2Y8UA

A. nidulans chitin deacetylase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
211
structure length
211
Chain Sequence
VPTGQVITQCTTPNTIALTFDDGPSEYTPQLLDLLSRYSARATFFVLGDAAAQNPGLLQRMRDEGHQVGAHTYDHVSLPSLGYDGIASQMTRLEEVIRPALGVAPAYMRPPYLETNELVLQVMRDLDYRVISASVDTKDYENQDADAIINTSFQLFLDQLDAGGNIVLAHDIHYWTVASLAERMLQEVNARGLIATTVGDCLGDGEIAWYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHITIN DEACETYLASE
publication title Cloning and Characterization of a Broad-Specificity Chitin Deacetylase from Aspergillus Nidulans Fgsc A4
rcsb
source organism Emericella nidulans
molecule tags Hydrolase
total genus 88
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01522 Polysacc_deac_1 Polysaccharide deacetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 2y8uA00
2C71A 4HD5A 2I5IA 1W17A 2J13A 2VYOA 3CL6A 4NYYA 2C1IA 4F9JA 4LY4A 2C79A 2XU2A 4NZ5A 2CC0A 1W1B1 2W3ZA 1XW8A 4NYUA 2E67A 4OUIA 3RXZA 2Y8UA 4M1BA 4NZ4A 5JMUA 2NLYA 1NY1A 3WX7A 3HFTA 4NZ1A 4F9DA 4L1GA 5BU6A 2DFAA 3QBUA 3S6OA 2C1GA 1Z7AA 3VUSA 2IW0A 3CL8A 4NZ3A 4NY2A 1W1A1 2QV5A 4V33A 3CL7A 4WCJA 4U10A 1V6TA
chains in the Genus database with same CATH superfamily
2WOQA 1FH9A 1X8FA 3TW6A 2OLAA 4HA3A 3RLGA 3P8IA 3UA4A 1V3KA 5KZEA 2NLYA 4XD3A 3U5YA 5DN1A 1CGXA 1EXBA 5DQPA 4HMCA 4E0CA 2BVTA 1QWKA 3BJFA 3EPMA 5CQ1A 3QTPA 1VYPX 4KEMA 4QG9A 4XAPA 2VT0A 2CZVA 3URNA 4PTWA 3NYDA 4FF7A 4Y6GA 1AD1A 3WQCA 2QZRA 4BI7A 3U48A 1A0DA 3W73A 1TMQA 2QUMA 4KWVA 3U2ZA 2GJLA 5M5DA 1FP9A 1IZJA 3GS6A 2IPFA 3D3FA 3DFYA 4LFYA 5HJXA 4CCDA 3M5XA 3GH5A 3UWWA 4WX2A 5T8GA 4AVNA 2V5LA 1XLHA 2QMJA 5F1VA 1EJVC 1R3WA 1SJBA 1I2RA 1LRNA 3IGUA 2Z25A 2ZZ7A 5LNWA 1W9DM 2GGGA 2VD9A 4N6FA 5HMEA 5HAOA 4M51A 2FGZA 4L4LA 1EEXA 2FJKA 1J18A 1V7YA 3M4HA 4DXXA 5MF5A 4H2HA 3RMJA 2CITA 4O50A 1XFCA 3MO7A 2QAFA 3PUDA 3RXZA 1NIUA 3BOFA 3STFA 3BLLA 4C7FA 1LLZA 4ERAA 3AMLA 4PCFA 2DZXA 4KIRA 3MB9A 4I7VA 4XK2A 3W7OA 1HNYA 5E0CA 4E6MA 3LHWA 4BQ5A 2NXHA 3HU7A 3UWEA 1RPXA 2V5CA 4EXAA 4OGZA 3PF3A 4FMVA 1W9UA 3C86A 1EIBA 5I6SA 4OIFA 2VFDA 1GOOA 3IV8A 3HZ3A 5CJNA 4I9JA 4Q8MA 4M7TA 5HWMA 3T81A 1GG1A 3MZ2A 4BI5A 2FIQA 2Y62A 5HA7A 4TV6A 4PULA 3BV7A 2REQB 2ZZ3A 1LLWA 2A3LA 3G24A 4D8AA 2F6UA 2V3FA 2W5FA 3EZ4A 3QZEA 5DXYA 5DMYA 5EU9A 4RZ5A 5CAHA 3NQAA 1L6YA 2VZTA 1X1ZA 1UR3M 3EDEA 4LVGA 5K9DA 5DT5A 2FPTA 3GYEA 1V0LA 1FCQA 3OGVA 5LIUX 4F4RA 5A3HA 4DIAA 4QNWA 3CAKA 3G6MA 3N1AA 3GW3A 2YL5A 4QE4A 2ZC1A 2WSQA 3LENA 3UJEA 2Z24A 4TTUA 3ZSTA 2E1DA 1JEZA 5A1AA 4GBUA 2OKOA 3GNPA 2C79A 1JCJA 4HU0A 3L2MA 1SYTA 4I8DA 4A3UA 3ZJ8A 2PPGA 3GX9A 2HQAA 4AEOA 4D6JA 4YHGA 4XBJA 2FH8A 1US0A 2BY2A 3S2CA 3UZZA 3NDYA 4PUEA 4RZBA 1ZCOA 4YU1A 4ML9A 1QNOA 5BOFA 1RSCA 3BW4A 1ZJIA 3N3MA 5JBDA 2VOTA 3LCHA 5DY2A 3DXIA 3CUXA 2X1RA 2XHYA 3UXKA 3WK3A 4O0KA 3ONBA 1Q6LA 3MJMA 3P3BA 3RX4A 1LYXA 3TONA 1OIFA 3HBLA 4I7WA 4LUTB 3WNPA 4IMGA 1TUFA 1XYBA 1TQXA 1XQKA 2CLEA 4J2PA 3KVKA 4Q8OA 3DIPA 4S3AA 1BG9A 1QR7A 4GKTA 3IEBA 3SGGA 3A5FA 1YXYA 1RBLA 4NJJA 1SMDA 2HVMA 2J66A 1BYAA 5AKQA 4XB3A 4S3DA 1TA3B 5CZJA 3P2VA 4GUJA 1EQCA 4BWLA 4RXFA 4UQ9A 2B31A 4C6QA 4BY3A 3CJPA 3VABA 4W93A 3LCWA 2PE4A 1KFBA 5AYXA 3GG0A 3KOZA 4TX9A 5FEWA 1TX0A 3DFTA 4NF7A 1L2UA 4WIWA 4MADA 3ME3A 3WMSA 3UCQA 1EGMA 3CH9A 2QGHA 2YX0A 1HVQA 2QPSA 4GI6A 2GOUA 2C1HA 6A3HA 3S42A 4PRTA 4NVTA 3EOLA 3QW3A 2YCEA 4H19A 3UPMA 2OSYA 1DTNA 3O2LA 4ACZA 2PRLA 2PLMA 2ZADA 4UCFA 2QCLA 3EWBX 3UXAA 1FWHC 6XIAA 3M16A 4O28A 2W66A 3ARQA 1VJIA 3VNKA 4XAFA 2QJJA 4NU7A 3KCLA 3E2VA 1O12A 3EWDA 3VNJA 4Q8VA 3UJRA 1F8IA 3AMDA 3C2YA 2HTMA 3PPFA 1TVNA 3W7HA 2VGBA 3R13A 4IGNA 3VDCA 3VDBA 1W32A 4JFVA 4NI3A 1H2JA 2DUXA 4L5ZA 4QJ4B 5LXXA 4YPJA 2WMJA 3GDBA 2VENA 5FACA 1H7XA 2G3JA 3DECA 4XSMA 4GLEA 1NFPA 4K7YA 1TPEA 4Y90A 3SGUA 3LNPA 1W1A1 3W9ZA 3K30A 4KT2A 1FA2A 2O56A 4WK9A 1H1YA 2BS9A 5KSWA 4HNVA 4DF1A 1UWIA 4DY1A 2Z1KA 3EX6A 3T2QA 4H9XA 5LIXX 2QJNA 3N4FA 5DY3A 4B90A 1HXJA 1P0DA 2G41A 3BVJA 3U5UA 4LBRA 3CIVA 2R9RA 5D4YA 3NYZA 4QTGA 1K9EA 4D6GA 3JS3A 5FAGA 4CCZA 5BZAA 4IUOA 3WO8A 4HTYA 1DQWA 4LGXA 3GHSA 1ME9A 4CD5A 3WH6A 2WJEA 2BWGA 3PAOA 3EKLA 2X2YA 2JIWA 3HGRA 1IWAA 3W1XA 1R6WA 3V75A 2A79A 4GA8A 1U5HA 3QVQA 4Z1DA 3ITVA 4HZMA 3ONCA 1IGWA 5CCZA 3WQEA 4W7WA 1LG1A 1Q66A 4ZXOA 2HNHA 5U4NA 2ZA1A 1ZAIA 1XUZA 4NNCA 1TJ1A 3KBWA 2OQLA 2V38A 5D9PA 1Z3NA 1MNSA 4QXIA 2J4GA 2ZFAA 5I00A 3N4AA 3JU2A 4OU1A 1WV2A 2X1TA 1Z7AA 1IZCA 4AH7A 4A29A 4PTVA 4R27A 1XF0A 2D22A 3A9IA 4GJJA 1RQHA 2PI6A 4N42A 5BRPA 3D46A 4LX4A 2VHLA 5I3IA 1PYFA 3ZSSA 1Q85A 2FTPA 1BSLA 3PJUA 3CAQA 5JH2A 2EPKX 1FH7A 4NZJA 5I09A 1GPWA 3LPOA 1P0NA 5TIMA 3WLNA 4D6CA 2WC3A 3N6QA 1UKTA 2VP8A 1A49A 5D2TA 3G18A 4RUBA 2PDYA 3R25A 3WFZA 4K1WA 8XIAA 1CENA 1J2WA 2Z1BA 3RM4A 3IIXA 2VUNA 1JGIA 1T8XA 1PCWA 1XIMA 1ZJHA 5TD4A 1U1JA 4ZO9A 1IXQA 3CT7A 3CU2A 1UKOA 3KXQA 3W2KA 1GJUA 3DX5A 4NNBA 2E9MA 2X8RA 5FL0A 4JN6A 3OEXA 3CBWA 1V0NA 2EKCA 3M44A 4UMBA 3SUUA 1J11A 3GZ3A 1XYAA 3LDVA 1GKQA 3DDMA 3MHUA 1MFUA 3LPFA 1CB2A 4GY1A 1ZBWA 1SW3A 2ONEA 1GQNA 2ZOXA 3QW4B 4P7LA 1J0HA 2BXZA 1H60A 4DBDA 2HCVA 2EQDA 4UQCA 1J79A 4LCSA 3L68A 3MSDA 1UWRA 3AXXA 4Q8NA 2CHRA 3F1QA 2W4XA 4WGXA 5A95A 4GH3A 3G1SA 2VELA 1VPYA 3H7UA 5LNUA 4IMEA 1OINA 3RU6A 5D37A 3NQ7A 3TSDA 1AFSA 4XO7A 4LUJA 1XLJA 2A3BA 1EF3A 1Z41A 4N4PA 3TVAA 2CZEA 1FCVA 3Q37A 3TYAA 1EOKA 4PUNA 4PBEA 3JUGA 5CG0A 1IYXA 3BG5A 2F84A 3HQOA 1RH9A 3RUBL 3M7WA 3QHMA 2NLIA 2ABAA 1LWJA 3N17A 3CTLA 3SCRA 2XM2A 1QRQA 3NURA 2WQPA 2FZNA 3S2NA 2ZIDA 2YB4A 3GR8A 3LPGA 2YLAA 1SZFA 3W7KA 3C4UA 4HN8A 3CMJA 4ECLA 1ZTVA 3TFXA 1UMYA 1OX5A 2C0HA 2V3GA 3APTA 2QMKA 1C92A 1R7OA 1Q2SA 1JAKA 3W0KA 1BWVA 2EBNA 3WQWA 2POTA 3GNNA 4XISA 3GXFA 3QGKC 1K6WA 4UNKA 1LF1A 1KBLA 3THUA 3ZQ9A 4QDWA 1OT2A 5DO8A 3T4WA 4FP1A 5AZ1A 1GW9A 3MDUA 1AZ2A 2C19A 1W8SA 3TYCA 1HW6A 1QDSA 3OQ8A 4BWLC 5JH1A 1ZAJA 1KBKA 2NVCA 3QC0A 3HPXA 3I10A 3OZYA 3A64A 4KRZA 1OFRA 1P6CA 3L2LA 3KS5A 3O63A 2V5BA 3U57A 3BJSA 1BG4A 3T05A 4PMVA 2YCKX 1PHQA 3PG9A 1N8WA 4PCTA 2WQDA 3CQKA 2WMKA 3TN4A 1JDFA 5LIKX 3V5FA 3UCDA 3C3UA 1B54A 3VTRA 4HOZA 1LLOA 5K4XA 2EPLX 1J2BA 1JVNA 4QIUA 3IGXA 1H0IA 5BRQA 2P50A 3W7CA 3CT2A 3GDMA 1PZ3A 3W7RA 2ZZ2A 5FF4A 3H22A 4LAMA 4XG1A 3AZSA 4S1FA 3TMQA 4PTNA 1FH8A 1TREA 1UWQA 2YCIX 3AMGA 3DAQA 4B4HA 2WZTA 5DX7A 4AY8A 3RILA 1SVDA 2FKPA 4ZBCA 1EJXC 1YDVA 9XIMA 5L6UA 2Y7DA 1AW1A 1Q6CA 3OLGA 5J8LA 1FX6A 5CPNA 1P43A 3B9DA 2CXEA 1RAKA 2IXVA 2QUUA 3FOKA 3L4WA 3W2LA 3WLSA 3SN1A 2RDTA 3K4AA 1W0MA 3WJYA 4MFEA 4UFJA 1OG6A 4QR6A 3AMKA 2P10A 4LB4A 3L0GA 3PS7A 3S83A 4C91A 1P4CA 4HNLA 5K9CA 1MUMA 4PB5A 3HGSA 3HM7A 1ZALA 2A3AA 3PSWA 3TC6A 1EYEA 4K39A 3B9EA 1R0MA 3L0KA 4I6VA 5LGXA 2VTFA 2YDQA 1OB0A 3B05A 1QUMA 1PKLA 3W25A 2OSWA 1R3RA 3AU2A 1WXJA 3A21A 3SRFA 3AIQA 3SRDA 4YNGA 4UMAA 4YTUA 1WP6A 1CIUA 1ZBCA 5HWJA 3JZEA 3UQNA 5EMMA 1ZJAA 3M47A 3TYDA 4IPNB 4JDBA 4YWSA 4FNTA 5GNZA 5I3HA 2DSWA 4FIRA 5BXTA 2PDCA 3QZ6A 4J3VA 2PP3A 3R89A 5TBOA 2XFYA 3WLRA 1UBPC 1ZU8A 4HPGA 5DRCA 4I3GA 1FWCC 2H9AB 4XAZA 2ZZ4A 1SZNA 2E77A 4MWAB 2AMGA 4ZTYA 3LLFA 2WBKA 5F2GA 4JFUA 1A5UA 4J9JA 3V1HA 1SZGA 3TA9A 3CV2A 5BW6A 3TW9A 3GK0A 1WXZA 1AZ1A 5D33A 1YRRA 3W75A 1XISA 1QTWA 3QSRA 4HK7A 3QV9A 1BYCA 4B5XA 4CN1A 1VAHA 2C3ZA 3BLOA 1XD0A 3M5YA 4BQ4A 4M24A 2VL4A 2UWFA 3E1F1 4AG0A 1W1TA 1NOUA 4ZQOA 4QQ3A 3HQNA 2VXNA 3GH7A 1T96A 2BGQA 3NQVA 1KLYA 4MFDA 1CTNA 3PP7A 4NAFA 5A8PA 2RAGA 3EX3A 3TTEA 3CPGA 3DFOA 1B3WA 2D24A 3GW0A 5E0KA 1K9FA 4JNMA 2H8ZA 3UZYA 1J5SA 2E3ZA 1JIBA 1YPXA 4UTIA 4XTIA 3GR4A 3GTXA 2PLJA 1K8CA 1NARA 4XWUA 4XZWA 4E3TA 3CQJA 2W92A 2XVKA 1V3MA 1I2PA 1Z48A 1TWZA 1GZJA 1IEQA 2Z0IA 5K4ZA 3LM3A 5GJMA 5IOBA 5EY5A 4PEEA 2PDLA 4A2SA 5FD0A 2HPIA 3QY8A 3G8EA 1JUEA 1VPXA 1K1DA 2ISDA 2J6VA 1EOMA 3G5EA 3ITCA 5AN7A 1XCWA 5ABHA 2CETA 5AC4A 1S2TA 2HV5A 1FWTA 3UWYA 1WKFA 5BRBA 1H7PA 2X1IA 3HJEA 2A5HA 3VOJA 3DFNA 3PZIA 1RUSA 3P84A 2NZLA 3VIKA 3TN3A 3HN3A 3C2FA 2WVVA 1DJZA 4M8UA 4X2PA 1UWUA 2YPIA 1KQZA 3SIMA 1UD5A 2ZKMX 4E2BA 3CZEA 3N2TA 3KM8A 3S9YA 2QV5A 3O05A 1ENUA 2Y88A 1P0BA 3B97A 4GZJA 4MWAD 4Y9MA 1TTIA 1QBBA 3RO8A 3SUWA 2RDWA 3NDOA 3UR8A 4FIQA 3GIQA 3TV8A 2WZHA 2OB3A 5AYBA 2GPTA 5A6MA 1OGBA 5HOSA 3SN0A 4ADSA 5KETA 4AVOA 2WO5A 4NSBA 4GJ1A 2WC4A 5CH9A 2OOFA 1CDGA 3VKDA 4MG4A 3BG9A 4IPLA 4ATLA 1MW0A 3HQPA 1MZHA 4C6KA 4UCGA 1CYGA 2AL1A 4IFKB 4WDWA 4U3CA 5IRPA 4YHEA 1R30A 4UTHA 5IXEA 3P8JA 5MKGB 1AMYA 1WZMA 1GOMA 3TJ4A 1VH7A 3UXDA 4UTJA 2XM1A 1YNQA 4IJCA 1BRLA 4AHPA 3BAYA 2J74A 4CEXC 3BK0A 3H70A 3O9NA 3K46A 2Z6IA 4Q4RA 1P7TA 3IRDA 4LVBA 3ZZ1A 2GK1A 1AW2A 3TQKA 3BZJA 4AY1A 1R47A 1RHCA 4Z1YA 4JQ4A 2A0NA 5D2XA 4U33A 2XIJA 3B8DA 3VOCA 1W9VA 4HB7A 1EHNA 4HU4A 4JIHA 3GNRA 1JULA 1TJ2A 1XM3A 1F4AA 4QS5A 2OVLA 2VEPA 3NQ8A 5FKYA 3S9ZA 3GAKA 4G8TA 1XYZA 1E1CA 2DSVA 3KVJA 3QHNA 4CU7A 1Y5WA 4QE1A 3IS4A 1JCYA 4LV4A 4AZIA 3VZXA 3CUIA 3MA8A 2NQLA 3IWPA 3QMTA 3MDWA 1E6QM 2AL2B 1QHPA 1EJSC 5HMDA 5A8MA 3CNYA 1Z69A 1BXNA 1EKOA 1YKWA 4UFLA 4Q4QA 7ENLA 1QFEA 2XSXA 1R3YA 1KFEA 2QUNA 4P8WA 1PX8A 1XLMA 4MVAA 1JZ8A 4R3UA 3BE7A 4UZUA 3BAXA 1B5TA 4FLRA 3TW7A 4AC1X 3RRXA 1PWLA 4JN7A 1K4GA 4S23A 2W6RA 1C29A 2IPWA 1LQ0A 4Q4KA 3KZPA 1WDDA 3T0TA 2BY3A 5KZ6A 3QGAC 1XIEA 1NQKA 2UY5A 4FR6A 5A94A 4IT1A 4C65A 2R82A 3GFXA 3H21A 1JI1A 2QNEA 1HJUA 3TQ0A 2DVTA 1M7XA 3KWSA 2OODA 1O68A 3S5ZA 4PL1A 1RBOB 3BH4A 2WSRA 2BV9A 1HO4A 1E9IA 4BFAA 3ZLFA 2XGIA 5PTDA 4W86A 3TXVA 1GCYA 3W1LA 5I0DA 4AF0B 4D2JA 1E4IA 3ZS4A 1SO5A 1E9ZB 3DYPA 3DUGA 5I3FA 2V69A 5T9CE 4GQBA 3MP3A 1XCFA 1YDYA 3MVTA 3LRMA 3SN4A 3WL1A 2OZ3A 3PN8A 4MWAC 5FJPA 3LS9A 2BZNA 5D38A 4UTWA 3C0JA 3EXTA 4O17A 1JPMA 4IZGA 4EVZA 3E74A 1OT1A 1KLZA 1A5LC 4IG2B 4HZ7A 1XYCA 1UR1A 2GJNA 2D1ZA 3WQ6A 1O5KA 2BOEX 2ZX9A 4CU6A 4NJKA 3NO3A 5AY7A 3RF9A 3WJSA 3VIIA 2P88A 1GZ1A 1TVLA 3TYUA 4QLKA 2W63A 1QHZA 3R0DA 3IIPA 3OGSA 4X61A 3SB0A 3TQPA 3PBVA 3KOFA 4W84A 4A22A 4AUBA 2G50A 4AYGA 4Z0JA 3UWUA 2JK2A 4HNOA 1FRBA 2VRKA 3T55A 4J40A 1OY0A 3WF0A 3VIGA 3T8QA 4R5EA 2DORA 4V2XA 3VKJA 2WANA 2Z1WA 5A2AA 2YDSA 1ICQA 2J7FA 3UWQA 1DWJM 3QKEA 6CGTA 6XIMA 1VZWA 1XW8A 5D9MA 3OP2A 3GG7A 4HNCA 1L0PA 1VCGA 4WKAA 4EE9A 1VB9A 4FXSA 2QULA 3GBEA 1G1YA 4OT7A 4LBUA 4CU8A 4S3BA 3WQ5A 2DVXA 4DO7A 3QFWA 1UP0A 2PSNA 1A3XA 1EPXA 3LLDA 5FJJA 1OX6A 1HKWA 4GIEA 1NY1A 4UBPC 3VGEA 1I1XA 4EXBA 1FKWA 3RPMA 1VQTA 1KWKA 3S1GA 1BXBA 1W5NA 1W9PA 4PMZA 1RCXB 4I8YA 1Q3NA 4IH3A 3ZXWA 1JYWA 1A5MC 3ANYA 3WNMA 4FNQA 3CH0A 1V51A 1UIOA 3HOJA 3UF9A 1J9YA 3PNZA 3RR4A 3GO2A 1E40A 4JS3A 1C91A 5C55A 4JTCA 3HFYA 3ISIX 1U2YA 3H6OA 1ICPA 1XL9A 3TLQA 4L7ZA 3C52A 2PRMA 4BKNA 1TTJA 2B4GA 1OCBA 3L67A 3TUUA 4UOZA 1OK6A 2EHHA 3WLKX 2WNWA 4PH6A 1NTHA 2Z1SA 3H2NA 4UOQA 4KGJA 1JZ6A 3D3AA 2D20A 3W2JA 4WSKA 4MNKA 4M7SA 3W7QA 4P7QA 1W1B1 4IP5A 1MW3A 1P48A 3AISA 2XUCA 4E2VA 2PDQA 3KP1A 1SW0A 2JKAA 4RE3A 3S6OA 1C90A 1JI2A 2G97A 4HHMA 5CC6A 4AIOA 1Z9AA 5F4SA 2X30A 3IJ6A 2QKFA 4Z2GA 3WLLA 3NOYA 1FFQA 1GOWA 3VMPA 1ZUAX 3AHYA 4Y8FA 4KWUA 3UXIA 4Y9AA 1NDWA 5CPOA 3N4EA 4F8XA 4GCXA 2G4JA 2GYIA 1WQ5A 2VRJA 4I5RA 4NAEB 2WYSA 4PZVA 3LBOA 3QYQA 1D7KA 1H41A 1F3TA 2XIOA 3AQUA 1NFBA 3A5VA 4HPXA 4Z1BA 3WLHA 1XQLA 2OZTA 4CQAA 7PTDA 5HK4A 3CZKA 3VD5A 3DBNA 5C54A 4AIEA 6TIMA 3T2PA 2HVNA 2OX1A 3ZFHA 4DWSB 3PR2A 4V33A 4REQB 1F61A 3EMCA 3UG4A 3REQB 1E6NA 2PDXA 5EMYA 4D6FA 3KFTA 3GG1A 3KL3A 3SCOA 1XYLA 2Z28A 1QI2A 3MZNA 2FMOA 3WMCA 5XIMA 2E8YA 4HYRA 4QCFA 3WJWA 3DHUA 1JYVA 5CSSA 4GZ7A 2J8GA 1OZQA 2QJMA 4ACYA 1DP0A 3D47A 1DORA 2VEFA 4DEFA 2J7BA 2O55A 5G1MA 2QUTA 3BLKA 1BKHA 4A3QA 1EHAA 1KXHA 3AS0A 3EA3A 4A2RA 5E70A 1XC6A 2Y0FA 4PFHA 1XXXA 1E0TA 3OU8A 1T41A 2HISA 1DXFA 1XIDA 2XH4A 5KZDA 1TR9A 3TX9A 3S8HA 3SI9A 2ZTKA 2OT1A 5ABFA 1ALDA 1BVWA 1M7JA 2HWGA 3O1NA 3FCPA 3PZTA 2CWNA 2WVSA 3ZVIA 1H7WA 3W2UA 4MNMA 2EXOA 1OBAA 3PBMA 5GNYA 4UTKA 3URAA 1IXNA 2DP3A 3TAKA 4HPJA 4ZOBA 4CLMA 1XICA 1EA9C 4MZYA 2WK2A 5EYWA 1CXFA 2FPVA 2WJFA 3CV7A 2WSYA 4D9PA 5L9FA 4UQEA 4ZQCA 2OXNA 5AHLA 1EP1A 3M07A 4KGLA 3F2BA 1QXLA 5AHIA 1VEMA 1XCXA 3THAA 1G5AA 3FN9A 4GIRA 3VXGA 1X7IA 1WXYA 3VDGA 4WKFA 3MI6A 2NV1A 1XLCA 4GI9A 3DHDA 4HPHA 1YTDA 3QR3A 1TELA 3JVAA 1W5QA 3AFBA 8RUCA 4J2MA 4O10A 4O16A 1MQRA 1TWSA 3MQTA 1A5OC 1QOXA 3VOFA 3TKFA 2PGWA 3B4YA 4OFCA 4AFYA 2VUYA 4DWSD 4B2DA 3L4XA 1HKIA 4FXJA 5EKYA 3W1MA 4D6DA 2R8WA 4JEJA 3NNTA 4WY0B 4HKPA 2Z2BA 2DJLA 3L12A 3PAJA 3FEMA 1DE5A 3O06A 3PFMA 1Q4NX 4PA8A 2FZ9A 1DWGM 3TZFA 3NSNA 5I03A 1N55A 4ES4A 2GLKA 1UA3A 4Q4MA 1AA1B 4RDVA 1U22A 2VYOA 5T9BG 4YXGA 4V28A 1XIFA 3VGGA 4A8NA 1BQCA 2CWXA 3OHIA 1VEOA 1CZ1A 1E9YB 2G8ZA 3L21A 5BYWA 3QLDA 3MWCA 3W23A 3W87A 1DWAM 4FOJA 4UTWC 1ELSA 1OC6A 3V5CA 3TTYA 3PWIA 3KCJA 1B4KA 4OHQA 4AMAA 2BXVA 2XVNA 3ZWSA 5FJUA 3W81A 3UP8A 4MZ8A 3T42A 5C9RA 3HF3A 4DBEA 5FAJA 1MEHA 4ADTA 2R6OA 3V18A 3VE9A 2V81A 2OTDA 2ZCGA 1TSIA 2WB5A 3BSHA 1UOZA 3A13A 3EWYA 2JGYA 4UMCA 1D8CA 4QSFA 2CNCA 2XYLA 1W1PA 1GT8A 3BDKA 3S1XA 1Z44A 1S5WA 1EDGA 1REQB 4CEUC 5IHRA 1IIGA 4BHYA 2JEQA 4A6GA 1EO5A 3B04A 4M6QA 5JIPA 3ZLGA 3IIVA 2DUAA 2OX4A 4JD4A 1HL8A 1N82A 3J7HA 4XZ9A 3S1UA 4I6KA 3CQIA 4JX6A 4JKLA 4NG3A 4QFUA 1W3LA 4HYWA 3D6NA 5A2CA 1ZCCA 1HQTA 5AHEA 4ICMA 2J9YA 5I02A 3B8SA 4CQ9A 2E7FA 1PWMA 4GD0A 4GX8A 1BQGA 2B7QA 1E6PA 5FSEC 2TODA 3G2GA 4CKQA 1KA9F 3AMCA 5DRIA 4MUZA 2EKGA 5G4WA 3AWOA 1VS1A 3EBVA 1TJ0A 4QISA 2H3DA 1Q45A 3TK7A 2HBVA 1JGMA 3VZZA 3D0CA 2HSAA 4H1ZA 4Q7BA 3SURA 2AAMA 4B92A 1S5MA 2V2HA 1GQJA 3K13A 2E5DA 2CHNA 3C3NA 2ZZ1A 3G3DA 3QEZA 2PS2A 2YLLA 2E9BA 3LCLA 3N13A 3KTCA 4EWJA 2CCRA 5F2MA 4R33A 1UKSA 1TR1A 1AL8A 1ODUA 3O6CA 4IIDA 3NAVA 4KCWA 2TYSA 2C0AA 2ESCA 2NQ9A 3M6YA 3WN6A 3CYJA 3S9IA 1DJNA 5BWAA 1LCOA 3KWXA 2P3EA 3WNNA 2A4AA 5HQLA 2C1GA 2AOSA 4DWSC 3ABRA 4U28A 3SCVA 2Z00A 4IP4A 3AS1A 8XIMA 4MB3A 1CB7B 1QMLA 4Q8UA 1TQJA 1ZL1A 4WD0A 2DZPA 3LXCA 4H6RA 3I65A 2Q3RA 4WXYA 3RM8A 1B3OA 3PTDA 3FGCB 2DPEA 1YDNA 3OVRA 4IJBA 2AMXA 5I7GA 3MHFA 2BP1A 2Q6ZA 1GOIA 1JZ2A 4UUIA 3CAVA 4IUGA 4F9JA 3BCJA 1KKRA 2VGGA 3IJQA 1YLVA 4O52A 3B9NA 1CXIA 5T26A 1V3JA 5LIWX 2C91A 2DIJA 3P62A 2ZVIA 5G2WA 4BF5A 4AISA 2G4FA 3RR1A 1J6PA 2DEPA 4J4KA 4LT9A 1XUUA 5A6AA 2OWWA 4DUOA 4IWWA 4E3VA 2WSKA 5CBJA 4RE2A 3AYRA 1RK6A 4JTRA 1Q65A 1A3WA 3LSBA 1WZKA 1M04A 2QVHA 3WLJA 3PM6A 1QW8A 1HUVA 4DZIA 5CBIA 1WOAA 2VRQA 3WQ8A 3WF4A 1JYXA 4DO4A 4C6LA 1UYQA 2C1IA 1PXGA 2ZUVA 3VD7A 4F2UA 2QLYA 4PUMA 4M29A 1F7BA 3SJ3A 1Q6FA 1G4EA 1KFCA 4H9TA 5CKSA 1C9WA 1UR4A 1XBVA 3ABZA 2Y8VA 5D09A 4RPPA 1J01A 2GVLA 4MB4A 4EACA 5EGRA 1KM1A 1M53A 5JQ9A 2D0GA 4O15A 5K9XA 4OJYA 3M43A 3QKZA 2ZZ6A 1VYRA 4N02A 5AHFA 2D2GA 4E2OA 3I6TA 2DSZA 1SW7A 1XDJA 4QLLA 1HG3A 1MXGA 2G3IA 1EX1A 7XIMA 1IV8A 1OG0A 3R94A 2YW4A 4ZSTA 3LN3A 2VFEA 4A35A 3W22A 3AIBA 3WYZA 2VX4A 3A4JA 4YL2A 3USBA 1QI5A 2WAGA 4A21A 2D0HA 4UTMA 1QNVA 3U8GA 2EAWA 5DF0A 3NA8A 3P82A 2VEIA 4UQAA 1ZRQA 5FF2A 3VD3A 1QPOA 1AK5A 4LAUA 4I9MA 3WMBA 3EMQA 3CGTA 2CZFA 1QOPA 1Q8JA 4PC8A 1GYNA 2XVPA 3N25A 3W7NA 3W88A 3IGSA 1J0IA 1EWDA 2IQTA 2DT1A 2G96A 4GCAA 4IPPA 4AD1A 1NSJA 5FI8A 2YFOA 1AH0A 4JTIA 4AX7A 2RKXA 1G4PA 3W27A 1JXKA 1MYRA 5LHFA 3MWAA 3VX0A 4D8LA 4MDPA 2ATMA 4NJIA 4TMBA 9CGTA 5HUOA 1SFJA 3CUFA 1UPMB 1OABA 3B03A 1TV4A 1F05A 3OVQA 3OLDA 4LY8A 3VIHA 3QOMA 1FQ0A 1QI3A 1RA5A 3Q67A 4O1DA 3WDPP 4PUJA 4KERA 3W70A 2HNEA 3PBYA 1ECEA 3BCDA 3LCFA 4EP8C 3A4WA 3PTKA 4ZVJA 4LSBA 4GE8A 1KTBA 2DIEA 4PMXA 3MW7A 2OYMA 1E72M 4ATDA 2OGYA 2QVNA 4JTUA 3RLVA 4O8AA 4NJHA 2J7GA 3FY1A 4BK9A 3H2FA 4GIAA 2MUCA 4B3ZA 1A47A 1PB0A 1CLKA 4MIMA 3PANA 2WHJA 1GJWA 4KRUA 1W3IA 5CPTA 3CMGA 1KR1A 1UD4A 1UR8A 1IEIA 2OWCA 5HQEA 4AY7A 3VNZA 4EANA 2OR2A 4E4UA 3MBDA 4GO8A 1XI3A 4LH8A 3ITOA 3JRKA 4J35A 3WG6A 4G7EB 2TSYA 4E4FA 3AYSA 4XX6A 2NSOA 4CNPA 1F6KA 4J3TA 1MDRA 5KITA 3A6OA 2D2HA 2UY4A 5XIAA 3CUGA 1V08A 1M41A 2ZUUA 2ZWZA 4L9YA 3PJTA 1LUCB 4C6EA 5CLTA 2BOFX 1VLIA 4JIQA 3GTHA 4KEVA 3MI2A 1XLEA 4UTTA 2O92A 4PMQA 4PUUA 3K4DA 3O15A 3CUJA 4UFHA 4ZOAA 2RJGA 2AQWA 3ARWA 3T40A 1JCTA 1UZ4A 5EFDA 4GPNA 5AVHA 3PULA 3NQMA 3KRBA 4RDYA 1WUEA 3SAZA 3LQLA 4UTUA 4S3KA 3CZ8A 3DFQA 1KRCC 1DVJA 3SDOA 1A5AA 4XSLA 2QR6A 1BHGA 4WGHA 2VZOA 2D69A 1KQYA 5HR7A 3OHMB 5G5IA 5D2YA 4MSSA 1A80A 7ODCA 3U4FA 3VC5A 5E9AA 4P2VA 4GOAA 4LALA 3N14A 4DRSA 1O6IA 6ENLA 2VNCA 4Z2KA 1KCZA 3V0SA 3I4KA 5LA0A 4B5WA 2I57A 5FESA 3ZLHA 3CLWA 2B81A 2YCLB 5BU6A 1POKA 1F2JA 1LOQA 4LVDA 3UEQA 1R7AA 1VBGA 5MHBA 3P6LA 4JTDA 3I6RA 3VNDA 3UPWA 2OU4A 4CN4A 5A6KA 1O4UA 2BMBA 3H23A 2NX3A 2ZA3A 4AD2A 4RK8A 4MPKA 1L8PA 1GTHA 3TCSA 5FF7A 5I3GA 4MUPA 2NT1A 2DDXA 3MS8A 1RQBA 3IVUA 2NQHA 4FNUA 5EMUA 1LWHA 3DKJA 1BKSA 5A69A 5F2IA 4AZ7A 3T4CA 2X05A 2WZEA 1GNXA 3THQA 1K77A 3L5AA 4XZHA 5HBFA 1A5NC 1TCDA 3C8NA 1RCOB 4ZTXA 3M7SA 1EWEA 1VBRA 4OKDA 5EBAA 1JPHA 3RAOA 3NR0A 3NO5A 3H7VA 3E0IA 3WF1A 4A8LA 4ZQRA 5CEWA 3PBUA 4JTHA 1QWGA 3UETA 3PUGA 1OZMA 3CC1A 3EB2A 1A0EA 1C7SA 1LWIA 2C14A 1JYNA 1YHTA 3OB8A 4DWDA 1VIWA 4QG6A 2XTKA 5JU6A 2VWSA 1TPWA 1BVNP 2CZ5A 2XZ9A 3II1A 3TEVA 4L9ZA 3TWAA 3DN5A 3M0YA 2QCDA 2V5DA 1KGUA 1OFBA 1MO0A 4H41A 1BWKA 1V0MA 3B8IA 3ITXA 2OGJA 3WEMA 3RLUA 3UZWA 3GQYA 3V35A 4V1YA 1YQ2A 1YADA 1WBJA 1IWBA 5IBXA 4L80A 1OIMA 1SSDA 3SCQA 3W6LA 3FJ6A 3IPWA 4OBSA 4IQEA 4XKYB 2UY3A 4M0XA 1EFZA 4J28A 1W37A 4FR1A 1XGDA 4ATWA 4DJDA 1UD6A 2VEKA 4W88A 3DERA 3LB0A 2WLZA 1XBYA 2F38A 4Q22A 1OCJA 4JQ1A 3IRSA 3BAWA 4JYFA 1FWSA 1V3LA 4LY4A 2XU2A 4W4QA 1QCWA 4X0NA 3WQOA 4PMUA 1F76A 4F0MA 4JTGA 4LYQA 3N6JA 4GZEA 1R86A 2PEVA 2FJUB 2QCDB 3R79A 3AHTA 4Q4PA 2Z26A 1WDQA 1I2NA 1OX4A 2J75A 4YCOA 3ARXA 3NL5A 3EYPA 3CIXA 4S3FA 1FDZA 2Q02A 4PMOA 2GSHA 4LYKA 5D05A 2EG7A 5JXQA 3LTSA 2O9OA 1IE7C 2YW3A 5FJOA 2C71A 1VFSA 1M01A 2FB3A 3KCOA 3PTMA 5FSDC 3T0CA 2ZXBA 1ZP3A 4JDYA 3N15A 3P14A 2PGFA 3AXIA 4S38A 3W3OA 4YVXA 2VO5A 2O7SA 4PCSA 4G56A 1ZHAA 5M3WA 1MZRA 2V8ZA 3CO4A 4IICA 1X6UA 4QJ3B 4FB7A 1YXCA 3RU8X 7CGTA 4ORIA 3WLIA 3A9BA 1HF6A 4LWWA 2V6AA 4OVXA 5E0FA 4ZFCA 4TUFA 3ITYA 3QH2A 4H7CA 4M3PA 1FCUA 3GXTA 1JDEA 3BJTA 1GOKA 2DH3A 1GQLA 4Y9OA 2BHZA 5AZ0A 5FJTA 1DJQA 1VCFA 3EDKA 3EEZA 3E0VA 4ZENA 3WBEA 3V7PA 1JPDX 4HA0A 4DF2A 4AX6A 4W8BA 1T6MA 4F0HA 1V93A 4LAOA 4GIYA 4KW2A 4B5TA 1H63A 1I8JA 2XN2A 1I0DA 1C9DA 2H90A 2VURA 4UFIA 4F0SA 1KM0A 3GSMA 3M64A 2VEGA 3WBWA 1S2VA 2WM0A 1PUDA 4NZ1A 2QW5A 1GHSA 4EX4A 4GVHA 4LS0A 3NDZA 3U2OA 3I7QA 2G3NA 2QCNA 3WENA 4E8DA 1JD9A 3OZMA 1WYIA 3EOOA 5A8QA 1XIHA 2J7EA 2FZDA 1S3TC 3MUXA 1H51A 1ISWA 1IT0A 3IUIA 1Q4WA 1MSSA 1J0YA 2XPKA 1DKWA 2YDAA 2YCJA 3QBUA 4MPQA 2XFRA 2XWEA 3WNLA 4GI4A 5B80A 1KRAC 2Y4SA 4DJDD 4AZ6A 3T78A 3CZLA 3FYPA 3VIPA 3I7SA 4S2BA 4GHRA 1TV2A 2ZUTA 2RJHA 1EEPA 2J62A 4Q8QA 4GNKB 2YBUA 3GU1A 3ES8A 5IM51 2EEXA 4UTTC 1VBJA 1IEVA 1XFBA 5EA9A 1W1VA 5EB8A 4DZAA 5HQMA 1RALA 3N19B 3IK2A 3UD6A 1BPLB 1RLCL 4U4MA 1W3NA 4YIWA 1ME7A 3QY6A 1G69A 3NEHA 4J3SA 2EJAA 3MY9A 1E43A 3THCA 1B3ZA 3KZSA 3I68A 1EP2A 2YXGA 4OE7A 2J7CA 4X3ZA 1KCKA 4LNCA 3LOTA 1T0OA 2DZSA 1RCQA 3NWRA 3N2XA 5HANA 5C7HA 1K7EA 1BYBA 3ATZA 3MP4A 2PZNA 3DI1A 3VK5A 1FDJA 4GVIA 2PF0A 4MTVA 1TX2A 1MRAA 3LV6A 3WH5A 1E1EA 2HXTA 1LL7A 1M6JA 2YFNA 4WF7A 5CC7A 4PUKA 3GFYA 3GKFA 3EX2A 3PFRA 3SW6A 3NZ1A 1GVEA 1T5AA 4ORMA 3MUIA 4US5A 3N2MA 1H49A 1UCWA 3K4WA 4L61A 5C0QA 1C8XA 2KX9A 3UR7A 1HT6A 4HT3A 3SCTA 3R0UA 2EO7A 2ZC8A 4ZL1A 3E49A 3GUGA 3E5PA 4HQVA 2QJIA 1QNQA 1PKNA 1GVRA 3TYBA 1Q63A 1OHLA 2JKPA 2XN1A 3PJXA 1RVGA 4NZ4A 5BOOA 1XS2A 2MANA 3NTYA 2OMAA 2NXIA 1ZGDA 1EB3A 1Q7QA 3AAMA 1TIMA 4HPNA 4JAWA 1TPC1 1Q6OA 3A3XA 3F5LA 1SJDA 3KBSA 2YYUA 1GHRA 3WELA 3ARRA 4M80A 1GUVA 2QF7A 4PTXA 3MO4A 3O7UA 3FA4A 3RDKA 1W3JA 1GYMA 4MZ1A 4JYEA 1RA0A 2J8TA 4AXKA 2J77A 4Z08A 3RM9A 4UNIA 1OSEA 4WDUA 5JUVA 4ZFMA 3M0HA 5SWUA 4OQVA 1JPKA 4A3HA 4L56A 4LS2A 4O54A 4C60A 3WLTA 4EKJA 2O4QA 3DH7A 3W53A 1PEZA 1DHKA 3WK1A 4C6PA 1O60A 3OBEA 2H8XA 4R34A 4GGBA 4MAVA 5GNXA 3L23A 4IIEA 3ENLA 4DZ5A 1JCLA 3UNTA 4MGGA 5IBXC 4HP5A 1LBLA 8CGTA 3USZA 3PZNA 1LG2A 3UG5A 3AHXA 3R2GA 2YSWA 4AHOA 3V5OA 5A8GA 4RPQA 3N04A 4DJDC 2JFEX 3ID7A 2G0WA 1UP2A 2ZTJA 4RW3A 1XLGA 3KRZA 1J4EA 1GVFA 3WQVA 4PRRA 1JPIA 1I1WA 1KM4A 1QJWA 3S46A 3E2SA 3AJ7A 4GXPA 2YGYA 2JGQA 2XDFA 2PF8A 3WBXA 5C5YA 1U33A 4YTQA 1U1UA 1W3HA 4IISA 1KRBC 4KFNA 1TPFA 5H8PA 2WLYA 3SQLA 3G1HA 4J3WA 1S39A 4XIMA 1ONEA 1XLDA 1A53A 1I9CB 4LUSA 3VUSA 2QCCA 4KIEA 1IXOA 2BLEA 4HIBA 4W87A 4WJXA 2EPHA 2A6LA 1M65A 1E15A 3LXBA 1FWAC 3BW2A 3QPZA 1RZMA 4GG9A 5I3KA 4XVDA 1Y0EA 1LT7A 3ZIZA 1J0KA 2DIKA 1SZEA 2V30A 2R91A 2DV0A 3H2MA 4UC5A 1FBAA 3AC0A 2FGBA 5I24A 2I5QA 3W7JA 3RYSA 2WM1A 3B40A 1TIWA 4B91A 4FI4A 4C5YA 3HB9A 4US5D 2Y8UA 3SY8A 4MM1A 1V8EA 1HIZA 3W6MA 2CPUA 4TU1A 2BSLA 2PBGA 3H24A 3SM0A 3V4BA 3IUDA 2PDKA 3NZGA 1VEPA 3AO0A 2VZSA 1AUSL 3FHQA 3QQWA 1E9LA 3B0UX 3AU6A 2FZMA 1XIGA 1IXPA 3EPOA 1LBMA 3RG6A 5G4EA 1DV7A 3PJWA 2WMHA 1GVSA 3FX4A 1VJSA 4FOKA 3WDQA 2V9DA 4TV5A 2JEPA 1F6PA 5LA2A 4S3EA 3TU9A 4O53A 4EAYA 3MJYA 2ALRA 1C8QA 1S1RA 4P61A 2E6DA 2JF6A 4IPIA 3F5KA 3VU2A 2HK1A 1X39A 3A24A 4AEFA 4H6EA 2XVGA 5LYRA 2Y5EA 3VPLA 3MVIA 1XRSA 4K7VA 3C2RA 3RIKA 3QF0A 4QP0A 3VCCA 4HOWA 3HMJG 1H11A 2EG8A 2E4TA 1RV8A 3CPRA 4Z2JA 1B90A 2WMIA 2X0YA 1N8FA 3DZ1A 2AKZA 3L5LA 5H8MA 1UZHA 4KF1A 2BTMA 3NEVA 1UD3A 5D2WA 2V68A 2OZ0A 2W62A 3SUVA 1WBHA 4P7OA 3AXKA 2YL6A 1W9BM 2OYKA 1AH3A 3QMSA 5KEZA 2V67A 1S1PA 5FF3A 1RD5A 4Z42C 1WNOA 4JBRA 3TTQA 3W1PA 4RDZA 2O9PA 1VFHA 2CLMA 1PIFA 3W01A 4MY1A 1UIPA 1F9CA 1TV8A 4U2ZA 3TDFA 1HKJA 3WH8A 1XPYA 1US3A 4KPLA 3BANA 1IT7A 4ACZB 6ALDA 5CSUA 4DUXA 3W7MA 1JDCA 2Y7FA 4P5UA 3NXLA 3UJ2A 2YA0A 1RBAA 2Y2WA 1YPIA 1E6XM 3F03K 5G2HA 4HHHA 1GOQA 4D6HA 4HSHA 1EYWA 4JQAA 3NZRA 3DENA 4DB7A 3EX4A 3NM3A 3LGEA 4MNLA 1US2A 4H6QA 3BPWA 2VD8A 2VX6A 1H62A 1GVQA 1XWYA 3EA2A 3UGVA 3Q58A 3BL3A 3KS6A 4IQJA 1GGOA 1WO2A 2INEA 3S47A 5GPRA 4PUDA 2QGYA 4LS1A 4L64A 1XINA 4UWMA 1PYMA 1O5QA 3SY5A 1H3GA 3C5QA 3W7LA 3G1AA 1PZ0A 1R9ZA 4YN5A 5HNUA 4IX0A 1TPH1 1E3ZA 1CW2A 1Q6QA 4GI8A 5C71A 4DUWA 1XKJA 2NQZA 2HE8A 2OQYA 3L65A 3ZT6A 5FOOA 4G1KA 1KFJA 1EBGA 3P81A 3O0FA 3DG6A 2J7DA 1SO3A 1GJPA 3M0ZA 3BZGA 2E0PA 2P53A 3W1RA 4D6IA 1TB3A 3SQMA 1VIZA 3I3BA 2J25A 1H5VA 1PIIA 1M03A 2MNRA 3H2CA 3BURA 4C7DA 3TR2A 4QEEA 1FXQA 1ME8A 3IVTA 3KBJA 2PBOA 1AVAA 1KCXA 1F8MA 3M0KA 1Q6DA 1GWJA 1YXDA 4G7FA 1MEWA 2IMRA 1QOQA 3IAQA 1WKYA 1RR2A 3VA8A 4LAKA 4RL3A 1CBGA 5CZTA 2PDMA 2FFIA 3BMXA 3N3TA 3WD3A 1V3HA 3TNBA 2UV8G 2GDVA 4IMCA 5DMLA 4GRSA 3CEUA 3PY2A 2VEMA 3KP0A 2C7FA 5XINA 4H8UA 1MUWA 1DPMA 1VRDA 4MKSA 2PRHA 4XIAA 3CK5A 1SFSA 1XDLA 4JTFA 1OF8A 4PEKA 1QW9A 1O1ZA 3LG3A 3ORWA 3C0SA 5A8NA 3OIHA 3FHAA 4O8RA 4PSPA 4TO8A 2G95A 3ARZA 3QMRA 2PFHA 1UR0A 1E6SM 1G01A 4DO5A 1DIKA 4PODA 1TO3A 2CFFA 3MP5A 2ZRYA 1FWDC 1X1OA 2NSXA 2VDGA 3UESA 2B7OA 3CV1A 3O8AA 1LM1A 4LJ3A 2D3NA 2FHCA 4TX6A 4MDOA 1B57A 4NX0A 1VR6A 3FVMA 1PKYA 1EQPA 3IVSA 3DU0A 4RNIA 4GZIA 3SIZA 2FTWA 2BGSA 4B16A 4A3YA 2PDGA 1U83A 3HPFA 5CAKA 4K38A 4WRHA 2PDIA 1VFUA 3SCWA 4PBFA 3OODA 2CXGA 3EOEA 4DXVA 3W1AA 1VC4A 1VHNA 2PZ0A 1KRMA 1H7RA 3U7VA 1G7VA 3VOHA 2PP1A 4TVCA 2DQXA 3DFSA 1B31A 2CKRA 3E02A 3TJLA 2V2CA 2RGMA 2R1LA 3NZQA 3AJXA 4HBKA 3TSBA 2CLPA 4O11A 3MU7A 3OOQA 4UQBA 2AGTA 2P76A 2GQAA 3NZPA 1AQHA 5AB3A 1D2KA 2HRWA 3GTFA 1XGZA 3E2RA 1PCKA 4N2YA 3BO9A 3CV6A 1PTGA 2BB0A 3PWGA 4DO6A 2RUSA 3OQEA 4NP7A 4D8ZA 3P67A 3IJLA 4YTTA 3RCYA 1UZDA 3TOYA 1E0WA 2DQWA 2PDPA 1N8IA 1WZLA 2ZX6A 3G1DA 1EJ7L 4AYSA 4RXGA 3KUMA 2YA1A 4B4FA 3HJZA 3DI0A 1NWRA 1I4NA 4IX2A 1JR1A 2QDHA 2P5NA 2WV8A 2PC4A 3GHTA 4AU0A 3GU2A 3P5ZA 5CC3A 4NXSA 3WEOA 3OVGA 2OSXA 4EF8A 4HZ8A 4NQ1A 2WPGA 3DOPA 4PRWA 4FALA 3GUWA 3H53A 1MI3A 4KETA 4EOUA 4AD0A 2A7NA 4GKLA 1EL3A 4WJEA 1E3XA 2FDSA 2XIIA 1ISXA 5DFAA 3UG8A 2C13A 3AALA 1PKMA 3LBCA 1R2RA 4QX4A 1GW1A 1G4SA 5BCAA 5IHSA 2R1PA 1X7FA 4PCPA 4TIMA 4ZR8A 3I7RA 1LOSA 2DFAA 1K8XA 1SGJA 1JQXA 1YTEA 2ZXQA 3LEPA 4LF1A 4NY2A 3L5MA 3F4NA 5HATA 4UR7A 4K6AA 2PTZA 3W83A 1OC7A 1ZFJA 3G0SA 5BROA 4AIUA 3B8TA 2PTDA 1WKDA 1WX0A 4JX4A 1E0VA 1UZ1A 3HO8A 1SU5A 1V6XA 4JYDA 2XSAA 3C2VA 5ABEA 1RD6A 3H2EA 2BGNE 2A2IA 1RPKA 4WOZA 1X97A 5BMWA 1UD2A 2OO0A 4UOJA 4HCDA 1XYMA 4L4OA 3M0MA 5HR6A 3KOWA 4M81A 4LBSA 1UR2A 4NUWA 3QC3A 3A4AA 3LHYA 2I9UA 1X8CA 2NVAA 1W54A 3TA6A 3EDDA 3G1VA 3ZO9A 4HU3A 5FF0A 4ZB0A 1LL4A 4XZMX 5M2FX 1S2AA 4Z17A 5A6BA 4WJ8A 1F73A 3WH7A 1XSIA 2J27A 4NKCA 3LUTA 4GXMA 3BLEA 3MSRA 1SR0A 3CHCA 4I5XA 1P0EA 1W3KA 3MUY1 4HSOA 2P1FA 5I3JA 4V15A 2A21A 4RDWA 4P8UA 1FWFC 4FX6M 4H8VA 1A5SA 3B8UA 5HPOA 1V03A 3QOKA 1H09A 1OFAA 2PGRA 3A3HA 4ZSUA 2FVKA 1HFBA 3GVWA 3WNOA 3GTNA 3GXNA 1F3EA 4OBTA 3ARYA 4YYFA 3T07A 4LYRA 2VGIA 3GRIA 3POCA 1U5VA 1UG6A 3K8KA 2H3BA 3GZAA 2Y63A 2PUZA 4PMDA 2BG5A 4C1KA 1H7OA 3LRKA 3W24A 1UH2A 2HJPA 4FLQA 4FX8A 3KOYA 1T7LA 2PDNA 1BGAA 3NIYA 2ANUA 1FWBC 1CXLA 3FXYA 3GXPA 3K8MA 1NJJA 1XIBA 1K7FA 4IOTA 4JCLA 1TCMA 4AD3A 1EO7A 5DT7A 3OZPA 3AWNA 3EOSA 1EDTA 1UWSA 1FXPA 2WPBA 3LPPA 4TX8A 3H55A 3FAXA 2WMGA 3NVTA 4HVXA 3WF3A 3BCFA 4TQTA 5C70A 1JL8A 1CEOA 4K8GA 2OG9A 3NQFA 4C6IA 2WKJA 5H1WA 5LXEA 2BVYA 3GXMA 4KBXA 2QDDA 4XV0A 3PWAA 2CEQA 4O4WA 3S2JA 2VR2A 5C7VA 2QXWA 3Q65A 1WA3A 1YTKA 2Z7KA 4HJWA 1I60A 2R94A 3KLLA 4A3RA 5H6HA 2GJXA 3C2OA 3EWZA 1P1XA 4MB5A 3KTSA 2NQJA 4R85A 4JQ2A 3Q2DA 3F4CA 1OCQA 4DZHA 4GC3A 2OCZA 1XLKA 3PG8A 1K3UA 5FEXA 1Y5XA 4B9ZA 4XBSA 1HGYA 4LF2A 1U30A 1OD0A 4S2CA 4NI8A 5HULA 4HNNA 4U3AA 2HZGA 3LZ3A 3A23A 3NQ6A 1HJVA 3COTA 3LQGA 1XSKA 1RVKA 1CNVA 3K5XA 1F4HA 3VGFA 3T7VA 3M0LA 1XYFA 2QCHA 3VMNA 3FDGA 4OUIA 3APGA 3NM1A 3B0PA 4NAFB 4RJEA 2Y6ZA 1KBBA 3APYA 4ZODA 3G1XA 4QITA 4Z2IA 1R87A 1EC9A 3VGHA 2FVLA 1FWGC 1Z42A 5D8WA 1UC4A 4DHGA 5AC8A 1AODA 3ZJ6A 1TMHA 2DZUA 2A7PA 1TKKA 1O5RA 3UJFA 4O1AA 2VGFA 3GVRA 4PBGA 1TRDA 5A6BD 1E5NA 4ZQNA 2FHBA 1EIXA 3TTOA 1XJBA 2XH0A 4GYFA 1XH1A 3IJDA 1GQKA 4W89A 3LNMA 3FDKA 2QJGA 2Q8XA 1E1FA 4CD7A 5AYYA 2FZ8A 5KTLA 3LXAA 2VZVA 1OQFA 4MYAA 3KX6A 2GUUA 3PUEA 1UA7A 3QQ0A 2ZA2A 3NXFA 1P1MA 4B15A 2GQ8A 1KCLA 1SUXA 7TAAA 5J5DA 3LM7A 1NDYA 1MUCA 1RJQA 4JIEA 1OGSA 4KWOA 3BQ6A 5ENLA 2HVOA 2QCEA 2ISFA 2JE8A 4L6OA 1SSGA 4JKKA 1B30A 5LIYX 4MHBA 2GOKA 2WVVB 3TROA 4ZO6A 5FEPA 3WBYA 4OOUA 1XH0A 4HCHA 4XD4A 2EGZA 5K2ZA 4DX3A 3URBA 2FYMA 2ACUA 2B0MA 1EJTC 3R0KA 4G9PA 4ZO7A 2Q8LA 1B9BA 4HNUA 3F2CA 3DFPA 2YIHA 5E6YA 4Z1AA 2VDHA 4LPCA 4P8VA 4Q8WA 4IMAA 4K2SA 5E93A 4CD4A 3W1TA 3FFSA 1XHGA 2GJPA 3AIEA 1H7NA 4XKMA 5FL1A 3FSUA 4ZE4A 3VNMA 1IF2A 4NHVA 2UY2A 3AIUA 3G0UA 3UCCA 2F7FA 3U9IA 3DEQA 2QHAA 3EOUA 4U5IA 4HD5A 4GQGA 4X9SA 2HDJA 4HNTA 4GABA 1CGVA 1EF2A 2ON3A 3N9RA 2J88A 3S5NA 3TFCA 1V02E 3VO0A 2REQA 4GC4A 5HWNA 4M1BA 2FHFA 1IT8A 3GXDA 4YYCA 3CL8A 3H2AA 3WUEA 2XH2A 3MI3A 4DM1A 1VBHA 1BRLB 9RUBA 1OWQA 4AQLA 1DJWA 3PBWA 3ECQA 1Z32X 3UXLA 4O19A 4WR3A 3GNXA 2DZAA 1P7TB 3BC9A 2FTYA 3WY1A 2GK1B 3AIVA 5CGMA 3RFAA 4KFOA 4K8HA 4RLIA 3W7IA 2ZBTA 2INFA 3VIFA 4JN8A 1QW7A 4UQDA 2J9ZA 1UW9A 3L7RA 4RV3A 2XFFA 2H6RA 3WDHA 1D8WA 4V1XA 1XLBA 3NOEA 3TR9A 3GWQA 1FWWA 4CQCA 2ASHA 3N34A 1B0IA 1W6TA 2I16A 1E1CB 1HKKA 2ZRUA 1HN1A 4LRTA 1RP8A 4JFWA 1E56A 1LRQA 5DCEA 3NSMA 4KKXA 3T09A 1OEPA 2J13A 4ZB2A 2BASA 3IUHA 4ERIA 3QFEA 5HPCA 1UD8A 3UZ5A 3ZM8A 3F2DA 3TLLA 2OQHA 4W85A 4LUTA 5CBBA 2IPJA 1JF5A 4KCUA 4ZO8A 3TN6A 3WBAA 2QPUA 3I3EA 3GAYA 5BOEA 3CHEA 3UR2A 5HJLA 5TF0A 1YPFA 1KBJA 1JUKA 3N12A 3MV11 4M5PA 3AXMA 4F40A 4U31A 1TA3A 1G6CA 4KEZA 1JF6A 2ZVRA 4R9OA 2ACQA 1NF7A 4L1XA 3SO7A 2ZWYA 4XQ6A 4QSHA 5G1YA 2YR1A 2OLSA 1TPDA 1DEDA 3QQ1A 1I6NA 4NYUA 3IJ7A 3EA1A 5FJIA 4ZGYA 3QV8A 3OBKA 2VC6A 1SFTA 3LGDA 4Q6XA 1QASA 1MWOA 1JUBA 1ZP4A 2GWGA 2AAAA 3QHOA 3FEQA 4N9EA 3OTRA 4EPEC 3E6EA 4EIVA 1NH6A 5M1TA 4I9AA 1WCGA 1W5MA 3GY1A 4Y96A 4PE8A 4OWGA 3WNKA 2DVUA 4DI9A 2ZUNA 1KWGA 2WCAA 3NSXA 3SZ8A 2PWHA 1NU5A 3WQGA 4J1OA 1M1BA 3CIWA 1FUYA 3WUGA 3NQEA 3SRHA 2I5GA 3PUOA 3QLLA 5JIWA 1V6UA 4JEQA 1UASA 3OVPA 3TMLA 3KW3A 1N7KA 5F4XA 2RH9A 1DXEA 3PPGA 4W8LA 2FMNA 5I78A 4PR4A 2BFGA 5FEZA 3ITTA 2OEKA 4PCNA 4M56A 3VDHA 3KVLA 5IFTA 4E4PA 2PWVA 4L6DA 4E8CA 4KWWA 1NWUA 2XIQA 4J5NA 5AECA 2KZHA 3MHGA 5DANA 5GJNA 1O94A 2PDWA 4H2CA 5CGQA 1YEYA 2QPXA 3LCGA 4IPJA 2BDQA 3GIPA 2G5WA 1RP9A 1ZPTA 3AS2A 3FS2A 4QG8A 1BEUA 1OJXA 4BF7A 3Q45A 1BWLA 2YL8A 3N2BA 2WCSA 5EL1A 3VE7A 1M7OA 5F4WA 3UA3A 4CUCA 4O0QA 2VVNA 3PB0A 3KOXA 5D30A 4ZQPA 2ZXAA 2OPJA 3EGJA 4P7NA 2Y70A 3V3WA 3B06A 1H1NA 3VILA 4IM4A 1Q5MA 2J8FA 1GTEA 2VCAA 2E8ZA 2PURA 4AVFA 1X1NA 1K8YA 2Y7GA 3R8HA 2PAJA 4AWTA 3M41A 2YXXA 1DJYA 3BOLA 3FVDA 1NF0A 4JIPA 2DJXA 3BMVA 4JFSA 3UY8A 4X9YA 1SFLA 3OBAA 4EWND 3N6HA 2F6KA 1MQPA 1K03A 2XINA 2FVMA 2P0OA 1ML1A 3AUOA 4LC8A 4NZ5A 1QBAA 4X2RA 4ZCWA 3WUFA 4S3JA 1LDCA 4UR9A 3EDJA 5CJMA 5A6JA 4DI8A 1HTIA 3THDA 4JFTA 2VCBA 2V0TA 2YBVA 4AZHA 3V0UA 3I4EA 2DZBA 3TYZA 1V77A 3LRLA 3WZ0E 1NP2A 1ZSXA 2R24A 3AOFA 2RGLA 4JGDA 1TWDA 1W2PA 2E6FA 1WE5A 3ANUA 2BOGX 3PC0A 2HXUA 2E67A 1JDAA 2DT3A 4WY0F 4B3KA 4N0RA 5GJPA 2NV2A 3HTWA 1BSIA 1JFHA 1RY0A 1YW1A 4EPKA 5RUBA 2GVGA 1Q7ZA 2E40A 2RFGA 4P8XA 3L4TA 2O0TA 4FSAA 3N29A 2D2OA 2ZDRA 4YJ5A 2A7RA 2E9LA 3VNLA 5I77A 3EX1A 3M0IA 2IKGA 5HNRA 1VP5A 3LLXA 2J79A 4DNMA 2VVSA 3PB2A 3SRKA 4AD5A 2NWSA 1EPVA 2PGEA 1NOFA 2WJZA 5AHMA 2PU0A 3SBFA 3GDKA 4C6BA 2W27A 3CMFA 1QHOA 1J10A 4FPSA 3S5SA 1A3HA 1WKEA 1XGEA 1OYCA 1N2VA 2JQXA 1C3FA 2CBUA 1IR2A 4A05A 2CBVA 3T1GA 4CQBA 1S38A 2GGJA 2PP0A 4JICA 1TZ9A 4KH2A 4KRTA 3PBGA 4OZOA 4Q4SA 2HMCA 5C9WA 4DJEA 2PA6A 4KFPA 1QPNA 4H83A 4MY9A 3IIOA 3RGTA 2F2KA 3SUSA 1RQEA 3WQDA 3TIMA 4QDMA 1OFEA 2IPGA 1EGZA 3DBPA 3W7GA 1ZBVA 2AQVA 3UG3A 1KD0A 5LGZA 3IACA 4Q7NA 4Q7IA 3WCZA 2YYTA 3RPTA 1TV7A 2GVJA 1WOBA 1R8LA 2E6YA 2RDXA 1Q7MA 3OIXA 4ADUA 1I2QA 3NJ3A 5KINA 1MFVA 3BUVA 1S46A 3PZQA 1GORA 3GNOA 3W00A 2XISA 1UUQA 4PB3A 4A8RA 2CLKA 4Q32A 3L9CA 1MVYA 2INZA 3VIMA 1TPUA 1VFLA 3GC5A 1YNPA 1O1HA 4H00A 2WC7A 4QNEA 1S2CA 3B8WA 4OTKA 5ABFB 1W2VA 2EPMX 1J93A 3XINA 1W17A 4AWSA 1P0KA 2PC8A 1WAWA 3U6WA 4WXZA 3WD0A 4KCTA 1KKOA 1SJCA 3B0VC 1WDRA 3WMLA 4CD6A 2NX1A 2GUYA 5DLCA 1UQZA 3U2CA 2IQDA 4JIIX 3P74A 3G0XA 4L1WA 1CWYA 1Y5VA 4MNJA 1XRVA 4L9XA 3QV7A 2PWGA 1FWIC 1QU4A 1J96A 2WNNA 5CZSA 2XIBA 4DLFA 3OZOA 2VQUA 3QN3A 3CWHA 3R4IA 3RK8A 3KDNA 3KRUA 3GVVA 1OD8A 5C2XA 4E38A 3UU0A 2Y5SA 2XWDA 4K1GA 3QM3A 4XTDA 1EZWA 5M17A 2V3DA 4UTLA 4IF2A 4V27A 4R9XA 4H8NA 4YVVA 5JBFA 4N9BA 2WVUA 2O4MA 3NQGA 3NG3A 3KE0A 3HG5A 3HQ1A 3VGBA 1NP0A 3SQSA 5DXXA 2ZQ0A 3UFYA 4HHPA 2IW0A 3BSGA 2ZX7A 4L6HA 3S1WA 3B4UA 2XSBA 3W82A 1C7TA 4A8IA 3ALGA 4AZGA 1ISVA 2VR5A 3BAJA 1LQAA 1NDVA 1I45A 1EUAA 2R1MA 2NUWA 2YL9A 5HMSA 4J3ZA 2Y5JA 3N2OA 2ISVA 2IKHA 3S5OA 1XG4A 2WVTA 4AEEA 2X0HA 2QCGA 1NWTA 2X1SA 3AIWA 3BAKA 3LU2A 4ZE5A 2Z29A 6TAAA 1ISZA 1S2WA 4AZCA 4E5TA 4Z2HA 1KFLA 3G22A 2GWNA 1FFRA 2DUZA 4IGHA 1UWTA 3ZYZA 2PTYA 1ICSA 3ITGA 2WNZA 4CNNA 2BBFA 3EWXA 1M5WA 1F3XA 1HL9A 7A3HA 1KM5A 3W74A 2FPYA 1S5VA 4DJED 1AJ0A 4LUYA 1HX0A 1DOSA 3G77A 2ACRA 2BODX 1XLFA 2G3FA 2Q71A 3W1NA 4PN2A 3C61A 1EGVA 2XVLA 2E5CA 2PDHA 4Q33A 4RKAA 3DYMA 3QRHA 3LI0A 2IS7A 1FHDA 3B0YA 3NL2A 2CESA 2W61A 1ZZMA 2CLHA 2ZRXA 2I7GA 2YZRA 3RJXA 1PDZA 2ODOA 1E73M 2DH2A 2GGHA 4WZHA 4AZCB 5U7SA 2Z27A 3SADA 1DJXA 3W85A 1YX1A 4WHBA 1DE6A 4H9MA 4TOQA 3BSMA 4WDTA 2Z6JA 1OFDA 2VX5A 4Z1CA 2P8CA 1EDQA 3V16A 1VF8A 2ZX5A 2CIPA 3RMEA 5AHNA 3T9PA 2JKEA 4DPPA 1O5XA 1Q6GA 3EXSA 4HOXA 1VFFA 3IJ8A 5CG7A 4C6NA 3CB3A 3KRSA 3STPA 2F8QA 1CX9A 1KB3A 3LTPA 1YDOA 1B9ZA 1KXQA 3KL0A 1JZ7A 3CLMA 1WDWA 1AJ2A 3R58A 1LOLA 3N18A 4B2DD 4I5UA 4Y9NA 3G8RA 3ZMRA 3UR5A 3BG3A 5CZ0A 4GYJA 4FHAA 5KZMA 4HZ6A 1CGYA 1F07A 4BQ3A 1ZLPA 3FXGA 3CAWA 3S6DA 3W38A 4K3ZA 1O7AA 2ABBA 4X0VA 4GY7A 2H9AA 1DIOA 4JXCA 4MWAA 3NCOA 1R5YA 3NPUA 2CZDA 3HMCA 3ICJA 2SFPA 2ZX8A 5BMXA 3BXWA 1LORA 4DJFA 4TVDA 2X40A 3MUAA 3GKAA 1LQ2A 4DPQA 5CSYA 1SO4A 3K2GA 4F0RA 2QS8A 1VFTA 1XIIA 5JBEA 4MJZA 1KXVA 5I2UA 3UNDA 5REQA 4RZ6A 1XH2A 4HJFA 2ALDA 3AROA 3WLMA 1AD4A 4PMYA 2WBGA 3HG3A 3MUZ1 3KHJA 3URQA 4NZCA 3TJIA 3GHRA 4J27A 1J8VA 3OG3A 1TMLA 1JZ4A 1JRBA 2ZUSA 3VNIA 4NRSA 3IGHX 5BXPA 1JCNA 3R10A 3GTIA 3YPIA 5A6TC 3QR1A 2B7NA 3MPGA 4H8HA 4Q4OA 3S1VA 1BF6A 2OJPA 4I9TA 4ZOEA 1AJZA 4ILSA 4ZA0A 1TJRA 2Y61A 3R12A 3RITA 4H01A 2CC0A 1PHWA 1TE1A 3EXRA 4DXKA 1W8GA 5LNSA 1CGUA 3KBMA 3QJAA 1NAL1 3L2IA 4LOCA 1IQ8A 1NDZA 3GD6A 4CNOA 4W5UA 5REQB 3WSUA 1T99A 3H8AA 4GJIA 1K02A 4GO9A 3GXIA 3WK2A 5AFDA 3C0QA 3CASA 2CERA 3E3HA 2IKJA 2X1UA 4HHLA 1UOKA 3ITLA 1GVYA 4BEUA 1HGWA 5TNVA 3WK0A 3A3WA 5EPDA 4DJEC 4QEHA 1Z8AA 1HP5A 1DJGA 3FW6A 3AZRA 4JY8A 4AMCA 4JX5A 2TPSA 3F4VA 1GONA 2QT3A 2YDRA 2HBXA 2BHYA 1PPIA 1K7XA 1FWRA 3IAPA 1L6GA 3UZXA 1U5JA 2L5HA 5KMYA 2UBPC 4OUEA 2Y85A 3TN5A 4AB4A 3ABXA 2EPNA 3LA4A 3WUBA 1UPPA 4H9VA 2YA2A 3SSJA 4U10A 1IHIA 4H7ZA 5LHEA 1LBFA 3QGVA 5DCBA 5LSMA 1FVPA 2VJXA 3VKCA 3O6YX 3NQBA 1OGGA 1BYDA 2A6NA 2ZE0A 3KLKA 3KTXA 3GDLA 1CI1A 3S0CA 5J04A 4ML4A 4AW7A 3VGDA 3KBVA 4Q8TA 1GVOA 4EXQA 4O0ZA 5EMKA 2WZMA 1AMKA 4HYVA 5CPQA 4FO4A 4ZMGA 1W1ZA 1ADSA 1X98A 5G1TA 4J7RA 5I79A 4FA3A 3A22A 4JL1A 3SEPA 4M82A 4UZSA 4FXFA 4CNTA 1EX5A 1V0KA 4IFKA 2YOCA 1VBUA 4RR4A 4DELA 5M03A 1E0UA 4LCQA 2XJ7A 2Z4GA 3WJXA 1ZB5A 3IJ9A 2WW5A 3HPZA 2ZRZA 5MKGA 4QGCA 1Q13A 3TXZA 1XLLA 3NUKA 3DHPA 4MJ2A 3VNYA 4URIA 4GISA 4Q3MA 3WQPA 1UQYA 5C2CA 3U0HA 1X6LA 3UJSA 3E12A 3FKKA 3PNUA 2CLIA 2PTWA 2XFWA 4DJFD 3CM4A 5DBUA 2FFCA 3ELFA 1WB0A 4WSHA 2IUZA 2JALA 3SCNA 4WDXA 1E70M 1UKQA 1O95A 1LZOA 1CXEA 2DU2A 4PMRA 2QDEA 3HA1A 1EJRC 5C2GA 3GC4A 2GZXA 1A5KC 5I06A 3P0XA 3OA5A 1FWJC 3GH4A 4P7RA 1DQUA 1F3WA 1RXOB 4FNRA 4MJMA 1PZ1A 3W84A 1UJQA 4O1BA 4XZBA 5CGTA 4BZYA 1PJ9A 4Y2WA 2GFTA 2AL2A 2X41A 4OECA 4IQDA 4XZIA 1R3QA 1EZ2A 3M5ZA 3GM8A 1VLWA 5I23A 3ZT7A 4Z2LA 3ABSA 4O13A 2OO6A 4PB4A 1EA0A 1QNRA 4DBSA 1DWFM 2VDIA 4ZOCA 4G2DA 3VAVA 4ZZ9A 3WQ4A 1H5YA 1W1IE 3BGGA 1AL7A 3LY0A 1PTAA 2GSJA 3FJNA 1KM6A 1E5JA 2PCQA 4ZEPA 5BXSA 1IGSA 2C18A 5D32A 1CGWA 4HMDA 1JZ5A 4PMNA 4EPDC 1OF6A 1W31A 4JPGA 2Y24A 2A85A 3DFHA 1FWEC 3HPAA 1X96A 2VWTA 4NL1A 5TQLA 3INPA 4GYPA 3E9AA 4IGMA 4XAYA 5DMMA 1R3VA 3TQVA 1RK5A 3H7RA 4GNJA 2NV9A 1PTDA 4EAMA 1VENA 2ZDSA 1RLDA 1U1HA 4B5NA 5HNTA 2HEJA 1H1ZA 1AW5A 2NW0A 3GG8A 3RCNA 4AF0A 5CLWA 1OCNA 2BXYA 5EMLA 3TSMA 1V5XA 3RN6A 1Z6KA 1C93A 4LAZA 1BTMA 1R9XA 2GGEA 4IJRA 3VKKA 2OFJA 1H0GA 2VFIA 4RNHA 1R85A 1Q6EA 1V6YA 2Y8KA 5CPSA 5C9UA 4NASA 3MKVA 4IG2A 4FK9A 2IXUA 3DCPA 3WDJA 3P0WA 4IXHA 3AI0A 1JG9A 4UNLA 5G2IA 4QHRA 4AD4A 5DBTA 2Y7EA 3NL6A 4PMJA 4PSRA 1JDDA 3BTNA 3P80A 1E0XA 2Z7GA 3CUZA 1QATA 4DM2A 1DIEA 1RJPA 2PCEA 4QAWA 3STGA 4RCXA 3ARVA 3KHDA 3UPBA 3PZGA 5K7JA 3AS3A 3L4YA 1ECQA 3OA3A 4NX5A 4GXWA 2ACSA 1PS9A 1ONXA 3R6IA 5B7YA 3PZMA 3UVIA 1TTPA 3CO8A 4W5ZA 3TJXA 5CSRA 4ICNA 1EC7A 3UWZA 3ZOAA 5CJ5A 4I90A 5F1UA 2QEZA 3MCOA 2WNQA 4FLOA 2WHKA 3MMTA 4IMFA 3VOIA 1KXTA 4LVAA 2VM8A 1JNEA 1GKPA 1P5BA 4JZ5A 3N2CA 1KV8A 4H04A 1FDYA 4CVWA 1LT8A 3KAOA 1TRIA 2ZXDA 3W28A 2Q3OA 4DBUA 4DJFC 4NNAA 2ZZ5A 1VPQA 3MUCA 2IQ0A 4O57A 3MYPA 4INFA 3W71A 3AYVA 3DGBA 5H2ZA 2CLFA 1QO2A 1KNWA 3WFLA 1VD6A 2GSEA 3VM7A 3E96A 1G0CA 2E5BA 4UFKA 1HZYA 2FGLA 3MCMA 1XIJA 5AC7A 3IV3A 1GG0A 1OYAA 4WKHA 4K37A 2KAUC 3UYIA 4FNPA 4AC7C 3WH9A 4OOZA 2O9RA 3GDTA 1EC8A 3EWCA 5H8UA 3LHUA 5F2LA 2O9TA 4JY9A 5CPLA 3MC5A 3NQ2A 4O14A 5LKYA 1B3YA 2W3ZA 2QJHA 3POHA 3IANA 4JNYA 2XG9A 4N6EA 1GZGA 1V4YA 4GH1A 1R3SA 5IFPA 4WEVX 2NXGA 4DUVA 3SGZA 1QPQA 3JR2A 4FS9A 2I56A 4LXFA 3STEA 1DYSA 3NPVA 3VMOA 5D9NA 1DTUA 5H91A 2DGAA 4WUIA 3TC7A 1YYAA 3B9AA 2WWDA 4JTKA 1VFOA 4LU0A 1R9YA 3W72A 1PBGA 4GUIA 3HPSA 3W86A 3PZVA 4H4IA 1FOBA 4LRSA 2QCFA 3EB3A 3RRAA 3HFTA 2DSUA 1UROA 2VZUA 3MSYA 3C6CA 2GL5A 1AQMA 3RNDA 3CPUA 3S5YA 1CPUA 3XISA 1JCXA 1B3XA 4E2DA 1F74A 5AVNA 1MW1A 2WCGA 3RHGA 3NO1A 2OELA 3OPSA 2CU0A 2VKZG 1SJAA 4NAEA 3FA5A 9XIAA 4O1FA 3H12A 3FLUA 3FNDA 2TMDA 3OW1A 3WDIA 4GINA 3HV9A 4GQQA 4DWSA 1ONWA 2HE5A 4REQA 3LBMA 3REQA 4YLWA 3GB6A 3O16A 5JVLA 5HMFA 1JZ3A 3CHFA 4AWEA 4C6CA 2V63A 3KEHA 2R1NA 1R38A 2CYGA 1EH9A 4TVUA 4FOUA 1DIDA 3FYOA 1OX4B 4LEQA 4HA1A 3SJNA 2Z1XA 4M6PA 3P61A 1EUNA 3OYZA 2V5KA 3FK4A 2ADAA 3CUHA 3LHTA 1LTDA 2I5IA 4DN1A 1BTCA 1SM9A 3RCMA 4MWAE 4E8GA 3BMWA 3LCIA 5HJYA 3R43A 3DG7A 3BICA 2BX7A 2BNJA 3SCSA 4GY0A 5ECUA 1ITCA 4JIRA 4F2BA 1SR9A 2YJQA 1V6TA 2ZUMA 4UR8A 2AQOA 2Q8ZA 3WFAA 5D04C 2X0SA 2Q01A 4GQRA 1VKFA 4F0LA 3NGFA 1KTNA 2E1WA 3U7BA 4ZXLA 5B7ZA 4F79A 2YB1A 3EAUA 1MQQA 4YCPA 3K1DA 4O12A 4MYXA 4BJHA 2D2JA 4AIBA 2Y89A 3NL3A 4GVGA 1D7FA 2J6XA 3WKZA 3L4UA 4QBXA 5D03A 1FHUA 3QYSA 3U2EA 1XSJA 3TOPA 1OVDA 4IXXA 5T91A 4IHCA 2ZICA 2X2GA 1XDMA 1A4LA 1NOWA 1IEWA 4JCMA 3CL6A 4D1IA 1L8NA 2RHGA 4EK7A 1I0BA 3AUJA 3EWWA 3LGGA 4GMEA 5JMUA 1HKMA 1KTCA 1XLIA 4U2YA 4AHQA 3RX2A 1NQ6A 2PD5A 4JQ3A 3LCXA 2W91A 4YWIA 2FH6A 1MRQA 1H61A 3N11A 4N4QA 4NJGA 1JRCA 1SMAA 2WHMA 3WDRA 1NEYA 3F5JA 1E6RA 4GYPC 4WY0A 3W26A 1ZY9A 1M9HA 3VC6A 4UTFA 3P93A 3WLOA 3KDOA 4HK6A 1D3CA 1IEXA 1TZ7A 2VR4A 2VOMA 1TVPA 3CTTA 4ROPA 5A6LA 5C6MA 4Y7EA 4D72A 1R46A 3G1YA 1ZS2A 4C5ZA 3L0NA 3SSZA 3T08A 1IIHA 4YS1A 3M0JA 2NQ5A 4IIHA 3Q94A 3XIMA 4XO6A 1Y7VA 5DCDA 3W76A 2I1OA 1XBZA 3UZJA 1PX4A 2QIWA 4FNSA 3VX1A 2D73A 5A2BA 3VD4A 3U4AA 4JTLA 3W7EA 1CXHA 3V1PA 1M68A 4I7UA 1QPRA 1XPGA 4GBDA 4IIFA 2BY0A 1GQIA 2A3EA 3TE9A 1CGTA 1E4NA 4TR9A 1PSCA 1E6ZA 1CCWB 4QCEA 1R2SA 1B1YA 3WX7A 4N9CA 1R2TA 3E0LA 5C9ZA 3FYYA 4TTGA 4Q6JA 4MOZA 3BQ5A 5AYZA 5I3DA 3MMDA 1ONRA 1XP3A 3O0KA 2WKGA 1YNYA 1REQA 1PE1A 3KVMA 1TV3A 4F0KA 3PZOA 3ALFA 4CGTA 3NPWA 4OV4A 3LMYA 1TPB1 1TJPA 4FLSA 3TP4A 4Z0SA 3UBPC 4QROA 1D3HA 5CZKA 1TE6A 4LV9A 1ZBKA 2DW6A 3GYCA 3LTYA 2GUBA 4XD5A 4MMWA 4C7GA 3ZR5A 2NX9A 1L6WA 3CB8A 3OLIA 1ITXA 4KQNA 1KO0A 2CKSA 4Y8EA 4N7QA 5IDZA 2X42A 1W5OA 4JKMA 1PO9A 4QLJA 3W7DA 1XG3A 4ALDA 1ITUA 2UZ9A 3STCA 2JF7A 2WMFA 4DYJA 3JW7A 3SCPA 5E5CA 1LJYA 4YTSA 3R5EA 1BF2A 4JOMA 4C1NA 2XGZA 4L4MA 1UBSA 3TTSA 4CVUA 5DELA 3TZNA 1W56A 1T40A 3OJGA 1K4HA 1LROA 1UUMA 3N73A 1XLAA 3BOXA 1J0JA 4AAJA 2DZVA 3W2MA 1FHLA 1HVXA 3RPDA 1XRFA 4O4VA 2A3HA 2J47A 4A4AA 3FA3A 4D71A 5GQBA 3QR0A 3NFUA 1BD0A 1BXCA 5D8ZA 4BF9A 2PLCA 3UVAA 3DC0A 4ROQA 2QCMA 4LYPA 1MW2A 2XZ7A 3QV6A 1W91A 4JL2A 4RNFA 1UR9A 3L66A 4NILA 1CLVA 5TAOA 2QIIA 2BVWA 2C6QA 3VOGA 2BHUA 3O3RA 3V0TA 1Q2RA 3AHZA 2VC7A 1HP4A 3FJLA 5EBUA 3N9KA 3VCRA 2GQ3A 3CL7A 4C1NB 3EWUA 3AICA 4ENLA 1ADDA 1J0ZA 1V6WA 4LQ1A 3IK4A 3EKGA 2IKIA 2I9EA 3FAWA 1K70A 3A12A 4M1RA 3BLIA 4QJ5B 5J5RA 4L65A 4XZLX 4DBWA 4PGLA 2DZTA 1MEIA 4WCJA 3D5HA 3RJYA 1KC7A 4O1EA 3MSGA 4TXEA 3GE7A 1B4EA 3FGCA 3BLPX 2PDBA 3EMZA 4MLJA 3R8GA 4HSNA 4US6A 1JXJA 3RO6A 3UERA 4B5SA 4B3LA 4HCLA 4Y9PA 2VCCA 3NQCA 3QSTA 4NRRA 1J12A 3M0XA 4IQLA 4MKVA 4X60A 2Q09A 1CT5A 1ITQA 4FEZA 2D3LA 4C90A 3ABQA 3H26A 1PIGA 4M6UA 1HL2A 2YXOA 1ODZA 3P5YA 3QPYA 5E1QA 4KESA 4XBKA 2NT0A 2XGBA 2WSPA 4ICCX 1X38A 4BQ2A 2ZUWA 4BCEA 4QE5A 1VGAA 3VDAA 1F5ZA 4AZBA 1HJSA 3BLFA 4QDPA 1FHVA 3S6TA 1QI0A 2I14A 1PDYA 1E71M 3T6CA 2J78A 4LVFA 3VIJA 2BY1A 2OKTA 3W1UA 3SECA 2DSKA 4GNVA 2DT0A 1EP3A 4LUSB 3GVQA 1XX1A 5A6SA 3BW3A 3LI1A 5LA1A 3HGJA 1A4MA 3LD5A 1TZZA 5EMJA 5CC5A 1YIXA 4DLMA 3OG2A 4CCCA 2F6XA 3R8RA 3WIJA 3F4WA 4J3UA 3SFWA 1UJPA 1D3GA 1A50A 3V36A 1QT1A 3M1ZA 2X16A 3CQ0A 4J3XA 1EXPA 3QY7A 4F3HA 1QO5A 4Q8PA 1TG7A 3O07A 4PL2A 1XD1A 4X63A 4QAIA 3DG3A 4XVEA 3IIZA 5G4HC 3HG4A 1VRXA 4LTSA 2V5JA 1XRTA 1NM9A 1CECA 3E2QA 1GK8A 2TRSA 1GKRA 4UB9A 4DF0A 4CCEA 1PZ2A 4GWEA 3T8LA 1HO1A 3G1RA 2J24A 4DNHA 4HK5A 2AGKA 2J7HA 3HG2A 3WJZA 2OOGA 1L6SA 2PWDA 2CLLA 5ABGA 4BA0A 3WLPA 4H7VA 1K6AA 3C0LA 4KCVA 4MF4A 5EFFA 3W2NA 4GX9A 2X7VA 4KS0A 3PZUA 1EBHA 3GLCA 1NFGA 4W8AA 2WWCA 4MLRA 1C8YA 1TYGA 3DYOA 3EPNA 3OLEA 4O1CA 1QVBA 2FZBA 2VFHA 4JTEA 4W9TA 1FY6A 3ATYA 2DZWA 2ICSA 2PLKA 3A4XA 3M9YA 4GFIA 3HV8A 2CLOA 4FZIA 3VIOA 1KM3A 5E6ZA 3K1GA 1R3TA 1KV5A 1TWWA 2X7WA 2PU1A 3MTWA 3LMZA 1HJQA 2BVDA 4FF5A 3RX3A 3H4GA 1TUXA 5BU9A 4XD6A 3UT0A 2VQTA 4G1NA 4U5KA 5FCZA 1W3TA 1AG1O 2WMIB 2F2HA 1B2YA 2Z1VA 2VFGA 3ZJ7A 4HMNA 4ASTA 1Q6RA 1A5BA 4AWUA 3W1QA 1UUOA 4QRNA 4EPBC 4UIOA 2G3MA 2PD9A 3NPXA 1OFOA 5FJRA 1O66A 3T0DA 3UGRA 2DW7A 3VKBA 1W9XA 1JNDA 1HKVA 4NIRA 2E25A 2QF8A 4IMDA 1GEQA 3AYTA 2E28A 3AIRA 2FQIA 4IFRA 4IIGA 4L4PA 2D23A 4L1GA 3DESA 3T44A 2DY3A 2EG6A 1QK0A 1P6BA 2GJRA 4MAZA 3E0WA 4JTAA 3UW6A 1RY8A 2OYLA 3ANVA 1OK4A 4R7OA 4TMCA 1BLIA 3G6LA 5HXMA 5D9OA 3S4TA 4UXDA 1KFWA 2DT2A 3CEPA 1MNZA 1UP3A 1V02A 1F6YA 5I5RA 2OWXA 1NWSA 3ARSA 3VUPA 4WLCA 3E38A 2F61A 4G7EA 3ZVHA 4JHOA 1THFD 2C8NA 1KM2A 2X09A 3KBNA 4YTRA 1XKYA 4CQDA 1XC4A 1OFPA 2NWRA 1E55A 3EB4A 1KR0A 2RDUA 3BARA 1G67A 1BVZA 1OM0A 2WXDM 4EF9A 2P3ZA 4CNSA 1LUCA 1IR1A 1JFXA 2PDUA 3LZ5A 3W02A 3FKRA 3W37A 4WSJA 5IDIA 4GACA 1FP8A 4LW7A 2P8BA 1XBXA 4QQUA 4B9YA 4C6JA 4W7VA 1OADA 1G9HA 1SPQA 1V79A 1V3IA 4G5DA 1TTQA 5HNNA 2VFFA 4YVPA 4IGSA 3ZR6A 3GR7A 4IIBA 4CN6A 3L4VA 2AKMA 3WLQA 4F9DA 3VCNA 3RLHA 5D02A 8A3HA 1YMYA 4OBRA 2HK0A 3MANA 1BGGA 4LC6A 4B5VA 4AZ5A 4X22A 4R53A 3GVGA 3ZVHB 4RV8A 2CBIA 3NGJA 3SCUA 5CPMA 3M6DA 1IZKA 2W67A 3DGRA 1J6OA 3CQHA 1PL9A 2A1YA 3WD1A 3B3DA 1AQ0A 3H2OA 2PB1A 3R7MA 5LZLA 1FKXA 4KMQA 4M6VA 1UKPA 4DYKA 2PDJA 1EJUC 1QI4A 4DYEA 2WKLA 4JR5A 4CQ8A 3GNDA 1WZAA 5E09A 3WEZA 3GDRA 4ONVA 4GGHA 2HS6A 4DAIA 3ZWTA 2YCLA 1H4PA 1K8ZA 1ADOA 1GVIA 1PVNA 4MY8A 2XIMA 3MKCA 2GVEA 4QS6A 2VMFA 1WUFA 2CBJA 1W5PA 3N9SA 3Q4DA 2R1KA 3PPHA 2W79A 3FV9A 3R1ZA 4JTTA 2WZIA 1L6FA 1AQFA 3TYEA 3GIYA 4GQ0A 4LEFA 4ZB5A