2Y8UA

A. nidulans chitin deacetylase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
211
structure length
211
Chain Sequence
VPTGQVITQCTTPNTIALTFDDGPSEYTPQLLDLLSRYSARATFFVLGDAAAQNPGLLQRMRDEGHQVGAHTYDHVSLPSLGYDGIASQMTRLEEVIRPALGVAPAYMRPPYLETNELVLQVMRDLDYRVISASVDTKDYENQDADAIINTSFQLFLDQLDAGGNIVLAHDIHYWTVASLAERMLQEVNARGLIATTVGDCLGDGEIAWYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHITIN DEACETYLASE
publication title Cloning and Characterization of a Broad-Specificity Chitin Deacetylase from Aspergillus Nidulans Fgsc A4
rcsb
source organism Emericella nidulans
molecule tags Hydrolase
total genus 88
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01522 Polysacc_deac_1 Polysaccharide deacetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 2y8uA00
4NZ5A 2Y8UA 1V6TA 3QBUA 1XW8A 2I5IA 2VYOA 3CL6A 4NYUA 4M1BA 1Z7AA 3S6OA 1W1B1 4V33A 2C71A 2DFAA 2J13A 4NYYA 4OUIA 3VUSA 3HFTA 5JMUA 2W3ZA 2QV5A 3CL8A 4F9DA 1NY1A 2XU2A 4HD5A 2E67A 5BU6A 2C79A 3RXZA 2C1IA 4NZ3A 4F9JA 2IW0A 3CL7A 4L1GA 2CC0A 1W17A 4WCJA 3WX7A 4LY4A 4NY2A 2C1GA 2NLYA 1W1A1 4U10A 4NZ4A 4NZ1A
chains in the Genus database with same CATH superfamily
3DESA 2Y8UA 5CQ1A 1TV7A 1I0BA 1LT8A 3RMEA 2BG5A 4V33A 3W7RA 1GVQA 2GJXB 3W29A 4E6MA 3E9AA 4JYFA 2E8ZA 4I7WA 3K4DA 3H2AA 1M6JA 3W23A 4KCUA 3TZFA 1BLIA 3WF3A 4LVDA 2ZZ4A 2BGQA 1UD8A 5C7HA 1JD9A 3IGXA 3TC3A 3QOMA 2QQ6A 5L6UA 2BP1A 1G4PA 4AW7A 1SFSA 3QPZA 3GR8A 3W22A 2PBOA 3PJWA 3BW3A 1V3HA 3N2TA 4A8NA 4KWSA 1XGDA 2RGLA 3CC1A 3WQOA 3BC9A 2ABAA 3VD7A 1IXQA 1S5MA 4JIQA 2VUYA 3RJYA 1GNXA 1E9IA 1R9XA 2CLIA 2V3DA 3C0JA 5HUPA 3MUZ1 4JIIX 1AW2A 1GOIA 4ZQMA 2P1FA 2VOMA 3NQBA 2H3BA 4GJIA 4H2CA 4UFMA 1EB3A 3BJFA 1GOXA 3ITGA 3FEQA 2J7DA 4N4PA 2QR6A 3GNRA 1UQYA 1OT2A 2HEJA 2ABBA 1OINA 3U4AA 1V08A 3MVIA 3GG7A 4J35A 3M46A 1EBGA 1Q65A 3SJNA 2ZXQA 1F7BA 1NU5A 3SADA 2C0AA 3K4WA 1YNYA 4IJBA 1MRAA 4DBEA 3ABQA 4NU7A 5EL1A 1O68A 3BLFA 2E25A 1Q2RA 4LBSA 1HJWA 3UD6A 3TW6A 4UTUA 2DZWA 2OX1A 4R7JA 4AZHA 3NYZA 3LLDA 3S9ZA 1ISYA 3CMGA 3CTLA 3CZ8A 3PTDA 1DJGA 1KKOA 2G96A 1SSDA 2PDBA 1UJQA 3AHTA 4AD4A 4GQGA 3HV8A 3ONBA 5GNZA 1TUFA 3DU0A 4GI4A 5LIKX 2P76A 4N9BA 3GM8A 4RE0A 4GGBA 2FQIA 3VKAA 1KR0A 3SECA 1EO5A 2E6DA 1TTJA 1XIDA 2DZBA 1GQKA 4LU0A 3TXZA 1OZQA 1F6KA 3W76A 3LV5A 3IAPA 4AWEA 4LC6A 3ISIX 1W5QA 2CITA 2GGHA 4W7WA 4ES4A 2ZRXA 2BVYA 3UEQA 1EL3A 4B5VA 4MY8A 3WLRA 5I77A 3QZAA 3SDOA 1CNVA 1XDMA 1A5KC 1OB0A 3W27A 4Y9NA 3LCGA 4JQ4A 4F40A 4I3GA 1FP9A 4NYYA 2YPIA 4WUIA 3SRHA 4CNUA 3W1QA 4DI9A 4KEMA 4IFKB 1EBHA 1JG9A 4LVBA 5I2UA 4K39A 4FNUA 2PC4A 1PZ1A 4J3TA 3U4FA 3CQ0A 1X1ZA 2TMDA 2X40A 4F0HA 4B3KA 2YR1A 3QZEA 4GZIA 2YL8A 4UQEA 4JNYA 1JFHA 4MNKA 4FNQA 2WZIA 1AH0A 2WMHA 2PLMA 3GH7A 2IQDA 3TTYA 1UYQA 3W26A 2BHUA 3E74A 3SCTA 1HKJA 4RPQA 4E8CA 1C7TA 4W7UA 4PUKA 4C6FA 2WLYA 1VLWA 4PTMA 2D1ZA 1D9EA 4NZJA 5HJXA 4RE2A 2IPJA 2C1IA 3W85A 5CPQA 3LQGA 1XLIA 3NPWA 4IP5A 1SFTA 3TR2A 1M04A 2R1MA 2Y70A 1EWEA 1OX4A 1AMYA 2X09A 2XGZA 4JN8A 4GUJA 4KWOA 1UZDA 1DYSA 1V3LA 3PPHA 1TQXA 1UG6A 8TIMA 4C6NA 3K5XA 5LIWX 2Z2AA 1FOBA 4KETA 1X7FA 3ZJ8A 3LLFA 1KWKA 1P6WA 4HVXA 4LC8A 4CEUC 5AC6A 3DG7A 4B9ZA 4IM4A 3ITXA 1KLZA 1WDQA 2QCNA 1OF6A 2CEQA 3EPNA 1CXIA 1W3LA 3S3GA 1FH9A 4R85A 2MUCA 4Z0JA 3G3DA 3IV3A 3ZWSA 2WSKA 1PO9A 4DLMA 4AIBA 3KRUA 4M7SA 4F0SA 3WUEA 2UBPC 2DT3A 2FGZA 2GGGA 4XKYA 3SN1A 3FX4A 1P5BA 1NF7A 5ABFA 2J9ZA 1MWOA 1HQTA 3IANA 2A2IA 3MP5A 1CPUA 3KP1A 2GSEA 3PZIA 3PZVA 2BY0A 4TX6A 1R30A 4WY0B 5JIWA 3GKFA 4JCMA 3B4YA 3CZJA 4MUPA 1GJWA 3C6CA 4RPPA 4DF2A 2DW7A 5CC7A 2EJAA 1UC5A 5A6LA 5FOOA 4JL2A 4O8AA 3V36A 1IWBA 1K7FA 1MDRA 3ZVHA 3TMQA 4GH3A 3FJNA 1XD0A 3QTPA 3FAWA 1V6VA 1XRFA 3RFAA 4XX6A 2V2HA 3UVIA 3VNJA 5REQB 2WJZA 5IXEA 3GX9A 4B3ZA 3GDRA 3EOSA 2BXYA 2F6XA 4J2MA 1ZL1A 2FLIA 1I1WA 4N6EA 3LERA 3W81A 1AL7A 3BH4A 4LGXA 1EA9C 3QLDA 1YXCA 4PMJA 2NQ5A 3QF0A 4YS1A 3W3OA 1WZMA 3GR7A 2FTWA 3UWWA 3GVVA 2DZTA 4ICCX 7TIMA 1YBQA 2C19A 3T0CA 1RXOB 1XX1A 4E0CA 1SJBA 4PFMA 1MO0A 1JPKA 3BZJA 3QV9A 4OU1A 1XGEA 4DJED 1XHGA 1L6FA 4GI8A 2E9BA 2XGBA 4C6CA 2CZ5A 3BJTA 4FZIA 1DJXA 2QVNA 3ABSA 3WD0A 4ADSA 3KFTA 1W2PA 1BWVA 3NL6A 4C6EA 4NJHA 4H2HA 4CLMA 3HGSA 5D2VA 3OYZA 1UROA 1GONA 4G2DA 2BOGX 4BJHA 4ZOBA 4AY1A 3BWWA 3B05A 3VNYA 2EPKX 4WJXA 2XH7A 3MV01 3WX7A 1CB2A 1DJHA 4MWAE 3MCMA 3PPGA 2QDGA 2JE8A 4QP0A 3WLJA 1LLWA 3KX6A 1TPEA 4PRTA 1EZ2A 2A3LA 1KFLA 9CGTA 2OO0A 3H21A 1GPWA 1H51A 5LGXA 3PJTA 2V3EA 2Z1WA 3CQIA 1HJSA 2BOEX 2EBNA 1IWPA 4GNVA 3NL3A 4H9TA 1GOMA 1H11A 1C90A 3NQ6A 4MJMA 1J5TA 1FKWA 4IIEA 3HOJA 4MFDA 2WMKA 3ZJ7A 3KBSA 3WBEA 2OGJA 1PWMA 2DVXA 4GJ1A 5A8GA 1R3QA 4H1ZA 4YVPA 1UPMB 4GFSA 3HG4A 4E38A 2VNCA 3DHDA 3EEGA 3K2GA 4GG9A 1A53A 1A0CA 3HQ1A 3N4FA 2KX9A 2H6RA 1YTDA 3LXBA 4JGDA 2BHYA 3W7LA 1V7AA 3GH5A 1CBGA 4MVAA 1QCWA 1XKYA 3UY7A 3N34A 3V3WA 2R24A 6REQA 2OLSA 3NO1A 2BY3A 3BTNA 1E43A 4W88A 3A47A 1EEXA 3N6JA 3GVWA 2FHCA 1JZ5A 3NPVA 7ODCA 1YE6A 1HP4A 4PTDA 1AL8A 4O15A 3AAMA 4DEFA 2QCFA 1CLKA 1UR0A 1L6SA 2B7OA 4WSHA 2FVLA 3DFOA 4JTIA 1TA3B 1DXIA 5JBDA 1M7OA 3HFYA 1QXLA 1H7NA 1EX5A 1M68A 4AEOA 4ZCWA 3L4ZA 1BHGA 1POJA 5TAOA 4PGLA 2QF7A 4CCEA 1BXNA 3HO8A 2F7FA 2FKPA 1F3WA 5HK4A 2QJIA 3W7NA 2EXOA 1YTEA 5A6MA 4E4FA 2XWDA 3MV11 1G94A 1OD0A 3W7EA 1J2BA 1AH4A 3STGA 4FX7A 1J4EA 4YVVA 1E0VA 3S5NA 2JGYA 2ZRWA 2VCAA 3U2ZA 3GXDA 4AEEA 1FKXA 1ZNNA 4GBDA 1EUNA 1PIIA 3M64A 2YXXA 1FWDC 3UJSA 3MHUA 1NOFA 2XN1A 4MWAA 1PTDA 4P7OA 3W7HA 4C1NA 4DHGA 4DO7A 4YIWA 1GOKA 2B81A 2ZZ6A 4O50A 3ANUA 1LWJA 4H6EA 4RXFA 1KQZA 4MM1A 1W91A 2G8ZA 4R3UA 4J1OA 3A3WA 1XKJA 3KDNA 3VNLA 3XISA 3B9AA 1H41A 5JH1A 2EPLX 4AC7C 4GYFA 1SMAA 1WKDA 3EBVA 1EWDA 1UBSA 5CCZA 1P1XA 2QT3A 4US6A 4D2JA 3QMRA 3E2RA 1GG1A 2E5CA 8A3HA 2Q71A 2J78A 4UQCA 4QIUA 1I2NA 3MQTA 2AAAA 4LW7A 3R58A 1KO0A 5BRBA 2NW0A 3EX6A 4O10A 1GGOA 1V0MA 1R87A 2AAMA 4GIEA 1B57A 1XLLA 3LHTA 1ECQA 9RUBA 1XH2A 3BL3A 2PAJA 3EWXA 1M9HA 1ZZMA 4HPGA 1VR6A 1ZALA 1M53A 2INFA 1L9WA 4S39A 5K3VA 1A4MA 4PB5A 1RV8A 4B5UA 4ERAA 5E70A 1XIBA 4GCAA 1XRVA 4IPJA 3PM6A 1OK4A 4LBUA 5F1UA 2ZE3A 4W89A 1IYXA 3VILA 4PEKA 1AJZA 4K8GA 1R7AA 1F8MA 3W72A 1EPVA 4I9MA 3VM7A 3A5FA 3TA6A 3NZ1A 3GXIA 4L5ZA 4IH3A 1AA1B 4FNSA 1TV8A 4LUYA 3SCRA 3IJ7A 1Y5VA 2YL6A 3WH9A 3AHVA 2VZSA 3RILA 1HG3A 1GQJA 2VQTA 1OGBA 5A3HA 1UWUA 4F2TA 1C7SA 1EOMA 1KXTA 4MG4A 3VDCA 3LHUA 4EANA 4FX6M 3IIPA 3ZLHA 1DJZA 1TV3A 2GDQA 1B9BA 2GVEA 3UETA 4F3HA 2IQ0A 3UZXA 4QJ5B 2QYGA 4IPPA 3W84A 5A69A 2F61A 3G1FA 4LAKA 4C6IA 1V6XA 2P88A 3GRIA 4GVIA 3KCJA 2OR2A 1BWLA 4W5UA 4IZGA 4Z2LA 2FB3A 4H7ZA 4XVDA 4TV6A 4RV8A 4HCHA 3JZEA 4HA1A 4BWLC 1UD5A 3F4VA 7REQB 4JY8A 2WMJA 1CGTA 4AY7A 3DI0A 1FHVA 4OV4A 1VEPA 1C91A 3S8HA 2V5JA 1MUWA 3PWIA 5A8PA 3OW1A 1IXPA 2WMFA 3CV1A 5BXPA 4S23A 3L0GA 3LDVA 3N4AA 4FEZA 9XIMA 8XIAA 1UB3A 1YTKA 4UZSA 4X9YA 2O0TA 3HV9A 1PEZA 5EA9A 4JHZA 1WBJA 1VYSX 1SMDA 2VR5A 3V16A 3GW3A 5J5DA 2HXUA 2V81A 1I2QA 2BY2A 1UZ4A 2OEJA 3H54A 4JDYA 5FJUA 3UZJA 1NP0A 3TV8A 1XLDA 5A2CA 3UJRA 1IEWA 3G1DA 1DWGM 1DIEA 2PTZA 3RLVA 4TR9A 3CHDA 3AICA 1OFDA 3VNDA 2JQXA 2Z27A 1ITXA 2QCMA 2X1RA 1DJIA 3EZ4A 1E3ZA 2JKAA 1VBJA 4L4MA 5G2IA 1WXYA 3WMLA 4NZ1A 5IFTA 4V1XA 4AWSA 4AYGA 4OGZA 5EMMA 3RMJA 3SIMA 3N29A 4QLKA 2O9TA 4IMCA 2RKXA 3NOYA 3W01A 4R7WA 4IHCA 2DIKA 3BW4A 3P8IA 3EDDA 3TTSA 3B06A 3H4GA 2DJLA 3AHZA 3IJIA 1EX1A 1E1CB 2C1HA 3CGTA 2C18A 4G8TA 1E0WA 4RW5A 3W1TA 3E96A 3A9IA 1EC7A 2J9YA 1U33A 2BXZA 3CQKA 4QS6A 3IJQA 4AXNA 3V1HA 1JYNA 3U2EA 1LYXA 2XHYA 2CLOA 4UTWA 2YSWA 4AZ6A 2W66A 5HJYA 3ENLA 3MZNA 3OLGA 3PBMA 3U7BA 4JQAA 4PRWA 4KBXA 3EPMA 2WMIB 1OABA 1NWTA 4UB9A 3P3BA 4ATLA 1WUFA 3QR0A 1FA2A 4PSPA 3AXXA 5DCDA 2C1GA 3ARWA 3B8SA 2J77A 3WDRA 4EPDC 3IRDA 4K36A 3VGEA 3VKCA 3CZEA 1AODA 1VF8A 3SUTA 3MUIA 3BURA 3OHMB 4L1XA 1K9FA 1F8IA 1EGZA 1O60A 3URBA 1V6TA 4AD5A 2ISDA 1QHOA 2G41A 3RF9A 2FB2A 2DIEA 2H9AB 5HQLA 1B4EA 4JQ3A 4QE4A 2NXHA 1KM4A 3BLLA 3L4VA 2A21A 4JDBA 2F84A 5FL1A 1OY0A 3W1UA 2WPBA 3AYRA 2WPGA 3ZM8A 3ICJA 5AC4A 3LPFA 1EP1A 2O7QA 3WKZA 4HBKA 2PDHA 1UIOA 1GZJA 1YXDA 1SU5A 1A5OC 4XBJA 3THUA 1UR3M 4IPLA 1UH3A 1K8XA 2D22A 1TPH1 3WQWA 2QVHA 3T0TA 3GFXA 3Q37A 4LVGA 5FJPA 1O1HA 3WNOA 2G5WA 1JPDX 2OZTA 2CBUA 1ITCA 3Q2DA 3NZPA 4MYAA 5EMJA 4O0ZA 1RZMA 3MUXA 4AHOA 1W9VA 4GNKB 4C6KA 2G4JA 2ZRZA 5KTLA 2V67A 3GUWA 3BG5A 1DQXA 2ZX8A 3QY8A 3N11A 4X2PA 2OKOA 1OT1A 2A7PA 5HNNA 4A6GA 5FJJA 1U5HA 1BYAA 2J62A 3II1A 3NZGA 4GVGA 4X3ZA 1E6ZA 4QNEA 4XO7A 3WJXA 1G4SA 4IQLA 1Q4NX 1MEIA 4IMAA 3TP4A 3L5MA 1ZAJA 1MFVA 3IK4A 4KGLA 1Z42A 1PCWA 1O12A 4P7RA 1J12A 3T44A 3TTEA 2W5FA 3WQ8A 1JCJA 2OZ0A 1WKEA 3DECA 1UW9A 4LEFA 1VFOA 1Z9AA 1JVNA 1LQ2A 3ZO9A 3Q67A 5A6JA 4WD0A 1ZQ5A 4B5WA 4EXBA 3RX3A 3BO9A 3NVTA 4YWSA 1VFTA 2YGYA 4NG3A 4FR6A 1WDDA 2G50A 1VZWA 4GHRA 4C6MA 1CGVA 3A6OA 4BWLA 3WCZA 1ZHAA 4G1KA 4RUBA 5IBXC 1CECA 1R3VA 3W1AA 3B8DA 3NQ2A 1DTUA 2H90A 1TIMA 4H9UA 3CUXA 1YXYA 3WJYA 3NQVA 4PTNA 3SQMA 3LHVA 2B7PA 3FYYA 5E0CA 1XDJA 3TWAA 3LBMA 3KE0A 5D04C 1Q66A 2CXEA 3UPWA 2R1KA 3UF9A 3ZMRA 1LOQA 1JCMP 1RBAA 1LQAA 4I6VA 4Z2KA 1IHIA 3W38A 3LBOA 2ODOA 3VVGA 4HYWA 4DYJA 4YL2A 1O66A 1VPXA 2NX9A 5TD4A 3VIFA 3SFWA 3UA4A 1VFSA 4XTDA 2QMJA 5K9CA 3WDIA 5FSDC 4C6OA 3VE9A 1TUXA 5BROA 2OVLA 1HZYA 4C6DA 3LBCA 5HR7A 1D7FA 4PMQA 3TDFA 3G1XA 3L0KA 3VD3A 3BAJA 3WENA 1J11A 2NV9A 3R13A 1ALDA 2FIQA 4OOZA 4WX2A 1F05A 1Q63A 1QBAA 5LKYA 3LZ5A 3OVPA 4H41A 2G3NA 4LAOA 4DO5A 2AGKA 1O4UA 4PUJA 3S2MA 5GPRA 3SCWA 4PMOA 5BXSA 3FDKA 2O55A 1SYTA 3TOPA 2OEMA 3GHRA 4DY1A 4UQ9A 2AKZA 3UZWA 1H61A 5F7UA 3LI1A 3I10A 1UKQA 1RA5A 2WZTA 2OELA 2IUZA 4A3RA 1GVSA 4DJFA 3QW3A 3BLOA 3WF2A 1MZRA 3WQVA 1J8VA 5EBAA 5ABEA 2JEPA 3ELFA 1Q6DA 3KTXA 1OBAA 1W3IA 4FPSA 4IX0A 3WZ0E 5A6BD 4IQEA 1BVWA 3YPIA 1WX0A 3UGVA 4DZHA 4HZ6A 4JY9A 2FGLA 4J3SA 1QWKA 1ZENA 2RUSA 1FHLA 1W3TA 1VBHA 2YDQA 2YLAA 3TONA 2XM2A 4Q8OA 2EAWA 3SRKA 2PTDA 4IIGA 5FF0A 4PCSA 1F3EA 1OFOA 3UXDA 3ZFHA 3MMDA 3KZPA 4HMDA 4GUGA 1V79A 2Z1KA 3EWUA 3EEZA 1P6BA 4NX5A 4HKPA 1QUMA 2GJLA 3HTWA 4KW2A 4IMGA 3AZTA 5HNUA 3BLIA 4M5PA 4A8RA 2D2HA 2HVOA 2W62A 4QNWA 4Q4QA 5HXMA 4CQAA 2EGZA 4R88A 1SZGA 3OODA 4YN5A 3CWHA 5I79A 1PKMA 1E70M 3NPUA 4FX8A 1ONRA 2XGIA 2QCHA 3IJ8A 2ZFAA 1POKA 3UWQA 4I7VA 4ZOAA 4UOQA 2XPKA 5EGRA 1TIWA 3RN6A 4Z42C 2FDMA 2Q8XA 1JXJA 4IFKA 3NDYA 1PAMA 1OFBA 3FV9A 3N2BA 3E38A 4ROQA 1TJ2A 3MU7A 1UWAA 3EDEA 1DKWA 2CYGA 3S2CA 2QIWA 4KERA 4A3YA 4MGGA 4EWJA 2R14A 1KFCA 3TCSA 3EKLA 4M0XA 1OG0A 3RM9A 3H53A 3R25A 5B80A 3PZGA 5J8LA 1OCQA 4W84A 4ZO9A 4KEUA 4WDTA 3M0VA 3OPSA 3V18A 3WEZA 3VX0A 4GCXA 3STFA 1H1YA 3OLIA 5EBUA 2X30A 2QMKA 1LOLA 1V8EA 3W9ZA 1PVNA 2HBVA 1VBGA 3QQWA 4XZMX 3WG6A 3ZYZA 4FNPA 2FMOA 4DUOA 2Y7GA 4LPCA 2V3FA 4MSSA 2A1YA 2VX7A 3KRSA 4DO4A 3W7JA 5E9XA 5A8NA 1K8YA 2D3NA 2C7FA 1ZTVA 4DN1A 1IGSA 2BVDA 4KQNA 1ZU8A 4TXEA 1D8WA 3D3AA 3RRAA 3FXGA 5J5RA 4JYDA 4TOQA 4MYXA 1CXFA 2BGNE 1JAEA 3H24A 3LLXA 4ZFCA 2ISSA 2J7HA 2CHRA 1K7XA 5CAHA 2BVWA 3C3NA 5CPLA 3UBPC 1LRTA 3MYOA 1O95A 1G01A 3UCQA 3PNUA 1IT7A 3BLEA 1SO5A 4HOXA 1ISZA 5JMUA 1FHUA 5KZ6A 1NM9A 1OX5A 3NQMA 4NJIA 3K13A 3PR2A 4FLSA 3L2MA 3RM4A 4FF5A 1YLVA 3XINA 3EDJA 1JNEA 1TWWA 3TC6A 1KM0A 2AOSA 2WXDM 3GY1A 3LTYA 2ZX7A 1LLZA 1SW0A 1Q7MA 2FZ9A 2PZNA 2WSQA 2PLCA 2XWEA 4JTQA 5CPSA 2W92A 1NDZA 3D47A 4AVOA 1JUKA 2O4MA 1BVZA 3LOTA 2IKJA 2OXNA 3SW6A 3BW2A 5A6TC 4MUZA 1W9PA 3UGRA 1TMHA 3NVDA 3EOUA 4OVXA 1IWAA 1W54A 1RCXB 2V5KA 2GQ9A 1W1VA 3L66A 2PWFA 1CGWA 3O8AA 2YDRA 4JTUA 3GE7A 4NL1A 2BLEA 4ZQCA 3O16A 5CSSA 1CXEA 2CKRA 4LVAA 4BF5A 3M7SA 3L4WA 4QBXA 2ZQ0A 3N04A 3T07A 4Q8VA 3RITA 1XYCA 4LJ3A 4O19A 2BMBA 1K4HA 4CD8A 1VCVA 3AOFA 1WKFA 4LNYA 1XD1A 3KWSA 4J27A 2ACSA 5G2WA 4G9PA 1XQLA 3FYOA 2Z7GA 1AQFA 1BRLA 1KFJA 1SFLA 1W5PA 4FO4A 1PYMA 2VC7A 4QG8A 3JVAA 3NQGA 2V3GA 4EKJA 5C9ZA 1ZB5A 1Z48A 5A1AA 5I02A 3BMVA 3PUGA 2TSYA 1TWDA 3S2LA 3T05A 3NYDA 4B2DD 4HSOA 1WBHA 3OIHA 3KCOA 3DFHA 2E9MA 2J7FA 4HSNA 2AL2B 2W27A 1LJYA 1GKQA 1T6MA 4FMVA 2YDAA 2YXOA 1XISA 5MHBA 2NT1A 3R0DA 1C8YA 3ZSSA 4JFTA 3IVTA 2YB4A 3UR5A 1W8SA 1R38A 5CBIA 4ZXOA 2ZTJA 4GY7A 3WD3A 3SJ3A 3DG6A 2VQUA 2P0OA 4HTBA 2XVGA 2RDTA 4RDWA 4H6KA 3SUUA 4ZGYA 1OGSA 1UWSA 4HJFA 2CBJA 3HB9A 4WOQA 1GHRA 2QHAA 5G5IA 1HX0A 2Q02A 3QTGA 4HIBA 2PA6A 3PUOA 5F2IA 2J8GA 4TVCA 5D33A 2ZRUA 1DIOA 4DWSA 3EXRA 1E4MM 2QAPA 2Z25A 2B7NA 2VCBA 3KP0A 1YRRA 1JD7A 3LYEA 2GDVA 1HTIA 1CX9A 1RPXA 3QXBA 1DL3A 1VP5A 4KIEA 4UR7A 3C0LA 1ZJAA 4CU6A 3V35A 1CXKA 4DF1A 2EQDA 2BODX 4JIHA 3IIXA 3ITOA 5H8MA 3VM5A 2FZDA 1EH9A 1GWJA 4PBEA 1TZZA 3PZTA 3G0UA 1Z6KA 3BAYA 3G8RA 3WQDA 4H7CA 2ZDRA 4A21A 1FH7A 2ESCA 3M0HA 4QCEA 4XZHA 1N55A 4NI8A 4GBUA 1FWCC 5K7JA 4LWWA 3SCOA 4D6FA 3PB2A 5EYWA 5F2MA 4REQA 3S4TA 1LL7A 4NVTA 2JGQA 4TTGA 2W91A 3FA3A 4XKYB 3TWBA 2WVTA 5DEZA 4CVWA 1E4NA 3S5SA 1GT8A 3W25A 4ZO7A 1WXZA 4U5IA 4RV3A 1GTHA 2WNNA 3QR3A 1QOPA 5A95A 2DUZA 1E1FA 3E0IA 2VX4A 1GYLA 1OGGA 3URNA 4HNNA 1RCOB 1NWUA 3CZKA 3UZZA 1RQEA 1S2CA 1TWIA 1HL2A 7PTDA 3E0FA 3DOPA 2WK2A 5FJOA 4L4LA 3WLLA 3U6WA 5E9AA 3F03K 2ZA1A 4DM1A 4WKHA 3DIPA 3SGGA 3KL3A 5A2AA 3CXOA 2A3EA 1ZS2A 3ZT5A 4UTJA 1TVPA 4IGMA 2J7GA 3ME3A 4ONVA 4A2RA 3G0SA 3TSMA 3Q94A 4AISA 3ANYA 3OGVA 3QLLA 5H2ZA 2VCCA 5HQMA 3C2FA 1A5AA 4M29A 1J2WA 1OQFA 5AHNA 4IQJA 3N17A 3E12A 4WK9A 1YBQB 4A2SA 2OQHA 5XINA 5JBFA 5LNWA 2FH8A 4A35A 2E5BA 5AOUA 1EOKA 1BXCA 3U48A 1Q3NA 1HJQA 4FAMA 4ZR8A 3S5ZA 1PV8A 4UNLA 3B40A 3SUVA 1HGYA 2Y4SA 4JTJA 4KPLA 1FTXA 1WKYA 1BTMA 5HBFA 1VFMA 2PE4A 2V63A 3G1RA 2ISVA 4DBDA 2PWGA 1CW2A 2BZNA 3F2DA 5T26A 3TYAA 5CSRA 1QJWA 5A8QA 2DFAA 4EWND 4C60A 3NSMA 5IM51 4QS5A 2ZOXA 3HN3A 1KRCC 2P8BA 5A8OA 1IR2A 2DVUA 1MRQA 3POCA 3UR2A 2Q3OA 3WJWA 3KW3A 1B9ZA 4H9XA 1ADSA 2OYMA 4LB3A 2CLHA 2QPUA 3L68A 3QV8A 4O52A 3A22A 4LANA 2FH6A 1PX4A 3W2UA 3P60A 1CTNA 2E67A 4I9TA 3K8MA 2VJXA 1UASA 2D3LA 3N19B 3VGBA 3LUTA 2NUWA 2NSOA 2GJRA 3P7YA 2X41A 1C29A 1PKLA 2DT0A 3ITCA 2DT2A 2JF7A 4OBSA 3GTIA 2FTPA 2QNEA 3EYPA 1B54A 3O05A 1X38A 4J9JA 3URQA 3LCFA 3M0LA 2V5DA 1QT1A 3AYTA 2YBTA 3GB6A 3AWNA 2GDUA 1LG2A 3E0WA 1UUMA 3HJZA 4QG6A 3WFZA 1JUEA 1M03A 4NQ1A 5HATA 4DUVA 2XU2A 2DEPA 2DSZA 4K2SA 4ZTXA 2XVLA 2BXVA 2J25A 3QV7A 3H7UA 4MF4A 1AG1O 4GY0A 4URIA 2WB5A 4GNJA 4FF7A 3C0SA 4MZ8A 3QFWA 4XWUA 1L6WA 7TAAA 2WM0A 3VD4A 2D20A 5HINA 3P0WA 1FQ0A 2Y1HA 1XGZA 4Z0SA 1O5XA 1NF0A 1FWEC 1QAPA 1UD6A 2W9MA 2WKLA 2OLHA 2F6KA 2A3BA 4Q4SA 4AMCA 3QEZA 3IK2A 1O5KA 2PBGA 3NURA 2JBMA 2NVCA 3H2OA 3WH5A 2XYLA 3C4UA 3W74A 3QZ6A 2L5HA 1VRDA 4J5NA 4QEEA 2GUUA 1UHVA 1E71M 1F6YA 2XSXA 3BMXA 2EJ1A 5LXEA 2REQA 3VOIA 3DG3A 3HM7A 3HGOA 1MDLA 4JN7A 1B1YA 5G4HC 5EY5A 1XLHA 4C1LA 2PWEA 3ARUA 2FVKA 4LV4A 4JTAA 3BGGA 3VGDA 3K4AA 1R9YA 1TG7A 2GVGA 1YQ2A 4BR1A 2J6XA 2A7NA 1TJRA 4OTKA 4M56A 2GSJA 3P5YA 3VMOA 1P0BA 1W1A1 3DGRA 2OSYA 1NVMA 3APGA 1EJTC 1M3UA 2E4TA 4P8VA 1BF2A 2XTKA 3MI6A 3AFBA 4HD5A 5A5WA 4CD5A 4PMDA 1I6NA 3U7VA 3C2EA 1DJNA 5HQEA 3CL7A 4D71A 2OPJA 2PGRA 4NY2A 1FCBA 3T2OA 1PWLA 2I5IA 3UESA 3KCLA 5LIXX 1QASA 5DFAA 2XINA 4E8GA 4MWAB 1X6NA 2OO6A 1S2UA 4C1NB 3E5BA 3DBNA 1JNDA 4HHPA 1OFAA 5IRPA 1QNRA 3TYCA 2G95A 4XD6A 3N3TA 1U83A 4Q22A 4TUFA 5CZJA 3KWXA 1CXHA 4HNCA 1WQ5A 3S6OA 2NX1A 3UQNA 2VC6A 3M07A 4ZE5A 3UNTA 4QJ3B 4GLEA 3GLCA 3VXGA 2CLFA 1BGAA 4QDWA 4DJDC 5ECUA 3H7VA 2YA2A 3D0CA 1DWFM 1DORA 1PZ3A 1KTBA 1US3A 5JIPA 3SI9A 2YLLA 3CM4A 1VHNA 2DSUA 3M0KA 3PAJA 3WUFA 1E9LA 4PB4A 3NXLA 3MKKA 1W6TA 1H4PA 3RCNA 4O54A 4HMCA 2VKZG 5CPOA 3CUGA 1GZGA 3ZLFA 1JCLA 5LA2A 3C8NA 2OWWA 1XFBA 5CAKA 3N1AA 2ZKMX 3OVQA 1GW1A 4ICMA 4GQRA 3F7JA 1NOWA 1TTQA 1F61A 2PTXA 3CUHA 4S3JA 3QN3A 3H8AA 3R94A 1NDWA 3VOCA 3W2KA 5KEZA 4YPJA 4KCVA 4QG9A 1FWRA 4IJCA 4D8ZA 4P8UA 1J18A 3WY1A 1ICQA 2GVLA 3G2GA 5E0FA 3O07A 3KOZA 6CGTA 2ZWZA 4Y9PA 4AVNA 4I9AA 3RM8A 3ZS4A 1B2YA 3M5VA 3GNPA 4K37A 3ITYA 3P5ZA 1BSIA 2Y8VA 3PY2A 1ZBKA 3KVJA 2QULA 4UNIA 4FOJA 4IFOA 4HA3A 4IF2A 1TCDA 4FOUA 1GVOA 3IIZA 2FZ8A 1UA7A 3IWPA 1CT5A 3LPGA 2C14A 1KC7A 1EJSC 1NELA 4UFLA 3M47A 3UG8A 5HNRA 4S3CA 1LUCB 5D09A 1Z8AA 3WD1A 4RZBA 1P4CA 3E2SA 3TFXA 1R3RA 3MWCA 4QE1A 4ILSA 1X1OA 4NYUA 4Q8WA 4DNHA 3THCA 8CGTA 4PEEA 4PSRA 3AIQA 4ZBCA 4WSKA 1XPGA 1W56A 1E0UA 2MNRA 3AXKA 4MIMA 2DP3A 4XIMA 3MP3A 4Q6XA 1XSIA 3C56A 4OFCA 5CPNA 2HROA 1KV8A 3UR8A 3CO4A 1PKNA 4V15A 4KH2A 1JDAA 3NOEA 1T96A 2HISA 4NASA 3EWDA 3HQNA 3LHYA 4RDZA 3WMSA 1V6WA 2XN0A 4XBSA 2Y5SA 4FI4A 3ZR4A 2DW6A 3GW0A 3W6YA 2HE5A 3CH9A 2DZXA 3JZUA 2YBUA 2E1WA 4LYQA 5LXXA 4UMCA 4EPBC 4DBWA 1I2OA 3KVMA 1J6PA 3V7PA 4DZAA 2WO5A 4AYSA 3TQKA 3GK0A 3LI0A 3TR9A 4NKCA 2P10A 1GQIA 1EC9A 3NZRA 4WCJA 2NVDA 4N9CA 4XAGA 2QPSA 5KETA 1L2QA 4I7UA 3I3EA 1BQCA 4ZB5A 1GEHA 1L8PA 3IS4A 2CZEA 3H7RA 3EOOA 4PULA 4Q7BA 3LSCA 2OKTA 2GWGA 4DWDA 1M7XA 3LCIA 3PJXA 1FWJC 4IGHA 4ZO6A 3H4WA 3WMCA 5I0DA 1QR7A 3VCCA 1UZHA 4FNRA 4ZOEA 5BW6A 4B4FA 4GVFA 2J7EA 4U3AA 4UFIA 5DMNA 4XSLA 3W07A 2GQAA 4IGSA 4ZB2A 2D0GA 1B3YA 1DVJA 2FMNA 2TAAA 4PODA 1ECEA 5FEPA 1HP5A 5A2BA 1XLKA 4R5EA 5AZ1A 1UIPA 4Y7EA 1K8ZA 3NQCA 4C7DA 1E5JA 3GU9A 1TPC1 2GGJA 3TN6A 5CJNA 4ATWA 4X61A 4XUYA 1V02A 1VS1A 4KFOA 4Q4OA 3PS7A 3WNMA 2QCGA 1TZ7A 1T8XA 2GJPA 3K1GA 1QPQA 1JPHA 1EXPA 2X42A 2YKKA 3VIOA 2IPGA 1AJ2A 3UR7A 1DIKA 1PL9A 2I1OA 2X1IA 3P8JA 5D2TA 5HAOA 4U28A 1RD6A 4GIRA 4MNMA 4XD5A 4I5RA 1GTEA 2QJJA 4CQCA 1DP0A 1R86A 2R8WA 5AYYA 2PP3A 3VIMA 3F4NA 3IACA 4XIAA 3PHAA 2OOGA 3COTA 4IXHA 4LH8A 2ISFA 3L2IA 3N9RA 1XIFA 4PMRA 4JKLA 3G22A 3H2FA 4S3DA 1VCGA 2PDXA 1YDVA 4O1BA 5KITA 3KL0A 3TN4A 4C6LA 3BSMA 1E6RA 1ISXA 1VC4A 3W7PA 2F2KA 4PC8A 3N2XA 4QFUA 1FWTA 4PTWA 4UQBA 1XIEA 1LWIA 2YDSA 3HPFA 3KTSA 4OV9A 1V0NA 3AS2A 4BI6A 1J6OA 3F5JA 1WNOA 1AUSL 3GG0A 1EF3A 4NNCA 3P81A 3VC6A 4PR4A 1JDCA 1VB9A 4S2BA 1X98A 3CU2A 4PBFA 1MQQA 1MW2A 3EOLA 1WE5A 5FJIA 1PHWA 3OZPA 4TX9A 3LCXA 4HOZA 5C9WA 1NY1A 2YCIX 3HBLA 3F1QA 3NTYA 1W1YA 1RPKA 5BWFA 3WF4A 3LGGA 3SURA 4OOUA 4B9YA 4B15A 2R82A 1KLYA 1AD4A 1K9TA 2EG6A 2X2YA 4TIMA 3W75A 1MUMA 1NDYA 3NG3A 4IPIA 4QSFA 1XCFA 3VTRA 3EXSA 3LHZA 1VPQA 1ZJBA 4ZVJA 3T0DA 3P0XA 1RHCA 2V9DA 2VL4A 1GOWA 3FA5A 3DC8A 4O17A 3MW7A 1JYWA 3B9OA 3ARTA 4EPEC 2RDUA 3K8KA 4WEVX 2CLKA 3LTSA 4MKNA 3VABA 5I3IA 4OE7A 3H12A 4RR4A 4ROPA 4JFSA 5DANA 3C2RA 1XBXA 4RNFA 4NAEB 4K7VA 3CBWA 3G6MA 1NFGA 3WLTA 4A22A 4UTHA 4NIRA 1BQGA 2OEKA 4YTUA 5HMSA 3HGRA 5EFFA 3VA8A 1WDSA 4QQ3A 3LEPA 4AHQA 4DELA 1NAL1 3PZQA 3VMPA 4YU1A 1KRAC 3VIIA 1IIHA 4F66A 1H3GA 3W1LA 3GTXA 2QJNA 1KM1A 4M6UA 1D3HA 1NFPA 1OC6A 3HU7A 4C7GA 3AUOA 1WO2A 1Z89A 4O14A 1TV5A 3VKJA 2X7WA 3N6HA 2HJPA 1GVFA 1XIMA 2RDWA 2XIMA 3TSDA 3QKZA 1XYZA 3NA8A 3UWYA 3KOXA 4NXSA 1UP2A 2Y8KA 5DT5A 1XBYA 4PCNA 3KS5A 4WDXA 3GDMA 1LL6A 1RJPA 5DRCA 3RLGA 2I5GA 1W37A 3VI2A 4LY8A 1DWAM 1KCXA 3WQCA 4FXSA 1IEXA 2CZDA 3FSTA 1W32A 3QQ1A 1A80A 4NJKA 4HA0A 3P80A 3MO4A 3ZR6A 1TWZA 5ENLA 4IIDA 1CEOA 3MI2A 4HTYA 2VR2A 5C0QA 2WSRA 3U3HA 5BMXA 3FYPA 3VFLA 1HKKA 1HF6A 1QI0A 4Z08A 3T55A 1Q6FA 1F07A 4BS0A 4WHBA 4IJRA 4BQ4A 2AKMA 2I14A 1G0CA 2VFFA 3SSZA 3VOFA 1FWIC 3IGHX 3UFYA 1ITUA 2G3IA 3U2OA 2V8ZA 1KFEA 4A29A 2EG7A 4FIRA 4ZEPA 1WYIA 4ML4A 3GTNA 2J24A 1WZKA 3H4XA 4NAFA 1NQKA 2RJHA 1E72M 3DBPA 1DV7A 3W7MA 3QJAA 2VFDA 3OHIA 4HNOA 3BAKA 2WBGA 4XZ9A 1PE1A 1Z32X 1MW3A 5DLCA 3C2OA 1SVDA 1JPIA 5KZDA 1VCFA 3G1YA 4C6JA 4RKAA 5J04A 1A3WA 1Q6CA 2B31A 4S3EA 4HPJA 4BEQA 4F9JA 3MMUA 4V27A 3W7QA 1XLBA 4ALDA 3ID7A 2PF0A 1QI2A 1S3HA 3CYVA 4AZ5A 3NL2A 3PBGA 1Q4WA 3GKAA 3C61A 4RZ5A 2HPIA 1DBTA 1XUUA 1OYBA 6ENLA 1CIUA 4QJ4B 3VKBA 2ZC8A 4F2BA 3ARQA 1AW1A 3EAUA 4UWMA 2OU4A 4GQBA 1WAUA 1NQ6A 2QLYA 1U2YA 1OYCA 4G56A 5F1VA 1UUOA 2VGBA 2QJHA 3W7KA 4GC4A 1KTCA 2Y24A 2JALA 3CB8A 3RIKA 4H7VA 2DH2A 5LHFA 3KBJA 3REQA 4ZO8A 3W6MA 5DCEA 3GH4A 1P0DA 4AZCB 3CUJA 1OJXA 4JAWA 3VCRA 5CGQA 3WEOA 2NQZA 1G4EA 4JNZA 1W1PA 3M1ZA 4ZODA 3L5AA 2ZICA 1VEMA 1SZNA 4NZFA 7ENLA 4AIOA 5HWMA 1KM5A 1EQPA 4I9JA 2YCKX 4C5ZA 4UMAA 3LMZA 2W79A 3QHNA 5MF5A 3OG2A 4KKXA 4HNUA 1CGYA 2HNHA 2Q09A 1H7PA 4YTTA 1ZFJA 4H01A 3FVMA 3WQ4A 4GX8A 1N8WA 4NX0A 3THQA 1TREA 2XVPA 3T40A 3SEPA 1PIFA 2DORA 4DXXA 1MW1A 2W61A 1HFBA 3PPCA 3WD2A 1RR2A 4LB4A 3PSWA 2AL2A 1R47A 3E0VA 5JH2A 3I3BA 4W86A 5XIMA 1OSEA 1M7JA 1JDEA 1OX6A 2CZVA 1I1XA 1MUCA 4LFYA 5GNXA 4HPXA 4GQ0A 1K70A 3S2JA 4BI7A 4ZZ9A 3VINA 2DGAA 5H91A 4Z1AA 1RJRA 1DIDA 5ABGA 1DTNA 1PX3A 2C16A 1U22A 3AS3A 4US5D 1FCQA 3BE7A 3DKJA 3LB0A 1CWYA 2YBVA 1BKHA 3R4IA 3VC5A 1QI5A 3TSBA 3WBWA 3V5OA 2X05A 3N14A 2HPMA 3M6DA 3OVRA 3OVGA 3THDA 1YIXA 4CQ9A 1HNYA 4L9ZA 1HKIA 2BWGA 1FWBC 2NQLA 3HURA 3PNZA 4PUNA 2O92A 1TVLA 4UR8A 3TX9A 3S1VA 2QUUA 3WEMA 4QTGA 1R3TA 4ACZB 4FSAA 3AXHA 4B90A 4HZ7A 1JPMA 3NSXA 3L21A 1H49A 3SBFA 3UVAA 5M3WA 1WDWA 3VDHA 3FLUA 1A5LC 5KZMA 2DZPA 1JFXA 1Z7AA 2HQAA 4RCXA 3O0KA 2Y88A 5TIMA 2Y89A 1JF5A 2NX3A 4MB1A 1XIJA 3EXTA 1IIGA 3V0UA 2RH9A 1ZLPA 3RG6A 5D9MA 1R3SA 1TCMA 1L6YA 4IIHA 2ZCGA 1Q6OA 5LZLA 4Y2WA 1J0YA 3A24A 4GUFA 1IZJA 3AS1A 2P53A 1PBGA 4E3TA 4MWAC 1IZKA 3AJ7A 3KBNA 4HU4A 2HK1A 4XB3A 1O1ZA 3LGDA 3AIVA 4H9YA 2JKEA 2E5DA 5F2GA 1PSCA 3O63A 1RVGA 1LRNA 4XK2A 4IIBA 5D2YA 5M17A 2DPEA 3WIJA 5G2HA 3UCCA 4Y6GA 5L9FA 4MY1A 1LCOA 1QWGA 2QCCA 1ICSA 4UIOA 4CVUA 1K4GA 1VGAA 1KBLA 5DO8A 3P84A 4CNTA 2FHFA 2CWNA 2XVNA 4MB3A 2PU1A 3EA3A 4JL1A 1VAHA 2V30A 4AF0A 3H2CA 3CUFA 4AQLA 4LYKA 3HQPA 1B3ZA 1KTNA 1QATA 1EYWA 5AYBA 1HJVA 3STPA 2JEQA 4HK5A 5AHIA 3N18A 3QR1A 3JU2A 3GTFA 3WQ5A 3URAA 3EB4A 4WOZA 1C8VA 3AIWA 1UH2A 5AY7A 3S42A 2QUVA 4BZYA 3NEHA 3W2MA 3N15A 3OO2A 3HPZA 4PMUA 1J0IA 2OLAA 3UG4A 3RO6A 4GA8A 1KRBC 3N6QA 3BG3A 3VD9A 3CMJA 2NV2A 4IP7A 2PDCA 3LM3A 3NGFA 3IRSA 3AISA 3BK0A 2C0HA 2DDXA 3M0YA 1U5VA 4O1CA 4GC3A 1TPDA 3KVLA 3OBEA 5E5CA 1DEDA 3KS6A 1BRLB 1JI1A 1S5TA 3N25A 5E09A 5TF0A 3TYBA 1X7IA 1KKRA 2IXVA 3CIWA 4OBRA 1TTIA 4TV5A 4AEFA 4K6AA 1JL8A 4M80A 1QO2A 5A6BA 1XQKA 4CD4A 1HXJA 3ARPA 3AUJA 3G1HA 1Q7ZA 4Y9AA 2FPVA 2Y7EA 3R8HA 3VDBA 4JX5A 3AIUA 1M41A 2PEVA 2PI6A 3OA3A 1PB0A 4N02A 1RAKA 1B31A 2PS2A 3ARYA 1XYAA 2X1UA 2VRQA 1A5CA 4EACA 3KM8A 2V2CA 1GKRA 2UY2A 3RRXA 4R9XA 3WLPA 3FIGA 3T8QA 1A5UA 1EYEA 2WV8A 4N6FA 4NHVA 3WH8A 1Y8BA 2JKPA 3UZ5A 4E2OA 1RK5A 1VFLA 4JTLA 1HGWA 2EPHA 3W1RA 3T09A 4KRUA 3CHEA 2WHKA 4BQ5A 2NQ9A 3BICA 4HJWA 3N2OA 2Z6JA 2Z7KA 5G1YA 3S9IA 4CQ8A 4DWSB 2VELA 1QI3A 3A12A 4XBKA 4TX8A 3O6YX 3VAVA 3MCNA 2R1PA 3FXYA 1S39A 4CGTA 3SZ8A 3WLNA 5G1TA 3FSUA 2YCLA 2ZVIA 5DRIA 3M4HA 3VNZA 3TA9A 4LOCA 3KBMA 5DN1A 3WF0A 3AU6A 4GX9A 3SY8A 2D24A 2PF8A 3B0PA 4UTIA 2CPUA 1A5NC 1SZRA 4ZXLA 2GFTA 1R2RA 1FFRA 1G9HA 5C55A 3OB8A 2VDHA 4N7QA 5K2ZA 1KV5A 1RD5A 3GXTA 3DYMA 4FLQA 4JXCA 2WHMA 5A94A 3UXAA 4AX7A 6TIMA 3GD6A 1XYLA 4L6DA 3W6LA 4AIUA 4JICA 1QOXA 4EAYA 3MDUA 4OQVA 3WDPP 2WKJA 2YA1A 2YCJA 1MVYA 2UY4A 3L23A 2VVNA 4NUWA 4AXKA 3FGCA 4REQB 4EXQA 3CHFA 3LK6A 1FWAC 3I4EA 2A7RA 3ABZA 3GO2A 3GYCA 1JI2A 3OBKA 2I7GA 4PL2A 1UWIA 1JCYA 2BNJA 3CEUA 3P14A 1ZAIA 4ZQOA 4YCPA 3KZSA 2WQDA 1VIWA 1W3KA 3IVSA 3U0HA 4R33A 3N73A 2VI0A 1HN1A 4EPKA 1S46A 4D8LA 4OUEA 3JR2A 4C7FA 3PWAA 3DFSA 2E7FA 2GYIA 1EHNA 3T2PA 2QCDA 3ATZA 2ZDSA 1XCXA 1E55A 3OQ8A 3O6DA 1B0IA 2TYSA 4KCTA 1OM0A 4IUOA 5BXTA 4E3VA 2PCQA 2C15A 1XH1A 4H9ZA 2EPMX 1QNOA 2PTWA 5CLTA 3A4JA 3MA8A 2Z0IA 3S1WA 4MJ2A 3PWGA 1B4KA 3GHUA 1GG0A 1Q85A 3L0NA 3BLPX 3LM7A 2GUBA 2O7SA 3LTPA 4PA8A 3W86A 4BKNA 3UU0A 3FS2A 5TBOA 1JULA 4BK9A 5HJLA 4G7FA 1I2PA 1CGUA 2P0IA 1F4HA 3FKRA 5A6SA 4UTWC 4TU1A 1LROA 3LV6A 3HG5A 5DMLA 1A49A 4D6DA 1HJUA 3ARZA 1N2VA 3WN6A 4XD3A 2GQ3A 1DWHM 3QKEA 3DGBA 1P6CA 3DH7A 1QTWA 1QW8A 4AIEA 2XN2A 3CPUA 1UKPA 3DC0A 4MAVA 1XYFA 3CLWA 4W5ZA 2VX5A 4H3DA 4C6PA 4HU0A 3SUSA 4HA4A 3W88A 2C6QA 3VUPA 2PLJA 5FF3A 3B3DA 4BA0A 4HOWA 8RUCA 5FJRA 1MQPA 4PFHA 4XZNX 3QGVA 3EA1A 1UP0A 5AC7A 2Y0FA 3S1GA 1P7TA 4PTXA 4GACA 4UC5A 2BHZA 4GO9A 3NEVA 1V3JA 4JHOA 3VNMA 4F0KA 3STCA 3QY7A 4AZIA 1EJRC 3Q65A 1B5TA 2XFWA 3UNDA 2V69A 5JXQA 2Z24A 1KR1A 2UY5A 4GYKA 2AGTA 2WJFA 1DXEA 2ZXDA 1DXFA 2NXGA 2NZLA 1VHCA 1EJUC 1U1JA 4WF7A 4HHLA 1S1RA 3RK8A 1TR9A 4AD0A 4XAZA 2VHLA 3V4BA 1XLGA 4QROA 5C9UA 1OG6A 1NFBA 3H2EA 4Y8FA 4XAYA 1LZOA 2V2DA 4OUIA 4MZ1A 5FI8A 4GY1A 3LD5A 3GBEA 4UBPC 3G5EA 5C7VA 1A3XA 2GOKA 3KOYA 5F4WA 2ALRA 4Q4MA 3LA4A 1ITQA 1WPCA 3GAYA 2A0NA 5D02A 2E6YA 1QPNA 4GIYA 1EGMA 3BCFA 1W1TA 2IXUA 1BF6A 1FWNA 1M65A 3SCPA 4ZB0A 4HP5A 2WC3A 4UOZA 1T99A 1V3KA 1J0ZA 4K38A 3NQ8A 3WFAA 3WLMA 3WNKA 1FDZA 4LYRA 4LBRA 2XM1A 1R0MA 3PPFA 1LUCA 2BTMA 3B97A 3TK7A 3GVRA 4LNCA 1OFQA 3A9BA 3H2NA 4DLFA 2NWRA 4A3HA 1E73M 1BYDA 5DXYA 4IPNB 4GZEA 3T78A 4UTMA 3T7VA 4TMBA 1E4IA 3TC7A 2WC7A 1YADA 2REQB 1JYXA 2GPTA 1SQ7A 3NIYA 4ADUA 2F2HA 1NWSA 4NXKA 3UA3A 4JHMA 3KRBA 4U4MA 4O1FA 4FNTA 4GUHA 2C3ZA 4FB7A 3TYEA 4FXFA 4R34A 1Z3NA 4I5XA 4LUIA 5CZTA 3RCYA 1E3XA 3M5XA 5BU6A 3T0BA 4B5SA 3MY9A 4JFUA 1W5OA 3NGJA 3NR0A 3TJXA 1TQJA 3OU8A 1W0MA 4MLJA 3CPGA 4YNGA 3GS6A 3PTKA 2E28A 1XYBA 3L67A 4EXAA 3MPGA 1EPXA 2OSXA 2QUNA 4DZ5A 4J7RA 3BCJA 4UMBA 1REQA 3WUGA 4HMEA 4L4OA 3DFYA 4B5TA 2PURA 4JD4A 3OOQA 2C8NA 1TV2A 1S5NA 2CCRA 4QM1A 2VXNA 5EPDA 4C6QA 1YPIA 2VTFA 4AVFA 1CCWB 1KXVA 3USZA 3QRHA 4MPKA 2B4GA 4S3BA 4D6JA 4WJ8A 3GXMA 1QNSA 4JYEA 4O4WA 2OGYA 4PUWA 2X1SA 1VJZA 4IUGA 3USBA 3MANA 3WSUA 3VUSA 2RJGA 2FZNA 3NXFA 4MOZA 5LIYX 3WQEA 4UFJA 1TELA 4DIAA 2EPNA 1MXDA 1VFUA 4WXZA 2QUMA 3AXIA 3I6EA 1LTDA 3GR4A 3OZYA 1V3IA 1UKSA 4S3FA 2AQWA 4G7EB 4JEQA 4JS3A 3W82A 3C86A 3EX2A 3PSVA 4RDYA 2GGEA 5AECA 1RVKA 4DB7A 3N9SA 4R27A 1XG4A 2WMGA 1UBPC 1JRBA 3K1DA 1FRBA 2FZMA 1ONWA 3ABRA 3A5VA 4GE8A 5D9PA 2DV0A 1Q6RA 5I09A 4XZIA 4XD4A 3GFZA 1GPFA 3CLMA 4WZHA 1H62A 3PTQA 4DJFC 1UD3A 4WJEA 1K6AA 4DNMA 1V3MA 2QEZA 3FEMA 4YTSA 1YMYA 4B91A 5JUVA 3WNNA 5CXPA 1RCQA 2XVKA 2IPFA 2P5NA 5FL0A 4FR1A 1JJKA 4O1DA 5AYZA 1JZ6A 1I8JA 5K9XA 4KGJA 4E2BA 1DE6A 2F8QA 4WDWA 3CJPA 3B0XA 3O9NA 3P67A 4ENLA 3MKCA 3PUDA 3PZUA 3W7DA 1U1HA 2IKHA 2DZVA 2FZBA 5CBBA 3B0YA 2CWXA 4XQ6A 3PULA 3U5YA 2J7CA 3IPWA 3VIPA 4LAMA 2AQOA 2E8YA 4EF9A 4L7ZA 4GIAA 1W1B1 2IPWA 4YCOA 5RUBA 2IQTA 2Z1BA 1QNVA 1T0OA 1XG3A 5DY2A 4IISA 4RDVA 4UQAA 4YMZA 1RSCA 3WLKX 2VEFA 1VFFA 2MANA 3TW9A 4D1JA 3TH6A 1M01A 3ZQ9A 2F38A 2V5LA 2Y7FA 4HNLA 2F6UA 2YXGA 3M6YA 3AO0A 2R1LA 4H04A 4MLRA 2XG9A 5AC8A 1LP6A 4O13A 2KZHA 3RU8X 2VC5A 4FLRA 4F48A 3VO0A 3GYEA 3CL6A 1KA9F 3BDKA 2WHJA 4BEUA 1KM3A 3PUEA 1XCWA 3ABXA 4PBGA 1KWGA 5FA5A 4LCSA 1RP9A 5C8BB 2V68A 4S3GA 3TLQA 3N13A 2UY3A 1DJQA 1QW7A 3RR4A 1FDJA 5D38A 3SN4A 1A0DA 2VEPA 2OOFA 4AUBA 1Q6QA 3MJMA 4UUIA 1D2KA 2YA0A 2JIWA 3PBUA 4QXIA 3JW7A 5CZ0A 2DQWA 5IOBA 3TW7A 3EOEA 4V2XA 1O94A 4NAEA 1LL4A 1OCNA 3OA5A 3SFKA 1JCXA 4H8HA 1SM9A 4O28A 2HXTA 4IL2A 2J27A 4JNMA 2QKFA 4GUIA 4BF9A 2WWDA 5AHMA 5HOSA 4HCLA 4GKTA 3CH0A 4CN1A 2WBKA 3R89A 4H9VA 1V6YA 3VD5A 5D9OA 1ODUA 1UCWA 4CCCA 3NUKA 1OD8A 3PVFA 4JKMA 4DO6A 2P3ZA 5EMLA 4L80A 3TYUA 3P6LA 3CK5A 1PDYA 1XSJA 1L8NA 3CZLA 4NP7A 2FPTA 1OFRA 5I6SA 3PG8A 4JBRA 3TOYA 3ZLGA 2WOQA 4EOUA 4Q7IA 2FJKA 2O56A 4RE4A 1QBBA 4HT3A 3C3UA 1V51A 3G1SA 1KM6A 1Q5MA 2O9OA 4INFA 1SJAA 3M0MA 5DX7A 2QW5A 2CESA 2W4XA 1SUXA 3CAWA 4KWUA 5FF7A 4NRSA 2E09A 1KB3A 4LT9A 1R3YA 1AK5A 3ZWTA 2ON3A 2ONEA 1BXBA 4CNPA 4C5YA 3WL1A 2J88A 3ES7A 2VMFA 5CG0A 3EB3A 1NARA 2PDFA 3T4CA 3DKLA 4JIEA 2QDHA 1UA3A 4W8AA 3RPTA 1DHKA 1AQ0A 3QVQA 3JUGA 3K8LA 4F9DA 1V0LA 2YCEA 2VC9A 4IFRA 3GDKA 1OK6A 1LM1A 1J93A 1BEUA 3AU2A 3W53A 4HZ8A 2RAGA 2Y6ZA 4HB7A 2DIJA 1AZ2A 3G77A 1DJWA 1RY0A 2Y2WA 3FK4A 1QOQA 1J79A 2XSAA 3SO7A 4O1EA 3UY8A 1TMQA 5FEZA 2HCVA 4UOJA 2E6FA 2EPOA 3W1NA 1QPRA 4H83A 5EU9A 2ZZ5A 2WCSA 1O5RA 1GK8A 4EVZA 2VFGA 4Q8QA 3RPDA 1GJPA 3NWRA 2VX6A 1KGWA 3UZYA 3MTWA 5FEXA 2Z28A 4HPNA 2WANA 2RFGA 3E2VA 1PHQA 1S2WA 2ZX5A 3UP8A 3BSHA 2NUXA 3DHFA 3TNBA 1R5YA 4CU8A 2A5HA 1JZ3A 3IGSA 2OT0A 2JIEA 3ZZ1A 3PP7A 3BOLA 3UYCA 5I24A 2NV1A 2CHNA 3T4WA 1M7PA 2ZUSA 2BVTA 3GSMA 5CSUA 2PDLA 3WL0A 3BCDA 1TJPA 4MADA 1H1NA 1TSIA 1F2JA 4PMNA 4KFPA 5GJNA 1BD0A 5I78A 2A6LA 4L1WA 4TVDA 5E0KA 2VRKA 4OECA 5AHFA 3C2YA 3BUVA 3VZZA 3OTRA 4AX6A 3H26A 3RUBL 1S2AA 3VGHA 4TMCA 1P48A 2CLLA 2EKCA 3FKKA 4ZTYA 2GQ8A 4AZCA 3GUGA 1FCUA 2HBXA 2VD9A 3WLIA 3GXFA 3U57A 4QGCA 1EP3A 4NZ3A 3ZR5A 4KMQA 3ZJKA 4UTFA 4DWSC 5C70A 2CLPA 3O3RA 4AZ7A 3DN5A 4PZVA 4XVEA 1FCVA 4J2PA 4JTKA 5H1WA 3H22A 3FHQA 3KDOA 1JCNA 3PTMA 1RLDA 2XH0A 3TYZA 4M1RA 4JN6A 1UWRA 3AHXA 2AL1A 5FCZA 3OLDA 5KSWA 3VOJA 3H70A 4HU8A 4RW3A 4ZL1A 3TMLA 3EDFA 1TKKA 3LPPA 1OFPA 2CBIA 1KNWA 4TO8A 3WLSA 4GJJA 2J9XA 5F4SA 1UOZA 1Q6GA 4S3KA 3FVDA 1W5MA 2PTYA 3V1PA 3BZGA 2OFJA 4CEXC 2YL5A 5LSMA 2TPSA 4CNOA 3E1F1 3E02A 2OYLA 3BJSA 3P62A 3PFMA 4N9DA 5C2XA 4ZSUA 2A4AA 3W2LA 4JKKA 3GC2A 3K46A 3T1GA 1SW3A 1JQXA 2H8XA 4FA3A 3ITTA 3RO8A 4WY0F 2E40A 1ZAHA 2GVJA 3PAOA 2CKSA 3OZOA 3EX3A 4AD2A 2R6OA 3OP2A 1QW9A 5LA0A 1V77A 2QAFA 5TQLA 2D69A 2QGYA 1YNPA 1LBMA 1XBVA 2GGIA 5CSYA 4HYVA 4NSBA 3MMWA 4JFWA 3MYPA 1VYPX 2PDPA 5LHEA 2RGMA 1VJIA 1WOBA 5MKGB 2BGSA 1IR1A 1NOUA 3RLHA 2NT0A 4QAIA 3E0LA 4GYJA 5I3HA 1ICPA 2FPYA 3OGRA 4NZ4A 5B7ZA 6XIMA 1AJ0A 2YW4A 3SR7A 2VT0A 4NAFB 4XKMA 3Q58A 4ACZA 5HULA 1NDVA 5HMDA 3W02A 4Z1DA 1P0NA 4DI8A 4NZCA 4Y96A 2OWCA 3ARXA 3R7MA 5LNVA 1XSKA 1AQMA 4GH1A 3GHSA 3DDMA 1XLFA 2DUXA 4L65A 1MQRA 3NSNA 2C91A 5XIAA 2ZX9A 4GOAA 2GK1B 2EO7A 1DWIM 4ZENA 3WELA 4IG2A 2DZAA 2FFCA 2CC0A 3EA2A 1WP6A 2VO5A 4CKQA 3VDAA 4YTQA 5BU9A 3AWOA 1I45A 4GI9A 5D30A 4ZSTA 3OGSA 1OVDA 5D8WA 2HK0A 1GZ1A 3F2CA 1Q13A 4IWWA 5I3GA 5K4ZA 3TQPA 2HVMA 4PMVA 3TN3A 3PZMA 4LAUA 4QISA 1Z44A 1U30A 4MPQA 2ZC1A 1US0A 4YLWA 2VEKA 3R12A 4FXJA 3SGZA 5FF2A 1LRQA 2OODA 4XSMA 4A05A 1ZJHA 4C90A 1OIMA 1PCKA 2HRWA 1PZ0A 3SRFA 5CBJA 2G0WA 3FAXA 4FP1A 1TRDA 3REQB 1KW1A 4W85A 3SM0A 3HMJG 2VZOA 1H7OA 3PBWA 4WGXA 1XLCA 3IUDA 1D8CA 3VZXA 5U4NA 1MXGA 5E6ZA 3N2CA 1B3OA 4F0MA 2Y5JA 2I16A 5BRPA 4MJ4A 4UCFA 4B3LA 3G18A 8XIMA 3AMCA 4ECLA 4XUGA 2WCAA 2JK2A 2BS9A 3DFQA 3GU1A 1MEHA 3GIPA 4EIVA 5I7GA 3AI0A 5M5DA 3AS0A 3GAKA 4UCGA 4QE5A 2A3CA 3GVQA 5IHSA 4ERIA 2DVTA 3R0KA 3CNYA 1ZBCA 3CEPA 4A8IA 4E2DA 2R91A 4J40A 1ESWA 1IT0A 1Q8JA 1R8LA 1DWJM 4XTIA 2PGEA 3G6LA 3QPYA 1H7RA 3AIRA 4LS1A 5HPOA 1XS2A 4IIFA 1TMLA 4AFYA 3U2CA 3ERPA 3KLLA 1J9YA 1XI3A 3AYSA 3T9PA 1OF8A 2ZA3A 1KQYA 1KFBA 3R1ZA 4G6CA 1RJQA 2WZHA 2BDQA 4IMDA 1DHPA 3FHAA 1B3XA 2PLKA 3GNOA 1NWRA 3UWZA 4DYEA 2ZRVA 1VYRA 3S83A 2WVVB 4ZE4A 3VKKA 3EB2A 1UZ1A 2VWSA 2ZUTA 3OIXA 3LMYA 3R2GA 2GL5A 4IICA 3BGJA 5HR6A 4BQ2A 2BOFX 4CD7A 4Q6JA 4IXXA 5CGMA 4D1IA 3DFPA 6XIAA 3TJLA 2QF8A 1GHSA 1IT8A 4LVFA 5EFDA 4X22A 4GYPC 3R79A 1HJXA 4JTTA 5LGZA 1X96A 1ZCCA 4JPGA 1ZJIA 3BPWA 3SAZA 4Y9OA 5E1QA 1A47A 1Z69A 5I03A 2XH4A 2PDJA 3VIKA 4P61A 4F2UA 1OIFA 4YVXA 2CBVA 3GWQA 3KVKA 3BG9A 1VH7A 3A4WA 3MS8A 3W37A 1G1YA 5H8PA 4Z1CA 1EJXC 4GK8A 3BMWA 4PMXA 3MT1A 4PUUA 4EE9A 1PJ9A 4Q3MA 1O7AA 5H6HA 1J10A 4KEVA 5DXXA 4GO8A 1HKVA 2JF6A 1BWKA 2YB1A 3PBVA 6ALDA 4Z17A 3MZ2A 4JIPA 1RLCL 4JTFA 4KIRA 1EA0A 4AC1X 1XLAA 3J7HA 4JQ2A 3CIXA 4CU7A 3VPLA 3QSRA 3GIQA 2ZWYA 4DJDD 3MBDA 2HVNA 2PWVA 2V5BA 5BMWA 2YJQA 5ABTA 4ASTA 3T08A 2I17A 1KRMA 1ZBVA 1LG1A 2Y61A 3FJ6A 1H7WA 5T9CE 3W1PA 4RE3A 3QHOA 3WK0A 3NPXA 3R8GA 5DBTA 4JTRA 1D3GA 2GOUA 1ZBWA 3CL8A 4OZOA 4AF0B 4MTVA 2V6AA 1QI4A 1P43A 3T42A 2PDKA 2TODA 2X7VA 1SO6A 4ZA0A 1C9DA 1KXHA 1W1ZA 4LCQA 1OZMA 1I0DA 3PFRA 3NO3A 5T9BG 4AAJA 1ZPTA 5I07A 1S1PA 1W9XA 4L9YA 4HHMA 2IW0A 3WBXA 4QEHA 4W4QA 4AZGA 2XFYA 5BNKA 1TFVA 4MFEA 3RX4A 1XDLA 2QV4A 5A6KA 1I2RA 3EDKA 3FOKA 1GKPA 3QFEA 5HNTA 1QHZA 2VGIA 1JZ2A 5CPTA 3ZXWA 4J3XA 1B90A 5C6MA 3LSBA 4ORMA 2ASHA 2NWSA 1UR9A 1GOQA 3SRDA 3UJ2A 3EWZA 2VDGA 1HL8A 3DX5A 3ZT7A 5LIUX 3EPOA 1JUBA 4Q8NA 5DQPA 3RAOA 1EDTA 4D6EA 2OJPA 2VEMA 4IQDA 1TPB1 4E4PA 3L65A 3NM1A 3TAKA 1A3HA 1S5WA 3UCDA 4MKVA 5G4WA 3A3HA 1C92A 4L9XA 1PX8A 4PMYA 4DJEC 3N9KA 4N2YA 3DCPA 1PIGA 1HUVA 4OHQA 2QJMA 1R6WA 5CG7A 5IDIA 3MC5A 3SUWA 5LA1A 2QV5A 5AC5A 4A8LA 2DZUA 2V38A 3CO8A 2QUTA 1BG9A 1RP8A 2O9PA 1S2VA 1XBZA 2XIIA 3IJLA 1KBJA 1X6UA 1H5VA 7A3HA 4X9SA 2BY1A 4QAWA 3JS3A 4IL0A 4IT1A 4WDUA 3IUIA 3R6IA 3VOGA 1O5QA 2POTA 3W0KA 3DERA 3MSGA 5AN7A 1A5SA 3DAQA 1ONEA 1PZ2A 3ANVA 3SSJA 4QR6A 2VZVA 4ADTA 1BTCA 4YHGA 4GZJA 3PG9A 4GKLA 2ADAA 2WSYA 3LQLA 1Q45A 4LV9A 5I00A 3TZNA 3WO8A 1ODZA 4W87A 1H60A 5CEWA 3WQ6A 4BCEA 1HKWA 4KCWA 1W31A 1MMFA 2VGGA 4U10A 1GVEA 4C1KA 2A3HA 2R1NA 2YCLB 3NJ3A 3LG3A 1XWYA 2CZFA 1OC7A 4CCZA 3TYDA 2PODA 1V03A 3B04A 4GVHA 4QLLA 4F0RA 3U5UA 1VQTA 3QGAC 3IUHA 1E0TA 3TXVA 3W24A 3A4XA 2P3EA 4JTGA 1NJJA 1I75A 1WZLA 1VENA 4PCTA 3MDWA 2BFGA 2VM8A 3CAKA 3GC4A 1XFCA 3S1XA 2OSWA 1A4LA 4IGNA 2FDSA 3GNNA 5FKYA 3WLHA 4OJYA 5D4YA 4D6HA 2OT1A 3BLDA 4QCFA 4US5A 1TE6A 1YPXA 4ACYA 1UR1A 3O0FA 4NT0A 3NNTA 4H19A 3FGCB 3I6TA 3I65A 4BI5A 1UMLA 2DSVA 5FF4A 3AMGA 4XISA 4HQVA 2YZ5A 4KF1A 2FVMA 2DH3A 3HPXA 3VMNA 3VDGA 4M51A 4X2RA 4M6PA 4F79A 3WDHA 4AWTA 4P8WA 1RBLA 1EP2A 2G3JA 3UWVA 4NNBA 3QY6A 3Q45A 1H1ZA 1CENA 3CUZA 4P7NA 2BSLA 2PDUA 5BOFA 2QPXA 6TAAA 4GYPA 2GVYA 3UPBA 2WJEA 2OTDA 2QIIA 4I8DA 2HTMA 3LU2A 1NH6A 2QCDB 1QK2A 2YW3A 3ALGA 3N3MA 4EAMA 2PGWA 3TVAA 1OHLA 5HUOA 1W3HA 1M5WA 4O57A 3MVTA 1QDSA 4GXPA 3CIVA 3O7UA 3SIZA 1D7KA 5G1MA 4Y9MA 9XIAA 4XG1A 4O18A 4LUSB 4BHYA 4B16A 3H23A 3TTQA 3QW4B 5D37A 4RXGA 2XDFA 3MSYA 3G24A 1QHPA 3UG3A 3DHUA 1H50A 2CHOA 1UUQA 1XL9A 4L4PA 5D03A 2PRLA 1GVIA 4RK8A 2ZADA 1UR2A 3GXNA 1EO7A 1T7LA 3L5LA 2WVSA 4HNTA 3IEBA 4P7QA 3NAVA 1QU4A 5I3DA 1FBAA 4Y8EA 3KBVA 1HO1A 4O8RA 1K9EA 3UJFA 1FP8A 1E1EA 1EFZA 3M0XA 4DUWA 1XXXA 3KAOA 4H4IA 2J75A 5AFDA 1MNSA 2PP0A 4GINA 4K8HA 2ZE0A 1P7TB 1TJ1A 1GJUA 1KBKA 4NJGA 4Q7NA 1TX2A 1ZCOA 3DZ1A 3OLEA 2V82A 3S5YA 2WNZA 4PN2A 3SQSA 1M1BA 3L4UA 2J6VA 3RHGA 2ISWA 4G7EA 3U8GA 2OMAA 3W7GA 3MKVA 3GDLA 4DAFA 4WLCA 2PDYA 2XH2A 2WW5A 3PN8A 1LOSA 3ITLA 3KRZA 3RX2A 1J0JA 4WKFA 1BGGA 2XIQA 4LX4A 2VVSA 2HSAA 4FS9A 4E8DA 1CYGA 1CLVA 1W3NA 3AMLA 2W3ZA 3B9NA 4FLOA 4ZMGA 2X2GA 3UW6A 1EGVA 2GWNA 2ZX6A 3MUY1 1DOSA 1PYFA 1J0KA 1C3FA 1UWTA 2WZEA 1F9CA 2J66A 3VZYA 1V5XA 2FHBA 1TYGA 1V02E 1C8QA 2HV5A 4HN8A 1GQNA 1GEQA 4DJEA 2VR4A 1AVAA 3PF3A 3AMKA 4PL1A 2HS6A 2Q01A 2V0TA 5LYRA 1G4TA 4U33A 2ZUMA 5I5RA 4Q8TA 4U31A 1TPFA 2NLYA 2G4FA 3ITVA 3MP4A 3HF3A 3GQYA 3KTCA 2X1TA 4QDPA 2B0MA 5PTDA 2OB3A 1ZP4A 4LAZA 1TZ9A 3BAWA 3VCNA 4WQ6A 2DUAA 4ZOCA 3NCOA 3H6OA 5JBEA 4DYKA 2DZSA 3CV7A 1RBOB 1K7EA 4HK6A 4AD3A 3ARRA 2SFPA 1L0PA 5AHEA 1XF0A 4AH7A 3E2QA 1K9DA 2A79A 5CZSA 2DSWA 3WK1A 2HNEA 2E0PA 5FACA 4Q4PA 3EKZA 3ORWA 3APTA 3QC3A 4Q33A 3FY1A 3I4KA 2XUCA 2XSBA 2I5QA 3LGEA 2POZA 2B7QA 1MI3A 1SZEA 2CIPA 4NJJA 4C65A 3HG2A 2GJXA 2IS7A 2PWHA 1IZCA 4U2YA 2WAGA 1K03A 3LY0A 3LENA 4LQ1A 4ZQPA 4XV0A 3A64A 1JZ4A 4M82A 3WK2A 1OYAA 4MMWA 3FCPA 1F5ZA 1TR1A 1PPIA 1XIHA 1CLXA 1XINA 3AROA 4XZBA 3VIGA 3L12A 5IDZA 5KMYA 3MSDA 2BBFA 4AY8A 5BCAA 1XRTA 5CPMA 4JX4A 4LUTB 4OT7A 2ZXBA 3M44A 1REQB 4ORIA 2QDEA 5BOEA 2NUYA 2ACQA 1SW7A 1AW5A 3HPAA 2PDNA 3CUIA 2ACUA 3HA1A 4DVOA 5D2XA 1W2VA 2C79A 3EX4A 1V7YA 3S5OA 1VRXA 2NQHA 1W9BM 1SPQA 1BYCA 3I6RA 4PMZA 5K9DA 1ZP3A 1OCBA 1UJPA 3P74A 2ICSA 3FN9A 1FX6A 3GVGA 1ISWA 3DENA 2AMGA 3PANA 3W73A 1BSLA 1H2JA 3CT7A 3WLOA 4KRTA 1YX1A 5F2LA 3TEVA 2NQJA 3SY1A 4O0QA 4BFAA 1X6LA 2FYMA 5GQBA 3GDTA 1F3XA 1UQZA 1J96A 4O12A 4O0KA 1CI1A 4LF1A 3C2VA 1VJSA 1TX0A 3STEA 3I7RA 1S2TA 3O1NA 3QMTA 3POHA 1XC4A 4P5UA 1E0XA 3F5LA 4M3PA 1E6XM 1E9YB 1VBUA 4HHHA 3E49A 4OKDA 4J3ZA 4A4AA 3MCOA 4LY4A 5B7YA 5FEWA 1IV8A 1XICA 4AG0A 3D5HA 4M1BA 3GZAA 4PCFA 4Q32A 4D6IA 3P2VA 3G1AA 4JTDA 4L64A 4F4RA 2VEGA 4O4VA 1TE1A 3B8IA 7CGTA 3F4DA 2HE8A 4Z2JA 5KINA 3NQFA 4BQ3A 1Z41A 2DQXA 2V5CA 1LT7A 4E5TA 1FVPA 2ZZ2A 2E68A 1R7OA 3NDOA 3SY5A 4TTUA 1LBLA 3LNPA 5ECVA 1KCLA 4ATDA 3L4YA 4GXWA 4QX4A 4CQBA 3WQPA 1UD2A 3IAQA 1G69A 5D32A 4J28A 2XZ9A 5C2CA 3H2MA 3WUBA 3S2NA 2PZ0A 3BOFA 1H0IA 3GZ3A 1KBBA 3A21A 4IMEA 3MB9A 3M5ZA 1UP3A 4R7OA 5HMFA 3KL5A 3LCHA 1PS9A 1YDOA 1ML1A 5D05A 2A85A 3TN5A 5AVNA 2O4QA 1XIIA 5LNUA 1TB3A 2W63A 3M7WA 4UZUA 2HMCA 2VRJA 1YEYA 1KGUA 3CV2A 1L6GA 1SJDA 3HGJA 3NL5A 3O2LA 5DMMA 1XJBA 1S5VA 1DQWA 4E4UA 3MI3A 3DFNA 5FAJA 2YOCA 5DMYA 4JFVA 5GJPA 4U5KA 1IGWA 3FDGA 1OWQA 3IVUA 2PUZA 4X0NA 3ZJ6A 1X97A 1GUVA 3HQOA 4S1FA 2G37A 1ZY9A 4Z1YA 4MKSA 1TPUA 5GVJA 2BASA 2OX4A 3MWAA 3CV6A 2ZIDA 3GTHA 4C6BA 4L61A 5I3JA 4AMAA 1NTHA 3O06A 4Z1BA 5C2GA 1LLOA 2UWFA 4F0LA 5JVLA 2IKIA 2DT1A 1ZUAX 1THFD 2PPGA 3GC5A 5AYXA 4Z2HA 2CLEA 4LRTA 3L7RA 1TV4A 1IXOA 4GRSA 3SCVA 2NSXA 3I3DA 5AYIA 3OEXA 1YPFA 4YXGA 3RXZA 1EJVC 3LNMA 3DHPA 4GD0A 4DBUA 4J3UA 3GG8A 3AALA 4PRRA 4DAIA 1JF6A 4GFIA 3CPRA 3WH7A 5DY3A 4Z2IA 3TQVA 2D0HA 1W8GA 3B9EA 3D46A 4M81A 4LS2A 4UFHA 5DF0A 5IBXA 2VZUA 3QHMA 4JTEA 1KBIA 3T81A 5FAGA 2JFEX 2UZ9A 3B8WA 2WC4A 5IHRA 2BB0A 3IJ6A 4Y90A 4HYRA 1XR2A 1Y65A 3VGFA 2QZRA 1Q8AA 3P61A 3CWOX 3B8UA 3BARA 2FFIA 3PZOA 3WNLA 1ONXA 4MWAD 3N4EA 3NQAA 2INZA 2E9LA 1H7XA 1US2A 3D6NA 4I6KA 4HGXA 4L1GA 4JZ5A 4NILA 1FY6A 3WYZA 3LCLA 4PTVA 2FTYA 1UR8A 2NVAA 3TIMA 4DQWA 2EG8A 2PU0A 4WY0A 2PDGA 3PZNA 4Q8MA 2J47A 3VFCA 2UV8G 1MEWA 1JXKA 3UYIA 2I9UA 3RCMA 3P82A 5HDRA 1V0KA 4QQUA 2PP1A 3BQ5A 3INPA 2OZ8A 4OBTA 5T8GA 2ZUVA 3ES8A 1SZFA 4XZLX 4LALA 2DSKA 2YZRA 4GI6A 1MFUA 4I90A 3PB0A 2BX7A 5D2WA 4RL3A 4B4HA 1ZSXA 4GWEA 2J8TA 1SFJA 5REQA 1JR1A 2DU2A 5A8MA 1VIZA 1E5NA 1UWQA 5CJ5A 1EDGA 4XAPA 2PGFA 3SCNA 3ZOAA 3SCQA 3WMBA 1BAGA 3M0IA 5FSEC 4CQDA 5MKGA 4LF2A 4QHRA 2PWUA 1C93A 2WJDA 3ZSTA 1Y7VA 4EX4A 4U2ZA 1PTGA 4KFNA 3CWNA 3F4WA 5GNYA 1FWGC 1E6QM 3PBYA 1WUEA 3UT0A 3G0XA 1EXBA 3DXIA 3LRKA 3B8VA 3AXMA 1ME9A 5BRQA 3OJGA 3W00A 4MZYA 3Q4DA 4OIFA 3S9YA 2VZTA 7XIMA 3W28A 1DPMA 2FJUB 1EZWA 2D2GA 2WVUA 2GK1A 3L2LA 2J13A 5SWUA 4IP4A 5FIPA 3SQLA 3BAIA 3UG5A 3WF1A 1WB0A 2Q8ZA 4LXFA 3RGTA 2I9EA 1WXJA 3V0TA 2VOTA 5CC3A 1E4LA 4HCDA 2NLIA 4XO6A 3EWBX 4P8XA 2EF9A 4LCRA 2ACRA 4NI3A 1FUYA 4HU3A 3SCSA 1PUDA 2YX0A 3F5KA 4X0VA 1SGJA 2ZYFA 1NP2A 1YDYA 4MNLA 3QMSA 4QDMA 1QK0A 2C71A 1G6CA 4D9PA 4QITA 4LYPA 1LF1A 2CETA 4I8YA 1BKSA 4JTSA 2Z4GA 1R2TA 2X16A 2YYTA 3IIVA 4GABA 4L56A 4FXRA 2J4GA 1W3JA 2VFIA 1OX4B 4XAFA 2GSHA 3GHTA 3E5PA 1UPPA 3B0VC 3TFCA 1JZ7A 3AIBA 3CT2A 3NQEA 2QGHA 3MJYA 5D8ZA 3AHYA 2E77A 1E40A 1S3TC 2W67A 3E6EA 3F4CA 1F76A 1W17A 5FESA 4EK7A 3KLKA 3E3HA 1K6WA 3LN3A 4CCDA 1F3TA 1MSSA 1RQBA 4LSBA 3QPEA 5CZKA 3LXAA 1WDPA 3CHCA 2R9RA 4X63A 4R9OA 2Y62A 4D6CA 2Z00A 3RU6A 4FOKA 1VBRA 1EJ7L 4PYSA 3C5QA 5HWNA 1KD0A 4UTTC 4K3ZA 3M41A 2Y5EA 1S38A 1FWWA 2ZUUA 3B9DA 1F6PA 2XISA 1UOKA 3ECQA 3UXLA 4UTLA 4LUJA 1KCKA 3LRLA 3A13A 1FWSA 3CAQA 3NO5A 5ABFB 2WM1A 3AQUA 3APYA 1V6UA 4O16A 2PDWA 3BV4A 1KM2A 2G97A 6A3HA 3LX9A 4R53A 1PTAA 1TA3A 1HVXA 4D72A 3R10A 3DI1A 2ZA2A 3T0AA 1RUSA 1FFQA 5F4XA 3CMFA 2ANUA 2Y85A 2QDDA 2QXWA 2KAUC 1OCJA 1ZRQA 1JRCA 1VLIA 1XW8A 1YE4A 3AYVA 6PTDA 5CLWA 3MHGA 3ZVHB 3VOHA 2D2JA 3CTTA 2XZ7A 1SR0A 1YKWA 3VKDA 3QH2A 4CNSA 5CC6A 3V75A 4RZ4A 3V0SA 1NSJA 1XLJA 3SB0A 5I3KA 1GW9A 2WVVA 2I57A 4WR3A 3TCEA 4WRHA 1G5AA 1AZ1A 5LNSA 2H3DA 4G1NA 1QPKA 3FA4A 2J7BA 3HIJA 4MB4A 3KBWA 4H6QA 5I3FA 1EHAA 1XRSA 1RA0A 5BYWA 1A5BA 2CU0A 5C9RA 2Q3RA 4POCA 4RZ6A 1HIZA 4NF7A 3WJSA 3UERA 4HMNA 2HZGA 3PJUA 3UXKA 2WYSA 3KOWA 2ATSA 1UC4A 1TJ0A 3BOXA 4A3QA 4MNJA 1GYNA 3HMCA 3ALFA 4J4KA 4S38A 3W7OA 3B8TA 4AZBA 4M7TA 4K8EA 1E51A 4B5NA 1VEOA 5CGTA 3T8LA 1W9UA 4ICNA 5C54A 2BV9A 1ADOA 4N42A 3L4TA 4B92A 4FIQA 4NRRA 4E2VA 4MB5A 1Q6LA 4IG2B 2CFFA 1G67A 4RNJA 3VIJA 2OG9A 2OYKA 4Q8PA 5KZEA 3EWCA 3TUUA 1O6IA 4HN4A 2J79A 4PE8A 4TQTA 3ZVIA 4O53A 3ZIZA 4AHPA 2CLMA 3R43A 1EF2A 3W71A 1KFWA 1TRIA 4PUMA 3UWUA 4M6VA 1E56A 1MXSA 3DFTA 1MZHA 3MMTA 1HVQA 2FGBA 2ZXAA 1BPLB 1T5AA 1X39A 4DUXA 3CQJA 1QO5A 1JDFA 2LLEA 2ZTKA 1KXQA 1PDZA 1TVNA 2E3ZA 2PD5A 4KWVA 1QNQA 3RNDA 5BZAA 5D9NA 3LZ3A 2RHGA 1EJWC 3TAOA 3O15A 1IEVA 1XV8A 3W87A 3MBFA 1KGXA 2PMQA 2Q8LA 4S2CA 5AVHA 1GQLA 3TLLA 3VIHA 1HT6A 5C71A 4FK9A 2A3AA 1HO4A 3UWEA 1UR4A 1X8FA 1BYBA 3WDJA 1LBFA 3DYOA 1RALA 1YYAA 3EMZA 6REQB 3B4UA 3WNPA 3S47A 3M0JA 4FALA 4WGHA 3T6CA 1WAWA 3S6TA 3C8FA 3QM3A 5LNRA 2CNCA 4S3AA 1SO3A 4F8XA 3OQEA 4KS0A 3QGKC 5DT7A 4UNKA 5G4EA 2X8RA 4X60A 2XJ7A 3NQDA 4O11A 1PXGA 1QRQA 3BAXA 4ZQRA 5AZ0A 1TWSA 4JX6A 1LDCA 3EGJA 5EMUA 4V1YA 3N12A 4KWWA 3VGGA 4P2VA 4HZMA 3KHDA 4KESA 2PRHA 3QV6A 1H0GA 2ATMA 1JDDA 3OG3A 1A0EA 1TPWA 4H00A 2WWCA 2QCLA 3W4RA 2Q6ZA 4D6GA 1JIBA 4AWUA 2OCZA 2ZZ1A 3TJ4A 3BV7A 4MDOA 1IQ8A 1DE5A 4Q8UA 4PB3A 3JRKA 3BANA 4XZWA 4MAZA 7REQA 4K1GA 1X1NA 3G1VA 3EMCA 3FW6A 3K30A 2H8ZA 1J01A 1UH4A 4RJEA 1CXLA 1IF2A 5CC5A 4JQ1A 2XIBA 4N4QA 4Q4RA 1XYMA 1FHDA 5BOOA 3UXIA 5JU6A 1DQUA 2PSNA 4YYFA 5BWAA 2WLZA 1T8QA 5A6AA 4UQDA 3LCWA 3HJEA 3RJXA 1QNPA 3FJ4A 3LRMA 1FWFC 1JAKA 1KCZA 2WKGA 3HZ3A 2Z29A 1SSGA 1AFSA 1JYVA 4Z2GA 2CERA 2RDXA 3S46A 4DRSA 2D2OA 4DX3A 4UTTA 2Y7DA 1B30A 2D0FA 3WBYA 1UKOA 3LPOA 3W7CA 1ME7A 3IGUA 4MJZA 4HK7A 4J3VA 5M2FX 4JEJA 5H8UA 1TO3A 2OQLA 3NDZA 3S0CA 3RPMA 4K7YA 1N82A 2OWXA 1E6NA 4DPQA 2X0HA 4QJ1A 4DXVA 2VD8A 3WH6A 3C0QA 1G7UA 4U3CA 4RNIA 1G7VA 3QC0A 3TE9A 4N0RA 4K68A 1E1CA 1JEZA 1WA3A 1E9ZB 1FDYA 1FWHC 1OEPA 1NIUA 1E6PA 2O9RA 1U5JA 1BVNP 1KFKA 2EHHA 4UXDA 2GZXA 4DBSA 3R5EA 3DEQA 4GPNA 3T2QA 3QSTA 2INEA 3DUGA 4PUDA 4WKAA 4DM2A 1YDNA 3FNDA 3RR1A 2ZBTA 2W6RA 5E93A 1R2SA 2VDIA 3VE7A 1HKMA 3TU9A 3H55A 1P0KA 3GXPA 3A3XA 3BXWA 3B0UX 2Z1XA 1OC5A 4DJFD 4AD1A 1VKFA 1L2UA 3EX1A 3EMQA 3KOFA 1B3VA 1V93A 3M9YA 2PD9A 3I7QA 4JCLA 2CW6A 1ELSA 1JQVA 4UFKA 3BLKA 1QVBA 3W2NA 1EIBA