA 4BF5A 3DFOA 3SQLA 1QJWA 2OLSA 5FD0A 3WLMA 2FH8A 5REQB 3ATZA 4C7FA 1EEXA 2XFWA 2CXGA 4FI4A 2IW0A 4QDPA 3SCUA 4B5SA 2LLEA 1MZHA 2XIOA 2BZNA 5E70A 4D6DA 4HSHA 2WZTA 4CD4A 1T40A 3ME3A 4ZO9A 5DT7A 1KFJA 2YJQA 3MKCA 2VC7A 1HKJA 3KL5A 2QDEA 2J79A 4MWAC 4O1FA 4AZBA 3HBLA 1FBAA 3W7QA 5CJNA 3M5ZA 4R85A 4RE4A 4Q6JA 3RCNA 3GKAA 3ZOAA 1U33A 4L65A 1IXQA 2QVNA 2XGBA 1EXBA 1Z8AA 4H04A 4KERA 4C5ZA 3PPHA 2C79A 5IHRA 4POCA 1ZHAA 2CHRA 1KM5A 1R9YA 4N9BA 1OVDA 4I6KA 1HO4A 4CEXC 3NURA 4RW5A 4MZ8A 5RUBA 3AS0A 4CN6A 1KR1A 5E09A 4CD8A 2PDWA 2YL8A 4HNLA 2XISA 3IIOA 3WK3A 1JZ8A 3W6LA 5KEZA 1OFPA 1OX4A 3M6DA 1W2VA 5BZAA 1LROA 4E38A 5C71A 4NI8A 1SM9A 3DI1A 3UY8A 1H50A 3MVTA 2ODOA 3WQFA 3HIJA 5D33A 2WNZA 4XZIA 4QG9A 2H6RA 2CBUA 2WSPA 3C0SA 3E0FA 5HNNA 3T4CA 1QDSA 5EY5A 2J66A 3W74A 3PFRA 3NM1A 1K8ZA 4R53A 1OABA 3VGBA 2WB5A 4ZQRA 3VM7A 2PWDA 4G7EA 3GZ3A 1HL8A 3LXCA 2Q02A 3MC5A 4MB5A 1KBJA 4QAWA 1MXSA 1JNEA 1ADDA 3GX9A 3WCZA 1VPXA 1YE6A 2V38A 1RJRA 2BFGA 2FJUB 2OSXA 3LRKA 3GVWA 3OA3A 4RDVA 2XYLA 2HXTA 3S1XA 2Z00A 3ZSSA 2P3EA 1F74A 3ABZA 4B91A 4EX4A 1JI2A 1G94A 1KBLA 4IQJA 1NQKA 2A3HA 3T0DA 3EWDA 1VBUA 4LUSA 1QMLA 3ARXA 3ABQA 3E96A 4CCDA 4ZO6A 1PUDA 1AH0A 1OGBA 5HINA 3TROA 4ZTYA 2HK0A 2VELA 4H00A 1ITCA 3A3WA 1C9WA 3E2RA 1XX1A 1LT7A 1HJWA 1QFEA 1LP6A 3SBFA 4I5UA 2CWXA 1EJSC 4XVEA 3RUBL 2PDJA 4LVBA 5CJMA 1K7FA 2E5BA 2WSQA 2DSWA 2UY2A 3NEVA 3YPIA 1GZGA 2BLEA 1SO3A 1D2KA 2E5CA 3TYDA 4XIMA 1FWWA 2FDSA 3R8RA 1O5QA 4N9DA 3V35A 5FACA 2FJKA 3HQOA 2E6YA 4ICNA 1R2TA 1K8CA 4PBGA 1G69A 3REQA 1E6ZA 1PL9A 4DIAA 2RGMA 2QUVA 2UY3A 3GTHA 4UQBA 4UB9A 4CQAA 1N82A 4R7JA 3SZ8A 3LNPA 3URNA 4HNOA 2VQTA 1NWUA 1V0KA 3BJSA 1P1XA 3QTPA 4Z0JA 3OQEA 3M5VA 2FZ8A 3NOEA 5BOOA 1HJUA 4B2DA 1EH9A 1ZAJA 9XIMA 4HHPA 4DBEA 4PL1A 3IGXA 3THCA 2PDFA 3FHQA 1QAPA 3AYVA 4NJKA 4R9OA 5C2CA 1CYGA 4OECA 3PUEA 3IVTA 3O2LA 3GM8A 3TAOA 4PUUA 3UR7A 1V6WA 2HE5A 3IIZA 1LYXA 3RPTA 3BV7A 1Y5XA 5CLWA 4EE9A 4JKMA 3N1AA 2BWGA 4UTTC 3WMCA 3SDOA 3WQGA 3BGAA 3P6LA 3Q45A 4N4QA 2GQAA 4HZ7A 1AH3A 1JUKA 3VGDA 2VT0A 1BG9A 2YA1A 1RBLA 3R0UA 2PP1A 1XR2A 4NY2A 4M6VA 4Q4PA 4OWGA 3T81A 5HR7A 1J2BA 3TTYA 5LGXA 4QR6A 2C1HA 2X30A 1ZS2A 3GU2A 3MV11 4IJRA 2DP3A 3NQBA 1VJSA 3W2JA 4IUGA 3IANA 3M64A 4E2BA 1PXGA 4FF5A 1CEOA 1A4LA 2RUSA 1KBKA 1KCXA 3BG3A 1R38A 4N02A 4O19A 1UASA 2YB4A 3WMBA 1H5VA 3C0LA 3W83A 4O28A 1AJZA 4LV4A 3RXZA 1ODZA 1R6WA 4J7RA 2G5WA 3A3XA 3NIYA 2J47A 4KWSA 1OC5A 4QNEA 4D6GA 3CUFA 4I7WA 3ZWTA 2NVDA 1HNYA 3W37A 3MP4A 1PE1A 4D8ZA 1LQ2A 4J28A 3S2JA 4I8YA 3ARZA 4V15A 5F4XA 1VIZA 4QLLA 5BYWA 3W2NA 4DJEA 2DQWA 1EWEA 1YKWA 1M5WA 3KOYA 1H60A 3HMCA 1BWKA 3UXDA 3QHMA 2D2JA 2Z28A 3GHSA 4HHMA 4QLJA 4JZ5A 3W1LA 2ZZ5A 2E3ZA 3TMLA 2VEFA 2GUBA 3LXBA 2EKGA 2XIMA 4KT2A 4FB7A 1GJUA 5D02A 4FR1A 3I3DA 5HAOA 3DZ1A 4DF2A 1FKXA 1OGGA 1FWEC 2RDUA 3DFNA 1W54A 1R5YA 3A13A 3F2BA 2FTYA 2ACUA 3POCA 2DUAA 4DWSC 4ADUA 4BF9A 3P2VA 2DFAA 3CAQA 1XKJA 3GW0A 1W1A1 4HN4A 4OFCA 3FGCA 2WSRA 2CXEA 1DV7A 3EPMA 4L4OA 2O7SA 2WC4A 3LI1A 1BYCA 4DXVA 3ITYA 3MUAA 3AIVA 3WLQA 4WZHA 3CXOA 5EYWA 3T09A 1OT2A 4JN6A 5CZSA 1JJKA 2DVTA 2PZNA 3VFCA 3AAMA 1OC7A 2Z1BA 5D4YA 2ZICA 5I00A 1XIIA 4H6EA 4PUNA 2YOCA 3EMQA 5IDZA 2BVYA 2CWNA 4ORIA 1MQPA 1DJIA 1CLKA 2PDLA 5I23A 2YFNA 5L9FA 3W2LA 1UYQA 4PN2A 4W89A 1N8WA 1D8WA 2XH2A 4UQAA 3LLDA 1S3TC 1EXPA 1E0TA 1MDRA 3SY5A 5F4SA 3LTSA 2GFTA 3NTYA 4A4AA 1PPIA 3T8QA 3LY0A 4N6FA 1PKNA 2ZUNA 4B3LA 2A3BA 4AQLA 2VFEA 4YVPA 2EPKX 3W7RA 3W7OA 2SFPA 3WF3A 3TQKA 3LN3A 4ZQOA 3G1AA 2XINA 3H21A 2VL4A 3F03K 4PCFA 3FCPA 4PRTA 1W9UA 1DHKA 4C6QA 2YLLA 3FA4A 4C91A 1UOZA 3KM8A 3KHDA 4GQ0A 4NNCA 4DF0A 5KSWA 1HKWA 2CC0A 3LV6A 2VEIA 2WJEA 5T26A 2PGRA 1L8PA 3WELA 1A0DA 1MQQA 5BCAA 4HPHA 1HKVA 1E1EA 1RJQA 1JPIA 3DECA 3CC1A 2QPSA 2VCCA 2ADAA 1IT8A 3P8JA 4I7VA 3BPWA 3MJMA 3FLUA 3T42A 4RNJA 4GOAA 1JGMA 5I03A 1XV8A 4JQ2A 4ZOEA 1QXLA 4ERIA 1EWDA 4LNCA 1XLMA 1JXJA 1WYIA 4JBRA 4GYPC 2OELA 1US3A 1MRQA 3QZEA 1WKFA 2YCKX 1B3WA 1EEPA 3MHUA 1HJVA 1MEIA 3MW7A 4AZ6A 3GR4A 3W7JA 4GIEA 2DUZA 1VEOA 2VFGA 4AYGA 2CZVA 3L4TA 1OSEA 4HA4A 3M5XA 5CPMA 5FJRA 3VGGA 1AMYA 4UMBA 1C3FA 9RUBA 3P67A 4D1IA 1V03A 2ESCA 2GJXA 2R24A 3FFSA 3IIPA 4PUDA 1EJRC 3WEMA 2D2GA 4OU1A 3UG5A 4AXKA 3AIWA 3VKBA 2ATMA 4PEKA 1I2OA 3QYSA 4M6UA 4CNNA 1TX2A 1VAHA 3EOUA 3UXLA 2CFFA 3BZJA 4RZBA 1JD9A 3OZYA 3ICJA 2XZ7A 3VCCA 2NUXA 3OLDA 2ZWZA 1DJHA 1VKFA 4OUIA 4A22A 2X2GA 4CNTA 4NJGA 3XIMA 3HGJA 4U5KA 1U5HA 1XH2A 2VFFA 3L0NA 3BOXA 4HVXA 2EHHA 2OXNA 1CXIA 1ESWA 3BGJA 6CGTA 2O4MA 1OX5A 1OWQA 3PS7A 1VB9A 2E9MA 2WHLA 4YVVA 1XYCA 1JR1A 4JHMA 2D24A 2PF8A 5G4HC 3SR7A 4IPLA 1EZWA 1A80A 2BOGX 3H4XA 4GE8A 3KVJA 5HOSA 1GPWA 1OADA 5M2FX 1NAL1 5LIWX 2P0OA 4CQ8A 3N3MA 3PY2A 3UPBA 1ITXA 3TWAA 1XP3A 4C6MA 3V0TA 1C92A 3H4GA 2Z1KA 2BNJA 4TUFA 4MNMA 3KRUA 4WQ6A 5CBBA 3O7UA 4RUBA 4KESA 3VNMA 3R4IA 4AD4A 3N73A 3KAOA 1J0IA 4OV9A 4UUIA 5CPQA 2E5DA 4AUBA 2XVNA 3N6HA 5GJNA 4NAFA 1IZJA 4DUWA 2DZAA 4UQEA 4J3TA 3KLLA 1NDZA 3WQWA 1G4PA 1OFOA 3GDRA 1MXDA 2CZ5A 2DSKA 4IQEA 1K9TA 2W62A 4JIQA 1J0HA 4WDWA 3WNMA 3KX6A 3LLFA 3N18A 2QGYA 4D6IA 3AXIA 4IIFA 3UNDA 3T6CA 4IM4A 3FDKA 4E3VA 2IKHA 1ALDA 3QMTA 1PIFA 2V3GA 3NQ6A 2H3DA 4ZGYA 1Y0EA 5D2WA 4RPPA 1YNQA 2YX0A 3VIHA 1SFTA 2ZZ3A 3KCJA 4GISA 2WVVA 3M1ZA 2QUUA 5I06A 2QCMA 3MMDA 1AJ2A 4A3UA 1FP9A 4KCVA 1IIHA 1YEYA 2I7GA 1D3HA 4GKLA 4H8NA 1OG0A 2VEPA 2ZOXA 2J7GA 4LY4A 2BY1A 3AROA 2E40A 3CHCA 4E4FA 1DORA 4PEEA 5DO8A 1IXOA 5BRQA 2FIQA 1OIMA 3AZRA 1SJBA 2R9RA 3AYSA 2E9BA 3C86A 4HNNA 3R8GA 2WQDA 1AQHA 5K9XA 2QPUA 3S9YA 5IM51 3PB0A 2P1FA 3GFXA 2QCEA 2J7FA 3W1MA 1A5OC 3B8WA 4NXKA 1H62A 2PD5A 5AHIA 2RGLA 4RV8A 3FY1A 1Q6LA 3QOKA 1BWVA 4LQ1A 1E9IA 2GK1B 3C2RA 4MLRA 2VD8A 3VC6A 2NQZA 1CECA 1JIBA 1US0A 1RHCA 1S46A 1UCWA 4C6BA 5FSDC 4K3ZA 1QTWA 1MUWA 2O92A 4DLMA 3K46A 1UJQA 3HPAA 1SFJA 5HPCA 1B4EA 3P5ZA 3UZYA 3UJFA 2BY2A 3KTSA 3ONCA 5HDRA 1CNVA 3GHTA 4WGXA 1XBVA 3SCNA 1QPNA 1B3YA 1GVIA 1SSDA 4PRRA 5BRPA 3OGRA 4OJYA 4MUPA 5E6ZA 3W76A 1V3KA 2J7EA 3NSXA 4P61A 3FJ6A 2FGZA 4PUKA 3SY1A 4CNPA 1U5VA 3ZMRA 4FA3A 3OA5A 4QTGA 2DW6A 3EKLA 3TDFA 4DJFA 3KP0A 1XUUA 3BQ5A