2Y8UA

A. nidulans chitin deacetylase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
211
structure length
211
Chain Sequence
VPTGQVITQCTTPNTIALTFDDGPSEYTPQLLDLLSRYSARATFFVLGDAAAQNPGLLQRMRDEGHQVGAHTYDHVSLPSLGYDGIASQMTRLEEVIRPALGVAPAYMRPPYLETNELVLQVMRDLDYRVISASVDTKDYENQDADAIINTSFQLFLDQLDAGGNIVLAHDIHYWTVASLAERMLQEVNARGLIATTVGDCLGDGEIAWYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CHITIN DEACETYLASE
publication title Cloning and Characterization of a Broad-Specificity Chitin Deacetylase from Aspergillus Nidulans Fgsc A4
rcsb
source organism Emericella nidulans
total genus 88
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01522 Polysacc_deac_1 Polysaccharide deacetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 2y8uA00
4LY4A 2NLYA 4V33A 5BU6A 3VUSA 4F9DA 4NZ1A 4NY2A 4U10A 4OUIA 2E67A 3WX7A 2C79A 2Y8UA 1Z7AA 2C71A 1XW8A 1NY1A 4M1BA 2DFAA 2IW0A 4NZ4A 2J13A 4L1GA 1V6TA 3QBUA 4WCJA 2VYOA 2I5IA 4F9JA 2C1IA 2CC0A 1W17A 3CL8A 4NYUA 4NZ3A 3S6OA 3HFTA 2W3ZA 2XU2A 2C1GA 3CL7A 4HD5A 4NZ5A 3CL6A 1W1B1 3RXZA 4NYYA 1W1A1 5JMUA 2QV5A
chains in the Genus database with same CATH superfamily
4M80A 3URBA 2EO7A 5FACA 3DFOA 2VZVA 3CLMA 4HBKA 3K5XA 1MQRA 2E4TA 4CN6A 1UWUA 3W02A 4BI7A 2POTA 3CEPA 3DFHA 5HJXA 4FIRA 1XLDA 1TIMA 3UP8A 3G0UA 5CG0A 1VH7A 2XWDA 4MM1A 3RR4A 3AJ7A 3UQNA 2QCNA 3FKRA 6CGTA 4ZOCA 4OFCA 1TCMA 3EA1A 3CUXA 2FB2A 3IGHX 3U8GA 1GTHA 2DFAA 3AISA 5HMFA 5GQBA 5IM51 3C56A 3QR3A 1W32A 1L2UA 4URIA 1BYDA 4W5ZA 1CLXA 2Z7KA 4ORIA 3RNDA 5KZ6A 3ZQ9A 4H9YA 1FWNA 2Z1SA 2WJEA 2OLHA 5FJJA 4WY0B 3I6RA 1U83A 4O18A 1WDWA 4J3ZA 5CBJA 4NZCA 3LHVA 1A5LC 1O4UA 5CJNA 1P6WA 4J9JA 3B3DA 4DNMA 4IIGA 1HKMA 4B15A 3OVGA 2Z1XA 2A21A 1H7OA 2J9XA 4PUJA 4GO8A 1Q4WA 1XSKA 3O0FA 4QFUA 1HKVA 1KFBA 1YXCA 1DTNA 1V0NA 1GOQA 3OG2A 1AQFA 7TAAA 4EIVA 2WO5A 2PZ0A 2YB4A 3ZS4A 1IT7A 2PWGA 4XZMX 5IDZA 1XLIA 4NJIA 1ONXA 2Y5SA 3GTFA 1QHZA 3HFTA 3RILA 3MMDA 4H7CA 4H6RA 2AQVA 3JVAA 4DWDA 4LYKA 4DIAA 1HGWA 1KV5A 2VGFA 3PWAA 3TH6A 3E49A 2PDKA 1KA9F 4LU0A 4C91A 1EBGA 3CWNA 5BCAA 2XPKA 2ZXAA 3QVQA 3LNMA 1UWSA 5D8ZA 4E6MA 3MUXA 3QC0A 4N9CA 4R9OA 2CFFA 4R88A 1QO2A 4NRRA 3S5YA 3H22A 2VFEA 4BQ2A 2C19A 4AXKA 3UZZA 3CZEA 1KKRA 1AD4A 4JTLA 1A5KC 1ZBWA 3VFCA 3ITCA 2O92A 1VIZA 1K6AA 3BAWA 4KFOA 3V0SA 5GVJA 2YIHA 1XIJA 4LUSA 1JRBA 3UXKA 4BWLC 4OV4A 1HL9A 5F7UA 1IGSA 2IXVA 3P2VA 3U2CA 4O12A 4OBSA 2GSEA 4Z1DA 1KTBA 3KVKA 4U3CA 3C2EA 5EMMA 1FDYA 5CLTA 1YPFA 1WA3A 3MI2A 4NZJA 5I3HA 2JKAA 3MU7A 4NYYA 3USZA 2NUXA 3QH2A 3UY8A 2D2GA 1AW2A 1SYTA 1BVNP 2G3NA 4MKVA 2DSKA 3LEPA 3HG5A 4QEEA 1BGAA 3R0UA 1OFOA 1J8VA 4R85A 1W31A 1WPCA 4PMJA 1AL8A 3P5ZA 1M7XA 5K4XA 3NO1A 5GJPA 4OUIA 3DUGA 2WVUA 3WF3A 2Z2UA 3M1ZA 4HNUA 4XBKA 1FXQA 1EOMA 3CLWA 1HG3A 4M6VA 3S0CA 1E0TA 3LQGA 4RX0A 2YFNA 3GTIA 2R82A 1VB9A 2XIQA 3V3WA 3CM4A 3ZLFA 4AXNA 2DH2A 5D03A 2EF9A 1DORA 3KOWA 3VIPA 4GZJA 2CBVA 3HURA 1XX1A 1H50A 1KTNA 5I24A 4GZEA 2BXZA 1EA0A 3B8TA 4O14A 1ONWA 4Q8QA 1EOKA 4ZZ9A 4PB5A 4ATLA 3AWOA 5FJIA 3M0JA 4I8DA 1LBLA 4GX8A 4LCQA 2KAUC 1JD7A 4TX9A 5HPCA 3GU1A 1K3UA 4LAMA 1EUNA 2OLAA 4NYUA 1QI2A 1XM3A 4A22A 1A3WA 1XI3A 3I4KA 3NOEA 4R7WA 5LNUA 1KM2A 3KCJA 2PD5A 2ESCA 3WLRA 3OEXA 2VJXA 3SGUA 6PTDA 1YDYA 3BSGA 2V6AA 3SQLA 9CGTA 1HW6A 1TPDA 3QN3A 1QUMA 4QIUA 3E0FA 4FNQA 1K7EA 5I2UA 5J5DA 3HG4A 2Z1VA 4CVUA 4YL2A 5D37A 3A4AA 4MADA 4A3RA 2D0HA 2Z7GA 1W2PA 3FGCB 5FA5A 2J79A 2IW0A 1B5TA 3TKFA 3VDBA 1J79A 2J9YA 1L0PA 3ZR5A 1GJUA 4WKHA 2P8CA 4IIHA 3MP4A 1XPGA 4X0VA 5F2LA 3RU6A 2H9AA 3SW6A 5T9CE 4FEZA 5A8PA 1NM9A 1EYEA 2ZBTA 3INPA 3SN0A 1Y5VA 1ZSXA 1F07A 1REQB 4Y9NA 5G2IA 1B3ZA 2PA6A 1VBHA 5AYBA 2ISDA 4HOZA 1KRCC 5IOBA 4Q22A 1K9DA 1IR1A 2ZC8A 1R87A 2QT3A 4QXIA 2XFWA 3E6EA 3R10A 4Y6GA 2QKFA 2IQ0A 4CUCA 4O0QA 2PPGA 3S9IA 1EH9A 2CLFA 3MWAA 2GVYA 3WK0A 4A8LA 1XLFA 5EL1A 4JNYA 1VJIA 2ZWYA 4A3UA 2VR5A 3MHUA 2HSAA 4V2XA 3S3GA 3AS0A 2YB1A 2YA0A 1UW9A 2NQ5A 2RDTA 1RP8A 3D47A 2WVVB 1EIXA 2XZ7A 3H2EA 4YS1A 1CGXA 3W6YA 1OX6A 2EPLX 1GVIA 4BA0A 1MYRA 1KQZA 2ZRUA 1XCXA 2A5HA 3S1UA 4I9TA 4M82A 2D73A 3QSTA 1KC7A 1CX9A 3WL1A 4GUHA 5KTLA 1V3IA 4AEFA 1DE5A 4Q32A 4H6QA 3RYSA 1LP6A 2QJHA 4GIAA 3AHTA 1K8CA 1NAL1 1LRQA 1XC6A 1JAKA 2BVWA 4KBXA 1ICPA 3LERA 3E74A 3OGRA 3OJGA 5DELA 3WNMA 4LY4A 2F6KA 1V03A 3S2MA 1WKDA 1XC4A 4AMAA 1DIEA 2BDQA 3V5CA 4ZO6A 1SGJA 3C0JA 1GQNA 1B9ZA 3MANA 5FEWA 2GK1B 4L7ZA 5LKYA 1LWHA 3R13A 3GW3A 4P7QA 2QUNA 2QUTA 3UBPC 3G2GA 2VUYA 5EFFA 3S5NA 3T2OA 3SCPA 1S2TA 4QJ4B 5CJ5A 5C6MA 2JK2A 1X96A 2VFDA 4KRTA 3BLPX 5CZKA 3T0AA 1DBTA 3HN3A 1KCKA 2PLMA 2ZA2A 1A53A 5E93A 3F1QA 3WDIA 4DAFA 4ALDA 5EMUA 3LXAA 1ZALA 4G1NA 4MYAA 4QITA 4WUIA 4ML4A 3MUZ1 1KM3A 3B0YA 3THUA 2XIJA 2HRWA 4TQTA 1Q7QA 3CBWA 1YBQA 5J5RA 1CLKA 3BCDA 2D2JA 5D2WA 4QGCA 1JRCA 3R11A 2VTFA 4Y96A 4QR6A 1E6XM 4PYSA 3E0LA 2IUZA 4YYCA 5F1VA 3F4VA 3PPGA 2EPKX 2YA2A 1RQEA 3Q37A 4OWGA 4CN4A 3FS2A 3L67A 3FJ6A 1TQJA 3TTSA 5GNZA 1CBGA 3IACA 1TWDA 4C6IA 2EG7A 3GTXA 2ZRVA 1TJRA 3PZUA 2J62A 4DYKA 1FXPA 2Q8LA 2IKIA 3PZ9A 1R8LA 4HNVA 1QTWA 1TPUA 4NZ5A 3WLQA 3BW3A 4NF7A 3WF4A 1UASA 2OSWA 4HYWA 1R3RA 3IIXA 5LNRA 3VIJA 4DO4A 5FF7A 4AHOA 1KRMA 1SVDA 3NYZA 2CYGA 1QPQA 3VD3A 4JTUA 1HFBA 3OPSA 5CEWA 4FK9A 4DJED 4HU4A 3NNTA 3DFPA 2ZYFA 3TSBA 1H1ZA 2NQLA 4ORMA 4GC3A 5DEZA 3LPOA 1M1BA 4LV9A 4XSMA 1WKFA 3PTMA 4HVXA 3W84A 1K4HA 2XINA 3NQEA 3OQ8A 3PSVA 5FF3A 3RX4A 3ZR4A 1UR9A 4PTNA 1HP5A 4OBTA 1VYSX 1F3EA 2DUZA 4JIHA 4AG0A 2Q8ZA 5BXPA 2REQA 2WNQA 3B97A 4D8ZA 5D02A 3VGDA 4DYJA 3M07A 4WEVX 2OPJA 1QU4A 1XP3A 2A4AA 4S3BA 1U1UA 3A21A 3GU9A 3BW4A 5CSSA 5H2ZA 4U5IA 2GWNA 3FX4A 1R3YA 3B9NA 1UJQA 2YCKX 3PZOA 3N12A 3VOJA 5E70A 5AHEA 1SZNA 1WDPA 4HQVA 1NU5A 4LUSB 3A22A 4EF9A 2C1GA 3UWVA 1L6FA 1OVDA 1Z3NA 2XM1A 1UKSA 2X09A 1T8QA 2VEFA 4W7WA 3RMJA 2EQDA 3IRDA 1KXVA 1TVNA 1IEWA 2P3EA 2WZHA 1VZWA 5FIPA 3B04A 4PUWA 3BOFA 1XLGA 2CETA 4RZ6A 1MNSA 1OF8A 4ERGA 3ARQA 3NDZA 3WLLA 4F2TA 5CGQA 4AVNA 3SSJA 1FWRA 1RK6A 2ZXBA 3ITTA 1CCWB 3T4CA 3VU2A 3MDUA 4DF1A 1QNVA 4XBSA 4JTTA 7XIMA 3U7BA 3O7UA 3NGJA 3WBAA 2Y24A 2E6DA 1TTIA 1KLYA 1RCOB 4O1EA 1LWJA 3CUJA 1WOAA 1HXJA 3PJUA 1TV5A 1GG0A 3UR2A 2A85A 4LC8A 4F0MA 4QSHA 3UA4A 2FGZA 4EK7A 3ITOA 1OABA 1XF0A 4UTIA 3UD6A 4N9DA 1KD0A 2X1SA 3H2NA 5GJMA 2QW5A 2ACRA 3MA8A 4BK9A 5DX7A 1CXHA 5A6KA 1I1WA 3PPFA 4UOZA 3ECQA 5I3IA 3IVSA 4YTTA 1UIOA 2BOFX 3PSWA 2F6UA 1ECEA 2D0GA 3PJTA 4LAZA 3UWYA 3KBNA 1UWTA 3CAWA 5LGXA 3KM8A 2B7PA 4ILSA 1E56A 4L80A 1O7AA 4ZXLA 3DC8A 4O0ZA 4DWSA 4ZQPA 3DECA 4OOZA 1OGBA 2ZZ7A 1OFPA 2WNNA 1WV2A 5FJTA 3WMLA 1FRBA 2C18A 3PZMA 4DZ5A 3NZQA 4U28A 3YPIA 3UCCA 4ZB0A 4IMDA 3NGFA 3TCEA 5CC3A 2C6QA 4UMCA 4D8LA 4CNTA 1FCUA 3Q58A 2FH8A 3LHYA 4ZB5A 4MG4A 3FDGA 4F0HA 2PRMA 4NU7A 2NXHA 5BMWA 2HK1A 4S23A 3W3OA 3EMQA 3UU0A 4A35A 4GJ1A 1QOQA 4HB7A 1DJNA 3FEQA 4JL2A 2CWXA 2QXWA 4J3UA 2QCDA 3DKJA 2GVGA 4O1BA 2ZDSA 5IFPA 4LV4A 4IX2A 3EWXA 3N9KA 4LVBA 4MY9A 1B31A 4IG2A 4EVZA 1OM0A 1FBAA 3F4DA 2H9AB 2NVDA 1E72M 2FDSA 5FESA 2XVLA 4C6BA 3IAPA 2GUUA 3W7GA 5BRQA 1UP0A 4XD4A 1GVOA 3PN8A 2FH6A 1EO7A 2OYLA 4HNNA 1DTUA 4TX6A 4GQQA 3W1UA 3H7UA 4CN1A 4ICCX 2J74A 3WLSA 5A6SA 3VX0A 4MFDA 3WQ4A 4L4LA 3LGEA 3RJYA 3PAJA 1E71M 2XHYA 2YJQA 1M41A 2OZTA 1W9PA 2TYSA 4IX0A 1XQKA 1UZ4A 3V0TA 4XQ6A 2NT0A 3E1F1 3OLGA 4XTDA 4I5UA 4QAWA 1BF2A 2A6NA 2JGYA 3RU8X 4B3ZA 4I90A 5I00A 1DWGM 5AHLA 1C9DA 4QJ1A 1CGUA 3APGA 4DHGA 1W9UA 1XKJA 5M5DA 1E9IA 5BYWA 1OD0A 1AMYA 2X16A 1OT1A 2ICSA 2IXUA 5AC8A 4HSHA 4KW2A 1FH7A 4DJFA 2PTWA 2NSOA 4NUWA 2PDIA 2Y1HA 3UWUA 3BJFA 4EPBC 4Q8UA 3I10A 2NWRA 2Y70A 2H8ZA 2DU2A 5LNSA 3TJXA 2WMHA 3PHAA 1ME9A 4JOMA 3NQBA 1WDQA 1ZY9A 3HPAA 4HZ8A 2ADAA 3BLLA 3POCA 5A6BD 4KH2A 1YXDA 3EKLA 1VCGA 2VNCA 4GYFA 1ISVA 4E8DA 1X6NA 2W6RA 2E9BA 5GNXA 1QNQA 4PL2A 1XJBA 3L4WA 4NASA 3QV8A 1WXJA 1ITUA 4HMCA 4G1KA 4WDXA 4HOXA 4H9MA 1Q6OA 4CQDA 3TSDA 3W1LA 2E9MA 5FEPA 3W2MA 4UB9A 1LF1A 2IPWA 4JEQA 2QULA 4I5RA 4K38A 2BNJA 4F3HA 2F61A 3VX1A 1Q6RA 3N2OA 4L56A 2FPYA 1NF7A 1YTEA 3BH4A 3U4FA 2D22A 3NM3A 2ZCGA 1UA3A 1KW1A 4J7RA 5CXPA 5GJNA 1IWPA 2WLZA 3CV6A 3TYAA 3NO5A 3HIJA 2WANA 2CHOA 3WEMA 5CLWA 2PDUA 4MB4A 3SM0A 3AFBA 1E4IA 1R2TA 2VP8A 1E0WA 4IMGA 1XYMA 3VOHA 3HGRA 5D38A 4J3VA 3R0DA 4PBFA 2B7QA 3N29A 3L2LA 4QLJA 3SY1A 1LM1A 1TRDA 1EC8A 1E6ZA 3CWOX 2CC0A 1YBQB 3BSHA 1UH4A 3PBGA 3H2FA 2GGEA 4P2VA 4ZTYA 3S1GA 3W74A 4S3DA 5FF4A 5HULA 2BBFA 5C2XA 5BRPA 4KPLA 1OC7A 2ATSA 1S2AA 4DO6A 1BSIA 1EKOA 4KEVA 4E38A 3AHXA 4Z1AA 1R86A 4YLWA 5C9UA 1LTDA 2WC7A 1YDNA 3A3XA 2QEZA 2WZIA 5EMJA 4LBRA 1R2RA 2QCMA 5CCZA 2OO6A 1B0IA 3HA1A 1RAKA 2Q8XA 3E2QA 4HMEA 2E8ZA 3QRHA 1UA7A 4OTKA 2F9RA 2PWVA 2DZXA 4XD3A 1W3JA 5BU6A 3WMSA 4HPJA 1Q8AA 1TG7A 3UWEA 2WBGA 4GQ0A 5FEXA 2PWHA 3EGJA 4JKMA 3E9AA 4LPCA 3NQ6A 1UR3M 3BW2A 2Z26A 1NFPA 5K9XA 2EJAA 1BXNA 2WM0A 4BJHA 1HJQA 3L5MA 1G4PA 3LZ5A 1LT7A 4LRTA 1Q63A 4KT2A 3QM3A 4INFA 4H1ZA 1WUFA 2E6FA 5D9OA 2R91A 1F8MA 1UUOA 1QPOA 1M7PA 4CCZA 1TKKA 1TWIA 4NJGA 5ABFA 3W73A 1PKMA 2BP1A 2OVLA 3GAKA 4IGMA 2QJJA 1LLZA 3B4YA 4AHPA 4FB7A 4ACZA 5K9CA 4OIFA 5KETA 4I5XA 3CUHA 2REQB 3TQ0A 3GDTA 3DH7A 5DY3A 4MJZA 4YHGA 4D6EA 1YIXA 3JR2A 3KVLA 3MTWA 3UZJA 2DT0A 3K8KA 4DZIA 1UZDA 4BCEA 1GONA 4YTQA 3IIOA 3TZNA 4FIQA 1IIHA 2QCCA 1XUZA 2FFIA 3UZWA 3RDKA 3W1XA 2TSYA 2FZDA 1GZGA 1W3NA 1VFHA 3CMJA 4F2BA 3MZ2A 5H6HA 3HV9A 4DPPA 3O63A 3M0KA 4OUEA 3AJXA 4ZTXA 3RGTA 2UY3A 1JPKA 4MB1A 4EWND 3W4RA 4ZOAA 3GHRA 3KX6A 4FLSA 2WKLA 3L5AA 1VRXA 3W82A 2DW7A 1XSJA 1DIOA 5HANA 2CWNA 4L64A 1V0KA 2PBGA 1TE1A 2DJLA 4H9VA 4F79A 3WFLA 3S6OA 4PMOA 1PHQA 4OT7A 3VIMA 1RSCA 3SI9A 5HNNA 2ON3A 2PODA 3MJMA 3I3BA 5AYYA 2WAGA 3M41A 1QI4A 1KFJA 1FHLA 3W00A 3VDHA 1I8JA 4HSNA 3I3DA 4CD6A 3QC3A 1LLOA 4BQ4A 3U2OA 1ZB5A 3W1RA 4XBJA 3KVJA 4I9MA 2PGFA 4CEUC 4JD4A 1DQUA 1V02E 1FWBC 5M17A 1ZAHA 4EPEC 1TO3A 4XISA 2OYKA 4JQ1A 4FR1A 3LOTA 4G7FA 2AGKA 5AN7A 4MNKA 4KCTA 3NZPA 2C13A 4C1LA 2WMKA 4JIRA 3CIVA 4EE9A 3A9IA 3VIFA 1SFSA 2ISFA 3EB4A 4MOZA 4K8HA 2V67A 4EKJA 3AZSA 1PV8A 3VOCA 1OF6A 3GXPA 3IV8A 1TA3B 2YL5A 3LV5A 4YHEA 2WWCA 4GGBA 5H8UA 3NM1A 4XSLA 1TJPA 4KCWA 3BLDA 1JDDA 3UPWA 1O94A 3WH9A 3A5FA 3QGVA 1KM5A 1PUDA 2VR4A 3UXDA 1H62A 1HN1A 1F3WA 4X61A 4YNGA 2DPEA 3MC5A 3GU2A 2G5WA 3EAUA 4HA3A 1W3KA 4DWSB 2XDFA 2QDDA 3GNPA 4HZMA 3W2KA 4OJYA 3CQHA 5DT5A 3VMNA 2J8FA 4C1KA 3R5EA 1XDLA 1XDJA 3JZUA 1VIWA 2XN1A 3TE9A 2PB1A 3UG5A 1GZ1A 4S3AA 3ME3A 4W89A 1P6BA 2AMXA 1FWIC 1JCMP 1HNYA 1V51A 4B4HA 4RNJA 1PO9A 1G69A 4U2ZA 2O9RA 4FZIA 1WDRA 4RR4A 2PFHA 4WK9A 1EC9A 2QCDB 4ZL1A 4FLRA 2O55A 5A8NA 4FXSA 4KEZA 3S83A 2F2HA 2FQIA 1BKSA 2E5BA 3T07A 3TN4A 1C91A 1XLJA 4BI6A 1PB0A 1W8SA 4E2VA 2ABAA 2HEJA 3LCLA 1JDFA 3SUTA 3TYEA 2NXIA 1KM1A 1MUCA 5D4YA 2ZDRA 1CNVA 4RE4A 5A6MA 1TV2A 3GXNA 4FO4A 1Z42A 2XJ7A 3UG4A 3QOMA 1S2CA 2PWUA 2WHLA 1LL6A 1XLBA 1QOPA 1I4NA 3N3MA 3PJWA 2NUYA 3DFTA 3LK6A 4KEUA 3TN6A 4X9SA 4IXHA 2VYOA 4Q4KA 3QFWA 3AMGA 1A5OC 3G24A 1FFQA 1XSIA 3Q4DA 2IMRA 1TMQA 3G1YA 3LI0A 1PYMA 4AUBA 1JG9A 4A3QA 3WDQA 3VAVA 4C90A 4IUOA 4Q8NA 1M3UA 4IF2A 1TB3A 1IEXA 1RXOB 1GQIA 1WCGA 1V8EA 3WJSA 1V7AA 5ABEA 1VHCA 3FFSA 1QVBA 4O0KA 3T44A 3RX3A 4FR6A 4O16A 1E73M 1JZ7A 1OFEA 4U31A 1D7FA 4IMAA 3NEHA 3QHOA 3TWAA 3WNPA 4XV0A 4HU3A 1MEIA 3WCZA 2GFTA 3GG1A 3HQ1A 3VNLA 1JR1A 4IH3A 2XFFA 3KTSA 5A8MA 3N2XA 4O50A 1RLDA 1E43A 4V15A 3W2UA 3CH0A 1TV4A 3PTKA 5AYZA 1SJAA 3ZVIA 3RR1A 3RMEA 4K37A 1QFEA 1QAPA 3FJ4A 2A7NA 4NX5A 3MMUA 5FSDC 2A2IA 1EX5A 1ZNNA 2GWGA 1XDMA 2R6OA 3CPRA 1NP0A 4RNHA 1Q6GA 3EDEA 4JN8A 3VOIA 3ORWA 1H60A 5DMLA 5I6SA 2XZ9A 9XIMA 2JF6A 4C7FA 3W22A 3W27A 3AYTA 3G6LA 3QF0A 3AIVA 1IZCA 3WBWA 1U22A 4TR9A 1SQ7A 1ICQA 4DJDC 1W1A1 4P8WA 5JMUA 1XLMA 3IUHA 1OB0A 2WKGA 2PZNA 5DANA 1OG6A 4AY8A 1OWQA 3UVIA 4D9PA 5ECUA 3EEGA 2V9DA 3TQVA 4C6JA 3TTEA 3O05A 2GUBA 1LZOA 1G0CA 1BKHA 1Y5XA 1XIIA 4WKAA 4B2DD 1XR2A 4BKNA 2HISA 1XXXA 2V5CA 2I7GA 4AVOA 3LXCA 1Y0EA 4DI8A 3WLPA 1W1PA 2J88A 2WQPA 3SZ8A 3OVPA 3SEPA 5JUVA 2HMCA 5C8BB 1CYGA 2UY2A 1IZJA 1CTNA 1W2VA 4IXXA 3A4XA 4E2DA 4AZBA 3P8IA 3R25A 3PUEA 2QS8A 4GJJA 3RLVA 3TLLA 3NQVA 1KBJA 2VOMA 8A3HA 1ZENA 2RHGA 3CL7A 1LJYA 2PDJA 1EB3A 3UZXA 4B16A 1KWGA 4X60A 3UR5A 4W93A 2OEKA 5CPOA 2YCEA 3EPOA 3EOUA 2VT0A 4M51A 3CZLA 4P7NA 4YVXA 3T1GA 1JAEA 2DZUA 5DXXA 3BWWA 2NX3A 3B0VC 5AC4A 1BRLB 2R14A 3QQWA 3IRSA 3PBVA 4UMBA 2WMIB 2RFGA 5E6YA 2J7FA 2YKKA 1TE6A 4GABA 1J5TA 5D9MA 3WUGA 5EFDA 1ZP3A 3W1TA 2O9PA 4C6CA 2VX4A 3KCLA 3AUOA 1NWSA 2NVCA 5C71A 4GCXA 4K7YA 1A0CA 1MXSA 2HK0A 3DEQA 5ABFB 2NUWA 1Q3NA 1SFTA 3W81A 5T26A 1JPDX 3PTDA 1OIFA 2G50A 1KBIA 4ACZB 4YIWA 2PDGA 3OYZA 4P61A 1WAWA 2VEGA 3CV2A 1G4EA 3W2NA 5I06A 1EJUC 3CEUA 1VD6A 3L4ZA 1XW8A 2VOTA 2G0WA 4PUMA 3LTYA 1MZHA 2CW6A 3I7QA 5E0FA 3DBNA 3VNJA 4A8NA 1RD5A 5LXEA 3IIPA 2YLLA 1PHWA 1PDYA 3IJ8A 4HK6A 1XS2A 4JIIX 4FS9A 3KHDA 4L4PA 3BVJA 3W7EA 2YBVA 4IP4A 3CZ8A 4Z17A 3W1NA 5IHSA 8RUCA 4GZ7A 4MB3A 4A8IA 3VGBA 1UWIA 1BD0A 3W07A 4G9PA 1TPEA 1WXYA 2O56A 4ICMA 4US6A 3WDRA 4QQ3A 3ID7A 5LIXX 3PULA 5EMKA 1NP2A 2ZZ3A 3SECA 4MAVA 2DZWA 4CD4A 3PM6A 2XVKA 1ML1A 1MZRA 1ITXA 1XG4A 2YYTA 4WF7A 1XFCA 3HGOA 4RZ4A 1FP8A 3C61A 3TJLA 1WXZA 2WBKA 3IAQA 4H2CA 4NJKA 1T0OA 1TUFA 3R6IA 3GBDA 2MANA 3SB0A 4C6NA 1DWAM 1KB3A 3L23A 2X40A 4CCCA 2F6XA 2PCQA 3EOOA 5A8GA 4RNFA 4LCSA 1LQ2A 1UPPA 2WYSA 4MWAE 5B7ZA 3MCNA 1N8FA 1KR0A 2Y88A 4C6DA 3LDVA 3SCQA 1O1ZA 1A5NC 3W25A 1QATA 2IKJA 4HSOA 3ZM8A 2ASHA 5L6UA 4N9BA 4DAIA 1EHAA 5DO8A 2GSJA 4YYFA 4EF8A 1W54A 2A6LA 3VKCA 3K30A 4Q3MA 1PZ1A 3FA3A 3UG8A 2QJGA 4AVFA 2E67A 4C1NB 4LBSA 3A4JA 1K03A 1EEXA 3TWBA 1WDDA 3NL3A 2V68A 4UCFA 2OQLA 2FYMA 4JYFA 2AQOA 1FCQA 4HT3A 4ZOBA 4A21A 3IJDA 1ISZA 4JQ3A 3E0IA 2VEMA 4ZODA 3SCWA 2YL6A 2OO0A 3APYA 3GXDA 3QLDA 3B8SA 4F0RA 3AIWA 2HBXA 3P6LA 3UXAA 4WX2A 1HZYA 1LRNA 3AO0A 2OGYA 2X0HA 3B9AA 3QGAC 4PCSA 3GZ3A 4IISA 2OT0A 3V4BA 3MQTA 1CXEA 1X6UA 2Y5EA 6XIAA 1SMAA 1GYLA 4PBGA 4JCLA 4ES4A 1HVXA 3K2GA 2B7OA 1M04A 1UJPA 2OWWA 1EDGA 2E9LA 3S5SA 1V6TA 4NT0A 4LT9A 1TIWA 3VKKA 4DUXA 5HNUA 1O95A 4J3SA 1GVSA 1GEHA 4S1FA 1S2UA 4WXZA 4KWSA 5IBXC 2OOGA 4UTKA 4CQCA 3VC5A 2XTKA 3BV4A 1ZQ5A 1DWHM 3WDJA 3U6WA 4QP0A 3M5VA 2A3HA 1C93A 2WW5A 1KFWA 1XLHA 2B0MA 1TREA 3EMZA 3NPUA 3O8AA 1M7OA 3LPFA 4O1FA 5LHFA 1XCWA 3QMTA 1FWDC 4D8AA 1KCXA 1AODA 1C7TA 4YVPA 2I14A 3BMVA 3E12A 4G8TA 1I2PA 2VQUA 1TPVA 3UA3A 3QFEA 1W5QA 2PF0A 2XYLA 4CLMA 3WQOA 4DLMA 3MVIA 2QUMA 3RRXA 1GWJA 4PTDA 2DT2A 3KRSA 4MJ4A 3FKKA 5AC5A 2FZMA 2GJPA 2MUCA 3LHUA 1V77A 3RPTA 4ONVA 1EXPA 1BVZA 3VZZA 3S42A 4TVUA 1JI1A 3OBKA 1Z89A 4M1BA 3AMCA 3OTRA 4MHBA 3UWQA 3GM8A 4XZHA 3DFNA 1E0UA 2D3NA 3DGBA 3GFZA 5FJOA 1L6WA 3EX6A 4WJXA 4XG1A 2AOSA 3PWGA 4US5D 2NQJA 4D2JA 4P7LA 2J7CA 1V3MA 5DMMA 3DN5A 2AQWA 3PNZA 4ZOEA 3WNLA 2DIEA 4KWUA 3LZ3A 5E9XA 1UR1A 1HJVA 4J1OA 5MHBA 3KEHA 3WH6A 1HT6A 3MBDA 3QW3A 4LANA 1MQQA 2W63A 2GJLA 4MVAA 2NQ9A 4WR3A 2Y7FA 3UJ2A 1NQ6A 2QDGA 1E51A 3H7VA 4JTGA 1V4YA 4B5UA 2ZKMX 4IJRA 3BTNA 4J5NA 1VS1A 3B4UA 3BAIA 3O2LA 4WXYA 4BR1A 1CECA 1B9BA 2BODX 2WCAA 3W29A 2FTWA 1GHRA 2V5BA 2Z29A 4NJHA 1JZ3A 3AIQA 1KRAC 3N04A 1H7NA 2Q01A 3URAA 4PMYA 2ZZ1A 3WENA 3ARSA 2YX0A 5CPQA 3WUFA 1W1ZA 1XLLA 1J4EA 3CS2A 4C5ZA 4CNOA 4XVEA 2ZADA 4EAYA 4B5VA 3MUAA 4HA1A 4O10A 2OOFA 4W8BA 1R9ZA 4GNVA 3GXTA 1VFTA 3DHPA 2KZHA 3BMWA 3N18A 3KUMA 2DZPA 2D1ZA 3UZ5A 4XB3A 3H4WA 4B5TA 4JTFA 2HCVA 3OIHA 4RL3A 3H2MA 4YXGA 2Z28A 4UQCA 3KP1A 5E0KA 1ZCCA 2QDEA 5CQ1A 3H26A 3ZMRA 1ODZA 3TROA 4O28A 2VRKA 3W87A 3OLIA 2VHLA 3D3FA 4AH7A 2D24A 1PYFA 2O7QA 3KRUA 1XHGA 4HN4A 1I0DA 3FW6A 5HPOA 5AC7A 2R1LA 4YWIA 2VENA 3FV9A 2PTYA 3M0YA 1D2KA 3UNTA 1BWLA 4UFHA 4TVCA 3CNYA 1PEZA 2YDRA 3TXZA 4JIQA 1RZMA 1ZFJA 1W56A 3DHFA 1YTDA 3KFTA 5BMXA 4GVGA 1BGGA 3GXFA 1M9HA 5CBBA 5FL0A 2QQ6A 2PWDA 3MUCA 1FH9A 3OODA 4AZGA 1VENA 4PMVA 5JH2A 1I2QA 4FNSA 1ZHAA 4NXSA 1OZMA 3NVTA 3TAKA 3LB0A 4A6GA 3GXMA 3IUDA 4MWAC 3S2CA 1VEPA 1EBHA 1UD5A 4WCJA 4OKDA 3A3HA 2YR1A 4HTYA 4GX9A 2J25A 2E1DA 4B5SA 3W7LA 1ZCOA 1XFBA 2XISA 1R3TA 3ZJKA 4Q7BA 1F76A 1TTPA 1ADOA 4DUOA 5C55A 2G37A 5H8PA 1P0EA 3M6YA 5JIWA 2VEKA 3MV01 1V0LA 3RM9A 4GQRA 3U5UA 4PRRA 3S6TA 1AJ0A 5JXQA 1K1DA 3W01A 4LYQA 1LYXA 3R43A 4HMDA 2BASA 4PN2A 1J0IA 2A7RA 4K7VA 3TTYA 4AZHA 4AF0A 3BLIA 1JCTA 3BARA 3CPUA 4ZBCA 4J4KA 4NX0A 3G1XA 3GHTA 1TR9A 3AIUA 1ZJBA 2BMBA 2WM1A 3STPA 1NEYA 1RCXB 1K7XA 1ZJAA 4RW3A 1XRSA 2YW4A 5M2FX 2PP0A 1V79A 4UTFA 4GHRA 1QXLA 1YW1A 1K9FA 2B81A 1ZBVA 3PBYA 3H55A 5HWMA 4EXAA 2Z00A 4TV6A 1IV8A 3KP0A 3AXMA 4P7RA 4LS0A 1A5SA 4BY3A 2VFFA 2W27A 3RG6A 4DO7A 3ARRA 4IIFA 3SQSA 3UG3A 5FSEC 1OCNA 4AZIA 4HHPA 3MSRA 1GYNA 2ACSA 2EPOA 3C2YA 1SSDA 3SN4A 3QY8A 1UH2A 4UTWC 1JUBA 2PD9A 2GGGA 1I60A 3E02A 1O68A 3H54A 1ZU8A 5BRBA 1PTAA 1Z6KA 5E5CA 2XGIA 2OU4A 1AK5A 4JPGA 1HJXA 1JIBA 4LH8A 1MEHA 5HDRA 1JZ8A 1C3FA 2V8ZA 5HWNA 1QI5A 1FWWA 2OEMA 3URNA 4YU1A 5HUPA 1VC4A 4AC7C 2F7FA 3WX7A 3W71A 1MDRA 1YPXA 3H8AA 1F6PA 4AFYA 2GQ3A 3ZJ6A 1N2VA 3SGZA 1A5UA 4JFUA 4UWMA 4EXBA 1UKOA 2RDUA 4NILA 3SURA 3G8RA 4RDVA 2WHJA 4DO5A 4J3WA 3WNNA 1G67A 4Q8OA 4DJDD 3OYXA 5I3DA 3BG3A 3JRKA 4V28A 4TUFA 4BF7A 3TJIA 2MNRA 4W4QA 4H83A 4W7VA 1RPKA 4GY7A 3B0PA 4JDBA 1AH4A 1F3XA 1GOOA 2BZNA 3VUPA 1SPQA 4JKLA 3W0KA 4GWEA 1E0VA 1RY8A 1AUSL 1GZJA 2GOUA 4HYRA 2V81A 3GC5A 4RDYA 1VLIA 3CT7A 1QCWA 2Z1WA 4MZ1A 4LRSA 4TU1A 3S46A 4HCHA 3HGSA 4UCGA 4XZ9A 2IPFA 3CC1A 4Q7IA 1FP9A 3AOFA 2WC3A 3WNOA 1UB3A 3VM5A 1B3OA 2CBUA 1RH9A 3SIMA 1E5JA 1O66A 1UR2A 1OYCA 4Q33A 4WOQA 5D2XA 4ATWA 3GKFA 3P80A 4GI8A 2OEJA 4BEUA 2ZTKA 4RK8A 5C9RA 2FHFA 5LA0A 4DY1A 3VKBA 3S4TA 2GJNA 1BYCA 4DBUA 3PJXA 3LHZA 2I5QA 3VNYA 2PTZA 3TR9A 1XRFA 2DSVA 3MP5A 1NJJA 4H9ZA 3KRBA 4MDPA 1OX4A 1FWAC 5BWAA 1H2JA 1TFVA 2Z0IA 4H6EA 5HQMA 4P8VA 4AEEA 4Z08A 3IV3A 2C1IA 2QGHA 4UZSA 3LBCA 3KBMA 1GQJA 4IMEA 1A49A 3W7KA 1GW9A 2PCEA 3O07A 3U9IA 3F5LA 3T0BA 3G1RA 4WDTA 3M9YA 4UTTA 1OCJA 2J13A 1DEDA 2GPTA 1CB2A 1FDZA 3L4TA 2WVSA 2CEQA 4LYRA 3M7SA 3ARXA 1EZWA 3LCIA 5HAOA 2VFHA 5LNVA 3TA6A 1HKJA 1RPXA 1REQA 3LM7A 4GIEA 1GKQA 1D7KA 3VVGA 4FNPA 3U57A 2EPNA 2ZUSA 1UD2A 4KGJA 5FAGA 3ABZA 4OGZA 3PTQA 3WO8A 3N14A 2C79A 5H91A 1BF6A 4ZMGA 4BI5A 1VBRA 2VXNA 3H12A 3LNPA 4UFLA 1FWCC 2VC6A 4UXDA 3S9YA 4Y7EA 4O1DA 3BICA 4ADSA 2UZ9A 4KWVA 5AHIA 4D6HA 2WSRA 2DGAA 5I0DA 1UWAA 4HHLA 3GH4A 3KL3A 3BGGA 1DHKA 2FTPA 4RE0A 4LW7A 1VGAA 1MUWA 3QW4B 5CKSA 1MQPA 3CUIA 4QJ3B 3SCRA 3QZAA 3CIWA 3DHDA 4N4QA 3CMGA 3MHGA 3ITGA 4F8XA 3G5EA 3WKZA 1EEPA 3XISA 1IEIA 3HTWA 3UEQA 3QSRA 4TMCA 2I9EA 1SO4A 1X7FA 4OBRA 1IWBA 2VKZG 1UC5A 1G7UA 1TVPA 3AXHA 3QEZA 3WD1A 3UETA 2E5DA 1R30A 3I6EA 1I2NA 3D0CA 5REQA 3VO0A 3DAQA 3ARYA 4AWUA 1J10A 1RR2A 3L0KA 2BGSA 4XUYA 2OWXA 3VDCA 2DP3A 1EA9C 3FA4A 3M0LA 3JW7A 3VM7A 2CXEA 2H90A 4MAZA 5JVLA 1XIHA 2CHNA 4RXGA 1DXFA 4JY9A 5C2CA 4AX6A 1SZGA 4M7TA 2VCCA 4NJJA 1UC4A 1POJA 1MSSA 3VKJA 1U30A 1QPNA 1Q6FA 4GGHA 3QBUA 2GK1A 5HMDA 3UYIA 1UD6A 4P8XA 3ABQA 4JGDA 3ZJ8A 1UP3A 4JYEA 1OGGA 5T8GA 1A5AA 1I9CB 2UBPC 3WBXA 3B0UX 2VZOA 4NZ1A 2NQZA 3GE7A 1PZ2A 2PEVA 2X2YA 4RZBA 3ARVA 3COTA 3M5ZA 3WLTA 3JZEA 4LB4A 4U3AA 1V3LA 2EKGA 2PC8A 1G4TA 2ZUTA 1UR4A 1QHOA 4B92A 5A1AA 1R47A 3U4AA 4J2MA 1L6SA 4F9DA 1A5CA 4HYVA 4HHMA 3WQVA 1A0DA 1ADDA 2WCGA 4S3FA 4CQ8A 1MXGA 4L1WA 3P60A 3VE9A 4FX8A 1J18A 3SIZA 2XFRA 4I7WA 4E8CA 3ZSTA 4MKNA 4XAPA 1H61A 1ELSA 2VFGA 1G5AA 1X6LA 3GVRA 4HCDA 3N2MA 1US3A 4J2PA 1DIKA 4WLCA 4ZR8A 1JNDA 2E5CA 4KETA 1OC6A 4ACYA 4QE1A 2CESA 4I7VA 3WH7A 1E9YB 2Z4GA 1FWSA 4GG9A 4DI9A 3K13A 1OQFA 4IFKA 3ABXA 2Y7GA 5HJYA 3WQFA 3KL5A 5I07A 4N9EA 1MNZA 2Y8KA 2XGZA 1OD8A 1OFAA 4GFIA 1IXNA 4RZ5A 2NV9A 5D30A 4B3KA 2JFEX 5FF2A 4C6PA 2NWSA 3CO8A 1V0MA 2J9ZA 3SRHA 2ZWZA 1XIFA 3OBEA 2CKRA 3OHMB 1BQCA 2FIQA 4CCDA 3BG9A 3C0LA 4CEXC 2QR6A 4NKCA 2XIMA 5AYXA 4AF0B 4BF5A 1SU5A 9XIAA 1XYCA 2XSXA 1LG2A 3GG8A 1EQPA 3UVAA 3T42A 2OSXA 3NQMA 3KDNA 2JF7A 3TNOA 3MBFA 4L6DA 4V1XA 2G96A 1F2JA 1O6IA 3MVTA 4NAEB 4PE8A 1SO5A 1HKIA 1Q2RA 3SCOA 4GH1A 3IVUA 4N42A 1WUEA 1NOWA 2GUYA 1S5VA 3VILA 4XUGA 2RJGA 3PWIA 1TYGA 4G2DA 3S5OA 3VNZA 1K70A 3WLOA 2C1HA 1QNOA 3LCFA 4IPPA 5CGMA 7ENLA 4FOJA 3VZXA 4RUBA 2OX1A 2WZMA 4AWEA 4L6OA 4CVWA 3W1PA 2CLIA 4M7SA 4C6FA 1Q6LA 3G3DA 4GNJA 3R2GA 1EJSC 2YCLA 3DDMA 1NSJA 2PUZA 4TX8A 1XKYA 3SRFA 2QYGA 2CBJA 2P1FA 4LAUA 1R9XA 3ABSA 4QBXA 3CIXA 1SW7A 3N9RA 4LCRA 2Y4SA 1H7PA 2PWFA 4PMUA 4OVXA 4JTHA 4J35A 2BV9A 2QPSA 3KLKA 4K6AA 1S46A 5HR7A 4LF1A 3EB3A 3AS2A 3VINA 4LVAA 3TOPA 2VVNA 3S1WA 1MRAA 3IIZA 2V30A 3OHIA 3NL6A 3EOSA 1KXQA 4MPKA 3K1GA 4WD0A 1E6QM 2GVJA 4CD5A 3F4NA 1TWSA 5AVNA 3EWZA 1XUUA 3FYOA 3NSNA 3DKLA 1R46A 3STFA 3HF3A 3CYJA 3LRMA 4D6CA 1FHVA 6XIMA 4LNYA 3ONBA 1XWYA 1XYLA 1E3ZA 4IP5A 1GUVA 4HPNA 4XZIA 3CB8A 2QVHA 1F5ZA 1ZL1A 4MY1A 1RBAA 4MNMA 3ITVA 5I03A 3T2QA 2VELA 1JCLA 3DI1A 2VURA 4MNJA 3BUVA 4LSBA 3VC6A 5AECA 3FVMA 3HB9A 3OLDA 1W9VA 3DXIA 4FAMA 3KWSA 3GC2A 1DXIA 3SJ3A 3RRAA 4K8EA 4IZGA 3TFCA 4JZ5A 1TWWA 3AIRA 4JFTA 4GRSA 1PIGA 3EOLA 3E0VA 3KZPA 1VQTA 1ZUAX 4K39A 3N6JA 1T7LA 5F4SA 3KBSA 3M5YA 2CLEA 3QYSA 5C70A 3LA4A 1M6JA 4CD8A 3EX3A 2HZGA 4HNOA 1JVNA 5B7YA 1SR0A 4LVDA 7REQA 1H63A 1IF2A 2CLPA 1JCJA 4LEQA 1OX4B 1GPFA 3OA3A 2ZRWA 1RHCA 5K9DA 1LBFA 5LXXA 1L2QA 4X2PA 4HP5A 2VDIA 3KL0A 4XD6A 3VGHA 4MKSA 3ITLA 4JL1A 1XLAA 3ABRA 1CGWA 4UBPC 5TF0A 1K77A 4PRTA 1IXQA 5AC6A 1XL9A 4MWAD 1H49A 1SJDA 3KRZA 1Q7MA 3QV7A 4AD1A 3HGJA 1YEYA 3L5LA 1RA5A 4UR9A 1CEOA 3STCA 3MI3A 1JCYA 2ZRXA 5XIMA 4KESA 3VIGA 4QNEA 2PDLA 4W87A 5CZJA 1WKEA 2LLEA 3W37A 4NI3A 3PB2A 1T8XA 2G3JA 2D2HA 3W88A 3P81A 1JD9A 4M56A 1AH3A 4C6QA 1WZAA 4GKTA 1WP6A 3AWNA 4MLRA 3EXTA 1JFHA 2HJPA 3G18A 1VEMA 5D05A 2ZFAA 2V63A 3H23A 1W5NA 1YDOA 1CIUA 4Q4PA 1W1IE 1US0A 3PP7A 4A3YA 4EXQA 2W79A 4W86A 4K2SA 3L2IA 3LXBA 5CC7A 3GVWA 3S1XA 4HNTA 5HQLA 2YLAA 2QIIA 3OG3A 5BOFA 1RV8A 4L1GA 2J7GA 4WJEA 1Q4NX 1V7YA 3RCNA 5CPNA 2VX5A 4JHMA 1PVNA 1VYRA 3MDWA 4DRSA 3S5ZA 2RDXA 2OX4A 4R53A 3BPWA 2PTXA 3LGDA 1XLKA 2WZTA 4GUJA 4HPGA 4PULA 3O9NA 3LI1A 2XVGA 1BQGA 3KTCA 1EF3A 5REQB 1GVYA 4IQEA 5AOUA 4CCEA 3W83A 1JXKA 3C0SA 2XSBA 3UWWA 2F84A 1YE6A 4PTMA 4AIOA 4X3ZA 1UKTA 3W7NA 1KLZA 2FLIA 4OE7A 3W7MA 1QMLA 4M6UA 4N6EA 1EP2A 1FWJC 2OQHA 3RCYA 2ZOXA 3NURA 1XH0A 3TNBA 3RJXA 2FJKA 2QJMA 1DP0A 3P7YA 3T0TA 4JN6A 3DU0A 1EX1A 3GRIA 4O1AA 4HGXA 2WMGA 2R9RA 4KFNA 4RPPA 5KZMA 1KBKA 2PS2A 2PI6A 2Y89A 4X22A 3WK2A 4QEHA 3TU9A 4H9UA 4ZA0A 3RN6A 1UHVA 2WJZA 3WF2A 4XD5A 3O6DA 2WSQA 4ZO9A 1KXHA 4U10A 3GR4A 2PWEA 1EJTC 1PWLA 5G1MA 3BQ5A 3PG8A 1JXJA 1X7IA 3WQGA 2QZRA 1P43A 4DNHA 1N55A 3WLHA 3AIBA 2ZZ5A 1BWVA 5TAOA 5A95A 2YXOA 1QK0A 1XYAA 1QPKA 3BLOA 1KCLA 5A6AA 1UMYA 2NW0A 3BURA 4O4VA 3O06A 3EKGA 1S1RA 3NQAA 1Q13A 1JDEA 3TW9A 2HE5A 3ISIX 3KTXA 2BOGX 1TCDA 2Z25A 5AZ1A 1TJ0A 3PG9A 1UR0A 3AU6A 1C90A 3CQ0A 4IIDA 1TMLA 3BJTA 3LBMA 5C7VA 4MLJA 4O53A 3HMCA 1VJSA 5LIWX 4PTVA 4IFKB 1SO3A 4PA8A 1GNXA 6ALDA 3H53A 3CQJA 1EC7A 3BCJA 1AA1B 3PFRA 3LCWA 2P0IA 1W5PA 3VTRA 3WD4A 3IJIA 3QQ1A 2Z24A 3ZYZA 4MF4A 5HNRA 1LCOA 5G2HA 2POZA 3DI0A 1GOWA 4MJ2A 1CDGA 3WQEA 4Q8WA 5BOEA 2VGBA 3TVAA 4AD0A 1DJGA 1LOLA 4UTLA 5C5YA 2QLYA 5KMYA 2V5LA 4S3EA 3O6CA 1HKWA 5TD4A 4GFSA 5TBOA 6A3HA 1R2SA 1C92A 4H01A 3EWDA 1ISYA 3F2DA 3BC9A 3CZKA 3USBA 5HQEA 2C16A 1DJZA 1XBVA 2OB3A 5ECVA 1B3XA 1SJBA 5I3FA 2O9TA 1F61A 2YBUA 4IL2A 1HJSA 1BWKA 2RKXA 3UJEA 1DYSA 3E5PA 2V2DA 3AZTA 4KKXA 4HA0A 1VFUA 2DVTA 3A47A 4YN5A 1IEVA 4TTUA 2HPIA 4L9XA 2PGRA 2CITA 1J11A 3L21A 5CC5A 3RO6A 2YCLB 2PGWA 1Z41A 3HZ3A 3OBAA 2O9OA 3SUSA 1SMDA 4Q4QA 5AVHA 3VGEA 2C3ZA 4M24A 3VPLA 4YTRA 3WQDA 3N2BA 4BHYA 3SAZA 2Y8VA 3R7MA 3HM7A 3ALFA 4PGLA 2J75A 2DIKA 4Y9MA 1XGDA 2PAJA 1WKYA 1R7AA 4G56A 4GKLA 2H6RA 4HJFA 4QAIA 3WJXA 3AXKA 2ACUA 1ZP4A 1CGYA 3TZFA 1U2YA 2X7VA 4GQGA 3GVGA 4UR8A 3PBUA 4IQDA 3RO8A 2G3MA 2NV1A 3KOZA 4GY1A 3SBFA 4AWSA 4AAJA 1XIDA 1EQCA 4R7JA 4RPQA 2H3DA 3U0HA 3WZ0E 1OYAA 2C7FA 1RJQA 3A64A 1E40A 2P53A 2WJFA 1O60A 1I75A 3S2JA 2ZQ0A 1C8XA 2YXXA 1XIMA 3PANA 1ONRA 1C8QA 4XO7A 1OHLA 4IWWA 3W23A 3ALGA 2ZX7A 3N4FA 3CAVA 3DCPA 1F3TA 4D71A 4H4IA 4O52A 4QTGA 3EYPA 4IPLA 1VKFA 3WQWA 2NQHA 1I45A 1GGOA 1FWHC 4PTWA 3NZGA 3ES7A 2WHMA 1JZ4A 3NDYA 4WJ8A 3CUZA 2RDWA 2PDBA 1TA3A 1N82A 2XH4A 4AC1X 3LN3A 4O4WA 2AL1A 2CIPA 1DKWA 3NPVA 1ZRQA 4LYPA 1EJXC 1QPRA 4Y8FA 2V5DA 1HF6A 3ATZA 2O7SA 3HG3A 4LXFA 1XIEA 8CGTA 2NVAA 3TOYA 2DUAA 4L9YA 3KHJA 4JIEA 1B3YA 3LCGA 4DJEA 1NWUA 5DF0A 3LHTA 3L9CA 4PEKA 5JBFA 1KFLA 3AXIA 4IP7A 1RA0A 1Q6DA 4PRWA 4PC8A 1EL3A 2Z2AA 7REQB 4CU7A 2GLKA 3MT1A 2B4GA 3UESA 4YMZA 3HV8A 4FXRA 4PFMA 4BS0A 2V3FA 3N4AA 1D8WA 4Y9OA 3T8QA 3NWRA 1I0BA 4OOUA 4U5KA 3KW3A 3LRKA 2PDHA 3GDKA 2OODA 3NQGA 4ZQOA 3UY7A 4H8NA 3GKAA 2E28A 4Y9AA 1Z69A 4ASTA 4DWSC 3ABOA 5TQLA 3D6NA 1RJPA 1E4NA 1BPLB 3G0XA 1XCFA 3CYVA 2QGYA 2ZVRA 3UWZA 2YCIX 4H3DA 5KINA 1A3XA 2NX1A 3GTHA 3STGA 3RLUA 3NQ8A 2IKGA 3XINA 3LENA 2OZ0A 2BY1A 3AC0A 1UZHA 3GX9A 3M64A 2DIJA 1PPIA 1WQ5A 3MB9A 5LIUX 4FLQA 2FFCA 5CPSA 3M43A 3QHMA 1RJRA 4OU1A 3W85A 1CENA 2HS6A 2WC4A 1W91A 3M0MA 2BY3A 1GVFA 2QVNA 2WXDM 4GXWA 4C6EA 3W7IA 4NSBA 1A47A 4TMBA 3IJLA 3BMXA 3TC3A 1ISWA 1EUAA 1AVAA 1VR6A 1Q65A 3VIOA 1LORA 1VBGA 1POKA 4CU8A 2DORA 5J8LA 5HUOA 2XN2A 2Q71A 1TSIA 1LLWA 1H3GA 2HWGA 2BWGA 3KS6A 3BXWA 3C5QA 4XZNX 4XZBA 4PFHA 3SY5A 1JFXA 2Y63A 3F2BA 1EXBA 2QV5A 4QQUA 3URQA 4GYJA 4XZWA 3OOQA 2DDXA 3TDFA 1L6GA 3GH7A 4Z1CA 4JX5A 2GZXA 1UR8A 4V27A 3LLDA 3OZPA 2W61A 1H1NA 1E6PA 3KZSA 3QMRA 2D20A 1IT8A 4NL1A 3NPWA 1GT8A 1B4EA 2ZUUA 5ABTA 1TPB1 4DF0A 5DRCA 3QY6A 1RP9A 4R33A 3W7OA 3UYCA 1J01A 1FCBA 3WIJA 1TPH1 1DJHA 1UOZA 3GDBA 3HMJG 3QR0A 4DJFC 1H5VA 5AKQA 3AHZA 1S1PA 3GHSA 4F4RA 4LWWA 2X30A 3PPHA 4Y8EA 3B8DA 3CV1A 1VCFA 3W1QA 2C8NA 3NSXA 1W9XA 3WF0A 3QLLA 4KF1A 3OVQA 3WY1A 5D32A 4QG6A 3QQ0A 3ZIZA 2ZVIA 3A24A 3VDGA 1FA2A 2H3BA 1UPMB 4MMWA 4QDMA 1C29A 4UC5A 4HOWA 5D2YA 3EB2A 1J0JA 4MWAB 2FZ8A 3WMBA 3BSMA 3ATYA 1UOKA 4PB4A 1EGVA 3EDKA 3O15A 1X8FA 3N19B 2BVYA 2QMKA 2BY2A 3E2SA 2PC4A 1VLWA 3M47A 3L12A 2C0HA 3EDDA 2Y62A 5M03A 3T8LA 5CSYA 2DQXA 2VDHA 3WH5A 4NAFA 3WD3A 4X2RA 3L4VA 4PB3A 3H2OA 3EBVA 3NVDA 3CB3A 3FHAA 1M68A 2VDGA 3PY2A 4N4PA 3CUFA 2HQAA 3IJQA 4MSSA 3C3UA 2QPXA 4XAGA 3RHGA 3REQB 2OWCA 2BGNE 1HVQA 3GAYA 2CCRA 2HS8A 2GQAA 3NL2A 1E6SM 4O13A 1E0XA 3GBEA 1Z48A 1KCZA 1PX8A 3WK1A 4RKAA 1DVJA 2YGYA 3LLFA 1OG0A 2WMJA 2GYIA 3SJNA 1M03A 1I2RA 3W6MA 4Z1BA 1PS9A 4ERIA 2BHYA 2Y5JA 4U2YA 1LROA 1QHPA 2XIOA 3BL3A 5DMNA 1ME7A 4NI8A 3ZJ7A 1OINA 4W84A 3CTTA 5F4WA 1CGTA 1BRLA 2ONEA 4FX6M 3C2FA 2WMIA 4C6KA 3GR8A 1SZEA 1EJVC 1JGIA 3NIYA 1XLEA 1IHIA 3TYBA 3DOPA 3QHNA 2XVNA 4DXXA 4AZ6A 3TC6A 3KBJA 4QCFA 2FTYA 1NIUA 4J28A 3H6OA 1S3TC 4UUIA 5T9BG 4ZENA 1TTQA 1KBLA 3GG7A 1UWQA 3WSUA 3CGTA 4RW5A 1M01A 3V5OA 4BQ5A 1PX3A 4Z2GA 3VD7A 2TRSA 5A6BA 1QWGA 3CZJA 1Y65A 3AU2A 2ODOA 4BWLA 3GVQA 1MXDA 2AAMA 4O15A 1QW7A 1WAUA 4HN8A 1VJZA 4UMAA 1W9BM 3MS8A 1H11A 3AI0A 2HVOA 3TV8A 4WSKA 3IJ9A 2V0TA 4UTMA 3UGVA 4DB7A 3I68A 3LG3A 4JTCA 4QS5A 2G97A 5K7JA 4IQJA 1TJ1A 3TR2A 1DOSA 4EP8C 5CSUA 1X8CA 1US2A 3GFYA 2R1NA 4JNMA 4QCEA 1YNQA 3BK0A 5DCDA 4EAMA 4MZ8A 2XH2A 3KDOA 1OX5A 3U7VA 4XIMA 1F6YA 2PLCA 2HPMA 5C2GA 6TIMA 4IJCA 4DZAA 5BW6A 1OFQA 4GVHA 3TYCA 1DQWA 3C3NA 4B9ZA 3VKDA 5EB8A 4H04A 2PP1A 4ML9A 2NV2A 4Y9PA 1P1XA 2G4FA 2G3IA 1J9YA 2ZC1A 4A29A 3M6DA 1CXLA 4JTAA 1NDYA 3NQCA 3E96A 1P0DA 2O4MA 3N6HA 2JE8A 3U3HA 4PUKA 5EGRA 7ODCA 1RBOB 2J24A 4QISA 5DBUA 5DCBA 1B4KA 5DY2A 5G1YA 2F8QA 3FY1A 4GE8A 1OK6A 5F2GA 4LS2A 1E6RA 1J6PA 2CBIA 1F4AA 1YMYA 3G77A 2CZDA 2QJNA 3DGRA 2G4JA 3BLKA 5HNTA 2DZSA 5AFDA 1E70M 4MDOA 2CPUA 4Q7NA 4NZ3A 4M19A 3GWQA 3QPYA 3S2NA 6REQA 3H70A 4QM1A 3NL5A 3MY9A 3R79A 1R38A 1KGWA 1TPFA 4RJEA 3W53A 3SFWA 1WB0A 1XD1A 4QDWA 3W1AA 1GOMA 1XQLA 1V3KA 3MCMA 4AYSA 1P0NA 2FVKA 3BLEA 5A94A 1Q66A 2OQYA 1JI2A 4Z0JA 3DIPA 1G94A 4JKKA 4HMNA 3C2VA 3FXGA 1LUCB 4KIEA 4C1NA 5HK4A 2XGBA 4D6JA 3ARTA 1NARA 4JIPA 3AYSA 3TQPA 3NSMA 4O11A 1NDZA 5FCZA 3DX5A 2ZA3A 3PBMA 4K3ZA 1YQ2A 3PF3A 3QPEA 1U1JA 4FXFA 3RLHA 5LNWA 3GD6A 4B90A 3ZT7A 2DJXA 1SW3A 3ES8A 4CNNA 3MMTA 1O1HA 1H51A 3EOEA 3EXSA 2E3ZA 2PDWA 3BAKA 4Z2LA 1HX0A 2AKZA 4IGSA 5I5RA 2PDPA 2ISSA 4JQ4A 4IQLA 1OT2A 1D9EA 1ONEA 5FI8A 3FAWA 3VIKA 2VGGA 5PTDA 2J27A 2OSYA 9RUBA 4R3UA 5H8MA 1YDVA 2VGIA 2YYUA 3P67A 1TPC1 4HK5A 1R7OA 4GI9A 2D0FA 2OLSA 1JDCA 1MEWA 2WVTA 1BAGA 2CZEA 1KNWA 4XO6A 5A2CA 1HQTA 3CZGA 3P3BA 3K8LA 3EZ4A 2PRHA 4RXFA 3TK7A 3ZWSA 4PR4A 3G1DA 2QF7A 3C86A 5FAJA 1K8YA 3MUIA 1TVLA 5FOOA 2IKHA 3T6CA 3TMLA 3IEBA 5E1QA 3KS5A 3TYDA 1KXTA 1S38A 3Q45A 2RJHA 1SSGA 4MB5A 4N6FA 5HWJA 4E3TA 4FSAA 1QR7A 1BYAA 4MUZA 3B0XA 4ZGYA 2DVUA 4ZQNA 4LB3A 2WSKA 4UIOA 3T09A 3WQ5A 1T96A 1Z44A 5G2WA 4KRUA 4PUNA 3RAOA 2OR2A 1LDCA 1ENUA 3ZT5A 3KAOA 1BEUA 3FJLA 5HOSA 1PWMA 1W0MA 3LMYA 1L9WA 1P0KA 3DG6A 1F73A 2QNEA 2XG9A 1PAMA 1AFSA 2E6YA 3WLNA 1NQKA 5BXSA 4K1GA 2ZX8A 4XX6A 3T9PA 1TELA 1J2BA 4PEEA 3VNDA 1HJUA 3D3AA 1TRIA 4F0SA 2OYMA 4IL0A 1GK8A 1XBZA 1G4SA 4AB4A 1HL8A 4N02A 4QJ5B 2FB3A 1JDAA 2J7EA 3RUBL 3RM8A 5CPLA 3ITYA 2E77A 3ICJA 4FOKA 2ZA1A 2YSWA 3SQMA 3K4DA 5IRPA 3NQ7A 4H9TA 3QY7A 4S39A 4AD5A 3WEZA 4X63A 3N2TA 5HA7A 3QMSA 2CKSA 7TIMA 2XIBA 2TPSA 3U5YA 1FFRA 2DSUA 1IZKA 4GACA 4F9JA 2RAGA 2EJ1A 2Y0FA 3WF1A 1D3HA 1BXCA 2NSXA 3W72A 3PZNA 3NR0A 3NXLA 3OVRA 1F6KA 3UR8A 1YKWA 4Q4RA 5K3VA 4PZVA 2X0YA 1Z7AA 1XYFA 2DZVA 2VZUA 4J3XA 2A3BA 1F4HA 2EBNA 3GIPA 5I77A 2R24A 2CZVA 3MUY1 1EZ2A 3LPPA 2J8TA 5MKGA 2WPGA 1K6WA 3SDOA 1OJXA 1FKWA 5BZAA 4JNZA 4IIBA 3IIVA 1RUSA 4Z2IA 3LCXA 2PU0A 3B9EA 2PLKA 1O5XA 2XVPA 5KZDA 3SCNA 2XUCA 2W3ZA 4KGLA 5ABGA 1QWKA 3EWYA 3MV11 2QCGA 1BG9A 2CLKA 4KWOA 1JCXA 1LOQA 2WCSA 4S2CA 3WBYA 3HU7A 3TX9A 4AIUA 2DVXA 4S3CA 1E3XA 5FJPA 5DMYA 2EG8A 4DVOA 3WLJA 4NAFB 4UNIA 3R0KA 4JTKA 4ATDA 1Q7ZA 1K9EA 1OZQA 4V33A 3VOGA 2ZX9A 4WKFA 3U48A 4PH6A 4A3HA 3FEMA 3PBWA 3GB6A 1MMFA 3MMWA 4JTIA 4AHQA 1LWIA 1UH3A 4AZ5A 4ADUA 1RBLA 1LBMA 3W6LA 4QNWA 3DBPA 1B3WA 5DN1A 3WLIA 2Z1BA 3F5KA 4GUIA 2FPVA 3S9ZA 3SCTA 3CTLA 1VP5A 5BXRA 1J96A 1GVRA 3HQOA 3CXOA 1KFCA 3OA5A 4CKQA 3IGUA 3VMOA 4JTEA 3RM4A 5G4WA 3UPBA 3FNDA 3Q94A 3O3RA 1QO5A 3H4XA 2ZUNA 3FA5A 3VCRA 1PIIA 4ZE5A 1S2WA 2VC9A 1OFDA 4J27A 4DBDA 1DXEA 4QROA 1V3HA 1OFRA 3CL6A 4DWSD 4E4UA 2VWTA 2BY0A 4I9JA 3PNUA 3ERPA 1ZLPA 1GYMA 3OZOA 1JZ6A 3M0HA 3PC0A 4IHCA 3PZQA 1UIPA 4ENLA 2W67A 4PMXA 5A69A 4OV9A 3F4WA 4AZ7A 3R58A 1OY0A 3GFXA 1M53A 3DERA 3WFZA 3P5YA 3QR1A 2H8XA 2BLEA 1QDSA 3H4GA 4P5UA 2PLJA 5E6ZA 1ALDA 3V75A 3GYEA 2EGZA 3SUVA 3IGSA 3ZWTA 2ISVA 4L65A 2I57A 3HQPA 2IPGA 2GL5A 3DYOA 1G01A 1OBAA 5SWUA 3T78A 1E6NA 4YCOA 5FJUA 2OKTA 3QGKC 3BLFA 2DUXA 2YA1A 4NG3A 3M7WA 2HVMA 2JEQA 2FDMA 1LL4A 1UG6A 3V18A 1OEPA 3OZMA 1Y5WA 3H2CA 3EWCA 5XIAA 4LC6A 3WDHA 3ZFHA 3CHFA 1HP4A 4TIMA 1TX0A 3UJFA 1W3IA 3T2PA 1UZ1A 2V5JA 1ODUA 2W91A 2W4XA 2R94A 1UBSA 3N73A 3VA8A 4Q8VA 4HCLA 3SADA 2QUVA 3EA2A 1H09A 3OO2A 3RX2A 1KWKA 4B2DA 4CNSA 4F48A 3ENLA 5CG7A 1Y7VA 3TONA 4ZSUA 4POCA 1PX4A 3BAYA 4LEFA 4GOAA 1K7FA 2ZZ4A 5BNKA 4AY1A 1OSEA 3LSBA 2QCFA 3VNKA 4AW7A 3GSMA 3CAQA 4L1XA 3WFAA 3N9SA 2ZX5A 1X97A 2RH9A 1FHUA 3AYVA 4JN7A 4XIAA 1V3JA 4B91A 1FX6A 2JQXA 3EPNA 5BOOA 3W7JA 1OGSA 1JGMA 1MW2A 1XD0A 3TTQA 4JXCA 1YXYA 4HZ6A 5DCEA 3SRKA 1JNEA 4P8UA 4RV3A 2E09A 4K8GA 4ZXOA 3OGVA 2EPMX 2GDQA 1BFNA 6REQB 4KQNA 1FWTA 5EBAA 4DJFD 1W37A 1V6UA 4E3VA 1RQHA 3TCSA 2HE8A 1G7VA 3NA8A 1EJRC 4WSHA 2ZZ2A 3IK2A 4C7DA 3GHUA 1Q6QA 5CAKA 1OFBA 2CU0A 4JTDA 4FI4A 4HK7A 3IWPA 2WK2A 3R89A 1H5YA 1Q6CA 3AZRA 3SFKA 4MJMA 4D72A 1W3TA 4X0NA 3NQ2A 2Z27A 4AD3A 3CMFA 3QZ6A 1AJ2A 2AL2A 4DUWA 1OC5A 3WJYA 5I79A 2OZ8A 2GOKA 5IDIA 3C2OA 5FKYA 1E4MM 3B8UA 2V38A 4QE4A 2P10A 3NAVA 2TODA 4JAWA 4UFJA 5I7GA 3ARPA 5LIYX 1P7TA 3W75A 1TV7A 2B7NA 3G8EA 3QTGA 5U4NA 3W9ZA 3DG7A 3IVTA 1OYBA 5EPDA 3T55A 2ABBA 3STEA 4OQVA 4C6OA 4CQBA 3FJNA 3IGXA 5CJMA 4G6CA 3FLUA 1NFGA 4FNRA 5M1TA 4WSJA 4DXVA 3KWXA 5C9WA 5DXYA 1H7RA 1N7KA 1JCNA 5I78A 1RQBA 1DJWA 1AZ2A 2B31A 4Y2WA 4PMRA 3PFMA 3R12A 4DM1A 4IICA 3GG0A 5F1UA 4LF2A 3EKZA 4JY8A 4UQEA 3PZGA 1SJCA 2E40A 5D2TA 1B54A 1C7SA 5E09A 3MKVA 1ZBCA 4NXKA 1PCWA 1HTIA 1H7WA 4M0XA 1IYXA 4HD5A 3FN9A 3G1VA 1J5SA 4H7ZA 3O6AA 3IJ6A 4WDUA 5JBEA 4JICA 1E1FA 3E2VA 3HO8A 2XIIA 4JX6A 4TXEA 4IMFA 3QKZA 1NELA 4M29A 1UCWA 3BO9A 4NP7A 3IJ7A 1GCYA 1UROA 5XINA 1DWJM 1XGZA 3W24A 1BG4A 4M6PA 4H19A 2E68A 2ZX6A 5I3JA 4Q8MA 1BYBA 3TSMA 2J6VA 3AHVA 3AS3A 1X1ZA 3L68A 2UY4A 2OJPA 4DXKA 3IUIA 1H0GA 4F0LA 1XLCA 2VEPA 4IT1A 1Q8JA 2QUUA 3CH9A 4GXPA 1AW5A 3BOLA 2PSNA 1XRTA 3E3HA 4J3TA 1E15A 3N4EA 2V3GA 4R27A 1RLCL 5FEZA 1UP2A 1QBAA 2BOEX 4M5PA 1E9ZB 4ZE4A 4PUUA 4GBUA 4ZSTA 1H41A 4EACA 1C8VA 2O4QA 3MW7A 2E0PA 3RPDA 4IGHA 4FF7A 1V6VA 3OP2A 1DPMA 4S38A 4L9ZA 4Y90A 1KFKA 1W1VA 1S5MA 4S3KA 1UWRA 2I16A 2Y6ZA 1O5RA 3NEVA 1W5MA 3AMLA 1THFD 2TMDA 1CLVA 3LUTA 1MRQA 1YTKA 1KQYA 1JL8A 3M44A 2QCEA 3WG6A 3MWCA 2YL9A 4CGTA 2CLHA 5EKYA 2QAPA 3DFSA 4JYDA 5MKGB 3UERA 4GINA 1BLIA 5J04A 1CXIA 1HUVA 2VCBA 3LPGA 3QZEA 3FYYA 4M81A 3LSCA 1FDJA 3I4EA 4C65A 1GORA 1R6WA 2SFPA 1DJXA 3L0NA 2G3FA 2YZRA 5E9AA 4F66A 3G1FA 3W7QA 3CV7A 4E5TA 3EA3A 3H7RA 3EWBX 1FCVA 2VM8A 3GDMA 2VCAA 3PK7A 2BGQA 2D69A 4ERAA 2R1KA 1QNPA 3VGGA 3RITA 4BFAA 1QI0A 1EIBA 3VCNA 2IQDA 1GKRA 2RGLA 5CH9A 1GQKA 3DZ1A 4HPXA 4B4FA 2FZNA 3VD4A 4CNUA 2FZ9A 2HXTA 4ZEPA 3A13A 3P61A 3W28A 2DZAA 1FY6A 4QG9A 2DSWA 3MO4A 2QCLA 3QJAA 3PUOA 4Z0SA 1UBPC 2CERA 5EU9A 4GK8A 1JYXA 4KCVA 3HPSA 1XIGA 4L5ZA 2WSYA 5I02A 1MO0A 3F03K 3VIHA 1AL7A 1BTMA 3EX4A 1VRDA 3V1HA 4CNPA 2OT1A 3F5JA 3R1ZA 2C71A 1JPIA 1KGXA 4RDZA 4HZ7A 1QNRA 4CQAA 3LHWA 4R7OA 1E5NA 1GJWA 5JU6A 5FD0A 3K4AA 1W1B1 4R34A 2YDSA 3HPXA 1TZ7A 3WYZA 1PZ0A 4H9XA 1ZTVA 3G1AA 4H7VA 2YW3A 3AIEA 3GH5A 3VD9A 4LUJA 1S5WA 3SUWA 3DYMA 3NDOA 8TIMA 2ZE3A 4ROPA 3AMKA 2Z2BA 3ARUA 2OG9A 4LQ1A 3KVMA 3POHA 4O17A 3GNNA 4UOJA 4PCPA 5D09A 1HKKA 3TN5A 1PTGA 2HVNA 2QAFA 1P48A 2CZFA 1WNOA 4LAOA 1GOKA 4XAZA 3SUUA 2YDQA 1EHNA 3N2CA 1R85A 2CLOA 4KMQA 1OCBA 4DBWA 5LGZA 5I09A 1P5BA 2J7HA 1EFZA 4PCNA 2J77A 4LX4A 4US5A 2VZSA 2A3CA 8XIMA 1IR2A 5IFTA 5JQ9A 2VMFA 1TZZA 3EXRA 4NHVA 1K8XA 4GLEA 5HINA 4UTJA 4JEJA 2J66A 4LY8A 8XIAA 3TYUA 3QTPA 4W85A 2VX7A 4E2OA 3N6QA 2PDCA 4PBEA 1E9LA 5I23A 3UXIA 4Z42C 1QT1A 3CO4A 4YCPA 2GJRA 3BG5A 4AY7A 4NAEA 5G5IA 3GXIA 3NG3A 4WIWA 1JJKA 4Z2HA 3W2LA 2INEA 3KOFA 2A1YA 4PSRA 3NOYA 4BQ3A 3AXXA 3JUGA 1UKQA 2F2KA 1AG1O 1R3QA 2X8RA 4G7EA 3V35A 3RK8A 3L66A 3D46A 2BVTA 2Q09A 3B8WA 3OQEA 2VQTA 3FSTA 3N11A 7PTDA 1MFVA 3KBVA 1EP1A 1NDVA 3ANUA 2PU1A 1DJQA 1VEOA 4AD2A 3SR7A 4MZYA 1JULA 3VNMA 1KGUA 3TYZA 4EOUA 1DL3A 2J4GA 4UQ9A 2PDNA 4LUYA 3BQ6A 4N7QA 4MIMA 1SFJA 1P4CA 7CGTA 3EDFA 3B05A 4CQ9A 4YTUA 4AIEA 3ZVHA 2I17A 3T0CA 4JDYA 1A4LA 1IIGA 3T40A 1WOBA 2DSZA 2J78A 2D23A 1P0BA 1XBYA 1H7XA 1YADA 4FLOA 4ZVJA 1E55A 3EDJA 3RXZA 4HKPA 4H00A 3A12A 1UQYA 3GLCA 4M6QA 2L5HA 1VFMA 4LUTA 3UCQA 1GOXA 2W0UA 1A4MA 2WMFA 5TNVA 4H8VA 2WHKA 2A3EA 3W70A 1K02A 4C7GA 2BTMA 2C0AA 1PSCA 5DRIA 4GIRA 1XV8A 3SSZA 3SCSA 3RFAA 1AW1A 2AL2B 2OZ3A 1MW1A 1FVPA 3LRLA 2PDQA 4O19A 1GVEA 1WX0A 3TA9A 3P93A 3M4HA 5BU9A 2R1MA 5CZSA 2X7WA 3SY8A 1TMHA 1J93A 3PAOA 1VHNA 1QW9A 4C60A 1P7TB 3TLQA 2D3LA 2GJXA 3G1SA 1QASA 3E5BA 1SZRA 1TV3A 3LS9A 2FJUB 4NNAA 1ZJIA 1W8GA 4WHBA 1R3VA 2YDAA 3WJZA 2J7DA 1SO6A 3TTOA 1QJWA 3DFQA 1ISXA 2ZUWA 2Q6ZA 1ICSA 4EWJA 4Q4SA 1ZJHA 1TR1A 4UZUA 2Z6IA 4GPNA 3GVVA 4IG2B 1O12A 1SFLA 1PKNA 3FSUA 4QLLA 4N0RA 3TAOA 4GCAA 1YX1A 1XICA 1JYVA 2YZ5A 5T91A 4XK2A 3P14A 3TN3A 1NH6A 1T41A 4RE2A 4CD7A 1YNPA 4ZB2A 5FJRA 2C14A 4YTSA 1PCKA 3AALA 1EDTA 2DV0A 1ITCA 3OW1A 4JBRA 1XG3A 3NTYA 3HBLA 4UQDA 1S39A 4GXMA 2DW6A 2ZUMA 3APTA 3BV7A 2XH0A 3V7PA 1UD8A 2GGJA 2V2CA 1O5KA 3SGGA 1A5BA 3VDAA 3WJWA 4IPIA 2VL4A 2PDYA 1E1CA 2W5FA 5A2AA 2ALRA 1KFEA 2DEPA 3P0XA 3GTNA 4ZO7A 4TVDA 3KOXA 3QOKA 3F2CA 5C9XA 4IFOA 3W26A 5D9NA 1HO4A 5A2BA 1QBBA 1J0YA 1I6NA 3KOYA 3TUUA 5C7HA 2YXGA 1RY0A 5GPRA 3IANA 2A3AA 1PBGA 3P74A 4K1WA 3UR7A 4UTTC 4AEOA 1WE5A 2CLMA 1AQ0A 5GNYA 2VRJA 1MW0A 1FTXA 3WLKX 4Q6JA 4XKMA 3M16A 4KIRA 1QK2A 1GEQA 4H2HA 1XH2A 1K9TA 4XVDA 1IGWA 1V93A 4DQWA 3OIXA 5EY5A 4QSFA 4AMCA 1PDZA 1IE7C 4FP1A 4L4OA 4FA3A 4ZQCA 1R3WA 1TPWA 3C8NA 4DJDA 4Q8TA 3GDRA 4H8UA 4DF2A 4NZFA 3GO2A 2VWSA 1HIZA 2WNZA 2CLLA 4P7OA 3J7HA 3ZSSA 2VFIA 3GS6A 1M65A 2Y7DA 1Q45A 2BXYA 4UQBA 4H6KA 1DJIA 1EDQA 4S3GA 2FHCA 3U2ZA 3L65A 4O8AA 3V0UA 4MNLA 5HJLA 1PKLA 5EYWA 1JF6A 3P8JA 2VD9A 4JFSA 2BX7A 4QS6A 2ZZ6A 3TQKA 1K4GA 4YPJA 3ONCA 2WB5A 5JIPA 4M3PA 3WUBA 4HJWA 2W9MA 4Z2JA 2I56A 1GQLA 5DT7A 1XYZA 2P76A 5HMEA 4LJ3A 2VUNA 3DENA 1U5JA 3WH8A 1JUKA 4EANA 2PDMA 3CASA 3EEZA 2UWFA 4QE5A 2X05A 4JX4A 1CZ1A 4DEFA 3WD0A 1IXOA 1L8PA 1PKYA 3P84A 3LGGA 2CNCA 3TIMA 1YNYA 3HJZA 4S2BA 4A05A 4GY0A 1Q2SA 2BS9A 1EP3A 1KM0A 1WZMA 3MJYA 3IPWA 1FH8A 3G22A 3LTSA 1P1MA 1EYWA 4XWUA 2X1UA 4F40A 1FKXA 4QX4A 1V02A 7A3HA 2E6AA 1RALA 1ZBKA 5CAHA 3AMDA 1XPYA 2DQWA 3ZOAA 4MTVA 2FZBA 4HPHA 5AY7A 4I6VA 3MKCA 3HPZA 4AYGA 4M1RA 1A5MC 4Q6XA 1JQXA 5CSRA 2AKMA 1WYIA 5A8QA 4DN1A 4FHAA 1NFBA 4ZO8A 1MW3A 5RUBA 1KTCA 4I8YA 3RLGA 1W3LA 1J2WA 1RK5A 3UNDA 3BANA 2J6XA 3AUJA 3CQIA 4O8RA 3R8RA 3VFLA 2WLYA 4JTRA 3VD5A 1ESWA 2DT1A 3MCOA 4KS0A 2PDXA 1IT0A 3C0QA 1YE4A 2WNWA 4OHQA 4D6GA 1EJWC 2VR2A 3S6DA 4C6LA 1DWIM 4A4AA 4R9XA 1MVYA 1MUMA 2IPJA 3MSDA 3LMZA 4DELA 2E1WA 2A7PA 1JZ2A 2GDUA 1YHTA 4L4MA 1Z32X 5TIMA 3VCCA 3LM3A 3BJSA 4PUDA 2VC5A 2Z1KA 3DYPA 4NQ1A 4UOQA 3NQFA 5LIKX 2WSPA 2OCZA 2RGMA 4E4PA 3A9BA 1CXFA 3R94A 3N25A 3UJRA 3TEVA 2P3ZA 3BDKA 3BGJA 1X1OA 2FMOA 4R5EA 3PUGA 2YFOA 3OGSA 3NXFA 1QW8A 3XIMA 2FKPA 2ANUA 2XH7A 3B06A 4U33A 3VABA 1T99A 3BOXA 4EPDC 4PMQA 2VI0A 4D6FA 4K36A 5LSMA 3JU2A 3MSGA 3M0IA 3GIQA 3NYDA 4BEQA 5C0QA 3TW6A 1GW1A 3O6YX 4K68A 2NXGA 3N34A 4MY8A 1JUEA 2W92A 4HU0A 4AWTA 3T7VA 1LL7A 2JEPA 3I6TA 1V08A 1XH1A 4XKYA 1JF5A 3T0DA 1TTJA 2OMAA 1WDSA 1VFLA 4RE3A 4IM4A 1EWEA 2YCJA 3U2EA 1UD3A 1GG1A 4LNCA 3KXQA 1QNSA 3W7DA 4JQAA 1NWTA 2BG5A 3PZIA 3LU2A 2AAAA 3VMPA 1S2VA 2NLYA 3QPZA 4G7EB 2E8YA 3CWHA 4DYEA 4EPKA 1X98A 3IARA 3CHVA 4HA4A 4QDPA 3FAXA 4GZIA 1KO0A 2R1PA 4UQAA 3W2JA 1J0KA 5G4EA 3AROA 1NDWA 1BXBA 2F38A 1NWRA 3AYRA 2G95A 2C15A 3G6MA 2EXOA 1W6TA 1U33A 3EPMA 4Z2KA 2JBMA 3WQCA 1EGMA 2VZTA 3NZ1A 4X9YA 1R0MA 1MWOA 3VE7A 3EWWA 2V2HA 1WZKA 3E2RA 3CK5A 4LGXA 1J12A 3HQNA 1MI3A 1GKPA 3LYEA 3LQLA 1XRVA 3K4WA 4Q4OA 2WZEA 4GD0A 5C9ZA 2CZ5A 4LALA 1VBUA 1L6YA 2E7FA 4E0CA 4KFPA 3ZVHB 1OADA 3WBEA 1MDLA 4F0KA 3W86A 2A3LA 1Q6EA 2RUSA 2ZXDA 5CZ0A 3VOFA 3WQ6A 1TZ9A 3CHCA 4ZFMA 1JEZA 3CQKA 1VFSA 1U5VA 4O54A 2I1OA 2Y2WA 4LUTB 3V5FA 1PJ9A 3PZVA 1KRBC 3CU2A 4HIBA 2WJDA 1GVQA 1MFUA 4E2BA 1GHSA 3SO7A 3VIIA 1T6MA 3W38A 1TUXA 4NNCA 2GQ8A 4QG8A 4HNCA 4WGHA 4O1CA 2OGJA 1QI3A 5A8OA 3MKKA 1LQ0A 3KBWA 3LD5A 4PMNA 3WUEA 3PUDA 1JZ5A 1KKOA 4LOCA 3BAXA 4ZQMA 2WQDA 3B9OA 1CWYA 3WQPA 4JTJA 3PR2A 1BSLA 1BVWA 2V3EA 1UUQA 1KR1A 5FL1A 2X0SA 1B57A 4REQA 4FPSA 2WV8A 2BFGA 3ZLHA 4B3LA 5AB3A 2ZICA 3T05A 3R4IA 1EGZA 3BZGA 1DQXA 4B5WA 1KV8A 4N2YA 4DBEA 1XYBA 2HV5A 3MYPA 2GJXB 5IBXA 3HJEA 5LYRA 1Z8AA 4V1YA 4DM2A 4MUPA 3ANYA 2QV4A 1U5HA 4UTHA 2Q3RA 1TJ2A 1CPUA 4WQ6A 2O0TA 2VVSA 4H8HA 2FGBA 3O16A 2I5GA 3RIKA 4Q8PA 2EG6A 2D2OA 3FXYA 2A0NA 4IPJA 5C54A 5KEZA 4C5YA 3LCHA 1PTDA 3KLLA 5KITA 1SR9A 3GNOA 3VNIA 3BGAA 1ZGDA 3WDPP 1KM6A 3QYQA 2NT1A 4GC4A 2JGQA 5JH1A 3TMQA 1CXKA 3R8GA 5EA9A 4UFIA 4GJIA 3CAKA 3UF9A 3ANVA 5AHMA 1VPXA 1DIDA 4DX3A 3FOKA 3FVDA 4GYKA 5HR6A 3C2RA 3NPXA 4LFYA 4GIYA 4XTIA 1E1EA 4ZQRA 3EMCA 4GI6A 1FUYA 1Y8BA 1JPMA 4I9AA 3M0VA 4ZCWA 1S5TA 5KSWA 1Z9AA 1G6CA 5AHNA 4W88A 5CPTA 4HU8A 1G9HA 2WKJA 3BZJA 1LT8A 1R5YA 2VRQA 1H0IA 2BHUA 4E8GA 2P50A 1E1CB 4FMVA 3WLMA 3V36A 1S3HA 4ROQA 4DBSA 3QV9A 3SRDA 4UNKA 4ICNA 1RCQA 3A3WA 1WBJA 2X42A 4PL1A 2XFYA 3ZXWA 3ITXA 2XN0A 4IIEA 4BF9A 3MI6A 1VBJA 4LVFA 5AHFA 2VO5A 2PP3A 3UGRA 4B9YA 3ZLGA 3NJ3A 1VYPX 2V82A 3NFUA 3ARWA 3ZT6A 2HTMA 2FVLA 4TOQA 1AQHA 1B3VA 5FF0A 4NIRA 3CL8A 2P8BA 4KWWA 2V3DA 2GQ9A 2YPIA 5BXTA 2V69A 1P6CA 3G0SA 4W7UA 1VFOA 1X1NA 1J6OA 4FNTA 4NVTA 3ZO9A 2X41A 4UFMA 4BZYA 1VF8A 3F4CA 3FIGA 4PTXA 1IWAA 2NZLA 4TTGA 4PSPA 1NOFA 3ZR6A 2FMNA 5G4HC 3AHYA 2XSAA 4W8LA 2FVMA 1A50A 1W1TA 1LOSA 2Y8UA 3UXLA 3HPFA 3F7JA 2QF8A 2I5IA 2Q02A 1LG1A 2IS7A 3FHQA 4GISA 2UY5A 2P5NA 3B8VA 3NZRA 4LAKA 5EBUA 5KZEA 1R3SA 4DLFA 3AS1A 1UMLA 4GUFA 4HNLA 4OECA 1CI1A 4PMDA 4WGXA 1OIMA 1FOBA 1WO2A 3TW7A 3IS4A 1WBHA 2QJIA 3T4WA 3PVFA 5DLCA 2Q3OA 3MZNA 1T5AA 4TO8A 3CJPA 3MYOA 5CGTA 3OLEA 3P62A 2JKEA 4JQ2A 4LS1A 4IJBA 1A3HA 4NY2A 1UD4A 3DG3A 3FK4A 5DFAA 2IQTA 1SW0A 5L9FA 3G1HA 3GNXA 1JQVA 5I3GA 5D04C 5CPMA 2FGLA 5HATA 4JTSA 5B80A 3THDA 2VX6A 2Y61A 2XWEA 4QHRA 4AZCA 1ZAJA 2GVLA 4AIBA 1X38A 3AICA 2I9UA 2PURA 2C91A 1TV8A 3WL0A 1GTEA 4I3GA 3TC7A 4GVFA 3W7CA 5A3HA 5A6TC 3VZYA 3B8IA 4MWAA 3LLXA 5DBTA 3OB8A 4MGGA 3PS7A 2ALDA 4E4FA 2E25A 5IHRA 5CC6A 1V6XA 3T08A 4JS3A 2BXVA 5AYIA 1ADSA 1UYQA 2W66A 4AISA 3M5XA 4MFEA 4KCUA 3FDKA 1SM9A 4WVXA 4MPQA 1VAHA 2ZE0A 2DH3A 3QV6A 5BROA 3H2AA 3I65A 4O57A 2XU2A 2PBOA 1PZ3A 2GVEA 4B5NA 2PRLA 2ZRYA 2Z6JA 4M8UA 3P82A 5IXEA 1B2YA 3DHUA 1WZLA 2EHHA 4KERA 1FWGC 2OXNA 5LHEA 3BCFA 3REQA 3B40A 1VCVA 3FYPA 4A2RA 1ECQA 5D2VA 4GBDA 2PDFA 1CB7B 3GQYA 3H24A 1JPHA 3I3EA 4W9TA 1W1YA 3AAMA 3UCDA 4L6HA 3VGFA 4I7UA 3WMCA 1D8CA 2ISWA 1GOIA 1W9DM 5D9PA 4WY0A