1ICSA

Crystal structure of 12-oxophytodienoate reductase 1 from tomato
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
363
structure length
353
Chain Sequence
QVDKIPLMSPCKMGKFELCHRVVLAPLTRQRSYGYIPQPHAILHYSQRSTNGGLLIGEATVISETGIGYKDVPGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNKDFQPNGEDPISCTDRGLTPQIMSNGIDIAHFTRPRRLTTDEIPQIVNEFRVAARNAIEAGFDGVEIHGAHGYLIDQFMKDQVNDRSDKYGGSLENRCRFALEIVEAVANEIGSDRVGIRISPFAHYNEAGDTNPTALGLYMVESLNKYDLAYCHVVEPRTESLVPMRKAYKGTFIVAGGYDREDGNRALIEDRADLVAYGRLFISNPDLPKRFELNAPLNKYNRDTFYTSDPIVGYTDYPFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 12-OXOPHYTODIENOATE REDUCTASE 1
publication title X-ray structure of 12-oxophytodienoate reductase 1 provides structural insight into substrate binding and specificity within the family of OYE.
pubmed doi rcsb
source organism Solanum lycopersicum
molecule tags Oxidoreductase
total genus 126
structure length 353
sequence length 363
chains with identical sequence B
ec nomenclature ec 1.3.1.42: 12-oxophytodienoate reductase.
pdb deposition date 2001-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1icsA00
3NZ1A 2ZZ7A 4XQ6A 1JRCA 3FIGA 1XDLA 3T4CA 4FNUA 2PURA 3W1RA 3Q2DA 4ZVJA 1KTBA 3AJXA 4IMCA 3JS3A 2H8ZA 1W1ZA 4EF8A 1ZJIA 3RLVA 3W23A 2QCCA 1XBXA 1FXQA 3W70A 3W7HA 4GNJA 3BGJA 3O07A 5TQLA 4AVFA 2R14A 2DZVA 1TREA 2FJKA 4BWLA 4S1FA 2CLLA 1NEYA 1UB3A 4O1CA 1EWDA 3KVLA 1W3NA 5LNWA 1DHPA 4Z1DA 4JTGA 3P61A 1EIXA 1KLYA 1OFPA 4RXGA 3W88A 3OVPA 2QUVA 4UFMA 3LERA 5FEZA 4P2VA 1VS1A 4ADSA 3HG5A 2QCFA 3IIVA 4JN6A 3NYZA 3BLIA 1W5QA 2QCMA 5C54A 2YGYA 2YSWA 1OFAA 3TCEA 4JY9A 4JYEA 2VFDA 4G1KA 3TQ0A 2I14A 2ZTJA 1JCYA 5F4SA 5E0KA 1XL9A 1YXCA 1OABA 4UCGA 3QMTA 5H2ZA 3FEMA 4U28A 3NAVA 2V2DA 1L9WA 3QPYA 4NJIA 3W6YA 1TCDA 5BNKA 5DCEA 3E02A 1E51A 2NXIA 4FX6M 5DN1A 4X3ZA 3W7QA 3LHZA 4O15A 3E49A 1VZWA 5D05A 2QR6A 4LVAA 4O57A 3S1WA 1GTEA 2CLIA 2P1FA 4RR4A 3SJ3A 1SR9A 3TXVA 5LNUA 3SFKA 2DZUA 5F2LA 4LVBA 4MY8A 3HGRA 2EHHA 2NLIA 3NQ6A 2C1HA 1LBFA 4R53A 1OK6A 4E38A 5D04C 5FF3A 4K6AA 4M19A 1SO4A 4ZMGA 3W72A 3CEPA 3TU9A 1PE1A 1FWRA 1GVQA 5EPDA 2ATMA 4UTTA 3HGJA 4GJ1A 2D73A 4O1DA 1SZFA 4A3UA 3R89A 1TO3A 3O05A 4B5NA 1LROA 3W76A 3QQ0A 5A8GA 3W71A 3DFSA 3FJ6A 4U4MA 3LX9A 1I2OA 1R30A 3TIMA 3CWOX 4HHPA 3INPA 3W7RA 1MEIA 3NA8A 4YCOA 2GVGA 3NPWA 3O15A 4H3DA 3UPWA 1KFCA 1PVNA 1LM1A 2FPTA 3STCA 1QFEA 3SZ8A 1SPQA 4ADTA 1QPOA 4NNCA 4N02A 2NX9A 4FNSA 1Z41A 1W5NA 2P0OA 4PL1A 5C6MA 2Y7EA 2V0TA 3VI2A 1BWLA 3BO9A 3S6DA 2NUYA 4QM1A 2ZRZA 1O5XA 2QCDB 1OYAA 3LLDA 4I7UA 4AAJA 5CG7A 1WBHA 2WJZA 1TRIA 4NJHA 4A21A 4LUJA 3TQVA 1VRDA 3GXPA 3O63A 3WJXA 3MI3A 3HIJA 5LZLA 5TIMA 1BEUA 3M43A 1DV7A 1XM3A 3BGGA 3TQKA 4I9AA 3FS2A 3KXQA 1L6SA 4CNPA 2V8ZA 4YXGA 1OHLA 3UQNA 4M6PA 1EA0A 1X6UA 3DFOA 3W7KA 3F03K 5AC6A 2WNZA 3HPSA 4H6KA 3OVRA 4N9BA 2X1UA 1KTNA 2Q8LA 3TSDA 3IVSA 3P80A 1DVJA 1YTEA 4UTWA 3UXAA 1PHQA 1GG0A 4GFSA 2JBMA 1YTKA 2WO5A 7TIMA 2I1OA 3OBKA 3ATYA 1R2SA 2H3DA 4PL2A 4HNUA 4BK9A 3G24A 3UWQA 5FEWA 4O13A 1F6PA 3DH7A 4DPQA 3GR7A 1RQEA 1Q6RA 1G6CA 3QFEA 3PVFA 3QQ1A 2J24A 4IWWA 3EX6A 5AHFA 1LLZA 3EKLA 3P84A 1TJRA 1G4PA 2DORA 1GOXA 3E0IA 4M6VA 2VFFA 3QSRA 1OFOA 2CLOA 5AHMA 5LNRA 5DXXA 3SECA 2V9DA 1MZHA 1QCWA 1GVFA 4UTJA 3FKRA 4ALDA 2ZZ1A 2ZRUA 3PG9A 5I3IA 4O19A 3SY5A 4BF9A 4CLMA 3GNNA 3IVTA 4OV4A 4H4IA 3F1QA 4WD0A 3QSTA 1DKWA 4MY1A 4POCA 1QPQA 1A5BA 1P0NA 1AK5A 2AAMA 4WY0B 1U5JA 2QEZA 1X7FA 2V2HA 4N9CA 2YYTA 4UFIA 4MIMA 5BOOA 2ZA3A 1HFBA 3QMSA 4Y90A 2CLHA 5AHNA 5F4XA 3PUOA 4NQ1A 4NJJA 3T44A 4DF1A 4FNQA 3UD6A 2PRHA 3L66A 3S1XA 1LOLA 3PULA 3BG3A 4I7VA 2PE4A 3I7QA 3W7EA 3GAKA 5EY5A 1Z48A 1ZAHA 2CW6A 1DL3A 2W0UA 4Y9AA 5I3GA 2E77A 4ML9A 1QNVA 4XUGA 2QUTA 3LOTA 3N3MA 4ORIA 1YDVA 3QPZA 1JVNA 3N2XA 4HNNA 3MP4A 1PHWA 3HGSA 1IXOA 1F74A 1F7BA 1QPNA 1R2TA 2NX3A 1LRQA 1XI3A 3TAKA 3A5FA 3HG2A 1B4KA 3B0PA 4KWVA 1I45A 1HG3A 3W1NA 3UXDA 4HPXA 3SW6A 1RD5A 4YMZA 3M0ZA 3CIWA 3LB0A 3Q37A 3GX9A 3KRUA 5ABTA 3WK2A 3B03A 3NQGA 5G2IA 3NQVA 2Z6JA 4RV8A 5L6UA 1SW7A 3G1FA 1PCWA 3DFTA 2NWRA 1X1ZA 1IXQA 1PCKA 3TJXA 1XFBA 1H7WA 3MI2A 5BW6A 1RPXA 2QJIA 2Y63A 4O52A 4DF0A 1S5WA 3NNTA 1J4EA 1K8ZA 1WOBA 1TRDA 3W84A 4AHQA 3UZJA 1SFJA 1XUZA 5U4NA 3Q94A 3PY2A 5AFDA 4N9DA 1OX4A 4UR7A 5HINA 1H7NA 2ZYFA 1JCMP 2J88A 4A2RA 5CPOA 3NL2A 3ATZA 3M5XA 1W3TA 4CQ8A 3MJYA 3SGZA 3HOJA 1DJNA 3CQ0A 5CKSA 3W87A 3V1PA 4AWSA 5A5WA 3PBUA 4K7YA 4R34A 3S1VA 2QCNA 3MP3A 5F2IA 5I3KA 1H5YA 2ZDRA 1J5TA 3LLFA 3NVTA 4L4LA 4JGDA 1FXPA 4NX0A 1ICQA 4S2BA 4WJEA 2FB2A 1QR7A 2X1RA 3PB2A 1RV8A 1ADOA 4IXXA 1BTMA 5AC8A 4OBTA 4Y96A 1ML1A 3ELFA 4Z0SA 3BARA 2JKPA 3TSBA 1H1YA 2JKAA 4LS1A 4LC6A 1XCFA 1H1ZA 1VCVA 2JKEA 2PRLA 4CCEA 5BRBA 1LTDA 2QCLA 3EX2A 5GVJA 3M5ZA 1KFJA 6ALDA 2J9YA 1G4EA 3DAQA 3H54A 5KZMA 4RZ6A 3U8GA 1FBAA 4NT0A 1JRBA 1THFD 4IJBA 3DXIA 4BI7A 1EP1A 1GEQA 5MHBA 2YW4A 3CU2A 2V5BA 3EWBX 3QYQA 1KFBA 2DU2A 1H62A 3O8AA 3O6DA 3PUDA 2RDWA 3IIZA 3M16A 3NPUA 3S1UA 3W07A 3VCRA 1B3OA 1CW2A 3S8HA 3LRMA 5HR7A 2A2IA 2JGQA 2R94A 3LHVA 4JD4A 5D32A 3W2MA 2ZRYA 1QO5A 4LW7A 2C0AA 3GK0A 4NVTA 4DELA 1FQ0A 1I2PA 2QCEA 4GXMA 1H63A 3FKKA 2B7OA 4JYDA 1TV8A 1GTHA 2H3BA 2ATSA 5FESA 1QAPA 1RQHA 3DGRA 3CM4A 2DP3A 3C6CA 5G1TA 1KA9F 4FIRA 2EKCA 2TSYA 4JDBA 4MJMA 4XWUA 5LHFA 1WYIA 3AO0A 1U83A 3GVGA 3L0KA 2Y61A 4WXZA 4O17A 4PODA 5D37A 3LXAA 4HNTA 3W74A 3A23A 3O06A 4O1BA 4DO4A 1QOQA 4OT7A 3SI9A 1W8SA 4JTLA 2QCHA 1TTQA 2XFWA 1JQVA 4GC4A 3UZ5A 3BW2A 1S5TA 1S3HA 1ZAIA 4AF0A 3STGA 2QAPA 3P7YA 4XTIA 2B7QA 2ZA2A 4LC8A 1A53A 3CTLA 2A5HA 4HSOA 4S2CA 3ANYA 3G22A 2Z0IA 3P60A 2QKFA 3FJLA 4JX4A 3W1TA 3FYOA 3KVKA 4LV4A 3L5LA 3R13A 1WBJA 1O4UA 3PM6A 2ZZ3A 4DBEA 1R47A 2YPIA 2YX0A 4Z1BA 3NPXA 1G7VA 1SFLA 1VYPX 4JIPA 3W1QA 1JR1A 2E6FA 5EYWA 4HSNA 2A7PA 3TNOA 3S0CA 1K7FA 1P0KA 4LT9A 4D2JA 3W2LA 3YPIA 2NXHA 2V30A 1WXJA 3TX9A 2ZA1A 1TV5A 3G0XA 1HO1A 1LORA 2DZXA 3LCIA 4N4QA 3S5NA 4C1LA 3U6WA 3SIZA 1EP3A 4ZQOA 2NXGA 5AN7A 3PB0A 2B7NA 1I2NA 4LVGA 5CSSA 1WA3A 1A5AA 1XBVA 5C5YA 3G8RA 2NUXA 1SZNA 1N7KA 2H6RA 3UWVA 3BPWA 1GJPA 3HF3A 1G4SA 4TIMA 1KW1A 4FHAA 5HR6A 1KM1A 4NXSA 5IBXA 4FF7A 3BVJA 1A5CA 5HUOA 1Q45A 4RLIA 1JCJA 4UTMA 1GVRA 3S5YA 5DBTA 3NQFA 5FI8A 1I4NA 2VFHA 1IIGA 5HWJA 1K02A 2CLEA 5LHEA 3PBWA 4A22A 1GWJA 1JQXA 4KKXA 2HS8A 3QZEA 3GZ3A 1OJXA 4MLJA 3MBFA 4EIVA 8TIMA 1K8YA 4FX8A 4BWLC 2Y7FA 3N9SA 1IGSA 3TFXA 1G7UA 4AB4A 4MYAA 4MYXA 4J9JA 2CWNA 4KFNA 1K8XA 4EF9A 4E2BA 4ZQNA 3ZR4A 2WSQA 3VKJA 4K36A 1K7XA 4NJKA 1C9DA 1SQ7A 4QIUA 2XN1A 4UTUA 4QAIA 1FWWA 1SSGA 2ISSA 3T55A 2ZRWA 1W5OA 2O7QA 4JY8A 1UUOA 3EXTA 4HNVA 3V75A 3UY8A 5K7JA 1B4EA 3MP5A 1W56A 2GUUA 3MO7A 1OX6A 2YR1A 5AHLA 4N6EA 1YTDA 2YXGA 1K3UA 5E93A 3PWAA 3NZRA 1TPB1 5DXYA 1AL7A 1T0OA 4LRTA 1FCBA 4O53A 2FFCA 3BLFA 4OQVA 4O18A 4Y8FA 4UMCA 2GJNA 2TYSA 1PL9A 3TDFA 5AHIA 2YCEA 3TMLA 4XZ9A 3C52A 3PBVA 5DBUA 1VPXA 1RQBA 4ZQMA 1K7EA 4TX9A 2JK2A 1GYLA 3M9YA 3ZFHA 1GPWA 4OWGA 1XXXA 2PC4A 4O4WA 4UTTC 3NQEA 3B0VC 5FEPA 2VFGA 4OGZA 1W37A 3EX1A 1SO5A 3WJWA 2GQAA 1VLIA 3LV5A 2E1DA 1H61A 3ABOA 2ZQ0A 3IIOA 4LV9A 1WOAA 3QM3A 3DENA 3LCLA 3K30A 1W0MA 3NM1A 3W1PA 1OYCA 1TMHA 1EUNA 4GUFA 3C61A 4IXHA 3MWAA 3GDRA 3G0SA 2JGYA 5FF7A 4MZ8A 4QJ1A 1MSSA 3IIXA 5D2TA 4AXKA 3M44A 3ABQA 4HIBA 3CWNA 3BK0A 4LWWA 2OT0A 3NQ8A 4UUIA 5KTLA 3DI1A 4HKPA 5HULA 3HB9A 4DO5A 3P5YA 4IX2A 4UIOA 5D33A 3OG3A 3UPBA 5SWUA 2VEIA 2Y6ZA 1OX5A 1JCXA 2C3ZA 4JS3A 1ICPA 1TIMA 3A24A 2I9EA 3NQCA 3W75A 5KINA 1XBYA 3E12A 4XKYB 4IMFA 4JDYA 2A6NA 4JYFA 2E68A 3UWZA 1ZFJA 1LRTA 4UTWC 4ZZ9A 4TMBA 1O5KA 3B06A 1FWNA 3L9CA 3UWYA 2GQ8A 3LTYA 1V5XA 2AQWA 3TSMA 3NQ7A 1LP6A 1OF8A 1AL8A 4LOCA 3LCFA 2QCDA 1X1OA 1SO6A 2QJGA 3LHTA 2CZ5A 4DF2A 3LHWA 3G18A 3GDTA 1WDWA 2TMDA 3N73A 1DQXA 1D9EA 1K03A 3UY7A 4N2YA 4ICNA 1ICSA 1Q6LA 2G97A 2FQIA 3EXSA 1C8VA 1H51A 2B4GA 3M5YA 2ALDA 2FB3A 3EWYA 2Q3RA 2QF7A 3N34A 4HPJA 3I68A 3IV3A 4MZYA 3LXCA 4LU0A 3LHYA 4GUJA 1DBTA 3L65A 2WV8A 3FA5A 1TPC1 1F76A 1KV8A 2TPSA 3LI0A 4RXFA 1ZENA 3BW4A 4CNOA 5HWNA 3HQ1A 3EX4A 5D02A 2OT1A 3W7IA 2Y7DA 4O16A 1YPIA 3G3DA 1SSDA 5IM51 3WJSA 2EF9A 2VFEA 4OV9A 3W7MA 4CCCA 4DQWA 3L67A 1KM2A 4M5PA 4ADUA 4FNRA 1EP2A 4PC8A 4O1AA 5K9XA 3LI1A 2B0MA 4OU1A 2FPVA 1OK4A 4TMCA 1J2WA 2A6LA 4N9EA 5BMWA 1Q3NA 3M1ZA 4RK8A 4XBSA 1ONRA 4RZ5A 5EA9A 3NQMA 1Q6OA 1LLWA 3W86A 2QJHA 3PF3A 1I2RA 3IGUA 1VGAA 5EMUA 3EWWA 4RX0A 4UXDA 1FWSA 3M7WA 3W3OA 4QQ3A 1M7PA 3B0UX 1UCWA 3LDVA 1G4TA 4FX7A 4WY0A 1KFEA 3MUXA 4E0CA 3W7NA 1GYNA 5G4WA 3QH2A 5DLCA 1W54A 1OFQA 4WOZA 5LKYA 5AB3A 3TV8A 3THAA 1TTJA 2Y62A 1GQNA 2ISVA 1OYBA 2OX1A 3PSWA 2DZTA 3TUUA 3R2GA 4JX6A 4QITA 3U2OA 1H7RA 5F1VA 1GT8A 2DZPA 3FLUA 3MMTA 5F2MA 1UJPA 2Y89A 2WNQA 2C15A 4HN4A 3MBDA 1FDJA 1G69A 5AHEA 3EWXA 4R7JA 4K8EA 1N8FA 3EWZA 1Q6QA 3BV4A 3QMRA 2FLIA 3RU6A 2WSYA 4YL2A 3GXNA 4NJGA 1ZY9A 1ALDA 3P74A 4IMDA 1CX9A 3BG9A 1HTIA 4JTJA 2J9XA 5EL1A 4UFJA 5D2YA 4MOZA 4TU1A 3PG8A 2HTMA 3WJZA 4RZ4A 4LVDA 1RVGA 4FNPA 3W7PA 2YDAA 4A2SA 2PCQA 1T96A 1X8FA 3KFTA 3WK1A 1IXPA 3M5VA 4MFEA 1YDNA 3SR7A 4NUWA 4UFLA 1TPVA 4X2RA 4IQLA 5FF0A 4O28A 3W2NA 3P82A 4DEFA 3W7CA 1DOSA 1TSIA 5HNRA 3ABRA 1MEWA 3STFA 1FCVA 3R12A 2C14A 1BWKA 3MHUA 2ABAA 3TR2A 2HS6A 3GYEA 1H7OA 5T26A 3CB8A 1SZEA 3G1XA 3LTSA 4WQ6A 4LUIA 3TC7A 2NZLA 4NZFA 2C6QA 3S5OA 5EBUA 1FUYA 3NEVA 1FDZA 3I6RA 1LOSA 2ABBA 1XUUA 1FDYA 3LBCA 4X9SA 3B8DA 1AW1A 3S42A 2BXVA 3NGJA 2YFOA 2VEPA 1IXNA 3S9YA 3IIPA 3P67A 5K4XA 3BW3A 1H7PA 3QJAA 4MPQA 2CLFA 4FEZA 3A22A 5HMSA 4EVZA 3NQDA 1TPFA 2BX7A 3RK8A 3T78A 2NV2A 4AEOA 4PH6A 2WPBA 3QRHA 2BZNA 3W2KA 5K9CA 1I8JA 3OHIA 4C1KA 1OVDA 3CT7A 5AOUA 1W5PA 1TPH1 5CZTA 4M7SA 4JICA 1KLZA 4KFOA 4O50A 3GIYA 2RFGA 1S5VA 5DCBA 3D0CA 2WOQA 3LRKA 2DZSA 1KFKA 3LHUA 1GZGA 2OMAA 3P62A 5LGZA 1HL2A 5LSMA 4JIQA 3STEA 5I3HA 2NX1A 4FXRA 3UWUA 2RDTA 2TRSA 2G95A 1SW0A 4O0ZA 2DJXA 3TH6A 3W1AA 4IMEA 1QWGA 3RFAA 5BMXA 3KAOA 3IGSA 4MFDA 2P10A 3LCHA 4AH7A 3W83A 5LNVA 3F4WA 2V82A 4UMAA 4O4VA 3A21A 4DO6A 1LOQA 2VC6A 3TE9A 4CNNA 5J5DA 6TIMA 2VELA 4LTSA 1P4CA 1JUEA 2VXNA 4CQ9A 4JTTA 4MLRA 1FWTA 4MZ1A 4TO8A 3NXFA 2CLKA 4YCPA 3OEXA 1Z44A 3G1VA 1O95A 2WQPA 3NR0A 4AMAA 1OFBA 4LS2A 1OG0A 5I3FA 1FX6A 1TPDA 4Q32A 3WFAA 1VLWA 3L2IA 3NL3A 5KSWA 3NOEA 4PFMA 4Z1AA 3HPXA 3TC6A 3TJLA 2J9ZA 4UTLA 2WNNA 5D2WA 5H91A 5K4ZA 1VQTA 4PCFA 5AYZA 3PR2A 2X16A 4UMBA 5G2HA 1TYGA 1Z42A 4JTFA 2BWGA 2ZTKA 3EXRA 3VE7A 4IMGA 4KFPA 5IBXC 3E96A 2NV1A 3I65A 3L5AA 1W31A 1XBZA 1PIIA 3G0UA 4WY0F 1KBJA 4MVAA 4JTIA 1ME7A 5G4EA 4WXYA 4DBDA 2EPHA 1DQWA 3UYCA 1DORA 2J27A 1TPWA 2AGKA 4M7TA 5G2WA 3H55A 2A21A 2VKZG 3L0GA 4O11A 1TB3A 2E6YA 3GAYA 2X1TA 2BSLA 2GJLA 1KV5A 2YFNA 3LRLA 4UC5A 2XN0A 3RF9A 2DZWA 1AMKA 1P1XA 3G8EA 3N14A 1YPFA 1PV8A 5CGQA 2OJPA 3H53A 1NVMA 4ONVA 3MYOA 2RHGA 1VYRA 3DKLA 4BI5A 1L6WA 4AWTA 4FO4A 1FY6A 4IUOA 3ZS4A 2X1SA 2E6AA 3C0JA 3DKJA 3L5MA 4UFHA 2X2GA 1F73A 2FIQA 2R8WA 3LTPA 1O60A 1LYXA 3DHDA 4K39A 3R8RA 1KM3A 2C18A 3GDKA 3TXZA 1VCFA 3FOKA 1WAUA 2V5LA 3DZ1A 4P61A 4UFKA 3GKAA 2CZEA 1TJPA 2CU0A 3CEUA 3PC0A 1A50A 2H8XA 3L68A 1PS9A 4R33A 3W7GA 1VHNA 1AG1O 4PA8A 3O6YX 2Q8ZA 4WOQA 4NNBA 5CPLA 4Z08A 1SO3A 2QDHA 2VFIA 4NNAA 3G1AA 5CPNA 3C56A 2YYUA 1M5WA 2Y88A 3WK0A 3LCXA 3USBA 4FB7A 4MUZA 3HMJG 3CC1A 4QNEA 3C2EA 4K37A 4IPJA 3MHGA 5FF2A 1ZAJA 1KFLA 2G5WA 1B57A 2FTPA 3M47A 1XDMA 2FDSA 4YWIA 5AYXA 4JTSA 2PRMA 1QOPA 4M6QA 1UBSA 2C13A 4XTDA 2E5CA 1F05A 3O6CA 2E6DA 1SU5A 3DFPA 1H7XA 2O7SA 4ZQPA 4AHPA 2F7FA 4ZQCA 1TPUA 5CZ0A 5C55A 3N19B 3W85A 2GVJA 3JRKA 2RH9A 3QW4B 1QDSA 1VHCA 1UASA 1R46A 5C2XA 1TTIA 4JR5A 2EAWA 3M41A 1AW5A 1KM0A 3TFCA 1KM6A 5FEXA 4UNLA 4ZL1A 3KOFA 4JTHA 1B9BA 2ZBTA 1SW3A 2ZZ5A 3CHVA 1VJIA 1UUMA 4LVFA 3LCWA 4WZHA 3HBLA 3W7LA 4JXCA 3C2FA 3MI6A 3CLMA 3UWWA 2BLEA 4IOTA 5DY2A 3NL6A 4QSHA 3PBYA 5D03A 3MYPA 2G96A 2C16A 3RNDA 3TROA 3EKZA 3OIXA 3W7OA 4Z0JA 3W7JA 3CPRA 4N4PA 4WX2A 4UTKA 1OFDA 5F2GA 1HO4A 2NUWA 4K38A 1KTCA 1OF6A 1NSJA 4RKAA 3NQ2A 2RDUA 3L0NA 4GRSA 4UNKA 4I7WA 3W7DA 1D3GA 2E09A 3PAJA 4O54A 5EKYA 1NF0A 4O14A 1IF2A 5D30A 2A7NA 1F6KA 3TA6A 2IQTA 4FXSA 2EGZA 3FFSA 4GBUA 4NU7A 1JUKA 2W79A 5F4WA 1KM4A 2Y70A 3IVUA 2J6XA 1TV7A 3JR2A 3P81A 1WX0A 4GUHA 1GVOA 1SZGA 4AHOA 4IGHA 1A5SA 4CCDA 1NAL1 3LM7A 5G1YA 3HO8A 5HJLA 4GWEA 2UV8G 5LGXA 1VYSX 4NXKA 1QO2A 2ZZ4A 1L2UA 5DELA 4NX5A 3GNDA 3HG3A 1EUAA 3F4NA 3TMQA 1V7YA 3A9IA 5D2VA 3PS7A 1RR2A 5E1QA 1GG1A 1VH7A 2FPYA 3R5EA 2GQ9A 3P5ZA 4IPIA 1NF7A 2NWSA 1OX4B 3VNDA 4BFAA 1N55A 4O12A 4RJEA 3LBMA 3BLEA 4K8HA 1R2RA 4JNMA 2VENA 3SGUA 3O1NA 4TR9A 3EX3A 4XBKA 1D3HA 2QCGA 4JX5A 3DU0A 3G1SA 4E2DA 1GVSA 5CZSA 1IIHA 2CZDA 3GXTA 3KVJA 3QEZA 4OE7A 4BI6A 1ZCOA 2KZHA 3LGEA 3T40A 1FCQA 4XKYA 4L4MA 5J5RA 3B05A 1JCLA 4EWND 5KZEA 2Y85A 1XC4A 4JTKA 3GLCA 2Z1BA 1FCUA 5F1UA 5KZDA 1JUBA 2LLEA 4JTUA 1KM5A 3TK7A 1SUXA 2CFFA 5D38A 3DBPA 2OZ0A 3G1HA 1ZNNA 3THQA 2ZRVA 3DHFA 3B04A 4CQAA 3CIXA 1G67A 2V2CA 4X22A 3HG4A 1XKYA 5D09A 4PTNA 2A4AA 2Y7GA 4PEKA 2HSAA 4JTEA 2QDGA 1W3IA 1BKSA 1T99A 5K9DA 2X30A 4K7VA 2QAFA 3GB6A 3W2UA 3C2RA 5KMYA 2Q3OA 1TTPA 4UTIA 2YW3A 4Z1CA 1QPRA 3TW7A 1LBLA 4Q4KA 1T8XA 2R91A 4GUIA 3Q58A 1EX5A 3KRSA 3KX6A 3RLUA 4EOUA 1ZALA 3HJZA 4RCXA 3B4UA 2A0NA 4WUIA 3VFLA 4O8RA 4IX0A 3WJYA 1WV2A 1JULA 3W1UA 2VEMA 1H50A 1MXSA 3GR8A 2CZFA 1H60A 3NO5A 3QW3A 1YLVA 2HMCA 3P8IA 1Y0EA 3G1YA 5D2XA 1L6YA 3I7RA 3DI0A 3VE9A 3WK3A 4JEQA 2XN2A 3NL5A 3O16A 1LDCA 1LZOA 3NQAA 3NM3A 1F2JA 2H90A 3LV6A 1MEHA 1LCOA 3KVMA 3I7SA 3SSJA 4Q33A 5FF4A 1YYAA 1EPXA 1HUVA 5L9FA 3A5VA 4GUGA 3N2MA 3W9ZA 3EEGA 3W2JA 3NDOA 3IEBA 4HT3A 4OHQA 1ME8A 3UNDA 4AF0B 3OA3A 1F5ZA 1C29A 3FYPA 4KWWA 2A1YA 4MJZA 1VR6A 5AC7A 4FNTA 1WQ5A 2V81A 3N9RA 3S5ZA 1YADA 2GPTA 3W1MA 4QISA 2GOUA 4MKNA 3KHJA 5K3VA 1LBMA 3PUEA 3W22A 1LRNA 1OFRA 2ZRXA 2ZCGA 1JCNA 1DJQA 4LRSA 1M6JA 3DFNA 4FIQA 4LNYA 5AYYA 1P5BA 2A85A 2Z6IA 3G3MA 2BTMA 3MHFA 3BG5A 4Y6GA 4LS0A 2A7RA 1AW2A 3NPVA 2VEKA 2ZFAA 3E9AA 3TW6A 2WKJA 2CLMA 4ZQRA 4O10A 4UTHA 3NG3A 2ISWA 4YLWA 2ZZ6A 4DXVA 5HWMA 3C4UA 5G5IA 3W1LA 5U7SA 2DJLA 1OFEA 1NFBA 2QUUA 4QNWA 3EB2A 2YZRA 1JJKA 2B7PA 2OCZA 3C8FA 4ORMA 3OVQA 1RZMA 1M7OA 3GDLA 1KBIA 1TQXA 4A29A 3C2VA 3C3NA 3MW7A 4N6FA 5CPMA 3M6YA 5HQEA 3L21A 5KITA 3LCGA 5CSRA 2WSRA 3HGOA 3QC3A 3GDMA 2F84A 2E5BA 3PSVA 3ABSA 4LY8A 2C19A 1I2QA 2E5DA 4UR8A 3ZWTA 1MO0A 1CI1A 2RKXA 1ZHAA 1VCGA 3GKFA 1TQJA 1QMLA 5TBOA 2GVLA 3P8JA 1VC4A 5DY3A 1YXYA 4MY9A 3IGXA 3TKFA 3QF0A 1ME9A 2ZZ2A 4BR1A 1O94A 4O0KA 3KRZA 3G1DA 3IRDA 5CZJA 3HPZA 5LNSA 3W1XA 5I3JA 2W6RA 1YXDA 1YDOA 3ZWSA 5HUPA 3DFQA 4DPPA 3W73A 5K2ZA 1TPEA 3T7VA 1EWEA 3EWUA 4W9TA 3RMJA 3C2OA 1EB3A 2VOMA 3LXBA 4AWUA 1W5MA 1EEPA 2Z2UA 4NZJA 3TAOA 4GE8A 5DCDA
chains in the Genus database with same CATH superfamily
3RRAA 1K6WA 5CAKA 1IEVA 5BXPA 1VBRA 2ADAA 3Q2DA 1R3TA 4GIEA 3TN4A 1UQZA 2HV5A 4HOZA 3CZLA 1W1ZA 2FYMA 2QCCA 3UXIA 4GNJA 3O07A 5TQLA 3CQKA 2WHMA 4LAKA 2J4GA 2FJKA 4O1CA 1B3ZA 2FGZA 1KLYA 1W9BM 1OFPA 3W88A 1VS1A 3B0XA 2J7FA 2F38A 4QTGA 1VEPA 2VQTA 5JBDA 2J7HA 2YSWA 4JYEA 4NSBA 2I14A 2NQLA 4A3YA 2O9PA 4UCGA 3FEMA 4EPDC 3NAVA 2V2DA 4KWSA 4IPPA 3W6YA 1E51A 2REQB 1BG4A 4FX6M 3QV8A 4X3ZA 1SMAA 4BQ4A 4O15A 1ZS2A 1WZLA 3VKKA 4BQ2A 3H2NA 4XZMX 1T8QA 4AIEA 1PTGA 1RK6A 3SJ3A 3GW0A 2V63A 4BA0A 2A3CA 1IE7C 3SFKA 5LNUA 4L9ZA 3VC6A 1CT5A 3PNZA 1RPKA 1WKFA 2EHHA 2C1HA 4GGBA 3AMKA 4R53A 3A47A 1E6PA 1B30A 1XSIA 3ARSA 3ES7A 4E38A 1W3HA 3VZXA 2Q8XA 1SO4A 3M46A 4B92A 4L6DA 2VC9A 3UZXA 5DMLA 1V02A 2HRWA 4J3ZA 2HDJA 5EPDA 3WDHA 3HGJA 4WSJA 4GCXA 3WLRA 5BROA 1NIUA 1SZFA 4A3UA 1TO3A 4XIAA 1FWCC 1TWDA 3NZGA 1UWTA 1E6RA 3INPA 4S3FA 2L5HA 3W7RA 1MEIA 1DWJM 4B3LA 4YCOA 1EEXA 2Z24A 1FHDA 3N29A 1LM1A 3II1A 2FPTA 1SPQA 4W7WA 1GVEA 4N02A 2OSXA 3IK4A 2V0TA 1QW7A 2QGHA 1BWLA 3S6DA 4I7UA 4AAJA 4AY7A 4G7EA 2WJZA 1EL3A 3VCNA 1UW9A 1VRDA 3O63A 4C6OA 4NILA 3E2QA 3HIJA 4JHOA 5LZLA 3H6OA 3CL8A 2Z28A 4G6CA 3REQB 5A6BA 3DC0A 5M1TA 3M43A 1DV7A 3TQKA 4YXGA 3U0HA 1SJAA 2BOEX 1OHLA 4KIRA 4PCSA 1CDGA 4QAWA 2PGFA 3DFOA 3CMFA 3W7KA 5AC6A 3H12A 3GD6A 1UD4A 1A0EA 2ZUVA 2AGTA 3IVSA 2G37A 4GINA 4B90A 1M53A 2DY3A 1GG0A 1CGWA 2D20A 2JBMA 1V02E 2BBFA 1DXEA 3ATYA 3VNZA 4WK9A 1JDFA 3G24A 3CZGA 4KEMA 3UJEA 5JUVA 1KXTA 1UROA 3GR7A 3QFEA 4QQUA 1B9ZA 5BRQA 2I7GA 1JPMA 4Q8NA 5DF0A 1LLZA 3EKLA 1RY0A 2DORA 4B5SA 1X97A 3SRKA 1MUCA 3O2LA 4YS1A 1MZHA 2XWDA 2Y1HA 4LB4A 3SQMA 3WNPA 4UTJA 4J27A 3ZZ1A 3N4EA 3FKRA 1HT6A 2ZZ1A 3PG9A 3ARTA 1TG7A 4W4QA 4CN1A 4O19A 1V6YA 1VF8A 3ONCA 2A3AA 4JFTA 3EGJA 1EJWC 3GHSA 4GVFA 4POCA 1QPQA 2C71A 4JL2A 3AXXA 5A1AA 2YA0A 4H9XA 4NASA 2QEZA 1X7FA 3WIJA 3W26A 1ODUA 4UFIA 3EEZA 3SEPA 3G77A 4Y90A 3KOZA 1B5TA 2PDCA 1XLKA 1M9HA 3EPNA 4GACA 3UD6A 2PRHA 1HW6A 1LOLA 3PULA 5I2UA 3WF1A 3HV8A 3GU9A 3W7EA 2PAJA 3ZT6A 3GAKA 3PFMA 7REQA 2XH4A 4E2VA 1Y8BA 1UR9A 3MVIA 4E3VA 4ORIA 1YDVA 3E5PA 3V5CA 4XZHA 4EANA 3MV11 1QPNA 1RLDA 2NX3A 5GJNA 2DSWA 3E5BA 1B2YA 1CEOA 2YXOA 3A5FA 4ZEPA 3HG2A 1EC9A 1I45A 3W1NA 1WZAA 1PBGA 3SW6A 3VDGA 2DPEA 3PZTA 4YMZA 5E5CA 1UZ1A 4J3SA 5ECUA 4IFRA 5ABTA 3MJMA 4REQA 1OB0A 2VX6A 4RV8A 4GNKB 1FRBA 1VFOA 3DFTA 4D6HA 1X1ZA 1PCKA 3URAA 3FY1A 4C1NA 3MI2A 1IWBA 3CL6A 4YTTA 1J4EA 1K8ZA 3W84A 3ZSTA 4PUJA 1XYBA 3UR5A 2XVKA 4MF4A 2J13A 3ITCA 4KQNA 4XBJA 2PDPA 4ERGA 4HD5A 3NL2A 3M5XA 1CGYA 1W3TA 2CBJA 4NI3A 3HOJA 3CQ0A 3GUWA 2PSNA 4AWSA 1FKXA 4W93A 4J3TA 4R34A 2NSXA 2QCNA 4XKMA 4KCVA 1UOKA 5EGRA 4O0QA 2CLPA 3DFYA 5HQMA 1J0IA 1QR7A 3F2CA 2X1RA 3CO8A 2OQLA 1E5NA 1E72M 2J66A 4OBTA 4OOUA 4HYRA 3S1GA 2NVCA 3ELFA 4WDWA 1XRVA 3APYA 1H1ZA 1GPFA 1VCVA 1GOQA 5BRBA 1LTDA 1O5RA 3EX2A 5GVJA 3ARZA 3M5ZA 6ALDA 1XHGA 2R1LA 3DAQA 3H54A 1U5VA 2PLKA 1FBAA 4Q8VA 4NT0A 3CAQA 1EO7A 3UT0A 3PJTA 4HNOA 3DXIA 2PDFA 4AISA 1KGXA 4UR9A 3PUDA 3NPUA 3S1UA 3VABA 4UQBA 1B3OA 3LRMA 3CTTA 1IEXA 2R94A 3USZA 4JD4A 2ZRYA 1BXBA 1ISYA 2Z2AA 2B7OA 1TV8A 1GTHA 3V16A 3VKDA 1AA1B 5FESA 1XYMA 4L1XA 1RUSA 3CM4A 1Q85A 3DGRA 4Q8MA 2DP3A 2IS7A 4LYRA 4FIRA 4JDBA 1F4AA 1XIEA 1UP3A 2Y61A 4JFWA 3F4CA 4O1BA 3ID7A 3A3WA 4JIEA 2NSOA 3SI9A 3GHTA 2QCHA 1TTQA 2WKLA 5HK4A 4JFVA 4WEVX 3VIKA 4AF0A 2G4FA 4PZVA 3UJ2A 3P7YA 1E6ZA 5C2GA 1A53A 3CTLA 2A5HA 1EZWA 2F6KA 3ANYA 2OXNA 1OEPA 3FJLA 4WDTA 1ONEA 4A4AA 2RGMA 3FYOA 1JD7A 3T6CA 4LV4A 4DJDC 1F07A 4LNCA 3B9OA 4V27A 1O4UA 1JI2A 4ZA0A 2AQVA 4W87A 3NPXA 1VYPX 3B8SA 4OUIA 1FHUA 1KCXA 4JKMA 4E8CA 3W2LA 3UCQA 2I16A 4CEXC 3CQJA 1EKOA 2FMOA 4IIFA 2DW7A 3SUVA 5D9MA 3OLIA 4YTSA 1XRSA 4F48A 3SIZA 2F6XA 4PBFA 3T0AA 3AIUA 3TOYA 3QTPA 4LVGA 5CSSA 1A5AA 5CZKA 5C5YA 4AEEA 2NUXA 2H6RA 3FK4A 3WL0A 1GJPA 1QNQA 1KW1A 2W9MA 4FHAA 5HR6A 2PDHA 4FF7A 1R3VA 4FSAA 3RPDA 1JCJA 4UTMA 3S5YA 1ZJAA 1IIGA 5HWJA 3M4HA 1GWJA 1JQXA 3AHVA 4AZHA 3W00A 2X7WA 4V1XA 2OYKA 3RLGA 5I78A 2Y7FA 3TONA 1RD6A 1G7UA 2IXUA 4MYXA 4KFNA 1K8XA 1VFLA 4AUBA 4ZQNA 5MKGB 4E5TA 4DBUA 2WANA 4QIUA 1C9WA 2VM8A 3KBJA 2QVNA 3CK5A 1JNEA 3T55A 3DIPA 3RITA 2EJ1A 3SUUA 4HNVA 3V75A 5FAJA 2OODA 2PTWA 3GYCA 3GTNA 3H70A 2YR1A 4RV3A 5CC6A 1K3UA 3L2LA 3IGHX 1TZ7A 1GOMA 4LRTA 4L1WA 3RM4A 1Z6KA 4YTRA 4S23A 4O18A 1PL9A 3LZ5A 4HVXA 4U3CA 4U33A 5AHIA 1XH1A 4DB7A 3RU8X 1VPXA 5IRPA 3TWBA 4AD0A 5A8OA 2OKOA 2ZUSA 4TX9A 2G3NA 3CHEA 1OC6A 2YIHA 1A5MC 1XXXA 4ENLA 1U30A 4OBRA 4UTTC 2QDEA 1V6XA 4TXEA 2VFGA 2REQA 1XDJA 1H61A 3ABOA 4PSRA 5BXRA 4C6MA 4A8LA 3DENA 3LCLA 4PMVA 4K68A 1W0MA 3MC5A 3BMXA 3THDA 1ONWA 3V18A 1TMHA 1IWPA 4GUFA 1DJGA 1A5UA 1MMFA 3MWAA 3COTA 3MU7A 1DP0A 1H0IA 3G0SA 3GDRA 1R3QA 3GQYA 4D6IA 1MSSA 4NAFB 3ABQA 4H00A 2BVWA 1QUMA 4C6IA 4UUIA 5KTLA 3ARQA 3DI1A 4KRTA 2ZWYA 4RPQA 4DWSB 4PB5A 1XIHA 3HB9A 4V2XA 3OG3A 3UPBA 5SWUA 2D2GA 4ZO9A 4WVXA 4W5ZA 3M0VA 4H7ZA 1JCXA 4JS3A 1TIMA 5DEZA 1V6TA 2I9EA 3NQCA 3OZMA 1XBYA 3GUGA 2VVSA 2BOFX 1K70A 4L61A 4GY1A 2PDBA 2W27A 5A6TC 2FH8A 3UWZA 3FN9A 1LRTA 2DV0A 4NRRA 4O1EA 3AYRA 1DJWA 4MDPA 1O5KA 1FWNA 2XGIA 2GQ8A 2XG9A 1V5XA 2Z1XA 3BAWA 4NG3A 3NQ7A 1GORA 2D24A 4LOCA 3EPOA 4HK5A 3O0KA 2QJGA 3UR2A 3WQFA 3SRFA 4JNZA 3VNIA 2Z00A 4XVDA 1M3UA 1NTHA 3REQA 1JI1A 3P2VA 1K03A 1WAWA 4CVUA 2KAUC 2FQIA 1H51A 3M5YA 5CGTA 3QHMA 2FB3A 2NT0A 3G6MA 1UR8A 1PWMA 1EF3A 2Q3RA 1RVKA 3S47A 4I5RA 2QF7A 1V51A 2XVNA 3ZMRA 1AH3A 1RXOB 3S2MA 3LHYA 3UESA 1TPC1 1KV8A 4B2DA 1ZB5A 4NI8A 1ITUA 1FH7A 4RXFA 1C8QA 3OGSA 3HQ1A 1VFTA 1D8CA 1OCQA 5T91A 3W7IA 2GQ3A 5BCAA 4O16A 1VBGA 4HA0A 4DUVA 5IM51 1W32A 4CCCA 4AX6A 1KM2A 4MB4A 1FWHC 1XC6A 4C6BA 4PC8A 3W6MA 2WWCA 1XWYA 5DMNA 1OK4A 4TMCA 3MCOA 4N9EA 4AZCB 3M1ZA 3WKZA 4RNHA 2GDUA 5EA9A 4HCHA 1ZU8A 2QS8A 3F7JA 3VM5A 3UG8A 5C70A 3OODA 5EMUA 4RX0A 2HVMA 2HPIA 4GQ0A 5H8PA 3W3OA 1UKPA 3MKCA 1M7PA 3CB3A 3MMUA 2DZAA 3W7NA 4ZE5A 4US5D 2E9LA 5DLCA 3ZIZA 5JIWA 3HURA 3DDMA 3ZR6A 5LKYA 3BLKA 4X61A 2ACSA 3TV8A 4IJRA 2XIJA 1GQNA 3L2MA 3LGGA 2ISVA 3MSDA 4W8BA 1TZ9A 3CV7A 2DZTA 3ZLFA 4JX6A 3AUOA 2VZVA 3AYVA 9XIAA 2DZPA 3FLUA 4I8DA 2VZSA 2C15A 4HN4A 1FDJA 4F0MA 1MW0A 1N8FA 1J5SA 3BV4A 3WQEA 1HIZA 1VEMA 2WSYA 4YL2A 4IMDA 3P0WA 1UP0A 1HTIA 4QE1A 1V7AA 2QYGA 4Z1YA 4IIDA 4TU1A 3M0IA 1Z8AA 3I4KA 1FVPA 1K9EA 1RVGA 4JQ4A 3K1GA 3N17A 1N2VA 4HHHA 2BY2A 4A2SA 2GZXA 1JEZA 1X8FA 3BLLA 1EDQA 1RP9A 4QCEA 4O28A 5TD4A 1TSIA 2PUZA 1Q6FA 3W02A 2KX9A 3STFA 1RH9A 1BWKA 2BB0A 3HM7A 3B40A 1JG9A 2WC7A 2GLKA 4HHMA 4XIMA 3U4AA 4C7GA 4R5EA 3G1XA 3LTSA 2I9UA 2C1GA 2XVLA 2P76A 3TC7A 1US0A 4PMYA 1SZRA 4Q4MA 2QT3A 3M7SA 2ABBA 1XUUA 3VFCA 8CGTA 2BXVA 2YFOA 3ZT5A 4RDVA 4MGGA 3NWRA 2VP8A 3QJAA 2X40A 4PUDA 3A22A 1CGVA 3K8LA 1BPLB 4EVZA 3NQDA 1GCYA 1TPFA 3WYZA 3RK8A 3T78A 1GZ1A 4PH6A 1I8JA 3BAKA 2PWGA 3CMJA 3OHIA 3CT7A 4QS6A 4GCAA 3BCFA 4Z42C 4QE5A 1TPH1 4M7SA 4KFOA 2XIMA 3HQOA 2QXWA 3UYIA 1S5VA 1H41A 3D0CA 2WLYA 3AICA 3GBDA 2WOQA 3LRKA 2ISFA 2DZSA 4J3VA 1M65A 4PTDA 4BY3A 5GPRA 1TVNA 1PYMA 4HK7A 1HL2A 4TV6A 3CV2A 1UKSA 4UCFA 3UWUA 2RDTA 3WF4A 3RFAA 2WXDM 3IGSA 5FJUA 2PD5A 3LCHA 4AD1A 4UMAA 2HXUA 4CD7A 3RM9A 1MXGA 5CAHA 4U2ZA 3PANA 4QG6A 1F4HA 5DT7A 4DO6A 1LOQA 5J5DA 1UWIA 1S3TC 2WZEA 1BVZA 1P4CA 4Z2KA 3CQHA 2G50A 1DIEA 1PZ0A 4MZ1A 4TO8A 3WY1A 1E1EA 2VDGA 4CD8A 3G1VA 3C86A 5CXPA 1O95A 2WQPA 4AMAA 2DT0A 4YWSA 4B91A 3PTMA 3WL1A 5LIWX 3PZ9A 5A6BD 1XSJA 3IJ9A 3UCDA 2VCCA 1KD0A 3RPTA 3KBVA 2E9BA 5K4ZA 5AYZA 5G2HA 4DVOA 1TYGA 3EXRA 5IBXC 2XSBA 3MUZ1 2CPUA 3EMCA 1BYDA 3I65A 3ARYA 3WUFA 1XBZA 4ZOAA 3THUA 3G0UA 2CBIA 3KS6A 1NOUA 4P8VA 1H2JA 3KZSA 4MVAA 5G4EA 4OOZA 3ZO9A 1CNVA 3GG8A 3M0XA 1DORA 1E70M 2YJQA 3ITLA 2AGKA 1CECA 3RDKA 5G2WA 3MMWA 3H55A 1PKMA 3OPSA 3VNKA 3OLEA 3PZQA 2VKZG 4Q3MA 3E3HA 2FHFA 4ZENA 3GAYA 2VCBA 2GDVA 2BSLA 1J10A 2GJLA 3BQ6A 1N8WA 4WSHA 3G8EA 3N14A 3EDEA 5CGQA 3H53A 2GWGA 3OYXA 3MYOA 1JF6A 1VYRA 1UA7A 4MNJA 2PWFA 3UU0A 8XIAA 2X1SA 3L5MA 1F73A 2R8WA 1Q6CA 3WLOA 1VCFA 2E8YA 3DZ1A 2E8ZA 4P61A 2Z26A 1QK2A 1KKOA 4R33A 2D0GA 1AG1O 5CPLA 1HJVA 2VFIA 4ZB2A 1D2KA 3WQWA 4J2MA 3WH9A 4R3UA 3HMJG 3CC1A 4QNEA 3C2EA 4K37A 3TLQA 2CXGA 5FF2A 1ZAJA 1PKLA 1KFLA 2G5WA 4YWIA 1XLIA 1XDMA 3G2GA 2PRMA 5MKGA 1UBSA 1UR2A 4J5NA 1IZCA 1IZJA 2ICSA 1H7XA 3S2CA 2O7SA 3R4IA 1A3WA 3LG3A 3TYCA 3AHYA 1L6FA 2JEQA 1PX4A 4D8LA 4YHGA 1TPUA 1XX1A 3N19B 2ZDSA 3VILA 4F2UA 1VHCA 2XU2A 2ODOA 3TFCA 1B9BA 5DT5A 4GYPA 4YIWA 2VGIA 4WZHA 2PC8A 3HBLA 2ZUNA 5EMYA 4JQAA 3AI0A 4IMAA 3MYPA 2G96A 2C16A 3RNDA 3OIXA 3W7OA 2YCIX 2WZIA 2Y8KA 1HO4A 1KTCA 3FJNA 3NQ2A 2BG5A 1LF1A 1RLCL 1W3KA 4O54A 3WMCA 3VGBA 4KCWA 4GBUA 4LF2A 4IJCA 2Z7GA 1JUKA 3DG7A 3JR2A 1HP4A 2UY4A 1OZQA 1GVOA 3RXZA 2F9RA 4UOJA 3BSMA 2PDWA 3AWNA 5G1YA 1E9LA 1SJDA 4GWEA 2ACQA 5LGXA 5KZ6A 4NX5A 1HKWA 3ABZA 4NAFA 2P50A 4GK8A 3WLMA 2QIIA 4NZ1A 3P5ZA 1NF7A 4GYJA 5GNZA 2NWSA 1A5OC 1OX4B 4MTVA 1N55A 1BTCA 1NJJA 1GHSA 3BLEA 4DWSA 1QHOA 3AMGA 3IACA 3TA9A 1YNYA 4PMXA 3LUTA 4XBKA 5CZSA 1YE4A 3LGEA 5HMFA 3T40A 2HNHA 5J5RA 3VD4A 3IAPA 3DG6A 5KZEA 1MNSA 4D6CA 1PZ1A 5F1UA 3MUAA 2IQDA 3KL5A 4PMDA 3N11A 5D38A 2XINA 2OZ0A 4J3UA 3WD1A 3B04A 2V2CA 4BF5A 2YL5A 4PTNA 2F8QA 4PEKA 1H09A 1UP2A 2G3IA 2BS9A 3I3EA 4HMDA 2OLSA 2D2OA 3H2FA 3SN0A 1R5YA 5K9DA 4DWDA 3W2UA 2DSUA 2Q3OA 2QV5A 1XISA 3Q58A 2VCAA 1EX5A 3KRSA 3KX6A 3QFWA 3RLUA 1ZALA 3NVDA 1E4IA 3B4UA 2A0NA 3VGHA 2HCVA 2O56A 4GQGA 2CERA 4PMOA 2W4XA 3OZOA 1UR4A 1PTAA 3U57A 1YE6A 1VD6A 3U2ZA 4YVXA 1PO9A 1F8IA 3E0VA 7PTDA 3P8IA 5EMKA 5D2XA 4GVIA 1KXVA 3I7RA 5A6MA 2XN2A 2J8TA 1Q66A 4BJHA 1LZOA 5I00A 3NM3A 1F2JA 3DHUA 3KVMA 2WCGA 3SSJA 1KWGA 4C5YA 4D1IA 5B7YA 4GUGA 3WLIA 3N2MA 3EEGA 4H9ZA 1A5NC 1TWZA 3NDOA 2AMGA 5HNUA 2PB1A 4AZCA 1LWJA 1VR6A 1S1RA 1V3IA 3TJIA 4MKNA 3WELA 3KHJA 2ZUMA 4QSFA 5K3VA 2VUYA 1IV8A 2V5CA 3VNMA 3DG3A 3W22A 2XTKA 4GQRA 3EAUA 1OFRA 1V03A 1JCNA 3B8TA 3FHAA 4LNYA 2A85A 3G3MA 1KKRA 3U7BA 3H22A 2J7BA 2O9RA 4MSSA 3E9AA 5LIUX 4LYPA 4J40A 2PEVA 2WKJA 2Z25A 2CLMA 5HWMA 2ZZ6A 5U7SA 1OFEA 5E0CA 3EB2A 3FEQA 1PKNA 1YPXA 1AQMA 1M7OA 3MCNA 4AD2A 1TQXA 3GY1A 2EPNA 3M6YA 4MB5A 1PPIA 1WB0A 4F0KA 1B1YA 1CB7B 3HGOA 3GDMA 2F84A 3WFZA 4W89A 1KQZA 4CN4A 2QDDA 3ABSA 1HVQA 4CKQA 4MB3A 3LQGA 2FZNA 3NXLA 3GKFA 1TQJA 1QMLA 2GVLA 3P8JA 1Q7MA 1SYTA 1ME9A 1UD8A 2AKMA 4O0KA 1W9XA 4JOMA 3KRZA 3G1DA 1CYGA 2W6RA 3W6LA 1XYAA 1SFTA 4E8DA 5K2ZA 4L6OA 3T7VA 3PAOA 4GA8A 1EWEA 3EWUA 4W9TA 4BZYA 2Z29A 5TF0A 1EEPA 4ERIA 3B3DA 5AZ0A 1W1IE 1XLEA 3OHMB 1RJPA 5DCDA 3R79A 1US3A 4D72A 2PDXA 4HK6A 1WDDA 4QGCA 3U48A 1E43A 4L4PA 1VFFA 2QPXA 4AG0A 1RJRA 4UWMA 1CPUA 4R9XA 1DYSA 2H8ZA 1QI2A 3CV1A 1O66A 4OFCA 3W23A 3OYZA 3W70A 3K1DA 3KTXA 2HJPA 1J01A 1TX2A 4JCMA 1TREA 4BWLA 1YNQA 4PTXA 1CXIA 2VEGA 1NEYA 1UB3A 3VKCA 1HF6A 3B9DA 4Z1DA 1EIXA 1TV4A 4RXGA 3OVPA 2QUVA 3DGBA 2I5QA 4GZIA 4IGSA 3GXFA 2FZ9A 3HG5A 4B5XA 3EB4A 2YL6A 4JN6A 3KCJA 4C6QA 1B54A 6REQB 2J78A 2FZDA 5C54A 3TOPA 2D0FA 4JY9A 3EPMA 4G1KA 4LYQA 1R87A 4OZOA 5F4SA 2HVOA 5E0KA 1XL9A 1YXCA 2EO7A 3LPGA 3PHAA 5I0DA 2DZBA 5FL1A 1JAEA 4NJIA 1LWIA 3BWWA 3E02A 4C6FA 4IZGA 3W7QA 3XISA 4DIAA 2QR6A 3S1WA 3AS0A 2PDLA 2CLIA 4RR4A 1SR9A 6TAAA 3GHUA 3UZYA 4AYSA 4MY8A 3HGRA 3KOWA 3VPLA 3WUGA 1KRMA 4GKLA 9XIMA 3NQ6A 2E67A 4BEUA 1I75A 5FF3A 4M19A 4G9PA 2EXOA 4QRNA 4ZO6A 4ZMGA 3KL0A 4RDWA 3TU9A 1FWRA 1GVQA 3D3AA 3CAWA 4M3PA 4B3ZA 1L8PA 2YCLB 5IOBA 4GVHA 1ZRQA 4O1DA 1A0DA 2J7DA 3O05A 4B5NA 3FJ6A 4MADA 2NQ5A 4AW7A 1I2OA 3FV9A 4HHPA 1XP3A 3NA8A 4Q8TA 1UMYA 4H3DA 1G5AA 2BGNE 4A3HA 1WDQA 3STCA 3SZ8A 4ADTA 4DYKA 1JFXA 2Z7KA 1U1UA 1Z41A 4PL1A 5C6MA 2J7GA 3E2RA 5CG7A 4B2DD 1W1A1 2OZTA 1TMQA 3OG2A 3VAVA 4A21A 5E09A 3FAXA 3GTFA 3PPHA 4LCQA 4HYVA 5DFAA 1Y7VA 1XR2A 4M51A 3AALA 3BGGA 3UJSA 4S38A 2V8ZA 3UQNA 2WMJA 3ES8A 1X6UA 1W1PA 3HPSA 3UFYA 2DEPA 4H6KA 3OVRA 1KTNA 2XVGA 4GXWA 5CH9A 4YPJA 5D9OA 3P80A 4P7NA 4PCTA 3KLLA 3H24A 3UXAA 1M1BA 1PHQA 1FOBA 3FCPA 5JBFA 4DI8A 1YTKA 3E6EA 2DVUA 2I1OA 2H3DA 2WVTA 3GHRA 4HNUA 2V3EA 1EYEA 3PBMA 1F6PA 4F2TA 1Q6RA 1G6CA 2OWWA 3PVFA 1XCWA 3PPCA 5CQ1A 4IWWA 3EX6A 5AHFA 1QW9A 1H1NA 2G4JA 1G4PA 3WQ6A 1GOXA 3GRIA 3UGVA 2VFFA 3QSRA 1OFOA 5LNRA 1AD4A 2PDUA 4ALDA 1RP8A 2CBVA 3RUBL 1PEZA 4XV0A 3OP2A 3GIPA 2PDKA 3CUGA 4HOXA 1AJ2A 2NLYA 5ABHA 1YRRA 1BLIA 2R6OA 4D6EA 3F1QA 5AC4A 1XH0A 3N6QA 4HMCA 3IARA 1A5BA 1MDRA 3BJTA 1ZBKA 3P6LA 3SCSA 4WGXA 4LX4A 1U2YA 4N9CA 1EOKA 1S5NA 5BOOA 3QMSA 1YNPA 4CD6A 3VD5A 5AHNA 1UHVA 3PUOA 3DECA 4NJJA 3WQGA 5HPOA 2HNEA 1PIFA 3V36A 4IQJA 1XINA 4IPNB 3BG3A 2PE4A 1NU5A 3I7QA 3KUMA 2VD8A 5FJJA 1KGUA 1Z48A 3ME3A 4Y9AA 5I3GA 3SN1A 1QNVA 2QUTA 3LOTA 1T7LA 1W17A 3N2XA 1EBGA 4GLEA 1IXOA 1KCZA 3WBAA 2YCJA 3TAKA 1B4KA 1QNSA 4HZMA 1B3WA 3FA4A 4KS0A 3UXDA 1V0NA 3TC3A 2X0HA 4DUWA 3KRUA 3WK2A 3VK5A 3NQGA 2HWGA 3KTSA 3QHOA 1E1CB 1UZ4A 1IZKA 3GW3A 1GOWA 3SO7A 3G1FA 1PCWA 5A6JA 2CNCA 3RLHA 1E6QM 4QDMA 1OQFA 4O52A 4DF0A 1X98A 4CQDA 4AHQA 4B5WA 1SFJA 2V68A 4R9OA 3Q94A 3PY2A 2NW0A 1OX4A 2PDQA 2PFHA 3H21A 4UR7A 1H7NA 2ZYFA 4ACZB 1UKTA 3UW6A 1NWRA 3KLKA 1MXDA 1LT8A 5CPOA 3QZ6A 2IPJA 7CGTA 4E2OA 2DVTA 3MJYA 4UOZA 1JDDA 1CXEA 1E4NA 4BCEA 3AWOA 3V1PA 5A5WA 3UNTA 3QGAC 3ARVA 4ICCX 1GVIA 3QKEA 5GNXA 5I3KA 1J5TA 3LLFA 3N13A 2OR2A 4L4LA 4JGDA 1FXPA 3SQSA 1ICQA 3CUIA 4WJEA 4M1RA 1RV8A 4GIYA 1NWSA 1BTMA 1UIOA 1UWRA 3TYUA 3TSBA 1ECEA 3GVQA 1XCFA 2VWSA 2JKEA 1UZHA 2ZC1A 4PMNA 4GJJA 4HQVA 3VNJA 5LA2A 1KFJA 3MDWA 3OZPA 1BGAA 2J9YA 4E6MA 3E1F1 4BKNA 1UWQA 4KEZA 1JRBA 1THFD 4UOQA 1CXFA 5MHBA 4OJYA 2V5BA 4S3JA 3EWBX 3QYQA 3O6DA 1RJQA 2FZ8A 3S9IA 4LEQA 5EFFA 1VENA 1UR0A 3LHVA 5D32A 3W2MA 2YBTA 3Q65A 4PMJA 1XLAA 2NQHA 3FKKA 4JYDA 5BWFA 2RJHA 1Q6DA 4K8GA 3RR1A 4MJMA 4XWUA 5LHFA 1WYIA 3AO0A 4WXZA 4O17A 3FHQA 3RJXA 4XK2A 3O06A 4W7UA 4DZAA 4OT7A 4C5ZA 1W8SA 3WBEA 3UZ5A 3BW2A 3QBUA 1S5TA 1ZAIA 3DN5A 2QAPA 4XTIA 4LC8A 2J47A 1EPVA 4O8AA 1VAHA 4IL2A 2YL8A 4AFYA 4TX6A 3TYBA 3IWPA 1QTWA 4DZ5A 1IT8A 3E38A 3W1TA 3L4WA 3C3UA 3CZKA 3AC0A 4KMQA 3JVAA 2WK2A 1G7VA 2WZHA 4JIPA 2VOTA 1JR1A 2CKSA 2E6FA 5EYWA 2AAAA 2E40A 4LY4A 2NQ9A 4L56A 4F2BA 3TNOA 3QXBA 1K7FA 4M80A 4U5IA 2V30A 3VYLA 3TTQA 2OKTA 3TTOA 3G0XA 4CN6A 4M82A 3AYSA 1X38A 1IEQA 2XISA 4ILSA 4MNKA 4W5UA 4J3WA 4CU7A 2DZXA 3UETA 3QHNA 4C1LA 3G6LA 1POJA 4NL1A 3PB0A 2W91A 1VBJA 4FMVA 3MKKA 3G8RA 1GQLA 2GUYA 3QGVA 1G4SA 1NQ6A 3MDUA 4NXSA 1A4LA 1A5CA 5HUOA 3H7UA 4PRWA 3N4FA 1GVRA 4Z2JA 4P7OA 5DBTA 2ZKMX 2VEFA 3MZ2A 3NQFA 5FI8A 4GI8A 1XRTA 3N2TA 2CLEA 3PTKA 2OU4A 2HS8A 4DZHA 4MLJA 2V6AA 2RDXA 3A64A 1K8YA 4FX8A 2HK1A 2VR5A 3HN3A 4NIRA 1IGSA 3TFXA 5CLTA 4AB4A 2GVEA 3ABXA 3GVRA 4V15A 3JZEA 3R43A 2DSZA 4ZCWA 3S9ZA 1HKJA 3BJFA 3D6NA 5JH2A 4I6VA 3PTDA 1H0GA 1FWWA 3PFRA 2ZRWA 1W5OA 4JY8A 1J0JA 1UUOA 1C92A 3CS2A 3EXTA 1I0BA 3RILA 5M2FX 2C0HA 3MP5A 2J8FA 1EGMA 1AQHA 1POKA 4CU8A 1W56A 3L4TA 1J93A 1Q65A 1YMYA 1HJUA 2GSJA 4NRSA 4N6EA 3FSTA 1MW2A 5E93A 4P7QA 1QW8A 3FVDA 4Z2IA 1TPB1 4HTYA 3SBFA 4YNGA 2PDGA 4KETA 4U5KA 2PPGA 1FCBA 2GSEA 4PTVA 4OQVA 4Y8FA 1KFWA 2GJNA 1Q63A 2TYSA 3TDFA 6REQA 2PDNA 4IQDA 1S46A 2IKGA 1HKMA 3TW9A 3PBVA 3WD4A 2JEPA 3GFYA 3CASA 3BTNA 1W9VA 2BY0A 1V8EA 3ZFHA 1GPWA 1NH6A 4AEFA 5JH1A 1L0PA 1UG6A 2VR2A 2J75A 1SO5A 2ZXAA 3WJWA 3LV5A 4DJFC 4XAGA 3IIOA 3MWCA 4DWSD 3VOHA 3NURA 3QM3A 4IP4A 2EG6A 2V67A 2O0TA 4KCTA 2V38A 3NM1A 3AIEA 3A12A 2O9TA 3O0FA 4ZOBA 3C61A 1JCTA 4KH2A 2ZUTA 3UJRA 2JGYA 5FF7A 2DIKA 4C6KA 3IIXA 1Q2RA 4CNUA 1UD6A 5D2TA 4AXKA 3M44A 1XIFA 3UR7A 2WMGA 5E6ZA 3B9AA 3CPGA 2V3FA 3TTSA 2YCLA 4BF7A 4F0RA 4QDWA 3P5YA 3GXMA 2XHYA 2VO5A 2Y6ZA 4D71A 4EACA 2C3ZA 2CITA 1ICPA 4AC1X 1ZL1A 5A6LA 1G9HA 4HA1A 3WH6A 1WDSA 3AOFA 4W88A 4TMBA 1B31A 2WMIB 2DH2A 3L9CA 3LTYA 2D0HA 4GH3A 1UC4A 4C6CA 1V6UA 4O1FA 1SO6A 1E0WA 3LHTA 1EGVA 5LIYX 3LHWA 1OG6A 4XZBA 3LSBA 3PZNA 4RNIA 3GTHA 2OEMA 1D9EA 4GPNA 1X39A 4ICNA 1ICSA 3IJIA 2G97A 1VBUA 4H8NA 2VDHA 1C8VA 2ALDA 3WDRA 1XGZA 3SCQA 3RHGA 2WMKA 3VA8A 4KWOA 3IV3A 3WSUA 2CIPA 3LXCA 4LU0A 4GUJA 2PP3A 3L65A 4GZJA 3WN6A 2OQYA 3FA5A 4BS0A 1F76A 1EC7A 3LI0A 2FHCA 2BOGX 4AD4A 3C5QA 4CNOA 3K8KA 2OOFA 3PJWA 5D02A 1EDTA 2JF7A 1J8VA 3WJSA 4YYFA 4OV9A 3QR1A 4DQWA 3KDNA 1S2VA 4FNRA 1NARA 4GMEA 3M6DA 4NZ3A 3QGKC 4OU1A 1HGYA 1A47A 5BMWA 1Q3NA 4XBSA 6XIAA 3KHDA 3WQOA 4ICMA 3R0KA 2OEJA 1I2RA 3EWWA 3M07A 3M7WA 1XD0A 2WSKA 4QBXA 4DO7A 3LDVA 3T81A 1G4TA 4DJEA 5EU9A 3MUXA 2OOGA 3OLGA 5FJOA 5G4WA 1BFNA 1GOKA 1AZ1A 1OFQA 3UJFA 2VJXA 3AU6A 1K4GA 3THAA 1TTJA 2R1PA 3POCA 1WXYA 1JF5A 2OX1A 2P53A 3PSWA 3CT2A 3FAWA 7ENLA 4M56A 2WAGA 3TUUA 3R2GA 4QITA 5F1VA 1TE1A 1GT8A 3N1AA 5F2MA 4JTQA 2CEQA 2Y89A 3JW7A 3MBDA 4HGXA 4Q7IA 4PFHA 2JIEA 3EWZA 1Q6QA 2R1MA 3VD7A 4HU3A 3VC5A 1VIWA 4UNIA 1U1JA 1ALDA 3WDJA 1YDYA 1JZ4A 3P0XA 2D23A 2J9XA 4I5UA 3BDKA 1XSKA 3V35A 4MOZA 1E4MM 5I02A 4M29A 1W3JA 3UF9A 1H11A 4RZ4A 3PZOA 3VDAA 2YB4A 3T2OA 4PCPA 2YDAA 3KBWA 4RNJA 1E1CA 1UUQA 3KFTA 2QPUA 4MFEA 1UC5A 4GFIA 4K2SA 1TPVA 4X2RA 2GOKA 3EA1A 2WLZA 4XSMA 3ENLA 3P82A 1V6VA 5FIPA 5HNRA 2W92A 1MEWA 1UR3M 5LXXA 2C14A 4GX8A 4ACZA 2ABAA 3WNKA 1Y5VA 3EA2A 3HMCA 2BGQA 4I9JA 3SURA 1UPPA 1GJWA 3AHTA 3GTIA 2W67A 2OSYA 4NZFA 5A2CA 3KL3A 3AFBA 3BMVA 4PMZA 1FUYA 1PTDA 5GQBA 4BEQA 4QX4A 3GR4A 3BOXA 2ZICA 1LOSA 1FDYA 3B8DA 1AW1A 3S42A 5CPQA 3VX1A 3DHPA 2GSHA 1H7PA 2CLFA 4XZWA 3CUHA 4LYKA 1E40A 1TCMA 5FKYA 2BZNA 3ARXA 1E0XA 3IUIA 2SFPA 2FJUB 1EBHA 1QOXA 1R9YA 1W5PA 2OG9A 5IDZA 4AC7C 2RFGA 5CBBA 5DCBA 3LGDA 3FVMA 5JVLA 1KFKA 3LHUA 4WGHA 2P3EA 5ABGA 4GD0A 2OMAA 1Z69A 5LGZA 1FH8A 1M7XA 1X96A 4JTAA 1QRQA 4AMCA 4D8AA 1W6TA 3EOSA 2TRSA 4O0ZA 2DJXA 1V0KA 1BRLB 1HKKA 3W38A 4ATWA 1DHKA 5BMXA 2HEJA 1FA2A 3C8NA 1EJUC 4MFDA 4AH7A 4CCZA 2C7FA 2VGGA 4O4VA 3A21A 3IV8A 6TIMA 3TZNA 2VELA 4KIEA 1SR0A 4S3AA 1T40A 4JTTA 1FWTA 3EOUA 3NXFA 2CLKA 1UA3A 1V0MA 1XH2A 3BJSA 1QHPA 3NSMA 1Z44A 3T9PA 3ZQ9A 2XYLA 1HVXA 3VD3A 3QR0A 1OFBA 3UEQA 1R7OA 4Q4SA 4DZIA 4EXBA 1Y5XA 5JBEA 3L2IA 2ISDA 2X09A 5EMJA 1VPYA 3SCNA 1EF2A 3AUJA 3E0FA 2J9ZA 4GKTA 2VZUA 4PCFA 4UMBA 1Z42A 3FSUA 4KFPA 2NV1A 1KRBC 4GVGA 2XH0A 4JTIA 1ME7A 4DBDA 2EPHA 3UYCA 2J27A 1TPWA 2DW6A 2UZ9A 4ASTA 4HOWA 4YTQA 2EPOA 2J74A 2A21A 3L0GA 1TB3A 2E6YA 1UJQA 3ZJ6A 3A4JA 3BLPX 3F4VA 3RF9A 1KV5A 3BAJA 4HCLA 1AMKA 1YPFA 2OJPA 3DX5A 4JNYA 4GYKA 4G8TA 1WO2A 4ONVA 3CZEA 1X8CA 4QG9A 2RHGA 3ANVA 2R9RA 4FO4A 3KEHA 1R38A 3W27A 4JAWA 3ZS4A 2E6AA 1S39A 4UFHA 2X2GA 1V4YA 2FIQA 1PX3A 1BF2A 3L23A 3HA1A 1MRAA 2C18A 1TV2A 3QLDA 3DESA 4HPGA 4GBDA 1WAUA 4KWUA 4ZO8A 3GKAA 1J0ZA 2CZEA 3VIOA 4C7FA 1Q5MA 3SQLA 3W7GA 4YVPA 4LBUA 3CPUA 3O6YX 4DJFA 4WOQA 4H7VA 2EEXA 1EO5A 1SO3A 2QDHA 4NNAA 5CPNA 3C56A 2G8ZA 2YYUA 3GE7A 5IHRA 4WJ8A 3VIMA 2BNJA 3WK0A 2FGBA 4FB7A 3UXLA 2P88A 4ZOEA 1D7KA 2ACRA 1VPQA 1Q6EA 1J96A 1YHTA 3JU2A 3M47A 4U10A 1XGDA 4JTSA 1QOPA 4IHCA 3BZJA 4M6QA 4DLMA 2C13A 4XTDA 2X0SA 3VDCA 4MJ2A 5REQA 4F9DA 2JE8A 2GGJA 3O6CA 4MB1A 1EDGA 1RBLA 1NELA 2ZX9A 1J18A 3KBMA 1M41A 1C3FA 4ZQPA 3DEQA 4EP8C 5JXQA 2YBVA 3H23A 4GY0A 4IQEA 5HXMA 3NSNA 2GJRA 3LMYA 3QW4B 1QDSA 1UASA 5C2XA 2EAWA 2ZUUA 1AW5A 1KM0A 3SY1A 3KOFA 2R82A 1SW3A 2ZZ5A 4FA3A 3A4WA 3CHVA 1UUMA 4CNTA 2YA1A 3LCWA 3W7LA 3NGFA 3MI6A 1PDZA 1CXLA 3OTRA 4IFOA 5BOEA 1DQUA 4HTBA 3W7JA 4WX2A 1H49A 1Z89A 3U5YA 5A3HA 4D6GA 3MUIA 2CBUA 4K38A 1NSJA 3FDKA 5CPSA 4I7WA 4KPLA 4Q8WA 3W7DA 2E09A 3PAJA 2CHOA 3PPFA 2GGGA 3H4WA 4O14A 1IF2A 5D30A 3V0SA 4FXSA 3DYOA 4I9MA 3CAKA 1FWFC 1K1DA 2V69A 1KM4A 3P81A 4GUHA 3QOKA 2Y8VA 4PUNA 1RALA 4IGHA 1KC7A 2G41A 3VCCA 5HA7A 5A8NA 4AY1A 3CIVA 3UP8A 1W8GA 3HO8A 4C6NA 2FVMA 1OZMA 4NXKA 1JPIA 1S2UA 1L2UA 5DELA 1KBBA 1EUAA 2NQZA 2P8BA 1RR2A 4DXKA 1VH7A 4IPIA 3VNLA 4YVVA 2XH7A 1XLLA 1V3LA 4GQQA 3VNDA 1OCNA 4HA4A 4MPKA 4O12A 4H8UA 4L6HA 4K8HA 3O1NA 4RDYA 4TR9A 4Q22A 2Z1WA 1JYNA 4JX5A 1UWAA 1IIHA 3GXTA 1TMLA 3KVJA 3AIQA 1K77A 1ZCOA 2D22A 2QPSA 1NY1A 4ZB5A 2QULA 4UQ9A 1XYFA 5BWAA 1MI3A 4IICA 1KO0A 2WMIA 4HZ6A 1E56A 3LPFA 2CFFA 2INZA 5J8LA 1ZNNA 4GIAA 3A13A 2ZRVA 1P6BA 5HDRA 4GC3A 3EYPA 3U3HA 5FL0A 2I56A 2UBPC 5C8BB 1EOMA 2X30A 4K7VA 2QAFA 3GB6A 1ODZA 1IT7A 1TTPA 2VX5A 3H2AA 1FP9A 3TW7A 2DFAA 2R91A 2E3ZA 4EOUA 3B8IA 4D1JA 3HJZA 3VFLA 4DYJA 1RK5A 4IX0A 1JULA 1OD8A 1KRAC 5C9ZA 1H60A 1HJQA 2PWHA 3BICA 2Z1KA 1G94A 3ITVA 3VE9A 3UG5A 1LDCA 3NQAA 6CGTA 3LV6A 1LCOA 5LYRA 4Q33A 5FF4A 3ANUA 2WZMA 3N2BA 4PTMA 2OB3A 3A5VA 3S2NA 3WH5A 5AYBA 5I24A 3S6TA 4U3AA 4HT3A 2Y24A 2PWVA 5LIXX 1ADSA 4DAIA 3UNDA 2PBGA 3OA3A 1F5ZA 3FYPA 4KWWA 2A1YA 3BGAA 2E1WA 3WLTA 3TQPA 4Y9NA 2V81A 1YEYA 1YADA 3W1MA 3CHCA 4RW3A 4QISA 2BMBA 4P8WA 1QBBA 3PUEA 1KBLA 1C7SA 3CWHA 4OVXA 2EG8A 4QHRA 3GG7A 3VMNA 2ZRXA 1XICA 1ZGDA 5A8PA 3SCOA 5EFDA 3ITTA 1J11A 3RCNA 3NPVA 1REQB 2ZFAA 4TV5A 5A6SA 3PUGA 4PUMA 3GU1A 4O10A 4ZQRA 4NYYA 4UTHA 3NG3A 5G5IA 3FW6A 3TTEA 2DJLA 1NFBA 5M3WA 2OCZA 3VGFA 4ORMA 3OVQA 4HJFA 3MTWA 1NP0A 3WF2A 3HQPA 3NIYA 4N6FA 1SVDA 2ZIDA 3WNMA 5HQEA 5KITA 2WSRA 1Q8AA 2E5BA 4ATLA 3PSVA 4HNLA 1QNOA 2VRKA 1WUEA 1XFCA 2W3ZA 3WBWA 4UR8A 3ZWTA 1CI1A 3CHFA 1UYQA 3VZZA 5TBOA 3MY9A 1VC4A 5DY3A 1YXYA 2WMFA 3TKFA 2IXVA 4MAZA 4BR1A 5HANA 1O94A 3GG0A 3F5JA 3W1XA 1QNRA 1WKEA 1YXDA 4BQ3A 2BV9A 3OOQA 4DPPA 3W73A 4PSPA 2DSVA 4R88A 1UQYA 4JPGA 3C2OA 3RYSA 4AWUA 1E4LA 2VMFA 3AXKA 3IS4A 2ZADA 4DUXA 4LBRA 4MWAB 2VQUA 3HPFA 3NZ1A 4JIRA 5HAOA 4XQ6A 1XDLA 3T4CA 4FNUA 2PURA 5CJ5A 1BVNP 3G1RA 1M68A 2BY3A 2D1ZA 4AZ7A 2J8GA 2H9AB 4EF8A 5HMEA 4I9TA 3RLVA 1TR9A 4HP5A 3VNYA 1XBXA 1FXQA 3GVWA 1W1B1 3PPGA 3W7HA 4AVFA 1JD9A 2R14A 2DZVA 4S1FA 2CLLA 2WNWA 4X60A 4LQ1A 1EWDA 1JZ6A 3KVLA 1W3NA 1AUSL 2OQHA 3LBOA 3B0YA 4NZ5A 5LNWA 1JDCA 3P61A 4HZ8A 3NO1A 3QV6A 1P0DA 1Q6GA 3UZZA 4UFMA 4V1YA 3WQ8A 3PZIA 3LERA 3RRXA 4ADSA 3IIVA 5BXTA 3NYZA 3ZT7A 1UPMB 3OZYA 1W5QA 1OFAA 4NKCA 2VFDA 3TQ0A 1I60A 1JCYA 1CLKA 2O55A 3GC5A 3QMTA 4ZTXA 1CLVA 2E9MA 1ISXA 2YB1A 5BNKA 3Q4DA 1DTUA 4AU0A 5DN1A 1BRLA 3ISIX 3TTYA 4NZ4A 3ECQA 4LVAA 1TIWA 1GTEA 3KWSA 4M0XA 3TXVA 4ACYA 4IGNA 1IR1A 2VR4A 2DZUA 5CG0A 5F2LA 3QC0A 1R6WA 3BOLA 2PBOA 4S3KA 1HXJA 2NLIA 3KOYA 1FH9A 1QPKA 3GNOA 3AZSA 4K6AA 5CSYA 3WF3A 4GXPA 2WHKA 4ZR8A 3CEPA 1EFZA 1WUFA 4Z17A 5E9AA 4FR1A 3CLWA 4IIGA 5CC3A 2ATMA 3NZPA 1Q13A 3IPWA 2QGYA 3APTA 1DIOA 5HJYA 1PYFA 3GNXA 3W76A 4MJ4A 3QQ0A 3SDOA 5A8GA 3DFSA 4KBXA 1R30A 3T4WA 3TIMA 1BHGA 2F6UA 2BVYA 3H8AA 3ARPA 3IAQA 3UPWA 1PVNA 1NOFA 4QS5A 2WHJA 4UQEA 1EXPA 1E6NA 3XIMA 2NX9A 1JL8A 2Y7EA 2YA2A 2NUYA 3D5HA 4QM1A 1V77A 4ZSTA 1OYAA 1TE6A 3VOCA 1WBHA 1I1XA 3N15A 1TRIA 4NJHA 4LUJA 3TQVA 4LAOA 3OLDA 4ZFMA 5TIMA 1BEUA 2XIIA 3B9EA 3KXQA 4CNPA 1HGWA 3HZ3A 5CC5A 3M0MA 2QLYA 3F03K 5DMYA 2WNZA 4KGLA 1BGGA 1ZP4A 2XGZA 2XM2A 2X1UA 4N9BA 2Q8LA 1XIBA 1UD2A 1UIPA 4CQBA 1DVJA 3ZOAA 4IG2B 3GFZA 2PCEA 4UTWA 5I5RA 2WO5A 7TIMA 1A49A 2E4TA 2XFFA 1R2SA 4M8UA 1GGOA 2IKIA 5JU6A 3OVGA 4BK9A 3RX2A 2EQDA 1XQKA 3DH7A 1QU4A 4DPQA 5CCZA 1RQEA 3QQ1A 4ZXLA 1PSCA 2J24A 4DJED 1JYVA 1GOIA 4H04A 3KTCA 1TJRA 4LAZA 3PZGA 3O9NA 4GYPC 3E0IA 3AXIA 2UWFA 1GONA 2NV9A 5AHMA 5DXXA 3SECA 2V9DA 1VP5A 1QCWA 1OGGA 1OIMA 3KZPA 1TKKA 2XWEA 2ZRUA 3SUWA 1F3XA 4U2YA 4CLMA 8A3HA 2FZMA 4DI9A 5AECA 3BZGA 3L7RA 1R3SA 1AFSA 3ITYA 1DKWA 5EMLA 3BLDA 1KCKA 4MY1A 3TN5A 4FK9A 1P0NA 3MZNA 1OSEA 1XIIA 2WM0A 2AAMA 1LL6A 4F0HA 4WY0B 2V2HA 1EJSC 1QASA 3CHDA 3BE7A 3KP1A 3PZMA 2ZA3A 1MQQA 5F4XA 1KWKA 1A5KC 4ZGYA 4NQ1A 4CD5A 4DF1A 4FNQA 5E0FA 3WLJA 1S2TA 2WWDA 4HHLA 5EY5A 2ZVRA 1ZAHA 2CW6A 3WX7A 4FXJA 2E77A 1Y65A 4XUGA 2QHAA 4EXQA 1PHWA 3HGSA 2UY2A 1F7BA 3T0CA 1LRQA 3N2CA 1WDRA 4DWSC 3VUSA 2DUXA 3WLQA 3M0YA 4HPXA 4KEUA 1GQIA 3SN4A 2YXXA 4XSLA 2ZE0A 3M0ZA 2QV4A 3Q37A 3J7HA 1US2A 2VX7A 3B03A 3B4YA 4H9MA 3FJ4A 1C90A 3UERA 5L6UA 3WLPA 3IJLA 5LIKX 2NWRA 4JKKA 3FNDA 1IXQA 2XVPA 1H7WA 2ZOXA 2Y63A 2OX4A 3NNTA 1WOBA 1TRDA 3UZJA 3OQEA 4NYUA 3RR4A 4FOJA 3WNNA 5HINA 2QIWA 5D8ZA 3RO6A 1BVWA 1JCMP 3AYTA 4A2RA 3BOFA 3CH0A 3NCOA 3VOGA 3QPEA 1E0UA 1GZJA 4CQ8A 5FJTA 5CKSA 3VZYA 1Z7AA 2WC3A 3TEVA 3S1VA 3MP3A 2GL5A 2MUCA 5F2IA 4TTGA 2ZDRA 3BAIA 3NVTA 1IR2A 1U22A 1MDLA 2VT0A 3WQCA 4S2BA 4NAEB 2FB2A 1VRXA 2Q09A 3ITXA 3PB2A 2PLMA 4IXXA 4XAZA 4QJ3B 1IT0A 5AC8A 3NZQA 1ML1A 1FWDC 3BARA 1EIBA 1H1YA 4LS1A 4LC6A 3CUFA 2QCLA 4KF1A 4S3EA 3WBYA 4NF7A 3ZM8A 2G3JA 3VIHA 3W82A 4MMWA 1EP1A 5IHSA 1RBOB 2RDWA 3IIZA 4H8HA 3SJNA 3W07A 5HR7A 2WVUA 2A2IA 4A3QA 2I17A 1E6XM 1W9PA 4LW7A 1QO5A 1TVLA 1K9DA 3GK0A 4NVTA 2WC4A 2PA6A 4GXMA 1CXHA 1H63A 4CEUC 1E55A 2OYMA 4ZB0A 1N82A 4WSKA 4DRSA 2AQOA 3WDIA 1QAPA 3WEMA 4XO7A 3WENA 1P0EA 3GVGA 3L0KA 3LENA 2WZTA 4PODA 5D37A 4HNTA 2F2KA 2HE8A 3W74A 1F3TA 2GJPA 1QOQA 1V0LA 1DJIA 3UCCA 1W9UA 2XFWA 1JQVA 4EK7A 5CC7A 1WZMA 1S3HA 2WJFA 4Z2GA 3STGA 3AHZA 2B7QA 3CMGA 1ZBWA 4HSOA 4S2CA 7TAAA 3G22A 3T2QA 4JX4A 3MMDA 4IPLA 1DJYA 3R13A 1WBJA 3M64A 1C91A 3TYZA 2ZZ3A 1R47A 1PWLA 2YPIA 1X7IA 3W1QA 3NDZA 4JTDA 1GQJA 2QMKA 3BUVA 4HSNA 1XLMA 3S0CA 1I6NA 1P6WA 3F4DA 1REQA 4AXNA 2OTDA 5D4YA 5C71A 1MNZA 2NXHA 1WXJA 3T07A 3VXGA 4FOUA 1TV5A 1HO1A 1YBQB 1LORA 3MS8A 4TTUA 4DJFD 3U6WA 4ZQOA 1EP3A 1MW1A 1JZ2A 1V3MA 5AN7A 2B7NA 3I10A 4IUGA 3KP0A 1ZJBA 4N42A 3S6OA 1XBVA 3UWEA 3A4AA 1MVYA 4HBKA 4F0SA 4ZE4A 2EPKX 2J79A 3TP4A 1GK8A 3HF3A 4TIMA 3L4YA 4C6EA 1KM1A 4KERA 2XZ9A 1LWHA 3MCMA 1Q45A 2DUAA 1L6GA 5F7UA 5GJMA 1BG9A 5HNTA 2VFHA 1K02A 1TUXA 5EBAA 2OGJA 1R3YA 4A22A 3K5XA 3PJUA 3T8LA 1FWGC 3N9KA 3ITGA 1OJXA 4PYSA 3W4RA 1QATA 1U33A 4HPNA 2PZNA 4EIVA 4AX7A 3T2PA 4BWLC 2YKKA 3WMLA 3AXMA 3LSCA 1HZYA 4MYAA 5IDIA 4MDOA 2ZX6A 1Y5WA 2P8CA 1NFPA 1OGBA 4ZO7A 4S3CA 4CNSA 3R0UA 4DY1A 4EF9A 1XYLA 4MWAA 4E2BA 3ZR4A 4K36A 4NJKA 3A9BA 2PDIA 2XN1A 4UTUA 4QAIA 3SUTA 4WKFA 1SSGA 1LG2A 2H9AA 3SAZA 4W8AA 2R1KA 3QN3A 4Z2LA 1XIDA 4UQCA 3UY8A 1B4EA 1QJWA 5AKQA 5DO8A 3WNLA 2GUUA 4HU4A 4EKJA 3E2SA 4J3XA 2WCAA 3S83A 5AHLA 2YXGA 4S3GA 6ENLA 3NO3A 3NZRA 1JDAA 4LB3A 1XIGA 3PP7A 1JZ8A 3AZTA 4Q8UA 1XLCA 2Y0FA 1OIFA 3BLFA 3QVQA 1XV8A 2OWXA 4UMCA 1TELA 1U5HA 2X41A 4A8RA 2YCEA 2WJEA 1RQBA 2HROA 2QZRA 1D3CA 1XS2A 1K7EA 4GH1A 1WP6A 2JK2A 4AIOA 4KGJA 2VGBA 1RBAA 3PNUA 1VIZA 3WNOA 3M9YA 1FWBC 4G7FA 4O4WA 3NQEA 5FEPA 4BHYA 3ONBA 3B8UA 2GQAA 4LJ3A 4LV9A 4FZIA 5C0QA 3EZ4A 3LQLA 2QUNA 3BSHA 1WOAA 4P8UA 4MWAE 1JGMA 5AY7A 1UWSA 1ENUA 3K30A 3CQIA 3W1PA 2DT2A 2WMHA 1A80A 2WKGA 4EAYA 5HQLA 1EJVC 3HFYA 4FLOA 3N04A 3CAVA 4RUBA 2ANUA 3CWNA 2OT0A 3TR9A 3NQ8A 1O6IA 4HKPA 1EJTC 1OGSA 2XFRA 3NUKA 1CENA 5DX7A 6PTDA 4DO5A 3F5KA 3KBSA 4UIOA 4X63A 3MO4A 2DVXA 3ZJKA 2VEIA 2GWNA 4J35A 1OX5A 4WR3A 1CIUA 4OTKA 3A24A 5I06A 3W75A 4PN2A 4XKYB 4IMFA 3CO4A 2OEKA 1EYWA 2I5GA 4JYFA 4QCFA 4ZZ9A 4H7CA 1ITCA 3UWYA 1RCQA 3H2EA 4G1NA 3FDGA 3TSMA 1TFVA 4KT2A 4OECA 1CLXA 4X9YA 1X1OA 1JYWA 3GWQA 3VGGA 4AIUA 3LN3A 3NEHA 4Q6JA 3KOXA 4XUYA 1XG4A 1RHCA 2VZOA 5DMMA 1X1NA 1DQXA 2INFA 1E9ZB 3UY7A 4N2YA 3VINA 1IEIA 3VX0A 3M0HA 3ZVHB 1UD3A 1UH4A 2P3ZA 4DM2A 5CLWA 3EWDA 3EWYA 1GJUA 3N34A 3TLLA 4HPJA 1BYBA 3DFHA 4H01A 3VIIA 1VKFA 4IG2A 4MZYA 1J79A 1LQ2A 4YHEA 1OM0A