1ICSA

Crystal structure of 12-oxophytodienoate reductase 1 from tomato
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
363
structure length
353
Chain Sequence
b'QVDKIPLMSPCKMGKFELCHRVVLAPLTRQRSYGYIPQPHAILHYSQRSTNGGLLIGEATVISETGIGYKDVPGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNKDFQPNGEDPISCTDRGLTPQIMSNGIDIAHFTRPRRLTTDEIPQIVNEFRVAARNAIEAGFDGVEIHGAHGYLIDQFMKDQVNDRSDKYGGSLENRCRFALEIVEAVANEIGSDRVGIRISPFAHYNEAGDTNPTALGLYMVESLNKYDLAYCHVVEPRTESLVPMRKAYKGTFIVAGGYDREDGNRALIEDRADLVAYGRLFISNPDLPKRFELNAPLNKYNRDTFYTSDPIVGYTDYPFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 12-OXOPHYTODIENOATE REDUCTASE 1
publication title X-ray structure of 12-oxophytodienoate reductase 1 provides structural insight into substrate binding and specificity within the family of OYE.
pubmed doi rcsb
source organism Solanum lycopersicum
molecule tags Oxidoreductase
total genus 126
structure length 353
sequence length 363
chains with identical sequence B
ec nomenclature ec 1.3.1.42: 12-oxophytodienoate reductase.
pdb deposition date 2001-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1icsA00
4PCFA 5AYYA 3GAKA 3S1XA 4IPJA 1K7EA 2R91A 3GLCA 1G69A 3W85A 2YW3A 4N9CA 3L5MA 2J9ZA 1YTKA 5D2VA 5DBTA 1H7NA 1I2QA 3B04A 5DCEA 3KOFA 3GB6A 5T26A 4ZQMA 4O14A 1KV5A 3TXZA 1ONRA 1QPRA 4CNNA 3IVUA 3ATZA 4KWWA 2UV8G 3I7SA 4XZ9A 1FY6A 1KBIA 3UWUA 3W1TA 1Q6QA 4QM1A 5BOOA 3TMLA 3LBMA 1H7OA 1LDCA 2H90A 5LNSA 3MP4A 2JKAA 5FF7A 1MZHA 2GVGA 4NZFA 1JUKA 1F73A 3LI1A 4TMCA 4BR1A 4DPQA 1WOBA 3ABSA 1A5CA 3NQMA 1NVMA 3R8RA 2E68A 4NUWA 2NUYA 3NPXA 4JNMA 2GOUA 1K03A 2J9YA 5MHBA 4TU1A 2TSYA 4LWWA 4BK9A 4FB7A 2YYUA 5F1VA 3P61A 2YX0A 1XBYA 2Q3RA 3FOKA 4PH6A 4BI6A 3NQFA 3G0UA 1QPQA 3N73A 2Y88A 1QOQA 2QAFA 2CLFA 3EXSA 3DHFA 3G1AA 2Y63A 2J9XA 5KINA 4O0ZA 3HG2A 5AHLA 3NZRA 5AC6A 3UXAA 4HKPA 1U83A 4OV4A 5CZTA 4OWGA 3FS2A 3GZ3A 5LHFA 4HT3A 1ZY9A 3S1VA 3F1QA 4DF1A 2WKJA 4UC5A 1GOXA 5F4SA 1PS9A 2QEZA 3A9IA 2PURA 3P82A 4OU1A 1YDNA 2X1UA 3EXTA 3WJWA 2QCHA 3FIGA 4NJKA 4H6KA 3C52A 1Q6OA 1V5XA 5G5IA 4FX7A 1OX4B 3YPIA 1GG0A 3HPXA 4H3DA 5DCDA 4N02A 3L67A 3G1SA 1W1ZA 2B7QA 2A5HA 2BTMA 1G4EA 2Q3OA 1WA3A 3QSRA 3LHTA 1VR6A 1L6SA 1WX0A 1UBSA 1YDVA 1Q6RA 3QZEA 1PL9A 3EWWA 3HQ1A 3NM3A 4JICA 4BI7A 1TJPA 3N3MA 3SIZA 1H7XA 2A21A 2VENA 1G7VA 1D9EA 4JTKA 1YTEA 3PG8A 3T40A 1SZGA 3W1AA 4J9JA 1O60A 3VE9A 5EMUA 1SFJA 2GUUA 1HO1A 1ZCOA 4WUIA 4XKYB 1TMHA 2VEPA 3EB2A 1RV8A 4IX2A 5AHFA 2J27A 3PSWA 1M6JA 3MO7A 4O54A 1EEPA 3PBWA 4LV9A 1QDSA 5EL1A 4YXGA 2CLIA 4L4MA 3W2JA 3I6RA 1FQ0A 3W86A 4LUJA 1OFAA 1P0KA 3C61A 1O95A 1SW3A 4O8RA 1ZAIA 1XM3A 4M7SA 4KFPA 1NSJA 3B06A 2C18A 3PR2A 4AF0A 4UUIA 1GJPA 4MZ8A 4UTHA 2EF9A 5C55A 3C4UA 2WNQA 1UUMA 3STCA 3OEXA 3QC3A 1GQNA 1RQBA 3O16A 3DHDA 4XBSA 5BW6A 3TU9A 1UJPA 1TO3A 2Y6ZA 2Y61A 5CSRA 2Y7DA 4A2SA 1K3UA 3EWYA 3JS3A 5AYXA 1S5WA 4LVAA 4RXGA 3GXPA 4LU0A 3TXVA 3E12A 4N4PA 1TPH1 1PHQA 1WQ5A 1XBZA 4ML9A 3LDVA 1SZFA 3TMQA 3RLVA 5AC7A 4MYAA 1A5AA 1JCYA 4TX9A 5EBUA 3P8JA 2A1YA 4O1DA 4O4WA 3ZR4A 1BWKA 4OT7A 3ANYA 1TJRA 4QNWA 3LHVA 4A29A 1E51A 3FJ6A 3W7DA 3W1LA 3NPWA 4AHQA 5FF0A 3PB2A 3P8IA 3TCEA 2A85A 3PAJA 3CC1A 1RQHA 3W1MA 4CNPA 1LP6A 2B7NA 2QCGA 3NPUA 4IJBA 3GR8A 5HQEA 4AH7A 1ZAJA 5D2YA 3W7RA 4POCA 3W73A 1S5VA 4FNTA 1VZWA 3UY7A 1MEWA 1VYSX 3TX9A 1VGAA 1XC4A 1KFCA 3H55A 4N9DA 5KMYA 1VHNA 4O13A 2CLKA 1KM0A 3Q37A 2R14A 3NL3A 3E02A 3THQA 3W1NA 3PVFA 5LGZA 2GQ9A 3W84A 5IBXC 1PVNA 3W83A 2RDWA 4BWLA 4K39A 2E5BA 3TW6A 2QCFA 4DBDA 1WBHA 4NJHA 4DO4A 2Y85A 5D09A 2FPTA 4PC8A 3DFNA 4RCXA 2W79A 3ATYA 1WV2A 1LLZA 2V2HA 6TIMA 1DL3A 3I7QA 3VFLA 2ISWA 3W1QA 4CLMA 3KRZA 4NNAA 2I9EA 3GXTA 5FI8A 2YXGA 4KKXA 1ML1A 3NXFA 1N55A 1LYXA 3E9AA 2VEIA 4MVAA 4X9SA 3STEA 3BO9A 1MXSA 1W5PA 4BWLC 4MKNA 3R13A 3KVJA 3TQVA 3S5NA 2Z1BA 5AHIA 3EX2A 5A5WA 5HR7A 5FESA 4LNYA 2ZTKA 2YR1A 1ICPA 1BEUA 4FXRA 3LCIA 3KVKA 4JX4A 1CX9A 4HNNA 1DHPA 4O0KA 1TSIA 3PUEA 1QFEA 3LTYA 1KFBA 1GTHA 4GUHA 3W1PA 5I3JA 1TPVA 1OYAA 4O16A 3DFTA 1VC4A 4O57A 4FNSA 3S0CA 4WXYA 4IUOA 4MFDA 4JGDA 3LCXA 1JQVA 4JIPA 3NQ6A 5EYWA 2ISVA 1W0MA 3PBVA 3CT7A 4RK8A 3W1XA 4UTTA 3IIOA 3LHZA 3GYEA 3G18A 4C1LA 4O15A 4UIOA 4N2YA 5J5RA 1RQEA 5F4WA 4ALDA 4MOZA 3W7NA 2ZZ4A 3PB0A 5AN7A 3EX4A 4PL1A 2BWGA 1EWDA 4MJZA 1LZOA 3LGEA 4A22A 2J6XA 3BPWA 1EPXA 2AQWA 3DGRA 2OT1A 3NA8A 1XXXA 2WOQA 4IMCA 4I7VA 1RR2A 3ZWSA 1IF2A 4JS3A 3N2MA 4IXXA 1XL9A 4M5PA 4JDYA 4PA8A 2DZXA 3JR2A 1W3IA 3R5EA 1AG1O 2BLEA 3LOTA 5D04C 3BW4A 3STGA 2C16A 2EHHA 3IV3A 3O6CA 3WK0A 3TE9A 4LRSA 1F5ZA 3BGGA 3G24A 4XWUA 3Q94A 1P4CA 4HNTA 1C8VA 1K8YA 5HWJA 4EIVA 3BG9A 3MW7A 1ZJIA 1ICQA 5HULA 5AOUA 4LOCA 5E1QA 5G2HA 3TJLA 4K7VA 3M5YA 3NPVA 3CM4A 3NG3A 3UWWA 1M5WA 5F2GA 4QAIA 3S6DA 3RF9A 3S42A 3MI2A 4HSOA 3BG3A 1QAPA 2VOMA 2Q8LA 5DLCA 1KTBA 4GUJA 3G1DA 1I2NA 3M47A 1JVNA 2ZQ0A 1VYPX 1W54A 4E2DA 5D30A 3M41A 5D2XA 4PL2A 3GIYA 2QDGA 1LCOA 2HS6A 3T55A 3UWZA 1H7PA 3NL2A 2V81A 1YXYA 1QNVA 4GE8A 4JN6A 1KV8A 1SO3A 3W22A 1C29A 4UTUA 1K7FA 1OFDA 1GVRA 1YDOA 4JTTA 2VELA 5CG7A 1IXPA 1DKWA 4DEFA 2Y89A 1TPB1 3W2KA 4CNOA 3MYPA 3IEBA 4Q33A 4OV9A 3S9YA 3GX9A 1N7KA 4MLJA 3F4NA 3PUOA 2WSQA 1LBFA 5KZMA 1Q3NA 1SPQA 3HGOA 1TRDA 1JUEA 4TR9A 5GVJA 3W7QA 5DBUA 1TQJA 3NQ2A 2G97A 2NV1A 1G4PA 2C0AA 2FQIA 3EX6A 5LNWA 1DJNA 1KLZA 3ZWTA 3W7KA 2EGZA 2ZA2A 5AC8A 4UTJA 3Q2DA 3QQ1A 3W7LA 1K8XA 5CPLA 1GZGA 4IMDA 1DJQA 3TNOA 5CSSA 3MHUA 2H8ZA 4UFIA 3WJXA 3O07A 1DQWA 2QCDB 4EOUA 1L6WA 1EWEA 4RKAA 2Z2UA 1VLIA 2RKXA 4E2BA 1Z41A 2ISSA 2VEKA 1IGSA 3TAKA 1TIMA 1W5MA 4FX6M 3DI1A 3LXCA 7TIMA 3DZ1A 1A50A 4YL2A 3W3OA 3C8FA 1JCNA 5FF3A 2ATMA 3IVTA 1JULA 3GNDA 2ZRZA 1R2TA 4QNEA 1VCVA 1FWNA 3EX3A 1H63A 1KFLA 4KFNA 5U7SA 1TTPA 1X1OA 5TIMA 5FF4A 3WJYA 3C2OA 3N2XA 1OFPA 3P80A 3MI3A 5EKYA 1W31A 5DXYA 3NNTA 1VYRA 2QKFA 2V0TA 4IMEA 1SZEA 4RR4A 5K9DA 3LCHA 5U4NA 4GBUA 3NO5A 1W3NA 3LLDA 5D03A 4EF8A 3TH6A 2PRLA 3PBUA 1AMKA 4NNBA 2E5CA 4TMBA 2PE4A 4ZMGA 4O19A 5LZLA 4MPQA 3LCFA 1K7XA 1TRIA 3WFAA 2ZFAA 4YLWA 2VFDA 3TSMA 2BXVA 1LROA 3DKLA 5FEXA 4DXVA 3ABOA 4ADUA 1PE1A 3IIVA 4NU7A 2DJLA 4JYEA 1LOLA 2BZNA 4UFJA 1R47A 1KM4A 2E1DA 3O8AA 3W7JA 3CIWA 4YCOA 3W9ZA 1A53A 1KLYA 2OT0A 4O17A 3I7RA 1H50A 3SGUA 2I1OA 3EXRA 3HF3A 2B0MA 3NQCA 2OCZA 1VQTA 2DU2A 4I7UA 4GUFA 2FB2A 3QPYA 1ME8A 4DF2A 1L6YA 4MFEA 2WNZA 4O52A 3TC6A 1GT8A 4JDBA 3ABQA 3USBA 1GVQA 1F2JA 3G3MA 1FXPA 4IWWA 3KHJA 2BSLA 5HNRA 1YXCA 3EWBX 3S1WA 8TIMA 4IX0A 2FFCA 3NL6A 3MHFA 1JR1A 1V7YA 4UTKA 1FWSA 2CW6A 1B9BA 1WYIA 1FCVA 1KFEA 3S5ZA 3GKFA 2WJZA 3C2VA 1YYAA 2ZZ3A 3WK3A 2ZRYA 3P62A 2Y70A 4XTDA 2C3ZA 2EKCA 2JGQA 4O53A 2X30A 1TPFA 2C6QA 3LHUA 4A3UA 1J4EA 3W88A 1IIGA 2DP3A 2NLIA 3LI0A 4KWVA 2YCEA 1RVGA 1OX6A 4GWEA 4O50A 3U2OA 3G8EA 3EX1A 3QW4B 3NQDA 3PWAA 1LOSA 1LOQA 3QMTA 4Y90A 1GYLA 3B4UA 1KM5A 1BKSA 3T78A 2D73A 4NXKA 3G1HA 4JXCA 5K9CA 4ZVJA 5CKSA 3W76A 2NUWA 1G7UA 1Z48A 1GYNA 3ABRA 4HNVA 4O10A 4JTSA 1HL2A 2WPBA 3SSJA 3LHWA 1SSGA 3LCGA 2DZWA 2QCDA 2WO5A 4EF9A 2CZDA 5FEZA 2QJGA 3OIXA 1KTNA 4H4IA 4K38A 3NOEA 2RHGA 3W07A 4CQ9A 1SW7A 4BFAA 2G96A 3IRDA 3FA5A 3R12A 3MI6A 1LRNA 5HR6A 2V8ZA 1DORA 1FWTA 1EP3A 2XN0A 2I14A 2QJHA 3PM6A 3QH2A 3SY5A 1ZFJA 4N6FA 2F7FA 1AW2A 2NUXA 4Z1DA 2QCEA 2NV2A 4O12A 4K8EA 3H54A 2E6FA 3SJ3A 5FEPA 1KTCA 4QIUA 2A4AA 1EA0A 1SFLA 5AYZA 1WOAA 1W8SA 3QQ0A 2ZCGA 3TR2A 4JR5A 5D2WA 1DVJA 5I3IA 5K7JA 4WQ6A 4O1AA 1JJKA 3R2GA 1OHLA 3N34A 4JY9A 5F4XA 1TB3A 5AFDA 1XBVA 3P81A 3M0ZA 1H62A 1VCFA 2V30A 3VCRA 2V9DA 4WY0F 4NQ1A 4X22A 1IXOA 3GDRA 1EIXA 4LY8A 3S5OA 1OG0A 1YPIA 2PCQA 3QF0A 1JUBA 5LGXA 5LNRA 1PCKA 5AB3A 3A21A 4JX6A 3WK1A 2A7RA 3EEGA 3W2NA 3DFQA 4QITA 2TPSA 2WSRA 1R30A 5HWMA 2DZVA 4AMAA 2YFNA 3B0VC 4WY0B 4ZL1A 1ZNNA 5IBXA 1WBJA 5DELA 4AXKA 1H1YA 5D33A 4P61A 2LLEA 3E49A 3TC7A 1LBMA 4Y9AA 5C6MA 4LV4A 3NL5A 3TW7A 4I7WA 3K30A 3P60A 4N4QA 5I3HA 4DO5A 3G0SA 3TDFA 1M7PA 4UFKA 4UFHA 3STFA 2HSAA 1XCFA 5DY2A 2ZZ2A 3UNDA 3PUDA 3PY2A 3L9CA 1W37A 1T0OA 3PC0A 1YLVA 3W87A 5ABTA 3LX9A 1OX4A 1C9DA 4HSNA 3C2EA 4LTSA 1WXJA 3W7PA 3M1ZA 4K37A 3G22A 4O28A 4ZQOA 4GNJA 1SU5A 1P5BA 3MBFA 1F7BA 3IGXA 2YFOA 1SZNA 3KVMA 3OVPA 1AL7A 3KRSA 4JTEA 3UZ5A 3TSDA 2YPIA 5K2ZA 3A22A 4S2BA 1TTJA 1OX5A 1LM1A 3B0UX 4A21A 3OVQA 3LERA 4CCEA 5D32A 3G8RA 4WJEA 3W7GA 2OJPA 3TJXA 3L66A 4MY9A 3IIZA 5TQLA 3LV5A 1BWLA 2ZZ1A 2DORA 4XKYA 2X1SA 2C1HA 1I2RA 3UZJA 4LC6A 4KFOA 1O5XA 3WJZA 5FF2A 2TMDA 4JTGA 3M7WA 3QRHA 3LTPA 4LUIA 3NQAA 3W6YA 4NXSA 2VFHA 3HMJG 2QCCA 3VNDA 2ZZ7A 5CGQA 2ZTJA 3RLUA 3P7YA 2X16A 4CQAA 1FWRA 3DH7A 4RLIA 2G95A 1EP2A 1N8FA 4MZ1A 2J88A 1M7OA 3DU0A 2VC6A 4PTNA 4UFMA 2CLLA 1OFBA 3TQKA 3FFSA 5AHMA 3TAOA 2ABAA 3RMJA 4CCCA 2TYSA 5F2MA 3KAOA 3NEVA 2ZRXA 4FIQA 2TRSA 4AAJA 1UUOA 2Q8ZA 4Z1BA 1OFRA 1SQ7A 3AJXA 1HFBA 4DPPA 3CHVA 3PF3A 2ZYFA 5F2LA 4M6VA 4X2RA 2OX1A 3T7VA 5BMWA 4Z1CA 4JY8A 4L4LA 3LB0A 3SECA 4UTIA 3O6DA 1G4SA 4RZ5A 5K3VA 3W7MA 4AHOA 2A7PA 1QO2A 3LTSA 1XDLA 4ZQCA 3W2UA 2XN1A 2WV8A 3FLUA 4ZQPA 1MEHA 2QDHA 3G1YA 5HWNA 3OHIA 4ZQNA 1VH7A 5G1TA 2QJIA 4NJGA 3LM7A 1Q6LA 2F84A 1TPEA 4WY0A 2QF7A 3CTLA 2G5WA 2NWSA 1J5TA 1VS1A 1KW1A 5TBOA 4NJJA 2RDUA 1ME7A 4I9AA 1NF0A 2CU0A 3EWXA 3B05A 3P67A 2Y7GA 4BF9A 1CW2A 3T44A 3RU6A 1JRCA 3N19B 4IMFA 1WDWA 4Z0SA 4Z0JA 3MP3A 1OYBA 4M19A 5K4XA 4OQVA 2P0OA 2WQPA 2C19A 4WX2A 3G3DA 1OYCA 1U5JA 3G1VA 1WAUA 3B0PA 1TPC1 2E77A 4OE7A 3NQ8A 4LS0A 3HPSA 3PBYA 1SW0A 3UWVA 3O05A 2PRHA 3UY8A 3LCLA 2ZDRA 1FXQA 2RFGA 4IGHA 3L0NA 1GEQA 1GG1A 4C1KA 1KBJA 3QSTA 3TV8A 1XFBA 3W71A 3LRKA 3MWAA 3DFSA 4RZ4A 4FNQA 3CPRA 3A5FA 4HN4A 4UMCA 1K8ZA 3A24A 4LVBA 4O1BA 1ALDA 4HNUA 5FEWA 1PCWA 5HMSA 3OG3A 5HJLA 1FCBA 4K6AA 5C54A 4MIMA 3CWOX 4WOQA 4DBEA 3MP5A 1HO4A 1A5BA 1FDJA 3QFEA 5C5YA 3BGJA 2E6YA 1H51A 3M43A 3GKAA 2WSYA 1O5KA 1Z44A 2FTPA 5BRBA 1QO5A 2VEMA 1I8JA 3S5YA 2YDAA 2FPYA 3FYOA 2NXHA 3INPA 4OBTA 4FHAA 2Z6JA 3TFCA 4GJ1A 4LRTA 4QSHA 3M5XA 1FBAA 4TIMA 3FEMA 3VI2A 4R7JA 3W23A 3MHGA 3CEUA 2O7QA 1RZMA 2B4GA 5DN1A 2Z6IA 1VJIA 3EWUA 3OVRA 2XN2A 3GVGA 5HUPA 3IIXA 1LRQA 3S1UA 5A8GA 2H3DA 2QUVA 5KTLA 3UXDA 1D3HA 1DV7A 4HHPA 3EKLA 4G1KA 3UWQA 2J24A 1F6KA 1B4EA 1F6PA 2CLOA 3GK0A 3QMRA 2IQTA 5G4EA 1TTIA 3NYZA 2C13A 4Y8FA 3HBLA 4AEOA 1KFKA 4ORMA 3GDLA 3CIXA 1JCLA 5I3FA 2V5LA 1G6CA 4Z1AA 3M5ZA 3UPBA 2DZTA 4W9TA 3LBCA 1OF6A 2DJXA 4FNUA 5LHEA 1ZHAA 4AB4A 4BI5A 2ZZ6A 3RNDA 2XFWA 1F05A 4AF0B 2FPVA 1H60A 3SGZA 3N14A 1HUVA 3FKKA 1YTDA 1X6UA 6ALDA 3SW6A 3GAYA 4NVTA 4YCPA 4QISA 3UYCA 4U4MA 5KSWA 3BLIA 1JQXA 3R89A 4E0CA 1IXNA 5E93A 1FDZA 4S2CA 4NJIA 4NZJA 2ZBTA 2X1TA 2AGKA 1AW5A 1VCGA 1OFEA 3DFPA 1TQXA 3VE7A 4R53A 3C2RA 1G67A 3M16A 2EAWA 2PRMA 2QCMA 4RXFA 4Z08A 1R2RA 1FWWA 4N9BA 5EPDA 1X1ZA 3UWYA 1SO4A 1JCXA 1VRDA 3V75A 1H5YA 2Y62A 4ADSA 4Y96A 2P10A 5BNKA 1ZENA 3ZFHA 4UTLA 3SFKA 4GXMA 4R33A 2E6AA 2A6NA 3W72A 3TQ0A 4DELA 3A5VA 2CWNA 1AK5A 3MMTA 4IPIA 4NX5A 1FCUA 1ICSA 4LC8A 4LS1A 5CZJA 4FX8A 3SI9A 2A2IA 2QAPA 2DZPA 3W74A 1W5OA 1XI3A 4XBKA 3G1XA 4R34A 1TPUA 3KVLA 4FIRA 1BTMA 1TTQA 3KXQA 3RK8A 3O1NA 4AHPA 4LW7A 1QOPA 2E6DA 2H6RA 4JTUA 3HG4A 1X8FA 3MYOA 3W7CA 1XKYA 5LNUA 4MY8A 3HGSA 4DQWA 1LRTA 1DQXA 1W5QA 3QW3A 5L6UA 3HG5A 4AWUA 3P84A 4XTIA 2JGYA 3W2LA 4U28A 4GUGA 1TV5A 3MUXA 2DZSA 3CQ0A 4RV8A 3W7EA 4IMGA 2ALDA 3TROA 1L9WA 3OBKA 5K4ZA 3M44A 1H7RA 4D2JA 4JD4A 4M6QA 3GXNA 3S8HA 3W1UA 2OZ0A 1LORA 1SR9A 3MJYA 4O18A 2VFGA 4QQ3A 5F2IA 1TV7A 5CZSA 2CFFA 4NNCA 4O4VA 2VFIA 2JKEA 3C56A 1LTDA 1QPOA 1VLWA 5H2ZA 1AL8A 2QR6A 3UPWA 5F1UA 3N9RA 4FF7A 3FJLA 2PC4A 1O4UA 4NT0A 2C14A 2RH9A 1EX5A 3KX6A 4WD0A 3RFAA 3W7IA 3NVTA 1Z42A 5J5DA 4JEQA 4LS2A 5HUOA 2NX9A 4JTFA 3BW3A 3TSBA 1PV8A 4EVZA 5I3GA 5C2XA 2YZRA 5AHNA 3HGJA 1OFQA 4IQLA 3W70A 1THFD 3QYQA 4E38A 5SWUA 2OMAA 3TK7A 1DBTA 2A7NA 4Q32A 1KM3A 3IGUA 4ZZ9A 5LNVA 5KZEA 2ABBA 3F4WA 4HIBA 3F03K 2VKZG 1JCMP 5EY5A 4A2RA 3C3NA 3CEPA 1EUNA 2R8WA 2NX3A 4MYXA 3HOJA 1GVFA 3FKRA 4P2VA 4FNRA 1NEYA 4FO4A 4FEZA 4AWTA 2Y7EA 1F74A 3M5VA 5KZDA 2GVJA 4M6PA 3LRLA 2YYTA 1NF7A 2QCLA 4QJ1A 1X7FA 3W75A 1J2WA 4MLRA 3HPZA 2KZHA 2VFFA 4S1FA 1H61A 1KM1A 3W7HA 1QR7A 1CI1A 5CZ0A 4LVDA 4X3ZA 1F76A 3L21A 1ZALA 1FX6A 4CCDA 5CPOA 2GPTA 1SUXA 4M7TA 2FJKA 1S5TA 4OHQA 2V2DA 4FXSA 4YMZA 2RDTA 4O1CA 5AHEA 5DY3A 4HPJA 2JBMA 3NAVA 2HS8A 3M9YA 2FB3A 2GQ8A 3CWNA 1DOSA 3DI0A 1T99A 1ZAHA 4LVGA 1R2SA 1W5NA 2VFEA 1B57A 1KA9F 2JK2A 4PFMA 2NX1A 1VPXA 2ATSA 3QJAA 5K9XA 5LKYA 1GWJA 4OGZA 3CU2A 3LV6A 1OABA 2ZRWA 4JTJA 4GFSA 1OF8A 1W3TA 2H8XA 3BVJA 2FIQA 1H1ZA 2GVLA 4AVFA 1MO0A 4WZHA 2A6LA 2QCNA 4UNLA 2W6RA 3NZ1A 3GDKA 1LBLA 1OFOA 1Q45A 1T96A 2ZRUA 3D0CA 3N9SA 5HINA 1XUUA 1LLWA 1R46A 3E96A 5E0KA 4UMBA 4UR7A 2NWRA 3TFXA 1MSSA 2CZFA 2BX7A 1PIIA 1S3HA 5I3KA 3LHYA 3OA3A 2E5DA 3U8GA 1I45A 4MZYA 4MY1A 1TPDA 3ELFA 4UNKA 1XUZA 4UTWA 1Y0EA 4JYFA 2CLEA 1YPFA 3EWZA 5L9FA 4PODA 1W56A 1XBXA 1TREA 3BARA 3BV4A 2QUUA 2H3BA 2ZZ5A 5H91A 3NDOA 3THAA 3DKJA 2X2GA 3M6YA 4JX5A 3MBDA 1UB3A 2QUTA 1EUAA 4UTMA 3GNNA 5LSMA 3C6CA 4ORIA 4ICNA 5G4WA 3KRUA 1UASA 4JYDA 1KFJA 2Z0IA 3VKJA 3QPZA 5D02A 3HB9A 3HJZA 3G0XA 2DZUA 3LLFA 2X1RA 3I68A 3EKZA 3DFOA 5G2IA 3O63A 4UTWC 3NQ7A 4EWND 2GJNA 1VHCA 2W0UA 1ADOA 2ZRVA 4ONVA 2GJLA 1P0NA 3PG9A 1QPNA 3BLFA 2VXNA 1NAL1 2CLMA 3NQGA 3O06A 3P5ZA 4IOTA 3G1FA 4GUIA 3BK0A 3LXBA 4UR8A 1GPWA 4UFLA 2EPHA 3TKFA 4NX0A 4FNPA 3L5LA 3W7OA 5IM51 4HPXA 3KFTA 1RD5A 3GDTA 3BW2A 3H53A 4JTIA 3NQVA 1ME9A 2HMCA 4CQ8A 1SO6A 3PSVA 5CPMA 1EB3A 3B03A 1HG3A 4K7YA 4O11A 1GVSA 4JTLA 1IXQA 4RX0A 3L2IA 1T8XA 1I4NA 4K36A 4UMAA 5DCBA 3L5AA 4AWSA 4ZQRA 1MEIA 1IIHA 1OVDA 4Q4KA 3IGSA 2V82A 2CLHA 3IIPA 4ADTA 5BMXA 4UTTC 1I2PA 4GRSA 4B5NA 4IXHA 3NR0A 1SSDA 3DENA 3SR7A 1UCWA 3C2FA 1TYGA 4MJMA 2P1FA 3LRMA 4RJEA 4WXZA 5KITA 1JRBA 3WJSA 2C15A 3NQEA 2R94A 2A0NA 1TV8A 3E0IA 3UD6A 3PS7A 1D3GA 2JKPA 2HTMA 2V5BA 2V2CA 1P1XA 3A23A 3FYPA 3TIMA 1QMLA 4Y6GA 1K02A 3B8DA 3BLEA 3SZ8A 4GC4A 4LVFA 5CPNA 1FDYA 5G2WA 3BG5A 3O15A 4YWIA 3T4CA 4JIQA 5D38A 2FLIA 3W2MA 1FCQA 3JRKA 3HG3A 4LT9A 3QM3A 3IVSA 4TO8A 3NGJA 5D2TA 4DF0A 3I65A 3NM1A 3PULA 1PHWA 3L68A 1QCWA 3Q58A 1OJXA 1OK6A 1O94A 1L2UA 4DO6A 1TCDA 2Y7FA 3LXAA 1H7WA 1FUYA 1HTIA 3TA6A 2YSWA 2B7OA 1KM6A 1YADA 4XQ6A 2AAMA 4JTHA 1QWGA 2O7SA 2YW4A 4PEKA 4WOZA 2GQAA 2NXGA 5EA9A 1NFBA 3DBPA 1SO5A 1RPXA 3GDMA 1GTEA 1KM2A 3HO8A 2FDSA 3AO0A 4N6EA 2YGYA 2NXIA 1YXDA 2CZEA 3TUUA 2WNNA 3CLMA 3QMSA 5D37A 4RZ6A 4XUGA 1B4KA 3ZS4A 3C0JA 3UQNA 3CB8A 1JCJA 4UXDA 1AW1A 1A5SA 3DAQA 3L0GA 4K8HA 4UCGA 1G4TA 3GR7A 3P74A 2ZA1A 4N9EA 3QEZA 2NZLA 1XDMA 1EP1A 4MUZA 2E09A 3P5YA 1TPWA 1GVOA 3V1PA 3U6WA 5G1YA 3W1RA 1OK4A 2CZ5A 3HIJA 3L65A 3O6YX 2B7PA 1I2OA 3DXIA 3WK2A 5DXXA 5D05A 3L0KA 1B3OA 2ZA3A 3LCWA 3HGRA
chains in the Genus database with same CATH superfamily
1P43A 1ISWA 4IPJA 4ZA0A 2R91A 3ZVHB 2YW3A 4N9CA 1XLIA 1JGMA 4CCZA 3TCSA 4YNGA 4ZSTA 4IQJA 4ZOAA 3N1AA 1VEPA 3EMZA 2MNRA 4FR1A 1MFVA 1CEOA 1GQKA 3RO6A 4DZIA 3GB6A 3LU2A 3GG8A 1NWUA 4OBRA 4IPLA 1QPRA 2VQUA 2QXWA 2OSYA 4KWWA 2UV8G 4PMQA 2A3AA 3W1TA 1FVPA 5A8QA 1UWUA 4QM1A 4AFYA 2D3NA 3MP4A 3AAMA 2JKAA 1PWLA 2RJGA 4NZFA 3LI1A 4GO9A 5A6TC 3ABSA 4JFWA 3FAXA 4JNMA 3RILA 2J9YA 2PFHA 3AU2A 5MHBA 4CD7A 1TWDA 4BK9A 2RGLA 1J0JA 2YA2A 2V5JA 3Q65A 2HK0A 4ZOCA 1WZLA 1E9YB 2F2HA 2Q3RA 4BI6A 3NQFA 3LMZA 1T7LA 3N73A 2E1WA 4DNMA 3TZNA 3DHFA 3PJTA 4X60A 3THCA 2WHJA 2Y63A 4MGGA 5KINA 4Q6XA 1XIBA 8XIAA 3WLLA 4MPKA 5CZTA 4P8WA 1WCGA 2XIJA 2AQVA 2ZVRA 1J96A 3SRDA 3J7HA 3N9KA 3F1QA 2Z29A 2WKJA 1BSIA 3UVIA 5F4SA 1V3IA 1RAKA 1PS9A 1HVXA 1R8LA 4M8UA 3M6DA 4UNIA 1DP0A 3LGGA 1YDNA 4GIAA 2D0GA 1WP6A 1UH2A 4IIDA 4IGMA 3FIGA 3IGHX 5G5IA 4AZCB 5I00A 3NJ3A 3THUA 5DCDA 4L61A 5HJYA 1V02A 4NL1A 4XG1A 4N02A 3IK2A 3G1SA 8A3HA 1WA3A 4G7EB 1C8XA 2VNCA 3W27A 4R9OA 1FHLA 1GKQA 1O5QA 3RYSA 3M0HA 3N3MA 3SIZA 3WEOA 3AU6A 3LQLA 2V63A 2ICSA 1XD0A 4UQDA 4Y7EA 3T42A 1E71M 1REQB 2G50A 4WUIA 2PD5A 4B92A 4XKYB 3TTEA 1PKNA 4V2XA 4IX2A 3TYUA 1FWCC 4US5A 1CXKA 3PSWA 4J3VA 2Y1HA 3E2VA 4W84A 1QDSA 3OLEA 2Y8UA 4GYPC 4CD4A 2CLIA 3I6RA 3CZ8A 1YX1A 1DE5A 2OYMA 3W86A 3ICJA 3VC5A 1OFAA 1VBUA 3C61A 3MMDA 1PSCA 4EACA 1LUCA 3UG3A 2IQDA 4AZGA 5DRIA 2WC4A 2CBJA 1KCXA 2VGGA 4KCWA 1GJPA 3WMLA 3SCVA 1PWMA 4DYKA 4UTHA 3LA4A 2V5DA 4XBSA 4IMAA 4URIA 1BAGA 1TO3A 4HD5A 5EFDA 1UA7A 3ARQA 3GHRA 1K3UA 3EWYA 4HN8A 2HPIA 1W32A 1OIFA 4XAGA 4N4PA 3WDRA 2BVWA 1XBZA 1W1IE 3SY1A 4ML9A 3TMQA 4AD5A 1A5AA 1ZBWA 2A1YA 4M1BA 4O4WA 1BWKA 3CPGA 2AKZA 3WD0A 3FJ6A 3W1LA 3PB2A 3TCEA 2E40A 3PAJA 1C92A 3TJIA 3TEVA 1S5MA 3DHUA 4FXFA 2HCVA 3W6MA 3W1MA 4LPCA 4CNPA 2B7NA 2CHRA 3N17A 3C0SA 5HQEA 4AH7A 1ZAJA 3XIMA 3ZR6A 2HISA 4FNTA 1VZWA 2YIHA 1XC4A 2JIWA 4FOUA 1V6TA 4O13A 1KM0A 2B81A 5AC4A 1PTGA 3LNMA 1XLAA 1UUQA 3RHGA 3W84A 5IBXC 1V8EA 4XAFA 1XSIA 1KRCC 4K39A 2E5BA 4HPHA 4DBDA 5D09A 4PTXA 1TUFA 2GGEA 4PC8A 3LZ3A 4L80A 4RCXA 1NWTA 1XLMA 4ZB2A 3ATYA 3IUHA 1WV2A 2V2HA 6TIMA 1R6WA 2QV5A 3VFLA 4LAKA 1US0A 2I9EA 3GXTA 2YXGA 4QS5A 3T9PA 4AIEA 3NXFA 1W91A 1RCOB 3MUAA 3WQ6A 1LYXA 2VEIA 1UOZA 3MPGA 4ZGYA 5HANA 4BWLC 2QVHA 3TQVA 4TTGA 1GCYA 5A5WA 5HR7A 2WJEA 2WSPA 2D0HA 2YR1A 4B16A 3KVKA 1CX9A 4HNNA 1DHPA 3CQKA 3PUEA 2W91A 3VIIA 1QNPA 3BQ6A 3G1RA 4K3ZA 2PD9A 1GTHA 4GUHA 3S9IA 3CUXA 1TPVA 4XZWA 3V7PA 3KOYA 3S0CA 2ZE3A 4ML4A 4IUOA 4EKJA 1Q8JA 1XG4A 1JQVA 5LXEA 2FHFA 4CEUC 3UWEA 5EYWA 3IUIA 1W0MA 3CT7A 4P5UA 1JF6A 3K1DA 5EMMA 3CB3A 5M17A 4MOZA 5DMNA 3W7NA 1RPKA 3V5FA 4Q6JA 1M01A 2P8BA 3IAPA 5CC7A 2G4JA 1JDCA 1C7SA 1JXJA 3BPWA 4PMXA 2VEGA 1EPXA 1U2YA 3OGRA 3PJUA 2BY1A 1O66A 4XZBA 4BA0A 1XXXA 1EJXC 2WMFA 1A49A 1DQUA 1YNQA 3DEQA 3ZWSA 1XQKA 3ID7A 4U3CA 2PS2A 1XL9A 3VUSA 4ENLA 4C60A 3R5EA 3STGA 3IV3A 3TE9A 5T9CE 1VBJA 3Q94A 1RY0A 4HNTA 3VOHA 4HTYA 1ITUA 4EIVA 4IQEA 3VOFA 1GHSA 3WD2A 4W85A 1V6XA 3OA5A 5G2HA 2JQXA 3S6OA 1I9CB 2PWHA 4PMUA 1WKYA 2CNCA 4PMNA 3QYSA 3UWWA 1DJZA 5F2GA 4IJCA 2A79A 3RF9A 3MI2A 4KT2A 3BG3A 2XVKA 3ANUA 5A95A 3AZRA 1KTBA 3G1DA 3TN5A 1I2NA 2NT0A 2OLHA 1W54A 2PDQA 1HJXA 3WH8A 2FZ9A 4PL2A 1EZ2A 1LCOA 3BLKA 3BAWA 3IANA 2V81A 1K4HA 5JIWA 2A3CA 4QG9A 3ZO9A 4JIEA 3NUKA 1SO3A 4XZHA 4UTUA 4B3KA 1K7FA 2ACRA 2Y89A 1M9HA 4AC7C 4M1RA 1ZJAA 3W2KA 3T1GA 3HPAA 3IEBA 3GX9A 4MLJA 1OGSA 5LXXA 1KB3A 5KZMA 1SVDA 2D2JA 3MANA 3CL7A 1K77A 3W7QA 2OEMA 3RJXA 5FSEC 2NV1A 2C0AA 2EEXA 2VVSA 3EX6A 1EC9A 2ZA2A 4UTJA 1V0NA 3Q2DA 3UG5A 4C90A 2P88A 4AQLA 1DJQA 2DH3A 2WBKA 4UFIA 4AUBA 4AU0A 1SZRA 1IEVA 1VLIA 4E2BA 4J2MA 2VEKA 2UY5A 3OJGA 4ZO7A 1W5MA 2XGIA 4H00A 7TIMA 5I3DA 1I60A 3DZ1A 2Y4SA 4YL2A 3C8FA 4NILA 4AXNA 3KCOA 3VD7A 1U33A 1KXVA 2ZRZA 4LEFA 2QIWA 2PF8A 1T5AA 1FWNA 1KFLA 2EPKX 4LBRA 4D6HA 1KCLA 3WJYA 3C2OA 2D20A 1MW1A 4FZIA 4A3RA 3VDHA 4GISA 5LIYX 1WZMA 3AI0A 2V0TA 3A4AA 2F38A 2FTWA 3MSDA 5JQ9A 1AZ1A 5KEZA 1F3XA 4Z1YA 3RM4A 1L6FA 3S6TA 4NNBA 4TMBA 7REQB 3V5CA 3ZJ6A 1V02E 5HMDA 1QI5A 3IJ6A 3N6HA 4R7OA 3T2QA 3MKKA 4YLWA 2VFDA 3THDA 1QT1A 2OYLA 1E6PA 4D6EA 1PE1A 2DJLA 1UKOA 1JYNA 1W3LA 4HU4A 5JBFA 3W7JA 3OBEA 3GC5A 1ITXA 2OT0A 2FJUB 1EJ7L 4O17A 2YDSA 3I7RA 2OWXA 3AWNA 2FB2A 3IAQA 4L64A 1JD7A 1GT8A 4JDBA 3V0SA 3RDKA 1VEMA 3KHJA 3UW6A 5TF0A 1YXCA 3LENA 3S1WA 4PRWA 3NL6A 5FJTA 1B9BA 4E2VA 4PTMA 1I6NA 1RUSA 4R9XA 2ZZ3A 2ZRYA 1KWKA 4F3HA 3A13A 1IR2A 1WB0A 3DECA 3HFTA 1CNVA 4ES4A 1PEZA 2C6QA 5G1MA 1C8YA 2ZVIA 3UXKA 3TZFA 3LI0A 4KWVA 1RVGA 1IT7A 4O50A 4JKKA 4Z17A 3G8EA 3EMCA 1K9DA 3UG8A 1LOQA 2W9MA 1GQIA 3WQCA 4UWMA 1KM5A 2E25A 2D73A 3ZQ9A 2ZX9A 9RUBA 1MDRA 3H6OA 4Z2HA 1DJWA 5ECUA 3W76A 3WN6A 2NUWA 4YVVA 3ABRA 3MSGA 2H9AA 4O10A 4JTSA 2WPBA 3LHWA 4EAYA 1TIWA 4EF9A 4IP5A 4UZSA 1HP5A 8RUCA 3ZYZA 4HA3A 4H4IA 4K38A 3NOEA 1GHRA 4IPNB 3EAUA 2O4MA 2HK1A 4CD8A 1J11A 2WCSA 5HR6A 5GJMA 1TVNA 4XSLA 1F07A 1XF0A 1EP3A 2I14A 1AMYA 1OC7A 3B0XA 3DYOA 4IUGA 1QUMA 3N2BA 1BSLA 5J04A 1VFTA 2J62A 1BYBA 4WEVX 3HJEA 4HMEA 5I23A 4JR5A 1P0DA 2OWWA 1S3TC 2ZUSA 4WQ6A 4GC3A 3TR9A 5IHSA 4O1AA 5E6ZA 4ZFCA 1TB3A 1Y65A 3M0ZA 2IPFA 3AXMA 2V30A 3VCRA 2Y2WA 2C7FA 4NQ1A 2GDQA 1IXOA 4LY8A 1DWAM 1OG0A 4B4HA 1PCKA 1R3QA 5AB3A 3A21A 3GIPA 5A8MA 3TN4A 2A7RA 2WSRA 4LCQA 2VDIA 5HWMA 4AMAA 5AVNA 1E0XA 3VIFA 4EK7A 4ZL1A 1XSJA 5IBXA 1FH9A 4U2ZA 3RUBL 4P8XA 4P61A 2NW0A 3CYJA 1LBMA 3HTWA 3HQOA 5C6MA 3GW0A 2PDGA 1DJIA 3P60A 5I3HA 4DO5A 3G0SA 4A3QA 1M7PA 1ZLPA 3V5OA 1XCFA 2QPUA 2XVNA 4EP8C 3CIVA 4KWOA 1W37A 5I24A 4AZCA 3LX9A 4JEJA 3T2OA 3W7PA 3WLQA 3M1ZA 4ZQOA 3TA9A 2BFGA 4GNJA 1SU5A 2ZX6A 1P5BA 3CGTA 1QU4A 6XIAA 1F7BA 2IS7A 1SZNA 4G7EA 3SN1A 2OZ8A 3KRSA 5A8PA 1MYRA 1ODZA 3TSDA 4DI9A 2BHYA 3NURA 3KOWA 3PPGA 2XUCA 1RK6A 3MS8A 4LYQA 1LM1A 3LERA 4Q8TA 3W7GA 2DVTA 4QDPA 2XZ7A 4AX7A 2P8CA 4FP1A 2DORA 4UR9A 4XKYA 4Q22A 4FMVA 4D71A 1XLEA 1YBQB 5FF2A 4PTVA 3NQAA 1A4MA 3N13A 1RD6A 2FMNA 2VFHA 2QCCA 2R1KA 4JHZA 3VNDA 4B5SA 3HMJG 4GZEA 3P7YA 4HQVA 5EMJA 2G95A 1EP2A 2FVLA 3B40A 2I16A 2VC6A 4IGNA 5GJNA 4PTNA 2CLLA 4NZ4A 5AHMA 2WZIA 3CUFA 3RMJA 2XINA 1A5OC 2VUYA 5F2MA 3NEVA 2ZRXA 4FIQA 1JD9A 1XRVA 1S46A 2Z1WA 2OLSA 4KW2A 1HFBA 4YS1A 4DPPA 1NFGA 4J7RA 4W8AA 5F2LA 4TOQA 1S39A 3TYAA 3O6DA 2NQZA 2X0SA 3N25A 2P50A 1WDSA 1BG4A 3W2UA 4IL2A 2XN1A 3MKVA 5A2AA 1B54A 1W9VA 1XD1A 4ZO8A 2IPJA 3QHNA 2QJIA 2DSZA 2Y5SA 4LH8A 3VO0A 3D3AA 4QLJA 2G5WA 2C1IA 1J5TA 2EXOA 3M7SA 4RPPA 4D6JA 4NJJA 3JUGA 2RDUA 2CU0A 3GFZA 1WDRA 3BOXA 2Y7GA 4X61A 1CW2A 2GSJA 3VVGA 3LQGA 1XIMA 2BOFX 5FIPA 1J18A 1DIOA 3MP3A 4U2YA 4WX2A 3G3DA 3NVDA 1U5JA 3H22A 1WAUA 3EZ4A 1LF1A 1A5LC 1B3XA 3HPSA 3UWVA 1DWJM 3O05A 2YCKX 1JZ8A 4IGHA 1TR9A 1EDTA 4C1KA 2XVLA 1XFBA 3DFSA 4RZ4A 4FNQA 4F79A 3A5FA 4NKCA 1S1PA 4HN4A 3SRFA 4FPSA 3IACA 3KBJA 1VJSA 1W3KA 5A6AA 4RE3A 2CCRA 2JE8A 3DDMA 4ERAA 3I6EA 4B5VA 4MIMA 2OVLA 3BOFA 1QNSA 4CQDA 4PFHA 1UR2A 4J1OA 3AIBA 1UKTA 5MKGA 4GYJA 4E8DA 1QO5A 2VEMA 1I8JA 4R3UA 4UQAA 2NSXA 2YDAA 4HSHA 3FYOA 4OBTA 2GUBA 4GJ1A 4F0LA 3M5XA 4TIMA 3IV8A 3FEMA 3UZYA 4R7JA 2VM8A 2PTYA 1XLDA 1OG6A 1HP4A 4S3DA 2O7QA 4D72A 3U5YA 3GTIA 4MNJA 1J10A 1YKWA 1YE6A 3OVRA 3IIXA 1OC5A 4I8DA 1Q7QA 2IKJA 3ZT7A 3UJRA 4MMWA 4W8LA 1FTXA 3EKLA 1NU5A 3UWQA 3V1HA 3B8UA 2J24A 3VKBA 1UJQA 3UXLA 1F6PA 2CLOA 3GK0A 1CWYA 5G4EA 3CZJA 4Y8FA 4AEOA 1KFKA 4H8NA 2VO5A 4ORMA 3GDLA 3CIXA 4PMVA 1JCLA 3FCPA 4BQ2A 3BSHA 4NAEB 3K4DA 5CCZA 5RUBA 1FKWA 3HU7A 1ONXA 4ATLA 1BVNP 3LBCA 2DJXA 4MB4A 5LHEA 1ZHAA 4BI5A 2HDJA 4XX6A 1R87A 1PZ0A 3TTYA 3H4WA 3MZNA 1H60A 1UC4A 2WMJA 3FKKA 4F0HA 3AIVA 1HJVA 3R1ZA 3SW6A 3GAYA 4QISA 3FJ4A 5KSWA 3UXIA 3R89A 4E0CA 5E93A 1Z8AA 2XGBA 3BWWA 3GH7A 1MVYA 4KBXA 1HF6A 3PJWA 1G67A 4BEUA 3DC8A 3M16A 2GLKA 4XO6A 4RXFA 3WSUA 1W2VA 2J6VA 3G5EA 1VRDA 3UA3A 2Y62A 3QR0A 2CBVA 3ITLA 1GOKA 2UZ9A 4D1JA 2VJXA 2IXUA 3H7UA 3AC0A 3C0LA 4ZXLA 4DELA 1FCUA 2OKTA 4Y2WA 5CZJA 3SI9A 3VIKA 2J66A 3OZPA 3W74A 1W5OA 3RM8A 5BWFA 4NF7A 4Z2KA 4FIRA 1Z3NA 2BVTA 1EF2A 2X40A 3O1NA 4LW7A 1QOPA 1CB2A 1UQYA 1UG6A 2XHYA 3LN3A 2FDMA 5ABEA 3CQJA 3R8GA 2VD8A 1XKYA 1R9YA 2PZNA 1XICA 3HGSA 1LRTA 1ZL1A 5L6UA 3PBGA 4M6UA 1V3LA 4U28A 3FY1A 4GUGA 4B15A 3MUXA 3RG6A 1XFCA 2ZWYA 2ALDA 4WVXA 4S3AA 1NP0A 1XPYA 4D2JA 4JD4A 1P7TB 3WQ8A 4HU3A 2CXEA 5I07A 2EG7A 1E70M 1KKOA 3K1GA 3CHEA 4ZE5A 1IT8A 1ONEA 4PMOA 2YBVA 3PWIA 4QQ3A 5F2IA 2Y5JA 5CZSA 1B3VA 2QYGA 3VMPA 4NNCA 2JKEA 3W00A 1ISXA 1QPOA 5H2ZA 5EU9A 5REQB 3BURA 3HA1A 2J75A 1I0DA 2DDXA 2V38A 3WNOA 3IS4A 4Q8MA 4TX6A 3FJLA 2PC4A 4NT0A 2C14A 1OD0A 3KX6A 3W7IA 4TV5A 3NVTA 4L65A 3WUBA 4JEQA 4UCFA 3BW3A 4H9XA 5C2XA 3BXWA 4I5UA 3AYTA 4RNFA 4WJXA 3AIUA 7REQA 1H4PA 1JNEA 1GPFA 2OMAA 3TK7A 1DBTA 3AHYA 3IGUA 1HKIA 2VUNA 1S2CA 5LNVA 2GGHA 3E5PA 4DZAA 2X0HA 4HIBA 1BFNA 2YL8A 3CZEA 4ICCX 2QNEA 1HGWA 1GVIA 1PTAA 2R8WA 2IPGA 1NDWA 1GVFA 3FKRA 1A80A 5TNVA 4MB3A 4FNRA 4FO4A 4FEZA 4AWTA 1F74A 2VX5A 4LAUA 1OGGA 4W87A 3LRLA 2YYTA 1RJRA 4QJ1A 4NIRA 1PAMA 4S1FA 3DERA 3W7HA 1KM1A 4XZIA 1CI1A 2AMGA 4H8UA 3L21A 1FX6A 5CPOA 4B4FA 1R3TA 4M7TA 2FJKA 3MKCA 1S5TA 1MWOA 2D24A 2XPKA 2PDBA 3N04A 4QROA 1KXHA 4HPJA 1CGWA 3KBSA 3M9YA 1PKMA 1GVYA 2GUYA 4DUVA 1TE6A 4CVUA 2VFEA 1FWDC 1MW0A 4AYSA 3UCCA 4LF2A 1FWHC 4PFMA 1OCJA 4WHBA 3CU2A 2E67A 1OABA 2VR4A 1OF8A 3KP1A 1Y5WA 3OP2A 4PCTA 2GVLA 3I4KA 1MO0A 3WQEA 3RLGA 3SRHA 2QCNA 3DESA 1K4GA 3QV6A 2W6RA 1VFFA 2B31A 2IXVA 3ORWA 1LBLA 1EJUC 5HINA 4UTFA 1LLWA 4AZBA 3L4WA 1R46A 4XIMA 3W29A 4UMBA 3WMBA 3MUIA 3KE0A 1OCQA 2HXTA 1MSSA 1XCWA 3S5SA 2OQYA 3NTYA 3VKAA 3LHYA 2RDXA 1PZ1A 3ECQA 2J8FA 1UD4A 1I45A 3L4TA 4GVGA 1Y0EA 3EKGA 3RITA 4PODA 2E0PA 2Z25A 1LG1A 5H91A 1TJ1A 3OG2A 3BLPX 3M6YA 3EOUA 5HA7A 1XS2A 3BMXA 4XISA 2KX9A 3TWAA 2GJXA 4J3TA 3C6CA 4ORIA 4ICNA 3QGKC 3KRUA 1UASA 2WNWA 1KFJA 4QCEA 1X8CA 5FJPA 1EGVA 1GEHA 3G0XA 1TWWA 2DZUA 4M29A 1QASA 3VKDA 3NQ7A 2GJNA 4QP0A 2GQ3A 2X05A 1E5NA 3T6CA 5HOSA 3PG9A 1EX1A 1QPNA 4XBJA 4QGCA 2CLMA 1QRQA 3P5ZA 4IOTA 1OGBA 3BK0A 2J7BA 3LXBA 4UFLA 4C6PA 1V6WA 4S3KA 2D23A 4WDXA 4E8GA 2W66A 3EDEA 1RD5A 2R1LA 5A2CA 1VIZA 3HMCA 1ZU8A 3UZXA 1ME9A 2HMCA 3WF2A 1EPVA 2GFTA 4AVOA 4OJYA 1GVSA 1JGIA 2HWGA 1I4NA 4LCRA 3GXDA 1XLCA 4Q4KA 3IGSA 2CLHA 3GW3A 4B5NA 2CITA 3DENA 1UCWA 3C2FA 4QHRA 1TYGA 2P1FA 3LRMA 1DE6A 4TVCA 3BOLA 3VKCA 1JRBA 1MXDA 3CBWA 3K2GA 2A0NA 3K8MA 2W61A 1D3GA 3VX0A 2V2CA 4Q4SA 3A23A 3FYPA 3R8HA 1E9LA 1K02A 3B8DA 3SZ8A 4GC4A 3IPWA 4LVFA 5CPNA 1FDYA 1ISZA 2DUAA 4YWIA 3EDDA 1CXFA 1FCQA 3IVSA 2YL9A 3PULA 5I77A 1AQMA 1O94A 4DO6A 1TCDA 3MQTA 4E2OA 1FUYA 3ENLA 1HTIA 3TA6A 2FMOA 1V0LA 1YADA 4JTHA 1EO7A 2REQB 5HMFA 1WE5A 1PUDA 2NXGA 3PZMA 3PZIA 1OT2A 3KCLA 3VZZA 3GDMA 1L6GA 1J6OA 3LY0A 5EB8A 2WLYA 4C6DA 2Z26A 4I9JA 3JU2A 4R5EA 3WEZA 4DJFD 1NIUA 2ACUA 2BNJA 3AICA 1JCJA 4KQNA 1HL9A 1YBQA 1AW1A 4I5RA 3JVAA 4GXPA 3GG7A 4A8NA 3P74A 3C3UA 2ZUMA 4LYKA 3WUFA 1XDMA 2SFPA 4IIHA 4AZ5A 4MUZA 3ZJKA 3VGEA 4JZ5A 5JVLA 3MUY1 5G1YA 5CG0A 1SYTA 3O6YX 3DXIA 3WK2A 5DXXA 2PBOA 4K68A 3W6LA 2ZA3A 3LCWA 2PP3A 1IEXA 3HGRA 4P8VA 2QUMA 4PCFA 1XX1A 4CUCA 3VOCA 1DXIA 3CV1A 1D2KA 2J9ZA 2UY4A 5CPTA 1EJTC 1JF5A 4JKLA 5D2VA 1H7NA 4WK9A 1XLLA 1I2QA 1W3JA 2XWDA 1E6RA 1V3HA 5T26A 1XIJA 2BB0A 1ONRA 5FJUA 2E8ZA 4H2HA 1TFVA 3WQOA 4CNNA 3IVUA 3ATZA 1UD8A 4XZ9A 3PZQA 4GYFA 4G8TA 1W2PA 1TZ7A 3BUVA 4AY7A 1Q6QA 4H83A 5BOOA 3TMLA 1LDCA 2H90A 5J8LA 5LNSA 1B3ZA 4DXXA 5FF7A 1MZHA 2BOGX 1TV4A 2C71A 1JUKA 4TQTA 2DZBA 4DPQA 4DLMA 1S2TA 1A5CA 2PDPA 3R8RA 2E68A 4PMRA 4NUWA 2OO6A 1GOQA 2GOUA 5DT5A 3UERA 2O9RA 3WL0A 3H23A 3GIQA 5F1VA 4GABA 3BZJA 1JI1A 2YX0A 1XBYA 4PH6A 3WD1A 2ZDSA 2ZXQA 1VPQA 3UG4A 1J79A 1OD8A 1XRSA 5FJJA 3WQFA 3G1AA 2QZRA 2Z27A 3VNIA 2ACQA 4I6VA 2YJQA 3NZRA 3WL1A 5AC6A 4JAWA 4HKPA 4OV4A 1R9ZA 1ZCCA 4OWGA 4OBSA 3GZ3A 1LLOA 3O3RA 3FHAA 4KERA 4DF1A 4UC5A 3H2OA 4AX6A 3AMGA 2GWNA 3W38A 2L5HA 2PURA 3P82A 4OU1A 1BXCA 3EXTA 3DGBA 4NP7A 3MU7A 4FX7A 1HT6A 3QV9A 2B7QA 3WYZA 1C91A 3QV8A 5C2CA 3SUVA 1UBSA 1Q6RA 3QZEA 4TXEA 3EWWA 3HQ1A 1H7XA 2A21A 1E3ZA 4IJRA 2HNHA 1O68A 3W28A 1YTEA 1SZGA 3GY1A 4HZ8A 1CTNA 3LBOA 1B31A 3LLXA 1TV2A 3W1AA 3R7MA 1PX3A 1KBKA 1TMHA 2VEPA 5AHFA 5LA1A 2J27A 2GOKA 4REQB 3B8SA 4YYFA 1IV8A 4CN6A 3O7UA 4GI4A 2DEPA 1RA5A 3PBWA 5CBIA 4LV9A 2Z7KA 2GSEA 4L4MA 1GGOA 1X7IA 3W2JA 3TLQA 3QY6A 5C9WA 1FQ0A 4HCDA 1TJ2A 2Q01A 4JFTA 4O8RA 1QW9A 3V4BA 1Z6KA 3FHQA 3D6NA 5C9XA 1XM3A 4KFPA 1NSJA 3KHDA 2C18A 4LGXA 5I03A 2OZ3A 5CGMA 2EF9A 5C55A 3PNZA 4KEMA 4PTWA 3QC3A 2XM2A 1GQNA 3O16A 4G9PA 5IFTA 4D8AA 2Y6ZA 4LUSA 3E74A 2Y61A 1SJAA 5CSRA 4A2SA 3ARZA 1UKPA 2QV4A 3JS3A 1JAEA 1S5WA 1M03A 1O1HA 2IPWA 4RXGA 4D6CA 4DLFA 3GXPA 1TPH1 1PHQA 1WQ5A 1KBLA 4JNYA 3RLVA 4MYAA 1JCYA 1HKMA 3P8JA 3PTKA 4O1DA 3LEPA 4AY8A 5BOFA 3WZ0E 4A29A 4AHQA 2DW6A 4ZXOA 2EG8A 3P8IA 3VNLA 1W8GA 2QCGA 3IARA 3VNMA 1R3WA 4GI8A 1JYVA 3W7RA 1S5VA 4PZVA 4US5D 3TX9A 5KMYA 4N9DA 1HJUA 5FAGA 1Z7AA 4Q4RA 4HHHA 3Q37A 2Z7GA 3NL3A 1WPCA 4C6MA 3W1NA 3PVFA 2GQ9A 6ENLA 2DPEA 3W83A 2EKGA 2RDWA 3TW6A 4C65A 4WLCA 4PUWA 1OY0A 2Y85A 1V3MA 4C1NB 2HVOA 1HXJA 1NM9A 4NZ5A 2WVTA 4FI4A 5FJIA 1LLZA 4FAMA 4DZHA 3I7QA 1JEZA 4CLMA 3KRZA 4KKXA 3BAXA 1U1HA 1N55A 5BXRA 1HX0A 4B3ZA 4C91A 3BO9A 1OCNA 1KXTA 2ZX5A 4MKNA 2WC7A 3VYLA 3VDGA 3S5NA 1O5RA 5REQA 3EX2A 1UKQA 3QFWA 5FCZA 4S3GA 4LNYA 4QJ4B 3SUUA 3LCIA 3VOIA 1E9ZB 4JL2A 1QNRA 4DWSD 2WK2A 1Z9AA 4H04A 1MRAA 4ZB5A 3BGAA 4F48A 1A0EA 3WMSA 3DFTA 4O57A 3ES7A 1O1ZA 3Q4DA 4IGSA 3LCXA 1R9XA 5A69A 4JIPA 3FGCB 2WMIA 3W1XA 1RP9A 4UIOA 1FH7A 1H5VA 2DIEA 3BH4A 5CLTA 1RQEA 4C6LA 4EE9A 4WJ8A 4ALDA 4I5XA 4DHGA 1TCMA 3S83A 3EX4A 3FXYA 4CQBA 2FYMA 3VIJA 2J6XA 3P0WA 2AQWA 2P3EA 1BYCA 2WOQA 4IMCA 1X1NA 4I7VA 2BG5A 3VA8A 2IQ0A 3QTPA 4C6FA 4EXQA 1S2AA 4JS3A 3EOLA 3N2MA 2Z24A 1VKFA 4PA8A 1K70A 2OWCA 2XVGA 4NYYA 3USZA 4DX3A 2BLEA 3O6CA 1BYAA 3L2LA 3NCOA 1C8VA 4ZB0A 1XJBA 1K8YA 1MQPA 3UR2A 4QCFA 2G41A 1ZJIA 4TTUA 5HULA 1E6ZA 4AMCA 3DN5A 4MTVA 4K7VA 1RP8A 3M5YA 4NI8A 2O56A 2E28A 1RJQA 1W1A1 3CM4A 1NOUA 1M5WA 4D6GA 1PDYA 4QAIA 2WKLA 3OW1A 1OWQA 1QAPA 3RAOA 3MY9A 5DLCA 4S38A 4PSPA 2XH7A 4GUJA 1W9XA 3AXXA 4LJ3A 1FA2A 5XIAA 1ITQA 1YE4A 2QJNA 5D30A 3S2NA 2QDGA 1LWHA 3T55A 1H7PA 4F8XA 1C93A 1U22A 2DSVA 3OPSA 3BLDA 1M65A 2PCEA 2Z4GA 2J7CA 4JN6A 4JBRA 5A6BA 2PDNA 1YDOA 3ZIZA 5TAOA 2VELA 1IXPA 1DKWA 4DEFA 1TPB1 1RH9A 3MYPA 1A0DA 3OB8A 2WSQA 1SPQA 3HGOA 4GJIA 4KETA 4TR9A 1UIOA 5DF0A 5DBUA 3E38A 1TQJA 2HRWA 2XSAA 3URBA 1KLZA 1BRLB 2J8TA 4XK2A 4V1XA 1DEDA 2PDCA 3AROA 3TNOA 3TQPA 5ABHA 1Z32X 3WJXA 2QCDB 4HJWA 3VOJA 4EOUA 4L4OA 4KEZA 2WZMA 1TIMA 1HZYA 2WWDA 1BG9A 1IT0A 2GL5A 1A50A 1JCNA 5IOBA 5FF3A 5JBEA 3APTA 4WKFA 2R1NA 3GNDA 2G8ZA 1MW3A 4S23A 3W82A 2W63A 3EX3A 1M53A 3SSZA 5U7SA 1TTPA 4KCTA 1G94A 3N2XA 5I6SA 1XLBA 2J79A 1Q7ZA 2I5IA 5DXYA 3DHPA 5T9BG 2DUZA 1FOBA 4IMEA 5K9DA 1MQRA 3LCHA 3AS2A 3NO5A 3NZPA 3SY8A 5D03A 3UJSA 4EF8A 3TH6A 3LSCA 1CGYA 4XB3A 4ICMA 4P8UA 3SN0A 2PE4A 4O0QA 2YOCA 2VI0A 3G6MA 5BXTA 4MPQA 4QDWA 2VRJA 2DSKA 5DQPA 2ZFAA 1XWYA 2BXVA 4H6EA 1LROA 3DKLA 1CGTA 1DWFM 5FEXA 3TYBA 3ABOA 4LBSA 3CHDA 4L56A 4JYEA 3CAVA 1LOLA 3S9ZA 4H2CA 1R47A 4KF1A 4G7FA 4L6HA 1KLYA 3ITGA 1H50A 4AEFA 1DJXA 3AUJA 3KOZA 4X0NA 3AHVA 2I1OA 3EXRA 2OCZA 1Q7MA 4I7UA 4DI8A 4DF2A 1L6YA 2YDQA 3CNYA 4OTKA 1UD2A 1FXPA 3LPOA 3EWBX 1OSEA 3MHFA 3QHOA 2X41A 1JR1A 1V7YA 1FWSA 1G01A 4DWSB 4G1NA 1WYIA 4OIFA 1JZ7A 2WJZA 4D6IA 3WK3A 3H2NA 2C3ZA 2VT0A 4O53A 3WENA 4H19A 4ZENA 2NLIA 2W67A 1OX6A 4GWEA 1XC6A 3EX1A 3BAYA 4F0RA 3PWAA 1LOSA 3CH0A 3T78A 4NXKA 1IZKA 2Y5EA 3DFYA 2V3GA 2CKRA 3NQBA 4PMZA 5C7HA 1G7UA 1Z48A 4I3GA 5E6YA 1PIGA 3CUIA 1HL2A 1H2JA 1SSGA 3SUTA 2XZ9A 2D2OA 2CZDA 4GJJA 2JIEA 3AMKA 3ITCA 1B1YA 4CQ9A 4BFAA 3IRDA 3FA5A 3R12A 5C2GA 5FL1A 1FKXA 5GNXA 4HOWA 3T0TA 3CUHA 4DN1A 2CETA 2V8ZA 4IH3A 3GD6A 3H7VA 5A3HA 2GVEA 4C6QA 3GU2A 2XN0A 2QJHA 3PM6A 1Q63A 4DO7A 4GZJA 2NV2A 1KTCA 4QIUA 1XYBA 3WQGA 3W37A 3RPTA 2FZ8A 3CUJA 3WLTA 3SJNA 3U2CA 1A5KC 1KQZA 4J3XA 4Y9PA 4AD3A 3L4XA 4X0VA 3B3DA 3TNBA 5K7JA 1WDDA 2WZTA 2MANA 2V5CA 1OHLA 5F4XA 1XBVA 1VCFA 1YNPA 1A5MC 4F2TA 2Q6ZA 2VRQA 5DMLA 2OSXA 1YPIA 5BCAA 4ZBCA 1GKPA 1WKEA 3WK1A 4R85A 1UR0A 1VAHA 1Z89A 4FA3A 3A3WA 3OBAA 1R30A 3ZOAA 4JCLA 1S2VA 4WY0B 5DELA 3TC3A 1IEIA 1YRRA 5D33A 2VX4A 3UR7A 3TC7A 4Y9AA 4LV4A 4I7WA 3TDFA 4UFKA 4UFHA 1TG7A 1SFTA 3NDZA 4ECLA 4WSHA 2PDFA 4YTUA 1MNZA 2BP1A 3PY2A 1YLVA 2PDWA 1C9DA 3KS6A 1MI3A 4HSNA 3WLNA 1E6QM 3G22A 3WEMA 4CU6A 3IGXA 2YFOA 1QI4A 2XIBA 1GOMA 4AEEA 1HW6A 1AL7A 1W1B1 1BKHA 2F2KA 3UZ5A 4XSMA 3EOEA 2J74A 4RW3A 1XH1A 5DEZA 2ZKMX 2XG9A 3SCOA 3HN3A 5HJXA 4GPNA 1C9WA 2PWGA 4S2BA 4M3PA 2XWEA 3GFYA 4KMQA 3IJQA 4GLEA 5HNTA 3B8VA 2J13A 5GQBA 3OTRA 3OVQA 5I5RA 3QN3A 1WO2A 2WMHA 3C86A 3G8RA 1AJ0A 3AXHA 5M1TA 4MY9A 3H2CA 1UR4A 3IIZA 1BWLA 2ZZ1A 3C5QA 1QI2A 2X1SA 5A1AA 4HZ7A 1I2RA 4ZOBA 3UZJA 1ZB5A 1W9DM 4REQA 4QTGA 2HEJA 2OPJA 3PP7A 4JTGA 4L9YA 3EWCA 3UGRA 5M03A 3H2MA 2ZTJA 1TX0A 2X16A 1FWRA 4O1EA 3B9EA 4Q8VA 2J88A 1M7OA 3DU0A 5I09A 3WF4A 3LPPA 2CKSA 2AKMA 3NZQA 1XP3A 3SM0A 1YW1A 2GDVA 3UESA 4CCCA 2TYSA 3KAOA 3F4CA 4RZBA 4A3HA 3FSTA 2TRSA 4PB3A 3UZZA 4A8LA 4AAJA 5FSDC 2E4TA 3K46A 2CLPA 3EDJA 3CHVA 2IKIA 3PF3A 1E4MM 4X2RA 3T7VA 1OINA 4Z1CA 4JY8A 1X39A 3EWDA 2WWCA 4MKSA 5LIWX 4FOJA 3T4WA 5ABGA 1U5VA 1XDLA 2G3FA 3KLKA 4DJFA 2HQAA 1O7AA 5HWNA 3GXMA 3ARXA 3OHIA 4ZQNA 4FOKA 1VH7A 3OQ8A 4IG2B 4NJGA 1DJGA 3PZ9A 5FJOA 5G1TA 3LM7A 3PFRA 1D7KA 2NWSA 1VS1A 2FVMA 2NQ5A 5ECVA 3GH4A 1ME7A 4I9AA 3URQA 2G0WA 3OU8A 3B05A 3RU6A 3N19B 5E9AA 4L4PA 2O9TA 3LPFA 5JH2A 1OYBA 4M19A 4YPJA 2WQPA 4D6DA 1BHGA 3VGFA 3G1VA 4JQ4A 5XINA 2BXZA 5HDRA 3CJPA 4OE7A 3RPDA 4LS0A 3EGJA 3V18A 3LCLA 4NHVA 1FXQA 2UWFA 4D8LA 4HOXA 3L0NA 3AMCA 3GC2A 1FH8A 3W71A 4A4AA 6XIMA 4C1NA 3MWAA 2AL2B 3CPRA 1IEWA 4MG4A 4UMCA 3VGBA 5IDZA 4YWSA 3A24A 1BVWA 4O1BA 2VZTA 1EGMA 1ALDA 3T2PA 2DVXA 1PCWA 2GK1A 5HJLA 3DCPA 2ASHA 3HQNA 3B9DA 4D6FA 1HO4A 1TVPA 1FDJA 4Q7IA 3BGJA 2E6YA 1H51A 4AW7A 2WSYA 3WQWA 5BRBA 1CLXA 2A3HA 2HJPA 1A3XA 3S5YA 1QK2A 4MUPA 3F5JA 1EO5A 1Q8AA 4FHAA 3TFCA 1PB0A 4LRTA 1US3A 3V3WA 3BQ5A 3R11A 4L7ZA 2YA1A 3W23A 1V93A 3MHGA 2VEFA 3FGCA 3VNJA 3EWUA 2XN2A 3GVGA 2C0HA 5A8GA 3M0JA 4IP4A 1S1RA 1DV7A 4GD0A 3N6QA 3NSMA 3M0XA 4PCSA 2IQTA 4H6QA 1FHUA 4TX8A 2C13A 3HBLA 4U3AA 4C6BA 4GK8A 5I3FA 4KCUA 3H4XA 2VX7A 2O4QA 3UPBA 2OO0A 2FZMA 3JW7A 4GZ7A 1JI2A 4KIRA 1QPKA 1OF6A 1TUXA 2VP8A 1KCKA 4AB4A 2V3EA 2QPSA 2DVUA 2XFWA 5EFFA 2PB1A 7ODCA 4DJDC 4AF0B 2BY2A 2FPVA 3RCMA 3IJDA 1X6UA 4B9ZA 6ALDA 3SCPA 3EB4A 4IFOA 4NVTA 4YCPA 3KBNA 1AFSA 5FACA 3GE7A 1IXNA 3UPMA 4S2CA 4NJIA 5EMYA 4BJHA 1DHKA 2XTKA 4YYCA 3MSRA 5AZ0A 2AGKA 4IZGA 1Q65A 1CXHA 1AW5A 4HA1A 2ZC1A 3UP8A 2Y0FA 3N15A 1OZQA 7CGTA 4Z08A 1R2RA 4N9BA 5EPDA 4X9YA 1JCXA 1VJZA 6A3HA 3RX2A 3TONA 3ONBA 1H5YA 2DH2A 1J01A 2VD9A 4ADSA 4Y96A 1ZENA 3SQLA 3RU8X 2C1GA 4P7NA 1HKVA 3BANA 3PZTA 3POCA 5E0CA 2YLAA 4NX5A 4MJ4A 4Q8NA 2YCLB 4LC8A 3R0UA 4FX8A 3PTQA 4RE0A 3VX1A 2QAPA 3M0VA 2NSOA 3RGTA 4H41A 2DZPA 1TPUA 4W8BA 1BTMA 2WHLA 4UBPC 4AD4A 3T0BA 3RO8A 3MSYA 3EMQA 1V0KA 3U9IA 4GINA 4KPLA 1QHZA 1ZSXA 3T08A 3LNPA 3OLDA 3MYOA 5LNUA 4MY8A 3BDKA 2QMKA 2ESCA 4YHEA 2PUZA 1QI0A 1DQXA 4DUWA 3HG5A 4AWUA 3ITVA 3W2LA 1TV5A 3CQ0A 2PA6A 4IMGA 3TROA 1L9WA 4HCLA 3OBKA 4BZYA 5M2FX 5FD0A 2DT2A 3S8HA 1TMQA 4Q3MA 2OQLA 3W1UA 1T41A 3WNKA 1FFQA 3WELA 1XCXA 4CNUA 3MJYA 1UH4A 4IIEA 3AISA 1XLGA 1TV7A 3WLIA 2UY3A 2KAUC 5E0FA 1N8WA 2JF6A 1E9IA 1LTDA 1VLWA 1JYXA 3UPWA 5F1UA 4GIEA 3N9RA 3CH9A 1H0IA 4FF7A 2RAGA 1TWIA 2PGFA 2ZUNA 1O4UA 3NSNA 2RH9A 3VINA 5J5DA 1NJJA 2WCAA 3TOYA 3NO1A 1AQ0A 2YZRA 3O0FA 5AHNA 4IQLA 5JBDA 1THFD 3QYQA 3VMNA 1J6PA 1V7AA 1QVBA 3DFHA 2VURA 4BF5A 4LAMA 4KIEA 4U33A 2QS8A 3F03K 4ZOEA 3QZ6A 1JCMP 2OFJA 4A2RA 3KEHA 1EDGA 3C3NA 3ZJ7A 2NX3A 4MYXA 3HOJA 5BOEA 4P2VA 1NEYA 1HL8A 4F4RA 2V69A 3CL6A 1YHTA 3FYYA 5KZDA 1NF7A 1A0CA 1BPLB 2CBIA 1X7FA 3R0KA 1J9YA 1J2WA 4DZ5A 1CCWB 2DW7A 3WQ5A 1DWIM 4DY1A 5H8UA 4AD1A 3R10A 1ZALA 2GPTA 1SUXA 2UBPC 3MC5A 2BGQA 4E4PA 4XD6A 2D3LA 2WVVA 4O1CA 4AC1X 2JBMA 4DWSA 2DY3A 3A4WA 2CHOA 4EXAA 1UMYA 2XM1A 2E9MA 2J78A 2PP0A 1B57A 2EG6A 2XH2A 3W4RA 2D0FA 1KA9F 1E1CB 2NX1A 3W53A 1W3HA 3REQA 1GWJA 5C71A 2ZUUA 1KGXA 2ZRWA 3WH5A 3T0CA 2OOFA 4HMCA 2H8XA 2WCGA 2OGYA 3U48A 3VD9A 4AVFA 3PUGA 1FWJC 2A6LA 1ADSA 3GU9A 3RCNA 4Q4MA 1U1JA 1VENA 4UNLA 1QNOA 5BU9A 1OZMA 1Q45A 5T8GA 1G1YA 4B5WA 5CPSA 4PCPA 5E0KA 2I56A 2CPUA 3KL5A 2NWRA 3HPFA 3OZMA 4DM2A 3L12A 2DQWA 1A5NC 3ME3A 1KQYA 1E0UA 1SJBA 3XINA 2ADAA 4MZYA 4GY1A 4S3CA 4UNKA 1XUZA 1EHNA 4UTWA 2CLEA 3CAKA 3E0FA 3BARA 3BV4A 2H3BA 3II1A 3FK4A 3GUWA 1N2VA 1E1EA 3H21A 1CGUA 2X2GA 4JX5A 5HAOA 1EUAA 3BJFA 1XLKA 3GHUA 3GNNA 5G4WA 4HJFA 3B8IA 3KTCA 4RE2A 2Z0IA 3VKJA 1XH2A 3HB9A 3VZXA 4PMJA 5DMYA 2PAJA 3I68A 4LYRA 3EKZA 2PEVA 3FDGA 2YZ5A 3O63A 3W0KA 3VIMA 1VHCA 1F4HA 1EJVC 2TODA 3ARPA 3BAIA 1PDZA 3BLFA 2WB5A 3VCNA 4C7FA 2VXNA 1CXEA 1NAL1 5AKQA 3B9AA 1S2UA 1AQHA 3DG7A 4B5UA 3TKFA 4NX0A 3B8TA 3WO8A 3WIJA 2BXYA 4HPXA 3KFTA 2D2HA 1SJCA 3S1GA 4YTTA 3NQVA 4HK5A 4CQ8A 2DIKA 4UQEA 1W1TA 3VNKA 1SO6A 3PSVA 5CBJA 1SM9A 1UWQA 3S3GA 4O11A 1IXQA 1T8XA 3MZ2A 3GVWA 4K36A 5DCBA 5BWAA 2ZADA 3R58A 4AWSA 3ZVIA 3OODA 4AVNA 3V0TA 1I2PA 1VFHA 1CXIA 3L4YA 3SR7A 4ROPA 1ZBCA 4MJMA 4WXZA 4RJEA 2I5QA 3QZAA 1UIPA 4GVIA 5CSYA 4QG8A 1JZ5A 3PS7A 2JKPA 3ARTA 1P1XA 1UWAA 2AQOA 1XINA 3TIMA 1R7AA 3TTOA 5G2WA 4ZODA 3PWGA 3SCNA 4FALA 1G5AA 9XIAA 3HG3A 5A6LA 4GY0A 3NGJA 1HKWA 3I65A 3A4XA 1PHWA 3L68A 4GQGA 1OJXA 4P7RA 1US2A 3N6JA 4GMEA 2Y7FA 3AWOA 2YSWA 4CQCA 2VCAA 4GKLA 4XQ6A 3DG3A 4PEKA 1NFBA 4F40A 2FDSA 1IZCA 1E5JA 1YXDA 2WNNA 4DYEA 1EBGA 3SIMA 9XIMA 3VCCA 4XUGA 1B4KA 1CENA 3CB8A 1DWHM 3WNNA 4YTRA 4UXDA 4XVDA 3AYSA 1A5SA 1F6YA 1G4TA 2OXNA 2VWSA 1Q2SA 2NZLA 2Z00A 2E09A 1GVOA 1CB7B 3V1PA 1U30A 1HVQA 1AD1A 1PTDA 2FHBA 4JFUA 3GNXA 2CZ5A 4W7UA 3HIJA 3L65A 4BS0A 2HVNA 4H8HA 5C0QA 5D05A 3QBUA 4EPEC 3TLLA 2OZTA 1VEOA 1RA0A 3KM8A 5FJRA 5AYYA 3S1XA 3EBVA 2DT3A 1E4NA 1VBRA 1ZJHA 1EDQA 4LBUA 3GLCA 4XUYA 1G69A 4IICA 4DJDA 1CIUA 1YMYA 1YTKA 2IMRA 2V3DA 3B04A 3G77A 3KOFA 5BU6A 3WDIA 3GYCA 1BQGA 4ZQMA 4O14A 1KV5A 4HP5A 3SB0A 2EPOA 1Q6EA 3C8NA 1IE7C 1QWKA 1GOOA 3I7SA 1MFUA 3VDBA 2W4XA 4M0XA 3NIYA 5HATA 3OVGA 1LUCB 3LBMA 2PZ0A 3FDKA 3SN4A 1GQJA 1IHIA 4TMCA 1WOBA 3NQMA 1J0KA 1LL6A 1EOKA 1ZUAX 3NPXA 5BXSA 4UQBA 4PRRA 3M0MA 3AOFA 4TU1A 3TYDA 4LWWA 4J2PA 4OOZA 4FB7A 2YYUA 4H9ZA 3OLIA 4ACZB 3P61A 3AIRA 4XAZA 5HXMA 4MB5A 1EKOA 1QPQA 3VFCA 2Y88A 3E0VA 1QOQA 2QAFA 2ONEA 3EXSA 4J27A 1OADA 3CAWA 4GO8A 4PUUA 1WUFA 4O0ZA 2HPMA 3UXAA 2AL2A 3PZNA 4FLRA 1QBAA 1U83A 3AZSA 3FS2A 4WKHA 1UZHA 1ZJBA 4HT3A 5LHFA 1ZY9A 3CWHA 1XRTA 1OC6A 3IWPA 1GOXA 3CZGA 4PBGA 1A3HA 3A9IA 1YIXA 5CGTA 1R38A 2QCHA 4H6KA 3C52A 1Q6OA 1V5XA 3MO4A 1OX4B 3YPIA 3VILA 4H7VA 3RJYA 2VWTA 4LF1A 4H3DA 3AXKA 1W9BM 3L67A 3O0KA 2A5HA 1G4EA 2Q3OA 4HK7A 1LT7A 5AYBA 1YDVA 1EEXA 3NM3A 4JICA 4BI7A 1TJPA 4TUFA 1E55A 4GYPA 3ZLHA 2YXXA 3PG8A 3T40A 1VFMA 5PTDA 3VE9A 2OQHA 5EMUA 2J47A 1ZCOA 4HMDA 3UR5A 3ZVHA 1RV8A 1PPIA 1EYWA 3DYMA 5B80A 2YCJA 1M6JA 4MF4A 4DB7A 3MO7A 4O54A 3JZEA 4W88A 2PDMA 4XIAA 4RDVA 5A8OA 2W27A 5EL1A 3NEHA 2DZAA 2G3IA 5FKYA 4LUJA 1FWIC 1P0KA 1PX8A 2POTA 4XAYA 1KR1A 4LUYA 1XQLA 2OX4A 3B06A 2W5FA 1XLJA 4AF0A 4UUIA 4MZ8A 1U1UA 1BGGA 1NH6A 3C4UA 2WNQA 4RPQA 5GPRA 1UUMA 3OEXA 4GA8A 1V51A 2QVNA 1RQBA 5BW6A 2NLYA 3BSGA 2IKGA 1UJPA 3WKZA 3EYPA 3RX4A 1J8VA 2Y7DA 3TWBA 1KCZA 5A6MA 2X7VA 4LVAA 1LJYA 2Z1VA 3H4GA 2X7WA 3MDUA 3CMFA 3TVAA 3LDVA 1SZFA 4C7DA 4TX9A 5EBUA 2P76A 4RW5A 4S3JA 1TJRA 4QNWA 3GBEA 4J4KA 3W7DA 1ODUA 2A85A 4H01A 2YCLA 3CC1A 1LP6A 4QXIA 3NPUA 1V77A 2OR2A 3GR8A 4LXFA 4B91A 5D2YA 4POCA 3W73A 1K6AA 1MEWA 1V3KA 3N18A 3UY7A 5A94A 1VYSX 1VGAA 3R79A 1KFCA 3WLSA 1XYMA 3EOOA 2VOTA 2CLKA 3UT0A 2WXDM 3HQPA 4L9XA 3KTSA 3MT1A 1PVNA 1NDVA 5IHRA 4BWLA 2QCFA 1WBHA 1E15A 3S47A 3DFNA 3VIPA 3TYEA 2W79A 4AZHA 4ZEPA 4EPBC 2WAGA 1HQTA 1DL3A 4PULA 4I90A 3W1QA 1KO0A 3EEZA 5FI8A 4DAIA 1ML1A 5CC3A 3KLLA 3E9AA 4GX8A 1J0IA 3L7RA 3BCFA 5C70A 4L9ZA 3WDHA 1REQA 3R13A 3KVJA 4N0RA 2BVYA 2PLCA 3MVIA 3CMGA 3ERPA 2PDUA 1ICPA 3OZYA 3C2YA 3W24A 3F2CA 4XVEA 4JX4A 4O0KA 4AZ6A 3DBNA 3LTYA 4IIFA 5I3JA 2HV5A 2Z1KA 3ALGA 1E0TA 1VC4A 2BASA 2WKGA 4PB5A 3GHTA 1F8IA 4MSSA 4MFDA 4JGDA 2ZXBA 2VHLA 4K8GA 1VPYA 3NQ6A 2Y24A 2PPGA 4B5TA 4YHGA 5T91A 3IIOA 3GYEA 3G18A 1ZBVA 4C1LA 2Z2BA 5M3WA 3DIPA 3PB0A 2I5GA 4PL1A 1M41A 4HBKA 2PF0A 2R1MA 1LZOA 3LGEA 1K9EA 4A22A 3FW6A 1HJSA 3VOGA 3ZT6A 4EX4A 5D9NA 2Q09A 1IF2A 4IXXA 4M5PA 1MXGA 4QR6A 4JDYA 2DZXA 4QLKA 5HMEA 5GNZA 1EIBA 3JR2A 3LOTA 5J5RA 2C16A 2EHHA 4V1YA 3WK0A 4LRSA 5CJMA 3H2AA 4XWUA 4DRSA 5HWJA 1ICQA 3N2OA 4IFKB 4GOAA 5AOUA 4LOCA 5E1QA 3NWRA 1E1CA 4MDPA 3VDCA 3NG3A 1NFPA 2I7GA 3S6DA 3EDKA 3VAVA 3QOMA 5DO8A 2VOMA 2Q8LA 3VNYA 4E6MA 3M47A 1JVNA 1UD5A 2ZQ0A 1XPGA 1VYPX 4TV6A 1XLHA 4E2DA 5D2XA 3M41A 3GIYA 2VZVA 3G2GA 2HS6A 3VZYA 3NL2A 2WANA 1YXYA 1QNVA 4BQ4A 2XSXA 3ITYA 4W89A 1UROA 3W22A 1C29A 7TAAA 4O8AA 4JTTA 5CG7A 2YKKA 3WLHA 1QNQA 3WF3A 4DYJA 1DJYA 1XISA 3WBWA 2PU0A 2WMKA 3F4NA 3QQWA 1LBFA 5CLWA 3STPA 3T07A 1LWIA 1TRDA 1BF6A 3R0DA 4QS6A 4JQ2A 3NQ2A 2G97A 1G4PA 5LNWA 2VC9A 1DJNA 3SQMA 4GGBA 3W7KA 2PTXA 5CPLA 1GZGA 1F61A 5CSSA 3U5UA 3MHUA 2H8ZA 1H09A 3O07A 4X2PA 1L6WA 1EWEA 2D22A 4RKAA 2I57A 4PE8A 2Z2UA 5LYRA 1FWEC 2RKXA 1Z41A 3BAJA 1IGSA 3F7JA 2CZVA 3TAKA 4J3SA 4AD0A 2VDHA 4GIRA 3K8LA 4GI6A 3AHZA 4LSBA 3SCQA 3EDFA 2Y8KA 4GKTA 3IVTA 1EC7A 2ODOA 2PWVA 3CQHA 1TWSA 1JPIA 4RDZA 1VCVA 1TV3A 2AMXA 1GK8A 1OB0A 1KFWA 1H63A 2J7HA 4PBEA 1E4LA 3TJ4A 1PYMA 5TIMA 3UGVA 4PUEA 1FHDA 5FF4A 3IJ7A 4GH3A 3A4JA 3MI3A 1EA9C 3CK5A 3TOPA 3KL0A 1W31A 1ZZMA 3NNTA 5E70A 1VYRA 5JIPA 1NQ6A 2O55A 4RR4A 4BQ3A 5U4NA 5A6BD 2PRLA 3GNPA 3WG6A 2E5CA 4ZMGA 4O19A 3W01A 3ARRA 3RPMA 1TRIA 2XIMA 3MWCA 3GDBA 1Q4WA 3TSMA 1XYCA 1XHGA 4DXVA 1CLKA 3U7BA 2WLZA 3IIVA 3QC0A 4WSJA 2BZNA 4GBDA 1HJWA 1KM4A 4M80A 1KC7A 5H8MA 3CIWA 1Y5VA 3W9ZA 4CVWA 1IGWA 1OT1A 4GY7A 3BL3A 4MWAB 2B0MA 1DTUA 3GS6A 4BF7A 2DU2A 4GUFA 1LL4A 2W92A 3PTDA 1ME8A 1GVEA 4MFEA 3QPYA 4YVXA 3WBXA 1LQAA 2WNZA 3QKZA 1EXBA 1GVQA 1F2JA 3TP4A 3PNUA 2QPXA 2BSLA 4YVPA 3SO7A 3CT2A 1H41A 3SFWA 2FFCA 2QGYA 4QE4A 2CW6A 2INZA 3KBMA 3S5ZA 1KFEA 3E2QA 3GKFA 3C2VA 1YYAA 4GFIA 2W3ZA 5JUVA 3P62A 2VCCA 3GC4A 2EKCA 4F9JA 3CS2A 3LHUA 3RN6A 1NARA 3OGVA 3VNZA 1IIGA 4TVUA 3N3TA 3GBDA 3QW4B 1AH4A 4QRNA 4Y90A 3B4UA 1CBGA 2WJDA 4GVHA 4DJEC 1UHVA 3CUGA 1S38A 5D8ZA 4JXCA 2GGJA 4W4QA 3VD5A 4Q8OA 3AXIA 1V08A 3WFLA 2RGMA 4HNVA 1UW9A 5A8NA 3WD3A 3WUGA 3SSJA 3EPNA 2QJGA 2PDHA 3GG0A 2XFYA 4QX4A 1KTNA 3E0LA 3UFYA 3CMJA 4IM4A 2RHGA 2G96A 2R1PA 4CN1A 1KWGA 1RLCL 3MI6A 3B9OA 2R9RA 2NQJA 2GZXA 1LRNA 5D9MA 2J7GA 2NVDA 1DORA 1TELA 1FWTA 1QJWA 3N2CA 1HKKA 3SY5A 3QH2A 5CPQA 2NUXA 1G9HA 1X97A 2QCEA 2E6FA 2BOEX 3GWQA 3KWSA 4P7QA 2PMQA 5FEPA