2NQJA

Crystal structure of escherichia coli endonuclease iv (endo iv) e261q mutant bound to damaged dna
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
279
structure length
279
Chain Sequence
MKYIGAHVSAAGGLANAAIRAAEIDATAFALFTKNQRQWRAAPLTTQTIDEFKAACEKYHYTSAQILPHDSYLINLGHPVTEALEKSRDAFIDEMQRCEQLGLSLLNFHPGSHLMQISEEDCLARIAESINIALDKTQGVTAVIENTAGQGSNLGFKFEHLAAIIDGVEDKSRVGVCIDTCHAFAAGYDLRTPAECEKTFADFARTVGFKYLRGMHLNDAKSTFGSRVDRHHSLGEGNIGHDAFRWIMQDDRFDGIPLILQTINPDIWAEEIAWLKAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 5'-D(*GP*CP*GP*TP*CP*CP*(3DR)P*CP*GP*AP*CP*GP*AP*CP*G)-3'
publication title DNA apurinic-apyrimidinic site binding and excision by endonuclease IV.
pubmed doi rcsb
source organism Escherichia coli
total genus 105
structure length 279
sequence length 279
chains with identical sequence B
ec nomenclature ec 3.1.21.2: Deoxyribonuclease IV.
pdb deposition date 2006-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 2nqjA00
2HCVA 2I56A 1XLMA 4YTRA 9XIAA 3ITYA 1TZ9A 1DXIA 3QZAA 4X60A 2XINA 3VNMA 3IUDA 3KCOA 4E3VA 5H1WA 5AVNA 4EAYA 5B7ZA 3KBMA 4US6A 2QUMA 3NGFA 3GNXA 4QEHA 1XYCA 4ZB5A 3KCLA 1XLCA 1DE6A 1XINA 4YTTA 1DE5A 3LMZA 3BWWA 3BZGA 2QUNA 3VNLA 2G4JA 3M0VA 4GJIA 4XKMA 3AYVA 1XLEA 3BZJA 4HGXA 3KBJA 1XLFA 4A8IA 2GYIA 4J4KA 2Q02A 5EMKA 8XIMA 4XSMA 1K77A 3ITOA 4A8RA 4ZBCA 1XIDA 5AVHA 1XIMA 4GQBA 2HK0A 3XIMA 4PFHA 3XISA 1XLDA 1XIEA 1S5NA 1O1HA 5XIMA 5XINA 4A8LA 1BXCA 3FVMA 1MNZA 1XLLA 4QE1A 2ZVRA 2X7VA 1XIHA 3UXIA 4YTSA 1XISA 1XLIA 1XIJA 1XIGA 1GW9A 2GVEA 4A8NA 3C0SA 3ITXA 4PGLA 3CWHA 3C0QA 1XYLA 4XIAA 4LNCA 3AYTA 3KBWA 5TNVA 1XICA 4YTUA 3QC0A 2J6VA 4OVXA 3XINA 3M0MA 1XYBA 3KTCA 4X61A 5B7YA 1DIDA 2GUBA 2OU4A 4HHLA 1XLKA 3DX5A 4QDWA 3VNJA 3QYSA 3KCJA 5B80A 1XLJA 3KBNA 3UA4A 3C0LA 3VNIA 4XIMA 1DIEA 4X63A 3IUHA 3N4AA 3BANA 2XISA 5I7GA 3UA3A 1XP3A 4DUOA 5EMMA 4W4QA 2QW5A 2XIMA 3CQHA 4GJJA 4QDPA 4ZB2A 1XLAA 3TVAA 3VYLA 1OADA 9XIMA 3UVAA 3ITVA 2NQHA 6XIMA 1QT1A 2NQ9A 5EMLA 3DBNA 3KBVA 3KWSA 1I6NA 1XIBA 3AAMA 4KW2A 3WQOA 4G56A 5C9ZA 3AALA 4QE5A 1BXBA 3JU2A 3ITLA 5EMJA 3UU0A 5XIAA 2HK1A 1S5MA 4ZB0A 1XLBA 1A0CA 4XSLA 3OBEA 4Q7IA 3IUIA 1CLKA 2G0WA 6XIAA 1XIIA 3P6LA 4QE4A 2QULA 2GLKA 7XIMA 4EACA 3M0XA 4GLEA 3P14A 4K3ZA 3BDKA 2X7WA 3L23A 1I60A 1MUWA 3VNKA 1QUMA 3M0YA 3CQKA 4K1GA 1QTWA 4XISA 3CQIA 1XIFA 1D8WA 3U3HA 1XYAA 5FA5A 2NQJA 1XLHA 3TC3A 3CQJA 1YX1A 3ITTA 3U0HA 1XYMA 2I57A 2ZDSA 3QXBA 3CNYA 4QEEA 3KBSA 5J8LA 1A0DA 1XLGA 3M0LA 5H6HA 4DVOA 1A0EA 8XIAA 4HHMA 3M0HA 4HNOA 4YTQA
chains in the Genus database with same CATH superfamily
2W9MA 3OZYA 4KGJA 5C6MA 3E02A 4GUIA 2A3EA 3IIPA 4NP7A 3WZ0E 3W82A 5JBEA 1S3TC 4AG0A 3REQA 1P1XA 3G1RA 1TFVA 2BDQA 3LB0A 1M1BA 4RW3A 2CITA 3N17A 2GVJA 4Z2JA 2GK1B 1K8CA 4C1NB 1V0KA 3F03K 5A8MA 4GBUA 2EG6A 1JXJA 5T9BG 4GVHA 4WXZA 3TTEA 2QVNA 4B2DD 1XFCA 1KO0A 1V3LA 2CYGA 4Y9OA 4KCTA 2C14A 2QCHA 3LI1A 2IXVA 3PS7A 1KGWA 4W7WA 3C2RA 1E5JA 1LL4A 1GOOA 3AZSA 1M7JA 3WF3A 1QXLA 3W7EA 3AU6A 3PUGA 4DI8A 1E0XA 3WMCA 1XW8A 2JIEA 3QKZA 4UCFA 3WEOA 2CWNA 2CBUA 1M3UA 1J9YA 3SIMA 1VYRA 3W2LA 3TQ0A 5DMMA 1CGWA 1QI5A 1ME7A 2PD5A 1B3OA 1P0KA 2YLAA 3GIQA 5DEZA 1O4UA 1XYAA 4O11A 4UTJA 2BY3A 3KRZA 3BLOA 2RDUA 1A0EA 1QHZA 2GJRA 5FJUA 1RJPA 3S9YA 1M5WA 5TIMA 4QITA 4DYJA 3L5MA 4HOWA 8TIMA 5A3HA 3DI0A 5HMFA 2XG9A 1UROA 2QCLA 4MLRA 5I2UA 1JPKA 4O50A 3O06A 6A3HA 4M6VA 5T9CE 4B5XA 4NAFA 3W75A 3PBYA 1PTDA 3ZR4A 1V8EA 2XVKA 4GQBA 5M3WA 3VFLA 3DHPA 3CAWA 1XS2A 3QLLA 2P53A 1YE4A 2WKLA 4AD1A 3P5ZA 1J5TA 1JFXA 4OOZA 5D2TA 2WHJA 1RQHA 4W86A 3QR3A 3IAQA 1QPRA 3GU1A 1RD6A 1G4PA 2EJAA 2UWFA 3U2EA 4S23A 3RCYA 2ASHA 1EYWA 4N02A 4ZB2A 4ZZ9A 3RR1A 1IEWA 3WDQA 4Q7NA 3FYYA 3AFBA 3RXZA 3RLHA 4UTHA 3SADA 4H7ZA 1LG1A 4QCEA 3UYIA 3R7MA 2QIIA 1XXXA 2INZA 3U4AA 1J0KA 3GQYA 2KZHA 1KR1A 3MMDA 1NSJA 3N13A 5BW6A 5BWFA 2NQJA 3AS2A 1W3LA 1RPKA 1FCQA 1CGXA 1P0NA 3I4KA 4GO8A 2J74A 4WDXA 1UKTA 3FOKA 2A3CA 1RBAA 2NWSA 5D30A 4AC1X 4O54A 2BXZA 4EPEC 5A8QA 2XU2A 3PWAA 3WLLA 1H50A 3BO9A 1T8XA 1A5KC 3LY0A 3RK8A 1AJ0A 2WBGA 3BW2A 1PHQA 1F4HA 4QHRA 2O7SA 2E4TA 1I2QA 1ZP3A 2R1NA 3LRKA 2V82A 4H8HA 4MFEA 4MIMA 5XIMA 3N4FA 2XUCA 4QGCA 4EAMA 2CFFA 4TVDA 3VIMA 1R3RA 4D6GA 4BZYA 5I3JA 3H4XA 1ZHAA 4NJKA 4H2CA 1ENUA 1LL6A 4BWLC 3IACA 5DO8A 1W9BM 3N4AA 3PZ9A 1C9DA 2G96A 2E9MA 4W5UA 4P7NA 3TQPA 2Y8VA 1PE1A 1QT1A 4WJXA 4G6CA 3WLRA 4L80A 4B5WA 5FEWA 1IT0A 1JULA 4DXKA 3VIGA 4QG9A 3H53A 2ZADA 3BVJA 1DTNA 4HTBA 1ITQA 2CC0A 1D3GA 4PMUA 1V02E 1X7IA 1R5YA 2C1IA 4NJHA 2A7NA 5I09A 4WSKA 4W85A 3NOYA 1UOZA 5DANA 5J8LA 2J88A 2IW0A 3TCSA 2C1HA 3HGRA 4C6KA 4ZTYA 4HNTA 2TSYA 4HA4A 4E8DA 1LQAA 3KUMA 2R82A 1UKSA 4LX4A 4RK8A 4RXGA 4PMQA 3B05A 1ME9A 2CZVA 3UXLA 1C7SA 1TX2A 3G1YA 4IIEA 1H11A 1XQKA 1YDYA 4LYPA 3LI0A 4YVXA 4M24A 3GG8A 1OD8A 2PTYA 1UWAA 1V03A 2UBPC 4MJMA 3EWDA 3HMCA 3CC1A 4GUFA 3GR7A 4C1NA 1XX1A 3H22A 1XISA 3G1FA 4WQ6A 1OVDA 4A8NA 1UD4A 3QTGA 4DLFA 3RYSA 3ALFA 4HNVA 2TODA 3H24A 4O1FA 1UD8A 3EBVA 3ZSTA 4ONVA 3LBOA 1R3TA 2R1MA 2JGQA 3VKAA 3CLWA 4DF0A 3H54A 2PWDA 5A5WA 3KBVA 1JIBA 4PUEA 4QQUA 1KW1A 3GFXA 4FIRA 1L6YA 2OG9A 3L4UA 2JQXA 3SSJA 1BYCA 2XHYA 3N29A 4YU1A 3MYOA 1T5AA 2GDQA 4ROQA 1TTPA 1HIZA 4M56A 3L21A 3CQKA 4KGLA 1GOMA 1ZQ5A 2QKFA 3WDHA 1MEIA 4EPKA 3WH5A 2J78A 2GSJA 4HU3A 5E0FA 4ZMGA 4DPPA 2X1SA 3FDGA 2DSUA 4HNCA 5HXMA 1GPFA 4OT7A 4ZOEA 3S1UA 4Q8QA 2OEJA 2VO5A 2QMKA 3AIUA 3TN6A 2GSEA 2CLPA 5FIPA 1LWJA 2C0AA 2Y0FA 3WH7A 3W7MA 3WNOA 5T8GA 2RHGA 1OCJA 1FWCC 1MW1A 4A8IA 4RZ4A 3MP5A 5FF0A 3DG3A 4I90A 4DJDC 5FKYA 1XRFA 1KKRA 2ISDA 2C18A 1EBGA 5E0KA 4PUKA 4QLJA 4LXFA 1N7KA 7ODCA 4GJ1A 1J0IA 2J6VA 3G8RA 5EKYA 4IF2A 4KEZA 5B7YA 2WK2A 1V6YA 2P1FA 3TYDA 4K8EA 3N6JA 2WWCA 4YPJA 3BANA 5F4SA 3V0UA 4NNBA 4GCXA 3LTSA 4HMEA 2I9UA 2PRMA 5EMJA 4OZOA 1RQEA 3S6DA 4K2SA 3WNLA 5REQB 3CPRA 3NO3A 3WH9A 2L5HA 1EJRC 4LRSA 5AHFA 4F0KA 5IHRA 2MUCA 2VL4A 4A3HA 4J28A 4AD3A 2HBXA 1OFPA 1GG1A 3CL8A 3B97A 1Q6GA 1W9DM 3S1VA 1FWBC 2EHHA 1DJXA 5HMDA 1E9YB 4ZQCA 3I3EA 1DORA 3CUJA 5DLCA 3W2MA 1SPQA 4MWAC 1C3FA 3KCLA 4J3SA 2ACRA 5D32A 1XKYA 3EMQA 2DT0A 4IQDA 2YDAA 4PL1A 3IPWA 3O8AA 8XIMA 1U1HA 2Z29A 2G95A 3LNPA 4MVAA 1KXQA 3FVMA 5HQLA 4MNKA 5L6UA 1B3ZA 3GFZA 4CLMA 2ZE3A 1IT8A 3I68A 3HPFA 4B92A 3W1RA 2Z25A 2D2GA 1VH7A 3TFXA 4FHAA 4JNMA 5D2YA 1DIEA 1C29A 2VWTA 4AH7A 5CPNA 3R11A 3MUIA 3L67A 4AZIA 4KW2A 1JJKA 2WMGA 3W7PA 3AALA 4GYJA 3EWBX 3HQOA 3S1WA 1XGDA 3UF9A 4ERGA 3EX1A 3PPFA 1LJYA 2KX9A 5A94A 2I5QA 2C79A 2PUZA 1D2KA 5G2WA 3R43A 3LA4A 1BFNA 1TJ2A 3VD9A 1WBJA 3GXPA 1IGSA 4O15A 3ITTA 5LNSA 4LVBA 2IPFA 1W5PA 2BTMA 4X3ZA 2G3NA 1ALDA 1PYMA 3FIGA 4GXWA 3QPEA 3WBXA 1VEOA 3BJTA 4J2MA 4MUZA 1EYEA 4YHGA 4V27A 1NP2A 4JKKA 2WMJA 1TTJA 3CTLA 1WOBA 3ME3A 1H09A 3P3BA 1G7VA 4ZB5A 4UTKA 3VNYA 3EEGA 1XFBA 4U2ZA 1KC7A 4P5UA 4B15A 4HPJA 5D2VA 1X1OA 5DRIA 1MFUA 1F61A 2QQ6A 4Z0SA 2XH7A 2R1LA 3NPXA 1Z7AA 4C6QA 2QCGA 4DJFD 2Q01A 2FH6A 1GZJA 2QEZA 2GUUA 3OVPA 3TOPA 2WV8A 5LXXA 1AODA 1DXEA 1WKYA 3PC0A 4U3AA 4A2SA 5DBUA 2Z6IA 1GVOA 1EQCA 1W32A 1BKHA 3SCOA 3VOIA 1HJQA 1ZP4A 3M0JA 1ISVA 3CS2A 1F3TA 3B06A 1YEYA 3RU8X 1TWDA 1W17A 4R85A 2Y89A 3R1ZA 3N14A 3V4BA 4NXKA 3DGBA 5K9DA 1SGJA 4O1CA 2VEKA 3A47A 1VJIA 3CQJA 4Q8WA 4UR7A 4TR9A 3OLIA 1B30A 3WLIA 2UY4A 3HPXA 1QJWA 4JQ3A 5HMSA 3IJ6A 1E40A 2WCGA 2DDXA 2CNCA 3GDRA 2CXEA 3DUGA 3IVUA 3BCJA 2GVLA 2ZQ0A 1E4LA 3TU9A 2W92A 2ZXQA 2PWGA 2PWUA 2W67A 4A8RA 3POCA 1R3WA 3SCTA 3HG3A 1C8QA 3UG8A 3IANA 4GGHA 4JEQA 2ZIDA 4KCWA 3POHA 5AC7A 3CV7A 4IQJA 4TIMA 2I17A 2YBTA 1O7AA 4L6OA 2VFDA 2OFJA 2PODA 3DN5A 3W22A 3KP0A 1M04A 2WCSA 3UA3A 3DBPA 4HMCA 1LLOA 3VC6A 3QTPA 2OLSA 1K9TA 4CU7A 4GQRA 1J18A 1JPMA 1YDVA 4LEFA 2FZ8A 5CZ0A 4QS5A 1E3ZA 3CL6A 5JIPA 2V5LA 1R2RA 1XLBA 1IV8A 1TG7A 4HA3A 5EPDA 4Q4QA 3PBGA 3TXZA 3WLTA 1GT8A 1MUCA 1OX5A 4AMAA 3BSGA 2FLIA 1HGWA 3HJZA 1TMLA 1F7BA 5G2HA 4C5ZA 3HMJG 3PWIA 1KFJA 4V1YA 1LF1A 3W1LA 2P10A 3LHTA 3VMOA 1JF5A 3UWWA 3NL3A 4B5NA 2GQ3A 2CZEA 2A6NA 4YLWA 5HK4A 3IARA 4WXYA 1EH9A 2XINA 4B90A 4ZOCA 4F2UA 1XUZA 2PDIA 4AMCA 1YBQB 4LYRA 3I6RA 1AW2A 4K36A 5TF0A 6CGTA 1AK5A 3TTSA 2XYLA 3PBUA 1A5UA 4Q8VA 1F73A 3DFTA 1OFAA 1QI4A 3NGJA 3I6TA 2BASA 2P3ZA 4W8AA 3PNZA 1P0DA 1ZJAA 4UOZA 5XINA 4V33A 5CG0A 2DUXA 1VLWA 4K1WA 3E1F1 4IMEA 2WZHA 1LUCB 1ZUAX 3WQ6A 1KR0A 4XAZA 1XLKA 1Y5XA 4AZBA 3WF2A 1VD6A 1M7PA 1V7AA 1A4LA 3ATYA 5CPMA 3RPMA 3LERA 3ZR5A 2NQ9A 4TX8A 3KVLA 1NDZA 5F4WA 1REQB 3DG6A 3SQLA 3PJTA 4D1IA 2J9XA 1D7KA 3PUDA 3GNOA 3C2OA 2Q6ZA 4E4PA 1E3XA 4CU8A 1JGMA 3MC5A 4HK6A 3LBCA 4FB7A 2NXGA 3CAVA 5ABGA 4DBDA 2OSYA 3PZNA 1WYIA 4PRTA 2G3MA 4LUYA 3MSRA 4QS6A 3LX9A 1KTCA 2J7EA 5F1UA 1IWAA 3VX1A 4DRSA 3WD0A 1CNVA 1YHTA 1WE5A 3R79A 4G8TA 5SWUA 3TX9A 4O0KA 2J7DA 5BMWA 2A3AA 1H60A 4I6VA 1E4IA 2EGZA 4GC3A 5BXSA 1QNPA 3WD2A 5C9UA 1FCUA 1W3IA 3W37A 3VABA 3M44A 4G7EA 3QV9A 4FF7A 3N2OA 2EPLX 3M46A 4DYEA 1H1YA 3D0CA 3KHDA 1OGBA 3AIWA 3WQFA 3ITXA 4JQ1A 2DSWA 4F66A 4QJ1A 3G0UA 4AEOA 2ZUSA 1EIXA 4LVAA 3G18A 4X61A 3WJYA 4FXFA 1C90A 1RA0A 3QLDA 5E6ZA 4X63A 3IUHA 4QDPA 1GZ1A 1H1ZA 2X30A 4F9JA 4EXQA 4JICA 3AAMA 1DJWA 4ML4A 1Q6CA 4ZCWA 4IQEA 5AYBA 3NDYA 4DJEA 4DF1A 5CJNA 6XIAA 2V2DA 1FWRA 4GYKA 1IR1A 1PDZA 3D3AA 1DL3A 1VPYA 2QUUA 5KETA 4GINA 5U4NA 1YTKA 2BZNA 2ZUTA 1EQPA 3UJEA 1TMHA 3VM5A 3HV8A 3GM8A 1GUVA 4BEUA 3P82A 3GDMA 6TIMA 3LXBA 3SGZA 3APYA 3MV11 2OZTA 2OR2A 3KDNA 4N6EA 3Q67A 4UTTC 2Z1SA 2H3BA 1IZCA 5ABFB 3UR7A 4LY4A 1H7OA 3BAIA 1DWIM 2XVNA 2ZXDA 3BZJA 5H2ZA 1JDAA 2CBJA 4Q33A 1CECA 1MXSA 4I7WA 3U57A 4L7ZA 2Z7KA 3SY8A 4J3ZA 3LPPA 2D20A 5DCEA 3GXIA 4Q32A 1XJBA 1TWSA 4M8UA 1CZ1A 4C1KA 3D46A 3AMCA 3T0CA 1QR7A 3M47A 3VXGA 2YCKX 3VIFA 3GZAA 4L56A 1EHAA 3R13A 4S3KA 4LALA 2QS8A 2NQHA 4Y8FA 1R0MA 3TSDA 3I7QA 5EMLA 1FY6A 1UQYA 2HQAA 3IJIA 1FP8A 3DC8A 2VDHA 1UUMA 1XHGA 4NRSA 5CPOA 3TMLA 2CPUA 4IPPA 4JR5A 3USZA 1AZ1A 1S5MA 4WEVX 1MRQA 3VU2A 3ZVHB 2QDGA 2PP0A 1UUOA 2PWHA 2WO5A 3W7LA 3NOEA 4K3ZA 4Q4RA 3L12A 5IFTA 1Y7VA 4C6MA 4CNUA 1UR3M 3GDLA 1HL9A 1HP4A 2OJPA 3SDOA 1TJPA 1TWZA 3TN4A 4IPIA 2NLYA 3UPBA 5D33A 2F84A 4LUJA 2ZUNA 3EOSA 4HPHA 2I14A 4AHQA 5IBXA 1AVAA 4P8VA 2MANA 2PDQA 1Q4NX 4ICNA 2J66A 4L9XA 3DOPA 1YBQA 2PS2A 3FX4A 2PBOA 5CAHA 4D9PA 5FACA 4ZEPA 2Q09A 2VD9A 3WK1A 4YTTA 3LMZA 2GQ8A 3V5CA 3AMGA 2PDJA 2X1RA 2WSQA 1XPGA 1OFOA 2WM1A 3VINA 3TYEA 1KLZA 3VC5A 3CLMA 4X22A 2YB4A 4PTVA 2VEFA 2WMIB 3PTQA 2E5DA 4GZEA 1ODUA 3XINA 3PBMA 5I3HA 1WDDA 3UCQA 2WQDA 2NT1A 4M80A 2SFPA 5AHLA 4MG4A 1QK0A 4W4QA 3A6OA 1OGGA 1DBTA 4LNYA 4WGHA 2PU1A 2VGGA 4DLMA 3AISA 1R2SA 4YNGA 1REQA 1OZMA 5G1YA 4YVVA 3WQGA 2VCAA 2Z2AA 1J01A 5FJTA 2RDWA 3UQNA 3SQSA 4JHOA 5FF3A 2NXIA 3TUUA 2W3ZA 4BFAA 4O18A 3C86A 1J12A 2ISWA 3LHZA 3MSGA 1Z3NA 1ISZA 4WDWA 2YZ5A 4KFNA 1E6ZA 1BQCA 3GTFA 1KRCC 1TTQA 4WDTA 1EP2A 3O3RA 3C3UA 2ZZ4A 1F6YA 2VC9A 4L1GA 1SSDA 1R46A 1WCGA 4B3LA 2FJUB 5LYRA 4CQDA 3IAPA 1SO5A 3QZAA 2YCLB 4ROPA 1V77A 1F05A 1UWIA 2BVYA 3LOTA 5E6YA 3NTYA 3EOOA 4LF1A 4BEQA 3KVJA 3PANA 3WUFA 2PC8A 4D6EA 3VPLA 3TXVA 3E5BA 1W1PA 3DKJA 2X1UA 3NXFA 3PWGA 4MY1A 4YXGA 2GQAA 5TNVA 3W6LA 1PAMA 5E93A 2YCJA 1YNQA 4OWGA 1R47A 3W76A 1WP6A 1DVJA 3IS4A 3VE9A 2Z4GA 1AG1O 1WXZA 4Y9MA 3GH5A 3QV8A 4Y8EA 1I8JA 3C3NA 3UU0A 1YW1A 1KCKA 4QP0A 5IOBA 1LBMA 1IYXA 2Y7GA 2FZBA 1HZYA 2O9PA 4BF9A 3ABOA 4D6FA 3O63A 3WD1A 4ZQOA 1FRBA 4L5ZA 1AH3A 2FH8A 2ABAA 5JH1A 3MSYA 4HOXA 3SY1A 1GTEA 1MDRA 2VNCA 3TAKA 4PUMA 4DF2A 1A53A 2CERA 4KQNA 3RLGA 2FGLA 3CWNA 2EO7A 4GD0A 1AUSL 2ZA3A 3C2VA 4FIQA 2VUYA 4NIRA 3ZYZA 2YYTA 1JDFA 4JTUA 1MW3A 3HG2A 1FWAC 5ABFA 2C8NA 3W7QA 2V68A 2OEMA 3R0KA 3KRSA 3RM9A 4FNSA 2ADAA 2DIKA 4QJ5B 3B9NA 3A3WA 4U10A 2NLIA 3ZM8A 1MZHA 1POKA 4YTSA 1S5WA 3FNDA 3F2BA 4K8GA 4N0RA 2PDYA 4PMZA 5DN1A 1O5QA 3P62A 3V0TA 3S2CA 4NJGA 1WDPA 4MDOA 2IUZA 1ZBVA 2VFEA 1H49A 4L4LA 2Q3OA 2BBFA 3FEMA 3WH6A 4IFKB 2BVTA 3A5FA 1GQNA 5HMEA 4OBTA 3O2LA 1WZLA 3KOZA 4HNUA 1V08A 5AECA 2R24A 3LHVA 4A35A 3ZVHA 1AZ2A 1E6QM 2VOTA 2IMRA 5J5RA 3B40A 3R0DA 4RCXA 1HX0A 4FR1A 2E25A 2ACSA 1TB3A 2BNJA 2ZC1A 3KLKA 1Z8AA 5HOSA 3TA9A 3RMJA 3MUY1 3TTYA 4K8HA 3ABZA 3P80A 2EG8A 3C6CA 1GVYA 4QAIA 5CSSA 5FL1A 3QPYA 4HYRA 2V3GA 3CJPA 5AYIA 3B8IA 1DXIA 3W86A 3HM7A 1PDYA 2J62A 3INPA 2EKCA 4KESA 1J79A 1IQ8A 2X2YA 4O0ZA 2VEGA 1EJ7L 4UQCA 2F6KA 2QUNA 2VEMA 4FF5A 3LYEA 3OB8A 3EXSA 2YW3A 3L4TA 2DT1A 1GYMA 5I00A 3XIMA 2V8ZA 4MPQA 1OG6A 3WH8A 1SFLA 4E2DA 3VMPA 1O68A 3SUWA 1F8IA 1ADDA 2WMIA 4Q6JA 4HZ7A 4Z08A 1E0TA 1HW6A 2ESCA 1YIXA 1HKIA 1OC6A 4ACZA 3APGA 3UWUA 1VIWA 4IGNA 1MW2A 3CZ8A 1E4NA 3ZJ8A 4PMDA 3ZWSA 4N9DA 3F2DA 4H83A 4I5UA 3L2IA 2Y7FA 3QOKA 4TV6A 1K03A 3W1XA 3VIOA 3OBEA 2EQDA 1LCOA 3AZRA 4JDBA 2DW6A 2DH3A 4JIQA 3S8HA 5M2FX 2EEXA 3BUVA 2X7WA 4RPPA 3CZGA 4N4PA 3VGBA 3I65A 3MVTA 5AHIA 1BGGA 4DZHA 3E38A 4PCTA 3RNDA 4HT3A 3ARPA 3TROA 4P7OA 3W6YA 4AVNA 4PUDA 1QNOA 4LEQA 5I78A 1Q65A 4JIHA 2DP3A 4BQ4A 2E0PA 4RUBA 3BOLA 3WLMA 2B7PA 4JQ2A 3CZKA 3WUEA 2YCLA 1B5TA 1GPWA 5JQ9A 1O5KA 6ALDA 5D9MA 4XZIA 2ZTJA 2B7QA 3RHGA 5HULA 1NWTA 2YL9A 3PJUA 4QG6A 2RDTA 5CGQA 3UETA 2QAPA 2D24A 1OZQA 2WZMA 2Q02A 3A3HA 2TPSA 4EPDC 4GQ0A 3G22A 3R2GA 3OP2A 4PFHA 5HINA 4IJCA 1YTEA 2Z26A 2C16A 1BQGA 2AKZA 3SM0A 4GE8A 3PPHA 4LC6A 4MZ8A 3AIBA 3UVIA 1R85A 2QF7A 1XL9A 4GFSA 5FCZA 4LB4A 2ZZ5A 5EA9A 4M29A 2FMNA 4R27A 4IGMA 1EXBA 1GHSA 3PAJA 4JFWA 2ZYFA 3B4UA 1ITCA 3JUGA 1ZGDA 4S3GA 3P93A 2BY1A 1K6AA 1SZGA 3AS3A 4OECA 4E4UA 3CYVA 1OX4B 4A3YA 3AXHA 3H6OA 2XJ7A 2D2OA 1SZEA 3F2CA 3TSMA 3UXDA 3BQ5A 4DZIA 3UT0A 1CT5A 4DO6A 3WN6A 4AZHA 3W1PA 5FAJA 1X7FA 3CEUA 3EA2A 3TC3A 1EDTA 4DHGA 1Z32X 1KD0A 1Q3NA 4GZJA 4ATDA 3LZ5A 1A49A 2P50A 4OBRA 4JTLA 1QATA 1UWUA 1XLCA 5RUBA 4H4IA 4LAZA 1KBJA 2Z1WA 3W7GA 3KEHA 3VGEA 1YXYA 3ARQA 2DORA 1E0VA 4IXHA 2NVAA 4HSNA 2J79A 4WZHA 3DENA 2AGKA 5AVHA 2F7FA 1UIPA 1XGZA 3EA1A 1VJZA 2YXXA 4IM4A 5AY7A 3LQGA 1UMLA 3AXMA 1YYAA 4GY0A 1N8FA 1W2VA 1YXCA 1O66A 5GJMA 1Y0EA 3F5KA 3T0BA 4TVCA 5D09A 2A7RA 4QROA 4IFKA 3GSMA 2DSKA 3GNDA 1RV8A 3W00A 1E56A 3DDMA 2ZX9A 4KEVA 3LK6A 4OTKA 1SO6A 3CAKA 1K7EA 4U3CA 4EXBA 4H8NA 3FEQA 4WY0F 2VM8A 4GI6A 4AD2A 3NEVA 2ZRYA 4DJEC 1G01A 1LQ2A 1DKWA 2A4AA 1QTWA 3DCPA 2O4QA 3W7KA 2ZE0A 4H7CA 5FA5A 3B8WA 1JUKA 3S6OA 1UYQA 4BCEA 1CXLA 1R9YA 4G9PA 2DZWA 4UB9A 1ZCOA 1SVDA 2DZPA 3B8DA 3M5ZA 5BRQA 3TQKA 2OWXA 4H7VA 3W26A 4ADSA 1P7TB 5A2BA 5B7ZA 4G5DA 2ATSA 2QF8A 1F6KA 3VDGA 4Z1DA 4Q8PA 3EWUA 3GDKA 1LROA 4OUEA 2HS6A 3V1HA 3E0WA 3NR0A 2ZX6A 1JCYA 4UZUA 4K6AA 1Q7ZA 1SO4A 4X2RA 5D38A 3FW6A 3FKRA 3NIYA 1QPQA 3MWAA 4KKXA 4I8YA 4HP5A 1XYFA 3BH4A 4AISA 5I02A 1R3QA 5B80A 3A24A 1JDDA 1JCXA 1EA9C 1OF6A 5A8PA 3UZJA 2CBVA 2POTA 5I5RA 1I6NA 1HF6A 2W66A 1R3VA 2NUYA 4FALA 4Q7IA 3IWPA 4IIGA 3WLJA 5LGXA 3GU9A 3T7VA 1FX6A 3NQDA 4P7RA 1EC8A 1X96A 2J8FA 2YIHA 2Y62A 4K1GA 1K4GA 2GZXA 3G1XA 4YHEA 3H70A 8RUCA 2O0TA 3S3GA 4JN7A 1D3CA 3E0VA 3T4WA 3WUBA 1R7AA 2RH9A 3HTWA 1XLGA 5I23A 4MY8A 1PJ9A 4LBSA 1E71M 1L6SA 1YLVA 3QYQA 4GMEA 3NQMA 1Q5MA 4MF4A 2BXVA 3MWCA 1OINA 5IBXC 2DQXA 1JUBA 1DE5A 3THAA 1X6LA 1JDEA 1KWGA 3H8AA 4PCFA 4OUIA 4DI9A 4FSAA 1RY8A 1K77A 1R2TA 3E6EA 3URAA 5D9OA 1HP5A 3ERPA 1BWLA 4YWSA 3FGCB 3M5VA 1V51A 3ZT7A 1VFHA 3GAYA 4PB4A 5DMNA 1RVKA 2J7HA 3W88A 3R5EA 1W9VA 1UH3A 1R9ZA 4H9MA 4JZ5A 5A2AA 1WKFA 1V6TA 2OLHA 3NQAA 4JCMA 4KWOA 1X97A 4AC7C 3TN3A 3AQUA 3RFAA 4RDZA 4Y6GA 3DI1A 3W24A 1CENA 4IX0A 4YCPA 1V6XA 2W5FA 1OX4A 1NARA 4H6RA 4D2JA 3E74A 2OZ3A 1GONA 3U2CA 3MV01 4HK5A 1I60A 4NX0A 3OA5A 1YRRA 3GC4A 3IJ7A 4XZNX 1KFBA 3W72A 4IMCA 4FNTA 4XWUA 5I3DA 4QSFA 4F0MA 3VD3A 1MEWA 3Q37A 5EMUA 5EU9A 3C61A 3HZ3A 4D6HA 4RW5A 3SCPA 3C4UA 1SFJA 3WLPA 2TMDA 3GYCA 3HO8A 3VNMA 1UD3A 1JCLA 3M1ZA 1C93A 2E9BA 1NQ6A 1V4YA 4FA3A 2INEA 1PXGA 1FWNA 2PDKA 4MYXA 1DIKA 4XZ9A 3A12A 3R94A 4DQWA 4J1OA 4FNRA 2FVKA 2GGIA 3E2RA 1EB3A 1ELSA 3C2EA 1I2PA 1Y5VA 2CCRA 5I6SA 1HKWA 4QE1A 1KBBA 2Y63A 4HZ6A 3UXIA 2OQHA 2IQDA 2W61A 1NWSA 2Y70A 3AUOA 4TMCA 1EJSC 1VYPX 1LORA 2ALDA 4ERIA 4ICCX 4F3HA 3O6DA 4ACYA 4F0LA 4UZSA 3IGSA 1K4HA 4PSRA 1HJXA 3O07A 5C2GA 1NIUA 4RNJA 3OODA 2WMKA 2BHZA 1IEXA 4PRWA 1TJRA 3V3WA 1A3WA 2A7PA 3EMCA 4NZ1A 4Q7BA 4L1WA 1AQMA 3P14A 1VS1A 4PMOA 1GYNA 2ZUVA 2J77A 2VDGA 1KRBC 3CMJA 1EJVC 2OODA 4AX7A 4TX6A 3M0LA 3AYSA 3BJFA 3VIPA 4PSPA 5AFDA 1XH2A 1UG6A 2GPTA 4RZ5A 3OG3A 4R9OA 1LP6A 4KERA 4CQAA 3O6CA 4JNYA 3U5UA 4PBGA 3TV8A 5E9XA 2Z1VA 1SJAA 4DAIA 4YMZA 4E8GA 5EMKA 1W37A 2PFHA 2VGFA 4B2DA 1S5NA 1NOUA 4PH6A 5CJ5A 3QFWA 2PA6A 5HWMA 1ZENA 4QISA 1PYFA 4IQLA 2XIIA 2PEVA 1XLJA 1XC6A 2YDQA 3SRDA 2VELA 5BU9A 4HJFA 1Q6RA 2D69A 1IZKA 3KRBA 1SJBA 2YFNA 4B5SA 2J6XA 6PTDA 5LIXX 2ZICA 1SMDA 3B3DA 1UZ1A 2DVUA 1W9PA 2V6AA 3GXTA 1C9WA 3UZYA 1WBHA 3H7UA 4K68A 4O13A 3O15A 2VZUA 1SFSA 3NQ2A 4OFCA 4PMXA 3SAZA 4Y96A 3K4DA 3U9IA 2ACUA 3PULA 2DSZA 3OIHA 1EGMA 5GNYA 5LA0A 3W74A 1VR6A 1IF2A 4YTRA 3O1NA 3OQ8A 4PTDA 1X38A 2H9AB 1ODZA 3NL5A 2RJHA 1QOQA 2XM2A 1FBAA 4N9CA 2FPTA 4JQAA 3NO5A 3W2JA 3PVFA 1F3EA 1SM9A 4GCAA 1L0PA 3MUZ1 1FWFC 3ALGA 1L8NA 3OA3A 4XSMA 4A29A 1G4SA 3MDWA 1A80A 2OGYA 3TYBA 3T81A 1AW5A 3NSNA 1UWQA 3ITGA 2VT0A 3VZZA 1XG4A 4FX7A 4IH3A 1EO5A 3AHTA 3QR1A 4JIRA 1BHGA 4PMJA 1KBKA 2OOGA 1KLYA 4HHLA 2H8XA 1H7NA 3KBNA 1UR4A 3WF1A 1T7LA 2XSAA 1RP9A 1HKKA 4F8XA 2J13A 2DH2A 4PCPA 1E9ZB 7REQA 4GK8A 1JD9A 1XV8A 1MRAA 1N8WA 1JI1A 3P81A 1WAWA 5F2LA 2YCEA 3M0IA 2ZRWA 2VR2A 1BPLB 2VR4A 1JG9A 3BDKA 3FDKA 5DMLA 3V18A 4Z1BA 3RO6A 1EJWC 1TVLA 3H7RA 3H12A 1H4PA 4GY1A 2V3EA 4HCHA 4YCOA 2VCCA 3U7BA 1ZB5A 5A6SA 1DWGM 1QASA 3G8EA 4FNPA 2JBMA 3DG7A 3NQEA 2QCDB 1W1IE 3GK0A 4U4MA 3WNPA 3LQLA 1P5BA 4UMBA 4PR4A 1RCXB 4U31A 4R53A 2XIBA 3L4YA 3I7RA 1M68A 3CUXA 3H2AA 3N15A 1B4KA 1JR1A 3UD6A 4RPQA 4XK2A 4GBDA 2E6FA 4IL0A 3FJ4A 4R5EA 1LOLA 3AYTA 4LNCA 4B4FA 4GYPC 7TAAA 3FJ6A 3E0IA 2Y4SA 1B4EA 4GABA 3M41A 4D8ZA 3T08A 4NZ3A 5A8GA 3A21A 4EPBC 3KAOA 3AZTA 4BI6A 4IIFA 3P67A 1G0CA 4DEFA 1CX9A 4K37A 3VOCA 3LTYA 3TTQA 4Q4KA 1TRIA 3CTTA 2OZ8A 5K9XA 3B8SA 3GDBA 1CXHA 3S42A 1EIBA 1ZTVA 3EPMA 1F4AA 3SW6A 3P74A 1TYGA 4KRZA 2PI6A 1PEZA 2C13A 2WVVA 1Q45A 3UWVA 3TQVA 3PPCA 4GXMA 2NV2A 2V3DA 3URNA 2OQLA 3BICA 4C6IA 4JTCA 4LCRA 2BLEA 3MUAA 4X0VA 1V79A 1KGXA 3GC5A 3W85A 1V02A 2PRLA 2VDIA 1C7TA 2UY5A 4MAVA 4KS0A 3CIXA 3GKAA 3SUUA 4WHBA 5GJPA 3OLDA 1BF2A 3HQ1A 1XDMA 3GB6A 3RX2A 4PZVA 4ZQRA 1Q6LA 4J3WA 2PDHA 1J4EA 3UZ5A 4QRNA 4DWDA 4B16A 2VC7A 1HO1A 5EY5A 3LTPA 1EUAA 4YVPA 1MYRA 1G5AA 3MTWA 2Z2UA 2DW7A 3GXDA 3MKVA 4PMYA 1EEXA 1PUDA 4WD0A 4M0XA 2B0MA 3H7VA 1FWJC 1PWLA 3CQHA 1J0JA 4PUNA 2XVLA 2WSYA 1SR9A 2PU0A 2Q3RA 1Q6EA 3T2OA 5LNWA 3TYAA 4GVGA 1PX3A 3U2ZA 3BMXA 4F40A 1JUEA 1FKWA 4D71A 3M5YA 3SSZA 3W70A 4UFIA 5IHSA 2YL8A 8CGTA 2GJLA 3MHGA 2I1OA 2CLEA 3VGFA 4BS0A 4WDUA 3JZEA 1Q8AA 2PB1A 5AHNA 1XCFA 1QVBA 1QCWA 4DVOA 1U5VA 3IIOA 3CQ0A 3GW3A 3LBMA 1EC7A 4BR1A 4P61A 4RDYA 3TZNA 2VD8A 2YJQA 2EPKX 1NQKA 1VEMA 4NZCA 3WL0A 2QGYA 3KBMA 4V1XA 4O52A 3PPGA 3TNBA 1B3WA 4ZQNA 1LQ0A 2OELA 3T6CA 2GQ9A 1WA3A 3L66A 4O53A 4YN5A 2NVCA 1EL3A 3N2TA 5C5YA 3T1GA 2D3LA 4R88A 4HOZA 2ZZ6A 1P6CA 2DY3A 1JVNA 3NQ8A 3W4RA 3V36A 5DFAA 1M65A 5CG7A 1PX8A 1LRTA 3QMSA 5E9AA 3TW9A 1GW1A 3BQ6A 1O94A 3W1UA 4WJEA 3KOXA 4CQBA 3VNIA 1D8CA 1XP3A 1KKOA 1S5VA 4JTRA 1K9EA 4DZAA 3H21A 5D05A 2GJXB 4DY1A 3MS8A 3W29A 5AC6A 4AB4A 3AHZA 2BVDA 2P8CA 3HJEA 3L2MA 4XTDA 3BCFA 2E68A 1RK6A 4LH8A 2IQTA 4MJ4A 4JOMA 1M41A 3AU2A 1SFTA 1RCQA 1IEQA 2ABBA 2PDNA 1EJXC 1UC5A 1I0BA 3AI0A 1CGVA 3ZLHA 2EPHA 5CPLA 1O60A 2VC6A 3S9IA 4LF2A 2G3JA 4O57A 2OXNA 3W28A 4MUPA 2G37A 1OY0A 4HPGA 1KFCA 4HZ8A 2Y85A 1W5MA 4M6QA 5LHEA 3DFYA 2G3FA 4GFIA 4BQ3A 4WIWA 1VB9A 1OEPA 4CD8A 5AKQA 1XUUA 4MB3A 2J75A 3K8MA 4XX6A 1D7FA 1TRDA 1W2PA 3A4XA 5I3KA 4NU7A 1TUXA 4IIBA 2HVNA 4XD3A 2PURA 1YQ2A 3GVRA 1G94A 1GW9A 4TOQA 1S39A 3BGGA 2DT2A 2J7CA 3PB0A 3OVGA 1NVMA 2BOFX 5CPSA 3W27A 3APTA 4A4AA 3ZT5A 4CVWA 4H3DA 4XKYB 4ATWA 1XH1A 5FEXA 3L2LA 4MJ2A 1JD7A 4H9ZA 1TELA 1XLAA 4MY9A 2J27A 1H7RA 5LIYX 4KRTA 1PZ1A 2E9LA 3VGHA 5LKYA 3MU7A 3NPVA 1QOPA 1BXBA 4CNSA 4O17A 1X8FA 4X0NA 2H3DA 3NYDA 1MUMA 4Q8UA 4Q8OA 3K8LA 2QULA 3ZLGA 3DERA 1E55A 3U7VA 1BYBA 4IZGA 2ZXAA 1J10A 4IIHA 1O5XA 3M07A 3OVRA 4UTWC 3TA6A 3W1TA 5CCZA 1FWEC 3GHSA 1HL8A 1R7OA 4OHQA 5LIWX 5C2XA 1QPKA 4HNOA 4NJIA 9XIAA 3FA4A 1TZ9A 2CETA 3MJMA 4LYKA 4IP4A 3K13A 2IKIA 1BVZA 3KOWA 2QJJA 2HPMA 4PTXA 4DWSC 1A5MC 4O12A 1OIMA 2ISSA 4EIVA 4AVOA 1M53A 1FXPA 1WV2A 1W9UA 3W7JA 3EXRA 1VCVA 3RDKA 3UZZA 1NJJA 3EKGA 2WC4A 1X1ZA 1F07A 4XO6A 1C8VA 4YYCA 4L4PA 1OB0A 3T42A 1BSIA 1XIGA 4ZTXA 4C65A 3G5EA 5CSYA 4FOUA 3GXFA 1KQZA 2BHYA 4TX9A 2VTFA 4MNJA 1PKYA 4L9ZA 2OTDA 3G1DA 3W07A 2XISA 4HN8A 3AYRA 4M7TA 3GH4A 1U1JA 1FWHC 4TMBA 2QPUA 3TEVA 3AC0A 1QDSA 3WQOA 4JFUA 2D2HA 3JU2A 4XV0A 2NSOA 4HZMA 3NEHA 4K7YA 1IXPA 1OABA 5CSRA 2FKPA 2VXNA 2WB5A 3RJXA 1ME8A 1TPC1 3L23A 2V67A 3BTNA 4ZVJA 1SZFA 4ZXLA 4ZO6A 3QW3A 3BAWA 1V3KA 3QY7A 3QGAC 5BNKA 1SZNA 2OSXA 3VOHA 4CNOA 1OFBA 1HQTA 2ZA1A 3QH2A 2PCEA 3CZLA 4B3ZA 4CCEA 4UFJA 1XYCA 3EDKA 4C6PA 2E7FA 2YX0A 3S46A 3R10A 2HTMA 1P6BA 3WBAA 1TE1A 2ZTKA 4XD4A 3ITOA 4UQDA 1QMLA 2HXUA 4BQ5A 4YJ5A 5C2CA 2J9YA 3N9SA 3PR2A 1GVSA 2D2JA 2QVHA 2H8ZA 1EFZA 1KM0A 3SJ3A 5M5DA 4LVDA 2IKJA 1FHDA 3QYSA 3V16A 4AIUA 3LCWA 1Q63A 2OVLA 2NSXA 3QMRA 3A9IA 3U5YA 9XIMA 4WUIA 5LA1A 1HFBA 4IG2A 2QPSA 2GJXA 1HL2A 1ZAIA 3UXAA 2XFWA 4KRUA 4BJHA 3QY8A 3FYOA 1ZY9A 1ZCCA 4UTFA 4AZGA 1DJGA 2GOKA 4H19A 2YA0A 7XIMA 2E1DA 3VGDA 3ENLA 1UPPA 1K02A 4LCSA 5DT7A 1JAEA 5FJRA 4IX2A 4EVZA 4WOQA 4GH1A 2E1WA 5IRPA 5JU6A 5CJMA 1JQXA 3WQVA 2HEJA 1WUEA 3DFNA 1QPOA 1OJXA 1ZPTA 4QAWA 4Z2LA 2JF7A 1A5SA 2QUVA 2AQOA 1XBZA 3AIEA 4LSBA 4X9SA 5A6AA 2IPWA 5HDRA 3UR2A 1PO9A 1JCMP 3WQWA 5FJOA 4ZENA 4D6IA 3W83A 3VNLA 4JPGA 2YL5A 1AD1A 1CXKA 2GVYA 1FWGC 4GPNA 3LLFA 2CHRA 3S47A 3CV2A 2ICSA 4HU0A 3QKEA 3FJLA 2F2KA 4RZ6A 1Z89A 3MSDA 2B7NA 4IJRA 3PG9A 3W7IA 2BV9A 3LHWA 3PBVA 3V7PA 3TW6A 4MKSA 3MVIA 1E6RA 3E2SA 3LN3A 3NSMA 3SCUA 1MSSA 2QCNA 3THCA 4ICMA 1CYGA 4ILSA 5JXQA 4XKYA 3SN4A 4JEJA 3D5HA 1DJQA 1LT7A 3TCEA 3C52A 5FOOA 2VZTA 3GTHA 1W56A 1XBVA 3MZNA 2VFIA 4LAUA 2PP1A 3CGTA 1AQFA 5HATA 3AMDA 3IGHX 3NQ7A 1ZU8A 4G1NA 4BHYA 1XIIA 2P0IA 2Y8KA 2YLLA 2CZ5A 5I79A 3SI9A 2CLHA 5MKGA 1OWQA 1MFVA 3K8KA 2V2CA 4JDYA 4HKPA 1JCTA 2WSRA 2FHFA 4HPXA 4AQLA 1WZAA 1RJRA 1UP3A 5LSMA 1D9EA 4FAMA 5CLTA 3S2NA 1RD5A 3KP1A 1TV3A 4LUIA 1UKOA 3ITYA 2DIJA 4FZIA 5CC6A 3DECA 3WYZA 1NFGA 4NASA 1E1EA 2CESA 4ZSTA 1ONXA 1DE6A 1XC4A 2KAUC 1C8YA 2FB3A 3KL3A 2ZZ1A 3QC3A 1Q2SA 4HD5A 3ZQ9A 1BYAA 1V6WA 3PM6A 5CBIA 1Z41A 1P48A 2INFA 4UQ9A 3NQBA 4PGLA 3WNKA 1B3VA 3LUTA 4GYFA 3WEZA 4OVXA 2C91A 3M0MA 2HBVA 3WSUA 3FV9A 3OOQA 3EX6A 3LEPA 1QO5A 3VZXA 2Y24A 3OZPA 2CZDA 3WK3A 3CPUA 1JYWA 1W1YA 3ARUA 1YXDA 3GH7A 1U5JA 3WLKX 4Q4OA 3FLUA 3W0KA 2XDFA 4O1AA 1CGTA 3NQVA 4UNKA 4QE5A 4BI7A 4PBFA 1A0CA 2C3ZA 4JAWA 2ZRVA 2IKHA 4NX5A 1PSCA 2E28A 1CPUA 2Z28A 2X16A 3ZOAA 2YW4A 3VOGA 1YTDA 1EOMA 2P8BA 1XLHA 5BOEA 1ZBWA 2QJNA 1L2UA 3QQWA 4I8DA 3N11A 3A22A 3L0KA 1PZ3A 1VC4A 3STEA 1GVRA 5I03A 4QG8A 4MYAA 1BXNA 2CEQA 3P2VA 1AL8A 5DF0A 3CEPA 1IR2A 2GK1A 4HIBA 4UFMA 2Z27A 1FTXA 2OLAA 5GVJA 4XZWA 3ES8A 2NX1A 1KTNA 2WHLA 3DHDA 3QGKC 5BYWA 2PTDA 3IRDA 3FHQA 3KBJA 2BMBA 3BV7A 3T4CA 3LENA 3VKJA 2BWGA 3LRLA 5FEPA 2D1ZA 3GBEA 1VFSA 1RH9A 5I77A 1GNXA 1FFQA 3KL0A 4L9YA 3UPMA 2OX4A 4GQQA 2F61A 5KITA 3R25A 1L6GA 3S2JA 4HSOA 3OVQA 2J7BA 4W7UA 5BU6A 2DZXA 1XH0A 5I7GA 3SFWA 6XIMA 5F2GA 1UMYA 4PL2A 3NZQA 3VD5A 5CC7A 4XG1A 4UFHA 4ZODA 4IMDA 1CLKA 5M1TA 2YKKA 4PODA 1W5QA 4AWTA 3QQ0A 1VENA 3D47A 2WJFA 1UC4A 4MZ1A 1IIHA 2DUAA 2GGGA 4QNWA 3DYPA 4C5YA 1JCJA 5AC5A 1VFLA 1CIUA 4M82A 1A0DA 4AWSA 4C91A 8XIAA 3R58A 2Q71A 1XG3A 3BOFA 4UMAA 3LCXA 4C6DA 2C0HA 1H0GA 1LOQA 2YXGA 1S5TA 3GNXA 3ZXWA 4E4FA 4LANA 2BSLA 4JXCA 2ZDRA 4HGXA 3MKKA 4JIIX 3BMVA 3KX6A 3LHUA 3A5VA 4QQ3A 2BOEX 3SUSA 3PFMA 1Q85A 3SFKA 3WJZA 5CGTA 1BXCA 1TQXA 2B7OA 4QFUA 3H23A 1S2AA 3THQA 3GRIA 4G7FA 5HBFA 4FLQA 4EKJA 4UIOA 1KB3A 3PB2A 1KM3A 2HRWA 1JEZA 4O19A 4LUSB 2ZRZA 2PLMA 2RDXA 1HKVA 4J3TA 1OIFA 1UOKA 1OCQA 3H2NA 3EAUA 3M0YA 2OZ0A 3PUOA 3K4AA 1OFEA 1FWDC 1OC5A 2DVXA 5JH2A 1JZ2A 5A6KA 3ZO9A 1Q7MA 3ES7A 4LS1A 1SQ7A 4ATLA 1PCWA 5H8MA 1X6UA 3NZPA 2E3ZA 2O7QA 3WQDA 5CLWA 1OFRA 1CEOA 1A5AA 3RILA 1NAL1 1BD0A 3NYZA 3QR0A 3SN0A 3NCOA 5H1WA 4EAYA 1I1WA 4XAPA 4HPNA 5GNXA 5H91A 3DESA 3OQEA 3W2UA 2NX3A 1W3TA 3EYPA 1I1XA 1R86A 2QUTA 3FA3A 2Z0IA 3QFEA 4S3CA 4MWAB 4DO7A 2VRQA 3SO7A 2UV8G 2HE5A 1W3NA 4V2XA 1XLDA 3IJDA 2E77A 4QR6A 3ZFHA 5EB8A 1K9DA 4RNIA 2FFCA 1DJHA 2HNEA 2XH2A 4IWWA 3L5LA 4M5PA 1Z48A 3B9EA 3HOJA 2PZNA 3LCFA 1LBFA 2H6RA 3ZWTA 1XSIA 1AA1B 4J2PA 5GPRA 1SR0A 2JKAA 3J7HA 5I24A 1ECEA 2A5HA 4JIPA 3IJLA 3N3MA 4AYGA 1KWKA 4S3BA 4WLCA 5D9PA 2WBKA 4BWLA 4WKFA 3SUVA 3LZ3A 3TTOA 4IMAA 5A6TC 3GLCA 3W38A 2D0GA 3S1XA 3WQ8A 1GKQA 4FLOA 3STGA 1MI3A 5PTDA 1LZOA 1MUWA 2O92A 4I9AA 3DFQA 2W91A 3MP3A 3STCA 3ONBA 4HB7A 4MB4A 4CCZA 2ZOXA 4AD4A 1PIGA 2B4GA 1YDOA 4W93A 3V75A 3WQ5A 3PJXA 3PBWA 1US3A 1POJA 3HA1A 4AXNA 3UCDA 1TR1A 1QNQA 2FZ9A 1TIMA 3PP7A 3LHYA 4GZIA 3B03A 5D8WA 2R1PA 4I5RA 3EOEA 3RM8A 3ZJ7A 5CAKA 4CQ8A 3CUGA 4GA8A 4R33A 4C6NA 5FL0A 4PTNA 2GVGA 5KSWA 4H6KA 3RLVA 3HU7A 3DH7A 3AHYA 4U5IA 4GUGA 4DJFC 2C7FA 3KWXA 3IJ9A 4IPNB 1RP8A 2AQVA 3HN3A 2QDEA 4KFPA 1XBYA 1G67A 1C8XA 1CW2A 5HUOA 2WNQA 2X0HA 3JW7A 3SCWA 1B3XA 1DQUA 4NZ5A 4HCDA 5CEWA 2HZGA 2Y8UA 3TP4A 3AXXA 3GXMA 2RJGA 3A4WA 2WHKA 3BOXA 4MNLA 4ZSUA 3T0AA 3PZOA 1DWAM 1N55A 4ZOAA 2W27A 1LYXA 3S1GA 3W2NA 4W8BA 2EF9A 1XIFA 2GGHA 4CNNA 4H04A 3TKFA 4Z0JA 4DXVA 1K3UA 2Y6ZA 3SB0A 1KCXA 3DZ1A 1SW7A 2DZBA 3VAVA 4UTLA 1CWYA 3WJWA 4DYKA 5I3IA 1WDSA 4I5XA 2QPXA 3KCOA 1IT7A 3CB3A 2QUMA 1UIOA 1Q8JA 3TN5A 1UJPA 5A6JA 5KEZA 3C8FA 1SSGA 4ZO9A 2WJEA 2BFGA 5I0DA 3BWWA 4M6UA 2PSNA 1GHRA 2NV1A 1AJ2A 2QV5A 3LDVA 3SN1A 1HKJA 5AHMA 4E2VA 1U30A 3DHUA 1QWGA 1W91A 5LNUA 1R38A 4Y9PA 1O1HA 1EZWA 4MKVA 4PA8A 4JTFA 4NILA 2QCCA 3NWRA 1K7XA 3NVTA 3WNMA 5ECUA 4XZHA 3UW6A 1AD4A 5HNNA 3DKLA 4DJDA 2QDHA 3AMKA 4P8XA 2WNNA 3KS5A 5REQA 1VF8A 1DEDA 1NM9A 1V3MA 4LYQA 8A3HA 2ODOA 4A2RA 3IIVA 3UVAA 4LVFA 1FH9A 4UTUA 3OLGA 4E8CA 5HPCA 4DBEA 2I16A 1DWJM 3AWOA 1JGIA 5HPOA 1NOFA 1MXDA 3ZVIA 5M03A 1TPWA 5JUVA 1J6PA 4AY7A 1GOQA 1EGZA 4NI8A 2OX1A 2AL1A 1KFEA 5E1QA 3E2QA 3T8LA 4M7SA 3EDJA 4DM2A 3CQIA 1K1DA 1D8WA 2YBVA 3H2CA 1X39A 4GVFA 1R3YA 1UA3A 4E0CA 1OYBA 3H2MA 2NZLA 4DPQA 1ZFJA 4AEFA 3QEZA 2ZXBA 4RDVA 4IL2A 3T40A 4EANA 4E3VA 1KRMA 3EB2A 1TPH1 1OBAA 2RGMA 1VBUA 1I2RA 5E09A 2I7GA 2XFFA 1QU4A 4E6MA 5BROA 3EWZA 3QZ6A 1K8ZA 3L4WA 1OFQA 1UH4A 3VX0A 1ZAJA 3IVTA 3OTRA 4EWJA 2D0HA 4S1FA 1XIEA 4A8LA 2QDDA 1KM2A 2J8GA 2OO0A 4G2DA 2A1YA 4AIBA 7PTDA 2GOUA 4Q8NA 3BMWA 3UFYA 3V0SA 4YS1A 2VZVA 2YB1A 5FF4A 1IIGA 3FSUA 1KXTA 1I0DA 4GKTA 1QBBA 1RALA 1S2VA 4REQB 5ABEA 4KCVA 4UWMA 3TVAA 4ZL1A 1NELA 2HROA 4KETA 4RLIA 3LGDA 2OT1A 3UGRA 4ZE4A 1TV4A 1VYSX 1VZWA 5JBFA 5I06A 1DP0A 3A23A 3W71A 2FZNA 3BLDA 1OX6A 4JY8A 1TKKA 1XQLA 3HIJA 3NM3A 2QLYA 3W7OA 3TAOA 5A8OA 4NKCA 3PG8A 1VBGA 1IWPA 5F1VA 4KBXA 4KEMA 3TOYA 1RCOB 4GRSA 3W1QA 1E0WA 1GQIA 1E15A 1TPVA 1LOSA 2WM0A 3L4VA 1I9CB 3PZMA 3RITA 1UP0A 1U83A 4R34A 1J0HA 1GZGA 1K70A 3U8GA 4PB3A 3WMSA 5DBTA 4JTTA 4MNMA 3FKKA 2GWNA 7A3HA 5HJYA 3F1QA 1FWIC 3F4NA 3NQCA 3BGAA 4PC8A 2VRJA 5C54A 1OYCA 1YKWA 1ISWA 3V1PA 2WJDA 1XIDA 4PTWA 5HJLA 3CAQA 1E6PA 3OEXA 4FNQA 4PFMA 1VPQA 1BEUA 4GIEA 2JKPA 1U22A 3UBPC 1A5NC 3FYPA 3QSTA 3HV9A 1E73M 5AYZA 3QMTA 1VP5A 7ENLA 4J27A 1PKMA 3EMZA 4OIFA 1UZHA 4NJJA 1TA3B 1WXYA 1ZBCA 4HYVA 3C0JA 3EDFA 1DQWA 1LBLA 2C19A 2WPBA 3T2QA 3ABSA 3EKLA 4I9TA 3ARTA 4H9TA 1YNPA 2OWWA 1CI1A 3KLLA 3N25A 5BCAA 1H51A 2BP1A 3PF3A 4HA1A 9RUBA 3MUXA 5A1AA 2I57A 1HT6A 1OD0A 3N2XA 1I2NA 4GNKB 5KINA 5IDZA 1RUSA 3CHFA 5K4XA 5KMYA 3ARRA 4WJ8A 1ZALA 1CB2A 3SR7A 2EXOA 1FDYA 1ECQA 4RL3A 3QOMA 2WKGA 2VQUA 1BSLA 3K46A 3A3XA 3DFHA 2WNZA 2XGIA 1UKQA 4AHOA 3V5FA 3F5LA 3T0DA 3P0XA 4IP7A 3KVKA 2WXDM 2E6AA 1Z44A 2DEPA 3STFA 5A95A 4NHVA 4X2PA 1GJWA 1VCFA 2DZTA 2GDVA 3S5ZA 3UWZA 2QV4A 3NUKA 4D8LA 1XYBA 5DELA 3VUPA 5DQPA 2R1KA 3PN8A 4EE9A 1UH2A 4NL1A 3JRKA 2CLIA 3K5XA 2XFYA 2XIMA 2XPKA 3VYLA 3W1MA 4HNLA 3SRHA 1G4TA 4JKLA 1QI2A 2RUSA 5A2CA 3NXLA 2W63A 1QW9A 1CXIA 2G0WA 2FHBA 4N2YA 1GYLA 4N7QA 4UMCA 3SUTA 4Q22A 3RRXA 3IIXA 1ICSA 4RE2A 3F4CA 2WVTA 1G6CA 4UTIA 1Z9AA 2F38A 1W8SA 4WF7A 3TLQA 4IGSA 3CNYA 2HVMA 3F5JA 3AIVA 4NNCA 4FK9A 4IISA 5H6HA 1OFDA 3TMQA 3WK2A 4HSHA 4KWSA 4XB3A 1YPIA 2PZ0A 1J2BA 1BG4A 3SZ8A 4W84A 1VFOA 4GQGA 1WO2A 1QRQA 1Y8BA 1UWTA 2B81A 1P43A 4YYFA 2ZKMX 1RZMA 1GK8A 1LUCA 3TWBA 4TXEA 4OV9A 4A6GA 4PB5A 2G5WA 4G1KA 4JL1A 4O1BA 1E72M 5FESA 1SYTA 2XSBA 2QIWA 5KTLA 1TMQA 2HJPA 5AN7A 3MHFA 1GGOA 3UNDA 3VKCA 1V0MA 3G77A 3KS6A 2PGRA 3CMFA 3BPWA 2A79A 1XYZA 5EFFA 3UG3A 4UCGA 2DJLA 4HHHA 2WJZA 1J93A 3VMNA 1EJUC 2ONEA 3HGOA 4PUWA 3UCCA 3S83A 4FMVA 4O1EA 1TV2A 3QW4B 1WUFA 4NG3A 1E5NA 4REQA 3EX3A 2PE4A 5CH9A 2QXWA 3VD7A 3JZUA 1XRVA 1DJIA 6TAAA 2JK2A 2WANA 1THFD 3VNZA 3ZJKA 2TAAA 2D3NA 4EXAA 2BVWA 1T99A 2HSAA 2DU2A 3I10A 4NXSA 4HQVA 4LBUA 1T40A 2NQ5A 2UZ9A 4GZ7A 3IIZA 4H8VA 3UGVA 3CHCA 3G6MA 4XTIA 3CUZA 3LXCA 4EF9A 3T44A 2Z7GA 4WK9A 4YTQA 3Q94A 3COTA 1XLMA 3T09A 1EXPA 4GNJA 1ESWA 1WZMA 3GY1A 3LSCA 4OU1A 2RFGA 3LGEA 3LCHA 3V5OA 3AWNA 3SRKA 3UESA 4US6A 5LA2A 1K6WA 4UFLA 4MDPA 4Z1AA 4GH3A 2Z1XA 1J5SA 1L6WA 1UBPC 1XLLA 3TONA 3SCNA 5BZAA 3SECA 1CGYA 1XI3A 4ADTA 5CSUA 4GI4A 1GKPA 3AIQA 4JHZA 4AHPA 1NWUA 1OK4A 2PDUA 1UBSA 1HVQA 5T26A 3VI2A 2X09A 1JL8A 2A3HA 2DZUA 5D8ZA 4IFOA 4LW7A 1NY1A 1TA3A 1MDLA 4US5D 1V0LA 1PL9A 5I3FA 4PMNA 2AKMA 1FQ0A 2FJKA 1BVNP 2Y7EA 4BI5A 3EPNA 2H90A 4DX3A 1F76A 3SRFA 2XIQA 1HJUA 5AYXA 2NUXA 4CNTA 1WXJA 3TJIA 3QHMA 4HMNA 1ICQA 3PZTA 4TVUA 4KCUA 1GOIA 4XISA 3UJFA 1DPMA 1W54A 4AWEA 4V28A 2DIEA 2FDSA 4MOZA 1CXEA 4O4VA 2XVGA 2HVOA 3MDUA 3PTKA 5L9FA 1JYXA 2V81A 1N2VA 4XAGA 4JYDA 2ZWYA 5A69A 3B0PA 3DEQA 4ES4A 4PEEA 9CGTA 5EYWA 4JCLA 4GG9A 5BRBA 3AXIA 3ZS4A 5E70A 3RX4A 4UTTA 5LZLA 3Q45A 4H1ZA 1X8CA 3MP4A 4FO4A 1XIHA 5LHFA 3WF0A 5FI8A 1L9WA 4MMWA 3FFSA 3BJSA 1LDCA 3JR2A 1XICA 3S0CA 3L5AA 5AC8A 1DIDA 4NAEB 1ISXA 1I2OA 3T0TA 2NQLA 4CN6A 3VDCA 4XIMA 5J5DA 1OCBA 1GKRA 3UNTA 2WW5A 2YSWA 3FXGA 3DU0A 2V38A 1DWHM 2X2GA 1H0IA 1GG0A 3W7DA 1HG3A 5F2MA 2YDSA 4J3XA 3MT1A 3Q58A 2PWEA 4HN4A 2PDPA 3N19B 4DUVA 4GWEA 1H2JA 1PZ2A 2BGSA 1ONRA 4DELA 3VIJA 2AAMA 3N3TA 3L0NA 1V3IA 2PDBA 4X60A 4I7UA 4AUBA 3M5XA 1NFPA 3RGTA 4GKLA 2G4JA 3AO0A 1RVGA 3M0VA 3AHVA 2ZA2A 1QNSA 1W1TA 3LU2A 4O8RA 3PSVA 1W8GA 2X05A 2HE8A 2NT0A 1BRLB 4XBSA 3RR4A 4AEEA 4DJDD 1WAUA 5TBOA 3DAQA 4ML9A 2G97A 3PTDA 3FK4A 1DOSA 2WC7A 3IK2A 4L61A 4LT9A 2PDFA 3T05A 1BAGA 1EJTC 1J96A 3WDJA 3M6YA 2VQTA 2O9TA 4DUOA 3PTMA 4JTAA 1OADA 3EOLA 2A21A 5C70A 4XAYA 2WLYA 2ZZ3A 4NQ1A 1LTDA 3VOJA 1KA9F 3W25A 1W1ZA 4HYWA 3MB9A 1XWYA 4E2OA 4PE8A 3EEZA 3QHNA 5K2ZA 3FXYA 2ZC8A 4OKDA 3TLLA 2VENA 2ZUMA 4WKAA 2DUZA 4MWAE 1FA2A 1TE6A 1GWJA 3WMBA 5LIKX 4NZ4A 5F7UA 4ZQPA 2G50A 1XGEA 2CBIA 3WLSA 4PTMA 5BXRA 2HCVA 2I56A 2XZ9A 1EA0A 1GQJA 1S1RA 3MQTA 1XCXA 2QJIA 3EWCA 1CB7B 1V7YA 5FJJA 5AVNA 3ORWA 3EB3A 1TJ1A 3NGFA 2PLKA 4MWAD 4NYYA 3WY1A 1OHLA 1HTIA 3M64A 4XZLX 1E9LA 2W62A 3KTXA 4MAZA 3GTNA 5G2IA 1ONWA 1WQ5A 1XBXA 4JTHA 3GDTA 4AYSA 1RAKA 2PLCA 1ZAHA 3G6LA 2QR6A 2OYMA 1Q13A 2HPIA 2ALRA 3E9AA 4RDWA 3M4HA 3BLEA 1U1UA 4LVGA 3CWOX 4AFYA 2PF0A 4FXSA 2E67A 1PX4A 2A3BA 3NA8A 4QM1A 1DHKA 1TJ0A 4R7JA 4UUIA 1U33A 2Y5JA 1A47A 3BG9A 3BV4A 4JN8A 3ITLA 4LS2A 4S38A 2OOFA 1V5XA 1UHVA 2X40A 3UZWA 4H9VA 5DY2A 2FGBA 2E6YA 4IUGA 4J3VA 3G3MA 2QJHA 3N9KA 4QEEA 4OJYA 2HDJA 3AJXA 2XH0A 4HJWA 2G3IA 4O28A 4ALDA 1WNOA 3M43A 5BOOA 1JZ6A 2UY2A 4Q4SA 2E8YA 3O6YX 1UWRA 4I9JA 1TCDA 2WC3A 2Y88A 2C71A 1HKMA 4B3KA 3P60A 2PPGA 2P5NA 2VGBA 2XGBA 2VOMA 4DUXA 2Y5SA 3PHAA 2CXGA 4CU6A 3B9OA 4UNLA 3BARA 3PFRA 2JEPA 2E5CA 4NF7A 3TIMA 1FKXA 3UJSA 5G4EA 1UWSA 3BW4A 1XYLA 2BODX 3QC0A 3FSTA 3QJAA 4NAEA 1EWDA 1ZSXA 2QHAA 1QHPA 4G7EB 3URBA 4E2BA 2DV0A 3OZMA 3MZ2A 4BKNA 1WDQA 4LGXA 3GE7A 1Q6DA 4L6DA 3GVGA 3ELFA 4GHRA 1Q7QA 1LT8A 3G2GA 3GHTA 1XSKA 1ZS2A 4LCQA 4URIA 4NZJA 1B2YA 3P6LA 5K9CA 5FD0A 2BY2A 1QUMA 1SUXA 4M81A 3CV6A 3WLOA 1GOXA 1BKSA 5HNRA 3U0HA 1R9XA 3WF4A 1B1YA 3KBSA 3EWXA 4UOJA 2FB2A 1P0BA 3B0XA 1R8LA 2VUNA 2XIJA 3SJNA 2V5BA 4GISA 5C7VA 4IMFA 2CLKA 3I4EA 4A3UA 1VFUA 1QBAA 3ARWA 1FOBA 1NOWA 3GNNA 3CMGA 1DXFA 4JTQA 5TAOA 1IXQA 5LGZA 1JYNA 3WDRA 3N9RA 3TYZA 2XIOA 4AIEA 1Q4WA 1OQFA 1Y65A 3KM8A 3DFPA 4IIDA 3NZGA 3BK0A 3GD6A 3WEMA 1VRDA 2QJMA 2WCAA 2EJ1A 3NL6A 3UWEA 1BRLA 4MGGA 3BURA 2GUYA 4LAOA 3W9ZA 3L4XA 3KVMA 2PMQA 1T6MA 2Q8ZA 3ZSSA 1U5HA 4MLJA 2QYGA 1HN1A 4WKHA 1XPYA 1KCLA 1TPB1 3L0GA 3HPAA 2LLEA 1AJZA 3BXWA 2NV9A 1WB0A 4J40A 2WZTA 3RU6A 1M6JA 2PP3A 2BG5A 4HVXA 1LG2A 3P61A 3OPSA 3UPWA 4LWWA 4EX4A 1HXJA 4EP8C 5LIUX 3U48A 4QNEA 3B0UX 2GWGA 4TU1A 3FS2A 4DO4A 3T2PA 3RIKA 1RXOB 1CBGA 1PKLA 4KMQA 1FP9A 2GDUA 4HHPA 4GC4A 1AH4A 1Z69A 1MVYA 1C91A 1VGAA 3A13A 4C6OA 3BLPX 2ISFA 4AZ5A 3WL1A 3QHOA 4XAFA 3HF3A 2O56A 5DCBA 5KZDA 4AAJA 4JTSA 3ARXA 1NEYA 4QEHA 2QCEA 3MI2A 2AQWA 4Y9NA 4AU0A 1CLXA 4INFA 4JYFA 2ON3A 5BXTA 3SEPA 4J4KA 3RPTA 4ZFMA 3EWWA 2FGZA 2VFFA 3ANVA 4MZYA 4DNMA 1JZ8A 1UKPA 3CUFA 4HBKA 2HV5A 3O0KA 4V15A 2CLLA 4O16A 1ADSA 3VNJA 4D6CA 3KCJA 1VIZA 2Z00A 5GQBA 4L4MA 1PV8A 5GNZA 1IXOA 1NDWA 2FDMA 4D72A 4AIOA 4U2YA 4MFDA 3ID7A 5HA7A 3EWYA 3MW7A 3TR9A 3HPSA 4QCFA 1W3JA 2IPGA 3PNUA 1FHLA 1O12A 1JFHA 4O4WA 1S38A 3U4FA 3MO4A 2A85A 4FLRA 1AQ0A 2G8ZA 2BY0A 3MY9A 4QX4A 1TZZA 2Y7DA 1F9CA 3QXBA 2EPNA 2PGWA 4ZGYA 3A4JA 4QLLA 2WWDA 4XQ6A 1QPNA 4CVUA 4HU4A 4S3JA 2JE8A 3P0WA 1D3HA 4DN1A 1E6NA 3N2MA 5AHEA 4DO5A 2R91A 1TVPA 3ARYA 1KM4A 3MI6A 1GVIA 4Z42C 1XINA 1MNSA 5K3VA 4OGZA 2JIWA 4GIYA 3TW7A 1TQJA 5EBUA 1UP2A 4Y9AA 1K7FA 3AIRA 4GGBA 1T0OA 3VA8A 3W7RA 3LLDA 5GJNA 2R94A 3WJSA 3KFTA 2FTYA 3RCNA 3NFUA 4MJZA 5HQEA 3CHEA 3THUA 5TD4A 1P0EA 3VIHA 4QDWA 1KV8A 3RX3A 5ECVA 2RGLA 3PZGA 3UR8A 3B9DA 2DQWA 3C5QA 4GJJA 1ZNNA 3QRHA 4C6CA 3UZXA 2QZRA 1W0MA 4A3QA 3WMLA 3WFAA 1BTCA 1Z42A 2G41A 2YA1A 3HQPA 1BTMA 4JTKA 3IUIA 3EB4A 1GTHA 1ZBKA 3LGGA 3M0XA 5MF5A 4C6BA 4JBRA 2D23A 4Y90A 1P7TA 6REQB 4DZ5A 1H7WA 1X98A 1JCNA 2OSWA 2ZDSA 3TJ4A 2VEIA 2E40A 4FOKA 5HQMA 5D03A 1NWRA 4X9YA 2FZMA 1O95A 1HJVA 3OJGA 3QGVA 4A22A 2C1GA 3VGGA 3EDDA 5C7HA 3R89A 1A3HA 2OGJA 4NVTA 2EKGA 1EDGA 3VKDA 3PY2A 3GYEA 3B4YA 3LRMA 1A4MA 3K1GA 3OW1A 3LMYA 4AY1A 5F2IA 5A6BA 2X0SA 1PBGA 4Q3MA 4W7VA 1V0NA 2V5DA 3CUHA 3R8RA 2IXUA 2A2IA 2C6QA 3WDIA 2ACQA 3G1VA 1TREA 3C0SA 4XUYA 1JRBA 1JNDA 1NDYA 1UJQA 3PZVA 4YTUA 5C0QA 4LUTB 3OYXA 4QLKA 4CN1A 2MNRA 4Q8TA 1Q6FA 1IWBA 1G4EA 2YDRA 2PRHA 3GHUA 3VILA 3CU2A 1R30A 2GFTA 2ANUA 4D6JA 1BWKA 4GO9A 4GY7A 3EDEA 1MW0A 1XRSA 3O05A 3VKBA 1US2A 3NM1A 2YFOA 1B54A 4UR8A 1HUVA 3BAKA 1KFLA 3R0UA 1U2YA 1BG9A 1F3XA 3R8GA 2I5IA 3W6MA 1GVEA 2NUWA 1UUQA 1V3JA 4JD4A 5FJIA 2DGAA 2XWDA 4B91A 3VK5A 3W02A 2JF6A 2VZOA 1K8YA 3T55A 1M7OA 2NX9A 3IUDA 1M9HA 3EOUA 3FGCA 2VURA 1W1A1 2POZA 4H6EA 3U6WA 4TTUA 1HO4A 1PS9A 3OGSA 4H41A 5FSDC 3ZZ1A 2GGEA 5CZKA 3BZGA 4OV4A 3VO0A 5FAGA 1QW8A 4QJ4B 5CZJA 5CC5A 3KHJA 3VTRA 1OSEA 4CGTA 3TJLA 2QGHA 4N9BA 1O6IA 2WLZA 5CPQA 3PJWA 3LCLA 5A6MA 5HANA 4CN4A 2ISVA 3AMLA 2FTPA 2JALA 4RJEA 4KT2A 4NRRA 3QBUA 1W5OA 4QJ3B 3W7CA 2J7FA 4C6EA 4M19A 3VDHA 1EX1A 1TUFA 1NDVA 3FVDA 3NQGA 1JAKA 1J11A 4TV5A 1XIBA 3CZEA 4PN2A 4JY9A 4AX6A 2E8ZA 3DFSA 3TE9A 1I45A 1UR8A 1GQLA 2EPOA 4IPJA 5H8PA 4OOUA 4DNHA 4ACZB 3SURA 4GX9A 1W1B1 4YL2A 3TYCA 3TNOA 5D37A 1DV7A 4MSSA 3WLHA 1VFMA 4LTSA 4Y2WA 1EZ2A 1XRTA 3W01A 5G1MA 2CWXA 1EEPA 1S3HA 1F74A 2WZEA 1JQVA 4JN6A 3NL2A 2V5KA 1A5BA 4H9YA 1W6TA 4JIEA 3F4VA 1P1MA 1AMYA 4QDMA 1H63A 3L68A 4GIRA 1GORA 3MBDA 4W5ZA 4XZBA 4U28A 3KTSA 1FH8A 5EFDA 4TUFA 3WQEA 2CU0A 4LFYA 4M6PA 1ZJIA 1W3HA 4MHBA 4F0SA 2IPJA 5CQ1A 3P5YA 1NTHA 2PTWA 3QF0A 2YGYA 4KH2A 3AROA 5ABTA 5FF7A 4A21A 1A5LC 3GKFA 2R14A 3VDAA 1RLDA 4B4HA 5KZ6A 1RQBA 2O9OA 3BLFA 1TR9A 1AL7A 2AL2B 4Z17A 5T91A 4DBWA 1JPIA 3MANA 3CASA 2JEQA 2I5GA 4LB3A 3S2LA 2GJNA 5C9ZA 5I07A 1X1NA 4JL2A 3A9BA 3TC6A 4KFOA 1FDZA 1L6FA 1LRQA 1GCYA 4UQEA 3ATZA 2EPMX 1B3YA 2RAGA 4A05A 3H26A 3NO1A 4IOTA 3QSRA 2PD9A 6REQA 1F3WA 3WLQA 2V30A 3GG7A 4E38A 4RX0A 3E12A 4GI8A 2PDXA 3KOYA 3S4TA 4U5KA 3HB9A 3WBEA 1W31A 4B5VA 5A6LA 2VX7A 1Q6QA 4GVIA 2WSKA 1YPFA 3WUGA 3W81A 1WDRA 3UY8A 3VOFA 5CKSA 3ICJA 4UQAA 3IVSA 2VKZG 3CH9A 1LWHA 4WX2A 3ABQA 2D22A 3RLUA 4GACA 2BS9A 1GVQA 5JVLA 4IICA 3EX4A 2Q8XA 2WKJA 5CC3A 2W79A 3KL5A 3ZJ6A 4ADUA 1BGAA 2CZFA 4Z2HA 3ECQA 2VYOA 1SMAA 3BLKA 4W88A 3UERA 4I9MA 1PCKA 4LUTA 4RXFA 4FPSA 2GSHA 1TCMA 2VX4A 3ZMRA 1FHVA 3M0ZA 4MB1A 1P6WA 4P7QA 3VCRA 1QW7A 3VUSA 3E96A 1UZDA 1E9IA 5EL1A 1B9BA 3C56A 4JFVA 4XBKA 4WVXA 3WFZA 1PHWA 3W1NA 2F6UA 1GOWA 2H9AA 4M51A 3G0SA 3TR2A 4OQVA 5FSEC 2YOCA 1TSIA 1GJPA 4AY8A 2P0OA 4PULA 1K8XA 1B90A 2EAWA 3QQ1A 2VI0A 1TWIA 1CDGA 3O16A 3DHFA 4ECLA 2WMFA 4BK9A 3E0LA 5BWAA 3N04A 1GQKA 4C60A 3VKKA 1MO0A 3RCMA 1YNYA 2PGFA 3BAXA 3RMEA 1Q66A 3LS9A 3TJXA 3QPZA 1OM0A 3RG6A 1B9ZA 1W3KA 3AYVA 5IXEA 3DIPA 5C8BB 4R7OA 2RKXA 2O55A 1KNWA 2XWEA 2X1TA 4O8AA 2AMXA 1ZJBA 5CXPA 2XZ7A 4HCLA 1WOAA 1AFSA 3GVQA 2Y61A 5HWJA 3KTCA 2O9RA 2QMJA 1PPIA 1RSCA 2GGJA 4J35A 4LC8A 3P84A 4QTGA 2A0NA 3GG1A 1M01A 2PDGA 1ZLPA 4QBXA 3ARSA 4JNZA 3QY6A 5IM51 3GAKA 4HA0A 3WFLA 2OWCA 3SBFA 4K39A 3RO8A 4ZB0A 4XSLA 4KWWA 2E5BA 1DJNA 2IQ0A 4Q8MA 3RN6A 4R7WA 1DWFM 1E1CB 1KFWA 3H2EA 4LV9A 2QCDA 4QSHA 3T9PA 4L64A 3WCZA 2W4XA 5D02A 3MUCA 4ASTA 4Y7EA 3CM4A 4RV3A 4LU0A 1BLIA 4CD7A 5BMXA 3LLXA 3OHMB 3QV7A 4ZR8A 1HJWA 2DZVA 3GG0A 3LSBA 5TQLA 4L4OA 3W3OA 3CO4A 3VIIA 5C71A 1F2JA 5D4YA 2DZSA 1G69A 1T41A 2VEPA 3R12A 3PZIA 3MI3A 5D2XA 4UQBA 3NAVA 4XVDA 2PTZA 3RPDA 5LNVA 2XFRA 3H2FA 3N73A 2ZCGA 4RV8A 2WNWA 1XIJA 2XM1A 4H9UA 4IFRA 4H2HA 4I6KA 4WR3A 2BHUA 2WOQA 4CD4A 2X0YA 1UQZA 3LD5A 4YWIA 3W23A 4D8AA 2YPIA 2J25A 2AL2A 3ANUA 3II1A 5EMMA 4NZFA 2NXHA 4EWND 4GYPA 4O0QA 4UFKA 3KWSA 4Z1YA 2WVUA 2WPGA 4WY0B 1YADA 2HK1A 2J24A 1EGVA 5DCDA 3CB8A 1TPDA 3NVDA 2DZAA 3ARVA 1GEHA 1VQTA 5C9WA 3CIVA 2BOGX 3G24A 5EBAA 3A4AA 3THDA 3ZR6A 2IS7A 2PDLA 3UP8A 1BWVA 3W2KA 2PCQA 3DC0A 5LNRA 1RA5A 1QHOA 1MQRA 2BGNE 3SCVA 2CLMA 3EXTA 2ZWZA 1RBOB 3CZJA 4IUOA 4IHCA 1OT2A 3CPGA 2PDWA 3WENA 4F2TA 1TPEA 3BCDA 3CIWA 1PTGA 2XTKA 4F0RA 1TPUA 2VVNA 2AOSA 2QT3A 3FAXA 3BGJA 4DXXA 1VAHA 1KM6A 3MKCA 4J9JA 3S6TA 1MWOA 3FAWA 3N4EA 4UBPC 1OG0A 4POCA 3WBYA 4DWSB 3WLNA 5BXPA 3GZ3A 7TIMA 4IPLA 3AUJA 5DX7A 1IGWA 4CD6A 3DXIA 1OC7A 2AGTA 1DJYA 3AS1A 3NQFA 1NP0A 3BG5A 3C0QA 1EP1A 1IEVA 3N6QA 3GR4A 4JKMA 2A6LA 4WCJA 4PMVA 3SCSA 1EKOA 2REQB 4IXXA 3IGUA 1DYSA 3OG2A 1KGUA 1FFRA 2V63A 4BF5A 2ZX8A 3ITVA 1LLZA 2DJXA 3LCIA 4ENLA 1AH0A 4J7RA 3EPOA 1KBLA 4AD0A 1SU5A 2CHNA 3H2OA 1XSJA 4MKNA 2ZX5A 3VNKA 4DJED 1BYDA 1TX0A 1MMFA 4KWVA 3NURA 1XD1A 2J4GA 1W1VA 5DMYA 2E09A 3UG5A 4C1LA 4KPLA 4B9ZA 4R9XA 1KM1A 3VCNA 1F6PA 4C6FA 1G1YA 2YZRA 4PEKA 4EF8A 2OQYA 4OE7A 3OBKA 4XD6A 1VBHA 3K30A 5A6BD 1JF6A 3CUIA 4FNUA 4GXPA 4LJ3A 2OCZA 4MPKA 2WHMA 2JFEX 1JI2A 1H7XA 3PK7A 3PZQA 4AWUA 5FF2A 4K7VA 3N2CA 4KWUA 1LL7A 4NI3A 2W0UA 4ZOBA 2X7VA 5DY3A 1ADOA 1F8MA 1NF7A 2J8TA 3Q2DA 3NG3A 4F9DA 4XIAA 2GL5A 1R6WA 4GUHA 1IZJA 1I75A 2YCIX 3F4DA 1T8QA 2GUBA 5DXXA 3ZT6A 4JFSA 4Z2IA 3B8TA 3N34A 3B0VC 2QJGA 3MHUA 3B9AA 3UA4A 3C0LA 4JFTA 1SJCA 4Z1CA 4P8WA 2FTWA 1EPVA 1JZ4A 4AZCB 3I6EA 3L65A 3ONCA 1V93A 3LM3A 1UR1A 3SIZA 1NFBA 4K38A 1H7PA 4LRTA 4E3TA 1H3GA 1TVNA 2YL6A 3EX2A 4CCDA 4F2BA 3KW3A 3K4WA 3URQA 4H6QA 1PWMA 3RJYA 2R8WA 3IRSA 1VFFA 1E1CA 4WOZA 5HJXA 5FJPA 3SQMA 1EDQA 3TSBA 1A5CA 1UPMB 1RJQA 1FCVA 1NH6A 1UASA 2DFAA 4HHMA 1QNVA 2Z2BA 4GUJA 3K2GA 3LV6A 1QFEA 2QAFA 4LQ1A 2WYSA 1UR9A 3GIPA 4XO7A 2PBGA 2HNHA 1H62A 2R9RA 2VFHA 1JRCA 2V9DA 2R6OA 4Z2GA 4HNNA 1S2UA 5AYYA 3O6AA 1XDJA 2VCBA 4AD5A 3USBA 2QCMA 2P88A 1ITXA 2W6RA 3OBAA 3M7SA 4LOCA 3HBLA 4N9EA 5IDIA 2GVEA 1X6NA 5FEZA 3KZSA 3MJYA 1LWIA 2CKSA 3DX5A 1MXGA 3L7RA 2FYMA 3W1AA 4CCCA 1IXNA 3NPUA 3LCGA 4Z2KA 4NSBA 1VRXA 1V6VA 4XVEA 3AHXA 4C6LA 2HMCA 2QCFA 5I3GA 1CXFA 2VRKA 1TWWA 1TV5A 4WY0A 1OT1A 4QXIA 2PDMA 1NU5A 4MADA 4ERAA 4LS0A 3OO2A 2BX7A 1QO2A 4W89A 3TZFA 1KTBA 4B5UA 7REQB 1HNYA 4I7VA 1FVPA 3GX9A 2FMOA 4XZMX 4LPCA 4CEUC 4EOUA 1G7UA 3EZ4A 4P7LA 3VDBA 4FP1A 4UTWA 3BSMA 1E6XM 2VP8A 4H9XA 1GEQA 3RF9A 1KM5A 2P76A 3NJ3A 4Q4MA 4WRHA 1VBRA 2VFGA 4CKQA 1HGYA 3KZPA 3GO2A 3N12A 4ORMA 3OYZA 4S2CA 4JGDA 1HVXA 1TIWA 4WSJA 3FY1A 2GYIA 5HAOA 4DWSA 1GOKA 1FDJA 1B0IA 4F48A 4FS9A 2CLOA 2WMHA 3GWQA 4JQ4A 1HJSA 5ABHA 4ZA0A 1MQPA 1VFTA 4OBSA 2CHOA 2NWRA 4CUCA 3AS0A 2F2HA 4E5TA 2REQA 2AMGA 2EG7A 2OKOA 3ANYA 2PGEA 3W7HA 1B57A 2QNEA 4G56A 4FXJA 3PAOA 1YE6A 2DPEA 5EMYA 3N2BA 2ZRUA 7CGTA 4QE4A 3M9YA 2GLKA 4DAFA 4JX4A 3CXOA 3VNDA 1FWTA 3CT2A 2VWSA 5U7SA 3U3HA 3FHAA 2OPJA 4HTYA 2FVMA 4PCNA 4GX8A 3GUWA 1VEPA 4IT1A 1S1PA 1QK2A 1ONEA 2DVTA 4RZBA 1IHIA 2ZZ2A 1ZL1A 3MCNA 1E43A 2X42A 1L2QA 3WIJA 2WAGA 4D6DA 2X8RA 1OGSA 1US0A 1JZ5A 3E3HA 2V69A 2C15A 4ZXOA 4F0HA 2WVVB 3O9NA 3LNMA 4AZ6A 4LY8A 3FCPA 1XLFA 2BGQA 3C8NA 4S39A 1WPCA 4O1DA 1V6UA 3FA5A 2DSVA 1JZ7A 2BXYA 4FXRA 1XIMA 1L8PA 3CBWA 5D2WA 4TO8A 2V0TA 4S3FA 3IV3A 3JS3A 1LM1A 3NDZA 3LPGA 3CK5A 2Z6JA 3VVGA 3QV6A 3NPWA 4JX6A 4ZO7A 1YPXA 5AB3A 2YBUA 4RNFA 4PYSA 5CBBA 1M7XA 4RKAA 3E49A 3SCQA 4N4QA 1BF6A 3BW3A 2OB3A 4AZCA 3EKZA 1JDCA 5CPTA 2V5CA 3VCCA 4JTJA 1KBIA 3S5OA 4NNAA 4IJBA 5G5IA 4JTIA 4KIRA 1KCZA