2NQJA

Crystal structure of escherichia coli endonuclease iv (endo iv) e261q mutant bound to damaged dna
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
279
structure length
279
Chain Sequence
MKYIGAHVSAAGGLANAAIRAAEIDATAFALFTKNQRQWRAAPLTTQTIDEFKAACEKYHYTSAQILPHDSYLINLGHPVTEALEKSRDAFIDEMQRCEQLGLSLLNFHPGSHLMQISEEDCLARIAESINIALDKTQGVTAVIENTAGQGSNLGFKFEHLAAIIDGVEDKSRVGVCIDTCHAFAAGYDLRTPAECEKTFADFARTVGFKYLRGMHLNDAKSTFGSRVDRHHSLGEGNIGHDAFRWIMQDDRFDGIPLILQTINPDIWAEEIAWLKAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*GP*TP*CP*CP*(3DR)P*CP*GP*AP*CP*GP*AP*CP*G)-3'
publication title DNA apurinic-apyrimidinic site binding and excision by endonuclease IV.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 105
structure length 279
sequence length 279
chains with identical sequence B
ec nomenclature ec 3.1.21.2: Deoxyribonuclease IV.
pdb deposition date 2006-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 2nqjA00
1XLBA 3AALA 3DBNA 2NQJA 4YTTA 4QE4A 2G0WA 1XIHA 4XKMA 6XIMA 1QT1A 1XIDA 1XYMA 1XLAA 1A0EA 1XLLA 4XISA 3GNXA 3C0QA 5B7YA 8XIAA 1XIIA 2GLKA 3QXBA 2XINA 5EMMA 1MUWA 4K1GA 4GQBA 4QE1A 3CQKA 3XINA 3KBWA 5H1WA 3UA4A 1XLGA 3C0LA 4W4QA 3XIMA 1XLDA 5EMLA 5B7ZA 3BWWA 3KCLA 4YTUA 2NQHA 1XIJA 3AAMA 3KTCA 4HNOA 4EACA 5AVHA 4YTSA 1XYAA 3M0VA 5J8LA 1XYLA 3VYLA 1TZ9A 3ITXA 3KBVA 4X63A 4XSMA 9XIAA 4J4KA 1XIBA 4LNCA 3N4AA 4PGLA 4DVOA 4A8LA 1K77A 2XIMA 3U3HA 4A8RA 2I57A 2G4JA 2GVEA 2ZDSA 3NGFA 3ITVA 3QZAA 3M0XA 4GJIA 5B80A 5C9ZA 3ITYA 3IUDA 4KW2A 3KCJA 4QDWA 4XSLA 3L23A 3UVAA 3VNIA 4YTRA 6XIAA 1XIMA 3BZGA 4QDPA 3BZJA 4HGXA 5AVNA 3BANA 3CNYA 1DE6A 3UA3A 3VNKA 5XIAA 3KBMA 1QTWA 3P6LA 5I7GA 1A0CA 1XLKA 4X61A 5H6HA 1XLFA 4G56A 5EMJA 2HK1A 3KBJA 3TC3A 1XYCA 1XP3A 3FVMA 4E3VA 3M0HA 3VNJA 1O1HA 1XISA 1OADA 1XIFA 3CQIA 3JU2A 2ZVRA 3KBSA 3KBNA 1XLCA 3P14A 4ZB0A 2X7VA 1XLEA 3CQHA 4K3ZA 3IUHA 3AYVA 1XLJA 1YX1A 3KWSA 3U0HA 1GW9A 2QUMA 3QYSA 3DX5A 1S5NA 4QE5A 1I6NA 2I56A 3ITLA 1XIEA 2Q02A 1DE5A 2XISA 3LMZA 1S5MA 3M0MA 1A0DA 2QW5A 5FA5A 5TNVA 4GJJA 1XINA 3BDKA 2QULA 1XICA 3ITTA 3M0YA 4US6A 2NQ9A 9XIMA 4HHMA 1XLHA 2GUBA 4OVXA 1CLKA 4DUOA 8XIMA 1DXIA 1XLIA 3XISA 4ZB2A 4EAYA 1XLMA 3CWHA 2QUNA 1DIDA 4GLEA 1XYBA 1QUMA 3VNLA 1MNZA 2HCVA 4HHLA 4A8IA 3AYTA 3QC0A 4YTQA 2OU4A 3IUIA 3VNMA 4Q7IA 3UXIA 2GYIA 4PFHA 1BXBA 1D8WA 4XIAA 3UU0A 7XIMA 3KCOA 2X7WA 4ZB5A 3WQOA 1XIGA 5XINA 4XIMA 3C0SA 3OBEA 3CQJA 4ZBCA 5XIMA 3TVAA 1I60A 5EMKA 4X60A 3ITOA 3M0LA 4QEHA 2J6VA 4A8NA 2HK0A 4QEEA 1BXCA 1DIEA
chains in the Genus database with same CATH superfamily
3VKCA 1YRRA 3I3BA 1TVLA 4HD5A 1UJQA 1W1VA 1JCLA 2FDSA 2QUUA 3LSBA 3H2MA 3ES7A 1PKNA 4C90A 5EMLA 3VKDA 3RXZA 2QAFA 5M1TA 4EACA 4LUSB 1PIFA 2YA2A 3A64A 4RPQA 5LGZA 1E15A 2OSWA 3U3HA 4XUGA 2G4JA 1NDWA 3PZ9A 4IMAA 3NVTA 4LC8A 1SO3A 2QGHA 4XSLA 3RU6A 3FDKA 4HA0A 3KLLA 5EBUA 1J2BA 1OWQA 3SIZA 3T0DA 1S46A 3K30A 3QV6A 3ARQA 1KFBA 1GOMA 2FMOA 1X8CA 1GZGA 1HZYA 1L0PA 2DEPA 4WXYA 3UWWA 5HNRA 2Z28A 1QW8A 3NQ7A 5DO8A 1I0DA 1OD0A 1UBSA 3UJRA 3LTPA 4IMCA 3W72A 3OO2A 1I4NA 1OM0A 3UXDA 1XLHA 2H9AA 1SJCA 4JQ2A 3HMCA 4WIWA 3KRSA 1C93A 3CL7A 4LAOA 1V3IA 4H01A 3R94A 3UW6A 4XIAA 1O60A 3NIYA 4CUCA 1FRBA 4AXNA 2QT3A 4GG9A 3ZJ8A 1ICSA 1UIOA 4QAIA 5I3FA 5JH1A 3K4WA 2IKHA 2JEQA 4PRTA 4C6LA 3G8EA 3VA8A 1PKYA 4JTTA 1DJGA 5FEPA 5CGTA 4H04A 5BOOA 1LRTA 1UR9A 4GA8A 1KM4A 4XBSA 1VLIA 4K8EA 3TLLA 4QCEA 3WNMA 3S2JA 4BI5A 4PTMA 3GDRA 2BGSA 5AC4A 4E2BA 3D3FA 3IRDA 4KW2A 4S3GA 4W85A 4U2ZA 3BLPX 4S3DA 1OT1A 5T8GA 3CV2A 1VCGA 4YCPA 2DT1A 1Z41A 5I5RA 3VE9A 1NWTA 3WNPA 1RSCA 1HO4A 1WXJA 3V0TA 3UPBA 1V93A 3GY1A 2WWDA 4EPDC 2XTKA 2RAGA 1KFKA 1EEPA 4MKNA 1QI5A 4WDUA 2XWDA 1SSGA 3GB6A 3TTQA 3UZJA 3ZFHA 3I68A 1VZWA 3NO5A 2Y88A 4I7UA 3GX9A 3WLMA 4DBUA 3FXGA 2QV5A 2ZUTA 1EHNA 3ANVA 5K4ZA 1CXFA 3W81A 4ACZA 3LHZA 4LYPA 2PPGA 4JQAA 3T8QA 3G77A 4GX9A 3JZUA 4Q6JA 1R9ZA 4I6KA 1S5TA 3TYZA 3SURA 4KBXA 5AN7A 4I5XA 4WY0B 1M1BA 1DORA 1AZ2A 1UROA 4QG9A 5HJYA 2NXIA 3MDWA 4OE7A 4C6DA 2HXUA 3WD3A 2Y1HA 2Y8VA 4GXPA 4NI3A 3KBWA 1MWOA 4CU6A 4IQJA 3TJLA 4B5SA 4DNHA 4WY0F 1PX4A 1VB9A 3RHGA 2V2HA 3MKKA 1JF6A 4V2XA 2ICSA 3H24A 4DJDC 2BLEA 4V28A 1W1PA 3FK4A 5C70A 3WUEA 1SR9A 3CJPA 3UZXA 1W3TA 2XGIA 1SQ7A 3P2VA 2WYSA 3W7LA 1KM2A 4LOCA 3W7RA 3V0UA 3W73A 3S5NA 3B0XA 2DZAA 4K68A 5D09A 4NZCA 5LHFA 3S0CA 1G67A 4K36A 1PB0A 2W79A 1DJHA 3LCIA 4JTSA 3TK7A 4C6KA 3H4WA 3F2DA 3M43A 4IUGA 1NWSA 2PWUA 5FCZA 4XD3A 3CUGA 5HXMA 3VIMA 4H6RA 1OX5A 2PA6A 4C6JA 1DTUA 4DO7A 3E2RA 1FWCC 1VAHA 4RX0A 3TTOA 4IJBA 4LUIA 1O66A 3DZ1A 1PVNA 5CXPA 3RM4A 2OT1A 2VRKA 1Q6RA 1GZJA 4RKAA 1UUMA 4GH3A 2V2CA 2ZRWA 4G7EB 4I9AA 4CD8A 2J9ZA 1A5LC 1QOQA 1QHOA 1Z44A 3S1UA 3E02A 2BY0A 3R11A 5CBJA 5BMXA 1H50A 1NWRA 2PP3A 3TJIA 1UWUA 1FXPA 3WUBA 1EJWC 1XX1A 2PZNA 1S2UA 1ZL1A 4CN6A 3TU9A 5CPTA 1QO2A 2AAAA 2DIJA 3OODA 4AIEA 3SECA 1B5TA 2B81A 3FLUA 4OV4A 1LRNA 4MF4A 4LFYA 3EDDA 1TB3A 3SADA 2OR2A 3UFYA 2QPSA 4JX4A 3U6WA 2PCQA 2HRWA 4F2UA 3NA8A 3I65A 3W27A 1N82A 3LHWA 1CT5A 3LK6A 5AHIA 1MUCA 1UPPA 2OEJA 2X0HA 2Z1XA 3CV7A 4OIFA 2YDQA 3W71A 4BI6A 3FNDA 4URIA 3GHSA 1EIXA 3CHEA 3U0HA 5K7JA 3LMYA 3CZKA 2TAAA 4YVPA 3D3AA 2LLEA 1VHNA 3CTLA 1KFCA 3EA3A 4RE4A 2J7DA 4UIOA 3MO7A 5C71A 1OT2A 1UD5A 5IM51 2P0OA 2VL4A 1FFRA 2PDHA 1JZ3A 1TUFA 4IP7A 4LAMA 1C7TA 1ZJIA 3TN4A 4HNCA 5I77A 3NURA 4CCZA 2E6YA 4ORIA 3B8IA 1JI2A 1I8JA 1L6WA 1W3KA 4FLQA 1R3VA 4C6OA 5IDZA 1HW6A 1E4LA 3A3WA 3LRKA 8RUCA 3KVLA 3O06A 6A3HA 2YBUA 1TELA 2HJPA 4D1IA 3LBOA 1V6XA 2XIMA 2I57A 1MEHA 1P0DA 1EDQA 2Q6ZA 1PE1A 4ZO6A 3BAIA 1D3HA 1L9WA 2DZVA 3NL3A 3PTDA 1UKTA 2ZRVA 3PY2A 4ZGYA 1XIMA 2C0AA 3VNKA 3WQFA 3PBVA 1KR1A 1N55A 3B0YA 5BZAA 3W07A 2WNZA 5I3KA 3GC2A 2CLFA 5HNUA 2AGTA 1LLOA 3MP3A 4D2JA 1W91A 4FNTA 3FFSA 4L6OA 2VDIA 4QSFA 4M7SA 1BTCA 5KITA 2ODOA 1UYQA 3RF9A 1E73M 4GJJA 1Q6GA 1XCFA 4MJZA 4NNBA 1KBLA 1EP1A 3TJ4A 4CNUA 1M7PA 4UTFA 1O5QA 2CLEA 3ZJKA 2O9OA 3JVAA 3BG5A 2ZOXA 4TQTA 1W1B1 1AJ0A 1EC7A 1ICPA 4CEUC 1CECA 3EEZA 3M0LA 3GU2A 1J2WA 3DBNA 5MKGB 4OQVA 4AVFA 3CPRA 4AWTA 4WOZA 3F4DA 3TN5A 2R1NA 3PAJA 4GABA 1I1WA 3T4WA 3DOPA 2C1HA 1FH7A 2EG8A 3MBFA 5HQEA 4JTHA 5H8UA 3W82A 2RKXA 3EGJA 1FWTA 3RX2A 1UR1A 3S46A 1ME9A 1R3QA 3MI3A 3MA8A 3UWEA 2QCMA 4HSNA 1MDLA 2NLIA 3GC5A 1MDRA 1FWWA 3OA3A 1KR0A 4LC6A 3OP2A 4Z2IA 1GVFA 2Q8XA 4PMYA 2PWEA 1RLDA 4PUMA 2WM0A 1JCTA 3BSMA 4DWDA 2FZDA 4HK7A 4L64A 5AYZA 1E6ZA 3APYA 4JIHA 1QI4A 1BVZA 1GNXA 1KBIA 2HSAA 3W75A 2O4QA 3OLDA 4C7GA 9XIMA 3HJEA 2GJLA 4JFWA 1P7TA 2YPIA 1A5MC 6REQA 4OOZA 3CXOA 1HKWA 4MSSA 3NAVA 4DUXA 4PEEA 4D9PA 4KFOA 4LBSA 1DPMA 2QMKA 2V82A 4W8BA 2VNCA 3NQMA 5I3IA 3RJYA 3ZVIA 2WM1A 1EL3A 1PHQA 1Y0EA 2VX4A 3PUGA 3IAQA 4C6PA 4PRWA 1XH1A 4OECA 1J0HA 2PI6A 4P8UA 5DCBA 4M0XA 3M64A 4O11A 3EWZA 3EXTA 2WMGA 3PBGA 4HIBA 5E0FA 1NTHA 3WEMA 3LV6A 1YDYA 4AEFA 4ZO7A 4E8DA 2GGEA 3FAXA 1IXPA 3V4BA 4XTDA 3UA4A 1S5VA 1XIJA 5AYXA 3PPFA 4J3TA 4PCFA 2XH0A 1VCFA 1DEDA 2MANA 3U2CA 2VC6A 3ITVA 1P1XA 3OBAA 3U2ZA 2DFAA 2CZVA 2FGLA 1W5NA 2QVHA 4PMDA 3UVAA 3VNIA 4Q4SA 2RJHA 1EIBA 3CNYA 3WH6A 2QCCA 2EPHA 1F2JA 4I9TA 2ZADA 3M0JA 3A47A 3KL0A 2PDJA 2D3LA 3EWDA 4FR1A 1WPCA 2KAUC 2OXNA 1QR7A 2ZUMA 1JNEA 1VIWA 3UJ2A 5CZ0A 3D0CA 2OLSA 3CUHA 4DO6A 2QIWA 5DELA 1PL9A 1JJKA 5LA2A 3RM9A 3P3BA 3W37A 1PX8A 4J3UA 1IV8A 1KA9F 4WDWA 3VFLA 1R3YA 4KEVA 2JQXA 4K38A 3STGA 3SY8A 4A3UA 3T55A 1UWRA 5E0KA 2AGKA 3H2FA 4ZL1A 4GI9A 2PLJA 4HPGA 1ZJAA 2DSWA 3S5YA 2D23A 2BOEX 3A3XA 3TTSA 2VP8A 1UB3A 4NZFA 4WKAA 4W5UA 2WZMA 3WK2A 1K4HA 2WHMA 2ZBTA 2OGYA 3UWZA 2ALDA 3LU2A 4TV6A 1XIBA 2OYMA 3RU8X 3WF2A 2ZDSA 4MG4A 5KZ6A 1QPOA 1V02A 4GGBA 1Z8AA 5CSRA 3E12A 1E1CA 2Y89A 1PSCA 4M1RA 2TODA 4UTKA 2ZRXA 2Y7FA 4PYSA 4JTEA 4DLMA 1O1HA 4H8HA 3HURA 3KBNA 4J9JA 3LERA 1J96A 5ABFA 4QE5A 1PKMA 3M0KA 4JTJA 1X98A 3TQ0A 1UWIA 2FJKA 3UNDA 2YFOA 3QF0A 4GUGA 4J3ZA 3GSMA 4EXAA 1DXIA 2P1FA 4WF7A 4FNQA 3CIXA 4O15A 1OG6A 1YBQB 2BFGA 4Z1AA 5LXEA 2FPTA 4MWAB 4IGMA 1A47A 3N17A 1W8SA 3LLFA 3HOJA 1L6SA 1PS9A 5DRIA 1NDVA 5DT5A 2ZXDA 3LQLA 1LZOA 5U7SA 1XR2A 1RH9A 1PHWA 1P6WA 3FDGA 4HNTA 5D2WA 3W6MA 2GJXB 2PEVA 2FH8A 4F40A 4NY2A 3ZIZA 1XYAA 1F05A 3CLMA 1LF1A 1H4PA 5REQB 4LNCA 1H0IA 3HV8A 4B2DA 5EBAA 3HJZA 2DW7A 4AY1A 2YCLB 2VR2A 4MLRA 4XVEA 3KE0A 1TCDA 4F0HA 4WSJA 3BZJA 3W2UA 2XVGA 3HF3A 4D71A 3ES8A 2AL2A 4NRRA 3MUXA 3WNLA 1OFDA 2WMIB 2FMNA 3DC0A 2PWVA 4YIWA 2QVNA 1BAGA 3G3MA 4R85A 4ZXOA 4QRNA 1DHPA 2PS2A 1UD3A 1UR2A 1VD6A 5G2HA 3JZEA 1I2NA 1SR0A 3KP0A 1WZLA 3HGOA 3R1ZA 1Q8JA 3N12A 1PIGA 3CUIA 3KOYA 4FAMA 1KM3A 2HTMA 3AYTA 3AXXA 1JZ4A 4XV0A 3STPA 5KZDA 3N6HA 1YDOA 5AC6A 3EXRA 4UB9A 3SUTA 5LNWA 3A4XA 3T0BA 2C3ZA 4PMQA 5GNXA 1A5OC 3K4DA 3C0QA 4JKLA 4GQRA 5G5IA 4E4FA 1NDZA 2WC4A 3UWUA 4R33A 3A4WA 2E3ZA 2JKEA 4CD4A 4XVDA 3C3NA 9XIAA 4LEQA 2WC7A 2E28A 3MZNA 3SB0A 4AG0A 4UOJA 3L4ZA 4Q4QA 5HQMA 4WUIA 3M47A 5C9XA 2DSKA 4C6BA 3KCJA 3T0AA 4LVBA 1FWSA 2VX5A 3NPWA 3KHJA 4JYFA 2ZE0A 2NV2A 3T40A 3W1AA 1QBBA 4NX5A 2CBVA 1TV8A 2F38A 4I8YA 1ZRQA 4H19A 3JU2A 1XLCA 1RALA 3GO2A 4F3HA 5A2CA 4YYCA 1A49A 1M03A 3GXMA 3UG8A 3H21A 2OB3A 3TA6A 1GCYA 2MUCA 4E2OA 3OVRA 1IF2A 1TMHA 1LOSA 3GS6A 4CN1A 4M6UA 4QROA 3PANA 1BLIA 4Q22A 3TUUA 4XTIA 1E55A 3POCA 3VIFA 1W31A 3Q2DA 5XIMA 1WCGA 3WJXA 9CGTA 5EMKA 2CITA 2AMXA 1XRTA 3MS8A 3B8WA 4CNTA 1TPWA 2XGZA 4D8ZA 1UH3A 2A3HA 2F2HA 2A3AA 4Y9MA 2OZ8A 3DHUA 3MO4A 1C9DA 4J3VA 4HYRA 3UJEA 3MW7A 2NXHA 1H2JA 3WF1A 9RUBA 4Q4MA 2YCEA 3ZXWA 3UJFA 3CQKA 4IP4A 1I75A 1KB3A 2VFFA 3H26A 5CH9A 1J93A 6CGTA 3WD0A 5M2FX 5E1QA 3V5CA 1XG3A 4EOUA 3L2MA 3V18A 1PTDA 2Y5SA 3WMCA 3H2AA 2J7FA 3M0XA 3OBKA 2A3LA 1VFOA 2YYUA 3UCDA 4FA3A 3D6NA 1UD2A 2EGZA 3CZGA 4HMDA 4WZHA 4PCNA 2AQOA 4ZCWA 2P3ZA 3RMJA 2YDAA 3BO9A 1GW9A 2ZZ2A 3BH4A 3DX5A 1BYCA 4XKYB 4A2SA 4N42A 1JULA 1EGMA 1CGWA 1OCJA 1UOKA 4DPPA 1IXNA 3PPHA 4A22A 4MHBA 3O2LA 3LBCA 3ARZA 1OABA 4ATDA 1QUMA 4ERAA 1A3WA 3R43A 1QNOA 1JRCA 3SRKA 3RPDA 4NAFB 3PAOA 1EJ7L 3BV7A 4HU3A 3GW0A 3TW7A 1BSIA 4ZQMA 3HPZA 3R0KA 1R38A 1SFJA 1V03A 3NL6A 3NNTA 4QISA 5D02A 3WQEA 4Q4RA 2VDHA 2P0IA 2HPMA 4IMEA 4GCAA 1TZZA 2IXUA 3NCOA 1B4EA 1XPYA 1Y5XA 3EB3A 5AHNA 3MYPA 4S39A 4CD5A 2VOTA 2G8ZA 1GPWA 3GD6A 4HHHA 4Z17A 1VBGA 4ZQRA 4UNLA 4YYFA 1C8QA 1FWRA 3KBVA 3ANUA 4AZHA 1J0YA 1SMAA 4O1CA 1KGUA 3H2OA 4DF2A 1U33A 2E7FA 3B4UA 5JBEA 4AD0A 1CDGA 3NOEA 3WFLA 1F6PA 3VDAA 3L4XA 1XYZA 3FCPA 3SW6A 1J4EA 1W2VA 3L4TA 3N15A 2Y5JA 1H7PA 3TW6A 3KBJA 4FLSA 4N7QA 4IX0A 4JN6A 1FH8A 5M17A 4E2VA 1PZ2A 2WJEA 1ZP3A 2BY1A 1R5YA 4K2SA 3KWSA 3TKFA 4DO4A 2O56A 3M0MA 2WZTA 3V5FA 1IZKA 4KH2A 5TNVA 4NZ4A 4UZUA 3LOTA 2F7FA 2QJHA 2YR1A 4Z42C 4QTGA 4DBSA 3IJLA 3C61A 5EYWA 2EKCA 2FHCA 1F3XA 3K13A 4WSHA 3VNYA 4PMOA 1YQ2A 3KS5A 2CZFA 3OQ8A 1WDDA 3BAWA 5XINA 2V67A 3LV5A 1BF6A 3R7MA 3OTRA 4DBEA 4WVXA 1V3KA 4S3JA 4QG8A 3IK2A 1ZCCA 5BRPA 1JYXA 5IBXC 2CLIA 1XF0A 4LS2A 3VI2A 3FYYA 3AIRA 1KM6A 1JFXA 2O55A 2UY4A 3OEXA 5A8GA 4GC4A 3M5ZA 1D3GA 4JYEA 2VM8A 2W27A 4U2YA 3QQWA 3NQBA 4FXFA 2C16A 2ZZ5A 2JGYA 3GDLA 3SGGA 3WDHA 4A8RA 2HE8A 1YPFA 4HOWA 3EWWA 2GK1A 1ZBVA 1XBYA 3BVJA 2H8ZA 4FO4A 1AVAA 3GRIA 2QCFA 3W2LA 5DEZA 2G3FA 4PMZA 5CPLA 3VXGA 4Y6GA 4BR1A 3KBSA 2WMHA 3VIKA 4K3ZA 1SMDA 3OOQA 4PUJA 2VJXA 5U4NA 2IW0A 1Y5WA 1WXZA 2V5CA 4BJHA 3UETA 4FOJA 1XICA 3NGJA 3M0YA 4AWSA 1WV2A 1ZAJA 3TNBA 3UCCA 4P8VA 4ENLA 2ZXAA 2YL8A 5FEWA 5AOUA 3JR2A 2QEZA 4XAYA 4GZ7A 2CZEA 1DQWA 3GAYA 3UU0A 1A5KC 2PDQA 3TYEA 4L6HA 1RLCL 1Y7VA 3T1GA 3TAKA 5I6SA 4NVTA 4C1NA 2QCLA 4CCDA 2KZHA 1D7KA 3AIWA 3T07A 2D73A 1XIIA 3R25A 8XIAA 3IJ9A 3QSRA 3DFTA 3BV4A 3F03K 4GHRA 3E49A 2OQYA 5CPSA 4KRTA 3N04A 4AMCA 3ABSA 5BU9A 3KVMA 3GTIA 1HJXA 2FPYA 2VEFA 4JFTA 3FA5A 1BXNA 1GVOA 3QBUA 1QWKA 4GXMA 4DJFD 3EKZA 4UTWA 4HT3A 4JFUA 4P7QA 3L5AA 1RVKA 3LHYA 4H9XA 2CBUA 3TCEA 3L0GA 3M0HA 4QLLA 1OADA 1SSDA 5FAGA 4HTBA 3CQHA 1TWWA 5I3HA 5J5DA 2Y8KA 4PUDA 5F1VA 2XISA 3NWRA 1ADSA 1DJYA 1WDQA 1RJRA 2E9LA 1ZJBA 3GDKA 4MDOA 4Y9AA 3GNDA 3NZGA 2FVLA 1UBPC 1US2A 4HHMA 3EDEA 4XUYA 4BEQA 4JR5A 3MUY1 2AOSA 3E9AA 1K6AA 3WUGA 1HJQA 1FHVA 1ZU8A 3Q37A 4C5ZA 2QCDA 3S6OA 5IHSA 2XZ9A 4NZ3A 3EWXA 1OZQA 2ACUA 1TV4A 5E9XA 1O95A 3WD1A 2XSAA 4YS1A 3LYEA 4ZFMA 1XIDA 1TE1A 2VVSA 1A0EA 1CXHA 2RDXA 4H9TA 1M7OA 3NPVA 5DBUA 2O4MA 4WJXA 2EQDA 1Q6LA 4Y8FA 1T6MA 1B2YA 4PCPA 4Y90A 4B92A 5E6YA 1HX0A 4WCJA 1ITCA 1RBLA 3G0XA 3T2OA 3G1FA 2UBPC 1AH4A 3B9OA 1NAL1 3G6MA 2VO5A 4N02A 4Z1DA 3O16A 3QKEA 3W7DA 1DV7A 4K37A 2NX3A 1XUZA 4ZOCA 1JYWA 1TTIA 4KCUA 5KETA 3VDHA 3CT2A 1MFVA 3WNOA 2PFHA 1LQ0A 3ALFA 1M04A 5AYYA 1TPB1 2WBGA 3NQVA 1XUUA 1MO0A 2Z29A 2WSQA 4ZB0A 2QDDA 4RZ5A 4UQ9A 4GPNA 2HZGA 1A5NC 1DE5A 2Y62A 5H8PA 4DQWA 3DFSA 1XM3A 6TIMA 3GNPA 2RDUA 1HL8A 3GG0A 4MYXA 1XINA 4I5UA 3W1LA 3GDBA 4W8LA 2PDYA 2IQDA 1XDLA 3EDFA 5CSUA 4W8AA 4B5VA 4HNVA 4ZODA 2QF8A 3FJ6A 1C3FA 1DIKA 4LF2A 2X2GA 3OPSA 3BAYA 1SW3A 4MYAA 3L4WA 4LANA 3KAOA 3FAWA 3I10A 3KRUA 3SRDA 2UV8G 3GAKA 4HKPA 1PX3A 1K9TA 3WQOA 1UC4A 1E3ZA 4GI8A 4GXWA 2ZUNA 4GY1A 3L5LA 3WQDA 1UKPA 3BL3A 4DY1A 1EX5A 5HR7A 4X9SA 1AZ1A 4TOQA 3L0KA 2PTYA 3WDRA 1DJZA 2OOFA 4ALDA 2R6OA 1YIXA 3WH7A 2O7SA 3N2XA 4J2PA 2HISA 1I2OA 1U1JA 3GXFA 3FY1A 3IIVA 4LAZA 2PF8A 3DENA 2NZLA 5CLWA 3AAMA 4P7NA 4MZYA 3WDJA 4IIBA 3VDGA 2EJAA 1HFBA 3SCUA 4LX4A 5F4WA 1LWJA 3HQ1A 1MFUA 2Z27A 1OK6A 2WKLA 4HMCA 3N3TA 1MRAA 2YXGA 1UIPA 1K70A 3ARSA 2BX7A 2X05A 3BGAA 1P6BA 3C0JA 3T7VA 4O8RA 2YB1A 4F0MA 1MXSA 3VMPA 2DQWA 3SGUA 3AUOA 3LM3A 1JDAA 3K8LA 1FHUA 3N2OA 1OX4A 3FKRA 1UR0A 1N8FA 2J79A 2Z1SA 3QVQA 4PBEA 3ZT5A 1E3XA 3OQEA 4DO5A 1HJVA 3PVFA 3QMTA 1R2TA 3CGTA 1L8PA 2ZTKA 3WLKX 1DIOA 4CNOA 4B2DD 2CZDA 4MOZA 3BTNA 3HV9A 4OGZA 1Q6CA 1CXIA 1OFEA 1QI2A 3GFZA 3O3RA 1ME7A 2OKTA 4GY7A 2ALRA 2X7WA 4Z2LA 3VZYA 3F2CA 1ONXA 3FHAA 3V3WA 3OGVA 2SFPA 1EC9A 4H41A 5I06A 3U5UA 4TU1A 1BPLB 3E3HA 1Q13A 1C8VA 1HNYA 4O50A 1PV8A 2H3BA 2PRLA 4G2DA 2E6AA 1AQ0A 4F4RA 4UQBA 3UZYA 5LIKX 4PTXA 1MYRA 1VFMA 3V0SA 4PFMA 3SUWA 2I5GA 3H7UA 1Q4WA 2ZXBA 3SJNA 4AMAA 4X63A 1H7RA 5AECA 3W00A 3EAUA 3MQTA 4LS1A 1JZ2A 3IIZA 1LL6A 2GQ8A 3AMKA 1L2UA 1Z7AA 2AQWA 5C9UA 4L7ZA 4S1FA 1XFCA 1V0NA 2TYSA 3OJGA 1JCJA 2J77A 4KS0A 3TC3A 1J0JA 1M9HA 1DWFM 3P61A 4HP5A 3RO6A 2BHUA 2R1KA 4CQ9A 3NQFA 4U33A 3ARUA 1B9ZA 2DJLA 4CLMA 1YX1A 1YNQA 4FLOA 1SGJA 1N2VA 2VMFA 1DL3A 2NQ9A 3A23A 4IX2A 1V5XA 1JDDA 2VQUA 1A4MA 1TPUA 5D05A 1FKWA 5CBBA 1TVPA 3TE9A 1XW8A 3EMZA 2PLCA 4A8IA 3C6CA 2PDMA 4JTDA 5HR6A 4YTQA 3TYCA 4M80A 4GZEA 1H09A 1Q65A 1E6QM 4KETA 4QGCA 5MF5A 3C0SA 1R8LA 4LT9A 3TR2A 4A8NA 1KXTA 1GG0A 2NQJA 2I14A 3SCPA 4LBRA 1FWHC 4JQ1A 5C54A 3P7YA 4Y9OA 3CQ0A 5I2UA 3TOYA 3U4AA 3BJFA 4W86A 1W54A 3MANA 3DHFA 5CPNA 2WSKA 2PODA 4DWSC 2IPWA 4GZIA 1HG3A 3JRKA 1XCWA 1NF7A 2QHAA 2V81A 4DZ5A 2A85A 3M07A 4A6GA 2VZUA 3KWXA 2WW5A 3USBA 8CGTA 4LUTA 4GH1A 4PZVA 1G69A 1HKJA 4C6CA 2CLHA 3BARA 1RCOB 4MFEA 5AHFA 1IEIA 4QQ3A 1RP9A 3FX4A 5BXPA 3M5VA 3WO8A 1OGSA 4HU0A 4A3RA 2AKZA 2VD9A 2O92A 5HMFA 4L4OA 1ZAHA 3MHUA 2HEJA 1VBRA 3ZOAA 3TTEA 1AFSA 5HQLA 4Q8UA 4HPXA 3TP4A 3GR8A 5F7UA 1LCOA 3A6OA 3DFNA 4S3EA 1E6NA 3VD4A 3DFPA 2ZRYA 4NL1A 4ZTXA 5DT7A 3MJMA 3N1AA 2Z7GA 3N14A 2CNCA 2AL1A 4O19A 5FJUA 4DM2A 3OA5A 1SM9A 2DPEA 1B3WA 3DKJA 1R3SA 3QXBA 3LEPA 1SZEA 3L4VA 3QSTA 4IGHA 3BOXA 1GYLA 5E09A 2WJZA 3RAOA 4IL2A 4PBFA 2GFTA 3V16A 2X16A 3WLRA 3WLQA 1UMLA 1C9WA 1OFOA 4Y9PA 1ECQA 4XSMA 1GVEA 4IQEA 2PLKA 3PG9A 3MP5A 3VOCA 1W3JA 1XCXA 2V0TA 4EK7A 2HROA 3WQVA 3B3DA 1TWZA 1K1DA 4XZBA 1W1ZA 4AH7A 3WLJA 5BYWA 4PL2A 5C9RA 1PUDA 1KFWA 3K4AA 4BZYA 3TX9A 4XZWA 5JBFA 2G5WA 4O8AA 1GORA 3GVVA 4DXKA 2Y0FA 2E25A 2Z2BA 1F74A 3GIPA 4H9MA 5KSWA 4LS0A 4CGTA 3SUUA 1K02A 1XLMA 4S2BA 2YGYA 5LNUA 1IGSA 4LUYA 1VCVA 1FOBA 1XBVA 3VCRA 4XZ9A 3UWVA 3I6RA 3V5OA 4Z2GA 1C91A 1VIZA 3RITA 3H2EA 4O4WA 1FA2A 4HHPA 2ZICA 4L1XA 2PWHA 4QE4A 4MIMA 4I90A 1R3TA 2DZWA 3P0XA 4JY9A 2GJPA 4AFYA 2WNWA 3URBA 1EQPA 1AL7A 3DERA 4U28A 1FWEC 3ERPA 3EWUA 3RCYA 3DFHA 3P62A 3CPGA 4NHVA 2INFA 3IAPA 3VYLA 1TX0A 3P81A 5GJMA 4HJWA 3PJUA 2R1MA 1CCWB 2PGRA 4IFOA 3W1RA 1H7OA 1Q85A 2Y70A 1J18A 3VD7A 2EF9A 2QCHA 4OFCA 2GDVA 3MB9A 4QDPA 1XV8A 4XBKA 5LIYX 1JUKA 1XLFA 3EMCA 2QUTA 4P7OA 4PCTA 4PUKA 3SQMA 1X7FA 2W0UA 1O5XA 1XIFA 2WK2A 2Y5EA 2Y24A 3GHUA 3W84A 2E77A 4BFAA 3GXIA 3AS0A 4DJEA 4GI4A 1JIBA 4K1WA 1OC6A 3HGRA 4P5UA 1HGWA 2DT0A 1J0KA 3A21A 3B05A 5A6TC 1RK6A 1E5NA 3BE7A 4A3QA 2CESA 4IFKB 5FF0A 1IT0A 2ZDRA 4RNJA 2XHYA 2YFNA 4MUPA 4GYPA 3OVGA 1BYAA 4WDXA 2G41A 4UQDA 2EKGA 3GUWA 3NQ6A 2MNRA 1UH4A 3CUFA 4MWAA 3EWBX 3F5LA 3B9DA 4TVDA 3BAKA 3WLLA 3RLGA 1XPGA 3CM4A 3AIUA 2NQZA 2W66A 3OG3A 4EVZA 3AMGA 1MUWA 4L4MA 1FDZA 4MAZA 4CEXC 3LHUA 5F2IA 1WBHA 3UF9A 1O6IA 1TTPA 2VKZG 3C2EA 1C8YA 1XYLA 4M3PA 1RQBA 3OU8A 2GGHA 3VABA 3ZYZA 1BFNA 3BC9A 1KM1A 4BCEA 3PC0A 4BWLA 2XVKA 3KW3A 3VK5A 1JGMA 5FF3A 1TE6A 4CQAA 1JEZA 1LLWA 2V5KA 3ZZ1A 1YHTA 2CLOA 2YLAA 1L8NA 3QTGA 2WB5A 2ZUWA 1R3WA 1VLWA 1QOXA 1G4SA 1UQZA 5FJRA 2V2DA 3EX1A 3BXWA 3T81A 2WMIA 4UTLA 1TV2A 3L4YA 3F7JA 3A5VA 2D2OA 3QLLA 2OKOA 1EWDA 5K9DA 1OG0A 2BTMA 2BG5A 2A3BA 3TNOA 2C14A 2ZX5A 4OWGA 4U31A 1FWFC 2PTDA 3CEPA 3CHDA 2P8CA 4PL1A 3HB9A 4FP1A 4N4PA 1E1EA 3WN6A 4CD7A 3DXIA 1PEZA 2BASA 4P8XA 1AH3A 4LBUA 3ZJ7A 3E2QA 3ANYA 2FPVA 3BLEA 3ID7A 3F1QA 3PPCA 5C6MA 4MJ4A 3MVIA 4AU0A 1KKOA 3LM7A 4D8LA 3KTCA 1TIWA 4HCHA 3GHTA 4Z1CA 2IKGA 4TO8A 3WJWA 3D46A 4R9OA 2BHZA 1CGUA 4JTGA 3C52A 4TX6A 4CD6A 4YU1A 4O17A 1UG6A 2ATMA 2REQB 1U22A 3CK5A 4MADA 3PJTA 2ZIDA 1A0CA 4AW7A 1HT6A 3ECQA 3URAA 2YB4A 4EPBC 2J74A 4IWWA 1L6YA 3AWNA 3LXAA 3QKZA 3IS4A 1OCQA 5CCZA 2ZQ0A 3CHCA 1X6LA 2QGYA 3HMJG 5I0DA 2Z6IA 1RK5A 3TONA 3W87A 3WQ6A 3OZOA 4IICA 1EP2A 3LRMA 2J7GA 3VZZA 1C8XA 4B15A 4LPCA 2J25A 3XISA 7REQB 1X39A 1OBAA 1XGZA 1RZMA 1US0A 1YE4A 4Z0JA 1SFTA 4JPGA 4JCLA 1X97A 4Q6XA 3VKJA 1LYXA 4K6AA 3KDNA 4F8XA 1J01A 3G1DA 3MMTA 1X7IA 1O5KA 3SFKA 2ZX7A 1F3EA 1WO2A 4Q8NA 5BNKA 5A3HA 1XLLA 3VUPA 3EOUA 5CLTA 2NVCA 4K7VA 2P53A 2NXGA 7A3HA 5FF7A 5H1WA 1U1UA 3BWWA 3SRHA 4WLCA 1T8QA 2WNNA 5JMUA 2VCCA 4MB5A 2HNEA 1ZHAA 4AC1X 1C29A 3QZAA 3GW3A 3NO3A 3P84A 1PPIA 4DNMA 6XIAA 3UERA 4Z08A 1NFGA 3UT0A 3BOFA 3QY8A 3KDOA 5BXRA 3WQ8A 4NYYA 1EYEA 4ZVJA 5D30A 2X1RA 4IPJA 2YIHA 4HNNA 4M56A 5L6UA 2GOKA 3C2VA 1TJRA 3PUDA 1CGYA 1E0UA 4FX7A 2YJQA 1GOKA 2Q8LA 4J3SA 3PG8A 3EPMA 2BXVA 1KC7A 1WKDA 2PGFA 3A3HA 1B57A 4J1OA 1O4UA 3N4EA 3B8DA 2HNHA 2QR6A 4DZHA 3IJ7A 3VD9A 3QGKC 3W1TA 3NSNA 1BVNP 1OX6A 3BMVA 5FJPA 1U5HA 1MQRA 1ITUA 3APGA 4OBTA 2IPFA 4GY0A 1B3OA 4ADSA 1YTDA 3IJDA 4LTSA 4MNLA 1YPIA 1XSJA 2ZRZA 3KRBA 5DMLA 4UQCA 3CV6A 2POZA 1TJPA 3NL2A 2OVLA 1ISXA 1AA1B 3W7QA 4HSHA 1PWLA 2F9RA 2QJJA 4DRSA 3W24A 3FEMA 4YVXA 4QJ5B 4JN7A 1UD6A 4UFMA 2VOMA 2CXEA 1QASA 5FI8A 4ERIA 3VOHA 4GC3A 1EA0A 4L9YA 1OFRA 5K3VA 1DHKA 1W56A 4PA8A 3R4IA 4KCVA 2C18A 3BICA 4JAWA 3B0VC 4HGXA 2OO6A 4H9YA 4CKQA 1K8ZA 3ZSSA 3SCOA 4A4AA 5K2ZA 2D2HA 2PBGA 4H83A 3RCNA 1CTNA 3IANA 1YTEA 3POHA 4PTNA 1QW7A 2DUZA 1TA3B 2GJNA 2H8XA 1S5MA 2NUYA 3LI1A 2ZKMX 5A2AA 2O9TA 3TXZA 1VBHA 3WLHA 8XIMA 1OVDA 2R24A 3KL3A 3VFCA 4AHQA 4PMXA 4UUIA 1UHVA 3K46A 4QG6A 3TCSA 5BU6A 4AAJA 4UCGA 3ZVHB 4XIMA 3G1HA 1GUVA 4IXHA 3VAVA 1JPHA 1VC4A 1LBLA 3GR7A 1EJSC 5A95A 3P60A 1MEIA 1V77A 3FS2A 1GYMA 4MKVA 4JIEA 7TIMA 3TEVA 3AMCA 2J9XA 1I2RA 4GQBA 2WKJA 1BRLA 3GBDA 4LVDA 3DCPA 3CTTA 1QK2A 5BCAA 2H90A 2R1PA 3RPMA 1W9PA 4LVGA 3IARA 1EJRC 2TMDA 3ARTA 5FESA 2XN2A 5I00A 3O0FA 3E0WA 4O12A 1JDEA 3R0DA 5C0QA 3MUCA 4N9DA 3TYDA 4Q8MA 2Z26A 5DY3A 1PTAA 4EWJA 2VWTA 4GO9A 4X61A 2XWEA 5K9CA 3ALGA 4QXIA 1XYCA 4L5ZA 4RZ6A 1V3MA 2V5DA 1RXOB 3TMLA 3WJYA 3VGEA 1RA5A 1E4IA 2D0FA 1I6NA 2Y7GA 4DJDA 1OY0A 3RN6A 1RY8A 1XSKA 4ERGA 3MJYA 2E1DA 2E8YA 3QW3A 5I03A 1NFPA 5D9MA 2I17A 4TTGA 2VGIA 3UR5A 3WQ5A 1SZFA 3IJ8A 4LSBA 2D3NA 1K8XA 3GDMA 1D8WA 5FD0A 2NX9A 2VUNA 3S42A 3UG3A 4QITA 1P6CA 4MDPA 4CCEA 1PKLA 3ONCA 1ZP4A 1P0KA 1VGAA 3VIOA 1CGXA 2WXDM 3MSGA 4X0VA 3N9RA 3LX9A 3LGEA 1GWJA 1JPKA 4NJIA 3UXKA 1W9UA 4F0KA 4RNIA 3NXFA 1RJQA 3RLUA 4ECLA 5BXSA 4F0LA 2VRQA 1VEPA 4LY8A 3VKKA 4R9XA 1E9IA 3QGAC 4PRRA 4GVGA 3IJ6A 2ZZ3A 4KEUA 1FWAC 2EO7A 2ZUVA 2VT0A 4Y8EA 2YBTA 4HNUA 1E4MM 1TCMA 2XN1A 4IUOA 3VMOA 5FJJA 3L4UA 4ADTA 3NSXA 4UWMA 2JALA 2ZXQA 2G3IA 1JD9A 3M5XA 4MWAE 2I9EA 2A3CA 3SDOA 2ZX9A 2XDFA 5HULA 3CMFA 3GG7A 4DELA 3VDBA 3LG3A 3IUHA 1SYTA 2QUMA 3UEQA 4AVNA 4CU8A 1ZAIA 3U8GA 2DJXA 3M7WA 3TIMA 4MVAA 3ELFA 1NFBA 1JL8A 1PDYA 2BDQA 1J10A 1G5AA 4AWEA 2CERA 3SCNA 2PWFA 2ZWYA 2WJDA 2JFEX 3F2BA 4NX0A 4O1EA 2JEPA 4ZSUA 2OSXA 4YWSA 3A24A 1QRQA 4FS9A 3SQLA 3W7KA 3MWCA 3DFQA 4GYKA 2OO0A 4JTFA 5DY2A 4J2MA 1TR1A 3UPWA 3PNUA 2H9AB 2DQXA 3HTWA 2DSZA 3ZSTA 5F4XA 1O5RA 2XM2A 2VGFA 1Q2RA 2Q09A 1AJZA 4AUBA 2C19A 3GC4A 4ZOBA 3THAA 3GTHA 2YL5A 4HPJA 1AJ2A 4J5NA 3NZQA 3T0CA 3TROA 3FJ4A 4YTUA 1OK4A 2OGJA 4R27A 1E70M 3PTKA 3L2IA 4XWUA 2A5HA 3TYUA 4FSAA 1LJYA 2J75A 2CHNA 1ADDA 3W1PA 1BHGA 2GSEA 3G1SA 3ARYA 3CWNA 3MZ2A 1G4EA 3UY7A 1TQXA 1XD0A 4AY8A 4JHOA 3R89A 2WLZA 1WYIA 2ZZ6A 3WLSA 3LBMA 3E2SA 2PRHA 4HZ6A 4JTIA 4B5NA 2FHBA 2CKRA 2G3MA 4NJHA 5LIXX 2BXYA 4MNJA 3LQGA 7CGTA 3VC6A 2VZVA 2ZZ1A 4BA0A 3STEA 4L9ZA 3GTFA 2DGAA 3BLFA 1GQIA 2C79A 3EOEA 1RPXA 1J6OA 3EXSA 4UQEA 5LKYA 1QAPA 2CW6A 5CJNA 2DY3A 2A21A 4L61A 1EZ2A 1RHCA 3VX0A 1DWJM 1TR9A 3WLIA 1RV8A 2V5BA 2P8BA 4JN8A 2NUXA 1CLVA 2YSWA 3MTWA 3NQEA 4QS6A 4ACZB 1BWLA 2GDUA 3LTYA 1OCBA 3W53A 1O12A 5IRPA 1F61A 3UR8A 1TKKA 4DJED 3TXVA 3MI2A 4LCRA 3DFYA 4BF5A 4RNFA 4YTSA 4X9YA 1ZCOA 3RDKA 3LCFA 2NV1A 5FEXA 5ECUA 4GUHA 4JY8A 2PTWA 2PWGA 3WL1A 1X1ZA 1BG4A 4MWAD 4DWSB 3MSYA 1E6PA 1PDZA 5FIPA 4YWIA 3N29A 1FQ0A 4BQ2A 3VPLA 2BY3A 3LXCA 4KRZA 3P8IA 1CBGA 4TX9A 3S9YA 3D5HA 2BSLA 2D0HA 3VM5A 5C2XA 3LPGA 4KKXA 1V4YA 3TYAA 1LP6A 3OGRA 5GJPA 5A6JA 4B3KA 1POJA 4O54A 1UD8A 1NDYA 3QZ6A 5I3GA 4OVXA 4KRUA 3ITGA 2UY5A 3NQGA 3T09A 4RUBA 3ITCA 3W7HA 5D37A 4FOKA 1AMKA 2E09A 1A5UA 3G8RA 2F6KA 1V0MA 4H9UA 3HFYA 5EFFA 1J79A 3UG4A 3UXIA 1AD4A 1UP0A 1W9XA 1DVJA 2ZA1A 3TN3A 4WJEA 1T41A 2Q71A 4QEHA 1W6TA 1IQ8A 5A6SA 3FJLA 3GUGA 2C8NA 4DI9A 3O9NA 3W3OA 4RV8A 3VX1A 2JBMA 1KBBA 3QN3A 1ALDA 1J8VA 1NP2A 3GH7A 3NQ2A 4MFDA 5GQBA 2VD8A 3P8JA 5KINA 4N9BA 3CT7A 2XSBA 4DXVA 5CGMA 2QYGA 4IIEA 4R53A 1FH9A 4DEFA 4H9ZA 1IEXA 3OLGA 5FKYA 2WHKA 3VIGA 2IPGA 3FGCA 4NASA 2PSNA 3G5EA 1KQZA 3AIVA 5RUBA 1CGVA 1V8EA 1EKOA 1LWIA 2YA1A 5DMYA 3WF3A 2QDHA 1V7YA 4HTYA 2IQTA 2W5FA 3DHDA 3EDJA 3BGGA 3LGDA 3W1XA 3W26A 3PZMA 3E74A 4D6EA 3BQ5A 3FA4A 1UWAA 3EWYA 4GQQA 2ISWA 4DYJA 4CNSA 1AG1O 4AHOA 3PBMA 3AIQA 1ZTVA 1XFBA 3W9ZA 5M03A 4AZGA 1ELSA 1DBTA 2TPSA 4DUVA 3V7PA 2YX0A 3UXAA 3KVKA 3HGJA 2HS8A 1BVWA 3QC0A 4XQ6A 1S38A 4PFHA 1EDTA 3W2JA 4HZMA 3ARWA 4AQLA 2VURA 1A50A 4QX4A 2IPJA 3H7VA 4AD4A 1H3GA 3UYCA 1QT1A 5AKQA 1LTDA 2VX6A 2OJPA 3SN1A 5HBFA 5JIWA 1E51A 2GLKA 4UMCA 4LJ3A 3W02A 2GJRA 4QE1A 5A6BA 2C6QA 1ZJHA 4P7LA 5C7HA 3V75A 1EEXA 3WBEA 2J8GA 2BY2A 3DYOA 2XYLA 5J8LA 2V9DA 3N6JA 4IJCA 5G4HC 1JXJA 1MW3A 4OV9A 3NL5A 1KTBA 2F6XA 3A22A 2PAJA 4TV5A 1PZ3A 4LV9A 3GK0A 3PB0A 3SCWA 3SCQA 4E4UA 1RR2A 3EDKA 4HCLA 4D6GA 1OEPA 3BUVA 2PDCA 4C6IA 4A29A 1R86A 3FVMA 2Z1BA 5T26A 4HA3A 3G0UA 1J9YA 3WFZA 1H0GA 3C2RA 1M7JA 5FACA 5I09A 1BG9A 2W61A 3U7BA 1DWAM 3EKGA 4MPQA 4A35A 4FHAA 2C1IA 5DN1A 1ZENA 1VENA 3VVGA 4GGHA 1YW1A 4JFVA 4UMBA 4G5DA 2HXTA 3WNKA 3HPXA 1F76A 1QCWA 3THQA 5AYIA 2A7RA 1F73A 4XAZA 2JF6A 3V1HA 1RBAA 3R12A 3F4VA 3DDMA 3VKAA 4ZE5A 2PUZA 3W7NA 2VFGA 3M7SA 1I60A 2FIQA 3E38A 1GOOA 4ZMGA 2FTPA 1NOFA 3KL5A 1OFPA 1EO7A 3ARXA 4YNGA 4INFA 2CBIA 1JAEA 4LU0A 4IL0A 4J3WA 3NVDA 1TPDA 4O0QA 1G4TA 5AC5A 4TTUA 5TQLA 3SBFA 1HGYA 1VBUA 2QS8A 3C0LA 2IQ0A 3QYQA 4AEEA 3G1VA 5IXEA 2ABAA 2Z25A 4I9JA 3WBAA 3G3DA 3EX6A 5C9ZA 1QPKA 4C5YA 2Y7DA 3B8UA 1YEYA 2DVTA 3O63A 4RXFA 1DJXA 1EH9A 1OFAA 4WDTA 4ZSTA 3CZ8A 1P0BA 3PN8A 5HUOA 2OOGA 2CWXA 4ACYA 3S83A 3CLWA 5L9FA 4B9YA 8TIMA 2PDWA 5LIUX 2QJNA 4WSKA 1SFLA 2CBJA 3LDVA 2R91A 5KZMA 1H7XA 4AD1A 3CL6A 2XIIA 4Y9NA 1P7TB 4CNPA 6REQB 4UTMA 4PR4A 4UXDA 4FIQA 1KTCA 1V7AA 2OODA 1KD0A 3E2VA 1CXLA 3CC1A 1K8CA 2Z1KA 4D1JA 4F9DA 2WCGA 1LBMA 1KWKA 1FP9A 4K1GA 2JIWA 4GCXA 3S6DA 5B7ZA 4C65A 1WKEA 4KQNA 1TPFA 4HNOA 1JCNA 3AU2A 3EWCA 2QZRA 4JFSA 3GWQA 1H62A 3PSVA 3PWAA 2OELA 3BMXA 3IVSA 4RV3A 3WF4A 1CXEA 3G1XA 4Q8VA 3N2BA 3UZZA 4IF2A 1P4CA 3FW6A 2DH2A 2HK1A 1LOLA 1XP3A 1ISZA 1J0IA 1XQKA 4AF0A 1ZBCA 1ENUA 2X7VA 3P5ZA 1E5JA 4GD0A 2Z2AA 4AIUA 3GNOA 3L9CA 4QS5A 3VZXA 3CHFA 3PUEA 3SUVA 1CLKA 3VOJA 3ZR5A 1VPYA 2HWGA 4B5TA 3MKCA 1XXXA 4IJRA 4GINA 4F66A 1TREA 3ITOA 2NSOA 3WNNA 5GNZA 2ACQA 1B31A 1HKMA 1VH7A 3EKLA 1XH0A 4KWOA 1HIZA 3UBPC 1ZS2A 5D04C 1JQXA 5EL1A 3OZMA 2CLLA 4DJDD 3TLQA 2OCZA 3EPOA 3QOKA 5HOSA 4EXBA 5FOOA 2WSYA 1UH2A 4PBGA 4AB4A 3H8AA 2A4AA 1XLGA 4F9JA 4H7VA 1LQ2A 4QLKA 4ZOAA 2TRSA 3ZWSA 6ALDA 1PYMA 4DVOA 3QV9A 1ONRA 3M5YA 4BQ4A 2E1WA 3VKBA 2QIIA 4AX7A 1ZALA 3FYOA 3PZIA 1BKHA 1JNDA 2EAWA 2J13A 3VMNA 3K1DA 1Q3NA 2F2KA 4AVOA 5DCDA 3N4FA 3R2GA 5CAKA 4RL3A 3I7RA 3B40A 1GW1A 3IV3A 4W7WA 3CQIA 3I7QA 4DF1A 4C6FA 3C3UA 2EG7A 2FTWA 1V3HA 4DJFA 2TSYA 4HOZA 1E1CB 2YYTA 3I3EA 1F4HA 1FP8A 3SJ3A 2FYMA 3L21A 1LL4A 1QBAA 3LI0A 2G96A 4AIOA 4E6MA 5ABFB 3JUGA 1TYGA 2IUZA 2FB2A 2P3EA 3M4HA 1A5SA 5CPMA 1X1OA 5LIWX 4Q7IA 3W2KA 1R7AA 4LXFA 1MZHA 3ZLHA 3CZEA 2QQ6A 1EF2A 3UD6A 1Q66A 4REQA 1Q7MA 3K8MA 2EBNA 1VQTA 3TA9A 1KCZA 2GQAA 4NZJA 4POCA 1IIGA 4FNPA 5A8QA 4AYGA 5B7YA 4O10A 3WZ0E 4BQ3A 2ZX8A 2ABBA 2E5CA 4FIRA 5CGQA 2UY3A 2J24A 1V6YA 3YPIA 2R82A 1AD1A 5H8MA 1KKRA 3PZUA 4LYKA 1PCKA 2RDTA 4A8LA 3THCA 4FI4A 3GE7A 3CB8A 3DG7A 4E38A 4PB3A 2HQAA 5TIMA 4KEZA 2WQDA 1WAUA 1YXDA 2FGZA 3E1F1 2WVTA 1SZGA 5J5RA 3ICJA 3WK0A 4UMAA 4RE2A 4FALA 3O6DA 1SO6A 2OLHA 3FA3A 3W4RA 4XD6A 3PB2A 2DORA 4HZ8A 4JIQA 4O1BA 1XC6A 1SPQA 1A0DA 2FLIA 1V3LA 2AL2B 3LGGA 2E5BA 1UD4A 5AHMA 4O0KA 2QULA 5I3DA 5A1AA 3VCNA 3C2YA 3TSMA 1E6RA 2R14A 4JGDA 2PDLA 3B8VA 5AY7A 2WANA 3HG4A 3NQCA 1NWUA 1P0NA 1CYGA 1GQKA 5ECVA 3MU7A 1R87A 4QLJA 3GIYA 3VIIA 2J7CA 3P82A 1UQYA 4H8NA 4FOUA 4B4FA 2OLAA 4NILA 4EE9A 1PZ1A 5TD4A 4UTHA 1GVYA 2JF7A 4HMEA 2QPUA 4E5TA 1HP5A 5CC3A 3UP8A 1OYCA 2J47A 3RYSA 4L6DA 2YZRA 5M3WA 3S1WA 4LGXA 5IBXA 2L5HA 1NSJA 2VDGA 3IJIA 3RPTA 2I5IA 3W22A 2WCAA 1HUVA 2BZNA 1WA3A 1KCXA 1VFFA 2OPJA 2OQHA 4MKSA 2JK2A 1Z89A 1G0CA 3TFCA 3DHPA 1LOQA 1NOUA 5DLCA 4I3GA 4IP5A 1FWBC 1AQFA 1V6UA 4QQUA 3CAQA 1ZLPA 3S47A 1P5BA 3GU1A 2WVVA 3AIBA 1UA7A 1RPKA 3HU7A 3V35A 1Y5VA 3CV1A 2Y6ZA 1NU5A 5KZEA 4UFHA 4JBRA 1FHDA 1CW2A 3W1UA 4J7RA 2B7NA 7PTDA 3FSTA 3A4AA 5CSSA 3MMDA 5TF0A 1LORA 2PWDA 3BJSA 3CO4A 5PTDA 5CZKA 1HL2A 4GOAA 3T4CA 4JS3A 1XYFA 3QLDA 5G4EA 1J6PA 1QOPA 4KIEA 4Q3MA 2OMAA 4N0RA 3LSCA 3MCNA 3KTXA 3ZQ9A 2XGBA 3P5YA 4WRHA 2QCGA 1GVRA 3BK0A 4K8GA 4BS0A 3W7JA 2VZTA 3REQA 5GNYA 5G2IA 1F5ZA 1XGEA 2FHFA 3WKZA 1TZ9A 1VBJA 4F2TA 2EPMX 1UP2A 4FX8A 3WK3A 1FCUA 4AXKA 1F9CA 2BMBA 3LD5A 5AC8A 4BWLC 1T8XA 3MDUA 3EOLA 3PBYA 1HKIA 4NIRA 3UWYA 2RGLA 3UA3A 4QAWA 4FF7A 3VIPA 3WJZA 3LENA 5A2BA 1C90A 4IG2A 2A7PA 3F5KA 4NU7A 4RE0A 3FOKA 2X40A 4ZR8A 1KFJA 4DZAA 4H6EA 1KCKA 1UWSA 3VGBA 3WX7A 1JRBA 2PU1A 4LRSA 1VYPX 3N19B 2ZYFA 4ZQPA 3USZA 2NW0A 4IZGA 2XPKA 4FXSA 4C1LA 4JX6A 4NG3A 7ENLA 1W5PA 3N2CA 3E5BA 3U5YA 3ZLFA 4PC8A 3M41A 4WHBA 1DKWA 1Q7QA 1QWGA 1TX2A 2HDJA 3GU9A 2ZUSA 1MZRA 3H6OA 3HN3A 4LB4A 5A8NA 2VRJA 5HPOA 2W62A 2I9UA 2WVSA 3GIQA 4EAMA 1ML1A 5T9BG 2V5LA 4S23A 2Z24A 1P0EA 2YXXA 3R79A 1TPVA 2VHLA 4H9VA 3LPFA 1QK0A 2ZC8A 5FAJA 1TG7A 3PZNA 3P80A 4NSBA 3VDCA 1NM9A 5JUVA 1N8WA 1CX9A 1QU4A 4PUWA 2YKKA 5D38A 3ZJ6A 5BW6A 2E68A 2V3EA 1XH2A 2NVDA 1R46A 1XG4A 2XN0A 3T0TA 1KXQA 2ESCA 4LAUA 6TAAA 1EX1A 4OUIA 4IQDA 4QJ1A 1D7FA 2H6RA 3BQ6A 1FY6A 4Z2JA 1GVSA 4JZ5A 6ENLA 4RR4A 3GVWA 4B3LA 1SZRA 1P43A 4H00A 2A3EA 3VNJA 3SSZA 2J8TA 4UOZA 2QLYA 5I23A 3V36A 3J7HA 4R3UA 1LUCA 2ISSA 3R0UA 5A6BD 3C5QA 2X8RA 3LMZA 4IGSA 2V3DA 1PCWA 3WH9A 1YADA 2PDXA 1KRAC 1PO9A 1B3VA 4JNYA 2E6FA 3NTYA 4WKFA 3VGDA 3T42A 5HUPA 3HG5A 2PU0A 1JVNA 4KFNA 3LCGA 2RFGA 1WAWA 1H60A 2VENA 4OBRA 2D24A 4QEEA 1RD6A 3F4WA 2WPGA 4Q4KA 3QOMA 4M81A 1W5QA 3URQA 3ABRA 4UFLA 2IKIA 2QXWA 3C56A 3A13A 3K2GA 4XD4A 1DWHM 5HNNA 4QCFA 3P67A 3W86A 3QMRA 1AUSL 3XINA 5LA1A 4GUJA 1C7SA 1KM0A 3Q67A 3W7EA 3TH6A 1AH0A 4IPNB 4NAEA 4MTVA 2J78A 4X2PA 1JF5A 1XRVA 4O1DA 2WZIA 3QEZA 4G6CA 1PIIA 3DUGA 1YLVA 1TJ0A 4G1NA 4U5IA 3BURA 2QKFA 3QFWA 5C8BB 4C6NA 4L65A 1AL8A 3AICA 4Z0SA 1FTXA 1QATA 2NT1A 2VUYA 3CH0A 4C91A 3JS3A 4AZCA 2ZZ7A 4HOXA 3CH9A 1EQCA 4HK5A 5DANA 3RM8A 4M6QA 2GK1B 3O05A 3WH5A 2A0NA 5FL1A 2W63A 1QNSA 1GOQA 2JIEA 2VC7A 2PC8A 1AW1A 1EGZA 3U48A 3CS2A 3DBPA 3BW3A 5ABTA 1XYBA 1DJWA 4WOQA 4G7FA 4WGXA 4EPEC 1Z6KA 3ZWTA 1HL9A 5EFDA 2OYLA 3NYZA 2DIEA 4IOTA 3DAQA 3OBEA 2Y63A 2DT3A 4M7TA 2BV9A 1HP4A 5FSEC 4XISA 3MV11 3PZQA 1LBFA 2JKAA 4UTUA 2EPLX 4ADUA 3KEHA 4IMDA 4C1NB 3W7OA 5D03A 4XX6A 3RO8A 3DG6A 4W88A 2ZRUA 5AYBA 3CL8A 4U10A 1EWEA 1B54A 5AC7A 3SCRA 3B04A 5FJOA 1QMLA 2WZHA 4W7UA 1MSSA 1X1NA 2Y85A 2PD9A 4HVXA 1VEOA 2VZSA 4QDWA 3B8SA 4UTTC 3NJ3A 2GUYA 5D2YA 4MB1A 4HZ7A 2F61A 1JGIA 2V3FA 1IEVA 1IHIA 4GBUA 3WFAA 4JQ4A 3SO7A 5F2LA 2A6LA 3ITLA 2ZC1A 1E56A 1XD1A 2PD5A 1E40A 2PE4A 5C2GA 3QGVA 5CKSA 1FXQA 4US5A 4ZQCA 5CZSA 1DIDA 1VRDA 1TFVA 3H2NA 4CQBA 1NP0A 3AYRA 3C4UA 2Y8UA 4GIYA 4ZA0A 4FF5A 4H7CA 3IUIA 4PN2A 3QTPA 5D9OA 3PULA 2RJGA 2YLLA 4RK8A 3WEZA 1E0XA 2YOCA 2XFYA 1NEYA 2OYKA 3WCZA 4PMNA 4Q8WA 3C86A 2WSPA 3MUZ1 1PAMA 3WMBA 4XO7A 3S6TA 4LUSA 3ZLGA 3L0NA 4JEJA 1JDCA 2X42A 4IH3A 1RBOB 2GL5A 3NDOA 2FH6A 3L66A 2QCDB 5AZ0A 4UTJA 4H4IA 4QJ4B 2VC5A 3TTYA 5JQ9A 3I7SA 3QRHA 2C15A 3GQYA 3PUOA 1WDRA 4BHYA 5I24A 1EJTC 1J11A 3KOWA 3ITYA 1BEUA 1CLXA 1I1XA 4GIAA 3NUKA 4P7RA 4DIAA 1M6JA 2RGMA 5XIAA 3AFBA 4EF9A 4EP8C 3EPNA 2W91A 1UCWA 5EMJA 3TOPA 1O68A 3PTQA 2HPIA 3DKLA 3PZGA 4DWSA 4L80A 1OF6A 1XISA 1KFEA 4GACA 1IT8A 5AHEA 3AOFA 1PXGA 1EB3A 4FNUA 4DBWA 4O28A 3QH2A 4KWSA 1ESWA 4U3AA 3A5FA 4AD5A 1CZ1A 1RQHA 2NX1A 3N73A 1ZFJA 3ZM8A 4GBDA 4LYQA 4OZOA 1NELA 2EPNA 2WLYA 3KCOA 3B9NA 5A8MA 3BGJA 1SZNA 3NDYA 3S1VA 1IZCA 2EPOA 4RNHA 5BXTA 3AALA 2BXZA 3M6YA 2VCBA 4WXZA 6XIMA 4O0ZA 3KOZA 4LALA 3WK1A 4BY3A 2E4TA 3DGBA 5HK4A 2J7EA 5HNTA 4V27A 2PDNA 4RLIA 1QNPA 2VEIA 3PZOA 1TJ1A 1EDGA 2ZFAA 3G1YA 2PP1A 2Q3RA 4O52A 1Q6EA 3BG9A 3I4KA 4AISA 2GDQA 1K9EA 4DPQA 3HZ3A 1SJBA 4L9XA 3QM3A 4ROQA 1GQJA 5DQPA 1VFTA 3T8LA 1YXYA 1V79A 3MMWA 1DJIA 1ZQ5A 5FL0A 1W2PA 3LTSA 4QJ3B 3B97A 2J66A 4DI8A 3AS2A 3RX4A 3MUIA 4IIFA 4AD3A 2NV9A 2GVYA 1H1YA 1B90A 1XWYA 1P1MA 5EMYA 3HM7A 3EA2A 1PTGA 3H70A 4EAYA 4AY7A 3RRAA 1KXVA 4NZ5A 4HB7A 4WY0A 1D3CA 1NF0A 4QR6A 1OX4B 2ADAA 3W6LA 1MQPA 2B31A 1F6KA 4YLWA 2G97A 4YVVA 1XIGA 3NQAA 3OLEA 2F8QA 2V8ZA 2OSYA 4RZ4A 3CB3A 1M41A 4KEMA 2CEQA 4EXQA 2XH7A 5M5DA 1TO3A 1X6UA 4B9ZA 1WDWA 4LY4A 1WUFA 5EMMA 3AHZA 5G1TA 3RIKA 3CZJA 1B3ZA 3LUTA 4XO6A 2D20A 3SN4A 3WYZA 3WQCA 2WMFA 1XLDA 1QJWA 1W3NA 5BRBA 4GNJA 5JXQA 3RGTA 3HBLA 4PMJA 4DYEA 1S3HA 1F8MA 4IPPA 4QP0A 2FZMA 4AZBA 2D2JA 3L23A 3N9KA 4IFRA 1U83A 3CIVA 4YPJA 1HVQA 3GG1A 5KEZA 3IPWA 2IS7A 4B91A 5KTLA 1MW1A 4PB4A 2ZA2A 1BD0A 3NEHA 2Z0IA 4Z2KA 1RUSA 5D2XA 3ZS4A 2CHOA 2GUUA 4IMGA 5A6KA 4OTKA 3DGRA 5BRQA 2OWWA 2Z2UA 1OGGA 2V63A 4ZO9A 4G7EA 3LLDA 3W25A 4PUEA 3LHTA 5TAOA 4BF7A 3I4EA 2GPTA 4QHRA 2PDBA 2WVUA 1KO0A 1PWMA 4TX8A 4Q8OA 3WLNA 1MW0A 2OU4A 3QHNA 3HO8A 4EWND 2CPUA 4GVFA 1WNOA 2CWNA 3R8HA 2A7NA 4XAFA 3H7RA 4W87A 4GO8A 2C0HA 2Z6JA 3THDA 3OHIA 2VEKA 2E8ZA 3IVTA 3RRXA 2PF0A 2QDEA 3QC3A 1S39A 3E0IA 1H7WA 5CC7A 4GKLA 1BQCA 2X1IA 2Y2WA 4BQ5A 4DUWA 4B16A 3LA4A 3NGFA 1KNWA 4D72A 3OVPA 4WD0A 3TFXA 3O0KA 3F4NA 2W67A 3BLDA 2RDWA 3BZGA 4J40A 4MLJA 2W9MA 2YW4A 2WC3A 2J6XA 3WIJA 1K8YA 2PTXA 2BVTA 4X2RA 1VF8A 3HA1A 4GQ0A 3AUJA 4GUFA 4OKDA 4D8AA 1UR4A 4LUTB 1GKRA 3QY7A 3FEQA 2FJUB 4XB3A 1LT8A 3N3MA 4US6A 4JXCA 1B3XA 4IPLA 2XG9A 5ABGA 1A3XA 2Z00A 3ZT6A 1XLIA 3CIWA 2QUNA 4LB3A 2Y7EA 3PHAA 2WV8A 2P10A 1MNZA 2XU2A 2CIPA 1JPMA 2VELA 4MMWA 3WMSA 5G2WA 5LGXA 3AXMA 3NM1A 2C71A 4XZMX 1V6VA 2FFIA 1FWJC 4YMZA 5T9CE 4Z1BA 2X1SA 1WZMA 3RJXA 2V6AA 4O14A 3LLXA 4O57A 3MCMA 3KHDA 4PH6A 3BLKA 2V68A 5HMDA 1EFZA 1M7XA 4IIHA 4JDYA 3MHFA 2FQIA 1WP6A 2DZTA 1V3JA 2DP3A 1EZWA 1KRBC 3KXQA 4HYVA 3DN5A 4Q33A 3W28A 3C2FA 2I5QA 4PUUA 1G01A 3WUFA 3QZEA 4V33A 3W7GA 1GZ1A 1QW9A 4F0SA 3PPGA 3SEPA 3AU6A 1EC8A 3IWPA 4Q4PA 4XD5A 2FZ8A 1X8FA 3PK7A 4DF0A 4NI8A 1VEMA 1GTHA 4JL2A 4HA4A 4ICNA 2XVLA 2CYGA 5DMNA 4I8DA 3GTXA 2ON3A 3G18A 2WPBA 2I16A 2XIJA 1W0MA 5E9AA 4AIBA 3Q45A 3WD2A 2E5DA 3L7RA 4UNKA 1BSLA 4O18A 4R88A 3R8RA 5G1MA 5BROA 1FWNA 3T2QA 3VGHA 4M1BA 5MKGA 2DZXA 2CHRA 4M29A 3THUA 3VNMA 4UR8A 1TV3A 2AKMA 1EA9C 3WLPA 5D9PA 4MJMA 1UUQA 1BKSA 1Z3NA 1UUOA 2B7QA 3WELA 1UOZA 2V5JA 1WQ5A 5GJNA 3TDFA 1R9YA 3O1NA 4WR3A 3NSMA 5HWNA 1AODA 2XIOA 4F0RA 3N34A 1A53A 2WBKA 3XIMA 3IGHX 4JOMA 1H5YA 5JBDA 3M6DA 5AVHA 2QCNA 3S9IA 3RLVA 1HJUA 3TC7A 3AO0A 3K5XA 2F84A 2HS6A 2BOFX 4S38A 4FR6A 1ADOA 1OFQA 3CUXA 2B0MA 3M46A 4JNZA 2CZ5A 3P0WA 4M51A 1E71M 2AQVA 5ABHA 4TUFA 1XC4A 4PSRA 1CPUA 4KMQA 1GHRA 2XFRA 4LCQA 4IGNA 4P8WA 4KERA 2QW5A 2BVWA 4LEFA 3RR1A 3OLIA 4PODA 3RILA 1H7NA 1ZNNA 4ONVA 2BVDA 2IXVA 4QFUA 1EXBA 1NIUA 1DXFA 3R10A 4AD2A 4Y96A 4Q32A 5I79A 4LH8A 3IIPA 1PJ9A 4FK9A 2ZWZA 4GQGA 3TVAA 1QNQA 3CMGA 2Y61A 4FPSA 3IUDA 1EPVA 3AJXA 1XLBA 3QV8A 4HPNA 5IDIA 3AQUA 2Z7KA 3P74A 4P61A 1R85A 1REQB 4M19A 3MWAA 1K03A 1VHCA 1DQUA 2EPKX 2XINA 2Q3OA 4RDWA 5EMUA 8A3HA 4Q4OA 1A5CA 2RUSA 2VWSA 5D32A 4GK8A 3ME3A 3KVJA 2GWNA 4I6VA 3EX3A 4ZZ9A 1IR1A 1RCQA 2HBVA 4RW3A 1G7VA 3DFOA 2B4GA 1S2VA 5EKYA 3AI0A 5EA9A 3FSUA 3G6LA 2B7OA 1GQNA 4D6DA 4KWWA 3N11A 5A6LA 2PURA 3RG6A 2YCJA 3OIXA 1FDYA 2XVNA 2EEXA 4IHCA 3BLLA 4E3VA 2CC0A 4H8UA 4O1FA 1UP3A 3AZSA 1Z32X 3AC0A 1JPIA 2YCKX 2CKSA 3LCHA 3AHYA 2HMCA 4NP7A 1XRFA 3DYPA 1CI1A 2OZ3A 4J3XA 4LWWA 3TQVA 1ZUAX 1AW2A 2ZVIA 1ZB5A 5EB8A 3UG5A 4V1YA 2ISFA 2P5NA 4ZEPA 2V30A 3LRLA 4GKTA 3MP4A 1LWHA 1K7XA 1IWAA 2CLKA 3IIOA 3VO0A 4TVCA 3QPYA 2OZTA 4HA1A 1A3HA 5LNRA 3WBYA 1YMYA 3C8FA 3F5JA 4NRSA 3QHOA 2J4GA 3IJQA 3QPEA 1L6FA 2BVYA 4M8UA 2BGQA 4PMRA 1M5WA 3T08A 4FEZA 2CXGA 4E0CA 1E9YB 3S5SA 2GVGA 4I7VA 2E0PA 4BKNA 5A8OA 2W3ZA 2WOQA 1LLZA 4UOQA 2AAMA 4US5D 1J5TA 3W0KA 3B4YA 5D8WA 1Q63A 1W5OA 4JHZA 3WMLA 1US3A 4E4PA 1T7LA 7TAAA 3W7MA 3S9ZA 3CWOX 5H91A 2G37A 3NOYA 2FDMA 3NQDA 1Z48A 3TSDA 3KLKA 3AHXA 1OJXA 1DE6A 1UZ1A 4WQ6A 4ML9A 3DH7A 5IHRA 4MPKA 1VYSX 2DW6A 2QUVA 5MHBA 4GUIA 2G3NA 3ABZA 3VTRA 3SR7A 4YL2A 3PSWA 3R13A 3KUMA 1Q6FA 3MPGA 3CZLA 3VE7A 1W32A 1UR3M 1G94A 3W2MA 1YBQA 2WKGA 4ZOEA 4GMEA 4GE8A 1E6XM 1OZMA 3APTA 5T91A 3BOLA 2XH4A 4ZB2A 2IMRA 3N25A 2ACSA 1UASA 2GSJA 5JVLA 1DP0A 3VNLA 4DAIA 4ZQOA 4NQ1A 1BGGA 2XH2A 1A5AA 4MZ8A 1JXKA 2IKJA 3E6EA 5EU9A 2PDFA 1JFHA 2GJXA 3SM0A 1BWKA 2VI0A 3C8NA 3KX6A 3I3DA 4DWSD 1TPC1 4K39A 2PDPA 4MUZA 4PE8A 4KF1A 3OW1A 4IIDA 4PTVA 5REQA 4DM1A 3GXNA 1QPQA 4IXXA 2GGGA 2YCLA 4PCSA 1R7OA 4WX2A 3LCLA 1PBGA 5HJLA 3LPPA 2P88A 4JKKA 1HJSA 3W1NA 1SJDA 1YNPA 3RCMA 1C92A 4A3YA 1WKYA 1DJNA 3UWQA 1J12A 2PDUA 4LAKA 4NYUA 3B9EA 1YDVA 4YTRA 4S3BA 3OIHA 2VFEA 3B8TA 3IEBA 2YXOA 1TIMA 1W1YA 3M1ZA 3BMWA 3PS7A 2QMJA 2X1UA 4GJ1A 2PCEA 4PEKA 1GT8A 4PUNA 1AW5A 4PMVA 1GQLA 1W8GA 2GGJA 4DJFC 3EOOA 3CMJA 2CCRA 3O6CA 4OUEA 3UR2A 1G1YA 2KX9A 3W7PA 3AXHA 2GUBA 1YE6A 4KESA 3LZ3A 1QDSA 1O94A 4V1XA 4HHLA 1JUEA 1OFBA 4LVAA 3IGUA 4IIGA 1H1ZA 3E5PA 4ZTYA 1M01A 4XZNX 3WF0A 5HWMA 5DRCA 3LXBA 1KRCC 4G56A 2ZTJA 3A9IA 3HFTA 4PMUA 3GTNA 1O7AA 5IFTA 1VS1A 1QPRA 3UVIA 2DUXA 4J27A 4PSPA 1IR2A 4FMVA 3EOSA 1EJVC 2DV0A 1M53A 3GR4A 4GIRA 2Z4GA 4JQ3A 1WB0A 3WH8A 2E9BA 4KGJA 4A3HA 3RR4A 3OGSA 2UY2A 5FJTA 5B80A 3GVQA 5JH2A 1QNVA 3TN6A 4JTKA 3GXTA 5E70A 1VKFA 3LY0A 1VFUA 1JZ5A 1FX6A 3T05A 5CJ5A 1KV5A 2WQPA 3O6AA 2PC4A 4ILSA 3N6QA 3FN9A 2NQ5A 4ASTA 2ZVRA 3RX3A 4GZJA 2YW3A 4ZO8A 1Y65A 1CXKA 1ICQA 5CZJA 1QHZA 3MYOA 7ODCA 4ATWA 4MM1A 1JDFA 3SZ8A 1MI3A 4XAGA 1YYAA 5G4WA 1SW0A 3H4GA 1MQQA 4GFIA 2BB0A 2G50A 1QI0A 2W92A 3TZNA 4B5XA 2X1TA 3S8HA 1IGWA 1Q6DA 3I6TA 4M6PA 1W3IA 1CIUA 2OZ0A 1TWIA 3N13A 1BWVA 4ATLA 3I6EA 4AZIA 3NO1A 4NJGA 1IYXA 4B90A 4JNMA 1WUEA 3EA1A 3FYPA 1TMLA 3QR1A 2WJFA 1GVQA 2VQTA 3K8KA 5CZTA 1T99A 4GWEA 3Q94A 2DH3A 4M5PA 1ZZMA 2D1ZA 1HQTA 3N9SA 4QNEA 2VFDA 1DJQA 3SAZA 4N2YA 3AXKA 3EBVA 5D2TA 4JTCA 4KIRA 5DXXA 2VEMA 4O16A 3HPFA 4LCSA 2VR4A 2FB3A 1XBZA 1B9BA 4JX5A 2WHLA 1U5VA 2E9MA 3S2CA 1R2SA 4Y7EA 2GVEA 1J0ZA 3GZAA 2H3DA 1BRLB 4B5WA 2J9YA 2G95A 1TUXA 2XSXA 4XKYA 4LF1A 1X6NA 2ISDA 1RA0A 1MW2A 1V0KA 5LXXA 1S2CA 4KWVA 1JZ8A 2ZCGA 1OSEA 1ODZA 1YPXA 3CO8A 1Q4NX 4JHMA 3BLOA 1E6SM 3CAVA 5FEZA 1CNVA 1SFSA 1OCNA 3KOXA 4NAFA 3FXYA 4W7VA 2X0SA 4HBKA 4JKMA 2DZPA 4JIIX 1BYBA 1EJUC 1MRQA 4XZHA 1OD8A 3IK4A 4CQCA 3M16A 1N7KA 1VP5A 2OEKA 1RJPA 7XIMA 3E0VA 4GYJA 3W7CA 1JCMP 1TVNA 2X30A 5FF2A 3OYXA 2GWGA 3A9BA 3W85A 1FCBA 6PTDA 4NUWA 3GNXA 3H4XA 3N2TA 3PZVA 1W5MA 4CN4A 3HPSA 1V02E 4Z2HA 5DF0A 3GDTA 3L5MA 3NM3A 1VFLA 4NT0A 1EOMA 3OVQA 4D6FA 4QDMA 3GNNA 3GLCA 3NPUA 4X22A 2WWCA 1OC7A 4GJIA 1HKVA 1F6YA 4FXRA 4W84A 3UZWA 2DZBA 4H6QA 5D8ZA 4OBSA 1QTWA 3TR9A 3W1QA 1OIMA 4RDYA 3KRZA 2XM1A 3UESA 3QR0A 3HG2A 3VU2A 4DYKA 3QFEA 2BBFA 4UCFA 4L4PA 4KGLA 2PGWA 3LZ5A 4U3CA 3WQGA 1WDPA 2Q02A 4D6IA 3KM8A 4IPIA 3AS1A 5FA5A 2E67A 4AZ6A 3KOFA 4DZIA 2NLYA 4C60A 2D22A 3A12A 1JD7A 3TMQA 3CASA 2DZUA 2YDSA 3MHGA 4R34A 1BF2A 1TSIA 3CAWA 1GOWA 2HVOA 4JIPA 3MCOA 3QW4B 4CQ8A 3AYSA 4MB3A 3GKFA 2DZSA 3VGGA 2BS9A 5I07A 1ZBWA 3M0ZA 1B3YA 2QDGA 1HVXA 5LSMA 1KLYA 3QQ0A 4JEQA 3BAXA 4FXJA 4E8GA 4CNNA 4CU7A 1WOBA 1I9CB 3MUAA 1EP3A 1IZJA 1H61A 2C13A 1XS2A 5EPDA 1KQYA 1QNRA 4NJKA 4RJEA 1HTIA 1WZKA 3KS6A 2PDIA 4S2CA 2NQLA 4NNCA 3LS9A 1D8CA 1HO1A 3GH5A 2I7GA 3RLHA 2GGIA 4AC7C 3UZ5A 4WGHA 3EEGA 4LNYA 3WG6A 4TXEA 1U2YA 3DYMA 4JTRA 1M65A 2O9PA 1GEQA 4L4LA 5DX7A 1Y8BA 1R2RA 4GIEA 4JTQA 2HBXA 4MAVA 4IM4A 3UYIA 4HU8A 1RY0A 3M0IA 4L1GA 3NPXA 4CVWA 2ZX6A 3GNRA 2NWRA 2D0GA 3UPMA 1TQJA 2PGEA 3VOGA 1UKOA 4S3KA 2WHJA 5F4SA 1GYNA 3T6CA 3INPA 1L2QA 4N6FA 3WDIA 1O1ZA 3HGSA 2X09A 3BJTA 3T9PA 3W1MA 4CQDA 3NR0A 4Q8PA 3TZFA 2VVNA 3PWGA 1W9BM 3RNDA 2V38A 1BTMA 1QO5A 4Q7BA 2NT0A 4YTTA 4H6KA 3V1PA 1JAKA 2F6UA 3WQ4A 1F3WA 4MY8A 1XLAA 2J8FA 2RHGA 1XI3A 5D4YA 1W17A 1XKJA 2O0TA 1UKSA 3QHMA 3WBWA 3SN0A 1FBAA 5I78A 5CPQA 2EHHA 2YA0A 4D6HA 4JTUA 2WSRA 5HMSA 3DI0A 4IISA 4L56A 4M6VA 3KP1A 1OC5A 3AMDA 4UFIA 5ABEA 1SU5A 2NVAA 3AHTA 4QIUA 3PJXA 1OQFA 3BCDA 2XZ7A 1JCYA 3EB4A 4HNLA 2J7HA 2VFHA 1K7FA 1WZAA 1TZ7A 3OB8A 1MUMA 3T44A 2NSXA 4EKJA 3GFXA 3HIJA 2ISVA 2X2YA 4V15A 3G22A 3WLOA 4Q7NA 1SVDA 2QF7A 4GNKB 3RUBL 3N18A 4W89A 1JG9A 1JUBA 1BYDA 4KFPA 4C7DA 1JYVA 1FDJA 4CCCA 3NG3A 5DCEA 1Z42A 4KWUA 4NKCA 3VC5A 3DESA 1RAKA 4HN8A 2J88A 4GI6A 1W37A 3COTA 3SRFA 1MVYA 1T40A 4K8HA 5DMMA 1LT7A 3FHQA 1GOIA 1K4GA 3B0PA 2VC9A 1KV8A 3WDQA 3GM8A 4AZ5A 4WKHA 5F2MA 4PULA 5JIPA 3TJXA 2XFFA 3FKKA 3IV8A 1IXOA 3H2CA 2ZE3A 1CB7B 5HATA 4DXXA 4Q8TA 3LCXA 4B5UA 2ASHA 3TV8A 3QMSA 5BWFA 3KTSA 1EUNA 4D6JA 4M24A 5AZ1A 3MVTA 1KGWA 1OGBA 2ZUUA 2GZXA 3CUZA 1W1IE 4JTLA 2R1LA 4UBPC 3KZSA 4XZIA 1MMFA 3FGCB 1XLEA 4H2CA 1ONWA 5AFDA 3AYVA 2VFIA 3AWOA 2I56A 3SCSA 3PP7A 2C1GA 5AHLA 4FZIA 4C6EA 3R6IA 3PWIA 2OTDA 2FKPA 1D2KA 2EXOA 3GHRA 1WKFA 2HCVA 3CHVA 1E0TA 3S4TA 4AHPA 1SO4A 3WEOA 1KBKA 4U4MA 5CPOA 1VYRA 3ZR6A 1QPNA 1U1HA 5HPCA 1W1TA 1K7EA 1BXCA 1BQGA 4WEVX 1V08A 1XIHA 3W38A 4GVIA 4A21A 1ZSXA 2VZOA 1EPXA 3S5ZA 4HN4A 1H51A 1YTKA 3AISA 2C91A 4QM1A 3QV7A 1GONA 2PZ0A 2CLMA 4EIVA 2I1OA 1DWGM 1NQ6A 5KMYA 4MNKA 1R3RA 3S2NA 4PGLA 2JE8A 3DECA 4LW7A 1EF3A 3ORWA 4Y2WA 4YHEA 3VD3A 2D2GA 5FF4A 4O4VA 4HU4A 2W4XA 2DDXA 2DT2A 5D2VA 1HXJA 5DFAA 3N2MA 1CB2A 1K3UA 2XFWA 5E93A 1IWPA 1SUXA 1UA3A 1UMYA 3IACA 4DB7A 1ZPTA 3U2OA 2UZ9A 4UFKA 2ZZ4A 2WAGA 1H5VA 2DUAA 1ME8A 2FVMA 3TQPA 4UQAA 1VPQA 3H53A 1MXGA 1GJWA 3BCJA 3ITTA 2Z1VA 1VFSA 4XZLX 1T0OA 3VD5A 2WZEA 1Q2SA 1M3UA 4JL1A 1EYWA 2VXNA 4GX8A 3VIJA 5CC6A 5HA7A 4HSOA 1LDCA 3L12A 1B4KA 1NARA 3DI1A 3NZPA 3FV9A 4KCTA 4H8VA 4QNWA 4S3CA 1F8IA 3PR2A 4L1WA 2QNEA 1T5AA 1OIFA 1IE7C 1FVPA 1HKKA 5E6ZA 4FB7A 1H49A 3DC8A 2GQ3A 3DIPA 5C9WA 2Y4SA 1TV7A 1LQAA 1J5SA 1EOKA 1A80A 5G1YA 4UTWC 1MEWA 4DAFA 3AROA 3UNTA 1OHLA 1WE5A 1MXDA 3NZRA 3DU0A 5TBOA 1XDJA 1YXCA 1CENA 1R0MA 3IVUA 1NVMA 1NH6A 1Q6QA 4E2DA 1DXEA 3FVDA 3W70A 1FWIC 2PRMA 4HCDA 1N8IA 1Z9AA 2V69A 3ZR4A 2VR5A 1H63A 3UGVA 4AYSA 3FIGA 4OJYA 4CVUA 1IXQA 4LYRA 3GH4A 2WMKA 3G24A 4FLRA 2ATSA 4A05A 4TIMA 4JTAA 4JCMA 4O13A 1FCQA 3EYPA 1GGOA 3NZ1A 5F1UA 1SO5A 3GG8A 3WSUA 1KLZA 4LUJA 5K9XA 4R7JA 1F07A 4X0NA 2O9RA 1P48A 5GPRA 4X3ZA 4OOUA 5LNVA 3S2MA 1IT7A 4MNMA 2PTZA 2P50A 1XRSA 4Q8QA 3W74A 2OX1A 1WOAA 1JPDX 2HE5A 3BSGA 3NXLA 3G1RA 4ZXLA 4N6EA 1CGTA 3TC6A 1R30A 2FZBA 3H12A 4UZSA 2A79A 3Q4DA 3BCFA 1DIEA 3G0SA 1XQLA 2PDKA 4B3ZA 3E0LA 2OX4A 1S1PA 4XKMA 4BI7A 2DVXA 2R94A 2DU2A 1E1FA 1K9DA 3STFA 2BGNE 4YXGA 4O1AA 1WXYA 1I45A 3U57A 3MKVA 2E40A 5AB3A 1S3TC 4G8TA 1TV5A 3KCLA 2NQHA 3VNDA 3AZRA 2NWSA 3T78A 3VM7A 3CYVA 1KW1A 1W9DM 3FJNA 1E4NA 5D9NA 2JKPA 3PNZA 4BK9A 5CG7A 4GRSA 1T96A 3NQ8A 3WBXA 2A2IA 4AWUA 4F48A 3O07A 5CJMA 2G3JA 1V6TA 5EGRA 5I7GA 5J04A 1XLKA 3QY6A 1GKPA 1LL7A 2X0YA 3OHMB 4WJ8A 1WBJA 2JGQA 1JZ7A 3P14A 1EBGA 4G1KA 4ICMA 1KM5A 1HF6A 1FWDC 4E3TA 4NXKA 4AX6A 1X38A 1DWIM 5CBIA 3BAJA 4JICA 3PZTA 3HPAA 2VTFA 3E96A 3OZYA 4AF0B 1GPFA 2Z1WA 3JW7A 3ARVA 3OZPA 3W2NA 5ENLA 1FHLA 1V0LA 4F2BA 4XK2A 3UJSA 2BHYA 2QJIA 3W01A 2GQ9A 2WNQA