2Y8UA

A. nidulans chitin deacetylase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
211
structure length
211
Chain Sequence
VPTGQVITQCTTPNTIALTFDDGPSEYTPQLLDLLSRYSARATFFVLGDAAAQNPGLLQRMRDEGHQVGAHTYDHVSLPSLGYDGIASQMTRLEEVIRPALGVAPAYMRPPYLETNELVLQVMRDLDYRVISASVDTKDYENQDADAIINTSFQLFLDQLDAGGNIVLAHDIHYWTVASLAERMLQEVNARGLIATTVGDCLGDGEIAWYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cloning and Characterization of a Broad-Specificity Chitin Deacetylase from Aspergillus Nidulans Fgsc A4
rcsb
source organism Emericella nidulans
molecule tags Hydrolase
molecule keywords CHITIN DEACETYLASE
total genus 88
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01522 Polysacc_deac_1 Polysaccharide deacetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 2y8uA00
2DFAA 3CL6A 1NY1A 1W17A 2VYOA 4NZ3A 3VUSA 4NYYA 4F9DA 1W1B1 3S6OA 2IW0A 4NZ4A 2CC0A 4LY4A 4NZ5A 1W1A1 4HD5A 2I5IA 4NZ1A 4U10A 1V6TA 4NYUA 3WX7A 2W3ZA 3CL7A 2NLYA 2C79A 4M1BA 4OUIA 4WCJA 2QV5A 1XW8A 4F9JA 2C1IA 2XU2A 1Z7AA 2J13A 3HFTA 3RXZA 4V33A 2C71A 3QBUA 2E67A 4L1GA 4NY2A 3CL8A 2Y8UA 2C1GA 5BU6A 5JMUA
chains in the Genus database with same CATH superfamily
3P80A 2ZOXA 1Y5WA 3MUXA 3O16A 3VNMA 1QWGA 2WPGA 3OBKA 1W8GA 2XIOA 2J7GA 1YKWA 2CLIA 3DKJA 1XRVA 3ABRA 3AWOA 3CQKA 2E1WA 3QM3A 3G6MA 4MZ8A 1PZ2A 3TTOA 2E6YA 3T2OA 2CKRA 5DXXA 1SJCA 3PPGA 1JUBA 2Y6ZA 1V0LA 1WX0A 2DH2A 1C7SA 2FLIA 3FAXA 4ZGYA 5KEZA 1RH9A 1XINA 3ZLGA 3S2LA 3WD0A 3MU7A 4AEEA 3GTXA 1QASA 4XG1A 4ZQPA 3REQA 4PFMA 1O5KA 1NJJA 5GNXA 3FA4A 1F7BA 4HCHA 4PSRA 1KQZA 3U5UA 3K2GA 4RDZA 3NZRA 4V33A 1QHZA 4JEQA 3GDRA 3NSMA 4D6EA 1XH0A 2HBVA 3XINA 3WQDA 4O8RA 3UWZA 4GY7A 1UZ4A 1LTDA 2BVWA 3UWVA 3TZFA 4FX7A 2OEJA 1O1ZA 3DESA 3IV3A 2XIBA 3LHZA 1EXBA 3KOYA 3C4UA 1UZHA 2R9RA 3N6QA 5DRCA 1GHSA 1XSKA 4MY9A 4G5DA 4DY1A 3STCA 1EOKA 4TTUA 3UEQA 4U33A 4FNRA 3BAYA 4NZFA 3ARTA 1EC9A 3WDRA 1J79A 4V15A 4JZ5A 4AX6A 4DPQA 3VE7A 4NUWA 1W9UA 3PBMA 4RZ5A 4KFNA 2WQPA 1H0GA 1IXQA 3UU0A 4GGHA 2VFFA 1AQFA 2GK1A 2OFJA 2OWWA 4L80A 1BD0A 4Q4RA 1EL3A 3GTFA 2PGRA 3AMKA 3UCQA 4Q3MA 1E0WA 2BFGA 3VD5A 4LS1A 3KZSA 3GE7A 3QC3A 2V81A 4QRNA 5TD4A 2W3ZA 1R5YA 3EPMA 4EXAA 1GVIA 2TMDA 4UTJA 5BROA 3P7YA 1CGTA 1UP0A 1EP1A 1FWNA 1T5AA 1UWAA 3M4HA 4YTUA 5XINA 3TUUA 1TCDA 3SN1A 1PL9A 4KMQA 1AVAA 1PX4A 4HJFA 1WXJA 5CQ1A 4GYJA 3ITYA 1FWSA 1OBAA 4Y6GA 3PFRA 1YXCA 1T8QA 1AQ0A 3CAQA 3MVTA 4NX0A 4DXVA 2VZTA 3DEQA 3UG3A 4NAFA 2CXEA 2IXVA 4F0RA 3RM9A 3W71A 2P0IA 5AVNA 1LBMA 1G69A 1K9FA 5BMWA 3W2KA 2J74A 1ONRA 4BA0A 1L2QA 2Z28A 3C2VA 1WKFA 1M65A 4H41A 2ZXBA 1YBQA 4XD4A 2V5CA 4LBRA 4LV9A 2VEMA 3N9RA 4UUIA 4XIAA 1Y65A 3NDZA 1REQB 2PBGA 4HA1A 2NQ5A 1W3NA 3W4RA 5LA2A 4RE3A 4ASTA 3AMDA 2IKJA 5LIWX 3N12A 3GUWA 1WPCA 1UOZA 3SY8A 4BEUA 5CSYA 2WM1A 1BEUA 3P3BA 1T99A 4B5TA 4G1KA 1JZ7A 1EJTC 1XV8A 2OO6A 3V16A 1EC8A 4RE4A 4D6CA 4U31A 4Z1DA 3PUGA 5K9DA 2WSPA 1V02A 5LIYX 1XH1A 1ZP4A 3MMDA 1EH9A 1RQBA 2PF0A 1L8PA 3KFTA 3I7QA 3B0PA 4QX4A 1QHOA 3RMJA 1H50A 4ZO7A 1KCXA 2PLCA 3PZMA 3TV8A 4B5XA 5E6YA 4UR8A 2E8YA 3HFYA 3NSNA 2VKZG 2G4FA 1CGXA 1E71M 3WSUA 4JEJA 4MKSA 2DQWA 2HSAA 2CYGA 4R34A 3VMPA 5I3HA 5I3DA 4KBXA 2WMIA 3W07A 4LUTA 3UJFA 2W4XA 4BWLA 4OFCA 3DECA 1UUMA 3OLGA 2VYOA 3VPLA 1YE4A 3JZEA 4L6OA 4QDPA 3CUHA 4HGXA 3AUOA 3SUWA 3ZT7A 1KLZA 4B5VA 1OYBA 1ZAIA 1LT7A 3EXRA 3HU7A 5I00A 3MCMA 1GJPA 3QY6A 4H2HA 1P0NA 4IGMA 5FJRA 3LV5A 8XIAA 3B9DA 1F2JA 1PIFA 3VNZA 4IPJA 6ENLA 5K7JA 4AU0A 4HB7A 2VDGA 4NZ5A 5L6UA 4UQCA 5G2WA 1NDWA 2C1IA 4B5SA 2A0NA 1RQEA 3TH6A 4HZMA 1YPXA 4MDOA 1KBLA 3R4IA 3WLQA 3IACA 3QLLA 1UMLA 3T8QA 2EGZA 2CLKA 3HPSA 3H70A 3I6EA 3VIOA 4KWWA 1X7FA 1UKOA 4P5UA 3EOSA 1WAUA 2C13A 5CZ0A 2O7SA 1E0UA 3G1YA 3AOFA 4G7EA 1DQUA 2WC7A 4KRTA 2Z6IA 5A6BA 3MCNA 4GC3A 2YJQA 5DBUA 5T9BG 3WK3A 3EXTA 1F4AA 4JY8A 4DAIA 3CT2A 5KZEA 4IFKA 3TC6A 1UD3A 1Z8AA 2PDWA 2ZCGA 3DG3A 2J9XA 4H9TA 5CXPA 3QV8A 3WLKX 3CQHA 3CEUA 5E9AA 3KCJA 3VXGA 2GZXA 1KTNA 3TAKA 2OJPA 3FV9A 2G3FA 3QR3A 4FLOA 5EA9A 1JYNA 3IVSA 3ECQA 2ISWA 1B3VA 9CGTA 4B92A 4DELA 4DZAA 2YSWA 2J6XA 4L9XA 3EWWA 4W7WA 3ARRA 2OODA 3PM6A 3HBLA 3DKLA 1TPUA 3DG7A 4WGHA 2C1HA 1TJPA 4DWSB 1TMLA 4AZ5A 1TTQA 1CZ1A 1KTBA 4F66A 3FY1A 3ZWSA 4XUYA 3TLLA 1BHGA 1I2RA 3ELFA 1Q7ZA 3EWXA 4U10A 4W7UA 1SUXA 3TC3A 4MNJA 1VZWA 2NUYA 4MLRA 1UD4A 1MUWA 1W2VA 5JIWA 1EQPA 1QXLA 4UQDA 3OIXA 5BXRA 2XVKA 3K8KA 4EE9A 3QH2A 1AJZA 2VD9A 2FPVA 4RCXA 4EVZA 3VD9A 4KRUA 2C6QA 2JKAA 4ATDA 2MNRA 3MBFA 4GH1A 4JQ1A 2ZZ1A 4ALDA 4J3VA 1FHDA 3HOJA 5AC5A 1ZJAA 1JI2A 1XWYA 3F2DA 3DHUA 1K1DA 3L0NA 4JNMA 3A5VA 1ZAJA 4I5RA 2FH6A 1XP3A 5AC4A 1FWBC 1XJBA 1EKOA 2PWFA 4D8AA 2XVGA 1I75A 4RDVA 3S5OA 3HJZA 2QDEA 4DBEA 2D22A 1CCWB 1AMYA 4XD5A 3MUIA 3D3FA 2G4JA 2YCEA 1VYSX 5IFTA 4NAFB 3EMCA 3L4UA 3FHAA 3BDKA 1Q3NA 1SR9A 1SJBA 2CIPA 1XYMA 4XAGA 4RNJA 3UR2A 4RKAA 4XZ9A 1WKYA 1KRCC 4DZHA 4HMEA 3ABXA 4LUIA 2DSWA 2BVDA 2GVGA 2VP8A 1T40A 3ZXWA 3L4ZA 4UFJA 4IFKB 1SSDA 4UOJA 4Y90A 2ZZ2A 4S3KA 3CH9A 2E6AA 5AZ0A 3O8AA 1O5XA 1B9ZA 3ONCA 1P0KA 3IUHA 5TQLA 2W63A 2D2HA 3LMYA 3ABZA 1QPNA 1EF2A 1AD4A 4NYYA 4M19A 3SAZA 1XYZA 1DP0A 1HKJA 3R10A 2J7BA 7A3HA 3LLFA 3RLVA 1IT0A 4XZNX 4P61A 4FOUA 3LY0A 5AC6A 1TA3A 3OZYA 4XZHA 1VAHA 3NPUA 3Q2DA 3F7JA 2FZBA 1QK0A 3W85A 5CH9A 2TSYA 1QNRA 4TV6A 1Z44A 3VX1A 1WAWA 4ENLA 2C8NA 3II1A 4U5KA 1H61A 4HTBA 1GJUA 4RNHA 4AIUA 1N2VA 4N9CA 1EO7A 3A12A 1V0MA 3SCNA 5BOFA 6XIAA 3CZLA 1OB0A 3WFZA 4S39A 2QCNA 3PTKA 2JGYA 1KM4A 2NQLA 5ABFB 4Q7BA 2QJGA 3M41A 1AL7A 1M1BA 3H2CA 3FGCB 4FIQA 2DGAA 4PUDA 1YE6A 4XAYA 1V02E 2GSEA 3EDFA 3SRKA 4MB5A 3F5JA 5EY5A 2PDCA 4JFWA 3IAQA 3A3HA 3NWRA 3IGUA 2Y63A 4XZIA 1M7XA 4GUHA 3TROA 1J5TA 4EX4A 1XXXA 3COTA 4G2DA 3WL1A 5CBIA 3GDLA 1HJVA 3LXCA 1LBLA 3A47A 4H00A 4IL2A 4CN4A 3DBPA 4M6PA 1V0KA 3ARUA 1R7OA 3FIGA 4HQVA 3F4DA 1MO0A 4QR6A 4DO6A 1GNXA 1OYAA 3STPA 4D6HA 3RJYA 5HR7A 4NASA 3SUTA 1F3EA 3QRHA 4UNIA 3NQAA 5M03A 1RA5A 3QMRA 2QPSA 2MANA 4NNAA 3WEMA 1BLIA 2XHYA 5HA7A 3KBWA 4PMRA 2C18A 1RLCL 4IUGA 4C6FA 4AHQA 3CHEA 5C9XA 1K02A 3G8EA 3N19B 1UR9A 4NNBA 3G5EA 3VMNA 2C3ZA 3FCPA 3NQMA 2GGIA 3DAQA 3HB9A 1KGUA 4C6JA 1FUYA 3MWCA 4K8EA 1HKMA 4JXCA 2QCHA 3CAWA 2GUBA 3FA3A 5I03A 3M1ZA 2OQHA 3RX2A 3PAOA 4K1GA 1V6TA 4PCSA 3QSTA 3KEHA 4WK9A 3GNOA 4U4MA 1GYNA 1O4UA 5LXEA 1P5BA 2JFEX 1LWIA 4JTTA 4S3EA 3N73A 3IS4A 2WO5A 1R86A 4Q8MA 3E5BA 3N29A 3WDQA 1S2VA 1J01A 1V03A 3LMZA 1A5MC 3FYPA 2WSYA 1UJQA 4LC6A 3S4TA 5A95A 4ZODA 1Q63A 4IPLA 2GJNA 1I1XA 3Q58A 2HNEA 4IIEA 3HV9A 2PDNA 2WWDA 2R94A 1PKMA 4A21A 2WBKA 2VM8A 4YHEA 1O1HA 5DRIA 3V18A 3FHQA 1O5QA 3QF0A 4AXNA 3OIHA 3CZKA 2IPWA 1AZ2A 1VFSA 4R7OA 3CUIA 1Q6FA 2DU2A 1QK2A 3PY2A 3SY1A 4D9PA 1G7VA 3WLPA 3KRZA 3OO2A 4N9BA 4GPNA 2ZX7A 4JAWA 1H7XA 3L2LA 1V3KA 1WZMA 4ATWA 2ZXAA 5LNRA 3IIPA 4KEMA 4V1XA 4R9XA 1R46A 2HVNA 3OTRA 2QCLA 2X0YA 3EB4A 5JVLA 2F84A 3B0VC 2QAFA 5I07A 1XBXA 1W2PA 1A5CA 3BQ6A 1EO5A 5AYZA 4LH8A 4H9ZA 3S1WA 1MEWA 4Z42C 3MHFA 1FHLA 3QSRA 1FWCC 1T41A 4AZHA 4UTHA 4GUGA 5T91A 3QQ0A 4HPXA 1PEZA 4F0SA 3I10A 1EB3A 4PTXA 5DT7A 5FEZA 4RPQA 1VFUA 4B9YA 3LRLA 4AXKA 2IPJA 1LRTA 3TN5A 4Q8QA 4X22A 1SO6A 4AWSA 1XLGA 4O1EA 3R58A 1QI0A 4E8GA 3LBMA 3BURA 3I65A 2AQVA 3QR0A 4Q4MA 4ZO6A 1HKIA 4A3YA 4C6MA 4HU4A 1TPEA 2I9EA 1H1NA 2FVKA 4DO7A 4P8UA 5C7VA 3RF9A 2XVNA 3J7HA 3JRKA 2QPUA 1TWZA 1C3FA 1CXHA 3KCLA 3MT1A 3TJLA 4QAIA 1CTNA 1E51A 3SEPA 2E9MA 1OM0A 4EPEC 3UNTA 2HJPA 1UOKA 4GO8A 3PTQA 4AHPA 1BVWA 4NU7A 4MJ4A 2P10A 2PWUA 2DIJA 1YXDA 1BF2A 4B91A 2E40A 4BI6A 3O6YX 4L61A 3M43A 4N9DA 4QE5A 1OX4A 4GZEA 2BVYA 2XWDA 3V1HA 3B8IA 5EBAA 1XYLA 4FNPA 2V8ZA 3N4FA 1V4YA 1E1EA 1SFLA 1YYAA 3SI9A 3AIWA 4H7ZA 3GD6A 3DCPA 2E25A 3M07A 1LBFA 2CBIA 3NQGA 2E28A 3KRBA 4DJEA 3GTIA 1XQKA 3VNJA 4Z2JA 1CW2A 3Q67A 4BK9A 3W86A 4W85A 4IXHA 2CLMA 4ZZ9A 3E9AA 1W54A 1TTIA 2Y7GA 2DPEA 5FF0A 2RDXA 2EEXA 2WLYA 4N4PA 4MYXA 3TWBA 3THDA 4QLKA 2VOMA 4NJJA 6XIMA 1N8IA 1LQAA 3S6TA 3WCZA 4Z1YA 2CLHA 2QIWA 3THUA 2NWSA 3KS5A 3O63A 3FEQA 1JRBA 3CUXA 3UR7A 3R12A 2VR4A 3FEMA 2FJKA 3UR8A 2ZWYA 1F8MA 1Q66A 2B0MA 1ZBVA 3M6YA 3KLKA 2CLPA 3MDUA 3D47A 4TMBA 3C2EA 4K8HA 4QJ4B 1XGZA 1P0EA 4NG3A 1R87A 3MANA 4CD7A 3RO6A 3M5XA 1ZBCA 2JGQA 2BHUA 3L4TA 1EX5A 4CEUC 1NDVA 2JEQA 3BQ5A 3H26A 4PMQA 3UYCA 2ACUA 4DJED 4CUCA 3A64A 1WUEA 3C0LA 1R3WA 3AS3A 5CJNA 3T42A 4GY1A 1C8XA 3CASA 1OGGA 2F2KA 4JYFA 3AXXA 2E09A 3RR1A 4DN1A 1RK6A 2XGZA 3PPHA 1QTWA 2HRWA 1XBYA 2E5BA 4A3HA 4Y9AA 3UG4A 1NWSA 3AZSA 4MAVA 1JIBA 4ZE5A 1W1B1 5HPOA 3VTRA 3HTWA 3LPPA 3GBEA 3WH5A 4F4RA 3RM8A 1HVXA 4M6QA 3PTDA 2NX9A 4DO5A 1OADA 3TDFA 2ZRYA 4IGNA 4YHGA 3P5ZA 1UD5A 2OR2A 3NQCA 2GJPA 2BX7A 4AIEA 5F4SA 1V3LA 1UIPA 3OGRA 4OBSA 2PDBA 2CERA 3K1GA 2XWEA 1TJ1A 4X2PA 3PZIA 3CIVA 3SIZA 1RPXA 1R0MA 2PDPA 4RDWA 4B4FA 3O07A 5C9WA 4CVWA 4ZOAA 1LJYA 3QKEA 3TN4A 3AS1A 1MEIA 3CQJA 1C29A 1NP0A 3GFXA 1Y8BA 1E9IA 4AD3A 3WJZA 4B3ZA 3IK2A 3WQOA 1UWQA 1YRRA 3BGJA 1W3HA 3BJTA 4M0XA 1L6WA 2D0GA 3USZA 1R2RA 4P7QA 3W7JA 1LL4A 5BXPA 5FL1A 2FB3A 2FZ8A 3W84A 3FVDA 4AZCB 3A4JA 1LL6A 3DUGA 3P67A 1E6PA 3MUY1 3BG3A 3GU1A 3LCLA 4JTCA 2VHLA 3HG5A 5EGRA 1LWJA 3S8HA 2YXGA 4XSLA 1EZ2A 3ZSTA 4E8DA 3NQ2A 1MRQA 5HINA 4C7GA 1SMAA 2V5KA 3AIQA 4Z2KA 1KRAC 3WQ5A 3EWBX 4R33A 3MHUA 1F9CA 2BOGX 3P60A 4HHMA 5BOOA 4MADA 1KRMA 4NRRA 5DXYA 4AZCA 1J0KA 3TAOA 5E0CA 4OHQA 1GORA 2OELA 2WANA 4M81A 2R1MA 3LOTA 3PB2A 4GISA 2GDVA 4PB4A 1ICPA 2SFPA 1PZ3A 1Z42A 3KDOA 3AROA 5ABFA 3A24A 4RLIA 2VVNA 4LCSA 4Q7IA 2WMGA 2J7CA 4IG2A 3N11A 4M1RA 4N9EA 2VOTA 2QAPA 4MNKA 5BZAA 2YDRA 3UD6A 2V3FA 2PWGA 3LN3A 2YLLA 3VKJA 3CPGA 2YW3A 1IV8A 4Q8NA 4JCMA 4ZCWA 1WDQA 2LLEA 2C15A 4CVUA 3TN3A 3PG9A 4YWSA 4P8WA 2Y8VA 2QMKA 1QI5A 3WH6A 2Q02A 3D5HA 2PI6A 3LV6A 2D3NA 1TPB1 5PTDA 2G97A 4O11A 4DM1A 3PBWA 2PURA 3BW4A 1Q5MA 5BWFA 4BI7A 5FJIA 5A94A 1C8QA 3OGSA 3DHPA 2INZA 4A8RA 1TWDA 2ATMA 4HHHA 2PSNA 1JPMA 4I9JA 1BGGA 1CGUA 3BTNA 1HJUA 3R94A 3AMCA 1GW9A 3KTSA 5I23A 4NJIA 3SQMA 1J93A 2OWCA 1F61A 4UIOA 5DMLA 2FGLA 4IMCA 3VIJA 1UKSA 3SJNA 3GTNA 3W28A 4GJ1A 2X30A 1Z48A 2ZFAA 4KEZA 4N0RA 3H21A 1FWFC 5CPNA 1US0A 2I5IA 3GG7A 5FI8A 3TYAA 1JG9A 5A6TC 3NGFA 3R43A 1A5KC 4I7VA 1E40A 3UA3A 2R1KA 1K3UA 4Y96A 1VBHA 4IIHA 2PWEA 4CQ9A 8XIMA 2FMNA 4RE0A 1W3LA 5A8NA 2Z2AA 1JPKA 1CLXA 4DLMA 4UTFA 1FWEC 3TQKA 4IGHA 1HL9A 1A80A 4AMAA 1P0BA 1A3HA 4OTKA 4EWND 4E4PA 2HVMA 5JUVA 1EIBA 4K68A 4IOTA 4CU6A 3BJFA 1XCXA 2BY0A 3BGGA 4GYPA 3W7CA 1A5LC 1IE7C 1SQ7A 3O05A 2ACQA 5IDZA 1V6VA 4AC1X 4XIMA 3BAWA 4XVDA 3BAIA 2NSXA 1NU5A 3KBNA 1MQRA 2UV8G 1GVFA 2P53A 3M0JA 4W8LA 2J4GA 3GVQA 3B04A 3PNUA 2GLKA 1XISA 2YDQA 3F4NA 5FF3A 1XKYA 4H6QA 2KAUC 1Q4WA 1VIWA 5FF7A 1FCUA 3D6NA 3UCDA 1XD1A 4O19A 4C5ZA 1PTGA 4GG9A 1ZGDA 2OSYA 4HYRA 1TRIA 3VABA 1JGIA 4W93A 4GUJA 1JYVA 1ME7A 4Y9PA 4MKVA 1D3GA 3BUVA 1HN1A 3CAVA 2O56A 3M16A 3BLIA 4XUGA 3CYJA 1W1IE 1JCYA 1EIXA 4D1IA 2E5DA 2QPXA 4DZIA 1TPWA 3W7PA 4XAFA 5DMMA 4IM4A 3PS7A 3GX9A 1YQ2A 3A3WA 3SCUA 1WZAA 3F5LA 1CX9A 2VFEA 4LBUA 4O4VA 3N9KA 4J2PA 3LNPA 3AU6A 3FLUA 3L4WA 2VCAA 4PUEA 1F4HA 3WDHA 3UJEA 3XISA 3S42A 3EBVA 1MI3A 2DZAA 5ABEA 3VIHA 2YBUA 1QT1A 2ZUMA 3IUDA 5AYYA 2E5CA 1D7KA 3U6WA 2VX4A 4GZJA 3QFEA 4U5IA 1E9YB 2YOCA 1PKNA 2ZIDA 1C9DA 1DJNA 1KC7A 2RAGA 4ZQMA 2NVCA 3WH8A 4FNUA 1N82A 5GNZA 1BRLA 3C2RA 4AH7A 2YXOA 4JTJA 1ISZA 5E1QA 5MKGA 2YXXA 3ITTA 3TYEA 4HSOA 1PPIA 2NLIA 1OCQA 5FAJA 2F9RA 1HF6A 1PDZA 4GLEA 2Y24A 3U48A 4IMAA 3KE0A 3WEOA 3W81A 3VNDA 3WQCA 1CGYA 3L4XA 2R1LA 2VJXA 4OUEA 3KUMA 3NQFA 3F4VA 2O4MA 2DQXA 1KFWA 2CKSA 3W2MA 4HU8A 3M0YA 3WBYA 2VFDA 4UFKA 2EPLX 4CCEA 3E2VA 2ACSA 3F4WA 4MWAC 4YWIA 4O28A 3WQEA 3VILA 3GB6A 4HKPA 1L6FA 3ABOA 4QLLA 3GZ3A 5CC5A 1W31A 1NM9A 2IQDA 2ZZ3A 3BPWA 1KXQA 4E3TA 1SVDA 3DDMA 3QKZA 2GOUA 4ZL1A 2QV4A 2I9UA 3C2FA 2REQB 3AIRA 2WVSA 1R3VA 2WZTA 1VCGA 3PAJA 4TTGA 4C1NA 3P82A 3C6CA 5CZKA 3W1MA 1CXLA 4JNYA 1CECA 2VR5A 3H54A 3ZLHA 3S5SA 3T55A 3CB8A 5CG0A 4ZXLA 4LY8A 1NFBA 2GQAA 1PX3A 1G01A 1MQPA 2PUZA 4PRRA 3T09A 4OWGA 4OUIA 3NL3A 2YDSA 1YMYA 4Q8PA 4QISA 5A8GA 5F2LA 3WD3A 3KP0A 3I7RA 3ITGA 5C70A 4WOZA 4ZQOA 2UBPC 3HV8A 2ZRZA 3IIXA 3PUEA 3O6DA 5F4XA 4CNTA 2NSOA 5F2IA 3WJXA 4ZB5A 1PKLA 4JGDA 4CNOA 2FHCA 1FRBA 8RUCA 1EZWA 4FXRA 5FD0A 4BJHA 3LPOA 2J9ZA 5D02A 1TV8A 4FOJA 1ZUAX 4PTWA 3EPNA 3W6LA 4J3TA 3U5YA 4WXZA 1C8YA 2AQWA 3VA8A 2BXYA 1TE6A 4WEVX 3ZFHA 3UGVA 3WNPA 1SFSA 4W7VA 4Y9NA 4NZCA 2BS9A 4EAMA 2X1IA 1OQFA 3GH7A 3ANYA 1Y5VA 1W1TA 4YN5A 2GJXA 2CBVA 4DBWA 1QI4A 3B0XA 4BHYA 3I3DA 1W3TA 3GLCA 4CCDA 4DEFA 2FFCA 4PBFA 4U2YA 3G1DA 1EP2A 4JICA 1ADDA 2VC7A 1VENA 3IRSA 4AG0A 4I8YA 3GRIA 3W88A 6PTDA 5DN1A 1X1NA 4IHCA 2IXUA 1JAEA 4WDXA 4CGTA 1ZL1A 4AFYA 3IVTA 3CMGA 2AKZA 1J5SA 3L5LA 1P0DA 3B4YA 5K9CA 1W37A 2OWXA 1VLWA 4LCRA 5AN7A 3LDVA 1R9YA 2E7FA 2BG5A 1UKPA 2GOKA 4GXWA 5BXSA 1T8XA 2PTWA 3QVQA 1AG1O 3HZ3A 3GKAA 1MDRA 2HK1A 2BB0A 3V5FA 1W9XA 3RK8A 4GXPA 2BVTA 4JBRA 4NI8A 2ZRWA 2DZXA 3W2NA 1DKWA 1E5JA 1EYEA 3JS3A 1MRAA 2NVAA 1H11A 1VFOA 1N8FA 1E6NA 2E9LA 3PG8A 3EDKA 4WRHA 3N04A 4AX7A 1B4KA 2RFGA 3GH5A 3E3HA 4CCCA 1LRNA 3CBWA 1SO5A 3AYSA 3EKLA 2O0TA 3H23A 1S39A 4HMNA 2QCCA 3CMFA 2BTMA 1UHVA 3U9IA 3EDEA 2R1PA 1I2PA 2J7DA 3SRDA 2QKFA 1VBUA 3OBAA 1BXCA 3RM4A 3W25A 4ZB0A 3K13A 1UB3A 2ZZ6A 3MZNA 4MZ1A 1WYIA 1GVQA 2V38A 4IJCA 3WQ8A 3AHXA 4AYGA 1LDCA 3DIPA 1U30A 3CHFA 2NQHA 1PCWA 3B9NA 4JD4A 4UFLA 1QATA 1V8EA 3CB3A 3IGSA 1QDSA 4B90A 3VDBA 4FX8A 1LOQA 5G4HC 3ITOA 3IJQA 1IR2A 1XDJA 8A3HA 5HQMA 1J18A 4N2YA 1SU5A 3UR5A 3DERA 1CGVA 4UC5A 1HKWA 3Q45A 1PZ1A 3BW3A 3GSMA 4Q4SA 4NZ3A 2VC6A 4TOQA 1IIHA 3NVDA 4LUSA 4JQ4A 4A3UA 3WEZA 5HJXA 5D9NA 1S5VA 2OX1A 4LF1A 3FJNA 1VRDA 3OVPA 3EWZA 3DHDA 4GE8A 1EFZA 1PAMA 2YGYA 3UPWA 4AEOA 3TYDA 1VD6A 2QUVA 3AIUA 2A6NA 3G18A 2CLFA 2WZMA 4PC8A 5CPTA 4IIBA 1QW7A 3R2GA 3TCEA 2OSXA 3TONA 3W9ZA 2PDGA 1LZOA 4S2CA 3VNIA 2PGFA 4TX6A 4GVHA 1ZCOA 1XH2A 2DIEA 2E4TA 2BODX 4ROQA 4PMUA 4GVFA 5A2BA 4DNHA 1UASA 5AECA 3CLMA 1OFPA 3NUKA 2WJEA 5LIKX 3B0UX 3AZTA 1KBJA 4DO4A 1FA2A 3FSUA 5LA0A 4WGXA 1X1OA 4UWMA 2Q01A 2QQ6A 1V0NA 5AHLA 5FF2A 3TEVA 1CB2A 3WUFA 1A50A 4A05A 1AW5A 3TNOA 2PDKA 4YTQA 4UQBA 4LU0A 3MI3A 1FH7A 3EA3A 3VDHA 4FK9A 3RHGA 4A3QA 1EDGA 3FGCA 1QOXA 2DP3A 2ZTKA 1ITCA 1P6BA 5HWNA 5XIAA 4OJYA 4ZOEA 2G3NA 4FPSA 1EGMA 2ANUA 4G9PA 4CU8A 5JBEA 3CV6A 1E72M 2D73A 3CWOX 5FL0A 2R91A 4C6OA 4EWJA 1EF3A 3FSTA 4BQ4A 2C79A 4KGLA 1BQGA 3SR7A 1XW8A 1Z89A 4XBJA 1PV8A 2NWRA 1P6CA 4PTVA 3W7HA 1OC6A 5G1YA 3RRAA 3VUPA 1NF0A 1QNVA 3I4EA 3LM7A 1OFDA 1ALDA 1M01A 5AYIA 4NJHA 1GOIA 1XLBA 5HQLA 3HG4A 3HGSA 4MF4A 4PTDA 4XO7A 1VBGA 3WUEA 4Z08A 1PO9A 4IMFA 4PMNA 3CWHA 2X42A 3GDTA 3NDYA 2HNHA 1VC4A 1LUCB 2H9AA 5M5DA 2OLHA 1C93A 1E4NA 2NUWA 1XFBA 3PUOA 4O52A 1UKTA 4GXMA 4CCZA 1B3ZA 4F3HA 3K1DA 2GYIA 4EF8A 2VFIA 4IIFA 4I6KA 3BOLA 3MCOA 2NQ9A 3LZ5A 1W6TA 3OHIA 3ZT6A 4MGGA 3W7MA 1XICA 5CBJA 1E3XA 3DYPA 1S3HA 3B9OA 3FXYA 3VKCA 3LU2A 2FKPA 1DXEA 1J0ZA 4LNYA 3E38A 1WXYA 2ZICA 2YW4A 3A6OA 2PDFA 1QR7A 1KFBA 3WQGA 1GVRA 4JHMA 3PBYA 3Q37A 5D2XA 7REQA 1OFQA 1VH7A 1KFCA 5DEZA 4PN2A 4B5NA 1UH4A 3QC0A 1QW9A 4WY0F 3ANUA 4PR4A 3QW4B 1AW2A 1OT2A 2QJIA 3NAVA 4L6DA 3SY5A 1UWUA 4LUTB 7ODCA 2HPMA 3A9IA 4ACYA 1J0JA 1QNQA 4TX9A 4JYEA 3BG5A 3L23A 1E1CB 1GVYA 5REQA 5H1WA 1QPQA 2QUTA 1TV2A 1JCLA 4GQ0A 4ZVJA 2GJLA 1FOBA 4TO8A 1GVEA 4A22A 3A21A 1JZ3A 3URNA 2AGKA 1Q85A 5KTLA 3O06A 5D2VA 4LPCA 3BLEA 4O13A 1C7TA 3IJLA 4OIFA 5LNSA 2CETA 4YL2A 1B31A 3DGBA 4GD0A 4PB5A 3TMQA 2ZDRA 3N2MA 4US5A 5CZSA 2RDTA 4IT1A 1ONWA 4CLMA 3FXGA 1WDPA 1TX2A 1BYCA 2A1YA 4LVGA 1U5HA 1SGJA 2VGFA 5T9CE 1XC6A 3LK6A 1VYPX 3TP4A 5JBDA 4I6VA 3EX1A 4W4QA 1E6ZA 5CKSA 3THCA 3EA2A 1UR3M 2XSXA 4AHOA 4S3GA 1ODUA 1ZALA 2OVLA 1NVMA 4L4OA 3MW7A 1GQNA 1OFBA 1JZ2A 2XSAA 3HFTA 3WQ4A 4HVXA 4XX6A 1LT8A 4U28A 3EDJA 1EGVA 1MYRA 3ZM8A 2XN0A 3GO2A 3NL5A 2BV9A 4ES4A 2Z7GA 1SZGA 2XN2A 4L4LA 2DW7A 3L5AA 3ZVHB 2ZUVA 4ZSUA 4HA3A 1U83A 1KGXA 5HULA 3WNLA 4GKTA 3E0VA 5H8UA 3WLTA 3ITVA 3TW9A 2Z29A 3T8LA 4EOUA 2OZ0A 1AW1A 5BCAA 1QPOA 3P14A 2XINA 1W17A 4BEQA 4QP0A 5DELA 1NARA 5AB3A 3CT7A 5G4EA 2IQTA 4UFIA 1UQYA 1W1A1 1DL3A 1LQ0A 3GXDA 4HMDA 4XKMA 5HAOA 3WD1A 8TIMA 3CUZA 2FTPA 3N25A 1IWAA 1OX6A 3KOXA 4YVPA 2YL9A 2PDQA 5U4NA 4FLQA 1J10A 3NZ1A 5E0FA 1XLEA 4O1BA 4HD5A 3PUDA 1B54A 3VZZA 3H7VA 4E8CA 4JHOA 5TF0A 3TX9A 1XLJA 2WM0A 3KVKA 3W02A 4LUJA 3TKFA 3WBXA 1ICSA 1ME8A 4WKAA 3S1UA 2QMJA 3FA5A 2YCKX 1YADA 3EWYA 1OWQA 4MIMA 1J0YA 2WMIB 2VRKA 5CJ5A 3T0AA 2Y7FA 4UB9A 3DFNA 1N7KA 3S5ZA 4P7OA 3OA3A 3HMJG 3RUBL 3FS2A 4MMWA 2A7PA 3RNDA 2NV1A 3KL0A 3OGVA 1KTCA 5JH1A 4GUIA 4PODA 4LEFA 3ZMRA 5E9XA 2CLLA 4E4UA 2AQOA 3UZJA 1OIMA 4K2SA 3EOUA 1SZRA 3PWAA 3GYCA 1A3WA 3C2OA 3CHVA 5CSRA 3KCOA 3ES8A 1OGSA 4PMDA 4KETA 3VIPA 4NNCA 5KMYA 4DWSD 5F1VA 3AMLA 1H51A 2PP0A 4HTYA 2BHYA 1UQZA 2J27A 2ZZ7A 2OZTA 3U2CA 4PCNA 2F38A 3QPEA 1KBBA 4DUWA 2OQYA 5HMSA 1V6WA 1DORA 4WF7A 2BZNA 4ZTXA 2WNZA 3QLDA 2OU4A 3WJYA 2GPTA 3BCDA 4WSJA 1LL7A 1JDCA 4BWLC 3AHVA 4H6KA 3QGKC 2XIMA 2EG8A 4JIRA 4KERA 4F2BA 4GY0A 3CZ8A 4ERIA 4PB3A 3B8TA 3DI0A 3VCCA 2P3ZA 4WSHA 5IM51 4UFMA 3L66A 4ML9A 1XUUA 2D2JA 4AW7A 4P7NA 2ON3A 3NXFA 3GU2A 4ICNA 1EA0A 4LGXA 3BVJA 3KOWA 3N2XA 4K6AA 2BGNE 4FZIA 3BARA 1NOFA 1U1JA 4DF0A 1OIFA 2E9BA 3VKKA 4ZO9A 3SECA 2QCFA 3B3DA 3AHZA 1CENA 1EHAA 4HSNA 2C0HA 1ELSA 4JIEA 4NHVA 2E0PA 4HNCA 3MYOA 3IV8A 1LROA 1ZFJA 4JL2A 3R0KA 3W74A 1L6GA 3K4DA 1J2WA 2WMFA 1ZHAA 4UZSA 3LM3A 4KESA 5I3KA 2BHZA 2VENA 1BAGA 4MUZA 2ABBA 3GXMA 1RBAA 3P81A 4C7FA 2QCDB 1E4IA 4QFUA 2Y85A 3KTCA 2O4QA 5LGZA 1KD0A 1UR2A 3LBCA 3UWWA 4DXXA 1XUZA 2D0HA 2PODA 4C91A 1LF1A 2OQLA 2QJNA 5D4YA 2QF7A 4W89A 4QTGA 1K8ZA 3AO0A 1QNSA 1B0IA 1KV8A 2P0OA 3CO4A 1DJZA 2ACRA 1I45A 1OHLA 4OECA 2ONEA 1E1CA 1E1FA 3WMLA 3GY1A 3CPRA 1GPFA 3CQ0A 3BO9A 2DSUA 2ZA1A 3AXIA 1O12A 1FKXA 3KVJA 3NQDA 4NP7A 1RD6A 3VD7A 2POTA 1MWOA 4V28A 1XYFA 3P5YA 4MY8A 3W82A 1TA3B 2Y0FA 1NWTA 4Q4KA 3GWQA 4ATLA 1XLLA 4HNVA 2HMCA 4S23A 5JU6A 1WDWA 4DNMA 4LWWA 1MZHA 1PWLA 5GJNA 4H04A 2AOSA 3FKRA 5IHSA 4DVOA 5EPDA 4XTDA 1KB3A 4HA0A 5ABGA 4HK7A 1Q8JA 3CV1A 1S5TA 3DX5A 3W73A 4E4FA 1YEYA 1YNPA 1RSCA 5EMYA 4UOZA 3LA4A 4FXFA 4L5ZA 3G3DA 3WENA 3A22A 3MO4A 4S2BA 1B4EA 4FOKA 5JMUA 1Q6RA 2G50A 2YL8A 2HWGA 4JTGA 3V0TA 1EP3A 3OZMA 2Z25A 2DUAA 4WXYA 2P5NA 4Z0JA 4HNUA 1G94A 5J8LA 1XD0A 4Q4PA 5EMMA 3NQVA 4CNNA 2VX5A 2WSKA 2VVSA 3ALFA 3LYEA 3T9PA 1PIGA 4JTKA 1FXPA 2XZ7A 4BF5A 3EWUA 1TTJA 4ZO8A 4MKNA 2OCZA 4KW2A 5I5RA 4PUMA 1KR0A 4AF0A 5TAOA 1DE6A 3DH7A 4F9JA 1TZZA 3AU2A 3VOCA 2BSLA 3POCA 3GNDA 4ZFCA 1VJIA 6TIMA 1B5TA 3IIZA 3EB3A 1PVNA 1UYQA 4REQB 1VIZA 5A6KA 1PB0A 3W6YA 2CFFA 3EWDA 1ZNNA 4I5XA 2X1RA 1FDYA 1BGAA 1WA3A 5LZLA 1G4SA 4IQEA 5HMFA 4TQTA 7REQB 1JPHA 3VYLA 5GVJA 1B3YA 1V08A 2X09A 2GDQA 2GVYA 1J0HA 2PPGA 3O15A 3T6CA 5D30A 2EAWA 9XIAA 1WBJA 3M0XA 3H6OA 3LRMA 3KP1A 2C7FA 2VQUA 1DIKA 3ANVA 1H2JA 1ZBKA 1X39A 5EMUA 2WK2A 2A6LA 4TMCA 5C71A 4FLSA 4RX0A 1A0EA 4NZJA 3EZ4A 4M29A 3UXKA 4QDWA 1R2SA 3ONBA 3G1RA 2ABAA 1J6OA 4GBUA 1Q8AA 4M8UA 4ZBCA 2IQ0A 4BY3A 4GO9A 2V3GA 4I90A 3CO8A 5A5WA 4LTSA 4EIVA 1MUMA 1KNWA 1Q7MA 1YLVA 3AAMA 3IJ7A 3EGJA 1N8WA 4AZ7A 2TRSA 3VU2A 2XGBA 4L9YA 1I1WA 4U3AA 3PJUA 3M0LA 3NA8A 1HJWA 4WD0A 1Q6LA 3STFA 3WLLA 1REQA 1XKJA 4QJ3B 3QN3A 4A2SA 3QBUA 1POKA 1MQQA 1TVLA 5LXXA 2BP1A 1YDVA 4JQ3A 4LRSA 4KF1A 3VK5A 5E0KA 1BYBA 2VELA 4Z1AA 3GXTA 3MP5A 3ZO9A 3WBEA 4O54A 1JCJA 4HYVA 1XIIA 3LSCA 2XYLA 3WD4A 4KCVA 4IP7A 5U7SA 3NQBA 1QI2A 4GH3A 1JPDX 1OCNA 3TZNA 1EJSC 1HTIA 3N4EA 1S2TA 2GWNA 2W79A 2VWTA 1A5AA 1BF6A 3RCMA 4O0ZA 1G5AA 1RLDA 3DFYA 2GJRA 4QS5A 3ATYA 1UA3A 4HCDA 4CNPA 1ZRQA 3KWXA 2QJJA 4JIIX 3C0JA 1GKRA 2QNEA 1MW0A 1XIGA 3SQLA 2VQTA 1E5NA 4M82A 1ML1A 3GTHA 1CGWA 4GJJA 4J3XA 1KCZA 3TOPA 1YNYA 3WUGA 1W3JA 3OQ8A 3WF1A 3E2RA 1M68A 5K3VA 1YTEA 4C90A 3VC5A 1ZPTA 3VNKA 5D9OA 2ZVRA 1B30A 2YCLA 3G6LA 4Q4OA 3MUAA 3H2OA 4E38A 4EPKA 3TR9A 1J96A 4S38A 4ONVA 3EOEA 2HQAA 3ARPA 4TV5A 4MSSA 1MXSA 2DZBA 3SRHA 3GS6A 3PWIA 1U1UA 3A4XA 4UOQA 3G1HA 3M44A 5LKYA 5CPLA 2QUUA 3CL7A 4FLRA 4QLJA 4F0KA 2O9OA 3GH4A 2O9RA 2NV2A 1B3OA 4KFOA 3S9IA 4D8LA 3EOLA 4JPGA 3TLQA 3TTYA 3HQPA 4DJFA 4GNKB 2PF8A 4HPHA 2PWVA 2ZWZA 1R8LA 1LG2A 1NQKA 1TJ0A 3B06A 3SCSA 3K5XA 3ZR5A 2WCSA 4AAJA 3TXVA 1M7PA 4IMDA 4LT9A 2VL4A 4HOXA 1C91A 2NXHA 1GKPA 2X1TA 2J9YA 1F73A 4MNMA 3STEA 3W7LA 4ORMA 4OKDA 4X63A 4DWSA 3NOEA 3W2LA 5CPQA 5A6AA 3QXBA 1W1PA 3TW6A 2H90A 1H1YA 4FF7A 2W66A 3KZPA 3FOKA 4AYSA 1GQLA 4GVIA 4FAMA 2AMXA 1GT8A 3ABSA 1Q7QA 5BOEA 1JFHA 2HK0A 3RJXA 2XTKA 3W1RA 5JQ9A 3MDWA 2OKTA 3VIGA 3MJMA 4CQCA 4LVAA 2XH2A 5IXEA 4LC8A 1H7RA 3EWCA 3ZOAA 4IMGA 4KH2A 4DBSA 1L6YA 3B9EA 1LOSA 4J3ZA 3KL5A 5FAGA 3M7SA 3MC5A 1W56A 4JNZA 2Z2BA 4DYJA 3N2TA 4HYWA 1CXKA 4PMVA 3QTPA 2BNJA 2RJHA 4IGSA 4LYKA 4OT7A 2B4GA 2XIQA 5A8MA 1I2QA 3H2FA 1IQ8A 6REQA 1KRBC 3S1XA 3BV4A 4XISA 1P4CA 3UPMA 5HJYA 5IHRA 3T0BA 3H53A 5M1TA 4NT0A 3HF3A 3OBEA 4FEZA 3S47A 1RZMA 2D1ZA 1CLVA 1VLIA 4QNWA 3WMSA 1WOAA 3D3AA 4LYPA 3TVAA 1FH9A 3U57A 3OQEA 2PP1A 1EUNA 7CGTA 4A29A 1JR1A 1V3IA 3NEHA 4P7LA 4HOZA 2CU0A 2CWXA 4ERAA 4YTTA 2G37A 4EKJA 3K46A 1EJWC 2NX1A 3E0FA 3W72A 3UXDA 3IRDA 2IKGA 2J8FA 2DJLA 3UXLA 3BWWA 5HMEA 3GR7A 3HG3A 3AS0A 2YYTA 1VFMA 4B15A 1SYTA 5A3HA 3TCSA 3U8GA 1VJZA 2PRLA 3KW3A 4DF2A 4YVXA 1OX5A 4FR1A 2UY3A 5A6SA 4MVAA 1OINA 4JX4A 1EPXA 2QUMA 3R25A 5I3GA 4PMOA 5G5IA 3WLJA 2QIIA 1D3HA 1IGWA 3JU2A 2ZRXA 3W83A 4PGLA 2YDAA 3BLLA 3E1F1 3GVWA 1KKRA 1JI1A 3EAUA 4W87A 3IJDA 5BNKA 2XU2A 1K6AA 1OT1A 3AICA 3U2ZA 1JXKA 4CD8A 1CB7B 3CPUA 4AY8A 2ZRUA 1R9ZA 3B8SA 1TV4A 2FPTA 4M5PA 3R8GA 1OCJA 3C0SA 5AHEA 3CIWA 4K37A 3LHYA 2CBUA 3ENLA 2DZWA 1S2UA 2QYGA 1DOSA 3KTXA 1X6UA 3RU8X 3NJ3A 1VR6A 4MPKA 4V2XA 3TYUA 2FH8A 3GW3A 4JCLA 3OG3A 1K4HA 2X16A 4XVEA 5DMNA 5LHEA 3SN0A 1JYWA 4EXBA 2CHOA 3AJ7A 3MWAA 3RX3A 1YBQB 3WUBA 1WNOA 2CEQA 4IFOA 4LAMA 4O14A 3N4AA 5DANA 3MQTA 5C7HA 1B57A 2PD5A 3A3XA 3R8HA 3HPAA 5I3IA 1HJSA 1FWHC 3QQ1A 1UP3A 1DHPA 1F8IA 2WVTA 5J5DA 2CCRA 1YPIA 2V2CA 2XFWA 2G95A 2V30A 2CBJA 5FEPA 4JYDA 1R38A 4LQ1A 1PHWA 3EX6A 1M9HA 4L9ZA 5AC7A 2BGQA 4KCTA 1GTHA 5ENLA 2ZQ0A 4N42A 2Y8UA 3NYDA 1HG3A 1RJRA 2Z24A 5FACA 3U7BA 5H91A 5A1AA 4UTWC 1K8XA 4EP8C 1BRLB 3GG1A 2WZHA 2IW0A 2WQDA 1H5YA 3W29A 1BXNA 5A8PA 3S9YA 5CPMA 5G2HA 5XIMA 2JKPA 1ISXA 2OB3A 4IXXA 1S5WA 3LX9A 2A5HA 5CC3A 4QG6A 1GOWA 2PS2A 4GBDA 2FZNA 3I6RA 1THFD 1E73M 4HZ6A 4PBGA 5HXMA 1PYFA 3SW6A 4B2DD 3VX0A 4CEXC 1JCMP 1MMFA 1WDSA 5M2FX 2J8TA 3H24A 1W9DM 1GK8A 4Q8OA 1GHRA 1FFQA 2B7NA 2PCEA 2NV9A 2FZMA 4I9TA 2F6XA 2ZRVA 1W5OA 2WHKA 3RIKA 1D2KA 3NPXA 3TC7A 3QMTA 4O18A 5HNRA 4FNSA 3O1NA 3RG6A 4YCOA 1HO4A 4UTLA 4GK8A 3PZGA 1HZYA 3R0UA 3MYPA 4ZFMA 1IZJA 4XAPA 2JF6A 5HNTA 1EJ7L 3BOXA 4AY1A 4LXFA 3F4CA 1D3CA 2XFRA 4UCGA 2GSHA 1H60A 3D0CA 3GVGA 1AQHA 1DJQA 5HMDA 4IPIA 1XPGA 5DCEA 2KX9A 3TJ4A 1HJQA 4QE4A 1G7UA 4GZIA 4GABA 5CG7A 3QV7A 2XFYA 1JF6A 2GJXB 3NYZA 5FSDC 1C90A 1CEOA 2BY3A 4BFAA 4C6EA 4JR5A 1BTMA 4L1XA 3AWNA 3EOOA 1EJXC 4DM2A 1LLOA 1L8NA 3PBUA 4R88A 3MBDA 1XS2A 4C6LA 2ZX5A 1TUFA 2Q8LA 4HBKA 2Y5JA 4H6EA 3HPZA 3DOPA 1FP9A 2A3AA 3W7OA 4AUBA 4DI8A 1OK6A 5E6ZA 2F6KA 1JD9A 1TREA 1E15A 2YPIA 1E6RA 1I2NA 2QCEA 2QHAA 3DENA 3LXAA 4BQ5A 1P43A 5A69A 1F6KA 1KO0A 4KRZA 3KHJA 4GHRA 1FFRA 3E2QA 5EMLA 1A5UA 4LAZA 5L9FA 1JDEA 2BOEX 5A6BD 5A2CA 3LNMA 3QHNA 3T0DA 5GNYA 4JOMA 2A4AA 3GZAA 5HWMA 2XH7A 1VCFA 2R82A 3KOZA 5CC7A 1VFTA 3G0SA 1XLMA 1VQTA 2PWDA 3CU2A 3BLFA 1KGWA 2V68A 4WDUA 5EKYA 2WKLA 3T0TA 1G1YA 2VNCA 4F79A 1K8CA 3I3EA 4PULA 4PEEA 3T7VA 1AMKA 4K38A 3O3RA 2GVJA 2EO7A 1JULA 2ZBTA 2IPFA 1Q6CA 1QCWA 1ZAHA 2RGLA 5DCDA 5I6SA 3RPDA 2V69A 3WQVA 1K70A 2Q09A 5HBFA 3AFBA 6REQB 4CNUA 2EKCA 5HOSA 1XSJA 3E02A 2DIKA 1A4MA 3U7VA 4N4QA 3N34A 2VI0A 4RW5A 2L5HA 1QI3A 3KWSA 4UNLA 4OZOA 1X7IA 4KWVA 3CL6A 5REQB 3NQ8A 4GQGA 4HSHA 4IH3A 3INPA 2CWNA 4WOQA 5F4WA 3WD2A 4QEHA 1C9WA 3W75A 3WG6A 2YR1A 4H8HA 4GX8A 4MWAB 1OK4A 2ISVA 1T96A 2R14A 3AYRA 1YTDA 4QDMA 4X3ZA 3N18A 4PMYA 3U0HA 2DDXA 3VCRA 4LAUA 3RX4A 4LRTA 4KWOA 3CWNA 2DY3A 1OC5A 3L67A 3BZGA 1AJ0A 1ENUA 2XUCA 2JALA 3W1LA 1VS1A 1Z7AA 4J35A 3WKZA 2D2GA 3QOMA 3PB0A 2YB4A 3CQIA 3KVLA 3T81A 2OPJA 3UY8A 4C6KA 3A5FA 4XKYA 3QEZA 4PTMA 2D0FA 3GHRA 4WR3A 2X1SA 3W7QA 1UD6A 3W3OA 4I7UA 1XIHA 2VUNA 3UWEA 3ZVIA 1K9TA 4Z0SA 4QG8A 1SZNA 4CNSA 2V3EA 4WJEA 2PFHA 5HWJA 2XFFA 2PDYA 2Q6ZA 2R8WA 3ARSA 2VXNA 1FDZA 2OYLA 2PU1A 4GQQA 1K8YA 3UERA 1A3XA 2Z1SA 2W9MA 4KFPA 1SJDA 1Q6QA 3LZ3A 3T1GA 4QJ1A 4AEFA 3UA4A 3VM7A 1GOQA 1LUCA 1KM6A 5EL1A 2XIJA 3ZJKA 4A8NA 3W2JA 4TVDA 2DT0A 4J40A 5EU9A 5FJTA 3MI6A 2V82A 4YYFA 4XTIA 5ECVA 4S3FA 1IGSA 5I09A 1KKOA 2G96A 3PBVA 2YYUA 2HEJA 4PH6A 4ICMA 2YKKA 4TVCA 2W62A 1IF2A 3S3GA 2WW5A 4JN7A 4AC7C 3V0SA 4BCEA 1GW1A 4UTWA 2QS8A 3KS6A 1K9DA 3DYMA 3CNYA 3W38A 1KFEA 4FI4A 3TTSA 3O0KA 4HPJA 1A5OC 1KA9F 3VD4A 3L7RA 2CLOA 3ARXA 4ZOBA 2INFA 4PRWA 4BF9A 3NTYA 1F3XA 1FQ0A 2EF9A 3LCIA 3SCPA 4QXIA 1XG4A 3IEBA 2JEPA 2D2OA 2IKHA 1ESWA 1HKKA 3IVUA 1DVJA 4ADSA 1UWSA 2VR2A 7ENLA 3TFCA 4REQA 4H4IA 3G1VA 1YIXA 5D9MA 3S1VA 1R3RA 4TR9A 3ZZ1A 2XPKA 3UESA 3DFTA 1DEDA 4C7DA 3GVRA 1X96A 3P61A 3BSHA 1XFCA 1H7PA 4GZ7A 4K39A 3VOJA 4MUPA 1NDYA 2GQ3A 3W27A 2VCCA 2V2DA 1HGWA 3L12A 5D03A 4UTUA 3K30A 4O50A 1IZKA 3RXZA 3SFWA 4UFHA 2JE8A 4BZYA 1B90A 4J27A 4JTUA 4X60A 1TWWA 1ODZA 2CZVA 5IBXA 2OMAA 1WDRA 3QTGA 3NQ6A 1HP4A 1W3IA 3P6LA 3AHYA 2I57A 1KFLA 3LQLA 4L4MA 2ZE3A 2CW6A 5D2YA 2QVNA 2VRJA 2QDDA 5FEXA 2FDMA 1IT8A 5LNUA 4IPPA 2GWGA 5T26A 1W3KA 2WPBA 2EJAA 5LSMA 1KXTA 3VO0A 4E2OA 4WSKA 1XBVA 2XJ7A 3W87A 3K4WA 1CXIA 3TXZA 5KITA 1FHVA 1KXVA 3REQB 3B40A 1W1VA 3BC9A 1TPFA 3R13A 4O8AA 4MOZA 4IISA 2INEA 3WLMA 3BSGA 2W6RA 2ODOA 1QUMA 5K4ZA 4XZBA 1BVZA 2DV0A 1W5MA 2ZTJA 3OZPA 3S2JA 3B97A 3R0DA 3FJ6A 1R3TA 1J11A 4GIYA 3NL6A 2VTFA 2V5LA 4CN6A 1U5VA 3TU9A 3ZJ7A 3PF3A 5DFAA 1UBPC 2ZC1A 3EPOA 3DFQA 2Z1WA 2OT0A 1R30A 3RR4A 3MSGA 1K6WA 5C55A 2CLEA 2BXVA 3TMLA 3LRKA 1QFEA 4D6JA 2QDHA 5AOUA 3MTWA 1DWGM 1XG3A 3PSWA 1C92A 1JAKA 4RE2A 5FOOA 4E2DA 3N9SA 1H49A 9RUBA 5TNVA 1YDNA 4YTRA 2C71A 2RH9A 1OFOA 4ZTYA 1H41A 1RUSA 1VFFA 4AF0B 1RALA 3WQ6A 1XGEA 3E2SA 3ITLA 4AVFA 1XCWA 1XLAA 4B2DA 2ZX9A 5I3FA 4HIBA 3S2MA 3ZQ9A 1A5NC 4M51A 3OLIA 1OSEA 3UJRA 3URBA 3T4WA 3LI1A 4YVVA 3SGGA 1JJKA 4BQ2A 4WJ8A 2J7HA 4CD5A 1IXNA 4G1NA 4W8AA 5DMYA 1FWWA 2EXOA 3PZ9A 2GVEA 1POJA 1BFNA 1XIDA 5DF0A 2FTWA 2DEPA 3VC6A 1TSIA 1UIOA 4LJ3A 3KBMA 1PX8A 1UH2A 3R1ZA 2F2HA 1TVNA 5FESA 4Y9MA 1PTDA 1IEQA 4ZOCA 3O7UA 3CIXA 2V0TA 3I68A 1ECQA 4C6DA 1XL9A 2RDWA 4B5WA 3WMCA 1E3ZA 5FA5A 5H6HA 3SZ8A 2HS8A 2FGZA 2YCLB 5AHNA 5AZ1A 3WO8A 2XSBA 3WK1A 4WLCA 4HN4A 2PDUA 1YDYA 1KWKA 1LRQA 4CD4A 2Z1BA 1EUAA 2WKGA 3GAYA 3LG3A 1H7WA 4DBUA 3R6IA 2WNWA 2NUXA 3PSVA 2XVLA 2EKGA 3I3BA 2RGMA 3KL3A 4JDBA 1LP6A 1OZQA 1TR9A 3WQPA 4NIRA 3S83A 1XRTA 3L9CA 1Z69A 1XSIA 1YW1A 5C9ZA 1FCVA 2P3EA 1A49A 1G6CA 1WO2A 2O7QA 4GFSA 4YTSA 1TYGA 4JTFA 1TCMA 3FX4A 1XYAA 1FDJA 2E6DA 4ZE4A 1W1ZA 2WVVB 2GQ9A 4LV4A 4UTTA 1OD8A 3FFSA 3HQ1A 5DQPA 5BU9A 1J2BA 1X98A 1J12A 2VDHA 1X8CA 2HCVA 3IGXA 3U4AA 2XIIA 5CSSA 1RD5A 2PU0A 4QITA 3B8VA 2UY2A 3SQSA 4FNTA 3W1PA 1TV5A 3EXSA 4Z17A 4KKXA 4YCPA 3GG8A 4C1NB 1WKEA 5D32A 2QXWA 3QYSA 1OGBA 4YIWA 2C1GA 4PTNA 4MM1A 4CQBA 2PZ0A 1RQHA 2BOFX 1UCWA 2O9TA 3QMSA 4JL1A 1JNDA 5BRBA 4H2CA 2PDHA 3PPFA 4UBPC 4QSHA 1RXOB 4UMAA 3PP7A 2NZLA 3NO1A 1Q6GA 2C16A 3AJXA 3TE9A 2X1UA 3N17A 2DJXA 3V7PA 3OW1A 2OOGA 3AZRA 3PZUA 4PSPA 1QBBA 3GXNA 4H6RA 5G1TA 2OT1A 5F7UA 3AS2A 3NL2A 3M0KA 5HATA 3V3WA 4Z2HA 3IIVA 4ZQNA 1V6UA 2VO5A 4XKYB 3CC1A 1VEPA 1M7JA 3OOQA 4P7RA 1ZJBA 3LENA 3P93A 2A79A 4LAOA 2EG6A 3PFMA 5JXQA 1JZ6A 3VOGA 1E43A 4LVDA 2Z1KA 1DQWA 2FHFA 1WBHA 2DT3A 2YLAA 2Y7EA 5BW6A 3M64A 3S2CA 2FHBA 4GFIA 4Q8WA 3CUGA 3G1SA 4H1ZA 3ITXA 4NAEA 2NQJA 3B9AA 3C52A 4MWAA 3UJ2A 2Z7KA 4LB3A 4FX6M 4E5TA 1S2AA 2VEPA 2WMKA 1DPMA 4IMEA 4XQ6A 3PZQA 2CESA 3ORWA 3VIIA 1HXJA 1R47A 1XRSA 1ITQA 3F1QA 4DI9A 4B9ZA 4ECLA 4ZMGA 4EK7A 1RP9A 5TIMA 5DBTA 4R3UA 4FXSA 1F6PA 1EXPA 1DIDA 1JEZA 3SCQA 3TN6A 3UNDA 2D23A 4H8UA 1XYCA 3AISA 1JF5A 3OVQA 1W9BM 3QHOA 2Y88A 2A21A 4UR7A 2JIEA 2YBVA 1W5NA 4YJ5A 1VPQA 1SO3A 2FJUB 2DSKA 3UPBA 1UW9A 7XIMA 2R24A 3NDOA 1LWHA 4JKLA 3VKBA 3C2YA 4Y2WA 1HIZA 3MI2A 1DTNA 5M3WA 1XLFA 4A8LA 4FNQA 1K77A 3NXLA 4PEKA 3PTMA 4AD5A 1DWIM 2XH0A 4B5UA 3CL8A 3PZNA 1OJXA 4CQDA 1UPMB 1DJXA 4JIHA 2AKMA 1PWMA 3UG8A 2PCQA 5G4WA 3VKAA 4DWDA 4NJGA 3VFLA 1Q2RA 4WIWA 1X97A 1KV5A 5C2XA 3UW6A 1DWAM 3FK4A 1DYSA 5JBFA 1YDOA 2Y8KA 4H9MA 3IANA 4JFTA 1U22A 4C6QA 4QE1A 4OQVA 3DI1A 2QVHA 5C9UA 1A0CA 4MY1A 1Q13A 3H7UA 3WNMA 1KM0A 1LQ2A 4IQLA 3RAOA 4F0MA 3PK7A 4ZXOA 4H8VA 1UUQA 4HPGA 3L4VA 4PUKA 2AL2A 4DPPA 5BRQA 4GVGA 1QO2A 3WFAA 3TSDA 4R9OA 3WH9A 1G4TA 2P8BA 3FYOA 2I56A 2ATSA 2Y62A 1Q6DA 3HQOA 4KEVA 3UZXA 3TJXA 2YX0A 3B8DA 3H4XA 3RFAA 2ZUWA 3APGA 2ZC8A 2J75A 3WL0A 3L2IA 3SN4A 2PRMA 3GBDA 3WY1A 3G77A 1VJSA 2OOFA 4JN8A 1V5XA 3TQ0A 2ZUSA 3NEVA 5IOBA 1OZMA 3ZR4A 3LQGA 2YIHA 1UZDA 4EXQA 2J78A 1ADOA 5C54A 2WZIA 1WV2A 3LLDA 5DT5A 4O10A 2WXDM 1W8SA 1XLKA 3S5NA 1XDMA 2OYMA 4DZ5A 1VFHA 5JIPA 4W88A 3R79A 3QW3A 1ISVA 5A6LA 3SCVA 2ISFA 1VFLA 1O66A 2CZFA 1QU4A 5H2ZA 3WFLA 4YPJA 1UKQA 4JTHA 1UC5A 1UROA 4XD3A 5CZTA 1IEXA 1MW2A 4J7RA 3H12A 2EPKX 1OYCA 3RO8A 3S9ZA 1NP2A 1DXIA 4DWSC 1GG1A 2JBMA 4RDYA 2Z27A 4BQ3A 2FYMA 1DBTA 2WC3A 3DC0A 1FWRA 2Z00A 3I4KA 4NXSA 4UZUA 3KM8A 1KXHA 1T7LA 2Y1HA 3LCGA 2PBOA 3MVIA 3EDDA 2VC9A 4US6A 1FCQA 4UXDA 1AL8A 2P76A 1AQMA 1K03A 1KW1A 4K7VA 1QJWA 4C6NA 4XWUA 4Q8TA 3EMQA 1AUSL 2HISA 3FKKA 3TYCA 2Q3RA 2RKXA 1V93A 3TA6A 4MB3A 3ZWTA 2UWFA 3LS9A 4PFHA 5CZJA 1RR2A 1L0PA 3FN9A 4JTLA 3TJIA 3AIEA 4LAKA 4Z2IA 1B9BA 5MF5A 4R5EA 1ZJIA 3WDPP 1VGAA 2XGIA 3K4AA 3O6CA 3C86A 2VZOA 4QG9A 4UTTC 3M6DA 3VGFA 1S2WA 1FWTA 4IX0A 2RDUA 1TIWA 3WX7A 1AH0A 3JR2A 4IUOA 4PUNA 3OVRA 1XIEA 3DC8A 4LVBA 2JQXA 3MS8A 3QZEA 3N6JA 1IR1A 3CXOA 2E3ZA 4YS1A 3AUJA 1S46A 1RJPA 1XX1A 2JK2A 2A2IA 1QPKA 4QAWA 2C0AA 4AZIA 1TQJA 3S46A 4IJRA 4LEQA 1UUOA 3CS2A 3VNYA 1HGYA 3SBFA 4LFYA 2YB1A 3E0WA 1U2YA 4PE8A 4LUSB 3NFUA 2C91A 1AA1B 1D8CA 3LGGA 1CXEA 4J2MA 5BYWA 3WDIA 4N6EA 5GJPA 4O17A 1K9EA 1E0VA 3ZS4A 2Z1VA 3DZ1A 2HXUA 5HPCA 2Y2WA 4FALA 2VEIA 5CGMA 2BWGA 2VD8A 2EJ1A 4UQAA 4DIAA 4X0NA 1IWBA 3IJ9A 1LLWA 1KM5A 1W5PA 4ADUA 1VPYA 1JDDA 2I5QA 4XK2A 1IIGA 1ZJHA 4KWUA 1BWKA 5I7GA 2QR6A 3LCXA 3W7IA 1WZLA 1ZY9A 1TQXA 4IF2A 1BKHA 4HNOA 2HROA 1GQIA 4JHZA 2ISSA 3W70A 4WDWA 5C2CA 2YL6A 3JVAA 4A4AA 1TPDA 3GNXA 3LCWA 3BLPX 4N02A 3THAA 4HHPA 3PNZA 2IMRA 3PPCA 4J28A 4C5YA 2DT2A 4NQ1A 2HVOA 1HX0A 3CHDA 1BVNP 5K4XA 4A2RA 2W91A 3HN3A 2ZKMX 1Q4NX 3THQA 1QO5A 4ADTA 1S2CA 2AAAA 1YXYA 3C3NA 3MO7A 5MHBA 4Q4QA 3C8NA 2WZEA 1LYXA 4XZMX 1JDFA 4P8VA 2PA6A 1XF0A 4BF7A 2PWHA 1E55A 2GDUA 4DJEC 1JDAA 5FEWA 1HVQA 3AIVA 4XZWA 3NM3A 3W1NA 4CQAA 1US2A 3ALGA 3QV9A 4LCQA 4D72A 2WHLA 3NNTA 5AC8A 1DHKA 3SCRA 5FKYA 4GIAA 3MKVA 4GI6A 1EC7A 1K4GA 3QFWA 1RK5A 2EPHA 3NZPA 2ISDA 3WELA 3HO8A 1JQVA 3BG9A 3B03A 3WNNA 1OY0A 5E09A 1IXPA 1EJVC 2BASA 1M6JA 3VE9A 4D71A 1YNQA 1J9YA 2G5WA 3T2PA 1H62A 1P6WA 3PZVA 4LS0A 2XG9A 3ARVA 2PGWA 4JS3A 1FWIC 1L2UA 1XLCA 4JIPA 1KWGA 3HGRA 5I79A 2WLZA 1OABA 3E0LA 1W0MA 4QIUA 5E93A 2D20A 2WWCA 2HV5A 2W61A 4W5ZA 2ZDSA 4H9VA 4GMEA 1WP6A 2BMBA 3RPMA 2EHHA 4MG4A 2QDGA 3U2EA 4ACZA 4URIA 2ZUTA 1CBGA 2R6OA 1Z32X 1RY8A 1XPYA 1TG7A 1DQXA 3D46A 4QM1A 2NVDA 5EB8A 5C8BB 4I5UA 3G1AA 3LHWA 3SCTA 3M47A 1FXQA 1GYMA 3LUTA 1RVGA 2PEVA 5CJMA 4QCFA 1DE5A 4YXGA 3BGAA 2RJGA 2DZTA 1UBSA 4Q33A 4YLWA 4M56A 3E12A 3KDNA 5DLCA 5KETA 4L1GA 3OVGA 4YYCA 2PDJA 4DRSA 1SW3A 3F03K 3WLHA 1CWYA 3I7SA 3WQFA 3BK0A 2YZ5A 2WVVA 3WF3A 1HO1A 3NPVA 2A3BA 2UY5A 4AQLA 3HG2A 2J66A 3S6DA 1E9ZB 3L21A 4YMZA 1X1ZA 4B16A 4LYQA 3N3TA 2VEFA 4NL1A 3AQUA 1H0IA 4NYUA 4MAZA 4D8ZA 2CXGA 2UY4A 3CM4A 3ID7A 5I24A 2H3BA 5DCBA 1SPQA 3M5ZA 1XIBA 4IP4A 2TODA 3GKFA 3M0HA 2J25A 3W76A 1SR0A 2DFAA 3DYOA 4F9DA 5F2GA 3LCHA 3QZAA 3MJYA 3IJ6A 3N15A 3EX2A 1FCBA 4PL1A 3RU6A 4WKHA 4ZQRA 3VINA 3KX6A 4K3ZA 4O1AA 2NXIA 5EBUA 3GHUA 1TIMA 1ZS2A 3ICJA 4H01A 1SMDA 3ERPA 1ZTVA 3FYYA 1ME9A 3BOFA 3NGJA 2X7VA 4CN1A 3RILA 1ZQ5A 4AWEA 2A7RA 1CIUA 5D04C 4WDTA 2WSRA 4JDYA 3ME3A 1RA0A 2OLAA 5C2GA 1R3QA 3HGJA 4IP5A 3L0GA 1ZU8A 2Y61A 3CUJA 1NOWA 3LD5A 4M6UA 3UETA 1RV8A 3LSBA 1RCQA 3GR8A 2VUYA 1DIOA 3GUGA 1TFVA 3M5VA 3F2CA 1O94A 2VX7A 3EKGA 2E1DA 2J88A 1OEPA 1FWJC 3VAVA 4KT2A 3WYZA 2QW5A 1MW1A 4H9UA 3UYIA 1L9WA 5CBBA 3LGDA 4MTVA 5ECUA 2XDFA 4Q8UA 3R89A 4MJ2A 1E6SM 4MJZA 1NDZA 3CZGA 4L4PA 2XM1A 3QQWA 1KM1A 4OBRA 3G0UA 1XIJA 1XHGA 2FIQA 4GRSA 3G2GA 2I5GA 4JKKA 1H1ZA 3W1UA 3TQPA 1EEPA 1GZ1A 3S6OA 2REQA 4PBEA 1FH8A 5D8ZA 1RVKA 2ZA2A 4G6CA 3CTTA 4NILA 4AZBA 2ALRA 5LYRA 1VYRA 1FWDC 3QHMA 3GIQA 1BYAA 3GW0A 3OA5A 4US5D 2GGHA 4X0VA 4NAEB 2VEKA 1DXFA 3DG6A 3EEGA 4A35A 1P7TA 4R53A 3GVVA 3RDKA 3L0KA 4MWAE 1F3WA 2DZSA 5FJJA 4O0KA 2MUCA 1WKDA 3NSXA 3EEZA 2ADAA 2OGJA 4NZ1A 1V6YA 1EJUC 2ZA3A 1TX0A 1NWRA 3NQ7A 5CSUA 1CPUA 4X9YA 1W32A 4PYSA 1I2OA 4TXEA 4Q32A 3H7RA 1XBZA 1MFUA 2CNCA 1WUFA 3NVTA 4O0QA 4HPNA 1R3SA 4B3KA 3GXFA 5I06A 1AK5A 3VUSA 5A6MA 2OO0A 5RUBA 3TYZA 3ZYZA 3GXIA 1AODA 4TX8A 1VF8A 1BYDA 4HA4A 1I4NA 3GYEA 3LGEA 1DIEA 2YA1A 4HK6A 5IBXC 2D3LA 4UNKA 4R7JA 5MKGB 2B31A 4M80A 1QBAA 4O12A 1E0XA 4LBSA 1QMLA 1CNVA 1F3TA 3M46A 1W5QA 3JUGA 4KCUA 2JKEA 1E56A 5BXTA 1Q6OA 4S1FA 3UWUA 2V5BA 4U2ZA 1MNSA 2CPUA 1XLDA 1OFRA 1PE1A 1OF8A 1ZSXA 1MDLA 3WLRA 1QOQA 2Y4SA 4PCFA 3VMOA 2Y70A 3V35A 3AIBA 3PZTA 3UGRA 1JL8A 3VZYA 3CLWA 4V1YA 2WAGA 4S3AA 2QLYA 1R85A 3SUVA 1F76A 3F2BA 3VNLA 1W9PA 4MNLA 1TE1A 2O92A 4AD4A 2QCMA 4FIRA 3GNRA 2VGIA 8CGTA 4BKNA 3TW7A 4AWUA 4UR9A 4D6FA 2YBTA 1M5WA 3OODA 3LERA 5E5CA 4JTDA 1NIUA 3GNPA 1EHNA 2IPGA 1SJAA 1VBJA 3ES7A 4S3DA 1ISYA 1X6LA 1VEMA 3T07A 2CZDA 1UZ1A 1TB3A 2NLYA 5CAHA 3UY7A 1PBGA 2C19A 4G8TA 1MW3A 3GG0A 2DVTA 5AHIA 2E67A 1RAKA 4WY0B 3SGUA 5B7ZA 3QJAA 1IYXA 4JTSA 1KCKA 2VZVA 2FPYA 2CZEA 4JN6A 3SURA 4M24A 5LA1A 2GL5A 2FTYA 1V3HA 4GQRA 4PZVA 4LS2A 3UXAA 4I3GA 3QPZA 4MLJA 4DJFC 4MWAD 4XV0A 3BH4A 2NQZA 1TRDA 1QNPA 2PMQA 1CLKA 3RITA 1P7TB 3SIMA 4N6FA 3APTA 3CUFA 1A5BA 3KBVA 4AMCA 2QZRA 4QGCA 3VDCA 1KQYA 3TNBA 1VPXA 1P48A 1GJWA 3FW6A 2ZUUA 4KIRA 4YU1A 4HCLA 1NF7A 3U3HA 5KZDA 2OZ3A 3KAOA 1FBAA 4QQUA 1PKYA 3NOYA 4IICA 2DZVA 2HXTA 1BSIA 3VGHA 2VWSA 4GACA 4IQJA 2ZUNA 1V3MA 1VEOA 3WMBA 3USBA 2QV5A 3OP2A 4HU0A 4G7FA 1BG9A 3P8JA 3NZQA 1I6NA 6TAAA 1TWSA 1ZLPA 5AFDA 5I77A 1BXBA 4E0CA 2V9DA 1K7FA 4LALA 3SUSA 1E0TA 4I7WA 3WNKA 5LIUX 4AVNA 4XBKA 3VGEA 3GFZA 1PSCA 2A7NA 4GI4A 3S5YA 2FFIA 2VFHA 4NF7A 4KEUA 2E77A 3WLNA 2J7EA 3BV7A 4OOZA 2ZYFA 2PP3A 5AHFA 3BJSA 5FSEC 3WF2A 1PIIA 4B4HA 3QGAC 3TA9A 3NR0A 5AY7A 3B05A 4HN8A 1E9LA 4OE7A 2PLJA 3BMWA 2GGGA 2PTYA 2IS7A 3P2VA 3B0YA 4DF1A 5C0QA 3S2NA 4O1FA 1ZB5A 3URAA 3MUZ1 9XIMA 5HUPA 1XIFA 1S3TC 5HNUA 1GOMA 4LB4A 2PLMA 2VMFA 2EQDA 3QY7A 5HANA 4HZ8A 3GDBA 4C65A 3UG5A 3LEPA 6A3HA 2X2GA 3M9YA 4MB1A 4O57A 1V51A 2VDIA 4LNCA 1O6IA 1NEYA 2PLKA 2V6AA 3IJ8A 1UR1A 1KM3A 4HZ7A 3PN8A 1JD7A 1P1MA 2CHRA 1EEXA 1GQJA 4QJ5B 2OKOA 2H6RA 1F74A 3DFPA 3L68A 3JW7A 1TZ7A 1HT6A 3AXHA 4N7QA 1E4LA 2I7GA 3W23A 3VGBA 1ITUA 3TSBA 3N2OA 3BE7A 3NCOA 2DUZA 3DXIA 1U33A 4GJIA 1EOMA 4GYFA 3KBJA 3OYZA 4DXKA 4NI3A 3BICA 1M3UA 3CH0A 1EA9C 1TPVA 3PR2A 1E6QM 2QT3A 1TV3A 3WJWA 1DTUA 1SW7A 1MNZA 3W1AA 2F7FA 3BL3A 3CTLA 4HNNA 2X7WA 1BSLA 4C6CA 3VCNA 4KPLA 3VGDA 1S1PA 3BW2A 1NFGA 2YCJA 3G24A 1C8VA 2BY2A 3GC5A 3U4FA 4CU7A 1J8VA 1A4LA 4AZ6A 3MP3A 3W1TA 3LHTA 3UVIA 3EMZA 1XQLA 3PHAA 3WJSA 4Z2LA 4M1BA 3W6MA 2Y7DA 4X9SA 4EPDC 1UPPA 1XI3A 3Q65A 3W7DA 3RGTA 2ZXQA 1UH3A 2G8ZA 4JFVA 2OEKA 4GGBA 4HHLA 3RMEA 3GNNA 2UZ9A 2YA2A 3M0MA 2XISA 1E70M 1OFEA 4EANA 3BMXA 4GX9A 1GQKA 1BWLA 1DWJM 4EF9A 3H8AA 1N55A 3OLDA 1B2YA 3FJLA 5BMXA 3H22A 4L64A 1R2TA 4HJWA 5FJPA 1HKVA 2F61A 3UCCA 3GK0A 1GG0A 4KWSA 4PRTA 3LTSA 2V67A 1Q65A 4FA3A 1I0DA 4R85A 1KFJA 1VRXA 3WF4A 4G56A 3OG2A 3V5CA 2PDLA 1HL8A 2B81A 2FDSA 1O95A 4QQ3A 4AY7A 4GKLA 3WLIA 4FB7A 1GVSA 2EPOA 3ARQA 1NQ6A 4JIQA 1XDLA 1YX1A 3UBPC 2QEZA 3WBWA 2NT1A 1D9EA 2QCGA 3QPYA 1YTKA 1TVPA 5F1UA 3AC0A 4QEEA 2KZHA 2WCGA 5D8WA 1HQTA 2OZ8A 3W0KA 5B7YA 2VT0A 3ZT5A 4LX4A 3W22A 3OYXA 1IZCA 2B7OA 3CV7A 4NRSA 4INFA 4YNGA 1YPFA 4RNIA 1JGMA 1EYWA 3PJTA 4GIRA 5K9XA 2X2YA 3QYQA 4UTIA 3V4BA 2WJDA 3SCWA 1BTCA 2WVUA 1NH6A 5CPOA 4CKQA 4A6GA 2X41A 3N6HA 1XR2A 3B4UA 3G8RA 4D1JA 4XO6A 4C6IA 2CZ5A 2X40A 4J4KA 4MFDA 3RRXA 3UXIA 4B3LA 2PTXA 5BWAA 3IARA 2H9AB 4XB3A 4DJDD 2PE4A 2WV8A 1IXOA 1TR1A 5G1MA 3BLDA 3H4GA 3H2MA 4AWTA 4M7SA 2XH4A 3W7KA 1VBRA 4GCAA 3RN6A 3S1GA 2WKJA 3DFSA 1I8JA 1PYMA 1HUVA 3CEPA 2YCIX 4RR4A 4H83A 1IHIA 2GUUA 4LUYA 1X38A 3ZJ6A 2PC4A 2VURA 4GA8A 1ZBWA 1SW0A 5LIXX 3MB9A 4ML4A 4U3CA 4GCXA 2F6UA 3CGTA 4Y9OA 2GUYA 2QF8A 3AYTA 3W24A 3VFCA 1KR1A 5C9RA 2BDQA 3UVAA 3POHA 4F2UA 3A23A 3BLOA 3CHCA 4GQBA 4DB7A 1V79A 4F0LA 3N13A 2IUZA 5FJOA 3DFOA 1FWAC 1UR0A 1LCOA 1MUCA 2RUSA 1GCYA 3H55A 3GHSA 3H2EA 4QCEA 3ISIX 3KBSA 3R5EA 2TAAA 2J13A 3WIJA 5H8PA 1HW6A 3PWGA 1UR8A 2HDJA 4LW7A 3DU0A 2Z2UA 2F8QA 4JFUA 4Y7EA 3XIMA 4J1OA 5H8MA 1FVPA 2WOQA 2FZDA 3W7EA 4LF2A 4C6BA 2AMGA 1F07A 4JKMA 3GC2A 4O4WA 4WQ6A 3PVFA 2XM2A 3CMJA 2WYSA 1TMHA 3VIMA 2PTZA 5D2WA 1TTPA 1Z9AA 3L5MA 2Y5EA 1M7OA 1V3JA 4ROPA 4DBDA 3DN5A 5HK4A 3GAKA 2A3CA 2G41A 2NX3A 4K36A 2A3EA 3HM7A 4J3UA 3C8FA 1SSGA 4KCWA 1JCTA 5GPRA 1J0IA 2WHJA 3V36A 3Q4DA 5FJUA 3GIPA 1J6PA 2J7FA 3VIKA 1V7AA 1PDYA 1JQXA 1NFPA 1QOPA 4QNEA 2GSJA 3O6AA 1KCLA 2BGSA 1JNEA 3A13A 4E6MA 1M53A 3C5QA 4PA8A 4UQ9A 5M17A 2G3JA 2G0WA 2FVMA 3N2BA 1X6NA 4Q22A 5EFDA 5HR6A 4HP5A 3L65A 1EWEA 2QULA 3FAWA 2Y89A 1WE5A 3HJEA 3P0XA 5HNNA 3TYBA 4GUFA 3MMTA 4WKFA 3SGZA 1QW8A 4F0HA 4K7YA 1TMQA 3VOIA 5BRPA 2FQIA 3SRFA 1G67A 4AIBA 3HMCA 4HOWA 3HURA 4M7TA 1V77A 1F05A 2ZX6A 3DFHA 3V1PA 1WB0A 3NPWA 4I9MA 3URQA 1RCXB 3PULA 2B7PA 1TO3A 4RV8A 2A3HA 3CZJA 2VZSA 2PDMA 1GEQA 2V3DA 3ARZA 4DX3A 4CQ8A 2AGTA 2FVLA 5EMJA 2Z4GA 4I8DA 3KRSA 4HMCA 3BSMA 5FF4A 4UQEA 4DQWA 4PCPA 1JPIA 1Z6KA 1TKKA 3ZLFA 2VX6A 2RHGA 1RY0A 5EMKA 4S3JA 5I78A 5FCZA 4GI9A 1JVNA 3IWPA 2WMJA 4F2TA 3NM1A 1ONXA 5A2AA 4MHBA 5B80A 4H9XA 1OF6A 2D24A 4JFSA 1A0DA 4FHAA 4HU3A 2DUXA 5HJLA 4F40A 4RJEA 1JCNA 1MEHA 5ABTA 3EYPA 1F5ZA 1SFTA 4Z2GA 1XYBA 1M03A 1DWFM 3GR4A 2E6FA 1T0OA 3R7MA 2J77A 3MMWA 1IWPA 3RCNA 2DZUA 2XVPA 2BXZA 4ZB2A 2IKIA 2WMHA 1ECEA 1GWJA 1WCGA 5HUOA 4ILSA 4XZLX 4Z1BA 3RYSA 3W01A 5I0DA 3EA1A 4PCTA 4C6PA 3LTYA 4KGJA 2W27A 4RXGA 5IFPA 3UWYA 4JTQA 4IL0A 3PC0A 2GK1B 2WJFA 4W9TA 1WQ5A 1GZGA 1OG0A 1KM2A 3GC4A 4UMBA 1VKFA 3A4AA 4MZYA 1H7NA 1ONEA 2ZADA 4IQDA 1DJGA 2W67A 1HNYA 2WNNA 1PZ0A 1MZRA 4IZGA 1DJIA 1R7AA 2VCBA 1GOOA 3WN6A 4W8BA 1H4PA 1UA7A 1JXJA 4MJMA 3APYA 1WXZA 3VOHA 4R7WA 3UWQA 1GEHA 1G4EA 4J3WA 5EYWA 1SM9A 3BAJA 4J3SA 3ZR6A 3TFXA 2W0UA 4DUXA 4PMZA 5CGTA 3RLUA 1GVOA 1CXFA 4J9JA 1FY6A 4C60A 3P0WA 3LPFA 5D09A 4E2BA 1MXDA 5AYXA 2I17A 5E70A 1IT7A 1UD8A 4BI5A 5HQEA 4ICCX 2WC4A 1MFVA 4O1CA 2DH3A 4D6IA 2H8ZA 3O9NA 3NZGA 1S1RA 4L56A 1Y7VA 3IPWA 4AB4A 1S38A 1Z3NA 4K8GA 1NSJA 1QNOA 3GU9A 3SSZA 4WZHA 3MSYA 3W7NA 4A8IA 3T2QA 3IGHX 3OB8A 3A9BA 2G3MA 3OEXA 3LBOA 1B3WA 2E8ZA 2E68A 3N14A 4L6HA 3SADA 1TZ9A 4E3VA 1BG4A 1PJ9A 5I2UA 2HE5A 2OSWA 1AH4A 3HGOA 3MKKA 4O1DA 2ZZ5A 7TAAA 1DWHM 1HL2A 1G9HA 3P74A 4GNJA 4MPQA 4ACZB 2HZGA 3MMUA 4MFEA 3WQWA 1OVDA 3AXMA 3TOYA 5JH2A 2A3LA 2Z26A 2J62A 3TQVA 4H8NA 3WK2A 4IIGA 2PRHA 3BMVA 3NO3A 4C1KA 3AXKA 3C0QA 3KRUA 3YPIA 5LNWA 4OV9A 1MVYA 1IEIA 4R27A 3VOFA 3MUCA 3UZZA 2XZ9A 4OU1A 3STGA 3OU8A 2ZE0A 1UWIA 1V6XA 4S3CA 4MDPA 1VHNA 1TUXA 3P8IA 1X8FA 3WF0A 5F2MA 3CV2A 1XM3A 3SJ3A 3E0IA 5AYBA 4NVTA 5LNVA 3UFYA 3TSMA 4RNFA 1XLIA 3SSJA 2J8GA 1HJXA 5DX7A 4IWWA 1TPH1 1D8WA 4L65A 1GKQA 3RLHA 4AD2A 1R9XA 3JZUA 1FX6A 3HPXA 2VFGA 3AYVA 1W9VA 3T40A 4DJFD 2OG9A 4GIEA 2GGEA 3VDAA 3QOKA 3B8WA 4H7CA 3RLGA 1UWTA 1EBGA 2OXNA 2HE8A 2ZVIA 2BLEA 2G3IA 2VRQA 3BANA 3E96A 4GYKA 4JQAA 1YHTA 3GM8A 4K1WA 4IJBA 2HTMA 4TUFA 4FO4A 4POCA 3T44A 3IIOA 4GWEA 3V75A 5LHFA 3M5YA 2VZUA 3TWAA 1EBHA 4LYRA 3LB0A 2FB2A 5KINA 4DJDC 1US3A 2P1FA 4Z1CA 4JTIA 1SFJA 3MSDA 3S0CA 4HK5A 1O7AA 3UQNA 4UCFA 2WHMA 1NTHA 3B8UA 3ARWA 1H09A 3GFYA 3LPGA 2V2HA 1L6SA 4A3RA 4GYPC 2NXGA 5AVHA 1I9CB 3IK4A 1G0CA 2GVLA 2J79A 1K7XA 1RCOB 3WDJA 1A5SA 3VD3A 5AKQA 3VVGA 3IAPA 5GQBA 5CGQA 3N3MA 1RHCA 4PMJA 5D2TA 1S5NA 3W1XA 1JYXA 2YZRA 3BAXA 2OEMA 3QZ6A 2V63A 5KZ6A 2OLSA 3FJ4A 4IPNB 1UR4A 3LHUA 1CDGA 4AD1A 3RCYA 3GDKA 2ICSA 2ZZ4A 4RL3A 4HNLA 3MHGA 2DORA 1GGOA 2PAJA 3E74A 5SWUA 1LORA 5D38A 1MSSA 5C5YA 2VGGA 4NKCA 4TVUA 2YL5A 2I14A 3FVMA 1UMYA 4WCJA 5CLTA 1TJRA 1GTEA 3MP4A 3MSRA 3SO7A 3T4CA 1H3GA 5DO8A 1U1HA 1QPRA 3SUUA 1IEVA 1JFXA 5CPSA 2WNQA 3PZOA 4RW3A 4WVXA 3VM5A 3PJWA 1OCBA 1GZJA 1EX1A 3C3UA 1AD1A 1Y0EA 5DY3A 3PJXA 1O5RA 3WNOA 2YFNA 4Q6JA 4GI8A 3QV6A 4H7VA 3NG3A 1TELA 3N1AA 3GXPA 1OD0A 1EWDA 1TJ2A 4Q8VA 3EB2A 4JQ2A 4NXKA 4OV4A 4TIMA 4WUIA 4JTAA 4JX6A 4PL2A 3EX4A 4O53A 3G1XA 5A6JA 3HIJA 4DUOA 1PTAA 1OC7A 4DLFA 4D6GA 5A8QA 3BCFA 1R3YA 1JUKA 1RPKA 1UG6A 3VI2A 2FMOA 4QBXA 1NY1A 3KOFA 1BPLB 2DVUA 2CC0A 3VDGA 1GYLA 2J47A 4RUBA 3UP8A 3V0UA 4FXJA 1NOUA 1B3XA 1XRFA 3W00A 4P8XA 3UZ5A 3KVMA 2Z6JA 2AAMA 5HDRA 3ARYA 4RZ6A 4Q7NA 4FMVA 3ZVHA 2PC8A 2EPNA 2PD9A 1EJRC 3TIMA 3KHDA 2YFOA 2ZX8A 1ICQA 3BAKA 2TYSA 4CD6A 1EDQA