1ICSA

Crystal structure of 12-oxophytodienoate reductase 1 from tomato
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
363
structure length
353
Chain Sequence
QVDKIPLMSPCKMGKFELCHRVVLAPLTRQRSYGYIPQPHAILHYSQRSTNGGLLIGEATVISETGIGYKDVPGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNKDFQPNGEDPISCTDRGLTPQIMSNGIDIAHFTRPRRLTTDEIPQIVNEFRVAARNAIEAGFDGVEIHGAHGYLIDQFMKDQVNDRSDKYGGSLENRCRFALEIVEAVANEIGSDRVGIRISPFAHYNEAGDTNPTALGLYMVESLNKYDLAYCHVVEPRTESLVPMRKAYKGTFIVAGGYDREDGNRALIEDRADLVAYGRLFISNPDLPKRFELNAPLNKYNRDTFYTSDPIVGYTDYPFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 12-OXOPHYTODIENOATE REDUCTASE 1
publication title X-ray structure of 12-oxophytodienoate reductase 1 provides structural insight into substrate binding and specificity within the family of OYE.
pubmed doi rcsb
source organism Solanum lycopersicum
molecule tags Oxidoreductase
total genus 126
structure length 353
sequence length 363
chains with identical sequence B
ec nomenclature ec 1.3.1.42: 12-oxophytodienoate reductase.
pdb deposition date 2001-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1icsA00
1DQWA 4XWUA 2YX0A 3M5ZA 4W9TA 3L5AA 3IVSA 3UY7A 1OYBA 4JTEA 4NJIA 5K9DA 4Y8FA 1QPRA 3LLDA 3C2OA 3W7MA 2WNQA 1NF0A 3W75A 4UR7A 1EWEA 3NPUA 1W5QA 4NUWA 3E96A 1UBSA 2W0UA 1OX4B 1ICSA 2HMCA 5AFDA 4NJJA 4WXYA 3HG5A 3TJXA 1RV8A 3MP5A 4IMDA 3W9ZA 3G1VA 1FX6A 3GX9A 3TA6A 2V82A 3WFAA 2LLEA 3NQEA 1EWDA 1OFQA 1OABA 2J24A 4YMZA 4N9BA 1K8YA 5EMUA 1M7PA 2ZZ5A 3NXFA 2Y88A 3YPIA 5D38A 3EXRA 1P0NA 1A50A 2ZRZA 3LBCA 2ZFAA 1VGAA 4DELA 3C4UA 5BRBA 2GVJA 5CZJA 5AB3A 4O1DA 4U28A 5J5RA 2CZ5A 2E6YA 4QSHA 4HSOA 1FXPA 3I7SA 4MOZA 5K2ZA 1I45A 3RK8A 4MZ1A 3TSDA 2ZTJA 4WJEA 1H50A 3RMJA 3QW4B 4RZ4A 3EXTA 3W74A 1U83A 3B4UA 2J6XA 3L5MA 4K39A 5F1UA 1GEQA 3M41A 3ANYA 4IWWA 4MUZA 3RF9A 3EXSA 3P82A 1TPH1 1PE1A 5CZ0A 1TTJA 5LHEA 5KMYA 1VCGA 1XDLA 3M47A 4FNUA 1OFDA 1W5NA 4QM1A 2BX7A 3HOJA 3BGJA 2VXNA 1KFJA 2Y85A 1EA0A 1XL9A 1F73A 1TSIA 2QAPA 4DF2A 5G2HA 4NU7A 3EX2A 1JQVA 2PC4A 1PHQA 2ZCGA 3BO9A 1DJQA 2NWRA 3M5VA 2CLEA 3VE7A 3W85A 4M6QA 3U6WA 4CCEA 4K37A 3TIMA 3H53A 5K9XA 5LNUA 3Q37A 3TXVA 3ZWSA 4YCPA 1OG0A 3QRHA 1JJKA 3KXQA 1N55A 1X8FA 3NL3A 4CNPA 1DKWA 4JYEA 3NEVA 2ZZ6A 5EL1A 1Y0EA 3PG8A 1XBZA 4DEFA 5FF7A 1TPUA 3S5ZA 2CLMA 2VENA 3CIWA 3PBVA 1FCUA 1GYNA 2RDUA 4O0KA 3LHWA 4IMEA 1DORA 1VS1A 2YFNA 3M5YA 4WOQA 3M9YA 2C0AA 2A6NA 4QNWA 1W5OA 2V2CA 2NZLA 2PRLA 5CZSA 1YDOA 1W1ZA 3IEBA 5F2GA 4ZL1A 1K7FA 1NVMA 1T96A 2Y6ZA 4LRTA 1YPIA 1HUVA 2XN0A 3EWXA 4BI6A 5HUOA 2WSRA 4O53A 3W7LA 4IXXA 1YXCA 5H2ZA 4OE7A 5TQLA 1JRCA 1UJPA 1L6YA 2ZQ0A 4CNOA 1GZGA 3U8GA 1KFCA 1VHCA 1UASA 2A7NA 4FO4A 3L0KA 1FDYA 1ZHAA 5TIMA 4ADUA 1W3IA 3T78A 8TIMA 1LCOA 4L4LA 3VFLA 1JULA 3HB9A 4JD4A 1H7RA 2X2GA 4AAJA 3CM4A 4R53A 2ABBA 3EX4A 1GQNA 1WDWA 2ZZ2A 3LCXA 2YZRA 4IQLA 1I4NA 4AXKA 1IF2A 4UFMA 3UZ5A 2ALDA 2FPVA 4IPIA 3C2RA 4UFLA 1RR2A 2QDHA 1GPWA 2X1TA 3N9RA 1CI1A 4UTKA 1U5JA 1YLVA 1TV7A 1GYLA 4AEOA 1FCQA 1FBAA 1H1YA 4MFDA 4BWLA 4LVBA 4LS1A 1W54A 3IGUA 5FEPA 2QR6A 1PCWA 1XUZA 2QJHA 4AMAA 3MJYA 3BG5A 2FLIA 2DZSA 2AAMA 3BLEA 2BSLA 3TQ0A 3G1SA 2YYUA 2C18A 4EF8A 2OX1A 3B05A 3I65A 4LU0A 5E0KA 4MPQA 3UQNA 5K3VA 3GNNA 4OWGA 4ZVJA 3VNDA 3JRKA 3N73A 2VFFA 4HNUA 2FB2A 1SZEA 1A5AA 3DZ1A 3CT7A 1KLZA 3TFCA 2Q8ZA 4X22A 3ATYA 4PA8A 5DLCA 1KM6A 2JBMA 3GDKA 1OFBA 3QEZA 2RDTA 4UTTC 1F74A 3EKZA 4ZMGA 3ZFHA 4FXSA 5D02A 2VELA 3RFAA 3BVJA 1RQHA 1JUEA 3W07A 3W6YA 1OFPA 3WK1A 1EUAA 4IMCA 4XTDA 1IXQA 4DQWA 3E0IA 1TQXA 4GFSA 4RR4A 1YTDA 2HS8A 3V1PA 2V2DA 3TMQA 5EKYA 1ZJIA 2RFGA 5HR7A 2TMDA 3TFXA 3BLIA 4IX0A 2QCHA 4GXMA 4FNPA 3L68A 1OF6A 2NUWA 3T7VA 1D9EA 2D73A 1OX4A 3S1UA 3LHVA 3DENA 3W1QA 3NPVA 3W72A 2V9DA 3UZJA 4RLIA 1L9WA 4PTNA 2A1YA 1GT8A 1Q6RA 2Q8LA 4Q4KA 5SWUA 5DCDA 4X2RA 3O8AA 4O16A 4ZQMA 3CPRA 4JY9A 3LERA 5D2YA 2CU0A 4M5PA 3RLVA 3W1AA 2GUUA 5C2XA 1RZMA 4LV4A 1AG1O 4MY8A 1VHNA 1VYPX 4K6AA 2B4GA 3THQA 5ABTA 5HNRA 1O4UA 4N6EA 1SW7A 3QH2A 5AC7A 1WBJA 3W7IA 4O28A 3PG9A 3TW7A 1SSGA 1GVQA 3KOFA 3N14A 1JCYA 3W86A 1R2SA 2QF7A 3PUOA 4MYXA 3CB8A 5AN7A 3M16A 1ZFJA 4S1FA 1IIHA 4YL2A 5FF0A 4UTUA 1WBHA 4LOCA 1O5KA 1WOAA 1NEYA 1ZAIA 4FX6M 4ADTA 1KV5A 4LVGA 1QPQA 3FFSA 4UTIA 3G8EA 2C15A 4QJ1A 3QFEA 3E02A 1XM3A 3S9YA 4O19A 4U4MA 1FUYA 4P2VA 3QMRA 3QZEA 4Y9AA 3P5ZA 4JDYA 2UV8G 3MYOA 1VLIA 3GVGA 3H55A 3DGRA 1TMHA 1DL3A 3S5YA 4QQ3A 2CLFA 1SW3A 1YPFA 3TUUA 4FIQA 2A5HA 2QCDB 4CNNA 3TSMA 3EEGA 3PBYA 5HR6A 3G18A 4BR1A 1EP2A 4YCOA 4WOZA 4AHPA 1F6PA 2WPBA 3R12A 1JCMP 3EKLA 3LOTA 3WJSA 3CEUA 3TK7A 1MEHA 3CTLA 4O11A 4OBTA 4WY0F 4RJEA 2GOUA 2CWNA 3PR2A 2I1OA 1VQTA 4FF7A 3LRMA 2ZA1A 1BWKA 2OCZA 1KTCA 4UMCA 5D05A 4JTSA 3SJ3A 1R47A 5KTLA 4FNQA 3MO7A 1OX5A 1TJPA 1GOXA 5AC8A 4I7WA 4XQ6A 4XTIA 4BI5A 1WV2A 1LDCA 4E2BA 1EPXA 3UXDA 4AHOA 3IGSA 2GJLA 3LB0A 3F4WA 4R33A 4E38A 1PHWA 2NV2A 2YPIA 1OX6A 5CPMA 1THFD 4AWSA 3UYCA 3S8HA 1OVDA 4UTWC 3NM1A 4IMFA 5HULA 3OA3A 4O1BA 3W76A 5CSSA 4AVFA 5A8GA 3LCFA 2NUXA 3PC0A 1BEUA 1KM4A 3A5FA 1H7PA 3DHDA 4AB4A 2A6LA 3W7QA 2A2IA 3ABOA 4J9JA 4IXHA 4LUJA 4O14A 4LWWA 1S5VA 4TU1A 2WSYA 2KZHA 2ZZ7A 3OVPA 3FJLA 1PIIA 1K3UA 4MY9A 1TPDA 3DKLA 4N4QA 1TTIA 2XN1A 2FB3A 1SO3A 4GUFA 1LTDA 1GG0A 1GVSA 3TC7A 5AYZA 3UD6A 2B7QA 4GUJA 3GXNA 2QAFA 2X30A 3R13A 1GVFA 3HPXA 3W73A 1JVNA 3I6RA 3HJZA 3G22A 3NL2A 1B3OA 3UWWA 3WK2A 4HN4A 2C1HA 3WJXA 2DZTA 3TE9A 2CW6A 2H3DA 1KFKA 3DHFA 3QJAA 4JTFA 1VLWA 3Q58A 3W1RA 2QCFA 3GDLA 3LHUA 4LC6A 4OU1A 4AH7A 3U2OA 3A9IA 1DOSA 2QCGA 3R5EA 4CLMA 2HSAA 5EYWA 7TIMA 1VC4A 3W70A 1JUBA 1LYXA 5EBUA 3Q2DA 4L4MA 2Y7EA 1BWLA 1RQBA 2NV1A 3QSTA 1OFOA 1AL8A 4NJHA 2ZA3A 1GTHA 5F4XA 2YGYA 2J27A 3BK0A 1XFBA 4LNYA 1H1ZA 2NX9A 1TPWA 3PB0A 1G6CA 2Y70A 2VFEA 3DFQA 4PH6A 3V75A 4LC8A 2WKJA 1I2OA 1KW1A 1UB3A 4AHQA 2CZDA 4D2JA 1BTMA 2OT1A 4CQAA 1W5PA 2FQIA 1V5XA 1YDVA 2W6RA 3ABSA 3CEPA 4P61A 4MZ8A 1LP6A 1LROA 3A21A 3HGJA 4JEQA 1T0OA 5DBUA 2J9YA 1EIXA 1SO5A 3S1WA 2OT0A 1SR9A 1TPEA 2R8WA 3R8RA 1HO4A 2A7RA 2VFHA 4S2BA 2V5BA 4JIQA 2DZXA 4UXDA 3HGRA 1X1OA 3LRLA 1K02A 1YTKA 1RVGA 2V2HA 5I3KA 3MI6A 4RCXA 3BW4A 3BLFA 3UWZA 3C8FA 2ATSA 5K7JA 3L2IA 1IIGA 4FNRA 2TSYA 3USBA 4NT0A 4ORMA 3PVFA 4ADSA 1TCDA 3KRSA 5MHBA 1NAL1 3LHZA 1O5XA 2O7QA 4UR8A 1TO3A 1JCNA 1YXYA 5F1VA 4NJKA 5EY5A 3FS2A 2GJNA 2Z6JA 3FOKA 3TV8A 3W7JA 3GAYA 2H8ZA 2WO5A 3BG3A 2E68A 3W71A 1SFLA 1Z41A 3T4CA 1NF7A 1D3GA 4CQ9A 3HQ1A 3NG3A 1KV8A 2H90A 2J88A 1LLZA 2ZZ1A 2VFIA 4NX0A 3LTYA 1H61A 1B57A 4O0ZA 2G95A 3KRZA 3W2JA 4O54A 4AWTA 5D32A 1TV5A 1HFBA 4BI7A 2QUTA 3W87A 1LRNA 3QM3A 1IXNA 2EKCA 4UC5A 5A5WA 1SUXA 2C16A 1B4EA 1XBYA 4ICNA 3LM7A 1M7OA 5D30A 3IIVA 4JNMA 3KVLA 1J2WA 3C6CA 4MFEA 4O10A 3DBPA 1ONRA 2ZRYA 4LVAA 3S6DA 3DFPA 1H63A 4GC4A 4HNVA 5AHIA 1E51A 1KM2A 3VE9A 4DPQA 2QCDA 4E0CA 1C9DA 1AW1A 4Z1DA 2OMAA 3W7KA 4DPPA 3GAKA 1EUNA 1QPOA 2ABAA 3TXZA 3DI1A 5LGXA 4JTGA 3Q94A 3SSJA 1X6UA 5F4WA 5HQEA 1D3HA 5D09A 5DBTA 3NOEA 2B7NA 1GG1A 1Z42A 2WSQA 4EIVA 4M6PA 4WUIA 3HF3A 3BARA 3G8RA 2YSWA 3R2GA 3W7PA 1L2UA 3TAKA 4UUIA 1OFAA 1H60A 4LVFA 1OYCA 1JCJA 3TQKA 3MUXA 1XC4A 3SI9A 2NX3A 4TX9A 2FTPA 1OK6A 3O6CA 1SZFA 3NQMA 2CZFA 4R7JA 1LLWA 2FPYA 5LNWA 4ORIA 3QW3A 1OHLA 1FY6A 2Y89A 4ZZ9A 5AOUA 4O4VA 2W79A 1WXJA 4GUIA 4B5NA 1VPXA 3UWUA 1SO4A 1FDJA 2Z2UA 3NQ2A 3G1HA 2BZNA 4LT9A 3GDRA 1LOQA 3BV4A 2NXHA 3P84A 5HWMA 3AJXA 3OG3A 5LNRA 1V7YA 3PSWA 5I3GA 4N9DA 2E5DA 3W1NA 1QR7A 2Z0IA 3NR0A 2DJLA 2R91A 3KAOA 3EWUA 2B7OA 3GDTA 3N19B 3TH6A 1ICPA 1VRDA 4JX5A 4PL1A 3CQ0A 3HBLA 2J9ZA 1DQXA 1RPXA 1Q3NA 1DBTA 1SZNA 1F5ZA 2ZYFA 5AHLA 1LOSA 3CC1A 3SGZA 4GUHA 4I9AA 1PVNA 3LCHA 5GVJA 1H7NA 1VH7A 1VR6A 3W22A 1LBMA 1T8XA 4FHAA 3G3MA 1W5MA 4LW7A 2ZZ4A 3W7CA 1FWTA 2Q3OA 3FKRA 5G5IA 1PS9A 3QQ0A 1QOQA 1KBJA 3T40A 1KM5A 4O1CA 4HSNA 5BMXA 2PRMA 4AF0B 1J5TA 3G0XA 1SQ7A 3M43A 1K8ZA 5CPNA 3LCIA 4O57A 3LHTA 3PBUA 2WOQA 1P5BA 5EPDA 2X1SA 3GXTA 1VJIA 1ZAHA 1ICQA 2FDSA 3KHJA 2PE4A 5FEZA 1MXSA 1W3NA 1EEPA 5G1YA 1SPQA 3LTPA 5LKYA 2CLHA 3ZR4A 3P81A 5I3JA 2ZRWA 3RNDA 1EP3A 4C1KA 5K9CA 4JTHA 1S3HA 3GB6A 3MWAA 4O8RA 4OV9A 4NX5A 3MI3A 4I7UA 1ME7A 5D2TA 2ISSA 3VKJA 5IBXC 1OYAA 2QJGA 3M1ZA 3NQFA 2O7SA 3P74A 5F2MA 2H6RA 2JGYA 4IX2A 4YWIA 4JTUA 2GQ8A 5U7SA 3EX1A 3PBWA 2VEKA 1FWSA 3W23A 3B0VC 3LBMA 4TIMA 3P60A 4O12A 3IV3A 1C29A 3W1LA 1OK4A 3MBDA 4TO8A 3O63A 3FA5A 4KFNA 3GDMA 4HT3A 3BW2A 3N3MA 3F4NA 3QQ1A 5D2VA 5FEWA 4RZ5A 3HMJG 5U4NA 2VKZG 1CW2A 3TJLA 1ZNNA 1KM3A 1R2TA 4Q33A 3CWOX 3AO0A 4A3UA 3STFA 3B03A 3KRUA 3L5LA 3HGOA 3MYPA 3LXAA 4ZQCA 5D2XA 4HPJA 3S5NA 3PSVA 5G4EA 3BW3A 4HKPA 2ZBTA 1XDMA 2NLIA 4NZJA 4RZ6A 2ZRVA 3ZS4A 3CWNA 3HGSA 3M0ZA 4MZYA 1TYGA 3EWZA 2CLKA 3UWYA 3QMTA 4C1LA 3E9AA 1WOBA 2FPTA 4LS0A 1JRBA 4UFHA 2G5WA 4OV4A 3CLMA 3DXIA 1SZGA 4HNNA 3STCA 3FYPA 2C14A 3O1NA 1TTQA 3IGXA 4LV9A 4RXGA 5LNVA 2X1RA 1G4SA 2IQTA 3NGJA 4RKAA 4QITA 3W84A 3HPZA 4O15A 4EOUA 1HO1A 2ZTKA 4X3ZA 5KITA 4UNKA 1HL2A 1UUMA 2HS6A 2JK2A 5HJLA 1VYSX 3TAOA 3NAVA 2QEZA 4A21A 4IMGA 2P10A 1QO5A 1TPB1 1RQEA 5I3IA 3QPYA 5G1TA 2WNZA 1F76A 4QIUA 4MJMA 3RU6A 4M19A 3SGUA 1W37A 4JGDA 1DVJA 3BGGA 4S2CA 1ZAJA 5CGQA 2VC6A 1KM0A 1QAPA 3KVJA 3L0NA 5BW6A 1S5TA 1OF8A 4UFJA 4DBDA 2B0MA 2R94A 1F05A 3DFTA 1T99A 1L6WA 3MW7A 1AW5A 3VI2A 4UTLA 2E6AA 5DCEA 1KTBA 2A7PA 3THAA 4WX2A 1QPNA 3QSRA 2A4AA 5FF3A 4PCFA 4LTSA 1QCWA 3L21A 1P0KA 5DXXA 3GKFA 3C0JA 2B7PA 3HO8A 3PY2A 5DN1A 4O4WA 4DF1A 4MVAA 2EF9A 4UFIA 1PL9A 1TB3A 1TPFA 1KFLA 2RKXA 1QO2A 4NQ1A 3SW6A 4Z0SA 3O6DA 4NZFA 4WD0A 3O07A 2GVGA 1TJRA 5LHFA 3S1VA 1BKSA 3W1PA 2YXGA 4JIPA 2Y7FA 2YW3A 3W2UA 4XKYB 5DY2A 2V81A 5C54A 4OGZA 1LORA 4FIRA 2XN2A 4O1AA 3INPA 1CX9A 4CQ8A 5HWNA 3N2XA 5FI8A 1G4EA 1K7XA 3EX6A 3ELFA 4NNAA 4PEKA 4BF9A 2NXIA 3H54A 4O52A 1M6JA 3FJ6A 3STEA 1HTIA 3W7GA 5CPOA 2TYSA 4QNEA 4KKXA 2ZDRA 3CU2A 3KFTA 1MEIA 5CPLA 4KFOA 4A29A 3W7EA 5J5DA 3DH7A 1B4KA 3W7DA 2Y61A 1JR1A 3NL6A 3W1MA 1GTEA 3NVTA 3WK3A 1QWGA 2P1FA 3NQ6A 4H4IA 2Z1BA 3N2MA 4JS3A 4POCA 4CCDA 3A22A 1WX0A 3NZRA 4YLWA 3GR8A 4KFPA 2J9XA 3ABRA 3L0GA 3O6YX 4XBSA 1QDSA 3WJWA 1RD5A 1H5YA 4CCCA 4XZ9A 3G0SA 3PAJA 4WXZA 5KINA 2CLIA 3PUDA 4JY8A 4GRSA 4JTLA 3TCEA 4K36A 2E77A 1AK5A 1FCVA 2DZPA 3T55A 3MBFA 3EWWA 4MLRA 6TIMA 2EHHA 2C19A 3W2KA 4PC8A 3M7WA 3LXBA 3NPXA 4KWVA 3DKJA 5F2LA 5F4SA 2V5LA 3MHUA 2ZRUA 2Z6IA 1LBFA 3E49A 4Z1CA 3MP3A 3NA8A 3UNDA 3GNDA 3LX9A 1ME8A 3W2NA 4MIMA 3TX9A 4HNTA 3FEMA 3KVKA 2WQPA 1AL7A 3ATZA 4UMAA 2AQWA 4MKNA 3MMTA 3GIYA 5EA9A 1XI3A 1R2RA 1KLYA 3SY5A 3GLCA 4FXRA 3P62A 3W83A 4RX0A 4MLJA 4EWND 4UTTA 3TKFA 5AHNA 4JYDA 4Z08A 1LM1A 3P8JA 1VCFA 2Y62A 3W7OA 3SFKA 2TPSA 1MO0A 3LLFA 4WY0B 5FF2A 3MP4A 3LI0A 3OHIA 4UNLA 2A85A 4JXCA 4DF0A 2DP3A 1H62A 2DZVA 1I2NA 3I68A 2NWSA 3A24A 3NQ7A 5DXYA 5KZDA 3IIZA 1TIMA 4JTIA 3C2FA 4UTHA 3TSBA 1R30A 1Q6OA 4Y6GA 3KVMA 3W7HA 5HINA 1XUUA 4PL2A 4TMCA 5LGZA 2DZUA 2VOMA 4LUIA 1N8FA 2NXGA 3C61A 2YDAA 4ZQOA 1VZWA 4N9EA 1I2QA 3GYEA 4NJGA 1TPVA 2EPHA 5IBXA 2QKFA 3CHVA 3NO5A 2V0TA 2RH9A 3FKKA 3L9CA 1F7BA 3NYZA 1FDZA 4N02A 2F84A 6ALDA 3N9SA 4KWWA 4A22A 3IVTA 4OHQA 1IXOA 1AW2A 1JCLA 2QJIA 2C6QA 1G4TA 1SFJA 2GQAA 1UCWA 2G97A 3DAQA 2BLEA 5CSRA 3TC6A 1WYIA 2JGQA 3T44A 5L6UA 2ISWA 1G69A 3QMSA 1GVRA 4DO5A 4YXGA 2A21A 3I7QA 3JS3A 1G7UA 1A5BA 4BK9A 4G1KA 1H51A 2CLLA 1H7OA 3A23A 4AWUA 3SECA 3G3DA 4O13A 1G7VA 1TREA 3PB2A 2QCCA 3HIJA 1KFEA 3QPZA 3G1YA 2V30A 1J4EA 5D04C 3GK0A 3TMLA 3C52A 3W2LA 1LRTA 1HG3A 1KFBA 5BMWA 4UTJA 3OEXA 2CFFA 3HG2A 4Y96A 4E2DA 4LY8A 3EB2A 3G24A 1YTEA 4UIOA 1W3TA 5E1QA 1O60A 4DBEA 3G0UA 3NL5A 2VFGA 3QF0A 4Z1BA 3P61A 2PURA 1KA9F 1TPC1 2QUVA 5I3FA 2VFDA 1H7WA 2QCMA 3FIGA 3QYQA 1KM1A 1FCBA 4GBUA 3DI0A 3O06A 4LVDA 3O05A 2PCQA 3PWAA 1FWNA 1FWWA 4O50A 2GQ9A 4FNSA 1F2JA 3LTSA 3C2EA 3LDVA 3LRKA 3LV5A 3TU9A 3OVRA 4XKYA 1P4CA 5HUPA 1S5WA 1IXPA 5E93A 3W1TA 3P8IA 4RXFA 4K8EA 1W56A 3R89A 2RDWA 5L9FA 3PS7A 3DFSA 1QOPA 1LOLA 1YDNA 3TDFA 3DFNA 4JX6A 5D33A 5C55A 3GR7A 2GVLA 4LRSA 5KSWA 4XBKA 5D2WA 1TRIA 4MJZA 1ALDA 2EAWA 1XKYA 2BTMA 1NSJA 5TBOA 1YADA 5H91A 2Y63A 1ZCOA 3LCWA 4NNBA 5D37A 4NXSA 3IIXA 4H3DA 1Z44A 1W0MA 5FEXA 1VCVA 4BFAA 2JKPA 3L66A 1R46A 4JTKA 3W1UA 3UWQA 5CG7A 3EWBX 4X9SA 2ISVA 1I2PA 2FJKA 3DFOA 4JTJA 4UTWA 5DELA 4GJ1A 1EB3A 3SR7A 4FX7A 5HWJA 3B0UX 4NNCA 3STGA 3MHFA 2DORA 2DJXA 4ZQPA 3EX3A 3LCLA 3FYOA 2JKAA 3C3NA 3TW6A 3CIXA 2F7FA 5FESA 3LCGA 1WQ5A 3LGEA 3GXPA 2E1DA 1GWJA 2C3ZA 4N6FA 5IM51 1SO6A 3F03K 3K30A 1JCXA 2Y7DA 1GJPA 1ZY9A 5AYYA 3VCRA 4QISA 2YR1A 2YYTA 3SZ8A 4IPJA 1QMLA 4M6VA 5C5YA 5C6MA 5D03A 5DCBA 2QCLA 1L6SA 5LNSA 3W3OA 3PM6A 4GE8A 2DZWA 3QC3A 3DU0A 3OIXA 3NQDA 4IJBA 1XCFA 3E12A 3ABQA 2YCEA 1M5WA 3A5VA 3NNTA 1JQXA 3HG4A 2ZZ3A 3UPBA 3C2VA 1DHPA 4IUOA 4M7TA 3P7YA 1ME9A 4JDBA 1YXDA 3IVUA 4JX4A 1YYAA 1TRDA 1UUOA 2YFOA 3JR2A 3B04A 4NVTA 2TRSA 4DO4A 4TMBA 3LHYA 2VEIA 4FB7A 4FNTA 2G96A 4WY0A 4N4PA 3NQVA 1MSSA 2A0NA 1K7EA 3OVQA 2Y7GA 4JTTA 3S1XA 4UTMA 3O15A 4EVZA 2QDGA 3G1XA 3W7NA 4XUGA 1NFBA 3UWVA 4IGHA 4N9CA 3B06A 1OJXA 1ADOA 4FEZA 4I7VA 4GNJA 5AHFA 1VYRA 2E6FA 5AC6A 1EX5A 3O16A 3ZWTA 1OFEA 3HPSA 4OT7A 4JICA 5T26A 5LSMA 4O18A 3TQVA 1A53A 3NM3A 1N7KA 5I3HA 3HG3A 3S0CA 4NXKA 4TR9A 5K4XA 1PV8A 3NPWA 1B9BA 1Q6LA 3W2MA 4H6KA 3GKAA 2H3BA 3C56A 5KZEA 3FLUA 4Y90A 1WAUA 4ML9A 1LBLA 5CKSA 2NUYA 2FIQA 4N2YA 4JN6A 1P1XA 3P5YA 3PULA 2I14A 2FFCA 1PCKA 2P0OA 2E09A 3G1AA 2CZEA 3UXAA 4GWEA 5AHMA 5BOOA 3OBKA 3MI2A 1W8SA 2WV8A 2WNNA 3EWYA 3TNOA 2QCEA 4ALDA 2ATMA 1O95A 1I8JA 3UPWA 4UFKA 3KX6A 4ONVA 2H8XA 1SU5A 4Q32A 3G1FA 4A2SA 2JKEA 1O94A 2QCNA 1IGSA 4OQVA 1FWRA 3IIOA 3G1DA 4K7VA 1ML1A 4MYAA 3S5OA 3RLUA 1WA3A 1GVOA 2BWGA 2BXVA 1TQJA 4BWLC 5DY3A 5KZMA 4WQ6A 4HHPA 4DO6A 4R34A 1DV7A 2DU2A 3WJZA 3W7RA 4QAIA 4RK8A 1K8XA 5K4ZA 5G2IA 1K03A 1JUKA 3W1XA 4DXVA 5F2IA 1SW0A 3MHGA 3M5XA 3IRDA 3NQAA 1TV8A 2CLOA 1H7XA 1ZENA 2I9EA 1EP1A 5G4WA 3WK0A 4A2RA 2V8ZA 3B0PA 5G2WA 1FQ0A 3BPWA 4JR5A 4RV8A 2XFWA 4UMBA 2C13A 3P80A 2EGZA 1LRQA 1LZOA 2VEMA 2R14A 5LZLA 1Q6QA 4PFMA 4WZHA 4JYFA 4PODA 2AGKA 5HMSA 1XBVA 4K7YA 1A5CA 3NQGA 2Q3RA 3LI1A 2YW4A 1QNVA 2X16A 1A5SA 1OFRA 1XBXA 1C8VA 2QUUA 3SIZA 3M6YA 2E5BA 2WJZA 1Q45A 3P67A 3I7RA 3N34A 3D0CA 3NQCA 2OJPA 2HTMA 1W31A 1XXXA 1FXQA 3L65A 1QFEA 3GZ3A 1KBIA 1Z48A 1KTNA 4ZQRA 1X7FA 2E5CA 3L67A 4K8HA 3TR2A 5AHEA 3UY8A 3F1QA 1MEWA 3M44A 4HIBA 3PF3A 4FX8A 1G4PA 2ZA2A 4LS2A 4ZQNA 4EF9A 1G67A 2GPTA 3NZ1A 4Z1AA 1X1ZA 2NX1A 3WJYA 5CZTA 2X1UA 1TTPA 5BNKA 4M7SA 4O17A 3LV6A 1SSDA 1AMKA 4AF0A 1DJNA 1I2RA 3LXCA 4HPXA 3TROA 4GUGA 5AYXA 4UCGA 4IOTA 5FF4A 2OZ0A 2E6DA 4Z0JA 4MY1A 2ZRXA 3NDOA 3PUEA 1F6KA 3S42A 2PRHA 2VEPA 3IIPA 3BG9A 1ZALA 2RHGA 3NQ8A 4K38A 3W88A 3B8DA 1MZHA
chains in the Genus database with same CATH superfamily
1DE5A 3TP4A 4XWUA 3WF1A 4W9TA 3ZT6A 1OYBA 3K4AA 4JTEA 4NJIA 5K9DA 1QPRA 2P8BA 3LLDA 4FOUA 3C2OA 3M4HA 3QPEA 4UR7A 1EWEA 1TWDA 3NPUA 1W5QA 1WZMA 3SCUA 2HMCA 4GGHA 1EKOA 3F5KA 4WXYA 1A5UA 3RLHA 3TJXA 1VAHA 4U5KA 7ODCA 5A94A 3K8MA 2ZUMA 1BWVA 3GX9A 3GG8A 1AZ2A 1O68A 3CQKA 3CUJA 1W1PA 4AY8A 1K8YA 5EMUA 1PKLA 7A3HA 3BQ6A 4BY3A 4QS5A 3ARZA 1A50A 1XLLA 1NTHA 1BKHA 7REQB 3LS9A 2ZFAA 1Y7VA 4O1DA 3QN3A 1FFRA 5J5RA 2W66A 4QSHA 2NSOA 1US3A 2VUYA 4MOZA 3ZJKA 3K8LA 3NFUA 4WIWA 4MZ1A 4RW5A 3RMJA 4DNMA 3AMCA 4RZ4A 3B4UA 2J6XA 4JQ1A 4C6DA 3M41A 1Q4WA 1C91A 3AROA 1FKXA 4MSSA 3F2CA 1XDLA 1OFDA 3AMGA 1DXFA 2VXNA 4G7FA 2Y85A 4LAUA 3R43A 2P5NA 2V5CA 2ZCGA 3GW0A 4G1NA 1KQZA 3M5VA 2WVTA 5FAJA 4QHRA 3U6WA 4K37A 3TIMA 3H53A 4AW7A 1H2JA 1GK8A 5LNUA 2ZICA 2CC0A 2EG8A 3BZJA 3Q37A 1OC6A 4YCPA 2UY4A 3KBJA 1S1PA 2CESA 1H49A 2Y24A 4CNPA 2NQJA 3XIMA 1OADA 4JYEA 1VFLA 5EL1A 1QBAA 1Y0EA 3BJFA 1RPKA 1TPUA 3V7PA 2YCLA 5E5CA 2CCRA 2RDUA 1V3MA 4IMEA 2VHLA 4ZE4A 4L6HA 2C0AA 3EPMA 2PRLA 6XIMA 3W02A 4PZVA 3IEBA 1W9XA 2WC4A 4XZHA 4RE3A 1X98A 1EDGA 5B7YA 1B3VA 2XN0A 3AYTA 2OTDA 4BI6A 3WDQA 3W7LA 4TVCA 5H2ZA 3NCOA 3W01A 1XIGA 2O9RA 4ZFMA 3NSXA 4MNKA 1VHCA 1UASA 3NZQA 1L2QA 2GLKA 1W3IA 3QTPA 3BMXA 4JD4A 5A6BA 2X2GA 4QLLA 2ABBA 2H9AA 3NJ3A 2Y5JA 3VIHA 4IQLA 4CQCA 3UZ5A 2A3HA 4Q3MA 2FPVA 1IT0A 4FLOA 3C2RA 1E56A 4DZHA 3CH0A 2QDHA 2BOFX 2X1TA 3AI0A 3R79A 3TZFA 1UD6A 4UTKA 1ZQ5A 2W4XA 1FCQA 1FBAA 4JCLA 4LS1A 2CKSA 5I00A 1C8XA 3IGUA 2ICSA 4ACZA 3G6MA 2FLIA 1R87A 2OX1A 2BY1A 3N29A 3WMLA 4MPQA 4GHRA 5LIYX 5K3VA 4ZVJA 3VNDA 3JRKA 1BG9A 1OCJA 1A5AA 2GGEA 3ARYA 1KLZA 3WLMA 2RAGA 1HT6A 3ATYA 5AC4A 4PA8A 4UTTC 3TWAA 4V2XA 2IUZA 4M3PA 3EKZA 3VD9A 6ENLA 3VKKA 3ZFHA 4HK5A 4AEEA 2YBUA 2VELA 1WNOA 3BVJA 2W63A 1RQHA 4IMCA 3MUCA 4A05A 1XF0A 4JFTA 1IXQA 1J0KA 3EWDA 3TOPA 1YTDA 2HS8A 4WKFA 2V2DA 5EKYA 1ZJIA 2RFGA 2TMDA 3GG7A 1W9BM 1OEPA 5CQ1A 3WQEA 1R8LA 3L68A 4XVEA 1K77A 3DX5A 5DANA 3ZZ1A 1V3JA 4R27A 3KS5A 3S1UA 3FA3A 2O55A 1ZBWA 1R3QA 2RJHA 4PTNA 4EPDC 1GT8A 1Q6RA 3VNIA 3VNYA 3CPRA 4XBJA 5D2YA 4I6KA 2CU0A 2WLZA 2J62A 4RNJA 3GBDA 3W1AA 1ZBKA 3L12A 3EA2A 3UJ2A 2WWCA 4YVVA 5C2XA 2WMJA 1JDCA 4LV4A 1TUXA 3KP1A 3E2RA 3THQA 1O1ZA 1UOZA 4UR9A 5HNRA 1SW7A 1ISYA 4RE4A 4Q4SA 1Q7MA 3EOOA 3DG7A 2QMJA 1JCYA 2Z29A 5AN7A 3M16A 2J4GA 4S1FA 4Y2WA 1GOMA 2B81A 4UTUA 1O5KA 4ADTA 5AY7A 4CEUC 1EGZA 4PYSA 4WF7A 1HKWA 2C7FA 4I5RA 4LXFA 1XM3A 2XH4A 4O19A 1XLAA 2XIOA 4IGSA 1EQPA 4Y9AA 1PX4A 1EC8A 3GVGA 1CDGA 3MMWA 1O7AA 1C3FA 3VUPA 1YPFA 1NWRA 2OEKA 2QCDB 4CNNA 1UD5A 3EEGA 3SDOA 2PODA 4YJ5A 4IIHA 3DHUA 3TN6A 4BR1A 2WPBA 3R12A 2X2YA 2VI0A 3I4EA 1A0CA 4MB5A 3LOTA 3BZGA 3WJSA 3QY7A 1KGUA 4WLCA 4O11A 3GXDA 1TMLA 5HNNA 4RJEA 2GOUA 1FWDC 1KXTA 3UCQA 3JW7A 1FH8A 3PBGA 1VQTA 1KKOA 4LUYA 3D46A 2ZA1A 2GGIA 3CYVA 3ARPA 3SN1A 3MO7A 1OX5A 4L6DA 4XTIA 5AKQA 1WV2A 4E2BA 1EH9A 3UXDA 1ISXA 1WUFA 4PSPA 3ISIX 1ENUA 1OGSA 3AIWA 4A6GA 4UBPC 1R3TA 5XIMA 1GCYA 3NM1A 4KW2A 3G5EA 5HULA 4O1BA 5CSSA 4AVFA 5A8GA 1QASA 5G4HC 2YDSA 3LZ5A 3S2LA 1H7PA 3IAPA 1PTDA 1EIBA 3ABOA 4IXHA 4FS9A 4O14A 2WSYA 5JU6A 2KZHA 2VP8A 3WSUA 2ZZ7A 3OVPA 1ONXA 5FJIA 1K3UA 3MV01 1V03A 4RZBA 4J3XA 2RGMA 1TTIA 4XZWA 2FB3A 1SO3A 1LTDA 1XG3A 3TC7A 3UEQA 3MUZ1 1JNEA 3BOXA 3GXNA 1GVFA 2V6AA 3W73A 2P76A 3B8SA 1E1FA 1KXQA 3KW3A 3UWWA 2C1HA 1E6XM 4BS0A 2DUXA 4JTFA 3UJFA 4Z2KA 3TCSA 2IKIA 3OBEA 3LHUA 4LC6A 3WMBA 3VKDA 4AH7A 3U2OA 4TUFA 4L9YA 3R5EA 1JEZA 1OBAA 1JUBA 3PTDA 1J8VA 1RQBA 3PJWA 2PTDA 4KF1A 1OFOA 3AIUA 2ACQA 1ISVA 5F4XA 2OU4A 4BF7A 3BK0A 1IR2A 1O1HA 4FP1A 5BWFA 2VCAA 1AH4A 1UR1A 3TYDA 3UETA 2OO0A 4H7ZA 4MKSA 1BTMA 4H2CA 1W5PA 4DB7A 1YDVA 3CEPA 4GISA 1JIBA 3K5XA 1FA2A 3DHPA 1LROA 1UROA 1M7XA 3CUFA 3UCDA 5DBUA 2J9YA 1SO5A 1M41A 1SR9A 4JKKA 1HO4A 2A7RA 2QULA 4B5XA 3V35A 4UXDA 1I0BA 1BVNP 3VM7A 2J8FA 1ZZMA 2PU1A 1H11A 4RCXA 4ZSUA 3BW4A 3PZQA 1V3KA 1E9IA 7ENLA 3WMSA 2KAUC 2ATSA 3L2IA 5GNXA 3MV11 3VC6A 3R8HA 3QBUA 1TCDA 2GFTA 4IQDA 4UR8A 2Y0FA 5EY5A 4GH3A 5DMNA 4AMCA 4PCNA 3FOKA 3W7JA 2BXZA 2XM2A 4URIA 3BG3A 2VX6A 3T4CA 4CQ9A 3OGSA 2D24A 4MWAE 5H6HA 2OR2A 2VC5A 1K4HA 4O0ZA 3FAXA 4O54A 5AYBA 3KBMA 3CAKA 1TV5A 3N9KA 2WHJA 3GD6A 3VU2A 3W87A 1XLGA 3VOGA 4UC5A 4FZIA 2PWGA 2C16A 4MJ2A 5LA1A 3VC5A 1M7OA 3H2MA 4DY1A 3E2SA 4NRSA 1J2WA 5C0QA 4AY1A 4CUCA 4GC4A 4CNSA 5E6YA 1E40A 1KM2A 4DPQA 4PMXA 2HE8A 4C65A 5A8QA 5H8PA 4Z1DA 2GVYA 2OMAA 3GAKA 3GTIA 5F4WA 1D3HA 3W29A 4GOAA 1HJSA 1V7AA 2B7NA 1GG1A 3WH5A 2DIEA 4WUIA 3SRDA 1UZ1A 5GNYA 3R2GA 2YL6A 2INEA 3TAKA 1OFAA 4LVFA 4F2TA 3CV7A 2WMKA 2QV5A 3H23A 4TX9A 4GJJA 3TYAA 4F9DA 2FTPA 2R24A 1SZFA 3NQMA 2FPYA 1HKVA 3K1GA 5LNWA 6REQA 3ERPA 3WFLA 4ZZ9A 3N2OA 4GUIA 4U33A 1XIJA 3UWUA 2IS7A 1SO4A 3IK4A 4OUIA 2BZNA 4W86A 4LT9A 2OWXA 2Z1KA 2XGBA 3BXWA 3LM3A 3TJ4A 4DUVA 2WKLA 4LCRA 1V7YA 4H41A 4N9DA 2NQLA 3CAWA 3W1NA 4XB3A 1QR7A 2Z0IA 1AJZA 1ZB5A 2DJLA 2ZOXA 1UA7A 2B7OA 4KIRA 3BWWA 3TH6A 1ICPA 4JX5A 4PL1A 1UZDA 3CQ0A 3PZVA 3QOKA 1Q3NA 1DBTA 4C90A 2ZYFA 3MZNA 2PBOA 4TV6A 1LOSA 4NYUA 3CZEA 4GUHA 4I9AA 2VD9A 3K8KA 3RX2A 1EZ2A 1VH7A 1YDYA 1LBMA 2VL4A 1F3XA 2VVNA 2P88A 4YTUA 4M82A 2X7VA 3SQMA 2R9RA 4IT1A 4ML4A 3SBFA 4F0SA 1PS9A 1DXEA 3HPAA 1E6RA 1KM5A 4O1CA 3SIMA 3SCWA 3EPOA 2JIWA 4L56A 1SQ7A 1XLBA 3M43A 4MTVA 3SO7A 3LHTA 3PBUA 1P0DA 2ON3A 2PU0A 1VJIA 1PKYA 1ZAHA 3UPMA 4Z42C 5DX7A 1MXSA 3FEQA 2FYMA 1SPQA 4DJDD 3EDEA 4G7EB 3ZR4A 4PTWA 5I0DA 1OC5A 5K9CA 4GQQA 2HCVA 1S3HA 1QTWA 3GB6A 4OV9A 3WLIA 1P6BA 4HTBA 3MI3A 4I7UA 2IKHA 4LB3A 3M1ZA 3NQFA 3IGHX 5HMFA 2GQ8A 2VDIA 5J04A 2C1GA 3PBWA 3QFWA 4JEJA 2VEKA 1NP0A 4LAKA 3U2CA 3W23A 3B0VC 3IV3A 4HPHA 4DZ5A 3LPOA 3MKVA 1OK4A 3ORWA 3P14A 1T7LA 4ZOAA 5AZ1A 3BW2A 3UG8A 1FP8A 3N3MA 4WEVX 3F4NA 3V16A 3QQ1A 5FEWA 1EL3A 2QPUA 2WPGA 4XX6A 1XGEA 4LUTB 4S3GA 3CWOX 3DYMA 1FOBA 3KRUA 4HHMA 4MNLA 3L5LA 3HGOA 3MYPA 3LXAA 4ZQCA 5D2XA 4GQ0A 1YE6A 4HPJA 5G4EA 3ZS4A 1C7SA 3M0ZA 4MZYA 4JNZA 1B31A 4EXAA 4FSAA 1W1TA 4GCXA 3E9AA 1XIHA 3D3FA 3WQ5A 1HJQA 1WOBA 4GYPA 2QXWA 5T9BG 2XJ7A 4HNNA 3O1NA 3KBNA 4RXGA 2Z00A 2X1RA 3W25A 2IQTA 5FSEC 1TWZA 2EXOA 4IP4A 2J7EA 3U57A 3DEQA 4C7FA 1HO1A 1MW0A 4UNKA 1X38A 5JIPA 1A5NC 1S2TA 4DJFC 2JE8A 1E6QM 4IMGA 1XYFA 1KKRA 3BL3A 3KHDA 2J25A 5I3IA 3ANVA 7XIMA 1V8EA 1CYGA 3KTSA 1U5VA 3AICA 3LY0A 3WLOA 1KM0A 2QGYA 3BICA 1QAPA 1I60A 1DIDA 4HHHA 1OF8A 3HPFA 4X63A 3DFTA 1T99A 3WF2A 4E2OA 1AW5A 2XH2A 3IJ9A 1DTNA 1QPNA 2W27A 4WX2A 8RUCA 2A4AA 5FF3A 3V1HA 1W1IE 4U2YA 1P0KA 1HQTA 5CSUA 3HV8A 1XLMA 5I77A 3PY2A 1B54A 4DF1A 3W00A 2EF9A 2OYKA 4CNTA 1PDZA 2RKXA 3AJ7A 3AISA 3O6DA 3F4DA 4U10A 4XO7A 3D5HA 3S1VA 1BKSA 1BPLB 2YXGA 1SMAA 2Y7FA 4XKYB 4AISA 1KCXA 1QVBA 1LORA 3L23A 2XN2A 1OQFA 3KTXA 1MW1A 5IDZA 3WNLA 1IZKA 3MKKA 1CLKA 3OPSA 1CX9A 4CQ8A 5FI8A 4AXNA 2VZOA 2G50A 3EX6A 4BF9A 1A0EA 1M6JA 3W7GA 5CPOA 2XUCA 3CU2A 4QEEA 5CPLA 3V4BA 3FJ4A 4AD4A 1XSIA 2Y61A 3KZSA 1TIWA 2PDHA 3MVTA 2PUZA 4Y7EA 1QI0A 2Z1BA 4JS3A 4TOQA 4CCDA 3O6YX 4YS1A 1GOOA 1M53A 3WJWA 3UERA 3SM0A 4XZ9A 3PAJA 1H0GA 4WXZA 3WDJA 2CLIA 3UVAA 3ZVIA 3TCEA 1KRCC 1XCXA 2ZWYA 1TJ1A 1AK5A 1RBAA 5EU9A 3RUBL 2XFYA 4IQJA 2EHHA 2C19A 4PC8A 3HQOA 1CLVA 4XG1A 2V5LA 1EHNA 5CC6A 4M0XA 1P6WA 2Q71A 4QXIA 4PFHA 3ARSA 2ZADA 3GNDA 3W26A 1JDAA 3LPPA 1PX3A 4HMDA 1AL7A 4BKNA 2AQWA 3OP2A 1B0IA 4ZXOA 5CBJA 1XI3A 1DHKA 2XG9A 3W83A 4UTTA 1GKPA 1J9YA 3N6JA 1J11A 4LUSB 3BOLA 1Z9AA 3TYUA 1MO0A 3MANA 2PMQA 3MP4A 4G6CA 3LI0A 3WBXA 4DF0A 4JXCA 1W1A1 4EAYA 2PLJA 3VMNA 3H8AA 4TX6A 4EWJA 4LALA 1I2NA 1PBGA 4GVFA 2AL2A 1K1DA 1HGWA 1TIMA 3C2FA 3DC0A 2WJEA 3OVGA 4HMCA 4AYSA 3QLDA 4B91A 5HINA 4TMCA 3MU7A 1UA3A 1V6XA 2D0HA 4D6GA 3W37A 1NDZA 1N8FA 2NXGA 3C61A 3GC4A 4ZQOA 2PP1A 1JDDA 2EG7A 1XIIA 2QKFA 4IUGA 1F9CA 3CHVA 3IJIA 4EE9A 3U0HA 2G8ZA 4EXQA 1HVQA 3BQ5A 1F7BA 1FDZA 2F84A 1W9UA 4A22A 3WEOA 4B2DA 2IQ0A 1L6GA 4A35A 4NZ5A 3T9PA 4QCFA 3APTA 4WRHA 1WYIA 3BMVA 2EO7A 3ICJA 3PZIA 3ZQ9A 5L6UA 3CUIA 5LIKX 2ISWA 1WKDA 1M03A 4JTRA 4B3LA 4K1WA 4DO5A 3H4WA 3AYVA 4C6KA 5CAHA 3EEZA 4BK9A 1F8MA 5LA2A 4G1KA 4H6EA 1UYQA 1H51A 4DYEA 4QG9A 3O0KA 4X0VA 4O13A 1G7VA 5EBAA 4CU7A 2HJPA 1TREA 4NSBA 2F8QA 2V30A 1J4EA 3F2DA 3W2LA 1T40A 1RK5A 2PF8A 1V79A 3OEXA 2CFFA 4ZEPA 3MDWA 3ITGA 1U30A 2A3CA 3G0UA 3H21A 3NYDA 1M1BA 9CGTA 2PURA 5JBFA 5I3FA 1JXKA 1W9PA 2DT2A 4G2DA 4LVDA 3O06A 3PPGA 3AALA 5M03A 2GZXA 1R9XA 1ZL1A 3OZMA 3UA4A 4KGLA 3MQTA 3LTSA 3C2EA 4EXBA 3LV5A 3R0DA 1E73M 2VURA 1E5JA 4FF5A 1KXVA 5I23A 1V3IA 1S5WA 5C7VA 2DH3A 3P8IA 1W56A 3CZLA 1DJXA 1YDNA 3P6LA 3TDFA 5D33A 5C55A 5D9NA 3L4TA 4LRSA 2X05A 4MPKA 1WB0A 4MJZA 1JDEA 1NSJA 4S39A 1YADA 4XZMX 1A4MA 2Y63A 1GONA 5GJMA 5D37A 2WVVA 3CBWA 1FFQA 3EOUA 1VCVA 2JKPA 5CC5A 2HNEA 4ATWA 2X42A 3B0XA 4X9SA 4Q8MA 2CYGA 4JTJA 3L4WA 1JNDA 3WH6A 3DG6A 1EB3A 2P0IA 1QI2A 3KBVA 4NNCA 4XZNX 3MHFA 1E6PA 4M1RA 1GPFA 3FYOA 3CIVA 1S2WA 3TW6A 2E67A 5AVNA 3JU2A 5FESA 2XHYA 1XISA 2HBVA 1GWJA 4N6FA 4XD5A 3UT0A 2ZC1A 1JCXA 1GJPA 1ZY9A 5H8UA 1NU5A 2FVKA 2BGSA 2DPEA 4KBXA 4IHCA 5AYYA 4QISA 3PNUA 2R1MA 1QMLA 4M6VA 1FWBC 4D8AA 3WCZA 1NWTA 3OLIA 1QNSA 5LNSA 2DZWA 1RP9A 2C79A 2WMGA 4IJBA 5HJYA 3ABQA 2YCEA 3NNTA 3HG4A 3JZEA 2YLAA 4DZAA 2HZGA 3E38A 3P7YA 1MWOA 1ME9A 3IVUA 4RDWA 3JUGA 4X0NA 1TRDA 1UUOA 3UA3A 2GSJA 4QE4A 3B04A 4LX4A 4TMBA 3LHYA 2G96A 4AZGA 2PDCA 5REQA 3MUIA 1K7EA 4A3QA 4UTMA 1ITUA 1UKSA 3O3RA 3O15A 3P0XA 4HK7A 1TMQA 5BXSA 4XUGA 3HFYA 4AD1A 4H19A 3RCMA 1IHIA 1OJXA 1ADOA 4I7VA 5AHFA 2ASHA 3R25A 4E3TA 3O16A 4ZB5A 3E5PA 3OU8A 3NM3A 2DSUA 4JOMA 2V67A 3KL5A 1PV8A 3NPWA 3W2MA 5KZEA 3FJNA 4Y90A 4ML9A 3NXLA 3CT2A 3S2CA 3TYCA 3P5YA 2WLYA 3BCFA 2I14A 3HMCA 3D6NA 2AKMA 2CHOA 2E09A 1US2A 1QJWA 4J3TA 3LQGA 5BOOA 3I3EA 4XSMA 3MI2A 4H6QA 2OELA 2V3GA 2QCEA 3H12A 1O95A 2IKGA 4UFKA 2YCLB 3RR4A 1R7OA 3KP0A 3KX6A 4Q32A 2JKEA 2R6OA 3AMKA 1O94A 2OQLA 2G3JA 1V0LA 4OBSA 3G1DA 3IAQA 3GQYA 3S5OA 2PZNA 5ECVA 1WA3A 2INFA 4B5VA 3E0VA 1VJSA 2BWGA 1TQJA 2FKPA 2BY3A 2DVXA 4HMNA 5DY3A 3NUKA 1CWYA 4F4RA 4DO6A 1QW7A 3WZ0E 1TZ9A 4KEZA 1N8IA 4RK8A 2XYLA 1U5HA 1JUKA 5F2IA 4R9OA 1NDWA 3VDBA 3SAZA 3UXLA 1UZHA 1QOXA 1SW0A 2QVHA 3NQAA 1EDTA 1ZENA 1EP1A 5G4WA 3WK0A 4A2RA 3EMCA 1FQ0A 4LAOA 3UG5A 4RV8A 2H9AB 1J5SA 2VEMA 1Q6QA 3QR0A 4PFMA 4JYFA 4K7YA 1KWKA 2Q09A 1YKWA 1QNVA 2XVPA 1OFRA 1C8VA 3SIZA 1JG9A 2WJZA 1Q45A 2YA1A 3D0CA 2BS9A 1F8IA 2OJPA 4HA4A 1EJRC 3MUY1 1P6CA 1XXXA 1P0BA 1UR3M 5PTDA 1E0UA 3GZ3A 4GXWA 1KBIA 4ACZB 1S1RA 2E5CA 3VNZA 5AHEA 3UY8A 3F1QA 4EPBC 3OJGA 3CQHA 1EO5A 3PF3A 2PI6A 2ZA2A 4JIHA 5DRCA 4I9TA 4AD5A 1G67A 4EF9A 4RNIA 3FSUA 2PPGA 2X1UA 3ZT5A 4O17A 1SSDA 1NY1A 1RLCL 4AF0A 4HPXA 5C9UA 4GUGA 3ITOA 4UCGA 4IOTA 5FIPA 3LNPA 2JQXA 1DWHM 1JZ7A 4MY1A 1F6KA 3GC2A 3IIPA 3BG9A 4K38A 1MZHA 1UH3A 3M5ZA 2ZDSA 4D6FA 4AYGA 3W75A 4L64A 1LQ2A 1Q65A 3T0TA 1VFSA 4NUWA 2QJMA 2PB1A 1M9HA 1ICSA 1LG2A 4IFOA 3S6TA 5AFDA 4NJJA 1XYZA 3O0FA 3CASA 3HG5A 4Q4RA 2FZNA 1RV8A 1Z8AA 1V6VA 4QTGA 2XWDA 4IMDA 3W9ZA 3G1VA 1FX6A 2CHRA 3S3GA 4HMEA 3AIRA 2V82A 3WFAA 3NQEA 4F9JA 2ACRA 3BE7A 1OABA 4QG6A 2PDGA 4YMZA 3UCCA 4N9BA 3U48A 2ZZ5A 3URQA 2J79A 2YDQA 2J13A 2NQ9A 4YPJA 5T9CE 2PWDA 4DELA 2PDQA 2O4QA 5BRBA 1CNVA 6XIAA 5DO8A 3UXIA 4H9XA 3BANA 2J7FA 3T2OA 4Q8PA 1WKFA 2XU2A 3RO8A 3HZ3A 1FXPA 3I7SA 1FH9A 4HYVA 1F07A 3NSMA 4XSLA 3N4EA 4PMRA 1Q4NX 2IPJA 3QYSA 1IT8A 1VBHA 3IUHA 2QMKA 2Z27A 3BSMA 5CH9A 1PE1A 1TTJA 5KMYA 4XAFA 4LYPA 4HU0A 3TONA 3M47A 5BWAA 4D6JA 2PWVA 3MT1A 1KFJA 2AOSA 1XL9A 2V3DA 3QZ6A 2QAPA 2CBJA 1D7KA 3M0KA 3EX2A 3ZSSA 2YL8A 3URAA 3OO2A 3BO9A 3VVGA 2CLEA 5DT5A 4M6QA 3CYJA 8CGTA 2ALRA 4KEUA 1QNOA 4TVDA 4KEMA 5JIWA 3TA9A 3K4DA 3BAKA 1E5NA 3S5ZA 3WIJA 3PANA 1BD0A 3MSGA 3NO1A 1JPHA 1GYNA 5TD4A 3QV9A 3CXOA 1DORA 2YFNA 1YRRA 4FK9A 4WOQA 2ZUSA 4BQ4A 4Q7IA 1QK0A 2NZLA 2A79A 1W1ZA 5F2GA 4ZL1A 3DC8A 5M3WA 1K7FA 1UC5A 3L7RA 3WD4A 2BGQA 3AC0A 3EWXA 3GVWA 2WSRA 4UNIA 4E4PA 4D72A 4MWAA 4CQDA 4LH8A 1JRCA 1UJPA 1QHOA 2GSHA 3WUBA 4ZA0A 1XD0A 3U8GA 2QV4A 1KFCA 1QNPA 1ZSXA 3UR8A 3N12A 5CSYA 3L0KA 5TIMA 4ADUA 3T78A 1MNZA 3HB9A 4DJFA 3QR3A 1CGUA 3CM4A 4R53A 3AYSA 1WXYA 1CGYA 1WDWA 4OTKA 3LCXA 3CTTA 1CB2A 1SJAA 4AXKA 4UFMA 2ALDA 1J01A 3LYEA 4IPLA 1LF1A 1GPWA 1H0IA 2F2KA 3N9RA 3BSHA 1OT2A 4DBWA 1JYXA 2RDXA 2DSKA 1Q7ZA 4LCQA 4AEOA 2O0TA 4BWLA 1H1YA 4WJXA 3BLDA 4ZENA 4A8NA 1XC6A 1JPMA 1W54A 1KWGA 4YN5A 2J7BA 4PUUA 3TQ0A 2HK0A 3VIKA 3I65A 4LU0A 1T5AA 2VO5A 4FMVA 1VKFA 4HNUA 2E3ZA 1U33A 4X22A 2XISA 4Y9OA 1KM6A 3QEZA 2RDTA 5C9XA 1F74A 1R9YA 5C8BB 4ZMGA 4HCLA 1UMLA 4QEHA 5D02A 3R7MA 3S9ZA 3RJYA 2GGJA 2YJQA 3W6YA 1OFPA 1EUAA 1M7JA 1TQXA 4GFSA 3IJ7A 4RR4A 2NQHA 4FOKA 1K8CA 3TFXA 3BLIA 3A64A 4HGXA 2PD5A 1XV8A 4ZOCA 4FNPA 3GIPA 1DQUA 3KM8A 4IGMA 3W72A 2G4FA 2VR5A 3RHGA 2V9DA 3UZJA 1L9WA 4J4KA 5JBDA 1XIMA 4ATLA 4OOZA 4O16A 1HP4A 4ZQMA 4AX6A 4M5PA 2WK2A 2WM0A 4M81A 1RA0A 5M5DA 1VHNA 5D4YA 4IL2A 3NEHA 2A3BA 1O4UA 3M46A 5FJOA 3QH2A 2VT0A 1WBJA 5AC7A 1TA3A 1TZZA 3KL3A 2I9UA 3PG9A 3QLLA 1R2SA 2QF7A 3T09A 1ZFJA 4KQNA 1QATA 5FF0A 2WHKA 2ISDA 2VEFA 1VBGA 4LOCA 1K4GA 1ZAIA 4GY1A 2J6VA 1KV5A 3FFSA 4UTIA 3G8EA 3UZYA 5CJ5A 2XGZA 9RUBA 3W28A 1HN1A 2VJXA 3IUDA 3QMRA 2VRKA 4XIMA 2VRJA 4JDYA 2UV8G 1W1B1 1K9FA 1VLIA 3T0CA 3DGRA 4NZCA 1TMHA 3S5YA 3TC3A 1WDDA 2CLFA 1UBPC 2WSPA 3ID7A 4LBUA 3TUUA 3N11A 2IPFA 4UWMA 1GGOA 3G18A 2EPNA 3AZRA 4NF7A 4K8GA 1EBGA 1JCMP 4MKVA 2KX9A 3TK7A 4TX8A 4K68A 2XM1A 2FH6A 2WYSA 2NVAA 2CWNA 3NURA 3MSDA 1XLCA 2I1OA 4Z2HA 2PZ0A 3GXFA 4FF7A 3LRMA 2VX7A 3VK5A 2HVMA 2ZWZA 2G41A 4W5ZA 3B9AA 3ES8A 4UMCA 5LIWX 5D05A 3SJ3A 5KTLA 3RILA 3AIBA 4LYQA 5AC8A 1UOKA 6REQB 3B9OA 1A49A 3FK4A 2XVGA 4EPKA 2WQDA 2F6XA 3LB0A 3F4WA 4E38A 1ECQA 1PHWA 5C9ZA 2FVMA 4M6UA 1OX6A 2WC7A 5CPMA 3KE0A 4UTWC 5FL0A 1ADSA 3UG4A 3AQUA 4TTUA 4FA3A 1NQ6A 4R9XA 1KM4A 5EB8A 1NJJA 3DHDA 3UP8A 1XSJA 3U5UA 4PRRA 3W7QA 2A2IA 3DFYA 1E4IA 4RW3A 4LWWA 4NP7A 4TU1A 4L4PA 2I5QA 3N2BA 3FJLA 1GOIA 1TPDA 5LA0A 2EG6A 2NQ5A 4N4QA 5FJJA 5D9OA 3UXKA 3B9EA 5FJTA 4CQBA 2CBIA 4GUFA 3ANUA 2XFFA 2UY2A 2DY3A 4GUJA 2QAFA 1PWMA 3HPXA 5AZ0A 3I6RA 2DGAA 3G22A 2PWEA 3WJXA 1FHVA 4DYJA 5BOFA 1RCQA 3TE9A 2R1KA 3VINA 1A47A 4KWOA 3QJAA 1VEPA 2DT1A 2HDJA 2QCFA 3GDLA 4RNFA 4A8LA 3VYLA 3U2ZA 2BVYA 7TIMA 5EYWA 4GD0A 3W70A 3QXBA 1LYXA 1RCOB 4JFWA 1ZJAA 4FXJA 1CXKA 2Y7EA 4JTAA 4LQ1A 2NV1A 2J47A 1E4NA 3QSTA 4E2VA 2FTYA 4QJ5B 4JKMA 1AL8A 5JVLA 2ZA3A 3OQ8A 4PUWA 5CZKA 4LNYA 3KLKA 3UFYA 4LC8A 4PMOA 4AHQA 5MF5A 3RAOA 1E15A 1XLDA 1PZ3A 2W6RA 4IJRA 3M0YA 4P61A 4MZ8A 3LGGA 1BG4A 3LN3A 3A21A 3BAIA 3HGJA 3OA5A 3MB9A 1DJYA 3VGDA 3OLGA 3R8RA 5CGMA 1LJYA 4CD7A 2V5BA 1YEYA 3HGRA 1K02A 1YTKA 3BAYA 5I3KA 3CZGA 3O6AA 3VAVA 1DTUA 2OGYA 1VEOA 3KTCA 1IIGA 1E0TA 4ZO7A 4OBRA 3USBA 3H2FA 4ORMA 4ADSA 5MHBA 3KRSA 1W3KA 1TJ2A 3LHZA 3AYRA 3W38A 5F1VA 3T07A 3TQPA 1A3HA 1IZCA 2Z7GA 1VJZA 3FXYA 1Z41A 3CH9A 5A2BA 1KV8A 3I10A 4K1GA 2ZZ1A 2VFIA 1EJXC 1H61A 1UWSA 3W2JA 2YDRA 4AWTA 2IXVA 3GVQA 3VMPA 3KEHA 3QM3A 4WGHA 2EKCA 5A5WA 2E0PA 1B4EA 1TE6A 4ICNA 4QBXA 2QNEA 3KVLA 4AVNA 4JTDA 2G37A 1A80A 5FKYA 2BBFA 3C6CA 3GDBA 4MFEA 2JF7A 4O10A 3DBPA 4LVAA 5DFAA 4AZ7A 1SFSA 3VE9A 2WBKA 4E0CA 4WR3A 1C9DA 3RGTA 1WO2A 4DPPA 2Y8KA 3A3XA 1EUNA 4Z2GA 3OYZA 3T8LA 5IDIA 3FGCA 1GVEA 5EMMA 5LGXA 4JTGA 1Q2SA 3EB3A 3LD5A 1XQLA 4AIEA 3SSJA 5HQEA 3AUOA 5D09A 5DBTA 3W24A 3NOEA 1TVNA 4M6PA 1EEXA 3GHSA 3W7PA 4XIAA 3AXMA 3BUVA 1AZ1A 1ZUAX 3WEMA 1H60A 1NM9A 1JCJA 3TQKA 3MUXA 3QZAA 4GZEA 4Q8VA 2PDPA 3TTSA 2WZTA 2NX3A 2TODA 2CZFA 1ZLPA 1E72M 1GKQA 4ORIA 1VP5A 3CLWA 1RBOB 1OHLA 1FY6A 3WN6A 4KESA 1KC7A 5AOUA 4DLMA 3WYZA 4YTQA 2Y8UA 1S3TC 1WXJA 4WKAA 2PGEA 2V68A 1VPXA 1TUFA 2Z2UA 3FW6A 4AZCA 3H2OA 1KR1A 3NQ2A 3KZPA 3G1HA 3VNLA 1Q63A 2POZA 3GDRA 3E5BA 3VILA 4OFCA 1DWIM 2ZUVA 3CUHA 3EOLA 2YCJA 3OZOA 1Q85A 4B2DD 2E5DA 2VWSA 2L5HA 3NR0A 2XFRA 2FVLA 2YB4A 3TLQA 3KAOA 2J7DA 3EWUA 3E2QA 4UQAA 2D20A 1VRDA 2J9ZA 1DQXA 3CHEA 4US5A 2D22A 1F5ZA 3H4XA 1M3UA 4BF5A 2OSWA 4W8BA 4RDYA 1B3ZA 1V6TA 3C8NA 3W22A 1T8XA 4FHAA 3BGAA 4LW7A 4K2SA 3HN3A 2Q3OA 4HOXA 4DAFA 4ERIA 2VWTA 4FPSA 4PCTA 3QQ0A 1JZ2A 1KBJA 3IWPA 5XIAA 3WNPA 3WUEA 5BMXA 1OINA 2O9TA 2HXTA 2WOQA 5ABEA 4V33A 1P5BA 5JQ9A 3WNKA 5EPDA 2FDSA 1ICQA 2OB3A 3LSBA 4D9PA 1EEPA 5G1YA 2DH2A 1GQJA 3EDDA 3LTPA 5LKYA 3KUMA 2CLHA 3P81A 2D23A 3AZTA 2NLYA 5A1AA 1BSIA 3MWAA 4ZO8A 1BXBA 4NX5A 3RPMA 1GZJA 2BOEX 5IBXC 1VRXA 3IACA 2O7SA 3P74A 5F2MA 2JGYA 3W27A 4C6MA 4JTUA 5U7SA 3COTA 1UWQA 4DO7A 3EX1A 2F2HA 5KETA 4KWSA 4TIMA 3P60A 2VZUA 4WHBA 1RY8A 3FA5A 1SZRA 1AODA 4KFNA 3GDMA 1GW9A 4RZ5A 5U4NA 2VKZG 1L0PA 1Z32X 2AL2B 3S47A 1ZNNA 1KM3A 1R2TA 1EOKA 1PZ1A 4Q8OA 4PMZA 1GORA 1XYLA 3LNMA 3S5NA 3PSVA 1EXBA 4PUJA 4MM1A 1XDMA 4RZ6A 4S3FA 3EWZA 4ATDA 4L9XA 4C1LA 4XK2A 3SY1A 3A9BA 1V02A 2PGFA 4C6BA 5TF0A 2V63A 1SZGA 3STCA 4WDWA 2C14A 2NW0A 4L65A 3IGXA 4S23A 4IIEA 4LV9A 1G4SA 1BFNA 2FZMA 2DEPA 3NGJA 1MMFA 2BODX 4RKAA 4DJDC 5A2AA 1E0XA 4EAMA 4EOUA 3U3HA 2ZTKA 1OGBA 5KITA 1GZ1A 3IJLA 2GDQA 3N18A 2HS6A 2JK2A 4JL1A 5HJLA 1JFXA 5T8GA 3AHYA 1TPB1 3HV9A 1DWGM 1RQEA 3QPYA 5G1TA 1F76A 4QIUA 1UP3A 4TQTA 3SGUA 4MDPA 3AHXA 1DVJA 3BGGA 1ELSA 5CGQA 2VC6A 5FCZA 3VTRA 3KVJA 3CQIA 3L0NA 3EA1A 3QTGA 2PLKA 1CGTA 3MMDA 3NVDA 4B92A 5CCZA 4KEVA 2E28A 1L6WA 4GX8A 1E6NA 1AH3A 2W67A 2E6AA 5DCEA 4GJIA 4PCFA 4HVXA 3APYA 4DN1A 1VFFA 1XW8A 2WZMA 3T1GA 3GKFA 2B7PA 1VENA 5C7HA 5DN1A 1RK6A 4O4WA 2DQWA 2E8ZA 4UFIA 1TB3A 4GVGA 1QO2A 4NQ1A 3SW6A 4Z0SA 3GFYA 4G5DA 4NZFA 2X09A 3LUTA 2XIQA 2ZE3A 3II1A 4S3AA 1JZ5A 4RDVA 2V81A 3VCCA 4DI9A 4OGZA 4CVWA 1OCBA 4KWUA 5IOBA 2R82A 1XLKA 1HZYA 1I0DA 3WD3A 4B15A 3INPA 2O9PA 4GVIA 1G4EA 3ZJ7A 1K7XA 5I07A 4NNAA 1P7TA 4PEKA 1V6WA 3OZPA 3NZGA 4O52A 1QXLA 5A8MA 2EKGA 3MCNA 5HXMA 1HTIA 2BB0A 4XV0A 5M1TA 1MEIA 3WQWA 3W7EA 2WVVB 4S3DA 3DH7A 1B4KA 3MCMA 4WK9A 1JR1A 3SEPA 3NVTA 5FAGA 4H4IA 4W7VA 3VKAA 3NZRA 1WX0A 3L4YA 3GR8A 3WH9A 3EOSA 3EB4A 4XBSA 1QDSA 3WKZA 2V5JA 1H5YA 4CCCA 2VC9A 3G0SA 3T8QA 3PUDA 2WNWA 4JY8A 3WBYA 1UKQA 4JTLA 1EF3A 2DUZA 4CKQA 3CV6A 2YB1A 1FCVA 1HXJA 2DZPA 2QUMA 2JEQA 6TAAA 2X7WA 4MLRA 4MJ4A 1GVYA 3M7WA 3KWSA 1W1YA 1BAGA 4NYYA 4IISA 1UR0A 1D8CA 1YW1A 3XISA 3CPUA 3LQLA 3BTNA 4TTGA 2Z6IA 3WDHA 1JZ4A 2G3NA 2ADAA 3NA8A 5HBFA 2DZBA 3LX9A 4MIMA 3TX9A 1J6OA 3KVKA 4HU3A 2WQPA 1DJZA 3E6EA 4Z17A 3GIYA 1UWUA 1B5TA 3CGTA 1C93A 1E3ZA 3SN4A 1KLYA 3SY5A 3GLCA 4DBUA 2EBNA 4FXRA 4RX0A 3KL0A 4EWND 3TKFA 5AYIA 4EK7A 4W88A 4Z08A 1LM1A 2Y62A 3SFKA 3LLFA 1UW9A 4C5YA 3OHIA 3AS1A 3JVAA 5RUBA 1Q13A 1JF5A 1PPIA 1V3LA 2DZVA 2O9OA 4ASTA 1ONEA 1PIGA 1JYWA 3NQ7A 3PTKA 5DXYA 1TVPA 1V3HA 5KZDA 3BLLA 1ZP3A 5A8OA 4IFRA 1R30A 2ZVIA 1XUUA 2AGTA 3UWEA 3SCSA 2DZUA 4H2HA 2VOMA 3OOQA 1VZWA 4N9EA 3RITA 1KCKA 1EJUC 1TPVA 2EPHA 1XJBA 3BLOA 2OOGA 3NO5A 5FD0A 3T05A 4GY0A 2QW5A 3FKKA 3L9CA 4N02A 4KWWA 4CN1A 1YX1A 1IXOA 4HZ6A 1JCLA 3S9IA 4RV3A 2C6QA 4GPNA 4DJED 1CENA 1G4TA 1B1YA 3DAQA 2BLEA 5CSRA 3IUIA 2OEJA 4LJ3A 3T44A 1G69A 3ZJ6A 3QMSA 3QR1A 4WSHA 1G7UA 1YE4A 4X61A 4I5XA 1H7OA 3SECA 4GIEA 4EKJA 3WNNA 3HIJA 1KFEA 4IH3A 3TMLA 4ZB0A 3PZUA 5FA5A 3VXGA 1KFBA 5BMWA 4CEXC 5A8PA 4HCHA 4UTJA 3E0WA 3HG2A 4RE2A 4UIOA 1YTEA 3T2QA 4DBEA 1NH6A 4DWSA 2VFGA 4E8GA 3CNYA 4AUBA 5A6AA 4JN7A 1ODZA 2VFDA 1H7WA 3SUVA 2CBUA 3FIGA 4F0MA 1ZBVA 1SR0A 1FCBA 1P43A 1S46A 1MFVA 2NVDA 1UPMB 3PWAA 1UQYA 1FWWA 4AU0A 4A3RA 4FNSA 4F48A 3LDVA 3LRKA 1HKKA 3PAOA 3RRAA 3TU9A 3OVRA 3CHDA 1LL4A 2DW6A 3RO6A 1Q8AA 1P4CA 5HUPA 4RXFA 4K8EA 3R89A 3DFSA 3E2VA 1EFZA 1XYCA 5KSWA 3UJEA 1RSCA 3BH4A 1ALDA 2EAWA 3WMCA 2HVNA 2BTMA 1TELA 2W61A 1ZCOA 3LCWA 1UPPA 4NXSA 1EJ7L 1XLEA 3IIXA 1W0MA 5FEXA 4BFAA 1X97A 3L66A 4L61A 4W7UA 2XDFA 5EMKA 1I2PA 4UTWA 5DELA 4DWDA 5C9RA 3SR7A 3F4CA 3GFZA 4E8DA 4UQBA 3B0UX 2NV9A 3STGA 3W82A 2PCEA 2DORA 2DJXA 4ZQPA 3QV6A 1DXIA 3LCLA 2OWWA 2GOKA 2CKRA 1HKIA 1Q6CA 3RXZA 1B90A 1NARA 1LWJA 2ZXBA 3VZZA 3GXPA 2C3ZA 5IM51 1TVLA 4Y8EA 4MWAD 3K30A 3V0UA 4MAZA 1E71M 1QI5A 3B97A 3GTNA 1XPGA 4HOZA 4HA0A 3T2PA 3SN0A 3NO3A 1A5OC 4FR1A 4XZBA 4E6MA 2YR1A 2YYTA 3SZ8A 4IPJA 4HK6A 5C5YA 2YBVA 1T8QA 2NT0A 4D6IA 3VMOA 5DCBA 3PM6A 1I75A 1REQA 3OIXA 1J12A 1XCFA 2ZUWA 1AVAA 4S3CA 4YWSA 3A6OA 5I24A 1M5WA 1WZLA 3SGGA 3VUSA 1DHPA 1YXDA 2WXDM 4JX4A 1O5QA 2TRSA 3H2EA 2VEIA 3KDNA 1TWSA 2PP0A 1UC4A 2GGGA 3OVQA 4QDPA 3F5LA 2AL1A 2W91A 4LAZA 3S1GA 4CD4A 4PUKA 1ISWA 3B06A 3NDYA 3VM5A 1BGAA 4OKDA 1MQRA 2BOGX 1TX2A 4GNJA 2PDFA 3ZWTA 2I57A 3FHQA 4OT7A 4JICA 3SRKA 4O18A 1H4PA 3HG3A 3S0CA 4NXKA 3R8GA 2Z28A 1Q6LA 1QI4A 1DWAM 1VFUA 3WQDA 2H3BA 4H1ZA 2ZX8A 3FLUA 3MC5A 3MY9A 4KH2A 1LBLA 3THCA 4AC1X 2J8TA 1MUMA 3CUXA 4N2YA 4JN6A 5HJXA 2FFCA 1UD4A 4Z1YA 2P0OA 2WAGA 3UXAA 1QNRA 2WHLA 3NQBA 5AHMA 6PTDA 3A3HA 1A0DA 1W8SA 2WV8A 2OLAA 1V77A 1WPCA 5HOSA 2QZRA 1UH2A 4Q4PA 4ENLA 4YTRA 1ZJHA 1Y65A 2VX5A 4JL2A 2WCGA 2H8XA 3HURA 4NAFA 5FSDC 3G1FA 3U9IA 4A2SA 2Z4GA 2QCNA 4OQVA 1IGSA 1FWRA 4AWEA 4B4FA 3NOYA 3GVRA 4D71A 1ML1A 4MYAA 2WBGA 1ODUA 1H5VA 5JXQA 2CPUA 4HHPA 4DYKA 3N6HA 2IXUA 1DV7A 2HPMA 5CC7A 3WJZA 3W7RA 1X39A 1K8XA 3GH4A 1WDPA 3GIQA 4MWAB 1RHCA 3GC5A 3SUSA 3W0KA 3MHGA 3M5XA 3IRDA 1X8CA 2I9EA 3FDKA 2V8ZA 3M07A 3B0PA 4GYJA 3BPWA 5G2WA 2GQ3A 5EMJA 2VGBA 2EGZA 5E09A 2OEMA 5LZLA 3SCVA 3VZYA 4BA0A 2AGKA 5HMSA 2Q3RA 1UD8A 3LI1A 3WLTA 4HNCA 2QUUA 4UQDA 2PF0A 4ZCWA 4AD3A 4PRWA 2UY5A 3NQCA 5I79A 3LGDA 1ZCCA 3L65A 1ITCA 4L1GA 1Z48A 1KTNA 4L1WA 4ZQRA 2HPIA 4K8HA 3TR2A 3ZVHA 1G4PA 2CXEA 4DVOA 2PA6A 4Z1AA 1X1ZA 3AMLA 4LYRA 4PTVA 3WJYA 3VOIA 1HGYA 5BNKA 3GY1A 1H09A 4O1FA 3TROA 2E1WA 1ZJBA 1KRMA 4V27A 3DERA 4BHYA 2OZ0A 1SMDA 3ARTA 3F5JA 2P53A 3ARRA 1IE7C 5CBIA 2QHAA 2FGBA 4C1NA 3RX3A 5CC3A 4R7WA 1RY0A 3IVSA 4HP5A 3N2CA 3OLDA 2YCKX 3TYZA 3WNMA 4ROQA 3W7MA 2WNQA 2OZ3A 2QYGA 3M0MA 2BDQA 3E96A 2WJFA 3OYXA 1WCGA 4BEQA 4DAIA 3H22A 4ZBCA 2CXGA 1U1JA 4GH1A 3MP5A 4QJ3B 4QAWA 4AG0A 1H41A 5CEWA 7PTDA 3STPA 4J3SA 4NHVA 2LLEA 1W17A 1OFQA 5I2UA 5HAOA 3EBVA 3N25A 1AUSL 2Y88A 5BOEA 3P93A 3LBCA 3M7SA 3BMWA 4E4FA 1KGWA 1VGAA 4OZOA 2OLHA 3C0QA 1TA3B 5AB3A 2I17A 4FXFA 1PTAA 2FHBA 2R1NA 2P8CA 2CZ5A 3BC9A 2J77A 3NIYA 3RM4A 1EXPA 3PZMA 1I45A 4Q7BA 4HZMA 3TSDA 4WJEA 1H50A 1IR1A 5BXTA 1ITXA 1ONWA 3UGRA 4WJ8A 3W74A 4JHZA 2YA0A 1U83A 4PMDA 4K39A 5F1UA 1R3RA 4MUZA 2G4JA 3EXSA 3P82A 3H7RA 3ZLFA 5BZAA 4W85A 1TPH1 5DMLA 2C0HA 5E9AA 2GWGA 5EFFA 4ZE5A 1FRBA 2Q8XA 3DYPA 3VIFA 4JIEA 3R58A 4QM1A 1UKTA 3HOJA 1F73A 3BSGA 1JQVA 4DX3A 1PHQA 4G56A 1NOUA 1SVDA 3EDKA 3W85A 1JZ6A 1CXEA 4CCEA 5I6SA 3MTWA 1UR4A 5K9XA 1MXGA 1VPQA 2YL5A 3M64A 5EFDA 3ZWSA 4CU6A 1OG0A 3N17A 3QRHA 1XR2A 2HV5A 1JJKA 3KXQA 4FLQA 3DECA 1DKWA 1BQGA 3WBEA 2ZZ6A 4GVHA 4DEFA 2WB5A 4PR4A 4HZ7A 3C0LA 3PBVA 4GK8A 4O0KA 3LHWA 4IICA 1ISZA 3OB8A 1SYTA 3M5YA 1N82A 4H04A 4XO6A 3PPFA 1VFHA 4Q6XA 1R6WA 1P1MA 3MSRA 3M9YA 2A6NA 1TR9A 2UWFA 1W5OA 2GUBA 1HJWA 1YDOA 4NASA 1DEDA 3VIOA 1UR9A 3O7UA 3RPTA 1NVMA 4XZIA 5E0CA 2Y6ZA 2I56A 3PNZA 3ZM8A 1RH9A 1K70A 4O53A 4IXXA 1YXCA 5TQLA 4DJDA 1L6YA 2ZQ0A 4CNOA 1LL6A 3SUTA 1EHAA 1YPXA 1VFTA 2X40A 1PJ9A 2OZTA 8TIMA 4L4LA 2YBTA 3FA4A 3VFLA 4C5ZA 1JULA 2AKZA 2VDHA 3U2EA 3EX4A 3FDGA 2PWFA 2YL9A 2ZZ2A 5EGRA 1AQFA 4GCAA 2D69A 4W84A 2YZRA 1I4NA 4PTMA 2J7CA 1XIDA 2PTYA 4U3AA 1S2CA 5FJUA 4ECLA 4UFLA 3ZMRA 1RR2A 1JPIA 2D1ZA 2ONEA 2FH8A 3SQLA 1CI1A 5HNTA 3I4KA 1TV7A 4MFDA 1SFTA 4LVBA 2HVOA 4I9JA 2Y2WA 4Q4OA 3EGJA 2QR6A 1VB9A 1XUZA 2QJHA 4AMAA 2DZSA 2AAMA 3G1SA 1OY0A 2C18A 2YYUA 4EF8A 1Q5MA 3GUWA 2PWHA 3FHAA 4IIBA 1PX8A 4LF1A 3UQNA 1L8PA 3R10A 4OWGA 3GUGA 3N73A 2FB2A 1SZEA 4M80A 1XIEA 4MF4A 1FTXA 3CT7A 1GUVA 4PBEA 9XIMA 1KCLA 1MQQA 3U4AA 1JI1A 3PJXA 2BHUA 3TEVA 1PXGA 2Q02A 3ZR6A 1UWRA 2W62A 3UR2A 3PPCA 1JUEA 3W07A 4IZGA 3TJIA 4DQWA 4Z2IA 4XAPA 3OLEA 2Z25A 2ZIDA 3TMQA 3IJDA 4A3HA 8XIMA 5G1MA 4AZIA 3IARA 5I09A 2VCBA 4IX0A 2QCHA 2VCCA 4GXMA 4LBSA 1OF6A 2NUWA 2C91A 1D9EA 2D73A 3C86A 1OX4A 2BY0A 3UU0A 5I02A 2XTKA 4YVPA 3DENA 3NPVA 3H6OA 1TKKA 1NWUA 2EPKX 5CPSA 2ZX6A 2A1YA 3FAWA 2Z2AA 5BU9A 3O8AA 4GY7A 2X8RA 4QG8A 4QQUA 4US5D 3LERA 3HTWA 4I6VA 3F4VA 2GUUA 1J6PA 4GMEA 2VC7A 4MY8A 1VYPX 4PMQA 4K6AA 4GI8A 5ABTA 2D3NA 1JD7A 3IPWA 1SSGA 4ZODA 4REQB 1GVQA 5TAOA 4MYXA 4QLJA 5BU6A 3H2CA 1IIHA 4HQVA 4YL2A 3WDRA 2UBPC 1RXOB 1WBHA 1NEYA 4FX6M 1HF6A 1QPQA 4MADA 2C15A 4QJ1A 1W6TA 3REQA 4U4MA 1OCNA 3PZ9A 1FUYA 3ARWA 3GU1A 2VX4A 3P5ZA 5ABFA 3MYOA 3HQNA 2A3LA 2PDNA 3AUJA 3H55A 2DFAA 1DL3A 4GQBA 2W92A 4QQ3A 1J2BA 1WDSA 1SW3A 3ZIZA 2A5HA 3RU8X 1E6SM 3TSMA 1GJUA 2IMRA 1EP2A 4YCOA 4WOZA 5ECUA 1DIEA 4JQ2A 3EKLA 5HATA 3U7VA 2G0WA 3FGCB 1KQYA 3T0AA 2PDLA 4OBTA 1DPMA 4M29A 1BTCA 1Z69A 3PR2A 4GFIA 4H9UA 2VGGA 1US0A 1ZP4A 4J3VA 4MHBA 1GVIA 1BWKA 2OCZA 3GTHA 3L2LA 1KTCA 2WW5A 2BFGA 4JTSA 2CHNA 1OB0A 4FNQA 3GBEA 1J79A 4C6LA 1DIOA 2E8YA 5BROA 1LDCA 4H9TA 1E0VA 1EPXA 4NZ1A 4GKLA 5HPCA 4R33A 3VGGA 1OG6A 2PDMA 1CIUA 2NV2A 2YPIA 4H8HA 2PDWA 1THFD 1MVYA 4KGJA 3S8HA 1KRAC 1OVDA 1OD8A 3C5QA 1TV3A 4IMFA 5C70A 4AZCB 1SM9A 3W76A 3M0IA 4XKMA 1XS2A 4XD3A 1XG4A 2PC8A 3LCFA 1KXHA 3PC0A 1BEUA 3A5FA 3EMZA 1CGXA 1CB7B 2QLYA 4J9JA 4LUJA 4IQEA 2WWDA 1S5VA 3VCNA 4UQEA 4XVDA 2GVEA 4KIEA 1J0JA 4GKTA 1JZ8A 1PIIA 4WDUA 3AXKA 5A6LA 3G77A 3S2NA 4P8VA 3DKLA 4WKHA 3JZUA 1CXIA 3WD0A 2XN1A 5HPOA 1MNSA 2B7QA 3MUAA 2X30A 4ERAA 4I8YA 3R13A 4MB1A 4AZ5A 1JVNA 1AFSA 3T0BA 3GO2A 3HJZA 1B3OA 4CGTA 4KS0A 3WK2A 3V5FA 2DZTA 3TYEA 2H3DA 2SFPA 1KFKA 2I5IA 3DHFA 3Q58A 3W1RA 1D7FA 1VIZA 2ZC8A 1LLOA 3MA8A 3WFZA 4PCPA 4LY4A 2QCGA 4CLMA 4AQLA 1VC4A 3NWRA 1BF2A 1CPUA 4XAGA 1JYVA 3Q2DA 5LIUX 2ZUTA 4HJFA 1GOQA 1BRLB 1RJPA 3M0XA 3M0JA 5JH1A 4NJHA 1GTHA 1E9ZB 4L80A 2YGYA 2J27A 4DXKA 1H1ZA 2NX9A 1TPWA 3PB0A 2VFEA 3DFQA 3V75A 1E6ZA 2YZ5A 2WKJA 1KW1A 4D2JA 2OT1A 1VFOA 4CQAA 3ABSA 4A3YA 3CL6A 4L6OA 1QT1A 3VD7A 4JEQA 4GYPC 2TAAA 1S2AA 3KCLA 2OT0A 4NKCA 4UZSA 4L1XA 4R3UA 4CCZA 3POCA 4JIQA 2QPSA 3WLLA 4HCDA 2Q6ZA 1UKOA 1RVGA 9XIAA 1PO9A 3FVDA 3UWZA 3C8FA 5K7JA 1DIKA 4JQ4A 4FNRA 4GO9A 1QW9A 3CV1A 4NT0A 3PVFA 2X41A 3FV9A 1J0YA 1NAL1 2O7QA 2DV0A 1JCNA 1E70M 1YXYA 3VOJA 1XLIA 2BHZA 2GJNA 2Z6JA 3TV8A 3GAYA 2H8ZA 1R3WA 4PMJA 4G8TA 3W71A 1SFLA 3LG3A 3ONCA 5E70A 1JZ3A 2HE5A 2H90A 3OTRA 3WENA 4QP0A 4NX0A 1KO0A 1B57A 2G95A 4PMUA 3FX4A 4JQAA 2QUTA 1LRNA 5I7GA 3SCTA 3IJ8A 2DVUA 4OIFA 3GU9A 3WD1A 4W4QA 4JNMA 1MDRA 4YYFA 5ABHA 2ZRYA 3ZLHA 4LFYA 1EGVA 1HKMA 1H63A 4HNVA 5AHIA 1E51A 4MMWA 1TR1A 1UWTA 4J7RA 3WQPA 4GA8A 5JUVA 1AQ0A 1E4LA 1AW1A 1XIFA 3V0SA 1IQ8A 2RGLA 2WANA 3W7KA 3TOYA 1QPOA 2OSXA 1E1CA 3TXZA 4QRNA 3MMUA 3WLKX 3Q94A 1X6UA 4ZXLA 2OWCA 1XKJA 3EYPA 2DT3A 4C6NA 4H9YA 3KBWA 3L4ZA 1Z42A 3VIJA 2WSQA 4EIVA 3HF3A 3UG3A 5IXEA 4V1XA 5D9PA 3BARA 3WLPA 2YSWA 5HMDA 2WVUA 3BV7A 1XH0A 3UJRA 1AJ0A 3VIGA 3SI9A 1GHSA 3O6CA 2ACUA 1LLWA 3E3HA 1HJXA 3TN4A 4TVUA 3RCYA 3U7BA 3VX0A 3P2VA 3CL7A 3BURA 1KR0A 2WVSA 4O4VA 2OFJA 4DZIA 1NWSA 4B5NA 3WG6A 1FDJA 1D3CA 5A95A 1LOQA 2NXHA 1ITQA 3AJXA 3OG3A 4C6IA 5LNRA 1HKJA 1CECA 5I3GA 2YXXA 2W5FA 1VBRA