2NQJA

Crystal structure of escherichia coli endonuclease iv (endo iv) e261q mutant bound to damaged dna
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
279
structure length
279
Chain Sequence
MKYIGAHVSAAGGLANAAIRAAEIDATAFALFTKNQRQWRAAPLTTQTIDEFKAACEKYHYTSAQILPHDSYLINLGHPVTEALEKSRDAFIDEMQRCEQLGLSLLNFHPGSHLMQISEEDCLARIAESINIALDKTQGVTAVIENTAGQGSNLGFKFEHLAAIIDGVEDKSRVGVCIDTCHAFAAGYDLRTPAECEKTFADFARTVGFKYLRGMHLNDAKSTFGSRVDRHHSLGEGNIGHDAFRWIMQDDRFDGIPLILQTINPDIWAEEIAWLKAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA apurinic-apyrimidinic site binding and excision by endonuclease IV.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords 5'-D(*GP*CP*GP*TP*CP*CP*(3DR)P*CP*GP*AP*CP*GP*AP*CP*G)-3'
total genus 105
structure length 279
sequence length 279
chains with identical sequence B
ec nomenclature ec 3.1.21.2: Deoxyribonuclease IV.
pdb deposition date 2006-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 2nqjA00
3ITOA 5H6HA 5C9ZA 4YTUA 2X7WA 1XP3A 1XYCA 4PFHA 1S5NA 3M0MA 3VNIA 4GLEA 2G4JA 5XIMA 3P6LA 4ZB5A 3VNMA 1XIIA 4QDPA 5EMLA 4QE1A 4W4QA 5XIAA 3IUDA 1XICA 1GW9A 3C0QA 1DE5A 1XIHA 1XYAA 1XYMA 4OVXA 3XINA 1XLKA 4QE4A 4A8IA 2NQ9A 1XINA 4QEHA 1QT1A 1XIMA 2J6VA 1XLJA 4US6A 3QYSA 3CQHA 4EAYA 4Q7IA 1D8WA 4DUOA 3KCLA 2OU4A 3M0HA 3KBJA 1XLAA 8XIMA 2XISA 1XYLA 2GLKA 3M0YA 4HHLA 1XISA 1XLMA 1XIBA 3U3HA 3UVAA 3M0LA 5J8LA 2HCVA 5H1WA 4HNOA 1XLBA 1XLDA 3CQIA 2GVEA 4GJIA 1XLFA 3M0XA 4YTRA 1XIGA 4E3VA 2QULA 4X63A 4XIMA 3BANA 3QC0A 7XIMA 3NGFA 2I56A 1DIEA 1TZ9A 4HGXA 3IUHA 3L23A 4LNCA 1MNZA 1XIJA 3KCOA 3LMZA 4ZB0A 3BZJA 4QEEA 4YTTA 2I57A 3KTCA 3ITYA 1XLEA 5I7GA 3BZGA 2ZDSA 1A0CA 2GUBA 2X7VA 3ITXA 3KBNA 1XLGA 3VYLA 4A8NA 3JU2A 1XLLA 1XIFA 3UA3A 3QZAA 3DBNA 1MUWA 1OADA 3AYTA 1O1HA 1XIEA 1S5MA 2G0WA 1XYBA 3TC3A 1QUMA 3KBWA 1I6NA 3ITTA 1XLHA 1XIDA 4DVOA 2Q02A 4XIAA 4K1GA 3CNYA 4A8RA 3XIMA 4K3ZA 3FVMA 3GNXA 3M0VA 3VNKA 4X60A 2NQHA 5AVNA 2NQJA 4PGLA 4XSMA 3KBVA 5XINA 3U0HA 3VNJA 5EMKA 1QTWA 5TNVA 3KCJA 2XIMA 4QDWA 1DXIA 3VNLA 1BXCA 4G56A 3CQJA 1XLIA 3BWWA 4KW2A 1CLKA 4HHMA 3UU0A 3IUIA 4X61A 3N4AA 3CQKA 4XSLA 3UXIA 4GQBA 1DIDA 4EACA 1BXBA 3KBMA 2QUNA 3BDKA 3KBSA 3CWHA 3P14A 5FA5A 3AAMA 2HK1A 4ZB2A 3WQOA 4GJJA 5B7ZA 2QUMA 4YTQA 3UA4A 2HK0A 5EMMA 9XIMA 3XISA 1A0DA 3C0LA 4XKMA 5EMJA 3TVAA 3DX5A 2QW5A 3C0SA 4J4KA 3OBEA 1A0EA 4YTSA 5B7YA 6XIMA 5B80A 1K77A 4XISA 2XINA 9XIAA 3AALA 1DE6A 1I60A 4ZBCA 1YX1A 2GYIA 3ITVA 3AYVA 2ZVRA 5AVHA 1XLCA 3ITLA 4QE5A 6XIAA 4A8LA 3KWSA 8XIAA 3QXBA
chains in the Genus database with same CATH superfamily
3NL5A 1FWJC 2Z6IA 1UKSA 4DO5A 2OELA 1PVNA 3NA8A 2YB1A 2X42A 3CO4A 3GO2A 4UTKA 4EWND 1E9LA 4QISA 2GVLA 1R9XA 1Y5XA 5CC6A 3WH8A 3RLHA 2Z00A 1OX4A 3WDJA 1F3XA 4TR9A 2OGJA 4LCSA 1DJNA 1XRFA 2B7QA 1TE6A 4N4PA 1UMLA 5BOFA 5DF0A 2F61A 1EIBA 3AMLA 4DO7A 3G24A 3LXBA 1Z69A 3RO8A 4AYSA 3H4WA 4UUIA 1MFUA 3WNNA 1XCFA 3B8DA 3L4WA 1IZCA 4A8RA 2DZSA 2VEGA 4GI9A 5AVNA 1I4NA 5A6BD 5M1TA 2POZA 4MB3A 5EPDA 2FH6A 3KCJA 3SY5A 4HIBA 1A5SA 5A5WA 4G7EA 2GGHA 5I3GA 3W1QA 2Q8XA 5A6TC 3GHSA 2GL5A 5G1YA 2WOQA 1XSJA 3XISA 2VEFA 3U2CA 3LEPA 3LRLA 5BCAA 2FZBA 2WZTA 4XBKA 3GDLA 1DJXA 3UGVA 1K02A 4A21A 4B2DD 2FKPA 4K1WA 2GVYA 4GQQA 1SJBA 3EMQA 1S5NA 2VUNA 1DJHA 2ZZ7A 1IXOA 2MNRA 3P93A 2E6YA 1IF2A 2OZ8A 2PDCA 3TONA 3LHUA 4NI8A 1XYAA 4CQCA 1O12A 1BGGA 3JW7A 1FWEC 4CKQA 4Z42C 2NVAA 4AIEA 2Y88A 1XPGA 4JHMA 3FOKA 4QG6A 4DZHA 1DEDA 1B5TA 3B4UA 2C79A 4YTTA 4EKJA 4Q22A 2WM1A 1M5WA 4HKPA 1R47A 3C8NA 5AYZA 1KRBC 1MVYA 3XIMA 3CEUA 3TQKA 2NQJA 5EMYA 1ITCA 2INFA 2JBMA 3H7VA 5LA2A 4DJDA 3DG6A 3EX2A 1J11A 2Y24A 1DIDA 4LCQA 2OYLA 1PTAA 5FA5A 1J2BA 2PDPA 1PL9A 1U1HA 3GG8A 2C1IA 1TPC1 3PJUA 4R33A 3M0ZA 2DW7A 1MXDA 3VZYA 2PDIA 3DDMA 4MNLA 1M6JA 3AHTA 2Z1XA 3DFHA 1NF0A 4DO6A 1S2CA 2GVJA 3MA8A 3JS3A 1OZMA 4IQEA 1DJQA 4CQDA 1A5CA 4Y2WA 2ZZ3A 1PWMA 1VP5A 2X2YA 4LH8A 3WUBA 1XYCA 5C9XA 2VQTA 3QGKC 3W2KA 1F6KA 4MJ2A 4PB3A 4ZXLA 4AISA 2Y8KA 4RLIA 4HA1A 4RDYA 5ENLA 3VGEA 3WK2A 1KBLA 2J6VA 2AGKA 2OLHA 3FCPA 3IGHX 1XC4A 3EWYA 4AX6A 2WJZA 3DFQA 2G3MA 2FQIA 3ABRA 3VX0A 5RUBA 1CGVA 1PDZA 4OJYA 3BURA 4LNCA 2FPVA 1TWIA 2R82A 3H21A 4HB7A 1V77A 4HPXA 4U28A 4TVCA 4O19A 4Y8FA 1G4PA 4A8NA 3W7DA 1E9ZB 4Q4RA 3ZWSA 4UQBA 1MUWA 5DMLA 4LYKA 2H3BA 4JTHA 4MPQA 1W3NA 3TWBA 2X1TA 1R7AA 1SO3A 3W73A 3UWQA 1EJSC 4HU0A 2DY3A 2C1HA 1AH4A 1UWRA 1WKYA 2VMFA 4GQ0A 4PMXA 1FA2A 4QDWA 4BEQA 3URAA 2ZA2A 3S2LA 2G96A 3UPMA 2Y61A 5DXYA 1MFVA 3G0XA 4J28A 2BOGX 2BMBA 2H9AA 5EY5A 5CCZA 1PKYA 1OK6A 5LIYX 3BTNA 4IMFA 4E4FA 4XKMA 3U4AA 3U57A 1UBPC 3TX9A 1UWUA 2WZMA 4ML9A 1T40A 4RE4A 2NSXA 2NWSA 3LCIA 2C1GA 4GKLA 4C1KA 3T0DA 5ABHA 4WCJA 4YYCA 3EMCA 4X2RA 1ISVA 1DE5A 2WWDA 3N25A 1UR9A 3FX4A 4JNZA 3EOSA 4GNVA 4LF2A 4HPJA 3CPRA 3M16A 1PYFA 4JFUA 5CG7A 4BCEA 4CNSA 1T0OA 3T78A 3EDDA 1IZJA 3CHFA 4IQDA 3F03K 3L4UA 3R7MA 3T07A 7ENLA 4EE9A 1BYDA 5A6BA 4OGZA 5A6KA 2GJNA 2D23A 3MVTA 4CVUA 3JU2A 2PURA 3QV7A 5REQA 1C8XA 2BWGA 4UNLA 4K8HA 1A5LC 5TBOA 3LXCA 3C52A 2WZEA 1RD5A 1UWTA 2I16A 1I2PA 1P48A 4HPHA 3WLLA 3W0KA 3N6JA 3CUXA 2I17A 1R38A 4GVFA 4TX6A 2ACQA 1FWDC 2OT1A 3QH2A 4BI5A 1XH2A 4MJZA 3UWEA 5B7ZA 1VFLA 1ZQ5A 1TTPA 2DVTA 1E6ZA 3T6CA 2QV4A 2BGSA 4Z2KA 3QVQA 5CSSA 4U2YA 3CXOA 2XTKA 2VO5A 4LEFA 4ZCWA 3KWSA 3T55A 4NZ5A 3VO0A 1BLIA 4RV8A 2ON3A 2RKXA 4NAEB 4V28A 1E3ZA 2WZHA 1S2AA 2X30A 3LPPA 2WHLA 1XWYA 3RRAA 3KBJA 2W91A 1UUOA 2YL6A 4Q8WA 4C6PA 4LXFA 3ZJ8A 4JEQA 3BK0A 3LQLA 4I7VA 1HX0A 4MHBA 2BS9A 4M82A 3I7QA 4LAUA 4IOTA 2BG5A 4IZGA 4CQBA 1PX3A 2J7HA 4UZUA 3PUDA 4BQ4A 3WQEA 2C3ZA 1A0CA 1O95A 1BAGA 1RXOB 2G0WA 3BV4A 1XBVA 1UWAA 1HIZA 1SR0A 4W89A 4REQB 3AJ7A 4JN7A 3U0HA 3MKKA 3CHDA 3GNNA 1MW2A 2W63A 1AW1A 1JGMA 1IT8A 3Q4DA 3BG3A 2XVPA 1VZWA 4HK6A 4PBGA 4MIMA 3MMWA 1U1JA 4I6KA 1G7VA 3BJSA 1UWQA 2D0GA 4GZ7A 1KKRA 4ZB2A 2DJLA 1Q6EA 1EBHA 4UTTA 3NQAA 3R10A 4FXSA 1SUXA 1JXJA 4HA4A 3V5OA 4PYSA 1U33A 3UCDA 5AZ0A 3W6LA 4ACZB 3TOYA 1TWWA 2DZWA 4YCPA 1CDGA 4K36A 2IPGA 3UYIA 2J9YA 5A69A 3W1AA 3V0SA 3NQ6A 3RLVA 3K8KA 3BLKA 4JTIA 4MLRA 2BY0A 3IJ7A 3R0KA 3NUKA 4L4MA 4AFYA 3RM4A 1PWLA 1UCWA 3DGRA 1NARA 3W7JA 1TJ0A 4DX3A 2HE5A 3CIVA 4IL0A 4MKNA 1UH3A 4NYUA 4DBWA 2HZGA 2I5QA 4AHPA 3KLKA 4PUWA 4ZSTA 3WK1A 1UD6A 4EK7A 4YVVA 3LMZA 1QOQA 3LCXA 5CZ0A 2Y6ZA 2GUBA 1OYAA 4TUFA 2CXEA 2J4GA 1G94A 2D73A 3A3XA 5DO8A 4L5ZA 4J5NA 1S5MA 1NFBA 4HN4A 1XR2A 1VFMA 3A21A 4HU8A 2Q02A 1FFRA 1VRXA 3HJEA 5KZ6A 1B1YA 2XVNA 3KS5A 3RFAA 1BQGA 3VCCA 4GQBA 2XH7A 2C91A 1SFSA 1J01A 5FOOA 3CPUA 3FKRA 5GJPA 5KSWA 5HQLA 3TN5A 3BLFA 1V3MA 3B40A 4WDWA 4PMUA 3QR1A 3AIRA 4ATLA 2VZUA 5E9AA 3F2DA 1E6XM 2E9BA 1X7IA 1OCBA 2OQLA 4DAIA 3S3GA 3BG5A 4G7EB 2OQYA 1R9YA 2WVTA 3MI3A 3RITA 4EWJA 4YL2A 2XVKA 4M1RA 1I0BA 4B5NA 3ZWTA 5FJOA 1U5VA 1I9CB 4TQTA 3VXGA 4HMEA 1F07A 1V3KA 3L7RA 4P7OA 1FRBA 2QAFA 3LCGA 1T99A 1TTJA 3F5JA 3ARSA 8TIMA 1MEHA 2H8ZA 1P0BA 4MWAD 3E0LA 3C56A 1UA7A 3TYUA 3A13A 4RW3A 1FDJA 5FJJA 1KM1A 4UOJA 5I06A 3T4CA 3N2TA 1CXFA 2FTPA 3TNOA 3ORWA 3GS6A 3PFMA 4FK9A 3CUFA 1SJCA 4RE3A 3WQ8A 5CSRA 4WOQA 3WO8A 3W7IA 4FOKA 3CZKA 2V3EA 1QO5A 1H41A 5IOBA 5JH1A 5LHFA 2VRJA 1NWRA 3W4RA 1NM9A 3VKJA 2PDXA 1LG2A 5C70A 3CHEA 5DRCA 4M7TA 4E8CA 1EHNA 3CAVA 3V1HA 1K77A 1B9ZA 3S83A 1CGTA 2BODX 1UW9A 2XIJA 4S3FA 3ABZA 1GVFA 2QHAA 3KVMA 3EBVA 2QGYA 4Y9AA 3ITOA 4CNPA 2DVUA 3VNDA 2Y7EA 5FI8A 3GY1A 1KXHA 1ZU8A 4TU1A 2XJ7A 3ZVHA 4L7ZA 2DSKA 2JF6A 1F4AA 1GKPA 3IUDA 4QXIA 2ATSA 3V5CA 5JMUA 1KFBA 2QXWA 2GJPA 4XVEA 1BGAA 3EEZA 1K9TA 2AAAA 2IKJA 4PL2A 2PP0A 2OU4A 4C6BA 3PBVA 2P8CA 4DWSD 2CWNA 1KLZA 1XFBA 2AMXA 1VBUA 3REQA 4XIMA 5EU9A 4S3EA 5BRBA 2F84A 3BMWA 4ZTXA 3MUAA 2ZBTA 1TQXA 3S9ZA 3UR2A 3BMVA 2PODA 1ME7A 4DXKA 1XIEA 2OZ0A 1UPMB 4C6QA 1R5YA 1GKQA 4HA0A 3ECQA 4F2TA 1ZBVA 3WK3A 1QHZA 1XF0A 1JUEA 2HQAA 2FGZA 3IVUA 3BE7A 4WJXA 3W2NA 1BKSA 4S3KA 4UQDA 3G5EA 3RHGA 3M6YA 2X1SA 2VCBA 1HO1A 1V6VA 2BVYA 2WKGA 2FTYA 2PGFA 2EHHA 3ARPA 1F6PA 3MO7A 3TMQA 5E6ZA 1EZ2A 1UWIA 2WSRA 4MPKA 2PWUA 4ZR8A 5I3JA 3LCHA 1Q63A 3NO3A 2QF8A 2OODA 5M03A 2QCHA 5I0DA 4JN6A 1GQNA 3MDWA 1JFHA 3KWXA 4M6VA 2EJ1A 5LIKX 3BQ5A 1WKEA 1R3TA 1K4HA 1LLWA 3VNYA 4U4MA 1S38A 1VBRA 4OU1A 1XLBA 4JIHA 2QJJA 4NVTA 1TTQA 5D32A 2DFAA 4JKMA 4MLJA 1E9IA 2UZ9A 3GSMA 3QQ0A 4XZMX 2A3BA 3APTA 1SW7A 4MFEA 3OBAA 3RLGA 2WQPA 4L1WA 1QJWA 4LPCA 3TN3A 3ABSA 2CIPA 2J88A 1T7LA 4I8YA 4QX4A 2G97A 2YL9A 3LA4A 3WJZA 4KEZA 1ISYA 3OHIA 3SO7A 3TOPA 3O6YX 3MWCA 5D4YA 2VXNA 3QJAA 2OSWA 3FIGA 3NZ1A 5HPCA 3GKAA 1QI2A 1QNOA 2VR2A 3EX1A 2XYLA 4K8EA 5AVHA 1KQYA 5GNZA 3S2MA 4MGGA 1NWTA 3W2UA 4OECA 5DANA 2C8NA 2R1KA 1G6CA 3L4XA 2XPKA 2ZC8A 4NZ1A 1L6SA 1DXFA 2Y8VA 3U2EA 1BG4A 4GO8A 3XINA 1EF2A 1Z32X 2QAPA 1WAUA 4XAPA 2HRWA 4ORIA 4WDXA 2GOKA 3MPGA 4NP7A 4C1NA 3M0YA 3WF2A 3WQCA 3ITGA 4O13A 1P0DA 3OVGA 5BZAA 5CJ5A 4MSSA 2NV2A 3HO8A 4MM1A 1WB0A 4P7NA 2WPGA 1A3HA 2A21A 2WWCA 3G1HA 4WRHA 1ISXA 1OADA 1R3WA 1FHUA 4P8VA 5LNWA 3W24A 1E0WA 4CLMA 1S5WA 2ZX7A 4JKLA 4X0VA 4JNMA 3W85A 4D72A 1GJPA 2WHKA 3F5KA 1EX5A 4JTCA 4HD5A 1UUQA 4H9ZA 1MW3A 4KRUA 4TV6A 5EGRA 3QC3A 1XGDA 3SCTA 2J24A 3P5YA 4BWLA 3WF4A 3PTMA 3ANUA 3GAKA 4PTDA 3CLMA 2VD9A 4DHGA 3C86A 4BHYA 1SYTA 1F7BA 1O68A 2ZOXA 3WDIA 3AS3A 3TZNA 3I7RA 4OZOA 2NVCA 3V4BA 1W56A 5EYWA 1CB2A 2D2GA 4NZJA 2Y0FA 5FF0A 1YRRA 4PN2A 4KRZA 2ZKMX 3TQ0A 4JFTA 5AC7A 2PDBA 4ACYA 1IGSA 1R3VA 5AECA 4WZHA 4W85A 4HVXA 1GCYA 1PS9A 5GNXA 1XISA 4HCDA 1NELA 4ERIA 1K8XA 3RAOA 4Q8QA 2OO0A 1J2WA 1SZFA 3CV1A 2E6AA 3ABXA 4YLWA 3AXHA 1S3HA 3V0TA 3QBUA 4Q8NA 3EWWA 2PTXA 3BZGA 4B3KA 2WO5A 1TWSA 1UH4A 3DFYA 1LWJA 2E8YA 3ATYA 3TC7A 3LZ3A 1QNSA 5LXXA 5FF3A 3FNDA 5BU9A 3ZSSA 5FL1A 1YXCA 1QXLA 3VNLA 3K8MA 4MZ8A 1THFD 3A22A 4GKTA 3HMCA 1CGUA 4JIEA 1M68A 1D3CA 2HS8A 2VURA 1YNPA 2VFHA 3B9OA 4WKHA 3G6LA 2DZXA 3W7GA 3WBWA 3AO0A 3TKFA 2CLIA 4I9JA 2EPNA 4G1NA 4PA8A 1GEHA 1PSCA 3PWAA 4OTKA 3MYOA 4PUDA 2VC9A 3S2CA 4ZFMA 1F74A 5G1MA 1WZMA 1YADA 4K6AA 3TR9A 4AZIA 3TJLA 3WQDA 1F61A 1EPVA 3BCDA 1OD0A 1ZJIA 4N4QA 3R8GA 3FA3A 3C61A 1JXKA 3UNDA 3VK5A 3PY2A 2PDKA 1EPXA 5J5DA 3CQHA 2ZVIA 3N73A 1Q4WA 4O14A 1GPWA 5FIPA 3STPA 4ATWA 1FH7A 3NSNA 5AHFA 2HNHA 1NP0A 1EGVA 3H54A 4PCSA 3VKDA 3AC0A 3P8IA 1EUNA 1I2RA 1Q3NA 1K6WA 3VYLA 1EEXA 1J4EA 1EKOA 2V2CA 1H5VA 1JF6A 3H2NA 1YHTA 2KZHA 4LTSA 1UZ4A 1K3UA 3WF0A 4WXZA 5CKSA 4BJHA 3OZOA 1JYWA 2RH9A 1MMFA 4H6EA 3FJ4A 5BXRA 1TR9A 4S38A 3N2MA 3BAYA 1P43A 3LPOA 4LS2A 3VDAA 1AQHA 1J10A 4PODA 4YMZA 2W6RA 3LPGA 3R25A 4JQ2A 1OC6A 3E2RA 5A6AA 1B3WA 5DT7A 4Z2LA 3LUTA 3SGUA 3IRDA 3KDNA 1UZDA 1DPMA 2WANA 4RR4A 5I78A 1GOKA 3W1XA 3DYOA 1D3HA 1VBJA 1EO5A 4KEMA 3CGTA 4UFKA 3W3OA 3BL3A 5F4WA 3R79A 3IAQA 3MV11 4JTRA 1FCUA 3GDRA 1F4HA 2V5DA 3KZPA 4XG1A 4IUGA 4CQ9A 3I4EA 1XUZA 1GVQA 2DT1A 4PMJA 1QOPA 1LT7A 2NT1A 1D8WA 4EX4A 3GDKA 1E51A 4MMWA 1ODUA 2X0YA 4W86A 4P61A 1WX0A 2VX7A 3EOUA 1LL7A 3SUWA 1YNQA 2ZX5A 3W1PA 4XO6A 5KTLA 3GDMA 5E9XA 3V1PA 2X1UA 2WJDA 2V5CA 1JPMA 1XIFA 1IEQA 1US0A 4D8LA 1K9FA 2O9RA 1ICPA 4WLCA 4DM1A 2GZXA 4XBSA 2PDUA 1XPYA 3RXZA 3W75A 4NUWA 1I6NA 4N9BA 1YTDA 4EXBA 1TTIA 2ZRXA 4UC5A 2W66A 3ANYA 1QW9A 4IX0A 3UNTA 3C0JA 4AIUA 2Q71A 1IXQA 1BXCA 1V6TA 3R11A 2GDVA 2FJKA 4BI7A 2QDGA 2GPTA 3AAMA 3C3UA 5A95A 1TMQA 1LRNA 2C16A 1TKKA 2EKGA 4YTQA 4GCXA 3C6CA 2CCRA 4C91A 1EJVC 1A0EA 4AZGA 1CT5A 4ADSA 3IVSA 5K9CA 3CH0A 2XN1A 1K8ZA 3KOYA 1KCZA 4XAFA 4W8LA 4ZQOA 4QCFA 4DPQA 5C9ZA 3ZFHA 2GSEA 3N17A 3OIHA 3QHNA 1QCWA 3MP4A 2WHMA 4P8WA 3UXKA 1O5KA 3W23A 1G69A 1LL6A 3BLEA 2VFFA 4WJ8A 1KTCA 2R14A 3RMJA 1ZRQA 2VL4A 3CAQA 2QJNA 2XSAA 4UOQA 4UR8A 1QFEA 4ADTA 2F7FA 1QW8A 3TN6A 2YL8A 4HHHA 2FHFA 4MKSA 3CC1A 4HGXA 3NJ3A 2NSOA 1OINA 1TE1A 1ONEA 1WO2A 1DVJA 1EWDA 1Q2SA 2ZUMA 4WK9A 2YCEA 1O1ZA 2ZQ0A 2J8TA 3HTWA 4TV5A 3N9KA 2WMFA 2PDHA 2UY5A 2QCFA 3C3NA 4KCTA 3D46A 1IT0A 3M64A 4RNJA 4JZ5A 5EB8A 1ZP4A 1GZGA 2WMIA 3R8RA 1L6WA 1KA9F 4AEEA 3CO8A 3PBMA 3CLWA 3OIXA 3EX4A 3EAUA 2RHGA 1VYSX 3IV3A 2HK1A 4LAKA 4LYQA 1TIMA 5HWMA 3G1DA 3GTFA 2PU1A 2VEPA 4D1IA 3B8UA 2G4FA 3KM8A 1FWAC 3PBYA 3CHVA 3GXPA 2GWNA 2J25A 3D3AA 4IQLA 3H26A 3BLPX 3EXTA 1XP3A 3E12A 2Q3OA 4A2SA 4HJFA 1W9UA 5E1QA 3AU6A 2XVGA 4JIPA 4WQ6A 2QCNA 4M6QA 2YGYA 1XSIA 3CS2A 1H51A 1LLOA 2E09A 4O0QA 3M0IA 4DJFC 3CZJA 4UQ9A 8XIMA 4JTLA 1GJUA 3BOLA 2CNCA 4UQAA 1YDYA 3CQIA 2REQA 3DEQA 3GBEA 1YLVA 1YPXA 1VH7A 2VDIA 3WNKA 1H5YA 4JBRA 1MNZA 1DKWA 1KRCC 1NQKA 2JKEA 2QMJA 4LUTB 7REQA 1JDCA 1JCTA 3TIMA 3RJXA 2XDFA 3GTHA 2ZZ6A 3MT1A 1HT6A 2J9ZA 3T40A 1OJXA 3UWYA 4CCDA 5C7VA 1GTEA 4ZENA 3PJWA 1Y0EA 4MFDA 3CL7A 3M5YA 4NG3A 5GJMA 3LZ5A 2QPSA 3MP5A 2Q8LA 2V82A 3BSMA 3JZUA 5CLTA 4KGLA 5EBAA 3UJ2A 1L2UA 4FOUA 2OKOA 1ZFJA 4X2PA 2YZRA 4FI4A 3B9AA 2D3NA 4L4PA 1X6LA 2E9LA 4J4KA 3VD4A 1I60A 1X6UA 1TVNA 3P3BA 1F3WA 3BH4A 1KBBA 2OQHA 2NLYA 2ZZ5A 1NWUA 5AHNA 2Z0IA 2GDQA 4FIRA 5G1TA 1EC9A 4MWAC 5FJIA 3LHZA 4F4RA 4HK5A 3SCVA 3EWDA 3HGJA 5HNNA 3MMTA 1V79A 1AQ0A 3E5BA 4XBJA 4NILA 3VD7A 3R6IA 2XISA 3AIVA 1UMYA 4HHLA 1N8WA 3INPA 3KHDA 1F05A 3ZT5A 1L2QA 2WJEA 1WXZA 1UKOA 2A1YA 3W87A 3MI6A 2FVLA 4IIDA 1JVNA 4IISA 1PZ1A 3W07A 4H8HA 3GZ3A 3G1FA 1UD5A 4E2OA 1VIWA 2Z2AA 4H00A 5C0QA 4KCUA 3STCA 3MUXA 4LX4A 1ZHAA 3WSUA 3MJMA 1UIPA 3T0CA 2G41A 2TODA 1RAKA 1GZ1A 1HJSA 5I24A 1E55A 4UFLA 3AIQA 2V5BA 1E6QM 3OW1A 5D05A 1RUSA 2CYGA 2WZIA 3WD1A 3VNZA 5JQ9A 2P53A 1HP5A 3N9SA 3QYQA 2H6RA 4HOXA 4LALA 3AU2A 4V2XA 4AZ5A 4PMRA 3WLRA 1SZRA 5K3VA 2QUMA 5HULA 4Q4OA 3AXXA 3KE0A 5D2YA 1US3A 1W9DM 3DKLA 4YTSA 5TQLA 5KZDA 1DL3A 3QRHA 2XGZA 3O2LA 3RU6A 3ITLA 2ATMA 4UR7A 2BZNA 1E71M 5CJNA 1XKJA 3DHFA 3G8EA 3KDOA 4PUMA 1FHLA 3POHA 1OGSA 1G0CA 3CYVA 3HV8A 1UBSA 3VDHA 3KP1A 3GE7A 1HKIA 3NQ7A 3IK4A 4UTFA 4ZOCA 4NYYA 1UPPA 3UWWA 2VRQA 3IPWA 4L64A 1RP8A 2FPYA 4EIVA 3NYZA 3WJWA 2PB1A 4DUXA 2PF8A 5DMYA 3W38A 5C6MA 4FSAA 2QT3A 2VEIA 2Z7KA 3ZYZA 2VYOA 3W6MA 4PMNA 3NQBA 3L2MA 1CENA 1TQJA 4YYFA 4HU4A 1EL3A 1IIHA 3LB0A 3P74A 2PP1A 3CB3A 2E5CA 4H9XA 3DGBA 3DG3A 3WH5A 4XZHA 2BVTA 4JIIX 1E4MM 2F9RA 3EA1A 3EPOA 4CD7A 5GQBA 2A3CA 4K1GA 3F1QA 1LORA 4ZO6A 1MDLA 2OEJA 4HTYA 2Q3RA 4FLRA 3U6WA 5EFFA 3ZQ9A 2BVDA 4G7FA 2ZX9A 1B4KA 5E93A 4DWSA 4QSHA 2WC7A 1H7PA 2DZVA 4O50A 4K39A 4RE0A 1RA5A 2ZE3A 5H8UA 4AUBA 3WLPA 1L6YA 4W7WA 5B7YA 2IS7A 1S5TA 4IX2A 2PMQA 4W7VA 5C9UA 3GUGA 5M3WA 5DCEA 3GW0A 4AZ6A 1XLCA 4B4HA 4IGMA 2X16A 1C9DA 3CIWA 2DZTA 1GVEA 3U7BA 4LB3A 3WF1A 2FGBA 4Z0JA 1K4GA 2OR2A 1RQHA 1FP9A 2D0FA 4M6PA 4NZCA 4IPNB 1J93A 1B90A 1GQJA 2J66A 3BGJA 4GJIA 2WMJA 3SCNA 2O4QA 4LBSA 5ABFB 1G67A 2HJPA 3ZS4A 1FHDA 4L6OA 3ZM8A 3C2VA 2HXUA 3GZAA 3M7SA 2DH3A 4G9PA 5HQMA 3Q94A 4OFCA 1W3IA 1GOOA 1FWGC 3VZZA 2BHUA 2PWGA 3TQVA 5D2XA 1IR2A 1YBQA 4QSFA 2VCCA 1PIFA 3LCFA 4PRRA 3IIZA 2ZUNA 4LY4A 1TVPA 2GFTA 1E6SM 2OGYA 4PMDA 3H4GA 1X6NA 4CD8A 1FCVA 1GWJA 5EMJA 4F8XA 1TPFA 1BF6A 3BSHA 3WQ4A 4LBRA 2C13A 1XD0A 2QV5A 4PB4A 1UD2A 3SB0A 4DYKA 4A8LA 3QXBA 3GYCA 3WJSA 4K7VA 4N42A 3OLIA 3K4DA 4ZODA 3RG6A 2I5IA 3GVRA 1X39A 3O16A 3WQPA 2JK2A 3G3DA 2VZTA 1MEIA 3N11A 2Q01A 3SECA 1M9HA 1BEUA 3AIBA 1ZGDA 3A12A 4E8DA 1VKFA 2C0HA 4R53A 3WKZA 3RLUA 3NYDA 3ZMRA 4H83A 5CBIA 4K68A 4H9TA 4PTMA 4FNSA 4NAFB 4XB3A 1F8MA 3MDUA 1JDAA 3LK6A 3UCQA 2I57A 3SZ8A 2QCDB 3NQEA 4AC7C 3GG0A 4DO4A 1OFPA 2YL5A 1DHPA 1O1HA 5LA0A 1E6PA 4HMNA 3SQLA 9RUBA 1G01A 3V75A 2ZZ1A 5XINA 3KX6A 3S6OA 1RZMA 2SFPA 1C3FA 3GVQA 1W2PA 3VUPA 2C0AA 1HFBA 3FLUA 1VRDA 3IIXA 3LI0A 2J8GA 3CZ8A 1GHRA 2NQZA 1PB0A 3ERPA 2WVVA 1XRSA 3EKZA 3UA4A 2CZFA 3PF3A 4L4OA 3STFA 1NOUA 2GQ9A 4AX7A 2WKJA 1TA3B 4N6EA 5KZEA 4JY9A 1VIZA 4YN5A 4F2UA 4N0RA 3OZPA 4QE5A 4GYPC 4MG4A 4DWSC 2KX9A 2AQOA 3ES7A 3WFZA 1GYNA 4M3PA 3DECA 4W4QA 3CZLA 1P7TA 5D2TA 3I3DA 2YFNA 4FNTA 1HP4A 1W8SA 3LM7A 4KWSA 3QPZA 2A7PA 8A3HA 3S0CA 3HG5A 1NFPA 3L66A 3UF9A 1EYWA 3UZWA 1ZP3A 2FGLA 4WY0A 1PTDA 1ONRA 2X05A 5H91A 4PMOA 2TSYA 1Q8JA 4FOJA 1BRLA 5A6JA 3KBNA 3H2OA 1OFAA 2OG9A 4YPJA 2FTWA 1TSIA 4LVDA 2P5NA 2J27A 3P62A 3TWAA 1UIOA 5MHBA 5CJMA 3W1UA 3PZOA 5IHSA 4C65A 4QQ3A 3MUCA 1NAL1 2DPEA 4QIUA 2ABBA 1GVOA 1RCXB 4DBDA 4G56A 5FCZA 4C6KA 1XLIA 1WQ5A 3RMEA 5I3DA 1MRQA 1KR1A 3H8AA 3PPGA 1YDVA 3UD6A 3ZR4A 2J9XA 3BDKA 3QKEA 4URIA 4CD4A 4B2DA 4Z1YA 1CXIA 4CQ8A 1KO0A 2BX7A 2DDXA 4IGNA 1WP6A 5HANA 5D02A 4LT9A 3G1XA 2BSLA 3TW7A 3A24A 4XISA 3WLIA 3RIKA 4IP5A 3GH5A 4S23A 2DIEA 5ECVA 3WFLA 4A4AA 1TPWA 4J3UA 3ZVIA 3WN6A 4YHGA 3A9IA 1JULA 2PLJA 4W84A 5J5RA 4B4FA 3IIOA 1JRCA 4O1EA 2QPXA 2CHNA 5D09A 4D8ZA 1PAMA 3ZR5A 3CUGA 2WVUA 2PTWA 2H9AB 4GVHA 1JR1A 2NX1A 3LRKA 3O7UA 3A9BA 4JX6A 2YXGA 2AL2B 3WELA 4EPKA 1Q6LA 3N2XA 1C29A 3BG9A 2GVGA 4GYJA 2E5DA 4AD3A 3ZJKA 3E0FA 1XH0A 3R0UA 5F4XA 1OCNA 1UR8A 4G5DA 1JGIA 2IPJA 1NVMA 3RGTA 5F2IA 2VDGA 2GWGA 4Q4QA 3OOQA 2Z25A 3QSRA 4OE7A 1OT2A 3QY8A 2Y4SA 3L5MA 4HHMA 4DBUA 1WDQA 3HV9A 1JUBA 4S3AA 4C6NA 2PWFA 1U83A 2FMOA 5D30A 2PLCA 3GBDA 3TVAA 3T0AA 1SO4A 1I8JA 3AIUA 4LVBA 6REQB 3JZEA 3LENA 3L4YA 2AKZA 1N8FA 3NOYA 2Y8UA 3AS1A 1PO9A 1A4LA 1TZZA 3QEZA 1YIXA 3LBCA 1TRIA 1AL8A 5AY7A 1C8QA 3F4NA 3GXIA 4D71A 4BK9A 2VTFA 2TRSA 2Z6JA 3RCMA 1R9ZA 3KW3A 2HNEA 1A5MC 2GOUA 5CXPA 4CU8A 1RJQA 5DXXA 5D38A 3PPHA 5CPQA 1R3QA 4YCOA 4N9DA 4MAZA 1KD0A 3GXMA 3MCMA 1TJ1A 3QLLA 3CIXA 2J75A 3SCRA 2VNCA 1XDJA 2EF9A 1R0MA 3W2LA 2QCGA 1F5ZA 1MNSA 3KTSA 1HL8A 2IXUA 2D20A 2R94A 5IHRA 3GB6A 1O94A 1A3XA 4HPGA 4B5WA 3KOWA 3N6QA 4AVNA 4DXVA 4RXFA 1FWRA 4DLFA 1LQ2A 1FKXA 3NQ2A 1V4YA 3VM7A 1W5QA 3VIGA 4F40A 1VBGA 4BS0A 4GVIA 1KFWA 1NU5A 3QN3A 3GU1A 5ABEA 3MMDA 1FP8A 2QW5A 4N2YA 2XGBA 2PF0A 2CLPA 1MWOA 2FHCA 4UMBA 4HBKA 4H7ZA 4X9YA 1IWPA 4PGLA 5C2GA 3QY6A 2DQXA 4WJEA 1VBHA 1RBLA 3QGAC 4XZLX 3PZNA 3LN3A 5LHEA 1IZKA 1DJYA 1W3TA 2B7PA 1W0MA 1PCKA 3AJXA 4REQA 1TWZA 2DIJA 1XIHA 2WNZA 3N04A 5DFAA 3SCOA 3THCA 3W7QA 4F0LA 3MHFA 1EP1A 4AZCA 3T9PA 1Q8AA 3GX9A 2PWVA 4GUIA 3BCJA 1VGAA 4IL2A 3OLGA 3U3HA 3GYEA 4QLJA 4LOCA 1H49A 3MMUA 3EB3A 3H7RA 1EYEA 1XIGA 5IDZA 1PKNA 4FXJA 4MF4A 2XGIA 1A5AA 2EPHA 1TJ2A 1K70A 1O60A 4HN8A 5JXQA 2YSWA 1UB3A 3KS6A 3M43A 4JS3A 5I3IA 4JFWA 2Y70A 2NUXA 3W72A 1XL9A 3SUTA 4QBXA 4EXQA 4YWIA 3I10A 4NJHA 3L4ZA 5FEXA 4QAIA 2Z24A 4X22A 2Z1KA 3U7VA 4GABA 2HE8A 3KOXA 2V63A 3DFOA 5HDRA 4FR1A 4KBXA 4GJJA 3ONBA 4JICA 1Q2RA 1E5NA 5I79A 1C91A 1YNYA 3DI0A 4UTHA 1HW6A 4HQVA 4AWSA 3TSBA 2H8XA 1KFJA 2XINA 2WYSA 3M7WA 3ARRA 1UKPA 3W2MA 4GH1A 1K7EA 5AN7A 3GU9A 4DUWA 3APYA 5LNSA 2PAJA 2FZ8A 1KQZA 4IICA 1OG0A 4LUSA 3LS9A 4E38A 5LIWX 4OUIA 3EB2A 2XWEA 2QS8A 3T09A 3UZ5A 1B54A 3DKJA 3L21A 1HGWA 4GYPA 3PUEA 2AMGA 5DT5A 2D1ZA 4DF0A 4FXFA 1JQXA 1Q7QA 1WOBA 4H01A 2YYTA 1GQKA 1RSCA 1DJIA 3CM4A 1XLGA 4NF7A 2DP3A 5FF4A 3GHRA 2DSVA 4O10A 2FB3A 1XV8A 1XQKA 1C7TA 3GD6A 2DZBA 1XYFA 3NO5A 6ALDA 3GW3A 3QV8A 4OOUA 5CZJA 4HJWA 3OZMA 3TYBA 3W86A 1RQEA 4LUYA 4FS9A 3MZNA 2XN2A 4LFYA 3GXNA 1TPH1 2Z7GA 5FL0A 1ODZA 3MUZ1 3NXFA 3O6DA 1EJWC 1Q13A 2WK2A 1K8CA 1Q6OA 1MRAA 2E0PA 3BICA 3LV5A 3UPWA 3NSXA 1VFFA 1EHAA 4RX0A 4HOZA 3CV6A 3L12A 3K13A 4H41A 1H0IA 3NZQA 3SRFA 4OHQA 5CPSA 5HUPA 2PZ0A 1XQLA 4GA8A 5LNVA 1N55A 1NEYA 3PJXA 3W7HA 3M46A 4CN1A 4JTQA 4AWTA 4IUOA 3RRXA 3MY9A 4DJED 4EPBC 4FO4A 3VIJA 1MZRA 1K7XA 3AROA 1YTKA 4HNOA 1XLFA 3SCWA 2WV8A 3MB9A 4XD5A 4BWLC 4ONVA 3PNZA 3C2RA 1KV5A 4MJMA 3NPWA 5DEZA 3O9NA 1TV3A 2FPTA 4EF9A 4WF7A 2EBNA 3TYAA 3II1A 1GTHA 1E56A 2RUSA 3CAKA 4JYFA 4GOAA 4H7CA 2HWGA 2YPIA 5BW6A 1GK8A 1QPRA 4KW2A 1TIWA 3OU8A 3VMPA 4POCA 2OWCA 3UU0A 1ONXA 5E0KA 2BGNE 2QUNA 3AWNA 2FFCA 3CUIA 4EAMA 2RDUA 1H7WA 2MUCA 1Z42A 2RAGA 1M7JA 1E70M 2VGFA 1EJXC 2E1WA 2J77A 2WBKA 3HMJG 4JHZA 4I9TA 3B9EA 2J74A 3S1GA 1JEZA 3DENA 1ZAJA 3CT2A 5EBUA 2A3EA 1OX5A 3UG3A 3Q45A 4KESA 5CBBA 1W1YA 3PPFA 3IRSA 1K7FA 2A3HA 3MCNA 3PZIA 3TUUA 2WXDM 3BLIA 3MV01 1IE7C 4GBDA 1P1MA 5H1WA 3WMSA 4B90A 3GXDA 3PUGA 2AKMA 1FCQA 3OYXA 4D6EA 4KERA 5LIUX 4FF7A 3W83A 4DZAA 2I1OA 3IARA 4D6HA 2PLKA 1B3ZA 1EC8A 4WGXA 2VC5A 1KV8A 4P7QA 5I77A 1WUFA 3NIYA 1KLYA 3QZEA 2EO7A 1NDYA 2A4AA 2YYUA 2HMCA 1H50A 4AD1A 4TMCA 3EZ4A 1X96A 3BW4A 1KFEA 4UFMA 4AD0A 4CGTA 3AWOA 1PCWA 5FJTA 4EACA 3VOCA 1JAEA 1F6YA 4LB4A 1IT7A 5HA7A 4A2RA 1JYXA 3JR2A 3SR7A 1TV7A 2REQB 1T96A 4QAWA 4TTGA 3ABOA 4JD4A 3RF9A 4AIOA 5HUOA 4R9OA 1AZ2A 4RJEA 1IEXA 1P5BA 2VGBA 3BPWA 5C8BB 3E1F1 1TPVA 4WSKA 4ZL1A 5HNUA 4RZ6A 3N6HA 3IJ8A 1ITXA 1E1FA 2FZMA 4NL1A 1F9CA 3UCCA 6REQA 2G37A 4NNAA 1BPLB 5CC7A 5MF5A 4PBFA 4MYAA 1CLVA 2F6KA 4O11A 3FAWA 3JVAA 3NOEA 2QJHA 4OOZA 1ADOA 1PX4A 1XIJA 1EXBA 3WNPA 3VIMA 1QATA 4MNJA 5DMMA 3UR8A 1LUCB 4IIHA 3G8RA 1T5AA 1KBKA 3RX2A 2PZNA 4UTWC 3TQPA 3FK4A 3S5ZA 2ASHA 3WD3A 4NNBA 2P8BA 1HKJA 1CECA 1QNQA 2VVNA 2Q8ZA 1CGYA 4O18A 1NDWA 4YVPA 2YCLB 4MZYA 4BQ5A 3LQGA 5BMXA 3AYRA 1PZ2A 3B8IA 4WEVX 1DHKA 3GKFA 1SQ7A 1WDSA 1B3YA 3MSRA 2QPUA 1KCKA 3TK7A 1Z89A 2DUXA 4XUGA 4RDWA 1WDDA 3C0SA 4RZ5A 4RNIA 4W93A 3TROA 1R3YA 4F0SA 4J2MA 1NF7A 3SM0A 4B15A 3VCNA 5GVJA 2V3DA 3G1RA 4UTLA 4GY0A 1LG1A 4KIEA 5BXSA 2Z28A 1G5AA 4NNCA 3W70A 1KXQA 1MXSA 3K2GA 3FS2A 3STGA 2QUVA 3TMLA 1CNVA 3CQ0A 2Z1SA 1QT1A 5BYWA 4JR5A 3AMKA 5ECUA 3NDOA 1YBQB 3BOFA 3HGOA 4L6HA 4ZTYA 3KZSA 4A3RA 1AJZA 2D2OA 2DEPA 4E3VA 1X1ZA 2QJGA 3ARWA 3WK0A 4DQWA 4CNUA 4H9YA 4H8UA 3RDKA 3EB4A 3KCOA 2ZIDA 1REQA 2XG9A 1YE6A 5HNTA 1OF6A 1LYXA 2Y7GA 3RNDA 1XYBA 4MY1A 3GTXA 2BV9A 1PZ3A 2ZFAA 5SWUA 1POJA 1P6CA 2NQHA 3FJ6A 4JQ4A 1BRLB 2E4TA 1JZ6A 3O05A 3IGXA 2VHLA 3NNTA 1OY0A 3BOXA 1W3LA 2UY3A 3BAWA 1E0UA 4EANA 4IHCA 1RK5A 3PZUA 2P1FA 4F48A 2A6LA 4IFKB 3G2GA 5DX7A 3PULA 1J8VA 4JOMA 4GWEA 5TF0A 6PTDA 3M41A 4AAJA 3ITCA 4DJDC 3AIEA 2DT2A 1ZBCA 2WHJA 1OVDA 3SW6A 3M07A 3W7MA 3QHOA 2XVLA 4PUEA 1SO5A 2CC0A 2PGWA 3AZRA 1OABA 3TSDA 3MBDA 3W9ZA 2ONEA 4PTNA 3BVJA 4MNKA 2ODOA 3FA5A 5D8WA 1SZNA 3DHDA 2A7NA 1XBZA 1UR4A 1RPXA 2WNNA 1ZBKA 3M5ZA 4X63A 1OFEA 5HJYA 2E3ZA 2Z29A 3M4HA 1LQAA 3U5YA 1TCDA 1SW3A 5AHIA 1GOMA 3UA3A 2FJUB 1AD4A 1V08A 4JQ1A 3ENLA 1JF5A 1EX1A 1IQ8A 5KITA 2YCJA 5DBTA 1MI3A 3VNKA 1JUKA 5AB3A 5AFDA 5CZSA 2CBUA 4WGHA 2DSUA 5H8MA 3WLQA 5K2ZA 3O1NA 3BWWA 3BGGA 4HNVA 3MKCA 4WUIA 4U5KA 3LOTA 2P50A 2WAGA 1QDSA 2B4GA 2GQAA 4XSLA 3AXKA 1US2A 1D2KA 3G3MA 3W22A 4R7OA 1QASA 4H9UA 1LBMA 3FW6A 2GGJA 4JL1A 3UPBA 1YX1A 4C5YA 1VHNA 4E0CA 1E6RA 4AD5A 3VZXA 1BQCA 4MDOA 3GR4A 3CZGA 5C2CA 1HKKA 2NV9A 3URBA 2YOCA 2WC4A 1X8FA 1M65A 1OGGA 1H60A 2L5HA 3SJNA 5FAGA 5MKGA 1OFDA 2KAUC 2O7QA 4MOZA 1ZAIA 4S2CA 2FYMA 2HV5A 5AHMA 4JTTA 2V9DA 4DF2A 4EF8A 4DI9A 3TEVA 4IIBA 2XIBA 4LAZA 4FZIA 3OGSA 1H7XA 5CAKA 1DWAM 2WCAA 5CSUA 3L23A 3UJEA 4E6MA 2XM2A 3AQUA 1O7AA 1XDLA 2TMDA 1UP3A 4NXKA 3WZ0E 1C93A 4LS0A 3AYTA 4U5IA 3A3HA 4GPNA 4US5A 1W1PA 4DJFD 1JZ8A 2Z2BA 2UV8G 1QPKA 3LTYA 3IJ6A 1F76A 4DNMA 3N3TA 1T8QA 3P2VA 4OT7A 3FVDA 4GY1A 5LSMA 1XXXA 2GQ8A 4FR6A 5A2BA 3R2GA 1FY6A 4L1XA 4XZBA 2NX3A 1Q85A 1KCXA 3KHJA 5CGMA 3GHTA 2OLSA 4QHRA 3SGZA 3PB2A 1QNVA 2YCIX 3WMCA 1X7FA 3QY7A 1WZKA 9XIMA 5K7JA 5D9OA 4O8AA 1UKTA 1VFOA 4ZFCA 1ITUA 4NZ3A 3USZA 4HNUA 3S5YA 3NL3A 4L80A 4QGCA 3BJFA 2VKZG 1VCGA 1YXDA 3H4XA 4ACZA 3W7NA 3LNPA 3SJ3A 4D6FA 3S1WA 3VNMA 5I00A 2BOFX 3N12A 2AAMA 2DUZA 3UERA 2WNQA 4OV4A 3WQ5A 1TYGA 3OVQA 1PBGA 4EPDC 3UESA 2E7FA 2J47A 4YTRA 2A5HA 3T2PA 1N7KA 4ZOBA 4HZ8A 3TA9A 4Y7EA 2P3EA 1EEPA 1XLEA 3JRKA 1P4CA 1VENA 4IWWA 3I6TA 2JGQA 2CZ5A 2J78A 4CEXC 4CN6A 1N2VA 2ABAA 2PBGA 4ZQNA 1ZY9A 1O5XA 1QNRA 3TH6A 4PFMA 1LLZA 3ES8A 2BBFA 1TUXA 1EUAA 3WEMA 4DJEA 3BCFA 3WLTA 1RPKA 3HG3A 1Z6KA 2PD5A 4L65A 3ANVA 1UD3A 1W31A 2PDQA 5JBFA 2AGTA 2ZA1A 3NQMA 3THAA 4GIYA 3WUEA 5JU6A 1WDRA 1V0NA 3VU2A 1CGXA 1GOQA 3ZXWA 3KRBA 3ICJA 4WXYA 2R1NA 4GYKA 4M80A 5G2WA 1GONA 3NM3A 6ENLA 2JF7A 1WA3A 2YB4A 4QS6A 4W5UA 2CZVA 4QDPA 3LM3A 4IP7A 3R43A 4HP5A 3P80A 3S4TA 3M0HA 3LLFA 2CETA 2E9MA 5F1VA 1I45A 2PRHA 1GVYA 2QVHA 1RH9A 2XHYA 1Z41A 3LMYA 1NH6A 4Y90A 3L0KA 2OYKA 4HU3A 3URQA 3LDVA 4LJ3A 2YW4A 4O15A 3S9IA 2ZRVA 3AZSA 2QJMA 2XFRA 3E2QA 3H6OA 2WMKA 3CBWA 4AXKA 4TO8A 2TYSA 1EZWA 2OLAA 5C7HA 4RDZA 3WQ6A 3GVGA 3B03A 1H7NA 2QYGA 4WSJA 4Q8TA 1SMAA 1I2QA 4LUSB 3FVMA 3M0VA 1CYGA 1EOKA 2HTMA 4I5XA 1NDZA 2DT0A 4UBPC 5PTDA 2V2DA 1DWFM 3LV6A 3HG2A 4WR3A 2QUTA 4TTUA 1VFHA 1H62A 1FDYA 3GXFA 1L9WA 4AZBA 3G6MA 1JCJA 1BVZA 1UA3A 3W26A 1U22A 4HYVA 3TCSA 4NJGA 1FWIC 1ZAHA 3SUUA 3HF3A 4J27A 2PD9A 3DI1A 1HG3A 1AQFA 3TYDA 4LUTA 4WHBA 1OF8A 2GUYA 4H6KA 1OD8A 3B8TA 1SJDA 2C71A 2WLZA 4KT2A 3PBWA 3LGDA 1L0PA 1HKWA 2Z2UA 2V3FA 1O5RA 1R8LA 5JH2A 3GNOA 3QV6A 3AFBA 1ZJAA 4AZCB 4ZA0A 2PLMA 3GTIA 3W29A 1GYLA 1KTBA 3TA6A 3QF0A 4M51A 3QM3A 5E09A 3C2FA 2PDGA 4M29A 2F6UA 4Y9MA 4CNNA 1YW1A 2INEA 5D2WA 2OX1A 4UFJA 4LYPA 3EX3A 1AUSL 2RGLA 4RXGA 1XGEA 1QI0A 3SQSA 3ARZA 1R85A 4I3GA 1V02E 2DSZA 3FFSA 1J0KA 2Z1WA 4CN4A 3AHYA 5DCBA 5KZMA 5HMFA 3EKLA 1BYAA 2IQ0A 2VZSA 1WV2A 3DFPA 3R89A 4DY1A 1S2UA 4GGHA 5BXTA 1N8IA 2F8QA 1ZCCA 1OFOA 3HURA 5T26A 5KMYA 3OA5A 4GNKB 1NQ6A 2BASA 4KFNA 2B81A 3UVIA 5FSEC 3APGA 5F4SA 1OC7A 4NU7A 3CL8A 3C8FA 4NRRA 2VELA 4DAFA 2CLEA 4W8AA 3GIQA 3I65A 1EDQA 4W87A 3TTYA 2A85A 5T8GA 4DNHA 1U2YA 3BAJA 3TFCA 4U3CA 1CIUA 3AMGA 3TFXA 1SR9A 4QNWA 1PHWA 1LTDA 4UTJA 1R3SA 2ISDA 4BEUA 1OWQA 4KMQA 4MYXA 3IIVA 3ARVA 3F4CA 1NP2A 3CTLA 4R3UA 1QK0A 1XBYA 4GIRA 3RPDA 2X0HA 3LPFA 2AQWA 3DN5A 1H1ZA 4V15A 2OZ3A 1XH1A 3NQCA 3M0LA 1UZHA 5LYRA 3SUVA 3ZT7A 2B7OA 4O16A 2PRLA 2DH2A 3WG6A 1Q7ZA 3AIWA 4I9MA 4WOZA 3MSDA 5AC8A 3KVKA 2GK1A 4Z1AA 1UD8A 4CD5A 1JL8A 2PWEA 4KQNA 1F73A 3THDA 1UYQA 2Y62A 3OGVA 1PV8A 3HGSA 3QKZA 1VFTA 4FIQA 4FLQA 1R2SA 2DVXA 4L56A 4S3JA 4PZVA 1VJSA 4TOQA 4N9CA 3M0KA 2NWRA 1CLKA 2VOMA 3D47A 2VRKA 4H3DA 2OSYA 4W88A 3ZLHA 4C6EA 5AC6A 3G0UA 4MWAE 3KBMA 1A5OC 5C54A 1UR3M 2YA1A 2VCAA 4PL1A 3GIYA 2PCQA 2GJXA 4UTTC 2BHZA 3B0VC 3NGJA 2X40A 1X8CA 1V0LA 5FEZA 3VGFA 1X38A 4MDPA 3GUWA 1AL7A 1XKYA 2DT3A 4PFHA 2GSJA 2DW6A 4HNNA 3ZJ7A 3CT7A 2YDRA 3MWAA 2A3LA 2BXZA 3HA1A 1ISZA 4CCCA 4I5UA 3LLXA 2NQ9A 3QYSA 3KLLA 3B3DA 1JYNA 3KCLA 4IGHA 2VZVA 3KRSA 4JTGA 4PH6A 4AF0B 1W1VA 1EGZA 1CX9A 1LP6A 1GG0A 5A6SA 4KS0A 4QR6A 1GOWA 4XAZA 2V2HA 4JTJA 4PMQA 1SFTA 1GOIA 5DMNA 1PUDA 1UP2A 1J18A 4Y8EA 3PPCA 3VDGA 3SY1A 1XUUA 4J35A 3AUOA 1Z7AA 2HVNA 3EDEA 2YA2A 4UWMA 4F0RA 3PAJA 1B3OA 1V0MA 1OZQA 1PX8A 4JXCA 3WUGA 2RDWA 3U5UA 3ZZ1A 3W7PA 3FEQA 4H8VA 4K8GA 3ARUA 4XO7A 5I09A 2PPGA 3PTKA 4NIRA 1EFZA 3RK8A 1DYSA 1LOSA 3CH9A 2AQVA 3VIOA 4GZEA 4OBTA 4Q3MA 5IRPA 2EG7A 1E40A 5HMDA 3G1SA 1RLCL 1EDTA 4UCGA 3EXRA 1XDMA 1O4UA 1RALA 1UC4A 3SN0A 2D22A 4IPLA 4QJ3B 3T2QA 2CXGA 4U2ZA 4DWDA 1R3RA 3SADA 2CBVA 3W81A 5LGXA 1PXGA 4ICMA 1F2JA 4FPSA 4JDBA 5BRPA 4HMDA 1LOLA 4UNIA 2GUUA 2RGMA 4QTGA 1BXNA 3FYPA 2HBXA 3HM7A 2ADAA 4C90A 5HQEA 1RVKA 4JCMA 1FVPA 2E25A 1IV8A 1XLLA 1Q66A 1WBHA 4ZVJA 1A47A 4LBUA 3TTEA 1A5BA 2EXOA 3NEVA 3R12A 1QPNA 4N9EA 3N3MA 1CZ1A 2XFWA 4Q4MA 3TXVA 4HSOA 3V35A 2DZUA 3ELFA 4D6CA 3GC4A 4RZBA 4EXAA 4IF2A 1FOBA 3T7VA 3PB0A 3EDKA 4JAWA 3HOJA 4R9XA 4AW7A 5EL1A 3DHPA 1TMLA 1W17A 3W1LA 4YXGA 2JEPA 4D6DA 4J9JA 2PDNA 5T9CE 3T0BA 4E8GA 4A05A 4TVUA 4XUYA 3NDZA 1HN1A 3H23A 2OWXA 2EEXA 4IT1A 3VOHA 2WSQA 4NQ1A 1HVXA 4US5D 3CZEA 1OCJA 4PSPA 3VUSA 4H9MA 3RUBL 1OYCA 1QHPA 4DJEC 3UG5A 2XM1A 1CXLA 5AOUA 3W74A 1EQCA 1VJZA 3WBYA 3LBOA 4Q8VA 3WQVA 1FXPA 4ZQCA 3WNMA 2FZ9A 4AY7A 1HJWA 3R0DA 3PJTA 3LX9A 1XYLA 2GLKA 3D3FA 1OX4B 3L68A 1JPHA 3DXIA 1GJWA 3B9DA 2Y2WA 3KTXA 1W5NA 1MYRA 1VFSA 4LS1A 4HNLA 2G3JA 3H2MA 4FP1A 4A3UA 2JFEX 2EPKX 3VKKA 1B3XA 1R46A 2BFGA 2VWTA 4V27A 4I90A 3OODA 7REQB 4AYGA 2VX5A 3WENA 1V02A 3PR2A 1TVLA 4XD3A 3RM8A 3LHVA 2FDSA 3NQGA 1O5QA 3GR8A 2VR5A 3VD5A 4X61A 1SZEA 3S5SA 3DESA 2G95A 3SI9A 3IANA 4PCTA 4FNQA 3A4XA 3BO9A 3KOZA 3C2OA 1WKFA 4WY0B 2ACSA 4DUVA 4QNEA 4UMAA 3A23A 4G2DA 2YDAA 4DI8A 1LL4A 3HJZA 3N1AA 2VUYA 4H2CA 3G1VA 4AWUA 3CYJA 3SRDA 3D5HA 4J3XA 3UWZA 3HFTA 1M53A 2XN0A 1IYXA 2ACUA 2YDQA 2A6NA 4ZE4A 4JX5A 3WMBA 1ITQA 2YLAA 2ZXDA 5A3HA 3MUY1 1BKHA 1CWYA 4Q8PA 4JEJA 1PHQA 1TPEA 3MKVA 1MEWA 3H55A 1JNEA 3TYZA 3GK0A 2ZWYA 1WAWA 2GGEA 3AISA 3MJYA 4D1JA 3TAKA 5CBJA 1JD9A 2YCKX 3R58A 3T44A 2B0MA 5MKGB 3DBNA 2ZICA 4RCXA 2ZX6A 1ZLPA 8RUCA 3J7HA 1UQYA 2XIOA 5M5DA 1XG4A 1KGWA 4FXRA 3SFWA 2VENA 3THUA 3FGCA 5EMUA 3IGUA 3NVDA 1ZCOA 3WLOA 3F2CA 2ZX8A 2W67A 3L2IA 3DYMA 2WSPA 3KBSA 4EP8C 3BQ6A 2WCGA 4C6FA 3WBEA 4ZO8A 1HKMA 4IPJA 1HL2A 4MUZA 1DE6A 4D2JA 2XFYA 2WNWA 3SSZA 1QOXA 3K5XA 4GMEA 4DPPA 3GDTA 2NW0A 4QITA 1W8GA 5HMSA 3GNPA 3MC5A 3L0GA 4NJJA 3QFEA 1YQ2A 4M81A 4O1CA 4B3ZA 3A4AA 1UP0A 4LYRA 4QFUA 1XLJA 3GFXA 4LRSA 2V8ZA 1Q6FA 1AA1B 4UTWA 1DQXA 4PRTA 2YZ5A 3QQ1A 1UD4A 3NGFA 3W02A 3CMGA 3KVJA 1JFXA 4J3ZA 3WF3A 2E40A 5LA1A 1E3XA 4QEEA 4X9SA 3MSYA 2VEMA 3USBA 5G4EA 1PKMA 3OTRA 4QCEA 1W1ZA 2BXVA 1BFNA 1O6IA 1FFQA 4I5RA 4NRSA 3E5PA 2IPWA 1XLHA 1VC4A 1GUVA 4W8BA 3A5VA 4I7UA 3WQFA 2O9OA 3UP8A 3VNJA 1ELSA 5FF2A 4AD2A 2DQWA 5LNRA 3GQYA 1JZ7A 4JYEA 1WZLA 1Z3NA 4DELA 3WH6A 3P0WA 3WQOA 4GHRA 3TTSA 4CVWA 3UZYA 1VYRA 1WYIA 3V18A 3W1MA 4IG2B 1GNXA 2OCZA 4GIAA 1FWHC 2A0NA 5HWNA 3K4WA 1G1YA 3GVVA 2XH0A 2J7GA 2ZA3A 3TXZA 3AOFA 2I7GA 4DLMA 4LVFA 1FH8A 2Q09A 3UW6A 2VWSA 1DWJM 2IW0A 1B4EA 1FCBA 5DELA 4N7QA 4PR4A 1Q4NX 5XIAA 2Y7FA 4OBRA 3AI0A 2ZUUA 4OVXA 1NY1A 1H1NA 1XC6A 4FX7A 1S39A 1H2JA 3THQA 4KWUA 2PDMA 2NX9A 1UOKA 2ZZ4A 3EX6A 1MSSA 4GX8A 4DYJA 5I3FA 4OBSA 4QJ4B 2V38A 3GRIA 4NASA 5IXEA 3WLSA 1EA9C 1CB7B 2OMAA 1H3GA 5JUVA 2XUCA 2PTYA 3RJYA 2ZRUA 3QMRA 1RP9A 4B3LA 2JE8A 3R13A 3NPUA 3MU7A 2HPIA 2IPFA 5K4ZA 4LY8A 2O55A 3U4FA 4QG9A 1B57A 2YFOA 4TIMA 1E43A 1MXGA 3STEA 2XZ7A 3NL6A 1UQZA 2LLEA 4S1FA 3G0SA 3P14A 3I3BA 4LEQA 1CXEA 3N13A 3WLHA 4KWOA 1YKWA 3IJ9A 4AB4A 1QK2A 1L8PA 3VABA 1XHGA 1OQFA 4MVAA 1DWIM 1LCOA 4XAGA 2QCLA 3TC6A 3AALA 1ZNNA 4FNRA 1TCMA 3FV9A 4RK8A 2Q6ZA 4P8UA 4GK8A 2RFGA 1HKVA 3OO2A 4A22A 1N82A 1UKQA 3FHAA 4R85A 3H2EA 4J40A 4OQVA 3SRKA 3OGRA 5HK4A 2D2HA 4GJ1A 1YPFA 4V1XA 5CPNA 1XSKA 1JPKA 2DZAA 1ADSA 5FESA 4EVZA 4UMCA 1V8EA 1ZS2A 3AS2A 3FKKA 3U9IA 3W82A 2OXNA 1XD1A 2QULA 4M56A 4J1OA 3URNA 3WQWA 3PP7A 3TSMA 2W3ZA 2OOFA 3T08A 2VX6A 1GYMA 4B92A 3IAPA 4AZ7A 3GAYA 4HTBA 3HQ1A 4JTDA 3PZ9A 4JQAA 4DZIA 3WIJA 3WJXA 3F2BA 3MUIA 4Q33A 4ZOEA 4RDVA 2VQUA 1MQPA 2YKKA 4Y9PA 1OC5A 1ZJHA 3VAVA 4DYEA 4IPIA 3H70A 4XSMA 2OO6A 1AD1A 2R1LA 2P76A 1DXIA 2ZC1A 3CMFA 4JX4A 4V33A 5FEPA 1G4EA 1H1YA 1PYMA 1G9HA 3BAKA 3B97A 2X8RA 1LT8A 3DYPA 4GGBA 1QRQA 1JQVA 3CTTA 4HOWA 1SZGA 1UHVA 4M24A 4RUBA 3AYVA 4S3GA 3S9YA 3YPIA 4UOZA 3MO4A 1WNOA 4GO9A 3SGGA 3M0MA 3V0UA 4PUKA 4Z1BA 4PCFA 2FZNA 7TIMA 3B0UX 2OKTA 4Q8UA 3OBKA 1KM0A 2CHRA 4EAYA 4TX8A 4GI6A 4S3DA 4GRSA 3EWCA 1NIUA 1JNDA 1E0VA 3DAQA 3A47A 3A5FA 2VC6A 4Z1CA 1XCXA 4WKFA 1GQLA 4LU0A 1PZ0A 3UWVA 3ITYA 4P7LA 4B5UA 3P61A 2BNJA 4HK7A 4B9YA 3FA4A 2Y5EA 4JTSA 3MBFA 2ESCA 4AMCA 4PBEA 4JIQA 7PTDA 4LCRA 2DORA 3H7UA 3PC0A 3EXSA 5DRIA 4AY8A 1E4NA 3OQEA 3WD2A 3GXTA 4GFIA 4BQ3A 3H53A 5D33A 1BG9A 1MO0A 4Q6JA 1W3JA 3DBPA 2ZADA 1G4SA 3PZQA 5C2XA 1KB3A 4ROPA 4F9DA 5FJRA 4UB9A 3OBEA 3H24A 1RJRA 2RJHA 1LROA 4RL3A 4L1GA 3EOEA 3MQTA 3SQMA 4AQLA 4S39A 4MJ4A 2CESA 1TV4A 2W61A 3O15A 1E6NA 3R4IA 1IWBA 2ZRYA 7TAAA 2VVSA 2ZYFA 4BI6A 3WLJA 1OG6A 1SSGA 3N29A 2VFGA 1K8YA 1XI3A 5C71A 3NZRA 3S1UA 3CMJA 3WNLA 3ZO9A 3UXDA 1FWTA 3VOGA 2R91A 3LTSA 4PUJA 3IK2A 1A4MA 1EBGA 3VGBA 4L9YA 4F9JA 5I2UA 3VKCA 2FVKA 4C1LA 3QPYA 1QU4A 5GJNA 2CU0A 5ABGA 1RK6A 3T8QA 1ZPTA 3A64A 4NJIA 1TX0A 1WBJA 2E67A 4FMVA 3RCYA 1MUMA 1VCVA 4DEFA 1PDYA 2IXVA 2W79A 5A8OA 5DQPA 4L9ZA 3EOOA 4PULA 1RCOB 4B16A 2W5FA 3L4VA 5KETA 5K9XA 5AC5A 5BWFA 1W6TA 1VD6A 4IIGA 3E3HA 5I5RA 2Y63A 3NG3A 4LSBA 5CH9A 2CLHA 1P0EA 4AVOA 1KBJA 4O1AA 3V16A 1LZOA 2PWHA 3U2OA 3PWIA 4PTXA 2E8ZA 4GFSA 3LI1A 4MADA 4S2BA 3GNRA 3EDJA 3O3RA 3FSTA 1H63A 1DQUA 1SW0A 6XIAA 3O63A 3B8VA 1LBLA 3S2NA 2YR1A 5CLWA 2X7WA 3HU7A 1SU5A 5BOOA 3GLCA 2ZWZA 3RR1A 1M7PA 4KIRA 3V3WA 4PB5A 2PGRA 2Y5JA 1V6WA 3AYSA 4XZIA 4U31A 3IV8A 4DUOA 3POCA 2J62A 4FX6M 5DCDA 5M17A 1IGWA 1BSIA 1JCXA 2ISVA 2ALRA 3ALFA 4FEZA 3IUHA 3E2VA 9CGTA 3VGGA 2BHYA 3M47A 1JCNA 4HNCA 3NM1A 1Z48A 2VI0A 3QZAA 2BB0A 4XX6A 2CLFA 4B5SA 3M0JA 4IP4A 1KW1A 4AEOA 1FX6A 3OYZA 4JFVA 3ITTA 4Q7BA 3A4JA 4K3ZA 4Q4KA 1R7OA 2CITA 2VGIA 1V3HA 3I6RA 1RY8A 3NO1A 4AIBA 1JIBA 4F66A 1W5OA 4YS1A 3TZFA 3AZTA 1SO6A 2PWDA 3N19B 2ZUSA 3B0XA 5EKYA 1T8XA 2FMNA 1ZZMA 2JKAA 1V6XA 1SPQA 2AL2A 1X97A 1T41A 1DTNA 1A0DA 3WL1A 1LUCA 4A6GA 3CK5A 3NFUA 1QPOA 3QOKA 5A8PA 1KR0A 3W2JA 1OB0A 3EGJA 1LM1A 3SN1A 3PS7A 1ALDA 3NCOA 3EWZA 1DV7A 1SSDA 4S3BA 3GC2A 2QCMA 2OJPA 3HPSA 2QF7A 3BAIA 2D3LA 1TJPA 3MYPA 4KWWA 4B9ZA 4QJ5B 1JAKA 3F7JA 2WVVB 2PCEA 3DFTA 1TJRA 3PTQA 3UR5A 2J13A 3LNMA 3PNUA 4LVAA 1P0NA 1AJ0A 3AICA 1DJWA 3VIHA 5G4HC 5CC3A 3VC5A 2PC8A 4AWEA 4KH2A 4R27A 1CPUA 1JCLA 1LJYA 3V5FA 1FTXA 2QIIA 5H8PA 4GBUA 2EKCA 2EGZA 1T6MA 1TRDA 3B9NA 2ISSA 2TAAA 2GGIA 1DXEA 1M03A 1OSEA 3QGVA 1CBGA 4WIWA 4JIRA 5FF7A 1EH9A 4D6IA 1C90A 1GORA 4HA3A 1OEPA 1KC7A 4ZO9A 1HJQA 3HN3A 4WDUA 4PRWA 2IQTA 1F3TA 5E5CA 3W7CA 4IFRA 3HQPA 2RDTA 3P82A 4WY0F 1ECEA 2V68A 3ID7A 5EMMA 2CEQA 3UY8A 1U5JA 3LBMA 4KRTA 1PJ9A 3OLDA 2FZDA 3ITVA 1M01A 1NFGA 3AMDA 1VLWA 3SBFA 1YMYA 4WDTA 5E0FA 3O07A 4JKKA 4O4VA 3N2CA 2UBPC 3IJLA 2PDJA 3VKBA 3C0QA 3FJLA 3W7KA 1POKA 3WMLA 1XIMA 2PDLA 1GW1A 2X1IA 5F2MA 5HJXA 2QJIA 1OFQA 3MHUA 3LHWA 3QV9A 1XLMA 4YWSA 1XLDA 1DWHM 3M0XA 2PI6A 4LV4A 4F2BA 3W25A 4D8AA 3L5AA 1TV8A 1ADDA 2CLMA 3NQ8A 3PFRA 1SJAA 4PC8A 3EYPA 2X09A 4KEVA 1G4TA 3HZ3A 4GUFA 1EP3A 2R8WA 2GSHA 1AVAA 3E6EA 3TYEA 6CGTA 3HB9A 1LRQA 4BZYA 4R88A 4DBSA 4QP0A 4KEUA 3WLKX 1R30A 3CB8A 4JYDA 1FWCC 3MI2A 1VEPA 5IM51 3EKGA 3TJIA 3UG8A 1OIMA 4L9XA 1MUCA 3SFKA 2CERA 2OZTA 3R5EA 1WUEA 2ZDRA 1S1PA 5D9PA 4Z0SA 4IH3A 2JQXA 4HZ7A 4QE1A 1JI2A 1XYMA 3P8JA 1J6OA 2W0UA 2YCLA 3TCEA 3Q65A 1Y65A 4O53A 3WBXA 3CV7A 2XWDA 5BMWA 2YA0A 5U4NA 4YVXA 3MW7A 4C6IA 1TZ9A 1XBXA 2NUWA 2CLLA 4MKVA 4I6VA 2W92A 2HVMA 1M7OA 2Y85A 2E68A 3EWUA 3KEHA 4ATDA 3T1GA 2GJLA 3PAOA 3VFLA 4XD4A 3W37A 4G8TA 4CNOA 4KF1A 5G2IA 1QUMA 4XIAA 4R7WA 1OYBA 1WDWA 4ICCX 5AYXA 3N18A 4AEFA 2JKPA 3FAXA 3VCRA 1MQRA 3LCWA 1TO3A 2POTA 4B5XA 1UZ1A 3WYZA 3VMOA 3NL2A 1VYPX 1AODA 3GDBA 2V69A 4F3HA 4IJBA 3W7LA 3K30A 3SCPA 5G4WA 5K4XA 5LIXX 2HROA 1YDNA 4J2PA 3KRUA 3OA3A 2CKRA 1KWKA 3O06A 4Z2JA 1U30A 2GJXB 1TFVA 1QR7A 4NJKA 3VNIA 1B30A 3BMXA 3CUZA 1VAHA 2HEJA 3TTQA 1JRBA 3CHCA 3EA2A 3N14A 3OEXA 2UY4A 1K03A 3ATZA 1GT8A 3QQWA 5LZLA 2CLKA 1ZALA 3FHQA 1RJPA 1ESWA 4H9VA 3EEGA 3W00A 1OHLA 4GVGA 1J0YA 3W7EA 5TAOA 3ZLFA 3UQNA 4XQ6A 1J0HA 3DFNA 3IGSA 4IMEA 4ZEPA 5BOEA 4WKAA 1B31A 4NZFA 3WEZA 1P7TB 3MSGA 4TVDA 4Z1DA 1DOSA 3L2LA 1V51A 1W5MA 4CEUC 2HBVA 4O57A 3WLNA 3Q58A 4H4IA 2NXHA 1WOAA 5FACA 2HS6A 3OPSA 3V7PA 4HZMA 1F3EA 1V3LA 4BY3A 1S2TA 1KGUA 4BQ2A 4JFSA 2W9MA 3PBGA 4O4WA 5DY3A 1QWGA 1RY0A 4D9PA 4ROQA 2O56A 3TP4A 4UNKA 5L6UA 3UFYA 5AHEA 3KVLA 3K1DA 2CBJA 4TXEA 3KOFA 7CGTA 4NHVA 4J3VA 4A3QA 4P7RA 2E1DA 3EA3A 2PSNA 3GC5A 1J5TA 3OQ8A 2ZXAA 2D0HA 3DIPA 4Q8OA 2QQ6A 1KBIA 2PBOA 3M5XA 1VR6A 1P6BA 1ML1A 4JTKA 4P8XA 2ZE0A 3QTPA 4DRSA 1XIBA 4M7SA 2B31A 5AYYA 4J3SA 3PSVA 2BXYA 3VOFA 3FYYA 4PMVA 3A4WA 3CWNA 3CEPA 1K9DA 3TDFA 2ZDSA 2PEVA 4G1KA 4LAOA 4OWGA 2VT0A 4D6JA 1PIIA 3FDGA 1A5NC 3C5QA 3D6NA 3OVRA 2ZCGA 1Y7VA 3P84A 1M04A 1YTEA 3AMCA 3OG2A 3GNXA 5HPOA 3LY0A 4PMYA 2XU2A 3KBVA 1K9EA 3GG1A 3NSMA 1EWEA 3P60A 1UWSA 4W9TA 3DG7A 2ZUWA 3W01A 3VIFA 3H22A 1Y5VA 4F0MA 1VF8A 3VGDA 3KP0A 1DJGA 5CSYA 1FWBC 3PBUA 4H6QA 5IBXC 1KKOA 5ABTA 1HL9A 2BP1A 3C2EA 3QSTA 4QLLA 4AH7A 4W7UA 1KM5A 4GE8A 2IUZA 4Z2GA 5DBUA 4FA3A 1NJJA 2CZEA 3HPFA 4ICNA 4UZSA 1DORA 1EF3A 1S2WA 4KWVA 1DIOA 1XIIA 4GC4A 2ISWA 3ARXA 4MNMA 1GW9A 3NVTA 1DBTA 3VMNA 1NTHA 4IJCA 5KEZA 2FHBA 2MANA 4RV3A 4GNJA 1HVQA 3CASA 1NOWA 2AOSA 1RBAA 3HIJA 1Q6GA 3W27A 1YDOA 3RX4A 3W71A 1BWVA 1GVIA 1UH2A 3VE7A 4LC6A 1S1RA 3RO6A 5AYBA 1YEYA 1XFCA 3RN6A 3M6DA 3SAZA 5HATA 3KTCA 4GXMA 3ZR6A 1TB3A 2YW3A 3M44A 4GI8A 1EXPA 2JALA 2NT0A 1FH9A 3REQB 3LGGA 3N4EA 1LBFA 3MTWA 3ONCA 3PWGA 3SEPA 2FH8A 2G3NA 1R6WA 5I6SA 2CWXA 4X3ZA 1J6PA 1A5KC 3B0PA 2VFIA 2D2JA 2QCDA 3PUOA 2GJRA 5TD4A 3UXIA 1I2NA 5A6LA 3Q67A 1W1B1 4UXDA 1L6GA 1B2YA 1CEOA 4Q7NA 1V3JA 1GQIA 4G6CA 1QI5A 3W1RA 1AG1O 1WPCA 4E4UA 3MVIA 1RCQA 2G3IA 4O17A 4LWWA 3A6OA 1P0KA 3WCZA 5A8GA 3WDHA 1HGYA 1XG3A 2WSKA 2X2GA 3A3WA 2VJXA 5FAJA 3OJGA 1K6AA 1PEZA 5JVLA 1FWSA 1AW5A 4NXSA 2G4JA 4MZ1A 4GIEA 2F6XA 1RHCA 1TPDA 4LC8A 4PMZA 3VIKA 4A8IA 1MW1A 1KGXA 4DXXA 5LNUA 4KETA 1AMYA 3EMZA 5BU6A 4B5TA 1GOXA 2VR4A 2NV1A 3W76A 2PU0A 1YE4A 1CLXA 2ZRZA 3BANA 2Z1VA 1VEMA 1PKLA 3HBLA 4M19A 2ISFA 4JDYA 4I7WA 1Q6QA 1D8CA 4UQEA 4GQGA 2QMKA 3P7YA 3PZGA 4L4LA 5D04C 5HINA 2HVOA 2V5JA 3F4VA 3E38A 3VDCA 1WKDA 1M41A 4JL2A 1RA0A 1R2RA 2BVWA 5TIMA 1AJ2A 2GQ3A 2PDYA 4C7DA 3N9RA 4IIFA 4HYRA 4GISA 1GVRA 3L65A 2PUZA 1KM2A 3FEMA 3S47A 2XIQA 1WXYA 4U3AA 2OB3A 1SMDA 2O0TA 4HZ6A 1XYZA 1ZENA 4YHEA 1DP0A 4IXHA 3CUJA 3PZMA 5D8ZA 5JBDA 1EIXA 4O1FA 3SURA 3HQNA 2OSXA 3QFWA 1C8VA 1Y5WA 5IBXA 3R8HA 1H0GA 4NY2A 4ZQMA 4ENLA 1ISWA 2GK1B 2VDHA 3WUFA 1HTIA 1XLKA 1UROA 5E70A 5AYIA 3IWPA 3NTYA 3F4WA 1A5UA 5G2HA 5FD0A 2YDSA 3BSGA 4LUJA 5CEWA 4IFOA 4L6DA 3UG4A 7XIMA 4GG9A 1FKWA 4GYFA 3MZ2A 2WJFA 3BW3A 4GQRA 2I5GA 4QG8A 3LGEA 1Q45A 4NX5A 1IXPA 2WMGA 4MWAA 3MHGA 4PE8A 1S46A 2VX4A 2WQDA 3AXMA 3ZLGA 3LXAA 2GGGA 2VGGA 2ZRWA 4CD6A 1VEOA 4H8NA 4CU7A 3L5LA 1NDVA 4IG2A 2WLYA 3PSWA 1J0IA 1FHVA 3O6AA 4QDMA 3VDBA 2C19A 3QZ6A 3C0LA 3JUGA 1HJUA 4RZ4A 3O6CA 4M0XA 1J96A 4QRNA 2V5KA 4AHOA 5AZ1A 3SIMA 1NOFA 3BLDA 1EB3A 4GI4A 4C60A 2GYIA 3ZVHB 2Z1BA 2OVLA 3GFYA 2EAWA 3P81A 4O0ZA 5H6HA 5D9MA 3EWBX 2PTDA 5IFPA 4WD0A 3VD9A 4LW7A 5EMLA 4C7FA 3VGHA 2V5LA 2VEKA 3MCOA 3T0TA 3VINA 5CZTA 1HNYA 5A6MA 3RCNA 1BWLA 2CW6A 4H1ZA 3QC0A 4E3TA 1EOMA 3VD3A 4RPQA 1GZJA 4Z2IA 4A3YA 2WM0A 3SN4A 4LANA 1TR1A 4NI3A 3G1AA 1BTMA 3TV8A 2BDQA 1TPUA 3KBWA 1H7OA 4XZNX 3WQGA 2DIKA 4MWAB 1QVBA 2BTMA 5A94A 3OG3A 4LF1A 4JTEA 2Z4GA 5T9BG 5JIWA 4N02A 3PVFA 1HJXA 1SM9A 2J79A 3KFTA 1ZBWA 2RJGA 4O28A 2UWFA 3PG9A 4GUHA 5FKYA 2J6XA 3NAVA 4YU1A 3LU2A 1PIGA 4H2HA 2I9UA 3R94A 1E9YB 1P1XA 4DN1A 3PN8A 1KNWA 1BSLA 2DJXA 2ZVRA 3G18A 4IMDA 1Q5MA 5F2LA 1F8IA 2AL1A 4GH3A 3UZXA 4ES4A 1EP2A 4H6RA 3MS8A 3HPAA 4Y9NA 5JBEA 4QQUA 4YNGA 3NPVA 5M2FX 4ERAA 1V5XA 1W5PA 2DU2A 4DF1A 3LERA 3RM9A 3S6TA 2OWWA 1P6WA 1I0DA 3CPGA 5A2AA 3O0KA 4K37A 1BYCA 3UVAA 5J8LA 2EPMX 2IKIA 3NWRA 1W1TA 3NZGA 3UZJA 1IEIA 1TWDA 2I56A 5CPOA 2JGYA 1FUYA 3MP3A 3T05A 4ECLA 5CG0A 1GVSA 3CJPA 2YXXA 1Q7MA 3OLEA 3EWXA 1C92A 2A7RA 1NWSA 4X0NA 1VPXA 3TC3A 3WH7A 3PTDA 1RD6A 1WDPA 1E73M 1TV2A 4Q6XA 2XSBA 1ENUA 5LXEA 1D9EA 1VB9A 3ISIX 3OHMB 3HPXA 3WJYA 3K1GA 2IMRA 2R6OA 1Q6RA 4JHOA 3HQOA 2VFEA 1ZUAX 2H3DA 2WW5A 1HF6A 2VFDA 1CXHA 1QO2A 2WCSA 3UJRA 3W6YA 1W9XA 4BFAA 3UY7A 6XIMA 1RBOB 2R24A 4M5PA 3TR2A 3GVWA 3VILA 1HXJA 4ZXOA 2C7FA 2PE4A 3UBPC 3CUHA 3LHYA 2PA6A 1V93A 4DIAA 4K7YA 4GD0A 4GLEA 2Y1HA 4YJ5A 3C2YA 3E0WA 3G1YA 1UUMA 3PANA 1VS1A 1W37A 1W9VA 5I23A 1FXQA 1M3UA 3RX3A 4Q7IA 1BF2A 1OT1A 1LDCA 4NAFA 3VX1A 1MW0A 4BKNA 3ARQA 2XIIA 2QVNA 3B8WA 5DY2A 4E5TA 2QZRA 4EOUA 4JCLA 4IGSA 2PDWA 1D7FA 3I68A 3Q2DA 2PFHA 4RPPA 4Y6GA 4GACA 5G5IA 3FSUA 3N2BA 2F38A 5E0CA 3KL0A 1GKRA 4RE2A 4PCPA 1RLDA 4EPEC 4QJ1A 3VTRA 4S3CA 1X98A 1MQQA 5EFDA 1H4PA 1QTWA 2TPSA 1FWNA 3UJFA 5A1AA 2O4MA 1FWFC 3ARTA 3LRMA 2IKHA 1D7KA 3LYEA 3QMSA 1BXBA 1QBAA 3UR7A 4A29A 1LWHA 3N15A 3S42A 4IFKA 3K46A 3ZJ6A 2VC7A 3ARYA 1YYAA 2ICSA 3HPZA 1E15A 2J7FA 4ZGYA 5DLCA 2ZTKA 4XV0A 2XFFA 4WSHA 3I7SA 3E49A 1HJVA 4JTFA 2OYMA 3LSCA 4AD4A 1L6FA 5F2GA 2CKSA 1JG9A 1KTNA 4DB7A 2CZDA 4E2DA 4Q4PA 4ILSA 2CFFA 3P6LA 4ZB5A 4XTIA 4FHAA 4FLOA 1OFBA 3WFAA 5U7SA 4BF7A 3V36A 4US6A 1LOQA 2RDXA 3TLQA 1LRTA 3ZSTA 3TLLA 4MTVA 1ZB5A 1U1UA 1SFLA 2EG8A 1QW7A 1JJKA 4YIWA 3IJDA 1QHOA 2HPMA 1E5JA 3UETA 3DCPA 1VJIA 3I4KA 4DZ5A 4UFIA 1EQPA 1MZHA 3KXQA 3TW6A 4ZB0A 3QR0A 3CV2A 3W28A 1ICSA 2NLIA 5A8NA 5CPTA 4QLKA 5CAHA 3ME3A 4H7VA 1EA0A 2ACRA 5K9DA 2UY2A 3HFYA 1HUVA 3T4WA 3B06A 4LNYA 3ZT6A 4HYWA 3GG7A 1CGWA 3NDYA 2Z26A 4B91A 3VA8A 2QCCA 3FXYA 5C9RA 5CPMA 4ORMA 1OIFA 3KUMA 5GPRA 1J0ZA 4DWSB 5I07A 3P67A 4AG0A 1D3GA 1ZTVA 1A3WA 1A53A 3DU0A 1KM4A 4ADUA 1VCFA 3GH4A 4NSBA 4XKYB 2E6FA 4QROA 1AQMA 3FJNA 4ZE5A 4XAYA 3S6DA 9XIAA 3VPLA 3EDFA 1M7XA 1A50A 1YPIA 4TX9A 4HCHA 2F2HA 3GTNA 1MDRA 2DGAA 3SSJA 2V0TA 4E2BA 3BW2A 4JPGA 4Q4SA 4KFPA 4DJDD 2QCEA 1A49A 4PTVA 5JIPA 1V7AA 2C18A 2HDJA 2X0SA 4GUJA 3FN9A 1UR1A 2VOTA 3E0VA 1IEVA 2V81A 4M1BA 1V0KA 3UXAA 1B9BA 2P0OA 4HT3A 1SGJA 3BAXA 3PK7A 2WB5A 2BLEA 3BLLA 3NEHA 2WC3A 1OGBA 4KFOA 2WPBA 1DJZA 1RV8A 2ANUA 1JDEA 3ALGA 3AUJA 4MB1A 4O1DA 1PPIA 1SVDA 3WH9A 1W3KA 1FQ0A 1TELA 4PEKA 4IMCA 1E0TA 3LCLA 3OZYA 1VLIA 3ZIZA 5CQ1A 1KM3A 3UEQA 3UJSA 3CNYA 3BV7A 1V6YA 3E0IA 1RR2A 5CGQA 1W91A 3B8SA 4GZJA 1Z44A 4O8RA 1OK4A 5LGZA 3CQJA 3B0YA 3M1ZA 4ZQRA 6A3HA 3I3EA 2PC4A 1E72M 4H19A 4C6OA 3IUIA 4OIFA 4AHQA 1UJQA 4Y9OA 1UR0A 1W3HA 3H12A 1R2TA 4O54A 3LG3A 4RNHA 4UR9A 3EPMA 2DV0A 3GM8A 5D2VA 1EJ7L 1X1OA 1TREA 1RVGA 3FY1A 2FDMA 1IXNA 3QW4B 1UR2A 2C6QA 2YXOA 4C6CA 1CXKA 4O52A 5REQB 3UGRA 4IJRA 3DUGA 2CHOA 3B04A 5IFTA 4FLSA 3PZTA 4JQ3A 1RQBA 2EQDA 1QPQA 1UG6A 1FWWA 2NUYA 2V6AA 3M9YA 2Y89A 4WX2A 4J7RA 2YIHA 4GUGA 3VM5A 3K4AA 4ZZ9A 1UASA 3SCSA 4ALDA 4N6FA 3SCUA 1JCMP 4LAMA 3OVPA 1Q6CA 1V3IA 3PZVA 5FEWA 3I6EA 3WL0A 1PTGA 3WBAA 4W5ZA 2ZUTA 2O7SA 3OP2A 1Q6DA 4HPNA 4C1NB 3S5OA 3VVGA 4XWUA 5HOSA 1I75A 3G22A 4LVGA 4C6DA 1S5VA 4PCNA 3U48A 4PEEA 3S1XA 3IACA 2OT0A 2I14A 2R1MA 1NSJA 5EMKA 3QHMA 1GHSA 4ZQPA 1OCQA 3TU9A 4C6LA 5FSDC